Page 1

Beruang Merah Tak Tergoyahkan Analisis Sarman Panggabean TIM asuhan Dick Advocaat, Beruang Merah, tak tergoyahkan lagi untuk lolos dari Grup A. Menghadapi Yunani, tim paling buncit malam nanti, hasil seri sudah cukup mengantarkan Rusia ke babak berikutnya. Pencetak gol terbanyak saat ini, Alan Dzagoev, bahkan sangat berpeluang menambahi koleksi tiga golnya. Ini akan melengkapi kisah indahnya sebagai striker pendatang baru, yang tak diduga muncul sebagai bomber utama selain Shirokov. Dengan poin empat tanpa mengindahkan pertandingan terakhir Ceko vs Polandia, ucapan selamat kita berikan kepada sang pelatih asal Belanda, Dick Advocaat. Kekuatan Rusia adalah strategi tim yang melakukan pertahanan utuh dengan empat pemain bertahan, yang selalu disiplin berada di daerahnya. Sistem seperti ini malah tak dimiliki Belanda, negara asal Advocaat, yang sedang kritis di Grup B. Kekurangan bantuan serangan dari pemain bertahan pun tidak mengurangi agresivitas penyerangan Beruang Merah. Sebab tiga gelandang serang Rusia; Roman Shirokov, Roman Pavlyuchenko dan Andrei Arshavin, motor permainan yang sangat meyakinkan. Selain progresif menguasai jalur tengah, mereka sekaligus sebagai pencetak gol berbahaya. Dalam dua pertandingan sebelumnya, kesuburan mencetak gol sebanyak lima kali merupakan bukti nyatanya. Rusia juga dapat kita calonkan akan maju terus sampai ke babak final. Lanjut ke hal A2 kol 1

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) SABTU, Legi, 16 Juni 2012/26 Rajab 1433 H z zNo: 23897

Tahun Ke-66

Terbit 24 Halaman (A1-12, B1-12) z zHarga Eceran: Rp 2.500,-

Labfor Selidiki Kebakaran Mako Satlantas

Tiga Singa Mengaum KIEV (Waspada): Kemenangan dramatis diraih timnas Inggris dengan membungkam Swedia 3-2 dalam lanjutan Grup D Euro 2012 di Stadion NSK Olympic, Kyiv, Sabtu (16/6) dinihari. Sebaliknya, kekalahan ini membuat Swedia tersingkir. Keputusan pelatih Roy Hodgson memainkan Andy Carroll di lini depan mendampingi Danny Welbeck terbukti jitu. Menit 23, umpan silang Steven Gerrard disambut sundulan keras Carroll tanpa mampu diselamatkan Andreas Isaksson. Tak ingin terus ditekan, Swedia mencoba menembus daerah pertahanan Inggris yang dikomandoi John Terry dan Joleon Lescott. Usaha Swedia baru berhasil saat peluit babak kedua dibunyikan. Free kick Zlatan Ibrahimovic membentur pagar betis mengakibatkan bola liar di muka gawang Joe Hart. Tanpa berpikir panjang, Olof Mellberg menyepak bola yang sebenarnya sempat diblok Hart dan mengenai badan Glen Johnson. Menit 59, Swedia berbalik unggul dan lagilagi Mellberg menjadi mimpi buruk bagi Joe Hart yang hanya bisa terpaku melihat gawangnya bobol. Merasa daya gedor Inggris mengendur, Hodgson memainkan Theo Walcott. Baru tiga menit memasuki lapangan, sentuhan pertama Walcott langsung berbuah gol penyeimbang. Tembakan kerasnya dari luar kotak terlarang mengejutkan Isaksson yang sudah mati langkah. Masuknya Walcott memang berpengaruh banyak terhadap permainan Inggris. Berkat umpan winger Arsenal ini, Danny Welbeck mencetak gol kemenangan Tiga Singa dengan tumitnya. Raihan tiga poin ini membawa Inggris menempati runner-up grup D dengan 4 poin atau di bawah Prancis yang sebelum mengalahkan Ukraina 2-0 di Donbass Arena. Hanya dalam tempo tiga menit, Prancis memastikan kemenangan lewat sumbangan gol Jeremy Menez dan Yohan Cabaye di menit 53 dan 56. (m33)

Waspada/Surya Efendi

PETUGAS Laboratorium Forensik Poldasu meneliti lokasi kebakaran Mako Satlantas Polresta Medan, Jumat (15/6). Akibat kebakaran ini, pengurusan surat izin mengemudi (SIM) dipindah ke Mapolresta Jl. HM Said Medan.

MEDAN ( Waspada): Tim Labfor Cabang Medan menyelidiki puing-puing di lokasi kebakaran Markas Komando (Mako) Sat Lantas Polresta Medan. Dari hasil olah TKP tersebut, tim Labfor mengambil sejumlah sample sisa kebakaran untuk bahan penyelidikan. Selain menyelidiki dan olah TKP, Polresta juga mengambil keterangan sejumlah saksi yang mengetahui dan melihat awal kebakaran tersebut. Namun, belum diketahui berapa jumlah saksi yang diperiksa. “Ada beberapa saksi yang diperiksa, namun saya belum tau berapa jumlahnya,” kata Kapolresta Medan Kombes Monang Situmorang, Jumat (15/6). Dijelaskan Situmorang, pasca kebakaran tersebut, personil Sat Lantas telah membersihkan sisa-sisa puing kebakaran. Personil juga telah memasang peralatan komputer di ruangan baru. Ruangan baru yang digunakan untuk ruang foto SIM tersebut sebelumnya digunakan Lanjut ke hal A2 kol 3

Bendahara Pemprovsu Gol MEDAN (Waspada): Bendahara Biro Umum Sekretariat Daerah Provinsi Sumut non aktif berinisial A yang diburon selama tiga minggu atas dugaan kasus korupsi Rp13 miliar ditangkap dari salah satu tempat di Kabupaten Batubara, Jumat (15/6).

Penangkapan tersebut dikatakan Direktur Reserse Kriminal Umum Polda Sumut Kombes Pol. Sadono Budi Nugroho. “Kita sudah menangkap tersangka di Batu-

bara. Barusan saja, ini masih dalam perjalanan ke Polda,” kata Sadono dihubungi Jumat sekira pukul 20:30. Dia mengatakan, upaya menangkap tersangka sudah

dilakukan dengan melakukan pengintaian di kediaman tersangka, juga di kantor Gubsu. “Selama tiga minggu ini anggota kita telah berusaha melakukan penangkapan. Dia

ditangkap di sebuah desa pedalaman Batubara,” katanya menyebutkan, saat ditangkap A yang kini tidak lagi menjabat Lanjut ke hal A2 kol 3

Gudang Arsip-Lab Dinas Bina Marga Medan Terbakar


PENGJAGA gawang Swedia, Andreas Isaksson (2 kiri), gagal menghalau bola hasil sentuhan tumit Danny Welbeck (2 kanan) yang memastikan kemenangan Inggris di laga Grup D Euro 2012 di Kiev, Sabtu (16/6) dinihari.

Agincourt Resources Challenge

Mogok Makan Berlanjut

MEDAN (Waspada): Kebakaran besar kembali terjadi di Medan. Kali ini, api melalap gudang arsip dan laboratorium Dinas Bina Marga Kota Medan di Jl. TB Simatupang, Kec Medan Sunggal, Jumat (15/6) malam sekitar pukul 19.30. Tidak ada korban jiwa dalam kebakaran tersebut dan kerugian masih dalam penghitungan. Saksi mata, Jaharuddin mengatakan, asap kebakaran pertama kali terlihat dari gudang asip. Selanjutnya melebar ke gedung labolatorium yang berada di sebelahnya. “Tadinya kami duduk di belakang dan melihat ada asap

dari gudang arsip. Aku langsung menelepon petugas kebakaran dan sebelum mereka sampai api sudah meyambar gudang laboratorium,” katanya. Kadis Bina Marga Kota Medan Gunawan mengatakan, gudang arsip itu berisikan dokumen dan kertas- kertas yang sudah lama tidak digunakan. Sedangkan gudang laboratorium yang terbakar berisi sejumlah peralatan penguji ketahanan bangunan dan aspal jalan. “Arsip yang terbakar itu, arsip sepuluh tahun lalu dan d a f t a r a b s e n p e g a w a i ,” Lanjut ke hal A2 kol 4

Mayat Bayi Dicuri Dari Kuburnya

“Agincourt Resources: Realy business or stupied case?” Judul yang di-ok-kan Wapemred Teruna Jasa Said untuk tulisan ini. Terinspirasi usai membaca berita Waspada mengenai kemarahan masyarakat Batangtoru yang terbit bersama Surat Kepada Ahok Martua Sitorus (13/6). “Ribuan Warga Batangtoru Marah, Bakar Mobil dan Pipa Limbah Tambang Emas”. Surat kepada Ahok mengingatkan supaya keharmonisan yang sudah lama ada dilanjut tingkatkan. Maksud tulisan ini sebagai tausiyah kepada Agincourt Resources (AR) dan para stakeholders di Sumatera Utara. Supaya tidak mengulangi kasus Freeport di Papua. Supaya

MEDAN (Waspada): Aksi mogok makan dan jahit mulut yang dilakukan Kelompok Tani Torang Jaya Mandiri (KTTJM) Padanglawas di DPRD Sumut terus berlanjut. Jumat (15/6) sore, Rio Situmorang, 27, salah satu petani pingsan dan dievakuasi ke RS Islam Malahayati Medan. “Saat mau ke kamar mandi keluar dari tenda dia pingsan, sehingga dilarikan ke

ANGKOLA TIMUR (Waspada): Ratusan warga di Desa Pargarutan Julu, Kec. Angkola Timur, Kab Tapanuli Selatan, digegerkan adanya pencurian jenazah balita dari makamnya, Jumat (15/6). Kepala Desa Pargarutan Julu, Yusron Harahap mengatakan kejadian diketahui Kamis (14/6) siang, saat ayah almarhum melihat makam anaknya seorang bayi lakilaki berumur tiga hari yang wafat dua minggu lalu sudah terbongkar. Saat diperiksa ternyata jenazah anaknya sudah tidak ada lagi di dalam kubur tersebut. ‘’Harapan kami kepada Polres Tapsel dapat mengungkap motif pembongkaran dan pencurian jenazah bocah itu dan menangkap pelakunya,’’ katanya. Informasi beredar di masyarakat di wilayah Pargarutan,

Lanjut ke hal A2 kol 3

Lanjut ke hal A2 kol 6

Lanjut ke hal A2 kol 1

Oleh Jhon Tafbu Titonga

Al Bayan


Ibu Negara Jalani Operasi Di AS JAKARTA (Antara): Ibu Negara Ani Yudhoyono akan menjalani operasi di Rumah Sakit Allegheny General Hospital, Pittsburgh, Pennsylvania, Amerika Serikat (AS), demikian kata Juru Bicara Kepresidenan, Julian Aldrin Pasha. “Tim dokter dari RS Allegheny General Hospital, Pittsburgh, Pennsylvania, AS menyatakan bahwa Ibu Negara Lanjut ke hal A2 kol 6

Gatot: Sekda Penentu Reformasi Birokrasi MEDAN (Waspada): Plt Gubsu H Gatot Pujo Nugroho mengukuhkan pengurus Komisariat Wilayah Forum Sekretaris Daerah Seluruh Indonesia (Komwil Forsesdasi) Provinsi Sumatera Utara periode 2011-2015, di Aula Martabe Kantor Gubsu, Jumat (15/6). Pengurus yang dikukuhkan sesuai SK No 001/Komwil Forsesdasi/Sumut/2012 tentang kepengurusan Komwil

Oleh: H. Ameer Hamzah

TIDAK banyak yang tahu tentang kegagahperkasaan pahlawan nasional dari Kab. Karo. Dia adalah Kiras Bangun atau yang lebih populer disapa Gara Mata (mata merah),

SAMOSIR (Waspada): Dua pelajar SMP Satu Atap Negeri 4 Pangururan, ditemukan tewas setelah tenggelam saat berenang di perairan Danau Toba, tepatnya di

Lanjut ke hal A2 kol 2

Lanjut ke hal A2 kol 3

Lanjut ke hal A2 kol 1

Waspada/Dede Basri Hasibuan

MAKAM Pahlawan Nasional Kiras Bagun atau lebih akrab disapa rakyat Karo dengan Gara Mata (Mata Merah) di Desa Batu Karang, Kec. Payung Kab. Karo.

Pahlawan Gara Mata Dari Karo

Lanjut ke hal A2 kol 6

Gara-gara Ganti Celana

JAKARTA (Waspada): Menteri Dalam Negeri Gamawan Fauzi menerima masukan Komisi Pemberantasan Korupsi (KPK) terkait Peraturan Menteri Dalam Negeri No 32 tentang hibah Bantuan Sosial (Bansos). Gamawan mengatakan regulasi itu nantinya diganti dengan Permendagri 39 tahun 2012 dengan maksud agar tidak banyak kepala daerah yang terjerat kasus hukum. “Kami sepakati bagaimana regulasinya yang akan diterbitkan termasuk aturan-aturan lain, karena KPK ada Direktur Pencegahan, pencegahan ini kita perketat regulasi, termasuk pengaturan tentang pertambangan, perizinan supaya

Dari Ustman bin Affan ra, ia berkata: Rasulullah SAW bersabda: Orang yang paling baik di antara kamu adalah yang mempelajari Alquran dan mengajarkannnya. (Shaheh Bukhari)

Forsesdasi Sumut diputuskan Sekda Kota Medan Syaiful Bahri sebagai Ketua Forsesdasi Sumut, sedangkan Sekda Pemprovsu selaku dewan Pembina. Dalam SK tersebut diatur jabatan kepengurusan Forsesdasi disesuaikan dengan jabatan Sekda. Apabila seseorang tidak lagi menjabat Sekda, secara langsung jabatan

Ada-ada Saja

Permendagri Bansos Direvisi

Pembaca Quran

MENJADI manusia yang paling baik sebenarnya mudah. Jadilah Anda sebagai qari dan qariah yang mampu membaca Alquran secara baik. Setelah Anda merasa Lanjut ke hal A2 kol 6


BERTOLAK KE MEKSIKO: Presiden Susilo Bambang Yudhoyono melambaikan tangan sesaat sebelum memasuki pesawat kepresidenan di Bandara Halim Perdanakusuma, Jakarta Timur, Jumat (15/6). Kepala Negara beserta rombongan bertolak menuju benua Amerika Selatan untuk menghadiri KTT G20 ke-7 di Los Cabos, Meksiko (17-19 Juni), KTT Rio+20 di Rio de Janeiro, Brazil (20-22 Juni) dan melakukan kunjungan kenegaraan ke Quito, Ekuador (22-23 Juni).

Waspada/Edison Samosir

RATUSAN Masyarakat Pangururan dibantu boat dan sampan mencari dua pelajar yang tenggelam saat mandi di Danau Toba, tepatnya di Pantai Pintu Batu, Jumat (15/6).

2 Pelajar Tewas Di Danau Toba

NALURI wanita ini akhirnya membuka tabir kecurangan suaminya yang ternyata beristri dua. Wanita asal Timur Tengah itu awalnya curiga karena suaminya selalu berganti-ganti celana dalam saat pulang ke Lanjut ke hal A2 kol 2

Serampang - Sekalian singgah nonton Euro - He.... he....he....

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) SABTU, Legi, 16 Juni 2012/26 Rajab 1433 H z zNo: 23897 * Tahun Ke-66

Terbit 24 Halaman (A1-12, B1-12) z zHarga Eceran: Rp 2.500,-

Waspada/Irwandi MN

TERSANGKA anggota sindikar curanmor bersama barang bukti saat diamankan di Mapolres Aceh Tengah, Jumat (15/6).

Polisi Bongkar Sindikat Curanmor Di Takengen

Bertolak Ke Meksiko Presiden Susilo Bambang Yudhoyono melambaikan tangan sesaat sebelum memasuki pesawat kepresidenan di Bandara Halim Perdanakusuma, Jakarta Timur, Jumat (15/6). Kepala Negara beserta rombongan bertolak menuju benua Amerika Selatan untuk menghadiri KTT G20 ke-7 di Los Cabos, Meksiko (1719 Juni), KTT Rio+20 di Rio de Janeiro, Brazil (2022 Juni) dan melakukan kunjungan kenegaraan ke Quito, Ekuador (22-23 Juni).

TAKENGEN (Waspada): Polres Aceh Tengah membongkar sindikat pencurian sepeda motor (curanmor) antarkabupaten. Sementara secara terpisah dua pelaku pencurian hewan dan pemakai narkoba juga diamankan. Lanjut ke hal A2 kol 6

Ibu Negara Jalani Operasi Di AS JAKARTA (Antara): Ibu Negara Ani Yudhoyono akan menjalani operasi di Rumah Sakit Allegheny General Hospital, Pittsburgh, Pennsylvania, Amerika Serikat (AS), demikian kata Juru Bicara Kepresidenan, Julian Aldrin Pasha. “Tim dokter dari RS Allegheny General Hospital, Pittsburgh, Pennsylvania, AS menyatakan bahwa Ibu Negara siap diambil tindakan besok (Sabtu (16/6) hari ini) pukul 07.30 waktu setempat atau pukul 19.30 WIB,” katanya ketika dihubungi di Jakarta, Jumat (15/6). Menurut Julian, Ibu Negara telah menjalani serangkaian pemeriksaan oleh tim dokter dan dilakukan secara menyeluruh. Julian tidak menyinggung tentang sakit yang sedang diderita oleh Ani Yudhoyono. “Mohon doa agar operasi berjalan lancar dan sukses,” katanya. Sebelumnya, Presiden Yudhoyono dalam keterangan pers di Istana Negara Jakarta mengatakan, Ibu Negara dijadwalkan menjalani tindakan medis sehingga harus berada di rumah sakit sehari sebelum hingga sehari setelah tindakan medis tersebut. “Khusus gangguan kesehatan yang sekarang saya tidak bisa menjelaskan secara teknis, tapi ada gangguan syaraf Lanjut ke hal A2 kol 5

-- Antara

2 Pelajar Tewas Di Danau Toba

SAMOSIR (Waspada): Dua pelajar SMP Satu Atap Negeri 4 Pangururan, ditemukan tewas setelah tenggelam saat berenang di perairan Danau Toba, tepatnya di perairan Pintu Batu, Kec Pangururan, Kab. Samosir, Jumat (15/6) petang. Seorang lagi teman korban Sinar Cahaya Br Situmorang selamat.

Informasi Waspada peroleh dari Kepala Sekolah SMP Satu Atap Negeri 4 Panguruarn TO Br Simbolon ,SPd korban Emma br Samosir, 15, dan Lamtiar Simbolon, 15, usai melakukan sidik jari pergi berenang di perairan Danau Toba. Namun, saat berenang ke-

duanya tenggelam. Sedangkan seorang lagi teman mereka selamat. Pantauan Waspada di lokasi, ratusan masyarakat berusaha mencari kedua korban tenggelam menggunakan dua boat dan dua sampan. Lokasi hilangnya kedua

pelajar itu merupakan perairan Danau Toba yang cukup dalam hingga 10 meter. Camat Pangururan, DPRD Samosir dan Tim dari Badan Penanggulangan Bencana Daerah Kab Samosir langsung turun ke lapangan. Sementara, Kepala Badan

Penanggulan Bencana Daerah Kab. Samosir Purnamawan Malau kepada Waspada, Jumat (15/6) mengatakan, pihaknya sudah menurunkan tim beserta alat bantu yang ada dan turut melakukan pencarian. Sekitar pukul 18:50, kedua korban ditemukan sudah tewas. (c11)

Mogok Makan Dan Jahit Mulut Berlanjut,Satu Pingsan MEDAN (Waspada): Aksi mogok makan dan jahit mulut yang dilakukan Kelompok Tani Torang Jaya Mandiri (KTTJM) Padanglawas di DPRD sumut terus berlanjut. Lanjut ke hal A2 kol 7

Tim Labfor Selidiki Kebakaran Mako Satlantas MEDAN (Waspada): Tim Labfor Cabang Medan menyelidiki puing-puing di lokasi kebakaran Markas Komando (Mako) Sat Lantas Polresta Medan. Dari hasil olah TKP tersebut, tim Labfor mengambil sejumlah sample sisa kebakaran untuk bahan penyelidikan. Selain menyelidiki dan olah TKP, Polresta juga mengambil keterangan sejumlah saksi yang mengetahui dan melihat awal kebakaran tersebut. Namun, belum diketahui berapa jumlah saksi yang diperiksa. “Ada beberapa saksi yang diperiksa, namun saya belum

tau berapa jumlahnya,” kata Kapolresta Medan Kombes Monang Situmorang, Jumat (15/6). Dijelaskan Situmorang, pasca kebakaran tersebut, personil Sat Lantas telah membersihkan sisa-sisa puing kebakaran. Personil juga telah memasang peralatan komputer di ruangan baru. Ruangan baru yang digunakan untuk ruang foto SIM tersebut sebelumnya digunakan sebagai kantin Bhayangkari. “Senin, pelayanan SIM akan normal kembali. Karena peralatan komputer foto SIM Lanjut ke hal A2 kol 1

Waspada/Surya Efendi

TELITI PENYEBAB KEBAKARAN: Sejumlah petugas Laboratorium Forensik Poldasu meneliti lokasi kebakaran Mako Satlantas Polresta Medan, Jumat (15/6). Akibat kebakaran ini, pengurusan surat izin mengemudi (SIM) dipindah ke Mapolresta Jl. HM Said Medan.

Agincourt Resources Challenge

Labfor Periksa Pembakaran Kantor KPU Sidimpuan

Mayat Bayi Dicuri Dari Kuburnya

“Agincourt Resources: Realy business or stupied case?” Judul yang di-ok-kan Wapemred Teruna Jasa Said untuk tulisan ini. Terinspirasi usai membaca berita Waspada mengenai kemarahan masyarakat Batangtoru yang terbit bersama Surat Kepada Ahok Martua Sitorus (13/6). “Ribuan Warga Batangtoru Marah, Bakar Mobil dan Pipa Limbah Tambang Emas”. Surat kepada Ahok mengingatkan supaya keharmonisan yang sudah lama ada dilanjut tingkatkan. Maksud tulisan ini sebagai tausiyah kepada Agincourt Resources (AR) dan para stakeholders di Sumatera Utara. Supaya tidak mengulangi kasus Freeport di Papua. Supaya

P.SIDIMPUAN (Waspada): Dua ahli forensik dari Laboratorium Forensik (Labfor) Polri Cabang Medan AKP Yudi Atnis dan AKP Roy Siburian memeriksa dan mengambil sampel barang bukti di lokasi kebakaran Lt 2 kantor Komisi Pemilihan Umum (KPU) Kota Padangsidimpuan, Jumat (15/6). Pantauan Waspada, tim

ANGKOLA TIMUR (Waspada): Ratusan warga di Desa Pargarutan Julu, Kec. Angkola Timur, Kab Tapanuli Selatan, digegerkan adanya pencurian jenazah balita dari makamnya, Jumat (15/6). Kepala Desa Pargarutan Julu, Yusron Harahap mengatakan kejadian diketahui Kamis (14/6) siang, saat ayah almarhum melihat makam anaknya seorang bayi lakilaki berumur tiga hari yang wafat dua minggu lalu sudah terbongkar. Saat diperiksa ternyata jenazah anaknya sudah tidak ada lagi di dalam kubur tersebut. ‘’Harapan kami kepada Polres Tapsel dapat mengungkap motif pembongkaran dan pencurian jenazah bocah itu dan menangkap pelakunya,’’ katanya. Informasi beredar di masyarakat di wilayah Pargarutan,

Lanjut ke hal A2 kol 2

Lanjut ke hal A2 kol 3

Lanjut ke hal A2 kol 6

Oleh Jhon Tafbu Titonga

Al Bayan


Neneng Pulang Ke Tanah Air Lewat Jalur TKI Ilegal

Pembaca Quran Oleh: H. Ameer Hamzah

Dituduh Curi Sepatu, Dianiaya Polisi IDI (Waspada): Polisi menangkap empat remaja karena tertuduh mencuri sepatu milik keponakan anggota Polisi yang bertugas di Polsek Idi, Rayeuk, Rabu (13/6). Namun, Polsek Idi, Aceh Timur, esoknya melepaskan kembali remajaremaja itu setelah diperiksa sehari penuh. Munawir, salah satu dari empat remaja itu harus masuk RSUD Idi, karena sakit di bagian dada dan perut diduga akibat mendapat perlakuan kasar dan disetrum oknum polisi. Keempat remaja

itu bernama Yani, 16, Budi, 18, Munawir, 15, dan Eka, 16, asal Idi Rayeuk. Munawir mengakui, dia mendapat tindakan kasar dari oknum polisi di Polsek Idi. Munawir mengaku dia dipukuli dengan sodokan lutut dan disetrum dengan sebuah alat di bagian dada. “Saya dipukuli di dada,” kata Munawir. Merasa sakit di bagian perut dan dada, selanjutnya Munawir didampingi tim advokasi Yayasan Advokasi Rakyat Aceh (YARA) dibawa ke

Beruang Merah Tak Tergoyahkan Analisis Sarman Panggabean

TIDAK banyak yang tahu tentang kegagahperkasaan pahlawan nasional dari Kab. Karo. Dia adalah Kiras Bangun atau yang lebih populer disapa Gara Mata (mata merah),

TIM asuhan Dick Advocaat, Beruang Merah, tak tergoyahkan lagi untuk lolos dari Grup A. Menghadapi Yunani, tim paling buncit malam nanti, hasil seri sudah cukup mengantarkan Rusia ke babak berikutnya. Pencetak gol terbanyak saat ini, Alan Dzagoev, bahkan sangat berpeluang menambahi koleksi tiga golnya. Ini akan melengkapi kisah indahnya sebagai striker pendatang baru, yang tak diduga muncul sebagai bomber utama selain Shirokov. Dengan poin empat tanpa mengindahkan pertandingan terakhir Ceko vs Polandia, ucapan selamat kita berikan kepada sang pelatih asal Belanda, Dick Advocaat. Kekuatan Rusia adalah strategi tim yang melakukan pertahanan utuh dengan empat pemain bertahan, yang selalu disiplin berada di daerahnya. Sistem seperti ini malah tak dimiliki Belanda, negara asal Advocaat, yang sedang kritis di Grup B. Kekurangan bantuan serangan dari pemain bertahan pun tidak mengurangi agresivitas penyerangan Beruang

Lanjut ke hal A2 kol 1

Lanjut ke hal A2 kol 6

Dari Ustman bin Affan ra, ia berkata: Rasulullah SAW bersabda: Orang yang paling baik di antara kamu adalah yang mempelajari Alquran dan mengajarkannnya. (Shaheh Bukhari) MENJADI manusia yang paling baik sebenarnya mudah. Jadilah Anda sebagai qari dan qariah yang mampu membaca Alquran secara baik. Setelah Anda merasa Lanjut ke hal A2 kol 2

JAKARTA (Waspada): Tekateki masuknya Neneng Sri Wahyuni, buronan kasus proyek Pembangkit Listrik Tenaga Surya ke Indonesia sedikit terang-benderang. Menurut pengakuan kepada salah satu pengacaranya, Hotman Paris Hutapea, Neneng masuk ke

Waspada/Muhammad H Ishak

ORANGTUA dan keluarga mendampingi Munawir, korban penganiayaan yang diduga dilakukan seorang anggota polisi ketika dirawat di RSUD Idi, Aceh Timur, Jumat (15/6).

Waspada/Dede Basri Hasibuan

Makam Pahlawan Nasional Kiras Bagun atau lebih akrab disapa rakyat Karo dengan Gara Mata (Mata Merah) di Desa Batu Karang, Kec. Payung Kab. Karo.

Pahlawan Gara Mata Dari Karo

Lanjut ke hal A2 kol 5

Rumah Sakit Umum Daerah (RSUD) Idi, Kamis (15/6), untuk proses visum dan dilakukan perawatan. Dokter di rumah sakit itu menyarankan Munawir dirawat inap. Hingga kini Munawir masih dalam perawatan tim medis. Direktur Eksekutif YARA, Safaruddin, Jumat (15/6) menjelaskan, kasus Munawir kini telah ditangani dan Ketua Staf Khusus YARA, Hasanuddin telah mendampingi Munawir Lanjut ke hal A2 kol 6

Ada-ada Saja

Gara-gara Ganti Celana

NALURI wanita ini akhirnya membuka tabir kecurangan suaminya yang ternyata beristri dua. Wanita asal Timur Tengah itu awalnya curiga karena suaminya selalu berganti-ganti celana dalam saat pulang ke Lanjut ke hal A2 kol 5

Serampang - Sekalian singgah nonton Euro - He.... he....he....

Berita Utama


SPBU Di Rantauprapat Meledak Banda Aceh 37 Derajat Celcius RANTAUPRAPAT (Waspada): SPBU No. 14 214 225 Jalan Ahmad Yani Kelurahan Bakaranbatu Kec. Rantau Selatan meledak, Jumat (15/6) siang. Tidak ada korban jiwa dalam peristiwa tersebut. Peristiwa kebakaran yang diawali ledakkan tabung gas diduga disebabkan tindakan karyawan SPBU yang memencet tombol yang menghubungkan tangki timbun dengan mesin pompa. Ledakkan keras pun berdentum sehingga karyawan SPBU maupun konsumen yang sedang

antre mengisi BBM lari berhamburan menyelamatkan diri. Takut pristiwa meledaknya SPBU terulang kembali. Masih segar dalam ingatan masyarakat Rantauprapat peristiwa SPBU Simpang Mangga No. 14.214.280 di Jalan Aek Tapa Kelurahan Bakaranbatu Kec. Rantau Selatan pernah meledak dan menewaskan dua orang karyawan SPBU serta melukai konsumen dan warga sekitar SPBU. Kejadian itu terulang kembali pada SPBU Ahmad Yani yang diduga masih satu pemilik dengan SPBU Sim-

pang Mangga yang hingga kini tidak diketahui pasti apakah pemilik diproses atau tidak. Akibat peristiwa itu, atap gudang terlepas; dinding belakang gudang jebol dan bagian depan gudang rusak. Polisi telah memasang police line di lokasi. Kapolres Labuhanbatu AKBP Hirbak Wahyu Setiawan mengatakan belum mengetahui pasti penyebab ledakkan. “Kita akan undang dulu tim ahli dari Pertamina,” ujarnya. (a17)

BANDA ACEH (Antara): Musim kemarau ini akan semakin panas di Banda Aceh, Provinsi Aceh. Staf Badan Meteorologi, Klimatologi dan Geofisika (BMKG) menyebutkan, ibukota Provinsi Aceh itu akan bertemperatur maksimal 37 derajat Celcius (98,6 derajat Fahrenheit). “Kemarau di Aceh sebenarnya sejak akhir Mei 2012, namun temperatur udara panas dirasakan dalam beberapa hari terakhir,” kata Staf Stasiun Meteorologi Blang Bintang

Tim Labfor ....

Medan. Sebagaimana diberitakan sebelumnya markas Satuan Lalulintas Polresta Medan yang berada di Jalan Adinegoro, Kamis (14/6) sekira pk 16:20 musnah terbakar. Tidak ada korban jiwa namun arsiparsip lalulintas, BAP Kecelakaan Lalulintas, monitor CCTV dan Komputer Online ke Mabes Polri turut terbakar. Kobaran api memporakporandakan lantai II yang merupakan ruang kerja Kasat Lantas Kompol M Risya Mustario, ruang Waka Satlantas AKP AA Rangkuti, ruang Kanit Dikyasa AKP Rosmawati, ruang Kanit Laka AKP Juwita, ruang Kaur Bin Ops Iptu Sitorus, ruang Minlaka, mushola dan ruang ADC Kasat Lantas. Kendati seluruh ruangan di lantai II terbakar, namun ruangan di lantai dasar tidak terbakar. Ratusan berkasberkas pemohon surat izin mengemudi (SIM), komputer cetak SIM dan sejumlah alat foto SIM selamat dari kobaran api. (h04)

Labfor Periksa....

Labfor Polri didampingi Kasat Reskrim Polres P.Sidimpuan, AKP Anjas Asmara Siregar dan Kasubbag Humas AKP Indra Dalimunthe mendatangi kantor KPU di Jalan Mawar, Kel. Ujung Padang, Kec. Sidimpuan Selatan, sekira pukul 16:00. Mereka menuju lantai dua bangunan kantor penyelenggara Pemilu yang dua hari sebelumnya dibakar seorang bakal calon wali kota dari jalur perseorangan, Ali Anas Hasibuan. Garis polisi yang sebelumnya dipasang di tangga kantor, langsung dibuka. Setelah mengambil keterangan ketua dan komisioner KPU, Arbanur Rasyid, Ahmad Efendi Nasution, Muzakkir Khotib, Mohot Lubis, dan Hapner Yani Siregar, Tim Labfor memulai penyelidikan dengan pengambilan gambar untuk dokumentasi. Selanjutnya dua pria yang mengenakan rompi dengan tulisan ‘Labfor’ itu meminta semua orang yang berada di kantor KPU untuk meninggalkan lokasi dengan ala-

san konsentrasi penyelidikan. Seusai melakukan penyelidikan dan pengambilan sampel, tim forensik bergegas meninggalkan kantor KPU menuju Mapolres Padangsidimpuan guna menyelidiki barang bukti berupa botol bekas air mineral yang diisi bensin oleh pelaku pembakaran. “Kita mengambil barang bukti forensik dengan menggunakan kapas pada residu (abu atau arang bekas pembakaran) seluruh barang bukti yang hangus. Selanjutnya kita akan memeriksa kandungan apa saja yang ada pada residu tersebut di Labfor Polri cabang Medan,” kata AKP Yudi Atnis kepada wartawan. Ditanya kapan hasil pemeriksaan forensik ini selesai, menurut AKP Roy Siburian paling lama dua pekan. “Kami tidak bisa menceritakan lebih banyak tentang pemeriksaan ini, karena kami memiliki kode etik. Tentang hal-hal yang menyangkut pidana, silakan tanyakan kepada Kasat Reskrim,” ujarnya.

kolonialis. Namo jadi Aras, yang artinya aliran air tenang jangan diangap remeh, karena akan bisa menjadi arus yang deras dan berbahaya. “Kata Namo-Aras memang sering ditulis Gara Mata di setiap pohon bambu. Ya, untuk menunjukan sikap perlawa-nan kepada Belanda, dan memacu semangat rakyat Karo,” terang Rekro Tarigan yang berperan penting mema-sukkan nama Kiras Bagun sebagai Pahlawan Nasional didampinggi Ketua PMK Desa Batu Karang, Sikap Tarigan kepada Waspada saat me-nyambangi makam Kiras Bagun, Jumat (15/6). Dikatakan Sekretaris Penggagas Pahlawan Nasional Kiras Bagun ini, Gara Mata me-mang gigih mengusir penjajah dari tanah kelahirannya. Dikisahkan, memasuki awal 1901, utusan Belanda bolak-balik, bahkan sampai empat kali, datang dari Binjai ke Kab. Karo dengan alasan untuk bersahabat dengan warga Karo, serta tidak akan ikut campur dalam urusan warga meng-ingat rakyat Karo sudah dapat mengatur diri sendiri, sesuai dengan pera-

datannya. Namun, kedatangan Belanda dengan berbagai alasan mendapat penolakan dari Mata Merah. Memasuki tahun 1902, dengan diam-diam serdadu Belanda be-rangkat ke Kab. Karo dengan tujuan Kabanjahe melalui lintas jalan Sunggal dan Sibolangit. Di Kabanjahe, persisnya di Satlantas Kabanjahe seka-rang, serdadu Belanda mendi-rikan pemondokan, dan dapat diketahui warga sekitar yang melihat orang berkulit putih ada di daerahnya. Kabar kedatangan Belanda sampai ke kuping Gara Mata. Mengetahui serdadu Belanda datang lagi, amarah si Mata Merah kian memuncak. Dia bersama pejuang lainnya angkat senjata dan berhasil mengusir penjajah. “Tahun 1903 Belanda datang lagi, dengan pasukan lebih kuat, dan Gara Mata bersatu menggalang kekuatan bersama rakyat Aceh. Dengan nama pertempuran Urang Satu, yang tujuannya tetap sama mengusir Belanda. Jika Belanda tetap di Bumi Turang diyakini

Belanda akan meng-atur di Karo dan menyengsarakan rakyat,” ujarnya. Pada 1904, Belanda memasuki wilayah Seberaya, menambah kemarahan Gara Mata dan kawan-kawan. Sang Mata Merah kembali mela-wan. 10 anggota Gara Mata tewas dalam pertempuran itu. Mereka sudah melakukan penjagaan ketat mulai dari Alas, Gayo, hingga ke tanah kelahirannya. Pada 22 Oktober 1942 Kiras Bangun wafat karena sakit akibat ulah Belanda yang mengerangkengnya tanpa bisa menggerakkan tubuhnya selama dalam pengasingan, dan dimakamkan di tanah kelahirannya. Pada 2005 Kiras Bagun alias Gara Mata sah menjadi pahlawan nasional yang disahkan Mensos Bachtiar Chamsyah pada 2005 di Jakar-ta. Makam sang pahlawan pada 2006 juga dibangun dengan anggaran Rp1 miliar. Juga Jalan Gara Mata dino-batkan di Kota Kabanjahe, tepatnya mulai dari tugu perjuangan hingga ke simpang empat. * Dede Basri Hasibuan

Agincourt ....

syarakat karena sungai kehidupan mereka dicemari limbah. Sudah disampaikan kepada semua pihak, Pemprov, Pemkab, dan DPRD. Karena perusahaan asing (PMA), Pemerintah juga sudah tahu persis melalui persyaratan PMA seperti studi kelayakan dan AMDAL. Surat kabar memberitakan kerja sama AR dengan perguruan tinggi tempat semua pakar berkumpul. Di Batangtoru juga ada entitas bisnis (PTPN3) yang sudah lama bertetangga dengan masyarakat desa. Ada banyak pihak yang disebut sebagai stakeholders. Masingmasing seharusnya peduli dan berperan mencegah-mengatasi masalah seperti yang menimpa AR. Masalahnya sederhana, yakni care and share. Pemrovsu, Pemkab Tapsel, dan DPRD sudah lama tahu ada tandatanda kemarahan. Tidak ada respon yang memadai. Polisi yang hadir di tempat perkara rupanya terlalu minim. Para pakar sudah membuat AMDAL tapi mungkin lupa dampak sosial tambang emas. Mungkin sudah ada analisis dan antisipasi dalam AMDAL namun tidak dipedulikan. Entitas bisnis, seperti PTPN3 yang ikut menanggung akibat kemarahan, sudah lama

bertetangga dengan masyarakat desa, sepantasnya sudah lama bisa ikut share. Tapi seperti biasa, BUMN pun sering abai pada lingkungannya. Ini dari pengalaman mengenal perusahaan perkebunan sejak anak-anak di Labuhanbatu tempat saya lahir dan besar. Bukan saja perusahaan pertambangan. Perkebunan pun sering konflik dengan masyarakat gara-gara lahan yang kian menyempit dan terpragmentasi. Jika sudah memuncak, perusahaan minta bantuan Polisi. Itu tercermin pada pertemuan Kapoldasu Irjen Pol Wisjnu Amat Sastro dengan Dirut PTPn2, PTPN3 dan PTPN4 di Mapoldasu (23/6). Di lain pihak rakyat sulit mafhum kalau pembagian lahan HGU kepada rakyat dikatakan merugikan negara. Sebab, rakyat juga unsur negara, sedangkan BUMN ialah badan privat. Belakangan ini konflik rakyat dengan dunia usaha makin sering terjadi. Di Medan, Langkat dan Batangtoru ialah contoh paling mudah sekarang. Sumber utama masalah ini hanyalah care and share. Solusinya juga bisa sederhana dan segera. Marilah kita bangun kehidupan yang care and share. Jadi, solusinya tidak rumit, semua kita care and share.

ku adalah yang membaca Alquran (Hr.Baihaqi). Membaca Alquran secara benar sebagaimana qari dan qariah kita itu sangat besar pahalanya dan termasuk orang yang selalu berdialog dengan Allah, (Hr: Turmudzi), menjadi teman para malaikat (Hr Dailami), jika ia menghafal ayat Alquran pahalanya berlipat ganda dan menjadi sahabat malaikat (Hr Bukhari dan Muslim). Orang membaca Alquran dan mengamalkan isinya ibarat buah jeruk manis, rasanya enak dan baunya harum (Hr Mutafaqun alaihi). Karena itu Rasulullah meminta kepada umatnya untuk mempelajari Alquran

dan mengamalkan isinya secara benar. Bila seseorang memenuhi ajakan Rasul, mereka diibaratkan seperti minyak wangi yang tercium wanginya di mana-mana (Hr:Ibnu Majah, Abu Daud, Mu s l i m d a n Tur m u d z i ) . Sahabat Nabi Abu Dzar alGhifari meriwayatkan bahwa Rasulullah bersabda: Wahai Abu Dzar! Kamu pergi mempelajari Alquran satu ayat, masih lebih baik dari kamu shalat sunat seratus rakaat (Hr :Ibnu majah). Semoga Allah SWT mengembalikan hati kita semua untuk tunduk dan patuh kepada Alquranul Karim. Amiiinnnn ya arhamarrahimiin.

tidak ada yang rusak karena berhasil diselamatkan oleh petugas,” ujarnya. Pantauan Waspada, seluruh personil Sat Lantas Polresta Medan terlihat sibuk membersihkan seluruh ruangan. Sejumlah teknisi listrik mulai memasang instalasi dan jaringan AC. Ruangan kantin Bhayangkari yang selama ini digunakan untuk kantin umum disulap menjadi ruang foto SIM sementara menunggu renovasi ruangan utama yang terbakar. Sementara itu, ruangan untuk pendaftaran bagi pemohon SIM Baru terpaksa dipindahkan ke aula Kamtibmas Polresta Medan, termasuk juga lokasi ujian teori dan praktek. Pada Jumat (15/6) pasca kebakaran tersebut, ada 30 pemohon SIM Baru yang mengikuti ujian teori dan praktek. Mereka mengikuti ujian di aula Kamtibmas dan melaksanakan ujian praktek di halaman upacara Polresta

History ....

berasal dari Desa Batu Karang, Kec. Payung. Bahkan, Gara Mata terlupakan oleh zaman. Banyak generasi muda yang tidak tahu bagaimana kegigihan anak Tanda Bangun dan Beru Ginting ini dalam mengusir penjajah. Mata Merah, selain menjabat sebagai kepala adat, juga orang terpandang di masa itu. Dia mengorganisir pemuda setempat untuk angkat senjata melawan penjajah pada 1900 – 1916. Dengan perlengkapan perang seadanya, Gara Mata bersama pejuang lainnya tampil ke medan perang melawan penindasan Belanda, yang memang kian merajarela di Bumi Turang dengan alasan memajukan pertanian, setelah berhasil menguasai sebagian Provinsi Sumatera Utara, tepatnya bagian Timur seperti Binjai dan Langkat pada 1870. Kisah kegagahperkasaan Gara Mata pernah ditulis Pendiri Harian Waspada alm. H. Mohammad Said pada 1973. Gara Mata sering menulis Namo-Aras di rumpun bam-bo, sebagai bagian dari upaya menunjukkan perlawanan kepada Belanda, sekaligus untuk memacu semangat rakyat Karo untuk melawan

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Mg6, MxB (terpaksa). 2. MxM+, Gh6. 3. MxG+, Bh7. 4. MxB+mat. (Jika lebih dulu 1. BxMh6+, GxB. 2. Mg6, Gf4. 3. Mh5+, Rg7. 4. Mh7+, RxK. 5. BxGf4+, Re5 atau Re6. 6. Mf5+mat. Atau 5. ...., Rg5. 6. Bf5+mat).

Jawaban TTS: TTS Topik

Musik & Filem

Sumatera Utara tidak menjadi identik dengan Papua. It’s a challenge, dan sekaligus sebagai teguran dan keraguan akar rumput terhadap AR, Pemprovsu, Pemkab Tapsel, DPRD dan Kepolisian. Ke m a r a h a n m a s y a r a k a t Batangtoru karena limbah tambang mencemari sungai harus dilihat dengan hati lapang. Orang desa, seperti saya, sangat faham dan sadar pentingnya fungsi sungai sebagai sumber kehidupan. Sungai merupakan tempat mengambil air minum, mandi, udhu’, mencuci dan membuang produk pagi alias MCK. Sungai juga sumber gizi dari ikan dan udang. Sumber pangan di daerah aliran sungai (DAS) seperti sayur pakis, dan buah seperti rukam dan jambu air. Pada musimnya anak-anak biasa mendapat durian hanyut saat mandi di sungai. Sungai ialah tempat olah raga renang, menyelam, kejarkejaran, latihan memperkuat otot, dan latihan memimpin. Pendeknya sungai ialah kehidupan. Jika ada pengrusakan sungai oleh manusia, orang desa bisa marah apalagi sudah lelah bicara baik-baik. Kasus Batangtoru sebenarnya sederhana. Ada pencemaran yang merisaukan ma-

Al Bayan ....

Jawaban Sudoku: 6 3 0 5 2 4 8 9 7 1

2 4 7 1 8 5 3 6 0 9

9 0 6 8 7 3 5 1 2 4

1 8 3 4 9 0 2 7 5 6

7 5 2 9 1 6 4 0 8 3

4 1 9 7 5 8 0 3 6 2

8 9 4 6 0 1 7 2 3 5

5 2 1 3 6 7 9 8 4 0

0 7 5 2 3 9 6 4 1 8

3 6 8 0 4 2 1 5 9 7

mampu membaca dengan baik Alquran itu Anda juga perlu mengajarkannya kepada orang lain. Masih ada satu syarat yang perlu Anda penuhi, yakni ikhlas lillahi ta’ala. Bila ketiga syarat ini dapat Anda penuhi InsyaAllah Anda termasuk manusia paling baik. Menurut Rasulullah SAW, para qari dan qariah yang mampu memenuhi tiga syarat di atas, manusia tersebut akan mendapat syafaat dari Alquran di hari akhirat kelak. Alquran datang dengan syafaat untuk membela pembacanya dari azab (Shaheh Muslim). Dalam hadits lain Rasulullah memuji: Yang paling utama dari umat-

Rahmad Tauladani di Banda Aceh, Jumat (15/6). Suhu udara panas dan masuknya musim kemarau itu, dia menjelaskan, secara umum juga terjadi di seluruh Indonesia. Ini termasuk cuaca dalam keadaan ekstrim. Faktor-faktor pemengaruh adalah kelembaban udara rendah (45-95 persen), kegagalan pembentukan awan hujan, dan hembusan permukaan dingin dari Samudera Hindia. Menyikapi cuaca panas, prakirawan BMKG itu mengSementara Kasat Reskrim, AKP Anjas Asmara Siregar, didampingi Kasubbag Humas, AKP Indra Dalimunthe, menyatakan tim Labfor Polri ini turun ke KPU atas perintah langsung dari Kapolda Sumatera Utara Irjen Wisjnu Amat Sastro. Ditanya mengenai pelaku, katanya hingga kini masih dimankan di ruang tahanan Mapolres Padangsidimpuan guna mempertanggungjawabkan perbuatannya yang membakar kantor KPU. “Kita sudah memeriksa sejumlah saksi dan mengamankan barang bukti berikut tersangka pelaku pembakaran di Mapolres Padangsidimpuan,” kata Kasat Reskrim, AKP Anjar Asmara Siregar. (a27)

Ibu Negara ....

atau tulang leher yang menurut tim dokter kepresidenan direkomendasikan, karena tidak dimungkinkan dilakukan di dalam negeri, maka dilakukan di sebuah rumah sakit oleh dokter di rumah sakit yang selama ini memiliki keahlian dan pengalaman di Pittsbrugh,” kata Presiden. Kepala Negara mengatakan, selama ini semua tindakan dan pemeriksaan medis bagi Presiden dan Ibu Negara dilakukan di dalam negeri, termasuk operasi pengangkatan kantong empedu yang dilakukan beberapa waktu lalu. Namun untuk gangguan kesehatan kali ini atas rekomendasi tim dokter kepresidenan maka tindakan medis dilakukan di luar negeri. Presiden mengatakan, pada 16 Juni mendatang, ia akan menjemput Ibu Negara pascatindakan medis di Amerika Serikat, dalam perjalanan menuju KTT G20 di Meksiko dan menghadiri KTT Pembangunan Berkelanjutan Rio+20 di Rio De Jenairo Brasil.

Neneng Pulang ....

Indonesia melalui jalur ilegal Tenaga Kerja Indonesia (TKI). “Dia masuk tidak dengan jalur resmi, tidak membawa dokumen apapun, tidak memalsukan apapun, dia mengikuti rombongan TKI,” kata Hotman Paris Hutapea usai menjenguk Neneng di Rutan Komisi Pemberantasan Korupsi, Jakarta Selatan, Jumat (15/6). Menurut Hotman, Neneng masuk ke Batam dari Malaysia melalui jalur ilegal TKI lewat laut. Maka itu, kata Hotman, istr i mantan B endahara Umum Partai Demokrat itu tidak memalsukan dokumen apapun ke Imigrasi setempat. “Dia tidak memalsukan dan tidak mempunyai dokumen resmi apapun,” kata pengacara yang hobi naik mobil mewah ini. Menurut Hotman, tidak ada salahnya bila Neneng yang juga warga negara Indonesia kembali ke kampung halamannya. “Apakah orang yang masuk ke negaranya itu ilegal?” Hotman bertanya balik. Satu hal yang ditekankan Hotman, kliennya itu masuk ke Indonesia tidak membawa dokumen apapun. Saat ini, baru itu yang Hotman peroleh berdasarkan pengakuan dari Neneng. “Detilnya itu saya tidak tahu. Tapi itu tadi pengakuannya. Bagaimana caranya, kami tidak tahu. Dia dari Kuala Lumpur ke Batam lewat laut,” ujar Hotman.

Ada-ada Saja ....

rumah. Ia pun kemudian melaporkan hal ini ke polisi. Kepada polisi, pria tersebut mengaku bahwa ia sudah setahun dipecat dari tempat kerjanya dan harus kawin dengan seorang wanita kaya untuk membiayai hidupnya. Menurutnya, wanita kaya tersebut sudah sejak lama jatuh hati dengannya. “Pria itu mengaku ia banyak menghabiskan waktu bersama istri keduanya, yang memberinya uang setara dengan gaji di tempatnya semula bekerja, plus uang tunjangan,” ujar pria tersebut yang dikutip situs berita Sayyidati. Pria itu tidak pernah berpikir sebelumnya, bahwa istri pertamanya akan mencurigai perihal dirinya berganti-ganti celana dalam. (rzl)

WASPADA Sabtu 16 Juni 2012

Mogok Makan ....

Mayat Bayi ....

Ketika tim Polres Tapsel turun ke tempat kejadian perkara (TKP) untuk memeriksa makam itu, Jumat siang, dipastikan jenazah balita itu sudah tidak ditemukan lagi. Sebelumnya keluarga almarhum melaporkan kejadian itu pada pagi harinya. Kapolres Tapsel, AKBP Subandriya, SH MH diwakili Kasat Reskrim, AKP Lukmin Siregar kepada Waspada lewat telefon, mengaku serius menyelidiki kasus aneh itu. (c13)

nya, dan pemerintah lebih berpihak kepada kepentingan pengusaha dari pada rakyatnya,”ujarnya. Saat ini, kata Sabber, jahit mulut masih dilakukan oleh 3 orang, satu diantaranya dirawat di RS Malahayati. Sebelumnya, aksi mogok makan dilakukan oleh 10 orang. Meskipun sudah sekitar 8 orang pingsan sejak aksi dimulai, aksi ini sambung Sabber, tidak akan pernah berhenti sebelum tuntutan mereka dikabulkan. “Senin ini jika tidak ditanggapi, masyarakat Padanglawas akan melakukan aksi gantung diri walaupun harus sampai mati,” terangnya. Setelah satu jam mendapatkan perawatan, kondisi Rio mulai stabil dan sadar. “Tim medis membuka jahitan di mulut, korban juga mendapatkan infus, untuk menaikkan cairan gula darah pasien. Jika kadar gula bagus pasien sudah boleh pulang,” ujar dr Anggraini. Sebelumnya, Kelompok Tani Torang Jaya Mandiri (KTTJM) ini melakukan aksi mogok makan dan aksi jahit mulut di depan kantor DPRDSU menuntut penghentian perampasan tanah yang dilakukan PT SRL dan PT SSL. (h02)

Polisi Bongkar ....

residivis) karena terlibat curanmor yang terjadi baru-baru ini di Kecamatan Pegasing. “Meski tersangka jaringan curanmor antarkabupaten terbongkar, namun kami masih melacak BKR alias Moses, warga Gayo Lues. Dia agen atau penadah hasil curian, kini dia DPO,” jelas Kapolres di hadapan wartawan di Mapolres Aceh Tengah, Jumat (15/6) Menurut Kapolres, dari tersangka polisi menyita barang bukti berupa satu unit sepeda motor NF125TD Nopol BL 6817 GO, NF125TR Nopol BL 6873 GJ, NF125TR Nopol BL 5114 GN, NF125TR Nopol 5178 GM, NF125TR Nopol BL 6873 GK, NC11DIA Nopol BL

3398 GO dan NF125TD Nopol 3476 GM. “Selebihnya barang bukti lainnya yang digunakan tersangka untuk menjalankan aksinya yakni kunci leter ‘T’, kunci 10 dan 12. Dua kunci terakhir disinyalir dimanfaatkan tersangka untuk mengganti plat kendaraan,” kata Dicky. Sementara itu, polisi setempat secara terpisah juga mengungkap 2 pencuri 7 ekor kambing di Kecamatan Linge yakni SUR, 25, dan JUN, 23. Di mana dalam menjalankan aksinya kedua pelaku menggunakan modus baru, dengan mencuri hewan dan memasukannya ke dalam mobil. (cb09/b32)

Dituduh Curi ....

Banda Aceh telah mendampingi orangtua Munawir melaporkan perkara penganiayaan itu ke Mapolres Aceh Timur di Peudawa dengan No.Pol:LP/ 80/VI/2012/ACEH/Res ATIM tanggal 15 Juni 2012. Tim advokasi YARA kini juga telah menurunkan tiga pengacara yakni Safaruddin, Muzakar dan Hendri Saputrai. “Kami mengecam pemukulan terhadap Munawir dan meminta Polri untuk menindak tegas oknum polisi yang me-

lakukan kekerasan dalam menjalankan tugasnya di Polsek Idi,” kata Safaruddin. Kapolres Aceh Timur AKBP Iwan Eka Putra ketika dikonfirmasi wartawan membenarkan petugas menerima laporan pengaduan perkara penganiayaan yang dilakukan anggota polisi di Mapolsek Idi. “Tunggu saja hasil visum tim medis. Jika hasil visum positif, maka perkara ini akan kita lanjutkan,” katanya. (b24)

Beruang Merah ....

bagi pembinaan sepakbola. Juga bisa menjadi bahan pemikiran bagi para pelatih bahwa merubah tradisi sebuah kesebelasan tidaklah segampang itu. Ethniki menjadi juara di Portugal tahun 2004 dengan strategi ultra-defensive, sistem pertahanan mereka waktu itu bahkan jauh lebih ketat dari catenaccio ala Italia. Sebagai jawara dengan permainan seperti itu, mereka bukan dipuji malahan mendapat ejekan sebagai pencipta sepakbola tidak enak untuk ditonton. Jadi, manakah yang diperlukan oleh para pelatih. Dipuji setinggi langit oleh para pengamat, pemirsa ataupun penonton langsung di arena namun akhirnya kalah dan tidak juara, atau menjadi pemenang dengan permainan seperti Ethniki?. Secara praktis, tuntutan untuk menjadi juara lebih baik dipertahankan. Maka, perubahan yang diperbuat oleh

Yunani untuk mengejar hajat sebagai juara dengan bermain cantik, kini terbukti sebagai kegagalan belaka. Sampai sejauh ini, coba bandingkan lagi dengan nasib Belanda. Dengan meninggalkan tradisi permainan keras dan coba melepaskan diri dari tradisi yang dimiliki khas Oranye, yaitu total football, Meneer juga terbukti gagal. Nyatanya, Yunani dan Belanda memang hanya mendapatkan bumerang yang menghancurkan prestasi tim nasional, karena meninggalkan tradisi. Saya malas untuk memperkeruh situasi dengan nilainilai strategi dan pola negara lain, karena sepakbola kita sendiri masih jauh lebih parah. Yunani, walaupun menduduki posisi tragis di Grup A, mereka tetaplah negara besar sepakbola. Tetapi Indonesia tidak, tim Garuda lebih jauh lagi di dasar bawah ranking FIFA....

imbau masyarakat agar lebih banyak mengonsumsi buahbuahan dan memperbanyak minum air putih sebagai upaya menghindari penyakit. Akan lain halnya jika temperatur udara di atas 45 derajat Celcius (113 derajat Fahrenheit); hutan kering bisa terbakar sendiri akibat pergesekan di antara daun dan ranting kering. “Artinya, kawasan hutan mudah terbakar sendiri jika suhu mencapai 45 derajat Celsius. Jangan buang puntung rokok sembarangan, temperatur 35-37 derajat Celcius,” katanya.

warga menduga adanya orang tidak dikenal (OTK) mencuri bayi laki-laki untuk syarat menuntut ilmu hitam. Pantauan Waspada, warga di desa tersebut terlihat cemas dan iba melihat keluarga almarhum bocah laki-laki yang hilang itu. Orangtua korban MH, 29, dan istrinya, AR, 28, tidak bisa menahan kesedihan hingga isak tangis keluarga jenazah itu terdengar di areal pemakaman.

Menurut Kapolres Aceh Tengah AKBP Dicky Sondani, terbongkarnya kasus curanmor ini berawal petugas mengamankan tersangka MY, 20, pada 19 Mei. Bahkan setelah pengembangan kasus ini, petugas mengungkap keterlibatan tersangka lainnya Nas, 41, ALY, 29, KAS, 25, Has Bin AS, 25, ISM, 25, HAS Bin Ahm, 40. Ketujuh tersangka tersangka ini berasal dari Gayo lues. Sedangkan tersangka lain bagian jaringan curanmor antarkabupaten asal Aceh Tengah: MYS, 60, (seorang penarik becak) berperan sebagai pemantau target. Sementara, polisi menangkap HEL, 22, (seorang

dalam proses pengobatan dan kasus tersebut kini telah dilaporkan ke Polres Aceh Timur, Jumat (15/6) dini hari. “Kita mendampingi Munawir hingga kasus ini selesai. Kasus ini akan kita selesaikan di pengadilan sehingga hukum benar-benar tegak dan rakyat miskin seperti keluarga Munawir bisa merasakan adilnya hukum di negeri ini,” kata Safaruddin seraya menyebutkan, tiga pengacara asal Merah. Sebab tiga gelandang serang Rusia; Roman Shirokov, Roman Pavlyuchenko dan Andrei Arshavin, motor permainan yang sangat meyakinkan. Selain progresif menguasai jalur tengah, mereka sekaligus sebagai pencetak gol berbahaya. Dalam dua pertandingan sebelumnya, kesuburan mencetak gol sebanyak lima kali merupakan bukti nyatanya. Rusia juga dapat kita calonkan akan maju terus sampai ke babak final. Sebaliknya, nasib Yunani sebagai mantan juara Euro 2004, sungguh tragis karena menduduki peringkat buncit. Sulit sekali untuk menantikan apakah Yunani mampu membuat kejutan pada pertandingan terakhir menghadapi Rusia. Penampilan anak-anak Negeri Dewa yang anti-klimaks dari 2004 hingga ke 2012 adalah sebuah contoh nyata

Jumat (15/6) sore, Rio Situmorang, 27, salah satu petani pingsan dan dievakuasi ke RS Islam Malahayati Medan. “Saat mau ke kamar mandi keluar dari tenda dia pingsan, sehingga dilarikan ke RS Malahayati,” ujar Sabber rekan korban. Menurutnya, Rio melakukan aksi mogok makan dan tutup mulut sudah delapan hari tepatnya sejak Jumat (8/6) kemarin. “Aksi ini kami lakukan untuk menuntut penghentian perampasan tanah yang kami miliki dan kami usahai bertahun-tahun.. Namun hingga hari ini tidak ada keseriusan dari pihak DPRD untuk menyelesaikan-


Berita Utama

Tabligh Akbar Dan Baksos Di Tasbi MEDAN (Waspada): Ikatan Keluarga Muslim Taman Setia Budi Indah (IKMT) Masjid Al Musabbihin hari ini, Sabtu (16/6), mengadakan tabligh akbar dan bakti sosial di kompleks perumahan tersebut. Ketua Panitia H. Soemardi KH, didampingi Sekretaris Hj Nalem Sembiring bersama Ketua IKMT H. Maulana Pohan dan Sekum H. Yose Rizal Ahmad mengharapkan partisipasi dan kehadiran warga muslim Tasbi dan sekitarnya juga warga Kota Medan pada umumnya. Menurut Soemardi, Jumat (15/6), tabligh akbar diadakan di Masjid Al Musabbihin ba’da Isya dengan penceramah Drs H. Mashuri Khomis, SH dari Jakarta. Selain itu, IKMT mengadakan khitanan massal di Masjid Al Arif (Tasbi II) pada 24 Juni pukul 09.00 dengan jumlah peserta 100 orang. Kemudian peresmian gedung sekolah TK diadakan di Masjid Al Abrar Desa Cinta Rakyat Berastagi (Desa Binaan IKMT), Minggu (1/7). Bangunan sekolah berdiri di atas tanah seluas 450 meter dengan luas 200 meter. (m13)

2 Pelajar Tewas ... perairan Danau Toba,tepatnya di perairan Pintu Batu, Kec Pangururan, Kab. Samosir, Jumat (15/6) petang. Seorang lagi teman korban Sinar Cahaya Br Situmorang selamat. Informasi Waspada peroleh dari Kepala Sekolah SMP Satu Atap Negeri 4 Pangururan TO Br Simbolon ,SPd korban Emma br Samosir, 15, dan Lamtiar Simbolon, 15, usai melakukan sidik jari pergi berenang di perairan Danau Toba. Namun, saat berenang keduanya tenggelam. Sedangkan seorang lagi teman mereka selamat. Pantauan Waspada di lokasi, ratusan masyarakat berusaha

mencari kedua korban tenggelam menggunakan dua boat dan dua sampan. Lokasi hilangnya kedua pelajar itu merupakan perairan Danau Toba yang cukup dalam hingga 10 meter. Camat Pangururan, DPRD Samosir dan Tim dari Badan Penanggulangan Bencana Daerah Kab Samosir langsung turun ke lapangan. Sementara, Kepala Badan Penanggulan Bencana Daerah Kab. Samosir Purnamawan Malau kepada Waspada, Jumat (15/6) mengatakan, pihaknya sudah menurunkan tim beserta alat bantu yang ada dan turut melakukan pencarian. Sekitar pukul 18:50, kedua korban ditemukan sudah tewas.(c11)

Beruang Merah ... Sebaliknya, nasib Yunani sebagai mantan juara Euro 2004, sungguh tragis karena menduduki peringkat buncit. Sulit sekali untuk menantikan apakah Yunani mampu membuat kejutan pada pertandingan terakhir menghadapi Rusia. Penampilan anak-anak Negeri Dewa yang anti-klimaks dari 2004 hingga ke 2012 adalah sebuah contoh nyata bagi pembinaan sepakbola. Juga bisa menjadi bahan pemikiran bagi para pelatih bahwa merubah tradisi sebuah kesebelasan tidaklah segampang itu. Ethniki menjadi juara di Portugal tahun 2004 dengan strategi ultra-defensive, sistem pertahanan mereka waktu itu bahkan jauh lebih ketat dari catenaccio ala Italia. Sebagai jawara dengan permainan seperti itu, mereka bukan dipuji malahan mendapat ejekan sebagai pencipta sepakbola tidak enak untuk ditonton. Jadi, manakah yang diperlukan oleh para pelatih. Dipuji setinggi langit oleh para pengamat, pemirsa ataupun penonton langsung di arena namun akhirnya kalah dan tidak juara, atau menjadi pemenang dengan permainan seperti Ethniki?. Secara praktis, tuntutan untuk menjadi juara lebih baik dipertahankan. Maka, perubahan yang diperbuat oleh Yunani untuk mengejar hajat sebagai juara dengan bermain cantik, kini terbukti sebagai kegagalan belaka. Sampai sejauh ini, coba bandingkan lagi dengan nasib Belanda. Dengan meninggalkan tradisi permainan keras dan coba melepaskan diri dari tradisi yang dimiliki khas Oranye, yaitu total football, Meneer juga terbukti gagal. Nyatanya, Yunani dan Belanda memang hanya mendapatkan bumerang yang menghancurkan prestasi tim nasional, karena meninggalkan tradisi. Saya malas untuk memperkeruh situasi dengan nilai-nilai strategi dan pola negara lain, karena sepakbola kita sendiri masih jauh lebih parah. Yunani, walaupun menduduki posisi tragis di Grup A, mereka tetaplah negara besar sepakbola. Tetapi Indonesia tidak, tim Garuda lebih jauh lagi di dasar bawah ranking FIFA....

Mayat Bayi ... warga menduga adanya orang tidak dikenal (OTK) mencuri bayi laki-laki untuk syarat menuntut ilmu hitam. Pantauan Waspada, warga di desa tersebut terlihat cemas dan iba melihat keluarga almarhum bocah laki-laki yang

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Mg6, MxB (terpaksa). 2. MxM+, Gh6. 3. MxG+, Bh7. 4. MxB+mat. (Jika lebih dulu 1. BxMh6+, GxB. 2. Mg6, Gf4. 3. Mh5+, Rg7. 4. Mh7+, RxK. 5. BxGf4+, Re5 atau Re6. 6. Mf5+mat. Atau 5. ...., Rg5. 6. Bf5+mat).

Jawaban TTS: TTS Topik

Musik & Filem

hilang itu. Orangtua korban MH, 29, dan istrinya, AR, 28, tidak bisa menahan kesedihan hingga isak tangis keluarga jenazah itu terdengar di areal pemakaman. Ketika tim Polres Tapsel turun ke tempat kejadian perkara (TKP) untuk memeriksa makam itu, Jumat siang, dipastikan jenazah balita itu sudah tidak ditemukan lagi. Sebelumnya keluarga almarhum melaporkan kejadian itu pada pagi harinya. Kapolres Tapsel, AKBP Subandriya, SH MH diwakili Kasat Reskrim, AKP Lukmin Siregar kepada Waspada lewat telefon, mengaku serius menyelidiki kasus aneh itu. (c13)

Ada-ada Saja ... rumah. Ia pun kemudian melaporkan hal ini ke polisi. Kepada polisi, pria tersebut mengaku bahwa ia sudah setahun dipecat dari tempat kerjanya dan harus kawin dengan seorang wanita kaya untuk membiayai hidupnya. Menurutnya, wanita kaya tersebut sudah sejak lama jatuh hati dengannya. “Pria itu mengaku ia banyak menghabiskan waktu bersama istri keduanya, yang memberinya uangsetaradengangajiditempatnya semula bekerja, plus uang tunjangan,”ujarpriatersebutyang dikutip situs berita Sayyidati. Pria itu tidak pernah berpikir sebelumnya, bahwa istri pertamanya akan mencurigai perihal dirinya berganti-ganti celana dalam. (rzl)


Jawaban Sudoku: 6 3 0 5 2 4 8 9 7 1

2 4 7 1 8 5 3 6 0 9

9 0 6 8 7 3 5 1 2 4

1 8 3 4 9 0 2 7 5 6

7 5 2 9 1 6 4 0 8 3

4 1 9 7 5 8 0 3 6 2

8 9 4 6 0 1 7 2 3 5

5 2 1 3 6 7 9 8 4 0

0 7 5 2 3 9 6 4 1 8

3 6 8 0 4 2 1 5 9 7

berasal dari Desa Batu Karang, Kec. Payung. Bahkan, Gara Mata terlupakan oleh zaman. Banyak generasi muda yang tidak tahu bagaimana kegigihan anakTanda Bangun dan Beru Ginting ini dalam mengusir penjajah. Mata Merah, selain menjabatsebagaikepalaadat,juga orang terpandangdimasaitu.Diamengorganisir pemuda setempat untuk angkat senjata melawan penjajah pada 1900 – 1916. Denganperlengkapanperang seadanya, Gara Mata bersama pejuanglainnyatam-pilkemedan perang melawan penindasan Belanda, yang memang kian merajarela di Bumi Turang dengan alasan memajukan pertanian, setelah berhasil menguasai sebagian Provinsi Sumatera Utara, tepatnya bagian Timur seperti Binjai dan Langkat pada 1870. Kisah kegagahperkasaan Gara Mata pernah ditulis Pendiri Harian Waspada alm. H. Mohammad Said pada 1973. Gara Mata sering menulis Namo-Aras di rumpun bambo,

ketiga yang tidak dilakukan walau uangnya sudah diambil. Selain itu, penyelewengan terhadap anggaran rutin yang diduga di mark up untuk belanja kebutuhan makanan dan anggaran perjalanan rutin, termasuk di antaranya dana perjalanan Pelaksana Tugas (Plt) Gubsu Gatot Pudjo Nugroho. Dana Rp13 miliar yang tidak bisa dipertanggungjawabkan itu diketahui setelah dilakukan audit oleh Badan Pemeriksa Keuangan dan Pembangunan (BPKP), terdapat pada 3 Daftar Pengguna Anggaran (DPA) atau 119 kode rekening bermasalah. “Dari hasil penyelidikan ada Rp25 miliar dana rutin/perjalanan dinas di Biro Umum TA 2011, tetapi dana yang tidak dapat dipertanggungjawabkan sebesar Rp13 miliar. Dana itulah ditengarai sebagai kerugian negara,” sebutnya. Dua tersangka baru Sementara Kabid Humas

Poldasu Kombes Pol. Heru Prakoso mengatakan, penyidik Subdit III/Tipikor Dit Reskrimsus masih mendalami penyidikan kasus itu. “Kemungkinan ada tersangka baru. Mereka Kabag Perbendaharaan berinisial HB dan Asisten IV Administrasi AN. Heru mengatakan, sebenarnya ada tiga orang yang bakal dijadikan tersangka baru, tetapi seorang di antaranya AS mantan Kepala Biro Umum Pemprovsu sudah meninggal dunia. Untuk menetapkan tersangka, kata dia, Poldasu telah memeriksa 37 saksi berasal dari kantor Gubsu dan instansi lainnya. Dari hasil audit BPKP ada 119 pos pengeluaran dan masingmasing pos mempunyai Kuasa Pengguna Anggaran (KPA). “Dari hasil audit BPKP akan diketahui siapa saya yang bertanggungjawab terhadap pengeluaran anggaran, kita lihat saja nanti,” sebut Heru.(m27)

untuk ruang foto SIM tersebut sebelumnya digunakan sebagai kantin Bhayangkari. “Senin, pelayanan SIM akan normal kembali. Karena peralatan komputer foto SIM tidak ada yang rusak karena berhasil diselamatkan oleh petugas,” ujarnya. Pantauan Waspada, seluruh personil Sat Lantas Polresta Medan terlihat sibuk membersihkan seluruh ruangan. Sejumlah teknisi listrik mulai memasang instalasi dan jaringan AC. Ruangan kantin Bhayangkari yang selama ini digunakan untuk kantin umum disulap menjadi ruang foto SIM sementara menunggu renovasi ru-

angan utama yang terbakar. Sementara itu, ruangan untuk pendaftaran bagi pemohon SIM Baru terpaksa dipindahkan ke aula Kamtibmas Polresta Medan, termasuk juga lokasi ujian teori dan praktek. Pada Jumat (15/6) pasca kebakaran tersebut, ada 30 pemohon SIM Baru yang mengikuti ujian teori dan praktek. Mereka mengikuti ujian di aula Kamtibmas dan melaksanakan ujian praktek di halaman upacara Polresta Medan. Sebagaimana diberitakan sebelumnya markas Satuan Lalulintas Polresta Medan yang berada di Jalan Adinegoro, Kamis (14/6) sekira pk 16:20 musnah terbakar. Tidak ada korban jiwa namun arsip-arsip lalulintas,

BAP Kecelakaan Lalulintas, monitorCCTVdanKomputerOnline ke Mabes Polri turut terbakar. Kobaran api memporakporandakan lantai II yang merupakan ruang kerja Kasat Lantas Kompol M Risya Mustario, ruang Waka Satlantas AKP AA Rangkuti, ruang Kanit Dikyasa AKP Rosmawati, ruang Kanit Laka AKP Juwita, ruang Kaur Bin Ops Iptu Sitorus, ruang Minlaka, mushola dan ruang ADC Kasat Lantas. Kendati seluruh ruangan di lantai II terbakar, namun ruangan di lantai dasar tidak terbakar. Ratusan berkas-berkas pemohon surat izin mengemudi (SIM), komputer cetak SIM dan sejumlah alat foto SIM selamat dari kobaran api. (h04)

Permendagri Bansos ...

Gudang Arsip ...

Bendahara Pemprovsu ... bendahara Setda Provsu sedang bersama temannya. “Dia (A) baru beberapa kali diperiksa, tetapi begitu penetapan tersangka mengarah kepadanya, dia tidak datang lagi setiap dipanggil. Bahkan jarang masuk kerja, sampai kemudian dinyatakan sebagai buronan. Kata Sadono, dugaan korupsi sebesar Rp13 miliar kepada A bersumber dari dana APBD TA 2011, di antaraya anggaran rutin yang dipergunakan untuk menutupi biaya papan bunga, uang kain, catering, tiket pesawat dan tunjangan tambahan penghasilan (TPP) pegawai Pemprov Sumut yang sudah lama tertunggak. Akumulasi anggaran yang diduga diselewengkan sebesar Rp25 miliar, juga termasuk dugaan penggelapan pajak yang tidak disetorkan dari Biro Umum serta pembayaran kepada pihak

Labfor Selidiki ...

jangan banyak yang ditangkap,” kata Gamawan di kantor KPK, Jakarta, Jumat (15/6). KPK, kata Gamawan, merespons baik konsultasi terkait regulasi itu. Menurut dia, sejumlah masukan diberikan KPK di antaranya, perihal anggaran Bansos harus bisa dipertanggungjawabkan. “Jadi, akuntabilitas semua pengaturan itu harus. Termasuk bantuan kepada ormas-ormas, LSM dan sebagainya. Siapapun yang terima bantuan dari pemerintah harus dipertanggungjawabkan, dan siap diaudit oleh BPK setiap tahun. Sudah saya catat sejumlah masukan,” katanya. Juru Bicara KPK Johan Budi SP mengatakan, kedatangan Mendagri ke KPK dalam rangka membicarakan kajian KPK dalam kaitan Bansos di Pemerintahan Daerah dan Kemendagri. “Disampaikan bahwa ada rekomendasi itu sudah KPK dan sudah ditindaklanjuti Mendagri tahun 2011. Mengenai akuntabilitas terhadap penggunaan pos anggaran bansos,” ujar Johan. (vvn)

Waspada/ Rustam Effendi

PETUGAS pemadam kebakaran membongkar dan menyiram api yang membakar gudang arsip dan labolatorium Dinas Bina Marga Kota Medan, Jumat (15/6) malam.

Sumatera Utara tidak menjadi identik dengan Papua. It’s a challenge, dan sekaligus sebagai teguran dan keraguan akar rumput terhadap AR, Pemprovsu, Pemkab Tapsel, DPRD dan Kepolisian. Kemarahan masyarakat Batangtoru karena limbah tambang mencemari sungai harus dilihat dengan hati lapang. Orang desa, seperti saya, sangat faham dan sadar pentingnya fungsi sungai sebagai sumber kehidupan. Sungai merupakan tem-pat mengambil air minum, mandi, udhu’, mencuci dan membuang produk pagi alias MCK. Sungai juga sumber gizi dari ikan dan udang. Sumber pangan di daerah aliran sungai (DAS) seperti sayur pakis, dan buah seperti rukam dan jambu air. Pada musimnya anak-anak biasa mendapat durian hanyut saat mandi di sungai. Sungai ialah tempat olah raga renang, menyelam, kejarkejaran, latihan memperkuat otot, dan latihan memimpin. Pendeknya sungai ialah kehidupan. Jika ada pengrusakan sungai oleh manusia, orang desa bisa marah apalagi sudah lelah bicara baik-baik. Kasus Batangtoru sebe-

narnya sederhana. Ada pencemaran yang merisaukan masyarakat karena sungai kehidupan mereka dicemari limbah. Sudah disampaikan kepada semua pihak, Pemprov, Pemkab, dan DPRD. Karena perusahaan asing (PMA), Pemerintah juga sudah tahu persis melalui persyaratan PMA seperti studi kelayakan dan AMDAL. Surat kabar memberitakan kerja sama AR dengan perguruan tinggi tempat semua pakar berkumpul. Di Batangtoru juga ada entitas bisnis (PTPN3) yang sudah lama bertetangga dengan masyarakat desa. Ada banyak pihak yang disebut sebagai stakeholders. Masing-masing seharusnya peduli dan berperan mencegah-mengatasi masalah seperti yang menimpa AR. Masalahnya sederhana, yakni care and share. Pemrovsu, Pemkab Tapsel, dan DPRD sudahlamatahuadatanda-tanda kemarahan. Tidak ada respon yang memadai. Polisi yang hadir di tempat perkara rupanya terlalu minim. Para pakar sudah membuat AMDAL tapi mungkin lupa dampak sosial tambang emas. Mungkin sudah ada analisis dan antisipasi dalam AMDAL namun tidak dipedulikan. Entitas bisnis, seperti PTPN3 yang ikut menanggung akibat

kemarahan, sudah lama bertetangga dengan masyarakat desa, sepantasnya sudah lama bisa ikut share. Tapi seperti biasa, BUMN pun sering abai pada lingkungannya. Ini dari pengalaman mengenal perusahaan perkebunan sejak anak-anak di Labuhanbatu tempat saya lahir dan besar. Bukan saja perusahaan pertambangan. Perkebunan pun sering konflik dengan masyarakat gara-gara lahan yang kian menyempit dan terpragmentasi. Jika sudah memuncak, perusahaan minta bantuan Polisi. Itu tercermin pada pertemuan Kapoldasu Irjen Pol Wisjnu Amat Sastro dengan Dirut PTPn2, PTPN3 dan PTPN4 di Mapoldasu (23/6). Di lain pihak rakyat sulit mafhum kalau pembagian lahan HGU kepada rakyat dikatakan merugikan negara. Sebab, rakyat juga unsur negara, sedangkan BUMN ialah badan privat. Belakangan ini konflik rakyat denganduniausahamakinsering terjadi. Di Medan, Langkat dan Batangtoru ialah contoh paling mudah sekarang. Sumber utama masalah ini hanyalah care and share. Solusinya juga bisa sederhana dan segera. Marilah kita bangun kehidupan yang care and share. Jadi, solusinya tidak rumit, semua kita care and share.

sebagai bagian dari upaya menunjukkan perlawanan kepada Belanda, sekaligus untuk memacu semangat rakyat Karo untuk melawan kolonialis. Namo jadi Aras, yang artinya aliran air tenang jangan diangap remeh, karena akan bisa menjadi arus yang deras dan berbahaya. “Kata Namo-Aras memang sering ditulis Gara Mata di setiap pohon bambu.Ya, untuk menunjukan sikap perlawanan kepada Belanda, dan memacu semangat rakyat Karo,” terang RekroTarigan yang berperan penting memasukkan nama Kiras Bagun sebagai Pahlawan Nasional didampinggi Ketua PMK Desa Batu Karang, Sikap Tarigan kepada Waspada saat menyambangi makam Kiras Bagun, Jumat (15/6). Dikatakan Sekretaris Penggagas Pahlawan Nasional Kiras Bagun ini, Gara Mata memang gigih mengusir penjajah dari tanah kelahirannya. Dikisahkan, memasukiawal1901,utusanBelanda bolak-balik, bahkan sampai empat kali, datang dari Binjai ke Kab. Karo dengan alasan untuk bersahabat dengan warga Karo, serta tidak akan ikut campur dalam

urusan warga mengingat rakyat Karo sudah dapat mengatur diri sendiri, sesuai dengan peradatannya. Namun,kedatanganBelanda dengan berbagai alasan mendapat penolakan dari Mata Merah. Memasuki tahun 1902, dengan diam-diam serdadu Belanda berangkat ke Kab. Karo dengan tujuan Kabanjahe melalui lintas jalan Sunggal dan Sibolangit. Di Kabanjahe, persisnya di Satlantas Kabanjahe sekarang, serdadu Belanda mendirikan pemondokan, dan dapat diketahui warga sekitar yang melihat orang berkulit putih ada di daerahnya. Kabar kedatangan Belanda sampai ke kuping Gara Mata. Mengetahui serdadu Belanda datang lagi, amarah si Mata Merah kian memuncak. Dia bersama pejuang lainnya angkat senjata dan berhasil mengusir penjajah. “Tahun 1903 Belanda datang lagi, dengan pasukan lebih kuat, dan Gara Mata bersatu menggalang kekuatan bersama rakyat Aceh. Dengan nama pertempuran Urang Satu, yang tujuannya tetap sama mengusir Belanda.

Jika Belanda tetap di BumiTurang diyakini Belanda akan mengatur di Karo dan menyengsarakan rakyat,” ujarnya. Pada 1904, Belanda memasuki wilayah Seberaya, menambah kemarahan Gara Mata dan kawan-kawan. Sang Mata Merah kembalimelawan.10anggotaGara Mata tewas dalam pertempuran itu. Mereka sudah melakukan penjagaan ketat mulai dari Alas, Gayo, hingga ke tanah kelahirannya. Pada 22 Oktober 1942 Kiras Bangun wafat karena sakit akibat ulah Belanda yang mengerangkengnya tanpa bisa menggerakkan tubuhnya selama dalam pengasingan, dan dimakamkan di tanah kelahirannya. Pada 2005 Kiras Bagun alias Gara Mata sah menjadi pahlawan nasional yang disahkan Mensos Bachtiar Chamsyah pada 2005 di Jakarta. Makam sang pahlawanpada2006jugadibangun dengan anggaran Rp1 miliar. Juga Jalan Gara Mata dinobatkan di Kota Kabanjahe, tepatnya mulai dari tugu perjuangan hingga ke simpang empat. * Dede Basri Hasibuan

Agincourt ...


PLT Gubsu Gatot Pujo Nugroho didampingi Sekdaprovsu Nurdin Lubis foto bersama pengurus Komwil Forsesdasi Sumut usai pengukuhan di Aula Martabe Kantor Gubsu, Jumat (15/6). Menurut Gatot, dalam membangun pemerintahan di daerah, sangat ditentukan kelihaian dari seorang Sekda. Pasalnya, saat kepala daerah memutuskan kebijakan, namun tak ditindaklanjuti Sekda hasilnya akan sia-sia. “Jadi Sekda ini sangat menentukan maju tidaknya satu wilayah, kemudian kepala daerah tak mampu bekerja bila Sekda tak kuat,” sebutnya. Dengan dibentuk dan dikukuhkannya Komwil Forsesdasi Sumut, Gatot berharap, masing-masing Sekda bisa saling bertukar pengalaman dalam membangun satu kota atau kabupaten. Sehingga forum ini benar-benar bisa menjadi manfaat bagi banyak orang. Dia juga mengingatkan,

untuk memberikan pelayanan kepada masyarakat PNS harus mampu bersikap melayani, jadi bukan sebaliknya PNS dilayani. Bila kejadiannya PNS tetap mengharapkan pelayanan, maka Sekda Perlu memberikan pemahaman yang lebih kepada PNS tersebut. “Jadi untuk melakukan reformasi birokrasi ditentukan oleh Sekda. Bila Sekda mampu melakukannya dan PNS tak lagi bersikap minta dilayani saya yakin daerah ini bisa lebih baik lagi,” katanya. Hadir dalam pengukuhan itu Sekda Pemprovsu Nurdin Lubis, SH, MM sekaligus Direktur Pembinaan Hukum Forsesdasi Pusat serta seluruh Sekda kabupaten/kota se-Sumut. (m28)

takan, Ibu Negara dijadwalkan menjalani tindakan medis sehingga harus berada di rumah sakit sehari sebelum hingga sehari setelah tindakan medis tersebut. “Khusus gangguan kesehatan yang sekarang saya tidak bisa menjelaskan secara teknis, tapi ada gangguan syaraf atau tulang leher yang menurut tim dokter kepresidenan direkomendasikan, karena tidak dimungkinkan dilakukan di dalam negeri, maka dilakukan di sebuah rumah sakit oleh dokter di rumah sakit yang selama ini memiliki keahlian dan pengalaman di Pittsbrugh,” kata Presiden. Kepala Negara mengatakan,

selama ini semua tindakan dan pemeriksaan medis bagi Presiden dan Ibu Negara dilakukan di dalam negeri, termasuk operasi pengangkatan kantong empedu yang dilakukan beberapa waktu lalu. Namun untuk gangguan kesehatan kali ini atas rekomendasi tim dokter kepresidenan maka tindakan medis dilakukan di luar negeri. Presiden mengatakan, pada 16 Juni mendatang, ia akan menjemput Ibu Negara pascatindakan medis di Amerika Serikat, dalam perjalanan menuju KTT G20 di Meksiko dan menghadiri KTT Pembangunan BerkelanjutanRio+20diRioDeJenairoBrasil.

Mogok Makan ...


RS Malahayati,” ujar Sabber rekan korban. Menurutnya, Rio melakukan aksi mogok makan dan tutup mulut sudah delapan hari tepatnya sejak Jumat (8/6) kemarin. “Aksi ini kami lakukan untuk menuntut penghentian perampasan tanah yang kami miliki dan kami usahai bertahun-tahun.. Namun hingga hari ini tidak ada keseriusan dari pihak DPRD untuk menyelesaikannya, dan pemerintah lebih berpihak kepada kepentingan pengusaha dari pada rakyat-

Aksi Gantung Diri Saat ini, kata Sabber, jahit mulut masih dilakukan oleh 3 orang, satu diantaranya dirawat di RS Malahayati.Sebelumnya, aksi mogok makan dilakukan oleh 10 orang. Meskipun sudah sekitar 8 orang pingsan sejak aksi dimulai, aksi ini sambung Sabber, tidak akan pernah berhenti sebelum tuntutan mereka dikabulkan. “Senin ini jika tidak ditanggapi, masyarakat Padanglawas akan melakukan aksi gantung diri walaupun harus sampai mati,” terangnya.

Setelah satu jam mendapatkan perawatan, kondisi Rio mulai stabil dan sadar. “Tim medis membuka jahitan di mulut, korban juga mendapatkan infus, untuk menaikkan cairan gula darah pasien. Jika kadar gula bagus pasien sudah boleh pulang,” ujar dr Anggraini. Sebelumnya, Kelompok Tani Torang Jaya Mandiri (KTTJM) ini melakukan aksi mogok makan dan aksi jahit mulut di depan kantorDPRDSUmenuntutpenghentian perampasan tanah yang dilakukan PT Sumatera Riang Lestari (PT SRL) dan PT Sumatera Silva Lestari (PT SSL). (h02)

Gatot: Sekda Penentu ... kepengurusan digantikan penggantinya. Usai melantik pengurus Komwil Forsesdasi Provinsi Sumut Gatot mengatakan, setelah dibentuk Forsesdasi secara nasional, ada muncul isu Asosiasi Gubernur dan AsosiasiWali Kota sertaAsosiasiBupatiakantersaingi. Dia mengaku, pada kesempatan ini tidak dalam mengomentari persaingan itu tapi jabatan Sekda dalam satu institusi pemerintahan daerah merupakan jabatan karier tertinggi dalam pegawai negeri sipil (PNS). Sedangkan Gubernur, Bupati dan Wali Kota merupakan jabatan politis. Kedua jabatan tersebut memiliki hirarki yang berbeda.

Ibu Negara Jalani ...

katanya saat bertemu di lokasi. Sementara itu, Kapolsek Medan Sunggal Kompol Budi Hendrawan mengaku masih melakukan penyelidikan penyebab kebakaran. Namun, dugaan sementara, kebakaran akibat hubungan arus pendek di gudang arsip. “Api bermula dari gudang arsip yang kemudian membesar dan membakar mesin genset yang ada di dalamnya,” ucap Kapolsek. Pantauan Waspada, sebanyak 7 mobil pemadam kebakaran milik Peko Medan diturunkan memadamkan api, yang berhasil dipadamkan satu jam kemudian. Sejumlah petugas Polsek Medan Sunggal dan beberapa anggota TNI AD dari kesatuan Kafaleri tampak disiagaan di lokasi guna mencegah adanya penjarahan. (h03)

WASPADA Sabtu 16 Juni 2012

diambil tindakan besok (Sabtu (16/6) hari ini) pukul 07.30 waktu setempat atau pukul 19.30WIB,” katanya ketika dihubungi di Jakarta, Jumat (15/6). Menurut Julian, Ibu Negara telah menjalani serangkaian pemeriksaan oleh tim dokter dan dilakukan secara menyeluruh. Julian tidak menyinggung tentang sakit yang sedang diderita oleh Ani Yudhoyono. ”Mohon doa agar operasi berjalan lancar dan sukses,” katanya. Sebelumnya, Presiden Yudhoyono dalam keterangan pers di Istana Negara Jakarta menga-

Al Bayan ... mampu membaca dengan baik Alquran itu Anda juga perlu mengajarkannya kepada orang lain. Masih ada satu syarat yang perlu Anda penuhi, yakni ikhlas lillahi ta’ala. Bila ketiga syarat ini dapat Anda penuhi InsyaAllah Anda termasuk manusia paling baik. Menurut Rasulullah SAW, para qari dan qariah yangmampumemenuhitigasyaratdiatas,manusia tersebut akan mendapat syafaat dari Alquran di hari akhirat kelak. Alquran datang dengan syafaat untuk membela pembacanya dari azab (Shaheh Muslim). Dalam hadits lain Rasulullah memuji: Yang paling utama dari umat-ku adalah yang membaca Alquran (Hr.Baihaqi). Membaca Alquran secara benar sebagaimana qari dan qariah kita itu sangat besar pahalanya dan termasuk orang yang selalu berdialog dengan Allah, (Hr: Turmudzi), menjadi teman para malai-

kat (Hr Dailami), jika ia menghafal ayat Alquran pahalanya berlipat ganda dan menjadi sahabat malaikat (Hr Bukhari dan Muslim). Orang membaca Alquran dan mengamalkan isinya ibarat buah jeruk manis, rasanya enak dan baunya harum (Hr Mutafaqun alaihi). Karena itu Rasulullah meminta kepada umatnya untuk mempelajari Alquran dan mengamalkan isinya secara benar. Bila seseorang memenuhi ajakan Rasul, mereka diibaratkan seperti minyak wangi yang tercium wanginya di manamana (Hr:Ibnu Majah, Abu Daud, Muslim dan Turmudzi). Sahabat Nabi Abu Dzar al-Ghifari meriwayatkan bahwa Rasulullah bersabda:Wahai Abu Dzar! Kamu pergi mempelajari Alquran satu ayat, masih lebih baik dari kamu shalat sunat seratus rakaat (Hr:Ibnu majah). Semoga Allah SWT mengembalikan hati kita semua untuk tunduk dan patuh kepada Alquranul Karim. Amiiinnnn ya arhamarrahimiin.

Medan Metropolitan Aksi Kejahatan Marak

WASPADA Sabtu 16 Juni 2012

MEDAN (Waspada): Aksi kejahatan jalanan belakangan terakhir ini marak di wilayah hukum Polresta Medan, sehingga menimbulkan keresahan dan ketidaknyamanan warga untuk beraktivitas. Seperti yang di alami korban Edward Thahir, yang kehilangan kaca spion sebelah kanan mobil Avanza warna hitam miliknya BK 1104 E. Kaca spion itu dicuri dua pelaku mengendarai sepedamotor ketika mobil diparkir di Jln. Soeprapto, Kel. Aur, Kec. Medan Maimun.

Begitu juga yang dialami Arminsyah Nasution. Mobilnya yang parkir di Jln. Soeprapto, belum lama ini, dibongkar pencuri dengan cara memecahkan kaca mobil tersebut. Akibat peristiwa itu, korban mengalami kerugian barang-barang elektronik. Sementara itu, korban Eka Puspika, 30, penduduk Komplek Rorinata V, Blok C, Desa Sukamaju, Kec. Sunggal, sepedamotornya Honda Beat BK 3221 ABF dirampok dua pelaku mengendarai sepedamotorYamaha Mio di Jalan Sukamaju, Desa Sunggal Kanan, Sunggal, Jumat (15/6). Korban dari rumahnya hendak pergi kerja di RS Bunda

Penganiaya Polisi Ditangkap MEDAN (Waspada): Seorang pengendara sepedamotor berinisial DSR,31,ditangkapusaimeninjuwajahanggotaIntelkamPolsekMedan Baru Brigadir Antoni Pasaribu, 32, sehingga satu gigi korban patah, di Jln. Gatot Subroto bundaran Majestik, Rabu (13/6). Penganiayaan itu dilakukan tersangka karena tidak senang ditegur anggota kepolisian itu supaya hati-hati agar tidak terjadi kecelakaan lalulintas yang saat itu sedang ada aksi unjukrasa. Keterangan Waspada peroleh di lapangan, peristiwa itu terjadi pukul12:05,korbanyangsedangmelaksanakantugasbersamapersonel Reskrim, Intelkam, Sabhara, Lantas Polsek Medan Baru melakukan pengamanan aksi unjukrasa di Jln. Gatot Subroto bundaran Majestik. Korban yang saat itu berpakaian preman melihat tersangka DSR, 31, mengendarai sepedamotor melintas di kawasan yang sedang terjadi unjukrasa tersebut. Selanjutnya Brigadir Pasaribu menengur tersangka agar jangan terjadi kecelakaan. Namun, tersangka tidak senang atas teguran itu, langsung mengejar korban yang sedang mengendarai mobil mengikuti para pendemo menuju kantor DPRD Sumut. Kemudian tersangka dengan emosi memukul wajah korban hingga satu gigi depan atas patah. Petugas kepolisian lainnya yang melakukan pengamanan aksi unjukrasa langsung menangkap tersangka dan terus dibawa ke Polsek Medan Baru. Kapolsek Medan Baru Kompol Dony Alexander SH, SIK, M.Hum, mengatakan, pihaknya sudah melakukan pemeriksaan terhadap korban dan saksi. (m36)

Oknum PNS Pemko Medan Diadukan Ke Polisi MEDAN (Waspada): Surya Hardinata Ginting, 25, korban penipuan calon tenaga kerja honorer, mengadukan seorang wanita berinisial Sft, 30, oknum PNS di Kantor Dinas Pertamanan Kota Medan, ke Polsek Sunggal. “Kami sudah berulangkali menemui Sft selaku staf Pemegang Barang Dinas Pertamanan Kota Medan, untuk meminta kembali uang Rp30 juta, karena kerja yang dijanjikannya hingga kini tidak ada realisasinya,” kata Surya kepada Waspada di Mapolsek Sunggal, Rabu (13/6) sore. Surya, penduduk Jln. Glugur Rimbun, Lingkungan I, Desa Sembahe Baru, Kec. Pancurbatu, Deliserdang, yang didampingi abangnya Monang Tarigan, 35, dan bibinya Marni Br Tarigan, 45, mengatakan, penipuan itu berawal pada tahun 2010, saat itu dirinya mendapat informasi di kantor Dinas Pertamanan Kota Medan ada penerimaan pegawai honorer dan disebut-sebut Sft bisa mengurusnya. Selanjutnya, korban bersama bibiknya menemui oknum PNS itu di rumahnya. Setelah terjadi kesepakan korban menyerahkan uang yang diminta sebanyak Rp30 juta untuk menjadi pegawai honorer kepada Sft disaksikan suaminya berinisial RZ. Ternyata setelah ditunggu sekian lama, korban belum juga bekerja seperti yang dijanjikan Sft. Sehingga korban meminta kembali uang yang telah diberikannya, namun oknum PNS itu selalu berkilah. “Saya sudah berulangkali menemuinya tetapi dia selalu memberi alasan tunggu dulu karena uang itu sudah diberikan kepada yang mengurusnya,” sebut Surya. Kapolsek Sunggal Kompol M Budi Hendrawan SH, SIK ketika dikonfirmasi membenarkan pihaknya ada menerima pengaduan Surya Hardinata Ginting. Namun, Tempat Kejadian Perkara (TKP) menyerahkan uang di kediaman Sft berada di wilayah hukum Polsek Pancurbatu. “Begitu pun pengaduan itu kita terima dan nanti kita ajukan ke Polsek Pancurbatu. Polsek Sunggal tetap meningkatkan pelayanan prima terpadu kepada masyarakat,” kata Budi didampingi Kanit Reskrim AKP Victor Ziliwu, SH, SIK. (m36)

Waspada/Ismanto Ismail

MARNI Br Tarigan, 45, memperlihatkan dua pasang pakaian dinas lengkap dengan logonya disaksikan petugas Reskrim Polsek Sunggal Briptu Dian Fernando Surbakti SH.

Thamrin Jln. Sei Batanghari. Namun, setiba di Jalan Sukamaju dihadang dua pelaku yang mengendarai sepedamotor Yamaha Mio. Pelaku langsung menodongkan senjata tajam dan memerintahkan korban turun dari sepedamotornya. Korban yang ketakutan hanya pasrah sepedamotornya diambil paksa pelaku. Selain mengambil sepedamotor, pelaku juga mengambil tas berisikan dua handphone, STNK, buku tabungan dan ATM Bank Buana, serta sejumlah uang. Berikut korban lainnya, Lea Febrianti Br Tarigan, 21, penduduk Jln. Setiabudi, Pasar V, Tanjungsari. Dia dirampok dua pelaku mengendarai sepedamotor di Pasar VII Tanjungsari. Sebe-

lumnya korban Lea bersama pacarnya Chan Kien Meng, 25,WN Malaysia penduduk Jln. Harimau, Taman Century, Johor Baru, dan Neli Kartika, 29, penduduk Jln. Sumpah Prajurit Medan, menumpang betor hendak menuju ke kantor Imigrasi di Jln. Mangkubumi Medan, untuk mengurus paspor. Ketika melintas di Pasar VII, Tanjungsari Medan, tas yang dipegang korban Lea dirampok dua pelaku mengendarai sepedamotor Yamaha RX King. Akibatnya, korban menderita kerugian tas berisikan uang 4 ribu ringgit dan Rp2 juta, ijazah SMKN VII asli milik Leo Febrianti Br Tarigan, Kartu Keluarga (KK) milik orangtuanya, akte kelahiran, paspor Malaysia, KTP, ATM Bank Hong Leong, ATM

BankUOB,ATMBankAllion, handphone milik Chan Kien Meng. Sedangkan Warnet Albenti di Jln. Binjai Km 10,2 Kec. Sunggal, Deliserdang, dibobol maling. Diduga pelakunya lebih dari satu orang itu mengendarai mobil menggondol 13 unit computer dari warnet tersebut. Salah seorang warga mengatakan, maraknya aksi kejahatan tersebut karena Polresta Medan khususnya Unit Jahtanras kurang serius mengungkapkan kasus tindak kejahatan yang terus bergulir. “Tindak kejahatan bisa ditekan, asalnya Unit Jahtanras Polresta Medan yang khusus menangani kasus tindak kejahatan dan kekerasan lebih serius mengungkapkan kasus-kasus tersebut,” katanya. (m36)

Pasar Induk Marelan Berbiaya Rp10 M Segera Dibangun MEDAN (Waspada): Pemerintah Kota Medan segera membangun pasar induk tradisional di Kec. Medan Marelan. Saat ini dalam proses tender elektronik. Dipastikan, tahun ini pasar yang dibangun untuk meminimalisir kemacatan di kawasan itu akan terealisasi. “Detail Engineering Design (DED) pasar induk Medan Marelan ini sudah selesai. Sekarang masih dalam proses tender, dan dalam waktu dekat akan segera dibangun,” kata Kepala Bidang Pembinaan dan Pengembangan Dinas Perumahan dan Pemukiman (Perkim) Kota Medan Yusdartono kepada wartawan, Kamis (14/6). Secara terpisah, Sekda Kota Medan Syaiful Bahri mengatakan, pasar induk di Kec. Medan Marelan ini, akan dibangun di lahan pasar yang lama yakni di pasar tradisional Marelan Pasar V Jln. Marelan Raya depan Rumah Sakit Wulan Windi dengan penambahan luas lahan ke belakang. Kata Syaiful, pemilihan lokasi dilakukan dari empat opsi yakni di pasar tradisional Marelan yang lama Jln. Marelan Raya Pasar V (dilakukan penamba-

han/pelebaran lahan ke belakang) dan lahan kosong dekat RS Wulan Windi/dibelakang ruko Jln. Marelan Raya Pasar V. Selanjutnya, lahan kosong dibelakang SPBU Pasar IV Jln. Marelan Raya dan lahan kosong dekat pergudangan BGR Paya Pasir Jln. Titi Pahlawan Pasar V Marelan. “Saat ini pembangunannya sudah dalam proses pembebasan lahan. Kita harapkan tahun ini pasar itu akan dibangun,” ujarnya. Menurut dia, pembangunan pasar induk itu menggunakan anggaran dari Pusat Investasi Pemerintah (PIP) dengan anggaran tahun 2012 sebesar Rp10 miliar. Tujuan pembangunan pasar induk dilakukan sebagai upaya meminimalisir kemacatan yang kerap terjadi di kawasan itu. “Pasar itu kita bangun supaya semakin indah. Makanya kita bangun juga pasar induk di kawasan Medan Tuntungan,” tuturnya. Kepala Badan Perencanaan Pembangunan Daerah (Bappeda) Kota Medan Zulkarnain mengatakan, pasar induk sayur dan tradisional Marelan itu dibangun untuk menampung para pedagang kaki lima (PKL)

sayur mayur yang sering berdagang di Jln. Kapten Rahmad Buddin depan Lapangan Rengas Pulau Marelan. Selama ini, keberadaan pedagang sayur itu mengganggu arus lalulintas di jalan lintas masuk dari Simpang Pasar V Marelan. “Pedagang sayur mayur di Marelan yang biasanya tumpah di pinggir jalan akan di relokasi ke Pasar Induk ini. Sekaligus, pasar tradisional Marelan di simpang pasar V Marelan juga akan direlokasi ke pasar induk. Jadi, pasar induk akan diperuntukan bagi petani sayur yang mau menjualkan hasil pertaniannya dan pasar tradisional,” ungkapnya. Sementara itu, dalam Layanan Pengadaan Secara Elektronik (LPSE) Kota Medan, pembangunan pasar sayur di Kecamatan Medan Marelan ini sudah masuk dalam proses tender elektronik. Dalam rencana pengadaan barang dan jasa, Dinas Perkim Medan menyebutkan anggaran pembangunan pasar sayur Marelan sebesar Rp9.971.390.000 dan konsultan pengawasan lanjutan pasar induk dianggarkan Rp385.850. 000. (m50)

Jumat Yang Mengharukan Di Masjid Bank Sumut MASJID di Lantai 10 Bank Sumut Jalan Imam Bonjol itu terasa sangat teduh walau di luar cuaca panas menyengat. Para jamaah bergantian mengambil wuduk lalu duduk berbaris rapi sesuai shaf yang ada. Seperti biasa pula ketika khatib sudah naik ke atas mimbar tempat duduk sudah terisi. Hingga ada yang berdiri sampai di luar. Khatib naik ke atas mimbar memberi pencerahan tentang mendekatkan diri kepada Allah dilanjutkan dengan shalat dua rakaat berjamaah. Di shaf terdepan terlihat sosok Direktur Utama Bank Sumut Gus Irawan Pasaribu (foto). Direktur yang sudah mengomandoi Bank Sumut selama 12 tahun atau tiga periode. Semua rukun shalat Jumat diikutinya sampai ke doa penutup. Tak terasa memang, Jumat (15/6), merupakan shalat jumat terakhirnya di bank daerah itu selama menjadi direktur utama. Terhitung hari ini Sabtu (16/ 6), dia akan meninggalkan bank yang sudah memiliki aset Rp20 triliun itu. Usai shalat Jumat dan doa, Gus Irawan Pasaribu bersalaman dengan para jamaah. Saat itulah terlihat keharuan. Para jamaah bergantian menyalami lalu memeluk Gus Irawan. Dia pun menerima semua uluran tangan dan peluk perpisahan dari mereka yang mendatanginya. Mayoritas karyawan me-

mang tak mengucapkan salam perpisahan. Tapi mereka tahu bahwa itulah untuk terakhir kalinya Gus Irawan Pasaribu shalat bersama di masjid Bank Sumut. Wajah yang datang menyalami dan memeluk Gus Irawan seperti larut dengan kesedihan. Memang tidak ada isak tangis berkepanjangan. Tapi dari cara karyawan mereka menyalam dan memeluk Gus Irawan terlihat kalau akan ada kehilangan besar. Selama menjabat Dirut Bank Sumut ada satu yang sulit dilupakan karyawan yaitu kebersamaan. Mereka masih belum akan tahu seperti apa bank milik pemerintah daerah itu ke depan sepeninggal Gus Irawan. Salaman dan pelukan tulus seperti menjadi doa untuk kesuksesan Dirut Bank Sumut tersebut sete-

lah mengakhiri periodenya. Di balik keharuan itu terlihat juga Pemimpin Divisi Umum Irwan Pulungan yang tak kuasa menahan harunya. Saat menyalami dan memeluk Gus Irawan Pasaribu, pancaran wajah Irwan terlihat sedih. Dia seperti terbawa kesedihan usai bersalaman. Begitupula dengan Bahrein H Siagian yang juga salah satu pemimpin divisi di Bank Sumut. Itulah segelintir suasana di Bank Sumut. Semua salam dan pelukan seperti tak terungkapkan dengan kata-kata. Gus Irawan memang telah mampu merekatkan semua karyawan. Dia mampu meletakkan dasar kebersamaan. Dengan kebersamaan Bank Sumut bisa maju dan mengatasi semua persoalan yang membelitnya sejak krisis ekonomi. Dalam setiap kali ceramahnya di hadapan karyawan Gus Irawan selalu mengingatkan jangan pernah melupakan Tuhan. “Saya yakin krisis yang kita lalui dan hadapi bersama-sama tidak akan bisa teratasi kalau tidak ada campur tanganTuhan. Makakitaharusmendekatkandiri kepada-Nya,” kata Gus Irawan. Dari situ pula dia mengembangkan Bank Sumut memiliki konsep keagamaan yang terarah termasuk pemotongan gaji karyawan untuk zakat, serta mengembangkan LAZ Bank Sumut. Kesedihan dan keharuan di ujung masa jabatan Gus Irawan tak hanya di masjid tersebut. Beberapa orang karyawan perempuan yang menyalami Gus Irawan ke ruang kerjanya tak sanggup menahan tangis. Namun seperti biasa Gus Irawan selalu bisa mengalihkan suasana. Dia selalu bisa menutup kesedihan dan keharuan. Selamat jalan Pak Gus, semoga bisa meletakkan dasar kebersamaan dan kekompakan di wadah yang lebih luas, begitulah harapan para karyawan kepadanya.(m06)


Waspada/M.Ferdinan Sembiring

REKTOR UISU Prof Ir H Zulkarnain Lubis MS, PhD (dua dari kanan) saat mewisuda lulusan UISU, di Gedung Selecta, Kamis (14/6).

TIK Ubah Paradigma Pembelajaran MEDAN (Waspada): Rektor Universitas Islam Sumatera Utara (UISU) Al Munawwarah Jln Sisingamangaraja Medan Prof. Ir. H Zulkarnain Lubis mengatakan, strategi pembelajaran telah mengalami perkembangan cukup pesat seiring dengan perkembangan teknologi informasi dan komunikasi (TIK). Ini berpengaruh terhadap perubahan paradigma strategi pembelajaran dari teacher-centered ke learner-centered. Metode pembelajaran yang memanfaatkan teknologi ICT (Information Communication Technology) salah satunya adalah E-Learning. “Proses pembelajaran dapat terjadi tanpa dibatasi ruang dan waktu dengan komunikasi terbuka antara dosen dan mahasiswa serta mahasiswa dengan mahasiswa,” kata Prof Zulkarnain ketika mewisuda 901 sarjana universitas tersebut di Gedung Selecta Medan, Kamis (14/6). Untuk tahun akademik 2012/2013, UISU Al Munawwarah bersama PTS anggota konsorsium E-Learning sudah menerima mahasiswa baru model

E-Learning dan akan dibuka perdana 14 Juli 2012 mendatang. UISU merencanakan membuka kelas E-Learning program studi Pendidikan Bahasa dan Sastra Indonesia, Pendidikan Pancasila dan Kewarganegaraan serta Program Mengajar Akta IV. Rektor menyebutkan Permendiknas No. 24 tahun 2012 tentang Pendidikan Jarak Jauh mendorong UISU untuk berperan aktif melaksanakan pembelajaran dengan model E-Learning. Di hadapan para wisudawan dan undangan, rektor mengatakan, kepercayaan masyarakat kepada UISU pada tahun akademik 2012/2013 begitu baik. “Civitas akademika UISU dan masyarakat telah memberi dukungan sehingga kondisi UISU saat ini sudah membanggakan. Ini ditandai dengan meningkatnya permintaan masyarakat maupun institusi agar UISU ikut serta dalam berbagai kegiatan di masyarakat,” tegasnya. Diantaranya, kerjasama UISU dengan German International Cooperation dan Taman

Simalem Resort, Pemkab Sibolga, PMI Sumut, Dinas Pendidikan Kota Medan untuk pelatihan kepala sekolah dan guruguru. Kemudian program Asean Flu yang disponsori WHO, FK UISU ditunjuk sebagai pusat flu burung wilayah regional I . Selain itu, bukti semboyan UISU ‘Just Fine’ benar-benar terealisasi adalah dengan kedatangan beberapa tokoh penting ke kampus UISU Jln. Sisingamangaraja Medan Seperti Surya Paloh (alumni UISU), Menteri Koperasi RI Syarief Hasan, Anggota DPR RI Sutan Bhatoegana, Kadiv Humas Polri Irjen Pol Saud Usman Nasution, mantan Wakil Presiden RI Jusuf Kalla, Dubes RI/mantan Menteri Tenaga Kerja Bomer Pasaribu dan mantan Pangkostrad Letjen TNI (purn) AY Nasution. “Jika tahun lalu dan tahun ini kita menyatakan ‘Just Fine’ (baik-baik saja), maka tahun depan Insya Allah, kita punya semboyan baru yaitu ‘So Beautiful’ yaitu begitu cantik dan indah di hati keluarga besar UISU dan masyarakat,” demikian rektor. (m49)

Kapolda Panggil Tiga Direktur PTPN MEDAN (Waspada): Tiga Direktur PerseroanTerbatas Perkebunan Nusantara (PTPN) yang berada di wilayah Sumatera Utara, bertemu Kapolda Sumut Irjen Pol. Wisjnu Amat Sastro, di Lantai II Gedung Mapolda Sumut, Rabu (13/6) pagi. Berdasarkan informasi di Mapoldasu, kedatangan tiga direktur perkebunan tersebut, masing-masing Direktur PTPN II Batara Moeda Nasution, Direktur PTPN III Megananda Daryono, dan Direktur PTPN IV Erwin Nasution atas dasar panggilan Wisjnu. Pertemuan dengan Kapolda berkaitan dengan terjadinya bentrok antara pekerja kebun dan masyarakat (penggarap) di beberapa wilayah di Sumut, termasuk kejadian pembakaran lima unit mobil milik perkebu-

nan di Sei Semayang, Deliserdang, belum lama ini. “Kedatangan ketiga direktur perkebunan itu juga berkaitan dari pertemuan audiensi Ketua Serikat Pekerja Perkebunan (SP Bun PTPN II) Idris belum lama ini, yang juga diterima langsung Kapolda,” kata sumber di kepolisian. Dalam audiensi, kata dia, SP Bun yang mewakili pekerja perkebunan menyampaikan tindakan kekerasan dilakukan oknum-oknum mafia tanah sehingga terjadi bentrok. Selain itu pekerja perkebunan merasa terancam saat beraktivitas. Pertemuan tertutup itu juga dihadiri Direktur Intelkam Kombes Pol. Bambang Sutjahjo, Direktur Binmas Kombes Pol. Hery Subiansauri dan beberapa pejabat utama lainnnya, dan

selesai sekira pukul 12:30. Namun Kabid Humas Polda Sumut Kombes Pol. Heru Prakoso mengaku tidak mengetahui adanya pertemuan itu. “Saya tidak tahu, belum ada monitor. Tapi kalau yang namanya tamu Kapolda kan ada selalu. Itu hal yang biasa,” sebutnya. Sedangkan Direktur Binmas Poldasu Kombes Hery Subiansauri membenarkan kedatangan tiga pejabat tersebut. Namun dia enggan memberikan penjelasan detail terkait pertemuan tiga direktur perkebunan itu dengan Kapolda secara detail.“Ya ada tadi di lantai II. Agendanya meminta masukan semua pihak atas persoalan-persoalan yang ada. Ini sebagai langkah arif menyikapi persoalan tanah yang belakangan ini sering terjadi,” ujar dia.(m27)

Medan Metropolitan Kapal Nelayan Minim Alat Keselamatan


WASPADA Sabtu 16 Juni 2012

Warga Blokir Jalan Larang Dump Truk Melintas

MEDAN (Waspada): Puluhan warga Perumnas Simalingkar, Desa Simalingkar, Kec.Pancurbatu,melakukanunjukrasadenganmemblokir Jalan Merica Raya, melarang puluhan unit dump truk milik pengusaha galian C melintas dari jalan tersebut, Kamis (14/6). Aksi pemblokiran jalan yang didominasi kaum ibu rumah tangga itu dimulai pukul 09:00, sempat merepotkan petugas Polsek Pancurbatu yang turun ke lokasi menertibkan arus lalulintas. Sedangkan aktivitas dump truk itu terpaksa dihentikan sementara oleh pihak Muspika Pancurbatu. Dalam pertemuan antara warga dan pihak pengusaha difasilitasi Muspika dipimpin Kapolsek Pancurbatu AKP S Siagian bersama Kasi Trantib Kecamatan Pancurbatu Wakil Karo Karo, warga menuntut dump truk galian c berukuran besar tidak boleh melintas kecuali truk berukuran kecil. Menurut warga, dump truk itu menimbulkan kerusakan Jalan Merica dan juga menimbulkan debu yang berterbangan di sepanjang jalan pemukiman padat penduduk tersebut. Selain itu getaran dan suara deru mesin dump truk yang setiap harinya banyak melintas, mengganggu ketentraman dan ketenangan warga. Rapat antara warga dan pengusaha yang difasilitasi Muspika tersebut, tidak menemukan titik temu penyelesaiannnya. Menurut Kapolsek Pancurbatu AKP S Siagian, untuk sementara aktivitas dump truk dihentikan sebelum ada kesepakatan kedua belah pihak. Dia meminta baik warga maupun pihak pengusaha tidak melakukan hal-hal yang dapat mengganggu kamtibmas.(m40)

Dua Penjambret Diringkus MEDAN (Waspada): Dua penjambret diringkus polisi dari Jln. Brigjen Katamso saat melakukan aksinya. Dari kedua tersangka diamankan barang bukti sepedamotor Honda Revo BK 2271 AO, uang Rp450 ribu dan kalung emas 10 gram lebih. Kedua tersangka ST, 31, warga Jln. Brigjen Katamso, dan FA, 28, warga Jln. Sutomo. Mereka menjambret Nurhayati, 62, yang baru saja pulang undangan di Jln. Brigjen Katamso Gang Pelita Ujung, Rabu (13/6). Kapolsek Medan Kota Kompol Sandy Sinurat kepada wartawan, Kamis (14/6) mengatakan, tersangka FA merupakan joki kendaraan. Dia mendekati korbannya dan tersangka ST bertugas menarik tas korban. Tetapi wanita itu melakukan perlawanan sehingga terjadi tarik menarik. Bahkan korban terjerembab, kemudian berteriak minta tolong sehingga mengundang perhatian warga yang kemudian melakukan penangkapan. Kata Sandy, pengakuan tersangka baru sekali beraksi, tetapi diragukan. “Kemungkinan mereka kerap beraksi disekitar Brigjen Katamso. Kepada masyarakat yang pernah menjadi korban penjambretan agar membuat pengaduan ke Polsek Medan kota,” katanya. Disebutkan dia, kedua tersangka juga residivis terlibat kasus peredaran narkoba dan kasus pencurian, yang menjalani hukuman penjara dua tahun. Selain kasus penjambretan, Polsek Medan Kota mengamankan penulis toto gelap ZA alias Zul, 33, warga Jln. Brigjen Katamso Gang Satria. Tersangka menulis togel sejak tiga bulan lalu dengan omset sekitar Rp300 ribu dengan komisi 15 persen dari bandar. Dari tersangka disita catatan nomor, alat tulis dan uang Rp129 ribu. Pengakuan Zul, seharinya bekerja sebagai pengemudi beca bermotor. Sedangkan rekap yang ditulisnya selalu dijemput orang berbeda. “Saya tidak kenal orangnya karena selalu bergantian yang mengambil rekap,” katanya.(m27)

BELAWAN (Waspada): Kapal ikan nelayan sangat minim alat keselamatan dan kalaupun ada bentuknya sudah tidak layak digunakan. Hal itu terungkap saat petugas Direktorat Polisi Perairan Polda Sumut mengadakan Operasi Pelayanan Prima di laut sepanjang pantai Belawan hingga Kwala Tanjung, Rabu (13/6). Walaupun ketersediaan alat keselamatan itu sangat penting bagi jiwa nelayan, namun mereka terkesan tidak peduli dan petugas yang bertanggung jawab mengawasi hal itu tidak tegas dalam menjalankan tugasnya. “Alat keselamatan seperti pelampung ini sangat penting dan jumlahnya harus sama dengan jumlah awak kapal,” kata Kasatrolda Dit Polair Polda Sumut AKBP Tulus Juswantoro SIk, saat memeriksa kelengkapan keselamatan KM Samudera Jaya di sekitar 17 mil dari Belawan. Rahmad alias Lilik, nahkoda KM Sumber Nusantara mengatakan, pihaknya telah menyediakan pelampung di kapal.

Namun karena jarang digunakan, pelampung yang merupakan salah satu alat keselamatan jiwa saat di laut itu rusak dan jarang diperiksa. “Sejak dikasih, pelampung ini belum pernah digunakan. Akibatnya rusak dan kami lupa memeriksanya. Selain itu pelampung juga sering diambil ABK,” sebutnya. Operasi Pelayanan Prima itu menempuh jarak 120 mil dari Belawan ditempuh selama 8 jam dengan kecepatan rata-rata 7 knot menggunakan KP Hayabusa 3008 milik Dit Polair Jakarta yang dinakhodai Iptu M Fahrurazi. Sasaran operasi untuk memeriksa dokumen kapal ikan seperti SIPI (Surat Izin Penangkap Ikan), alat tangkap dan alat keselamatan kapal seperti pelampung dan obat-obatan. Dalam operasi itu, tiga kapal nelayan Belawan yakni KM Samudera Jaya, KM Sumber Nusantara, dan KM Ketabo diperiksa. Hasilnya, semua izin kapal itu lengkap kecuali masalah alat keselamatan kapal yang minim. “Dalam operasi ini kita tidak melakukan tindakan penghukuman karena ini hanya sebagai tindakan peringatan. Namun setelah ini jika masih ditemukan

kesalahan maka akan ditindakan tegas,” ujar AKBP Tulus Juswantoro. Dalam operasi itu juga dilakukan penyebaran surat larangan pengoperasian kapal ikan tarik dua kapal dari Dinas Pertanian dan Kelautan serta pelayanan pemeriksaan kesehatan nelayan di laut. “Semua kegiatan ini dalam rangka HUT Bhayangkara,” tutur Tulus didampingi Kasibinmas Sarair Ditpolair Kompol Ir Revol Khair SH. Meski dalam oprasi tersebut tidak ditemukan kecurangan serta kesalahan, namun Ditpolairdasu akan terus mengadakan patroli rutin guna menjaga stabilitas penangkapan ikan di zona perairan Belawan. Sanksi denda Rp2 miliar dan kurungan 5 tahun penjara akan dikenakan kepada kapal penangkap maupun pengangkut ikan apabila kedapatan izinnya telah mati. Sedangkan bagi kapal yang kedapatan kelengkapan keselamatan atau pengaman seperti pelampung tidak sesuai dengan jumlah ABK, akan diberi tindakan sanksi ringan serta teguran. (h03)

Waspada/ Rustam Effendi

KASATROLDA Dit Polair Polda Sumut AKBP Tulus Juswantoro SIk, Kasibinmas Sarair Ditpolair Polda Sumut Kompol Ir Revol Khair SH, dan Iptu M. Fahrurazi memeriksa dokumen kapal nelayan saat mengadakan Operasi Pelayanan Prima di laut sepanjang pantai Belawan hingga Kwala Tanjung.

Gatot Ajak Pemuda Berpartisipasi Dalam Pembangunan

Waspada/Amir Syarifuddin

PLT GUBSU Gatot Pujo Nugroho menghadiri Rakerwil Gerakan Pemuda Al-Wasliyah Sumut, di Hotel Madani Medan.

MEDAN (Waspada): Plt Gubernur Sumatera Utara H Gatot Pujo Nugroho, ST mengatakan, perubahan suatu bangsa itu berada di tangan pemuda, untuk itu dia mengajak para pemuda untuk bersama-sama berpartisipasi dalam pembangunan karena di tangan pemudalah harapan suatu bangsa. Hal itu disampaikan Gatot dalam acara pelantikan dan Rakerwil I PimpinanWilayah Gerakan Pemuda Al-Washliyah Sumatera Utara, di Hotel Madani, Senin (11/6). Untuk itu, kata dia, sudah selayaknya bangsa ini menaruh harapan besar pada pemuda karena pemuda adalah ujung tombak perubahan. “Siapapun yang melakukan perubahan pasti mengandalkan pemuda dengan demikian tentu pelantikan dan Rakerwil Pemuda Al-Washliyah ini menjadi harapan besar nantinya dalam

mengajak elemen masyarakat dan kepemudaan lainnya untuk bersama-sama berpartisipasi dalam proses pembangunan,” harapnya. Gatot menjelaskan, Alquran juga telah menerangkan kesuksesan dan keberhasilan tak lepas dari andil pemuda. “Untuk itu saya menaruh harapan besar pada pemuda dan dengan Rakerwil ini nantinya dapat memberikan dan merumuskan suatu ide dan kesepakatan dalam berorganisasi dan dapat membantu pemerintah untuk kelangsungan pembangunan di Sumut ini,” sebutnya. Gatot mengingatkan, pemuda yang terorganisir dalam organisasi kepemudaan hendaklah jangan semua terjun ke dunia politik. Mungkin sebagian pemuda bisa didesain menjadi pengusaha, budayawan dan sekmen lainnya sehingga pe-

muda mewarnai semua sekmen yang ada. “Dengan begitu saya yakin, bangsa dan negara ini akan maju karena sebagaimanakitaketahuikeberhasilansuatu bangsa dan negara terletak pada pemudanya yang bisa melengkapi dari semua aspek,” ujarnya. Dalam kesempatan itu Gatot mengimbau di Rakerwil ini nantinya Gerakan Pemuda Al-Washliyah dapat merumuskan tentang kriteria pemuda dan batasan umur serta definisi pemuda. “Jadi ini mungkin sebuah masukan gimana tentang definisi pemuda yang mungkin bisa masuk kedalam struktur organisasi, “ katanya. Sementara itu Ketua PW GPA H Isma Padli A Pulungan SH, MH mengharapkan, Gerakan Pemuda Al-Washliyah memberikan manfaat kepada pembangunan bangsa dan negara ini khususnya di Sumut.(m28)

16 Koramil Gelar Karya Bakti Sambut HUT Ke-62 Kodam I/BB Waspada/Ist

ARIFIN Ilham didampingi Amiruddin MS (duduk) menyampaikan tausiyah pada Zikir dan Tabligh Akbar Tazkira Sumut di Masjid Agung Medan.

Tazkira Gelar Zikir, Tabligh Akbar Bersama Arifin Ilham MEDAN (Waspada): Ribuan jamaah Majelis Zikir Tazkira Sumut dan umat Islam di Medan, secara khusyuk mendengarkan tausiyah disampaikan KH Arifin Ilham dalam acara zikir dan tabligh akbar, di Masjid Agung, Minggu (10/6) lalu. Arifin Ilham yang didampingi Ketua Umum Tazkira Sumut Buya KH Amiruddin MS mengatakan, orang-orang yang senantiasa berzikir kepada Allah, membuat nafsunya menjadi tenang. “Majelis zikir merupakan majelis para Malaikat. Karena itu, saat Malaikat Izrail ingin mencabut nyawa orang-orang yang selalu berzikir kepada Allah SWT, dia mengucapkan kata salam sebagai penghormatan kepada mereka,” ujar Arifin. Menurutnya, dalam Alquran banyak ayat yang menjelaskan tentang balasan yang baik bagi orang-orang yang senantiasa berzikir kepada Allah SWT. Karena itu, dia mengajak umat Islam agar masing-masing memperingatkan dirinya kepada Allah SWT, apakah sudah berzikir kepada-Nya atau melupakan nama-Nya. Mengayomi majelis Sementara itu, KH Amiruddin MS mengatakan, isi tausiyah KH Arifin Ilham sangat bernas. Apalagi, selalu mengajak jamaah untuk berzikir kepada Allah. Pada hakekatnya, lanjutnya, jika kita banyak berzikir kepada Allah SWT membuat hati dan jiwa kita menjadi tenteram, tenang dan nyaman dalam beraktivitas. Apalagi, berzikir tidak mengenal waktu dan tempat. Sehingga, kapan saja dan dimana saja bisa selalu berzikir kepada Allah SWT. Kata Amiruddin, dirinya diamanahkan KH Arifin Ilham agar dapat mengayomi keberadaan majelis-majelis zikir yang ada di Sumut, untuk bersama-sama mencari dan mencapai keridhoan Allah SWT. “Beliau menginginkan agar majelis-majelis zikir di Sumut dapat terbina secara baik dan saling mendukung,” katanya. (cwan)

MEDAN (Waspada): Sebanyak 16 Koramil, Satuan Kodam I/BB beserta unsur Muspika dan masyarakat secara serentak melakukan karya bakti di beberapa kecamatan di Medan, Jumat (15/6). Karya bakti ini digelar menyambut HUT ke-62 Kodam I/BB pada 20 Juni 2012. Di wilayah Koramil 04/Medan Kota, karya bakti berlangsung di Perkuburan Jln. Halat dipimpin Danramil 04/MK Kapten Kav. A. Fitrahudinsyah Lubis dan Camat Medan Area Khairuddin Rangkuty. “Ada 150 personil TNI-AD dari Koramil dan Batalyon Kavaleri 6/Serbu yang kita libatkan di sini. Kita juga bekerjasama dengan masyarakat, Organisasi Kepemudaan dan lainnya,” kata Fitrahudinsyah. Menurut Fitrahudinsyah, karya bakti ini merupakan komunikasi sosial untuk lebih mendekatkan diri kepada masyarakat. “Kita memilih kuburan ini karena kita lihat kurang terawat. Jadi, dalam menyambut HUT ke-62 Kodam I/BB, karya bakti kita fokuskan di sini. Mudah-mudahan, karya bakti ini bisa menggugah masyarakat agar lebih peduli akan kebersihan lingkungan,” tambahnya. Sementara itu, karya bakti juga dilaksanakan Koramil 07/ Medan Tuntungan dibantu prajurit Hubdam I/BB, Arhanudse 11/BS, OKP, Ormas dan mas-

yarakat serta Muspika Medan Selayang. Karya bakti dilakukan di daerah pemukiman penduduk Jln. Cempaka Raya, Cempaka Indah dan Cempaka I Kec. Medan Selayang. “Ada 200 orang yang terlibat pada karya bakti ini. Mudahmudahan dengan adanya karya bakti ini, Medan kembali meraih Adipura Kencana tahun depan. Kita berharap bisa menggugah masyarakat agar lebih peduli akan kebersihan lingkungan.

Kegiatan ini juga untuk mencegah penyakit berbasis lingkungan,” kata Danramil 07/MT Kapten Inf. Zulkarnaen. Sedangkan untuk wilayah Koramil 06/Medan Sunggal, karya bakti dilakukan di Pasar Kampung Lalang, depan Makodam I/BB dan beberapa wilayah lainnya. Karya bakti dipimpin Danramil 06/Medan Sunggal Kapten Inf. Karjono. “Kita mengimbau pedagang agar membuang sampah pada tempat-

nya. Sebab, sampah yang dibuang secara sembarangan akan menjadi sumber penyakit,” kata Kapten Inf. Karjono. Di tempat terpisah, Koramil 05/Medan Baru beserta unsur Muspika Medan Baru, Medan Polonia, Medan Maimun serta OKP dan masyarakat menggelar karya bakti di Kelurahan Titi Rante. Kegiatan ini dipimpin Danramil 05/MB Kapten Arh. K. Sidabutar dan dihadiri Camat

Waspada/Mursal AI

DANRAMIL 04/MK Kapt. Kav. A. Fitrahudinsyah Lubis (kiri) meninjau karya bakti di Perkuburan Halat Medan, Jumas (15/6) pagi.

Medan Baru Robert Napitupulu, Camat Medan Polonia Ody Doddyprasetyo, Camat Medan Maimun Said Reza, Ketua AMPI Medan Baru Leo Pasaribu, Ketua PP Medan Baru serta Lurah Titi Rante. Karya bakti tersebut melibatkan 265 personel dari Koramil 05/MB, Yonkav-6/Serbu, Polsek Medan Baru, Zidam I/ BB, petugas Puskesmas Medan Baru dan masyarakat setempat. Mereka membersihkan kawa-

san lapangan sepakbola Jln. Rebab, Kelurahan Titi Rante, Medan Baru. Menurut K. Sidabutar, selama ini lapangan tersebut tidak dapat sepenuhnya dimanfaatkan masyarakat. Namun, dengan dilaksanakannya karya bakti, maka lapangan itu bisa kembali dimanfaatkan untuk berbagai kegiatan, terutama olahraga. Diharapkan masyarakat merawat dan menjaga lapangan itu.(h02/m34)

Waspada/Mursal AI

DANRAMIL 07/MT Kapt. Inf. Zulkarnaen (kanan) ikut membersihkan selokan sekitar rumah warga Jln. Cempaka I Kec. Medan Selayang, Jumat (15/6).

WASPADA Sabtu 16 Juni 2012

Medan Metropolitan


Pujakesuma Berperan Penting Untuk Pembangunan Sumut

Waspada/Surya Efendi

PENGENALAN PSN PADA USIA DINI: Direktur Pengendalian Penyakit Bersumber Binatang (P2B2) Ditjen P2PL Kementerian Kesehatan Dr. Rita Kusriastuti, MSc (tiga dari kanan) didampingi Kadis Kesehatan Kota Medan Dr. Edwin Effendy, MSc (kanan) bersama mitra kerja lainnya menjelaskan, gerakan dan pemberdayaan masyarakat dalam upaya Pemberantasan Sarang Nyamuk (PSN) kepada murid SD (usia dini) yang digelar PT Johnson Home Hygiene Products (JHHP) di Amaliun Convention Hall Jl. Amaliun Medan, Jumat (15/6). Kegiatan ini dalam rangka mendukung Asean Dengue Day yang digelar serentak di sejumlah kota besar di Indonesia.

DBD Masih Ancam Indonesia MEDAN (Waspada): Penyakit Demam Berdarah Dengue (DBD) masih mengancam Indonesia, karena kasus DBD menempati urutan tertinggi di Asean. Pertahunnya, warga yang menderita DBD mencapai 50.000 dengan angka kematiannya 0,8 persen. Demikian diungkapkan Direktur Pengendalian Penyakit Bersumber Binatang (P2B2) Ditjen P2PL dr. Rita Kusriastuti usai peringatan pelaksanaan Asean Dengue Day ke 2 di Amaliun Convention, Jumat (15/6). “Ancaman jadi sangat besar kalau dibiarkan. Tahun 2009, jumlah kasusnya mencapai 150.000 dengan angka kematiannya 1 persen. Dalam dua

tahun terakhir, terjadi penurunan 50 persen. Tahun 2010, kasusnya turun menjadi 70.000 dan pada 2011, turun lagi menjadi 50.000 kasus dengan angka kematiannya 0,8 persen. Tapi, kalau dibiarkan ancamannya sangat besar,” katanya. Dijelaskannya, hampir di setiap daerah perkotaan, jumlah kasus DBD tinggi. Di Indonesia sendiri, berdasarkan persentasenya ada 10 besar daerah provinsi yang jumlah kasusnya tertinggi. Di antaranya, Bali, Sulawesi Tengah, Kepulauan Riau, Jakarta, Jambi, NAD, Riau, Sumatera Barat. dan Sumatera Utara. “Ke-10 daerah itu sebagai kota besar dengan resiko tinggi karena banyak orang datang dan pergi, penduduk lebih padat dan perilaku hidup bersih

warganya. Hal itu karena DBD merupakan penyakit perkotaan dan semakin padat penduduknya, maka akan semakin tinggi jumlah kasusnya,” sebutnya. Disamping besarnya jumlah kasus temuan, pergeseran korban DBD dari kelompok usia anak ke usia dewasa juga terjadi, khususnya di kota-kota besar yang sudah menjadi daerah endemis DBD. Dijelaskannya, DBD terdiri dari 4 tingkatan, dimana pada awal penularan biasanya kelompok usia anakanak yang menjadi korban. Namun seiring terbentuknya imunitas, maka peningkatan level DBD hingga ke level empat terjadi dan penderitanya bergeser ke kelompok usia dewasa. Pemerintah Indonesia sedang membangun koordinasi dengan negara-negara lain di

Asean untuk menekan angka pertumbuhan jumlah kasus DBD. Bahkan, Indonesia siap belajar dari Thailand yang terbilang paling sukses menurunkan jumlah korbannya ke tingkat minimum. Diakui Rita, upaya tersebut membutuhkan kemitraaan berkesadaran dengan masyarakat. Agar pemberantasan DBD dapat dilakukan secara rutin dan meluas. Salah satunya dengan Piagam “Jakarta Call For Action” yang dicanangkan dari Jakarta untuk seluruh negara Asean. “Makanya, penanggulangan DBD tidak bisa dilakukan sendiri-sendiri. Tapi, semua pihak harus membuat pertahanan ditingkat keluarga dan lingkungan. Caranya sederhana, yakni serentak melakukan Pem-

berantasan Sarang Nyamuk. Agar target menurunkan angka kematian menjadi 0,5 persen bisa tercapai,” katanya. Kepala Dinas Kesehatan Kota Medan Edwin Effendi menyebutkan, DBD merupakan program khusus yang rutin dilaksanakan di Medan. Untuk mendukung program itu, pihaknya terus berupaya merevitalisasi posyandu dan optimal memberikan pemahaman dan kesadaran kepada masyarakat. “Sebenarnya, untuk menanggulangi DBD ini yang paling utama adalah merubah perilaku hidup sehat di tengah masyarakat. Itulah yang sedang kita berikan kesadaran kepada masyarakat supaya prilaku hidup sehat itu jadi membudaya,” ujar Edwin. (h02)

Dua Kubu BM PAN Sumut Silaturahmi Ke Harian Waspada

Anang: Komit Perbaiki Kesejahteraan Umat

Cokie: Serahkan Melalui Jalur Hukum

MEDAN (Waspada): Dewan Pimpinan Wilayah (DPW ) Barisan Muda Penegak Amanat Nasional Sumatera Utara (BMPAN Sumut) sebagai pelopor pembaharuan dan harapan bangsa, berkomitmen memperbaiki kesejahteraan umat dan membenahi ketertinggalan generasi muda dengan menempatkan kader-kadernya sebagai anggota legislatif mengawal pembangunan. Demikian dikatakan Ketua BM PAN Sumut Anang Anas Azhar, MA saat bersilaturahmi ke gedung Bumi Warta Harian Waspada Medan, Kamis (14/ 6), bersama rombongan setelah terbentuk susunan pengurus BMPAN Sumut Periode 2011-2016 yang diamanahkan 22 DPD BM PAN se-Sumut. Rombongan diterima Humas Harian Waspada H. Erwan Effendi. Turut hadir dalam audiensi tersebut yakni Sekretaris Edi Sahputra, Wakil Ketua M Syahban, Jamaluddin, Ahmad Khairuddin, Hadi Alimuddin AR Hutagalung, Azhari A Marpaung, Ruslan, Zulfiansyah dan lainnya. Silaturahmi juga dihadiri Pengurus Majelis Pertimbangan Barisan (MPB) BM PAN Sumut di bawah pimpinan H. Wildan Aswan Tanjung, Wakil Ketua MPB Husni Hamid Lubis, Muhammad Fadil dan Abdul Hakim Lubis. Anang Anas menyebutkan, komitmen tersebut akan dimulai dari rangkaian pelantikan pengurus BMPAN Sumut periode 2011-2016 yang dilaksanakan pada Juli 2012 mendatang. Kemudian penyerahan santunan kepada anak yatim, pemberian sembako kepada kaum dhuafa, pengobatan gratis dan mengunjungi panti asuhan. Kegiatan ini sebagai simbol silaturahmi BM PAN kepada masyarakat terutama konstituen Partai Amanat Nasional (PAN) seperti panti asuhan Muhammadiyah, Aisyiah dan Alwashliyah yang ada di Sumut. “Ini rangkaian kegiatan yang kita persiapkan dalam rangka pelantikan dan bersilaturahmi kepada masyarakat, agar mereka tahu bahwa BM PAN tetap eksis di tengah-tengah masyarakat. BM PAN berkomitmen berusaha memperbaiki kesejahteraan umat, memperbaiki keterbelakangan generasi yang selama ini banyak tertinggal. Dengan bantuan dan partisipasi ini, kita berharap bisa membantu anak-anak dan fakir miskin serta kaum dhuafa yang ada di Sumut,” ujarnya. Pada tahun pertama pengurusan ini, kata Anang, pihaknya akan melakukan konsolidasi total ke 33 kabupaten/kota yang ada di Sumut dan ditargetkan selesai pada akhir Desember 2012. Pada tahun kedua, akan dilaksanakan kerja sesuai dengan harapan masyarakat luas. Di tahun ketiga yakni 2014, BM PAN akan menjaring kader-kadernya untuk menjadi calon legislatif bahkan legislatif di setiap daerah kabupaten/kota. “Inilah yang menjadi tonggak awal dan ujung tombak kita menguatkan BM PAN untuk berkiprah di tengah-tengah masyarakat melalui calon legislative. Bahkan menjadi legislatif terpilih nanti agar bisa mengawal pembangunan dari proses perkembangan atas konsolidasi yang telah dilakukan. Sebagai finalisasi, BM PAN akan menjalankan tugas berat untuk memenangkan Hatta Radjasa menjadi Presiden pada 2014,” ujarnya. Sementara itu, pimpinan Waspada yang diwakili Kabag Humas H Erwan Effendi, menyambut baik silaturahmi rombongan DPW BMPAN Sumut dan berharap organisasi tersebut dapat tumbuh dan berkembang secara baik serta mampu menyahuti keinginan masyarakat dengan bekerja, bergerak dan berbuat demi kepentingan masyarakat. Mudah-mudahan BMPAN Sumut bisa menjadi organisasi yang bermanfaat bagi semuanya. (m41)

MEDAN (Waspada): Sehubungan akan dilantikya kepengurusan periode 2012-2017, sejumlah pengurus DPW Barisan Muda Penegak Amanat Nasional (BM PAN) Sumut melakukan audiensi ke gedung Bumi Warta Harian Waspada Medan, Jumat (15/6). Rombongan dipimpin Ketua DPW BM PAN Sumut HM Iskandar Sakty Batubara, SE, MSP yang akrab disapa Cokie didampingi S. Sapta Buana Lubis (wakil ketua), Abdul Majid Siregar (wakil ketua), Zainuddin, SE (wakil ketua), Junaidi Syahputra Hasibuan (wakil ketua), Sabri Fiin Tanjung, July Mardiah,SH (bendahara), Amrival, Darwis, Arwin Rahmadsyah (wakil bendahara), Ahmad Fajar, Nur Asiyah Tanjung, SE (wakil sekretaris). Mereka diterima Humas Harian Waspada H. Erwan Effendi. Cokie mengucapkan terimakasih kepada Harian Waspada yang telah menerima audiensi pengurus BM PAN Sumut. “Kehadiran kami untuk menyampaikan keberadaan BM PAN sehingga masyarakat mengetahui dan mau menerimanya. Mengenai pengurus BM PAN Sumut yang sah, semua tergantung legalitasnya,” kata Cokie. Sebagai organisasi kemasyarakatan, lanjut Cokie, BM PAN menilai Harian Waspada sebagai suratkabar politik yang religius dan nasionalis memiliki peranan penting dalam menyebarluaskan informasi kepada masyarakat. Hal ini juga berlaku bagi penyebarluasan informasi tentang keberadaan pengurus BM PAN yang memiliki legimitasi. “Jika ada pihak-pihak yang mengaku sebagai pengurus BM PAN Sumut, maka kita menganggap hal itu sebagai dinamika berorganisasi. Jika ada pihak-pihak yang mengklaim sebagai pengurus BM PAN yang sah, maka kami dengan jiwa besar menyerahkannya melalui jalur hukum,” kata Cokie. Menurut Cokie, kehadiran para pengurus di gedung Bumi Warta Harian Waspada, menjadi motivasi bagi kader BM PAN Sumut. Mereka mencontoh para senior terdahulu yang telah banyak berbuat demi kebesaran BM PAN di masa mendatang. Cokie menambahkan, pelantikan pengurus BM PAN Sumut akan digelar di Ball Room Grand Aston Medan pada 15 Juli 2012 dengan menghadirkan petinggi DPP PAN, DPP BM PAN dan sejumlah menteri. Acara ini diisi dengan hiburan dari etnis Melayu, Jawa dan Tionghoa. Sebelum pelantikan, akan dilaksanakan bakti sosial berupa donor darah dan penyerahan perlengkapan sekolah kepada 1.000-an siswa kurang mampu yang berprestasi. Kemudian, dilaksanakan Rakor BM PAN untuk menyusun program kerja sehingga percepatan konsolidasi organisasi ke daerah segera tercapai. “Ir. Hatta Rajasa sebagai Ketua Umum DPP PAN, diharapkan bisa menjadi pemimpin Indonesia pada era reformasi ini,” tambah Zainuddin, SE dan Sapta Buana. Sementara itu, Humas Harian Waspada H. Erwan Effendi menceritakan tentang perjalanan Harian Waspada yang didirikan H.Mohammad Said dan Hj. Ani Idrus. Kedua tokoh pers nasional itu berjuang melawan penjajahan melalui pemberitaan yang disampaikan kepada masyarakat luas. Erwan juga menyambut baik keberadaan BM PAN di Sumatera Utara. “Kami mengapresiasi BM PAN sebagai organisasi kemasyarakatan yang membawa pencerahan bagi kehidupan masyarakat dan pembangunan di Sumatera Utara,” ujarnya.(m24)


KETUA BM PAN Sumut Anang Anas Azhar, MA dan rombongan foto bersama saat bersilaturahmi ke gedung Bumi Warta Harian Waspada Jln. Letjen Suprapto No.1 Medan, Kamis (14/6).

Waspada/Surya Efendi

KETUA BM PAN Sumut Iskandar Sakty Batubara (tiga dari kiri) bersama pengurus BM PAN Sumut lainnya mendengar penjelasan Humas Harian Waspada H Erwan Effendi (dua darikiri) di gedung Bumi Warta Harian Waspada Medan, Jumat (15/6).

MEDAN (Waspada): Dewan Pembina Paguyuban Keluarga Besar (PKB) Pujakesuma yang juga Plt Gubernur Sumatera Utara H Gatot Pujo Nugroho ST, mengukuhkan kepengurusan DPP PKB Pujakesuma di bawah kepemimpinan H Suratman SP, di Tiara Convention Hall Jalan Cut Mutia Medan, Minggu (10/6) malam. Bersamaan dengan itu, DPP PKB Pujakesuma juga melantik DPW Pujakesuma Sumut, DPW Wanita Pujakesuma Sumut, DPW GM Pujakesuma Sumut, DPD PKB Pujakesuma Kota Medan, DPD Pujakesuma Kota Binjai, DPD Pujakesuma Langkat dan DPD Pujakesuma Deliserdang masa bhakti 20112016. Dalam amanatnya Gatot Pujo Nugroho mengharapkan, pelantikan yang sekaligus menjadi ajang silaturahmi ini tidak hanya sekedar seremonial saja. Melainkan bisa sebagai momentum untuk melakukan tugas pokok organisasi. “Ketika anda tadi ditanya kesiapan tentu anda sudah menyatakan siap dilantik. Itu artinya awal untuk melakukan tugas organisasi. Dalam kontek bernegara dan berbangsa ada empat pilar yang menjadi pedoman yakni UUD 1945, Pancasila, NKRI dan Bhineka Tunggal Ika, sedangkan di Pujakesuma ada empat pilar yang menjadi karakter yakni rukun, raket, regeng dan rumekso,” ujarnya. Gatot tak lupa mengucapkan selamat kepada seluruh pengurus yang baru dikukuhkan. Bersamaan dengan itu dia tak lupa mengingatkan organisasi ini adalah alat, bukan tujuan. Jadi, hadirnya organisasi ini tujuan untuk menjadikan Sumut maju, mandiri dan

sejahtera dalam bingkai keberagaman. “Organisasi Pujakesuma punya peran kontribusi untuk pembangunan. Jadi alatnya adalah dengan organisasi Pujakesuma dengan kualitas keilmuan, kualitas pendidikan dan Alhamdulillah sebagian dewan pakar pembina Pujakesuma banyak yang profesor,” tuturnya. Jadi, lanjut Gatot, untuk bisa memberikan sesuatu tentu kita harus terlebih dahulu mempunyai sesuatu. Pujakesuma tidak akan bisa memberikan kontribusi kalau tidak punya sesuatu. “Saya mengajak dan mengingatkan dan selalu mengulangulang, kita semua untuk membantu pendidikan warga Jawa, perekonomian warga Jawa dan kita tingkatkan sosial budaya. Ketika sudah mempunyai modal dasar ini bersama elemen masyarakat di Sumut maka kita dapat mewujudkan mimpi kita bersama untuk bekerja sama dengan pemerintah menjadikan Sumut ikon pertumbuhan Indonesia bahagian Barat,” katanya. Sementara Ketua Panitia Pelaksana Pengukuhan dan Pelantikan Prof DR Hj Sri Sulistyawati SH, Msi mengatakan, pelaksanan pengukuhan dan pelantikan sempat tertunda karena harus menyelesaikan persoalan interen. Acara pengukuhan dan pelantikan dihadiri beberapa pejabat di Sumut. Antara lain, Ketua DPRD Sumut Saleh Bangun, anggota DPR-RI Dapil Sumut Chairuman Harahap dan sejumlah SKPD Pemerintah Provinsi Sumut. Ribuan warga jawa dan simpatisan terlihat antusias mengikuti acara demi acara hingga larut malam. Diakhir acara, Plt Gubsu Gatot Pujo Nugroho mendapat ucapan selamat atas hari kelahirannya yang ke-50. Semua yang hadir berdoa agar Plt Gubsu panjang umur, sehat selalu dan dapat memimpin Sumut lebih lama lagi.(m28)

Waspada/Amir Syarifuddin

GATOT Pujo Nugroho mengukuhkan kepengurusan DPP PKB Pujakesuma, di Tiara Hotel Medan.

37 Santri RA/MDA Khatam Quran MEDAN (Wasapada): Sebanyak 37 santriwan maupun santriwati Raudhatul Atfal (RA) dan Madrasah Diniyah Amaliyah (MDA) AlJamiatus Syafiiyah Jln. STM/Sukatari, Kel. Sukamaju, Medan Johor, diwisuda dan khatam Quran, Ming-gu (10/6). Acara tersebut dirangkaikan dengan peringatan Israk Mikraj Nabi Muhammad SAW 1433 H, diawali khatam Quran dipimpin Ustadz Ali Idrus S.Ag, wali kelas IV MDA madrasah tersebut yang dihadiri para orangtua dan wali murid serta tokoh-tokoh masyarakat Kelurahan Suka Maju, Medan Johor. Kepala Sekolah RA dan MDA Suryaniar S.Ag menyampaikan terima kasih kepada wali murid yang telah mempercayai mendidik putra-putri mereka di sekolah Al-Jamiatus Syafiiyah. Dia berharap agar putra/putri yang mendapat didikan di lembaga pendidikan tersebut nantinya menjadi anak-anak yang berakhlak mulia, berguna kepada ke-

luarga bangsa dan negara. Menurut dia, hal tersebut berkaitan ilmu pengetahuan yang diterapkan kepada anak-anak didik lebih banyak pendidikan agama dibandingkan pendidikan umum. “Saya yakin anak-anak ini lebih patuh kepada kedua orangtuanya,” ujarnya. Acara tersebut dimeriahkan dengan berbagai tarian ditampilkan para santriwan maupun santriwati, pembacaan ayat-ayat pendek kitab suci Alquran, serta percakapan tiga bahasa yaitu Inggris, Arab, dan Bahasa Indonesia. Sementara Ustadz Ali Idrus menuturkan, kepercayaan masyarakat mendidik putra/putri mereka di RA maupun MDA dari tahun ke tahun semakin meningkat. “Alhamdulillah kepercayaan orangtua murid semakin baik,” ujarnya. Sedangkan Drs H Sahlan Harun dalam ceramah Israk Mikraj mengimbau masyarakat agar meningkatkan pengamalan amal-amal ibadah terutama menjelang bulan suci Ramadhan yang segera tiba. (m32)

Waspada/Abdullah Dadeh

USTADZ Ali Idrus S.Ag memimpin khatam Quran santriawan/ti MDA dan RA Al-Jamiatus Syafiiyah, Kel. Sukamaju, Medan Johor.

Medan Metropolitan


WASPADA Sabtu 16 Juni 2012

Polisi Gembok Ban Lima Mobil Parkir Berlapis MEDAN (Waspada): Ban lima mobil yang parkir berlapis di Jln. Listrik simpang Jln. Imam Bonjol Medan, terpaksa digembok oleh petugas Sat Lantas Polresta Medan, saat melakukan penertiban parkir berlapis di kawasan Jalan Imam Bonjol, Kamis (14/6) sekira pukul 11:00. Seorang petugas Sat Lantas Polresta menyebutkan, tindakan tersebut dilakukan untuk menyadarkan para pengendara bermotor untuk tidak memarkirkan mobilnya sembarangan, apalagi sampai parkir berlapis karena mempersempit ruas jalan raya hingga membuat arus lalulintas jadi macat. Dari ke lima mobil yang digembok berwarna kuning ini, polisi menahan surat kendaraan bermotor dan memberikan surat tilang kepada seluruh pengendara mobil tersebut untuk mengikuti sidang di Pengadilan Negeri (PN) Medan. Sementara itu, Kasat Lantas Polresta

Medan Kompol M Risya Mustario menjelaskan, pihaknya tetap melakukan razia terhadap parkir berlapis di sejumlah ruas jalan di Kota Medan.”Parkir berlapis ini bisa membuat kemacatan, ini kurangnya kesadaran pengemudi, razia ini tetap kita lakukan,” ujarnya. Ketika merazia parkir berlapis tersebut, kata Risya, pihaknya tidak menemukan juru parkir. “Karena melihat ada petugas Sat Lantas datang, juru parkir langsung menghilang,” sebutnya seraya mengimbau agar juru parkir tidak membuat parkir berlapis. Aksi penertiban parkir berlapis dengan cara menggembok ban kendaraan bermotor tersebut, sempat menjadi pusat perhatian pengguna jalan yang melintas. Apalagi keberadaan parkir berlapis membuat arus lalulintas di kawasan Jalan Listrik simpang Jalan Imam Bonjol jadi sempit dan macat. (h04)

30 Ribu Jenis Tanaman Herbal Ada Di Indonesia


Jadwal Penerbangan Di Bandara Polonia No. Penerbangan Ke Flight


Tiba Dari



GARUDA INDONESIA 1 Jakarta GA-181 2 Jakarta GA-183 3 Jakarta GA-185 4 Jakarta GA-187 5 Jakarta GA-189 6 Jakarta GA-191 7 Jakarta GA-193 8 Jakarta GA-147 9 Jakarta GA-195 10 Banda Aceh GA-142 11 Banda Aceh GA-14.6

05.30 08.40 10.45 11.55 13.55 15.45 18.35 18.30 19.50 09.40 14.50

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Banda Aceh Banda Aceh

GA-180 GA-182 GA-184 GA-186 GA-146 GA-188 GA-190 GA-192 GA-196 GA-143 GA-147

07.55 08.55 11.10 13.00 14.05 15.10 17.50 19.05 21.35 12.25 17.45

CITILINK 1 Jakarta 2 Jakarta

09.45 19.00

Jakarta Jakarta

GA-040 GA-044

09.15 18.30

06.15 09.40 08.05 17.55 10.05 18.25 21.20 13.30 15.05 08.40 12.00

Kuala Lumpur Kuala Lumpur Kuala Lumpur Kuala Lumpur Penang Penang Kuala Lumpur Jakarta Bangkok (2,4,6) Bandung Surabaya

QZ-8051 QZ-8055 AK-450 AK-454 QZ-8073 AK-5836 AK-456 QZ-7502 QZ-8085 QZ-7986 QZ-7610

08.40 12.05 07.35 17.30 09.40 18.00 20.55 13.05 20.10 05.45 08.30

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Penang Penang Jakarta Jakarta Jakarta Jakarta Jakarta Surabay Surabaya Banda Aceh Batam

JT-380 JT-300 JT-394 JT-302 JT-210 JT-200 JT-204 JT-398 JT-382 JT-384 JT-202 JT-212 JT-396 JT- 8289 JT-8287 JT-206 JT-208 JT-388 JT-308 JT-218 JT-971 JT-973 JT-397 JT-970

08.20 09.20 10.20 11.20 11.50 12.20 13.20 14.20 15.20 16.20 17.20 17.50 18.20 11.35 15.00 19.20 20.20 21.55 22.20 23.20 12.16 15.55 07.40 12.15

GA-041 GA-045

AIR ASIA 1 Kuala Lumpur QZ-8050 2 Kuala Lumpur QZ- 8054 3 Kuala Lumpur AK- 451 4 Kuala Lumpur AK-455 5 Penang QZ-8072 6 Penang AK-5937 8 Kuala Lumpur AK-457 9 Jakarta QZ-7503 10 Bangkok (1,4,6) QZ-8084 11 Bandung QZ-7487 12 Surabaya QZ-7611 LION AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Jakarta 5 Jakarta 6 Jakarta 7 Jakarta 8 Jakarta 9 Jakarta 10 Jakarta 11 Jakarta 12 Jakarta 13 Jakarta 14 Penang 15 Penang 16 Jakarta 17 Jakarta 18 Jakarta 19 Jakarta 20 Jakarta 21 Surabaya 22 Surabaya 23 Banda Aceh 24 Batam

JT- 211 JT- 381 JT- 397 JT- 207 JT- 301 JT- 395 JT- 303 JT- 213 JT-201 JT- 387 JT-399 JT-383 JT-205 JT-8288 JT-8286 JT-385 JT-203 JT-215 JT-309 JT-209 JT-972 JT-972 JT-396 JT 970

06.00 07.00 08.20 09.00 10.00 11.00 12.00 12.30 13.00 14.00 15.00 16.00 16.35 09.10 12.30 17.00 18.00 18.30 20,00 21.00 07.00 12.55 19.00 07.00

MALAYSIA 1 Kuala Lumpur MH-861 2 Kuala Lumpur MH-865

09.30 19.05

Kuala Lumpur MH-860 08.50 Kuala Lumpur MH-864 18.40

SILK AIR 1 Singapura 2 Singapura 3 Singapura (7)

MI-233 MI-237 MI-241

08.40 20.35 21.05

Singapura Singapura Singapura (7)

MI-232 MI-238 MI-242

07.50 19.50 20.00

VALUAIR 1 Singapura (4,7) VF-582 2 Singapura (1,3,6) VF-584

09.35 17.25

Singapura (4.7) VF-581 Singapura (1,3,6) VF-583

09.10 17.50

BATAVIA AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Batam

Y6-592 Y6-594 Y6-596 7P-568

10.10 16.15 20.00 13.00

Jakarta Jakarta Jakarta Batam

Y6-591 Y6-593 Y6-595 7P-567

09.55 18.30 19.20 11.05

SRIWIJAYA AIR 1 Jakarta 2 Jakarta 3 Batam 4 Pekanbaru 5 Pekanbaru 6 Banda Aceh 7 Penang 8 Padang

SJ-015 SJ-011 SJ-035 SJ-043 SJ-041 SJ-010 SJ-102 SJ-021

13.25 15.00 16.20 10.20 16.00 11.55 07.20 15.25

Jakarta Jakarta Batam Pekanbaru Pekanbaru Banda Aceh Penang Padang

SJ-010 SJ-016 SJ-034 SJ-042 SJ-040 SJ-011 SJ-103 SJ-020

11.20 18.35 15.45 12.50 15.25 13.25 10. 00 14.50

13.15 11.00

Subang Penang

FY-3412 FY-3402

12.56 10.40

SRIWIJAYA AIR 1 Subang FY -3413 2 Penang FY- 34.03

Jadwal Perjalanan Kereta Api No KA

Nama KA




U.2 U.4 U.6 U.8 U.1 U.3 U.5 U.7 U.10 U.12 U.9 U.11 U.14 U.16 U.18 U.13 U.15 U.17 U.22 U.21 PLB 7000 PLB 7007 PLB 7014 PLB 7017 PLB 7002 PLB 7004 PLB 7008 PLB 7010 PLB 7012 PLB 7001 PLB 7006 PLB 7015 PLB 7003 PLB 7005 PLB 7009 PLB 7011 PLB 7013

Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Putri Deli Putri Deli Putri Deli Putri Deli Putri Deli Putri Deli Siantar Ekspres Siantar Ekspres Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa

Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Bisnis Bisnis Bisnis Bisnis Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonom Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi

Medan Medan Medan Medan Rantau Prapat Rantau Prapat Rantau Prapat Rantau Prapat Medan Medan Binjai Binjai Medan Medan Medan Tanjung Balai Tanjung Balai Tanjung Balai Medan Siantar Medan Medan Medan Medan Medan Medan Medan Medan Medan Tebing Tinggi Belawan Belawan Binjai Binjai Binjai Binjai Binjai

Rantau Prapat Rantau Prapat Rantau Prapat Rantau Prapat Medan Medan Medan Medan Binjai Binjai Medan Medan Tanjung Balai Tanjung Balai Tanjung Balai Medan Medan Medan Siantar Medan Tebing Tinggi Belawan Belawan Belawan Binjai Binjai Binjai Binjai Binjai Medan Medan Medan Medan Medan Medan Medan Medan

Berangkat Datang

Informasi Pemesanan -Stasiun KA Medan (061) 4514114, -Stasiun KA R. Prapat (0624) 21617.

08.00 10.30 15.00 22.50 08.00 14.45 17.10 23.00 04.50 20.15 09.20 21.40 06.50 12.50 17.10 07.15 11.55 19.25 11.25 07.00 18.00 07.30 16.50 12.00 07.30 05.00 09.50 12.15 14.40 06.20 08.40 17.50 08.55 06.30 11.00 13.30 15.50

13.21 15.25 20.28 03.52 13.22 19.59 22.01 04.24 05.42 21.07 10.12 22.32 11.17 17.27 22.15 11.54 16.28 22.47 14.50 10.45 20.04 08.17 17.37 12.47 08.22 05.52 10.42 13.07 15.32 07.21 09.27 18.27 09.47 07.22 11.52 14.22 16.42

PETUGAS Sat Lantas Polresta Medan menggembok roda mobil yang pengendaranya memarkirkan kendaraannya hingga dua lapis di Jln. Imam Bonjol Medan, Kamis (14/6).

Jaksa Tahan Mantan Sekretaris Dan Bendahara Panwaslu MEDAN (Waspada): Mantan Sekretaris dan Bendahara Panwaslukada Kota Medan 2010, Sabaruddin dan Iskandar ditahan Kejaksaan Negeri (Kejari) Medan, dalam dugaan korupsi senilai Rp6 miliar. “Setelah dilakukan pemeriksaan secara rutin dan bahkan telah ditetapkan tersangka terhadap mantan sekretaris dan bendahara Panwaslukada Kota Medan 2010, Sabaruddin dan Iskandar dilakukan penahanan di Lembaga Pemasyarakatan (LP) Tanjung Gusta, Medan,” ujar Kepala Seksi Pidana Khusus (Kasi Pidsus) Robinson Sitorus, di Kejari Medan, Kamis (14/6). Kata Robinson, dari hasil penyidikan yang telah dilakukan oleh tim Pidsus Kejari Medan akhir 2011 hingga saat ini ditemukan beberapa pengeluaran yang tidak jelas pertanggungja-

waban. Mulai dari indikasi penggelembungan (mark-up) hingga dugaan kegiatan fiktif. “Penghitungan kerugian berdasarkan audit Badan Pemeriksa Keuangan dan Pembangunan (BPKP) Sumut saat ini kerugian negara diperkirakan sekitar Rp200 juta,” ujarnya. Data yang diperoleh melalui sewa kendaraan yang dikeluarkan itu berkisar Rp6 juta per bulan, setelah dilakukan pengecekan, faktanya tidak sesuai. Selain kendaraan itu, juga adanya pengeluaran untuk perawatan kendaraan sebesar Rp164 juta yang tidak jelas pertanggungjawabannya. Selain itu, diduga ada kegiatan fiktif dan penggelembungan harga. Di antaranya mengenai sewa gedung untuk kantor Rp80 juta, pengadaan alat kantor, beberapa laporan kegiatan dan pembayaran perjalanan dinas Sedangkan mengenai pemanggilan mantan Ketua Pan-

waslukada Kota Medan M Aswin, terkait kasus ini, Robinson mengatakan, telah memanggil Aswin beberapa hari yang lalu, namun Kejari Medan belum mau terburu-buru bakal menetapkan mantan Ketua Panwas ini menjadi tersangka tetapi dia menegaskan tidak tertutup kemungkinan bakal menjadi tersangka. “Pemanggilan hanya sebatas meminta keterangan, sedangkan statusnya masih saksi. Namun apabila ditemukan bukti yang cukup, bisa saja M Aswin bakal kita jadikan tersangka juga. Itu tergantung pengumpulan bukti-bukti yang cukup,” sebutnya. Sebelumnya kedua tersangka Sabaruddin dan Iskandar yang datang mulai pukul 09:00 pagi tersebut terus menjalani pemeriksaan di Kejari Medan hingga pukul 14.00, dan dilakukan penahanan sekitar pukul 14.35. (m38)

Istri Adukan Suami Bawa Kabur Mobil, 400 Handphone MEDAN (Waspada): Eli, 28, warga Jln. Pasar VIII, Desa Tembung, Kec. Percut Seituan, mengadukan suaminya ke Polresta Medan, Rabu (13/6), karena membawa kabur mobil dan 400 unit handphone bersama wanita selingkuhannya. Ali, 50, ayah kandung Eli, yang menemani anaknya itu ke Polresta Medan menyebutkan, hubungan rumah tangga anaknya itu sudah 5 bulan terakhir ini sudah tidak harmonis, sejak terdengar kabar menantunya berinisial Po, 32, diduga sudah memiliki wanita idaman.

Korban Eli memergoki suaminya bersama wanita lain di dalam mobil kepunyaan mereka di SPBU Tembung, Minggu (10/6). Ketika itu, dia mengendarai sepedamotor melihat suaminya baru saja keluar dari SPBU langsung mengejarnya. Karena mobil yang dikendarai suaminya melaju kencang, Eli tak bisa menyusulnya. Kemudian Eli pergi ke toko ponsel mereka di Jalan Pasar VII Simpang Jodoh,Tembung. Di dalam toko ponsel itu, Eli tidak menemukan lagi 400 unit HP dagang-

an mereka. “Eli sangat terpukul atas peristiwa itu, apalagi mobil Honda Jazz dan 400 unit HP senilai hampir Rp80 juta telah dibawa kabur oleh suami yang telah memberinya dua anak itu. Sebelum melarikan diri, suaminya sempat berpesan via SMS kepada Eli agar tidak melaporkan peristiwa itu kepada pihak kepolisian,” kata Ali. Namun, lanjut Ali, pihak keluarga sudah kesal melihat tingkah Po, sehingga melaporkan kasus tersebut ke Polresta Medan. (h04)

22 Rumah Terbakar Tidak Dapat Bantuan Bedah Rumah MEDAN (Waspada): Sebanyak 22 unit rumah semi permanen milik warga yang musnah terbakar di Dusun II Pondok Seng, DesaTuntungan I, Pancur-

batu, tidak mendapat bantuan bedah rumah karena telah mendapat bantuan dana dari Bupati. Demikian dikatakan Camat Pancurbatu Suriyadi Aritonang

PA Eksekusi Rumah MEDAN (Waspada): Pengadilan Agama Kelas 1 A Medan melakukan eksekusi rumah di Jalan Gatot Subroto Km 6,5 No 173 Medan, Kel. Sei Sikambing B, Medan Sunggal, Rabu (13/6). Rumah tersebut ditempati oleh Dr Surya Wirawan Lubis Bin Japar Lubis, 59, selaku termohon eksekusi I, dan Rizky Perdana Lubis Bin Dr Surya Wirawan Lubis, 22, selaku termohon eksekusi II. Pelaksanaan eksekusi berjalan lancar dan tanpa perlawanan dari pihak termohon eksekusi . Meski begitu, pihak kepolisian dan aparat kelurahan berjaga-jaga mengawasi jalannya eksekusi yang berlangsunglebihkurangtigajam. Panitera Pengadilan Agama Kelas 1 A Medan Hilman Lubis SH menyebutkan, eksekusi dilakukan setelah melalui prosedur dan tata cara pengadilan yang sah. “Prosesnya sudah berjalan hampir satu tahun agar penghuni rumah ini mengosongkan lahan tersebut, namun baru

sekarang terlaksana pengosongannya,” katanya. Sebelumnya juru sita Pengadilan Agama Fuadi Can Nasution SH membacakan putusan pelaksanaan eksekusi atas sebidang tanah pertapakan beserta satu rumah tinggal permanen di Jln. Gatot Subroto Km 6,5 No 173, Kel. Sei Sikambing, Medan Sunggal, sesuai dengan sertifikat hak milik nomor 125 atas nama Anneke Djuraidah Hanum, agar dikosongkan dan diserahkan kepada pemohon eksekusi pengosongan atas nama Agus Leowardy, 58, penduduk Jalan Irian Barat Medan. Eksekusi itu berdasarkan surat keterangan pemenang lelang tanggal 27 Maret 2012 yang dikeluarkan Kantor Pelayanan Kekayaan Negara dan Lelang Medan yang menerangkan bahwa pemohon (Agus Leowardy) adalah pemenang lelang sesuai dengan risalah lelang nomor 203/2012 tanggal 27 Maret 2012. (m37)

yang dikonfirmasi wartawan, Selasa (12/6), sehubungan harapan warga agar rumah mereka yang musnah terbakar dibantu perbaikannya dalam program bedah rumah. “Kalau untuk 22 rumah warga Dusun II Pondok Seng yang musnah terbakar itu tidak masuk program bedah rumah Pemkab Deliserdang karena tidak termasuk dalam kriteria, “ ujarnya. Namun, kata dia, untuk mengurangi penderitaan masyarakat, Bupati Deliserdang telah memberikan bantuan dana untuk 22 kepala keluarga pemilik rumah korban kebakaran tersebut. Pantauan wartawan di lapangan, sebagian korban kebakaran sedang berupaya membangun rumahnya masingmasing dengan kemampuan seadanya. Sedangkan sebagian dari korban masih mengungsi di rumah para kerabatnya. Mereka sangat berharap mendapat bantuan bahan bangunan untuk mendirikan rumahnya kembali. Pjs Kapolsek Pancurbatu AKP S Siagian kepada wartawan mengatakan, pihaknya bersama keluarga besar Polsek Pancurbatu akan memberikan bantuan kepada para korban kebakaran.(m40)

MEDAN (Waspada): Di dunia ini ada 40 ribu jenis spesies tanaman herbal dan di antaranya sekitar 30 ribu berasal dari Indonesia. Sebanyak 9.600 berkhasiat untuk dijadikan obat dan 400 lagi dimanfaatkan sebagai obat tradisional. Namun, hanya tujuh produk yang sudah masuk ke dalam phito farmaka. “Harusnya Indonesia bisa mengeksplorasi obat-obatan herbal di negeri ini. Kita harus jadi tuan rumah di negeri sendiri,” kata Ketua Perhimpunan Dokter Herbal Medik Indonesia (PDHMI) Sumatera Utara Prof dr Amri Amir SpF (K) DFM SH SpAK di RSUD dr Pirngadi Medan, Senin (11/6). Menurut dia, Indonesia saat ini kalah dengan China dan Korea dalam penggunaan obat herbal. Padahal, kedua negara itu hanya memiliki sedikit tanaman obat. Akan tetapi, dua negara itu sudah bisa melayani kesehatan masyarakat dengan menggunakan obat herbal. “Kita memiliki 80 persen tanaman obat, tapi masih jalan di tempat. Kita berharap, ke depan obat herbal Indonesia mendunia seperti sistem pengobatan herbal China,” sebut Amri

didampingi Ketua Panitia Seminar Nasional Penerapan Complementary Alternative Medicine (CAM) Herbal Medik dan Akupunktur dalam Pelayanan Kesehatan dr Saiful Bahri SpM, Rosnizar Arifin SpAK, Drs Awaluddin Saragih MSi, Apt, dan dr Daniel Irawan SpKK. Dengan perkembangannya, lanjut Prof Amir, ke depan dokter di rumah sakit maupun di Puskesmas sudah bisa meresepkan obat herbal untuk pengobatan pasien. “Kita sudah mengembangkan teknik akupunktur di RS Pirngadi. Sekarang, pelayanan tersebut sudah ditanggung dalam Askes. Awalnya, pasien hanya satu per hari. Sekarang, tiap hari sudah 20 pasien. Bahkan, RS Pirngadi salah satu rumah sakit terkenal dengan metode akupuntur,” sebuta. Ketua Panitia dr Saiful Bahri SpM menambahkan, seminar kali ini dilaksanakan di RS Pirngadi Medan pada Sabtu (16/6) nanti. “Pesertanya terbatas. Maksimal 300 orang,” tuturnya. Adapun pembicaranya yakni, Dirjen Kemenkes Dr Abidinsyah Siregar DHSM MKes, Prof dr Amri Amir SpF (K) DFM SH SpAK, Dr Aldrin Nelwan Pancaputra SpAK M Biomed (Onk) MKes MARS, dan beberapa narasumber lainnya. (h02)

Penertiban PKL Harus Dengan Solusi Manusiawi MEDAN (Waspada): Penertiban pedagang kaki lima (PKL) harus dilakukan dengan solusi yang manusiawi dan diawali dengan duduk bersama semua pihak. Hal itu disampaikanVikaris Jenderal Keuskupan Agung Medan Pastor Elias Sembiring OFM Cap dalam Rapat Koordinasi Membicarakan Penertiban PKL di Jalan Selamat Riyadi Medan, di Paddock Restorant Jalan Dr Mansyur, Kamis (14/6).“Untuk mendapatkan solusi yang manusiawi itu, maka diperlukan komunikasi yang intens dan duduk bersama dengan semua pihak,” katanya. Rapat koordinasi yang dipimpin Kepala Satpol PP Kota Medan Drs Kriswan dihadiri Kasi Pemeliharaan Jalan Dinas Binamarga A Buchari, Kasi Pembinaan Perumahan Tondi Nasha Nasution, Kabid Pengawasan Dinas Pertamanan Zulkarnain Lubis, Habib F Lubis SSos, Kasi Pengendalian Dishub G Tampubolon, Camat Medan Maimon Said Reza SSTP, Danramil 05/MB, Danpom AU, Wadan Satlak Hartib Denpom 1/5, Kapolsek Medan Kota, Lurah Jati, Kasubsi Dal Ops Brimobdasu, Direktur RS Santa Elisabeth Medan Dr Bungaran Sihombing, Ketua Yayasan RS Santa Elisabeth Medan Sr Petra FSE, Sr Wilfrida br Simbolon

FSE, dr Maria Cristina, Antonius Tumanggor. Krisnawan menyampaikan rencana penertiban itu atas instruksi Wali Kota Medan yang mengutamakan penataan rumah sakit di Kota Medan, terutama rumah sakit yang memiliki nilai historis. Pemikiran itu muncul karena dalam penilaian Adipura yang memiliki nilai tertinggi adalah penataan rumah sakit. Sementara pada kenyataaanya bahwa RS Elishabet Medan adalah salah satu rumah sakit yang memiliki nilai historis yang perlu ditata dan dilestarikan. Untuk bisa menjadikan rumah sakit bersejarah maka harus memiliki kriteria khusus, di antarannya memiliki nilai estetika, bebas dari pedagang kaki lima, drainase yang baik, dan tertib lalulintas. Sementara itu, Dr Bungaran Sihombing mengatakan, permasalahan yang dihadapi selama ini adalah sulitnya akses masuk ke rumah sakit, disebabkan kemacatan arus lalulintas dan terganggunya kenyamanan pasien karena aktivitas hiburan malam yang berlangsung hingga pagi hari. Dalam rapat itu, semua pihak yang hadir mendukung rencana penertiban, namun setelah dilakukan terlebih dahulu pendekatan persuasif dan memberi solusi yang baik bagi semua pihak. (m36)

Calon Wisudawan UMA Dilatih Masuki Dunia Kerja MEDAN (Waspada): Sekitar 150 orang calon wisudawan Universitas Medan Area (UMA) mendapat pembekalan lewat Pelatihan Persiapan Memasuki Dunia Kerja, di Aula FISIP UMA Jln. Kolam Medan Estate, Rabu (6/6). Wakil Rektor III UMA Ir Zulheri Noer MP mengatakan, pembekalan semacam ini sangat diperlukan para calon sarjana yang akan meninggalkan kampus dan menghadapi dunia nyata, dimana kompetensi persaingan merebut lowongan pekerjaan cukup bervariasi. “Jadi, kita tidak membiarkan lulusan UMA lepas begitu saja tanpa mendapat pembekalan menghadapi dunia kerja. Ilmu pengetahuan yang mereka peroleh selama di bangku perkualiahan tentu tidak cukup untuk membuat mereka siap menghadapi berbagai ujian, tantangan dan berbagai prasyarat sebelum memasuki dunia kerja,” ujar Zulheri, usai membuka acara tersebut. Sementara itu, Kepala Biro Administrasi Kemahasiswaan & Registrasi UMA Drs Mulia Siregar Mpsi, melalui Sekretarisnya Sri Irawati S.Sos selaku pelaksana kegiatan itu mengata-

kan, upaya universitas dalam menciptakan lulusan berkualitas, handal dan profesional, terus saja dilakukan. Belum lama ini, pihaknya juga telah melakukan berbagai aktifitas seperti Pelatihan Kepribadian. Semuanya ini bertujuan untuk memberikan wawasan keilmuan, pengalaman hidup dan kematangan sikap para lulusan UMA. Dalam pelatihan yang mengambil tema “Mempersiapkan SDM di Dunia Kerja dan Tips-Trik MenghadapiWawancara dan Psikotes” berlangsung sehari penuh ini, diharapkan calon wisudawan UMA dari berbagai fakul-tas mendapatkan pengalaman menghadapi berbagai tantangan, ujian dan tatacara membuat lamaran pekerjaan, mengikuti psikotest dan ujian-ujian lainnya,” ujar Sri Irawati didampingi Humas UMA Ir Asmah Indrawati MP. Sri Irawati menjelaskan, pemateri kegiatan itu seluruhnya merupakan alumni UMA yang telah memiliki karir baik, antara lain Marwan Hasibuan S.Psi, Drs Bahrum Jamil MAP, Adi Satrya ST dan Laili Alfita S.Psi, MM. Mereka memberikan materi atara lain cara membuat lamaran kerja, menghadapi wawancara dan psikotes. (m49)


TEPUNGTAWAR: Al Ustad KH Amiruddin MS menepung tawari Ny AyuYuyu Setiana (istri Pangkosek 04) disaksikan Hj Fatimah Habibi Syamsul, dalam acara tepung tawar yang digelar pengajian Sejuta Ummat, di Jalan Bahmandaris, Medan Baru, Kamis (14/6). Acara tepung tawar tersebut dilaksanakan pengajian Sejuta Ummat sebagai ungkapan selamat datang di Medan. Menurut KH Amiruddin, tepung tawar adalah mengikuti adat bukan ritual agama.

WASPADA Sabtu 16 Juni 2012



Irmadi Lubis: SBY Perlihatkan Kelemahannya Berantas Korupsi JAKARTA (Waspada): Politisi Partai Demokrasi Indonesia Perjuangan (PDIP) H Irmadi Lubis menilai pidato Ketua Dewan Pembina Partai Demokrat Susilo Bambang Yudhoyono (SBY) tentang partai lain lebih korup dibanding Partai Demokrat, bukan hanya berpotensi memicu ketegangan dengan partai anggota koalisi, tetapi tanpa disadari, SBY justru memperlihatkan kelemahannya dalam memberantas korupsi. Pemberantasan korupsi yang diusung SBY sejak disumpah menjadi presiden, ternyata hanya untuk pencitraan. “ Pidato soal korupsi itu menunjukkan kelemahan dan ketidakberdayaan SBY selama ini dalam memberantas korupsi, ujar Irmadi Lubis, (foto) menjawab Waspada di Jakata, Jumat (15/6). Menurutnya, jika SBY memang berada di baris terdepan dalam memberantas korupsi, seharusnya SBY tidak hanya berpidato. Sebagai Ketua Dewan Pembina Partai Demokrat, sejatinya SBY tidak perlu meminta para kadernya mengundurkan diri sendiri, tetapi harus tegas untuk memberhentikan para kader Partai Demokrat yang terjerat proses hukum tindak pidana korupsi . “ Sudah tahu ada kadernya yang terindikasi melakukan korupsi, kok hanya diminta mundur sendiri ? Kalau begini bagaimana mau memberantas korupsi? Seharusnya di partai yang didirikan sendiri harus tegas, dengan memecat para kadernya yang teridikasi korupsi “ ujar Irmadi. Bagi PDI Perjuangan sendiri, tambah Irmadi, pernyataan SBY soal patai lain lebih korup, tidak begitu terganggu. Pasalnya, PDI Perjuangan sebagai parpol oposisi tidak mempunyai ruang bagi kadernya untuk melakukan korupsi . “ Yang punya kesempatan dan peluang melakukan itu adalah Parpol yang berada di lingkaran kekuasaan. Parpol yang berada di luar kekuasaan akan sulit mendapat peluang melakukan korupsi, “ tutur Irmadi Lubis. Sebagaimana diketahui, Forum Komunikasi Pendiri dan Deklarator (FKPD) Partai Demokrat, yang berlangsung, Rabu (13/ 6) malam, SBY menegaskan, tidak hanya kader Partai Demokrat yang korupsi. Para kader di parpol lain juga turut terlibat kasus korupsi. Bahkan, korupsi yang dilakukan politisi parpol lainnya lebih parah. Disebutkan berdasarkan data yang dimilik, di jajaran DPRD tingkat provinsi selama 2004-2012, korupsi yang dilakukan oknum Partai Demokrat mencapai 3,9 persen. Di atas Partai Demokrat, ada 4 partai dengan persentasenya 34,6 persen, 24,6 persen, 9,2 persen, dan 5,32 persen. Korupsi di jajaran DPRD tingkat kabupaten/kota, oknum Partai Demokrat yang terlibat adalah 11,5 persen. Di atas Partai Demokrat, ada dua parpol lainnya, masing-masing 27 persen dan 14,4 persen. Di tingkat menteri, anggota DPR, gubernur, hingga bupati/wali kota, kader Partai Demokrat yang terlibat 8,6 persen. Di atas Partai Demokrat, ada dua parpol, masingmasing 33,7 persen dan 16,6 persen. (aya)

Tjahjo: Tata Kelola Pemerintahan Tidak Terkendali Dengan Baik JAKARTA (Waspada): Partai Demokrasi Indonesia Perjuangan (PDI-P) menilai arah tata kelola pemerintah tidak terkendali dengan baik, akibat banyaknya gugatan elemen bangsa terkait UU dan peraturan pemerintah ke Mahkamah Konstitusi (MK) yang putusannya mengalahkan pemerintah. “Bayangkan sebuah negara yang besar membuat Keppres (wakil menteri) digugat dan dibatalkan MK. Kalau Rukun Tangga ( RT) digugat warga dan dibatalkan wajar. Kalau negara mengeluarkan Keppres tapi dibatalkan, ini sangat memalukan. Ini menunjukkan carut marut dalam mengelolanya dan kita malu sebagai warganegara melihat ini,” ujar Sekjen DPP PDI Perjuangan Tjahjo Kumolo saat membuka Diklat Bidang Kaderisasi PDI Perjuangan, di Lenteng Agung, Jakarta, Jumat (15/6) Tjahjo mengkritik kebutuhan menteri didampingi wakil menteri serta kinerja kementerian. Kementerian yang tidak jalan, menurutnya, harusnya menterinya diganti. Dia juga menyayangkan, dalam praktik kehidupan berbangsa saat ini , pengamalan sila-sila Pancasila mengendur, serta kebebasan beragama yang sudah terancam. Menyangkut persiapan PDI P memajukan calon legislator (caleg) , PDIP mengwajibkan calegnya mengikuti dan lulus psikotes, serta ikut pendidikan dan pelatihan (diklat) kader. Untuk itu, jelasnya, awal Juli ini para caleg mulai mengikut psikotes. Sementara bagi caleg yang belum ikut diklat kader, harus mengikutinya sebelum pelaksanaan pemilu legislatif. Ketua DPP Bidang Kaderisasi Idham Samawi menambahkan sesuai amanah Kongres III di Bali, PDIP adalah partai ideologis sehingga pendidikan kader sangat penting dilakukan. “Pemenangan pemilu dan pemilu pilpres pada masa mendatang dimulai dengan pendidikan kader yang serius,” tandas Idham. (aya)

Sinyal Itu Untuk Angie JAKARTA (Waspada): Wakil Ketua Dewan Pembina Partai Demokrat Marzuki Alie menilai, pernyataan Ketua Dewan Pembina Partai Demokrat Susilo Bambang Yudhoyono (SBY) dalam pertemuan dengan Forum Komunikasi Pendiri dan Deklarator Demokrat, soal kader yang sebaiknya mundur bila jadi tersangka, ditujukan kepada Angelina ‘Angie’ Sondakh. “Saya kira tidak ada sinyal-sinyal, Partai Demokrat itu partai yang mengusung karakter yang bersih, cerdas, dan santun. Jadi kalau tidak mengikuti itu ya sudah keluar saja. Itu kan normatif dan tidak ada sesuatu yang aneh. Kalau sudah tersangkut ya berhenti saja lah, tidak usah minta diberhentikan,” kata Marzuki di gedung DPR, Jakarta, Kamis (14/6). Menurut Marzuki, SBY hanya menekankan bahwa yang yang terlibat kasus korupsi berarti tidak siap bekerja dengan bersih dan tidak siap membangun karakter yang santun Marzuki Alie mengajak seluruh elemen partai untuk tetap setia mendukung Anas Urbaningrum sebagai Ketua Umum Partai Demokrat yang terpilih melalui mekanisme sah di Kongres. Seruan itu disampaikan Marzuki di tengah gonjang-ganjing isu bahwa SBY, sebagai Ketua Majelis Tinggi dan Ketua Dewan Pembina Partai Demokrat dianggap sedang berusaha mendongkel Anas dari kursi ketua umum. Marzuki menyatakan tak ada kubukubuan di Partai Demokrat. Kalau kubu-kubuan benar ada, kata dia, seharusnya Partai Demokrat sudah pecah sejak dahulu. (aya)

Kepemimpinan Hatta Diakui Internasional JAKARTA (Waspada): Politisi Partai Amanat Nasional (PAN) di DPR RI menyatakan, pemimpin Indonesia ke depan sangat penting untuk diakui oleh dunia Internasional. Mendekati Pilpres 2014, Ketua Umum Partai Amanat Nasional (PAN) Hatta Rajasa yang disebut-sebut sebagai salah satu calon presiden (Capres) yang akan mengisi bursa pencapresan tersebut, dinilai layak untuk membawa Indonesia dikenal di luar negeri. Hal ini terkait sejumlah penghargaan yang diraih Hatta Rajasa dari dunia Internasional. “Bang Hatta sudah menerima sejumlah penghargaan dunia. Dia pernah menerima penghargaan dari Amerika Serikat. Yang terbaru, dia menerima penghargaan dari Slovakia. Itu penting untuk pemimpin bangsa yang dinilai mampu oleh dunia, sehingga Indonesia jauh lebih dikenal lagi,” kata anggota Komisi III DPR Taslim Chaniago di gedung DPR Jakarta , Kamis (14/6). Menurut Taslim, apa yang diberikan oleh dunia kepada Hatta adalah sebagai bentuk pengakuan atas prestasi kinerja, dedikasi dan kredibilitas Menko Perekonomian itu. “Dunia sudah mengakui kemampuan Hatta dibidang ekonomi dan politik. Jadi, wajar jika kader PAN secara final mendorong Hatta sebagai capres tunggal karena sangat mumpuni dari semua tokoh lintas partai dan semua capres lainnya,” tegasnya. Sementara Ketua Badan Pemenangan Pemilu (Bapilu) DPP PAN Viva Yoga Mauladi yang menyebutkan, dunia Internasional sudah mengetahui kapasitas, integritas dan kredibilitas Hatta Rajasa dibidang politik dan ekonomi. “Penghargaan-penghargaan yang diberikan negara luar kepada Hatta sebagai bukti jika negara lain mengakui kemampuan Hatta Rajasa,” katanya. Viva menegaskan, pemberian penghargaan dunia internasional kepada Hatta sebagai bukti Hatta layak jadi pemimpin bangsa karena mempunyai pengalaman mengelola pemerintahan, khsususnya bidang ekonomi.(j07)

SPS Pusat Gelar Debat Ekre Di Medan


KEPALA Sub-Direktorat Energi Terbarukan Kosasih Abbas (berkacamata) keluar dari gedung KPK, Jakarta Selatan, Jumat (15/6). Kosasih ditahan KPK dalam kasus korupsi proyek Solar Home System (SHS) di Kementerian Energi Sumber Daya Mineral (ESDM) tahun 2007 dan 2008.

KPK Tahan 2 Tersangka Korupsi JAKARTA (Waspada): Komisi Pemberantasan Korupsi (KPK) melanjutkan tradisi Jumat “keramat” dengan melakukan upaya hukum paksa berupa penahanan terhadap tersangka kasus korupsi. Jumat (15/6) KPK menahan Pejabat Pembuat Komitmen di Direktorat Jenderal ESDM, Kosasih. “Kami melakukan upaya penahanan tersangka dalam pengadaan Solar Home System

tahun 2007-2008 selama 20 hari ke depan di rutan Cipinang,” kata Juru Bicara KPK, Johan Budi SP di kantornya, Jumat (15/6). Kosasih selaku PPK diduga telah melakukan korupsi secara bersama-sama dengan Jacobus Purwono, Dirjen Listrik dan Pemanfaatan Energi Listrik dalam pengadaan Solar Home System tahun 2007-2008 di Kementerian ESDM itu. KPK menjerat Kosasih de-

ngan Pasal 2 ayat 1 atau pasal 3 dan atau pasal 5 dan atau pasal 11 Undang-undang Pemberantasan Tindak Pidana Korupsi. Atas perbuatannya, negara mengalami kerugian sebesar Rp144 miliar. Selain Kosasih, KPK juga melakukan penahanan terhadap Direktur Pemberdayaan Keuangan PT Barata Indonesia, Mahyudin Harahap. Mahyudin diduga melakukan ko-

rupsi atas pembelian tanah di Jalan Raya Ngagel 109, Wonokromo, Surabaya. Mahyudin dijerat pasal 2 ayat 1 atau pasal 3 UU pemberantasan tindak pidana korupsi. Atas pernbuatannya negara mengalami kerugian sebesar Rp21 miliar. “Untuk kepentingan penyidikan KPK melakukan penahanan terhadap MH di Rutan Cipinang selama 20 hari ke depan,” ucap Johan. (vvn)

KPP DPR: Tarik Penjabat Gubernur Dan Kapolda Dari Papua JAKARTA (Waspada): Kaukus Parlemen Papua (KPP) yang terdiri dari anggota DPR dan DPD RI dari Papua dan Papua Barat menyesalkan terjadinya penembakan terhadap Ketua I Komite Nasional Papua Barat (KNPB) Mako Tabuni, yang katanya tewas ditembak karena melakukan perlawanan saat akan ditangkap. Namun, KPP belum meyakini kalau tertembaknya Mako Tabuni tersebut akibat melakukan perlawanan, karena mereka itu mahasiswa yang tidak memiliki senjata. Demikian diungkapkan dua anggota Kaukus Papua Parlemen (KPP) dari FPD DPR Diaz Gwijangge dan FPG DPR Paskalis Kossay pada wartawan di Gedung DPR RI Jakarta, Jumat (15/6). “Seharusnya penemba-

kan dan kekerasan lainnya dihindari karena tak akan menyelesaikan masalah. Harus mengedepankan pendekatan dialog, pendekatan hati dan hati-hati. Bukan malah dengan melanggar hak asasi manusia. Apalagi, penanganan terhadap korban itu tidak manusiawi,” kata Diaz. Paskalis mengatakan, yang kami persoalankan penanganan masalah Papua sangat tidak profesional dan tidak manusiawi. “Harapan kami Papua dibangun dengan profesional, berkali-kali kami sampaikan, tetapi pemerintah tidak pernah serius. “Kami ingin Pemerintah segera menarik Kapolda Papua, karena tidak mampu menangani Papua, karena itu harus copot atau ditarik,”ujarnya.

Sedangkan penjabat Gubernur Papua yang sekarang seharusnya tugasnya hanya 6 bulan untuk mencari gubernur yang definitif. Karena itu, tambahnya, penjabat Gubernur Papua segera ditarik. Apalagi sesuai UU Otsus Papua gubernur dan wakilnya orang asli Papua. Oleh karena itu segera ditarik. Selain itu Paskalis dan Diaz meminta agar Presiden Susilo Bambang Yudhoyono (SBY) tidak menganggap kasus Papua itu kecil dibanding dengan di TimurTengah.“Ini penembakan sudah terjadi sejak dulu dan pasca reformasi muncul otonomi khusus (Otsus) dengan anggaran triliunan rupiah ternyata tidak berpengaruh, tidak berdampak terhadap kesejahteraan rakyat Papua. Sebaliknya,

rakyat makin menderita, trauma dan tidak nyaman dengan banyaknya penembakan akhirakhir ini berbarengan dengan makin banyak pengiriman TNI/ Polri ke Papua,” tutur Paskalis. Yang pasti, lanjut Diaz, penembakan di depan orang banyak itu merupakan teror yang bisa menjadikan trauma bagi anak-anak karena yang ditembak tersebut masih anakanak. Rakyat Papua katanya, hanya ingin dialog dan bukannya ditembak. Hanya saja pemerintah ketakutan dengan dialog tersebut, yang selalu diidentikkan dengan ‘merdeka’ dari NKRI. “Permintaan Papua merdeka ketika dialog itu bukan berarti Papua harus merdeka, melainkan mencari solusi yang terbaik bagi rakyat,” ujar Diaz. (j07)

DPR: Jumlah Ormas Sudah Mengerikan Kemendagri: Ada Ormas Proposal JAKARTA (Waspada): Pansus RUU Ormas DPR RI menilai jumlah Ormas di Indonesia sudah mengerikan, sehingga perlu regulasi yang mengatur keberadaannya. Provinsi Aceh disebut salah satu wilayah menjamurnya Ormas atau LSM asing. Kemendagri mengungkapkan, sudah sudah 65.577 Ormas yang terdaftar. “Faktanya bisa 10 kali lipat dari jumlah itu belum termasuk LSM asing,” ujar Kasubdit Kesbangpol Kemendagri, Bahtiar M.Si dalam dialektika berjudul Tarik Ulur RUU Ormas di DPR RI, Jakarta, Kamis (14/6). Sementara itu Ormas terbesar Nahdlatul Ulama (NU) melalui PB NU, Slamet Effendi Yusuf menyatakan tak terlalu bimbang dengan Undang-Undang Organisasi Kemasyarakatan (UU Ormas) yang akan disahkan oleh DPR RI Juli mendatang. Ketua Pansus RUU Ormas DPR RI, Malik Haramain mengatakan, hasil uji publik terhadap RUU Ormas, prinsipnya UU Ormas bukan dalam konteks mengendalikan, tetapi melindungi sesuai UUD. “Jumlah Ormas yang ada sudah mengerikan, jumlahnya jauh lebih besar ormasnya dari anggotanya,” ungkap Malik Haramain dalam

acara menghadirkan juga pembicara dari Kementerian Luar Negeri, Dindin Wahyudin yang menyatakan jumlah LSM asing terdaftar di Kemenlu baru 109. Tetapi yang mendaftar lebih banyak, ujarnya. Malik Haramain menegaskan, UU No 8 tahun 1985 tentang Keormasan yang ada sekarang ini sudah tidak sesuai lagi. “Jadi RUU Ormas tidak sekedar revisi, tetapi mengganti,”tukas Malik. Menurut dia, UU Ormas yang baru nanti diseting supaya keberadaan Ormas produktif, sebagai aspirasi masyarakat untuk bisa berkarya dalam pembangunan. “Karena itu RUU Ormas membahas di antaranya, definisi ormas, status hukum ormas dan akan disahkan Juli 2012 atau masa sidang ini,” tegas Malik. Sekalipun diluar terjadi pro dan kontra masalah RUU Ormas itu, Malik menyebut hanya dua hal yang menjadi perdebatan yakni masalah asas Ormas, berasas Pancasila atau Ormas berasas tidak bertentangan dengan Pancasila. Begitu juga dengan Ormas asing atau LSM asing dalam UU No 8 Tahun 85, aturannya tidak lengkap. Sedangkan dalam UU Ormas nanti akan diatur LSM

Asing harus terdaftar, dan ada sanksi bagi ormas asing. “Menurut saya, LSM (Ormas) asing harus punya ijin operasional, pendaftaran ijin operasional harus kepada pemerintah. Jangan sampai nanti ada ormas asing beroperasi tidak diketahui oleh pemerintah. Dananya juga harus jelas dari mana dan dibuat untuk apa saja,”ujar Malik. Sementara itu Dindin Wahyudin dari Kemenlu mengatakan, sudah ada 109 ormas asing yang terdaftar, sedangkan yang mendaftar jumlahnya 149. “Jadi ada yang ditolak. Kami temukan ada ormas asing mencari dana di Indonesia. Permasalahan di lapangan ormas asing itu sudah berbadan hukum lokal,”Jadi tak bisa dilakukan tindakan. Ormas asing itu diantaranya beroperasi di Indonesia. Puncaknya menjamur LSM Asing setelah terjadi tsunami di Aceh dengan alasan membantu kemanusiaan,”kata Dindin. “Pemerintah membutuhkan Ormas. Karena itu bagaimana memberdayakan ormas sebagai gerakan untuk membangun masyarakat dengan tujuan sosial, kemanusiaan,” katanya. Menurut penelitian Kemendagri, ada ormas membawa

thema demokrasi, tetapi tata kelola organisasinya tidak demokrasi bahkan ada ketuanya seumur hidup. Ada banyak ormas asing beroperasi di kabupaten, tetapi tidak diketahui oleh bupati, maupun gubernur. “Bahkan ada 497 ormas beroperasi melakukan aktivitas seperti penyidik. Ormas tidak boleh melakukan aktivitas seperti Kejaksaan dan Kepolisian. Ada lagi Ormas proposal yang dapat dilihat dari nomor suratnya No 001, mengajukan proposal, kemudian No 002 juga mengajukan proposal anggaran kegiatan, “tegas Bahtiar. Bagi NU, kata Slamet Effedi Yusuf, NU tak terlalu bimbang. Ada pro dan kontra terhadap RUU itu. “NU berpendapat apabila dijadikan untuk menjadi kemaslahatan bangsa dan umat diperlukan sebuah UU. “Tapi UU Ormas harus bisa menjamin prinsip dasar yang dijamin oleh UUD seperti hak menyampaikan pendapat,”ujarnya. Slamet mengingatkan lagi, pembicaraan tentang UU Ormas jangan terburu-buru. Masih banyak pertimbangan yang harus dilakukan. “Kalau hanya melahirkan kehebohan baru , jangan terburu-buru, sementara masih ada UU yang lain yang bisa mengatur.(j07)

JAKARTA (Waspada): Serikat Perusahaan Pers (SPS) Pusat dan SPS Cabang Sumatera Utara bekerjasama dengan Kementerian Perdagangan, Selasa (19/6), menggelar lomba debat tentang ekonomi kreatif bagi pelajar SMA se-Sumatera Utara. Lomba yang bakal diselenggarakan di Aula Martabe, kantor Gubernur Sumatera Utara ini, bertujuan untuk mengenalkan ekonomi kreatif, menumbuhkan jiwa wirausaha, dan mengembangkan minat baca di kalangan pelajar SMA se-Indonesia, khususnya Sumut Dikemas dalam program bertajuk Festival Ekonomi Kreatif Tingkat SMA dan Sederajat se-Indonesia (FEKSI), Medan bakal menjadi kota ketujuh dari 10 kota yang disinggahi event debat ekonomi kreatif ini. Sebelumnya, FEKSI 2012 diselenggarakan di Jakarta (8/5), Bandung (10/5), Yogyakarta (16/5), Surabaya (22/5), Palembang (25/5), Banjarmasin (15/6). Setelah Medan, FEKSI akan hadir di Makassar (22/6), Semarang (26/6) dan Denpasar (29/6). “Kami akan memilih satu tim debat terbaik dari masing-masing kota untuk diundang dalam babak grand final bersama Menteri Perdagangan di Jakarta pada 12 Juli 2012,” ungkap Asmono Wikan, Direktur Eksekutif SPS Pusat yang menjadi penanggungjawab nasional FEKSI 2012. Hingga Kamis (14/6), jumlah peserta yang telah mendaftar untuk mengikuti lomba debat FEKSI 2012 wilayah Sumatera Utara sebanyak 17 tim. “Bagi sekolah-sekolah di Medan dan sekitarnya yang belum mendaftar, kami masih membuka pendaftaran lomba debat FEKSI wilayah Sumatera Utara hingga Sabtu (16/6),” lanjut Asmono. Semua peserta debat akan memperoleh sertifikat dan konsumsi selama acara berlangsung. Khusus bagi pemenang 10 besar akan mendapat bingkisan souvenir dari panitia. Sedangkan tiga besar pemenang akan memperoleh trophy tetap dan uang pembinaan. Disamping mempertandingkan lomba debat, FEKSI 2012 juga menggelar lomba menulis artikel, lomba foto jurnalisme menggunakan kamera handphone, dan lomba mading (khusus Jakarta). “Untuk lomba artikel dan foto jurnalisme, kami buka se-Indonesia, tidak terbatas bagi pelajar SMA dari 10 kota saja,” pungkas Asmono. Bagi pelajar di Medan dan sekitarnya yang ingin mendaftar lomba debat Selasa 19 Juni, bisa menghubungi panitia FEKSI 2012 di nomor 0853 1090 2036 (Riska Fera) dan 0812 1935 2994 (Theresia). (rel)

F-PG Minta Pemilihan KDH Oleh DPRD Dikaji JAKARTA (Waspada): Fraksi Partai Golkar (F-PG) meminta usulan pemerintah terkait pemilihan Gubernur (KDH) oleh DPRD agar dikaji lebih lanjut. “Usulan tersebut perlu dikaji lebih lanjut untuk menghasilkan formulasi terbaik bagi penyelenggaraan pemilihan kepala daerah,”kata juru bicara FPG Azhar Romli menanggapi usulan Pemerintah yang tertuang dalam Rancangan Undang -Undang (RUU) Pemilihan Kepala Daerah, pada rapat kerja dengan Menteri Dalam Negeri di gedung DPR, Jakarta, Rabu (13/6). Sedangkan Fraksi Partai Demokrat (F-PD) mendukung usulan pemerintah agar gubernur dipilih oleh DPRD Provinsi. F-PD menilai praktik pemilihan kepala daerah secara langsung oleh rakyat telah membawa ekses dan efek samping yang besar dan berat bagi negara, daerah, calon kepala daerah dan rakyat. F-PD berpendapat, ekses dan efek samping pemilihan kepala daerah secara langsung yakni adanya konflik sosial baik secara vertikal maupun horizontal yang bisa mengganggu stabilitas nasional, besarnya anggaran penyelenggaraan pemilihan kepala daerah yang harus dipikul APBN, APBD, calon kepala daerah dan rakyat dan banyaknya waktu yang terbuang sia-sia menyiapkan dan menyelenggarakan pilkada khususnya pilkada provinsi. Selain itu biaya politik yang sangat besar yang harus ditanggung kepala daerah terpilih membuat maraknya praktik korupsi, kolusi dan nepotisme sebagai upaya kepala daerah untuk mengembalikan modal politik yang sudah dikeluarkannya. Mendagri Gamawan Fauzi sebelumnya memaparkan sejumlah opsi seputar UU Pilkada. Opsi pertama, gubernur dan bupati dipilih tidak satu paket dengan wakil gubernur dan wakil bupati. Gubernur dan bupati dipilih DPRD. Sementara wakil gubernur dan wakil bupati ditunjuk oleh gubernur atau bupati terpilih, atau dari PNS yang ditunjuk pusat. Berdasarkan pengalaman UU Pilkada (dulu UU Pemerintah Daerah), ada Pilkada yang satu paket yakni kepala daerah dan wakil kepala daerah dipilih bersamaan atau juga tidak sepaket. Pemerintah cenderung mengusulkan pemilihan kepala daerah tidak satu paket.(aya)

Perdossi Gelar Layanan Kesehatan Saraf Gratis Di Medan JAKARTA (Waspada): Untuk mengedukasi masyarakat tentang gangguan saraf, Perhimpunan Dokter Spesialis Saraf Indonesia (Perdossi) bekerja sama dengan perusahaan farmasi membuka Neuropati Service Point (NSP) di sejumlah Rumah Sakit (RS) di tiga kota, yakni Jakarta, Surabaya dan Medan. RS Methodist, menjadi salah satu dari dua RS yang dijadwalkan melakukan pelayanan pada 20 - 29 Juli 2012. Neuropati Service Point merupakan tempat pemeriksaan kondisi saraf secara gratis dengan pelayanan praktis, mudah, cepat dan dekat. ”Pemeriksaan di Neuropati Service Point merupakan penapisan noninvasif. Pasien bisa duduk nyaman, sementara dilakukan pemeriksaan di titik-titik tertentu di telapak kaki pasien untuk mengetahui kecepatan hantar saraf,” kata Ketua Kelompok Studi Neurofisiologi dan Saraf Tepi Perdossi , yang juga dokter ahli saraf dari Departemen Neurologi FKUI/RSCM, Manfaluthy Hakim di Jakarta, Kamis (14/6). Gejala awal terutama dirasakan pada ujung organ gerak, seperti jari tangan dan bagian kaki yang merupakan ”ujung” dari juluran saraf tepi. ”Kesemutan merupakan tanda paling awal neuropati. Kesemutan ini terjadi secara spontan tanpa provokasi,” kata Manfaluthy. Ketua Perdossi Moh Hasan Machfoed mengatakan, neuropati sering tak disadari sebagai penyakit dan dianggap sebagai kondisi umum. Padahal, gangguan saraf itu dapat dicegah. Jika gangguan dibiarkan, dapat terjadi kerusakan saraf lebih berat sehingga mengganggu pergerakan dan mobilitas penderita. Untuk mencegah neuropati, perlu pola hidup sehat guna menghindari diabetes, gangguan jantung dan hipertensi. (dianw)

Ancaman Narkoba Makin Serius NARKOBA merupakan kejahatan transnational crime yang senantiasa melibatkan jaringan sindikat lintas negara, yang meliputi negara produsen Narkoba, negara transit, maupun negara tujuan pemasaran Narkoba. Jaringan sindikat Narkoba ini dikendalikan secara rahasia, melibatkan multi kewarganegaraan, dengan menggunakan berbagai modus operandi. Oleh karena itu dalam penanganannya diperlukan kerjasama internasional yang sinergis, efektif, efisien, dan bertanggung jawab. Ancaman Narkoba dunia saat ini menunjukkan peningkatan serius, dengan semakin berkembangnya simbiose mutualis antara satu kejahatan lintas negara dengan kejahatan lintas negara lainnya, seperti People Smuggling dengan Narkoba, Arms Smuggling dengan Narkoba, dan Terorisme dengan Narkoba atau yang lebih dikenal dengan Narco Terorism. Jika dahulu jaringan sindikat memproduksi dan menjual Narkoba dalam rangka bisnis ilegal demi kepentingan ekonomi semata, kini paradigma itu mulai berubah. Saat ini banyak sindikat yang memperdagangkan Narkoba dengan maksud untuk membiayai kegiatan kejahatan lainnya, termasuk terorisme. Pada pertemuan IDEC XXVII di Rio de Janeiro – Brasil tahun 2010 lalu, secara aklamasi Kepala BNN Gories Mere telah terpilih sebagai Presiden IDEC XXIX, yang menjabat untuk periode 2011 – 2012 dan pada tahun 2012 ini Indonesia bersama Amerika Serikat (co-host) menjadi tuan rumah

konferensi tingkat dunia dalam bidang penanggulangan kejahatan Narkoba atau dikenal dengan istilah International Drugs Enforcement Conference (IDEC), di Nusa Dua – Bali, tanggal 12 hingga 14 Juni 2012. Pelaksanaan IDEC XXIX kali ini mengusung tema “Enhancing The Spirit of International Partnership to Achieve the Greatest Success on Fighting Drug Crime” (Meningkatkan Semangat Kerjasama Internasional untuk Mencapai Kesuksesan dalam Memberantas Kejahatan Narkoba). Konferensi IDEC XXIX dibuka oleh Wakil Presiden RI Dr. Boediono, Selasa (12/6), di Nusa Dua, Bali, dihadiri Kapolri, Menkum & HAM, Presiden IDEC, Kepala US-DEA, Duta Besar Amerika Serikat untuk Indonesia serta Gubernur Provinsi Bali. Kegiatan ini sendiri diikuti oleh 55 negara anggota IDEC (Members) dan 24 negara anggota pengawas (Observers). Pada forum ini para peserta IDEC akan membahas mengenai target operasi dari masing-masing kelompok kerja regional. Selain itu agenda penting lainnya adalah peralihan jabatan Presiden IDEC dari Indonesia kepada Rusia, yang akan dilaksanakan di akhir kegiatan. Dalam sejarahnya, IDEC merupakan sebuah lembaga kerjasama negara-negara tingkat regional yang dibentuk pada tahun 1983 dan sejak saat itu rutin dilaksanakan tiap tahun. Konferensi IDEC sendiri dicetuskan pertama kali oleh negaranegara yang telah mengikuti program pelatihan drugs enforcement yang diadakan oleh US-DEA dan konferensi ini pertama kali dilaksa-

nakan di Panama City – Panama. Tujuan yang ingin dicapai adalah membangun kerjasama dan komitmen regional para pejabat penegak hukum dari seluruh belahan bumi untuk mensukseskan upaya pemberantasan peredaran gelap Narkoba. Awalnya anggota IDEC hanya berasal dari negara-negara di Belahan Barat dan memiliki empat kelompok kerja, yaitu kawasan Andrean, Southern Cone, Amerika Tengah, serta Meksiko dan Karibia. Selanjutnya pada pertemuan IDEC XX disepakati untuk meningkatkan forum ini ke tataran global dengan membentuk dua kelompok kerja tambahan, yaitu kawasan Eropa, Afrika, Timur Tengah dan Timur Jauh. Pada akhirnya hingga saat ini pembagian kelompok kerja IDEC terdiri dari kawasan Eropa & Afrika, kawasan Timur Jauh, kawasan Amerika Selatan, kawasan Amerika Utara dan Tengah, kawasan Karibia, serta kawasan Selatan dan Asia Tengah. “Kita semua tentunya menyadari bahwa jaringan sindikat akan terus mengupayakan berbagai macam cara untuk menyelundupkan Narkoba melalui modus atau peralatan teknologi yang semakin canggih. Oleh karenanya melalui forum ini diharapkan dapat memfasilitasi negara-negara anggota untuk saling meningkatkan kerjasama dan bertukar informasi, dalam hal operasi pemberantasan Narkoba di wilayahnya masing-masing,” cetus Kepala BNN Gories Mere. *Nurkarim Nehe

Luar Negeri Demokrasi Mesir Terancam, MA Batalkan Parlemen A8

KAIRO (AP/BBC): Putusan Mahkamah Agung (MA) Mesir yang membatalkan parlemen hasil pemilihan umum tahun lalu dinilai mengancam demokrasi yang masih rapuh di Mesir. Hal ini disampaikan oleh kelompok Ikhwanul Muslimin (IM).

“Mesirdapatkembalimelalui hari-hari yang berbahaya jika kekuasaan dikembalikan kepada rezim sebelumnya,” sebut IM dalam pernyataannya, yang dikutip BBC, Jumat, (15/6). Bahkan menurut IM, keputusan MA itu akan membawaMesirmenujuhari-hari yangjauhlebihsulitdanberbahaya dibandingkan saat-saat terakhir tergulingnyarezimHusniMubarak. “Semua pencapaian yang diraih melalui revolusi dapat terhapus dan gagal begitu saja dengan penyerahan kekuasaan ke salah satu simbol yang merupakan bagian dari rezim sebelumnya,” tegas IM dalam pernyataan-

nya. Berdasarkan keputusan MA, pemilu pertama parlemen dinilai tidak sah secara konstitusional. MA pun memutuskan agar pemilu ulang segera dilaksanakan. Putusan MA ini pun sekaligus mengembalikan kekuasaan legislatif ke DewanTertinggi Angkatan Bersenjata Mesir SCAF yang selama ini bertugasi mengawasi transisi Mesir usai lengsernya Mubarak pada Februari 2011 lalu. Tidak hanya membatalkan pemilu parlemen Mesir. Namun, MA juga mengizinkan mantan PM Mesir era Mubarak Ahmed Shafiq untuk maju mencalonkan diri dalam Pilpres

Mesir. Menanggapi putusan MA ini kandidat presiden dari IM Mohammed Mursi mengatakan meski dirinya sangat tidak puas dengan putusan MA namun, dirinya menghormati putusan tersebut. “Saya menghormati putusan MA karena Saya menghormati institusi negara dan prinsip pemisahan kekuasaan,” ujar Mursi.Namun,padakesempatan yang berbeda Mursi justru memperingatakan bahwa kelompok minoritas tengah berusaha untuk merebut kembali kekuasaan. Da-

lam pemilu pertama parlemen Mesir pasca lengsernya Mubarak pada 2011 lalu, IM diketahui berhasil keluar sebagai pemenang dengan meraih 46 persen suara. Kandidat Presiden dari IM, Mohammed Mursi, pun dilaporkanakanberhadapandenganAhmedShafiqyangmerupakanmantanPerdanaMenteridieraMubarak dalampemilihanumumpresiden yangakanberlangsungmingguini. IM yang menguasai sebagian besar kursi parlemen, mengatakan keputusan itu akan menjurus ke arah yang lebih berbahaya di-

banding pada masa di bawah kekuasaan rezim Mubarak penindas.PernyataanJumat itumengatakankemajuanyangdibuatsejak digulingkannya Mubarak tahun lalu ‘terhapus dan terbalik.’ Keputusan Mahkamah Agung menyebabkan Mesir kini tanpa parlemen dan konsentrasi kekuasaan bahkan lebih ketat lagi di tangan para jenderal yang mengambil alihnya dari Mubarak. Bahkan menurut IM, keputusan MA itu akan membawa Mesir menuju hari-hari yang jauh lebih sulit dan berbahaya dibanding-

WASPADA Sabtu 16 Juni 2012

Seputar ASEAN

kan pada saat-saat terakhir tergulingnya rezim Husni Mubarak. Berdasarkan keputusan MA, pemilu pertama parlemen dinilai tidak sah secara konstitusional. MA pun memutuskan agar pemilu ulang segera dilaksanakan. PutusanMAinipunsekaligusmengembalikan kekuasaan legislatif ke Dewan Tertinggi Angkatan Bersenjata Mesir SCAF yang selama ini bertugasi mengawasi transisi Mesir usai lengsernya Mubarak pada Februari 2011 lalu. Tidak hanya membatalkan pemilu parlemen Mesir.(m10)

Polisi Tangkap Tersangka Terakhir Pelaku Serangan Gas Tokyo TOKYO, Jepang (CNN): Pihak berwenang menangkap tersangka terakhir dalam serangan gas syaraf yang mematikan di stasiun kereta api bawah tanah Tokyo di tahun 1995 lalu, kata polisi Jumat (15/6). Dia ditangkap di depan toko buku komik di Tokyo setelah staf toko tersebut melaporkan ke polisi tentang keberadaan seorang pria yangmiriptersangka.Pemeriksaansidikjaripositifmenunjukkanbahwa pria tersebut adalah Katsuya Takahashi (54), satu-satunya tersangka serangan gas yang masih buron, kata jubir Polisi MetropolitanTokyo. Takahashi ditahan atas tuduhan pembunuhan dan usaha pembunuhan dalam serangan itu, menurut jubir tersebut. Selama jam sibuk Maret 1995, sejumlah anggota sekte Aum Supreme Truth menyebarkan gas sarin yang menyebabkan tewasnya 13 orang dan menyebabkan lebih 5.500 pengguna kereta jatuh sakit. Ribuan polisi dikerahkan untuk mencari tersangka. Minggu lalu, polisi menangkap seorang anggota lain sekte hari kiamat itu.Lebih 200 anggota sekte dinyatakan bersalah setelah serangan gas tersebut. 13Diantaranya,termasukShokoAsahara,gurusektetersebut,dijatuhi hukumanmati.Begitupun,belumsatupundiantaramerekadieksekusi. Sekte tersebut mengklaim diri sebagai kelompok agama paling lemah lembut, namun pada puncak kegiatannya di tahun 90-an, sekte tersebut mengatakan hari kiamat sudah dekat dan dunia ini harus bersiap menghadapi berbagai macam bencana.(m23)

China Keberatan Dengan Latihan Perang AS, Korsel Dan Jepang BEIJING (Waspada): China mengutarakan keberatannya terhadap latihan tempur bersama yang dilakukan Jepang di dekat Semenanjung Korea. Jepang pun mengundang Korea Selatan (Korsel) dan Amerika Serikat dalam latihan perang itu. “China berpendapat bahwa komunitas internasional, khususnya negara Asia Pasifik harus melakukan tindakan yang kondusif dan damai, guna menjaga keamanan Semenanjung Korea dan Asia Utara, bukan sebaliknya,” ujar juru bicara Kementerian Luar Negeri China, Liu Weimin, seperti dikutip Xinhua, Jumat (15/6). Latihan yang melibatkan tiga angkatan laut dari tiga negara itu akan digelar di Pulau Jeju, Korsel. Pasukan dari AS, Korsel dan Jepang akan dilatih pula untuk melakukan operasi penyelamatan di wilayah maritim. Rabu lalu, Pentagon melaporkan, latihan angka-tan laut itu akandigelarpada21dan22Junimendatang.Jepangsebelumnyasempat berpartisipasi dalam latihan militer AS dan Korsel, namun Jepang hanya menjadi pengamat. Latihan militer yang akan dilakukan akan menjadi latihan pertama yang melibatkan ketiga negara tersebut.


SEORANG etnis Rohingya dari Myanmar yang hidup di Malaysia memegang sebuah spanduk dalam satu rapat umum yang

menyerukan agar dihentikannya pembantaian dan kekerasan terhadap warga Muslim Rohingya di Myanmar. Dia bersama warga Rohingya lainnya melakukan unjukrasa di dekat Kedubes Myanmar di Kuala Lumpur Jumat (15/6).

Myanmar Mulai Bangun Kamp Penampungan Korban Kerusuhan SITTWE (AP/Reuters): Konflik sekte berdarah yang terjadi di Myanmar, menyebabkan ribuan orang kehilangan tempat tinggal. Pemerintah Myanmar bergerak cepat untuk membuat penampungan bagi warga dan sekurang-kurangnya 49 orang tewas akibat kerusuhan itu sejak pekan lalu. “49 Orang terbunuh sejak Jumat 1 Juni pekan lalu, sementara hampir 2.600 rumah terbakar akibatkerusuhanini,”ujarMenteri KeamanandanPerbatasanMyanmar Htein lin, seperti dikutip The News,Jumat(15/6).Jumlahkorban tewas tersebut belum termasuk 10wargaMuslimyangdipukulhinggatewaspada3Junilalu.Kerusuhan inisendirimelibatkanetnisRakhine yangmayoritasberagamaBudha, dengan etnis Rohingnya yang mayoritasnya beragama Islam di negara bagian Rakhine. Hampir 31.900 warga dari kedua belah pihak saat ini tengah ditempatkan pada 37 penampungandiRakhine.Kerusuhaninimenunjukkan potensi konflik yang masih ada di Myanmar. Kepala KejaksaanAgungRakhineHlaThein mengatakan,tidakadayangmenang darikerusuhanini.“Yangdidapatkansaatinihanyapengungsi.Setiap orangmemilikitugasagarkejadian initidakterjadilagi.Tetapiamatsulit untuk membicarakan damai bila keduabelahpihaktidaksalingmempercayai,” tutur Thein. Dua kelompok etnis ini saling tuduh melakukan kekerasan. Beberapa hari terakhir, kondisi di

Rakhine dipenuhi dengan warga yang memegang senjata untuk menjagakeamanan.Diskriminasi yang berlangsung bertahun-tahun terhadap etnis Rohingya, membuat etnis Muslim itu tidak memilikiwilayah.MenurutPerserikatan Bangsa-Bangsa (PBB) sekira 800 ribu etnis Rohingya berdomisili di Myanmar. Hingga kini mereka dianggap sebagai warga asing. Puluhan ribu Muslim Rohingya dan etnis Budha Rakhine yang kehilangan tempat tinggalnya berada dalam kondisi kelaparan, kehausan dan membutuhkan tempat bernaung di baratlaut Myanmar setelah mereka melarikan diri dari bentrokan sekte ter-

buruk di negara itu dalam kurun waktu bertahun-tahun. Tempat-tempat di mana terjadi bentrokan awal minggu ini, termasuk ibukota Sittwe, dalam kondisi tenang seiring kekerasan mereda setelah berhari-hari serangan pembakaran dan pembunuhan yang menjadi tantangan terbesar bagi Presiden Thein Sein sejak berkuasa tahun lalu. “Ketegangan antara kedua kelompok telah mereda. Ada sekitar20.000pengungsidiSittwe. Sebagian besar mereka dari desadesa di mana orang-orang melarikan diri karena ketakutan terhadap kerusuhan yang terjadi,” kata Aung Myat Kyaw, senator Rakhine, kepada Reuters.

China Laporkan Tentang Bakar Diri Di Wilayah Tibet BEIJING (AP):Seorang pria Tibet membakar dirinya sendiri Jumat (15/6) pagi di provinsi Qinghai, baratlaut China, demikian laporan dari kelompok advokasi untuk HAM Tibet. Organisasi menambahkan serangkaian sekitar 36 aksi bakar diri terjadi di kawasan etnis Tibet di China tahun lalu untuk memprotes dari apa yang menurut para aktivis kekuasaan tangan besi Beijing di daerah warga Tibet. Kelompok HAM menyebut jatidiri pria itu sebagai Tamding Thar, yang berusia kira-kira 60 tahun. Kantor berita resmi China XinhuamembenarkanaksibakardiriituterjadiJumatpagidiKecamatan Jianzha di prefektur otonomi Tibet di provinsi Huangnan atau kecamatan Chentsa di prefektur Malho dalam bahasa Tibet. Xinhua mengatakan jatidiri orang itu dan sebab kematiannya masih dalam penyelidikan. Beijing menyalahkan pemimpin spiritual Buddha Dalai Lama yang mendorong aksi bakar diri itu. Dalai Lama membantah tuduhan itu dan mengatakan tindaka itu merupakan akibat tindakan China yang melakukan penindasan di Tibet. (m10)

China Marah Terhadap Pejabat Yang Paksa Wanita Menggugurkan


SANITASI MAKANAN. Para anggota legislatif dari oposisi utama Taiwan, Partai Demokrat Progresif (atas) dan Partai Nasionalis (bawah) yang berkuasa saling memamerkan spanduk mereka dalam sidang lembaga Legislatif Yuan untuk melakukan pemungutan suara dalam amandemen UU Sanitasi Makanan di Taipeh Jumat (15/6). UU itu merupakan kunci bagi izin impor daging dari AS, yang berisi bahan-bahan aditif ractopamine dan membuka kembali perundingan antara kedua negara.

HONGKONG (Antara/Xinhua-OANA): Gempa dengan kekua-tan 6,3 Skala Richter mengguncang Mindanao, Filipina Selatan, Jumat (15/6), kata Hongkong Observatory. Pusat gempa, yang terjadi pukul 09:14 waktu setempat, mulanya ditetapkan pada 5,6 derajat lintang utara dan 126,5 derajat bujur timur, atau sekitar 152 km dari kota Jenderal Santos di Filipina Selatan dengan kedalaman sekitar 69,4 km, demikian laporan Xinhua. Sementara itu USGS menyatakan gempa tersebut berkekuatan 5,5 Skala Richter. Tak ada laporan mengenai korban jiwa atau kerusakan sejauh ini tapi gempa itu terasa di beberapa provinsi Mindanao, dari Ausan del Sur sampai utara dan provinsi Davao di beberapa bagian timur dan selatan pulau tersebut. Filipina berada di wilayah yang disebut Pasifik Ring of Fire, tempat gesekan lempeng benua seringkali mengakibatkan aktivitas gempa dan vulkanis.

Kepala Peninjau PBB Di Syria Peringatkan Peningkatan Rusuh

Pesawat Rusia Hilang Di Pegunungan Ural MOSKOW (Waspada): Kepolisian Rusia menyisir wilayah Pegunungan Ural, Rusia, untuk mencari tahu keberadaan sebuah pesawat yang hilang Senin lalu. Pesawat berjenis Antonov-2 itu mengangkut 12 penumpang, yang semuanya diperkirakan dalam keadaan mabuk setelah berpesta. Harian Sydney Morning Herald, Jumat (15/6) melaporkan, dugaan tersebut diperoleh setelah polisi menemukan botol-botol minumanyangkosongdilapanganterbang.Diduga,parapenumpang memutuskan menyewa pesawat secara spontan usai berlibur merayakan Hari Kenegaraan Rusia. “Pesawat lepas landas tanpa izin dari lapangan terbang Serov pukul 22:00 Senin. Diperkirakan 12 penumpang dan satu pilot berada di dalamnya,” kata juru bicara kepolisian Yekaterinburg. Kementerian Keadaan Darurat mengirim enam pesawat untuk menyisir area Ural seluas 12 ribu kilometer persegi guna mencari jejak-jejakpesawat.Namunhinggasaatini,tanda-tandakeberadaannya belumditemukan.Ponselparapenumpangjugatidakdapatdihubungi. Di antara para penumpang, terdapat Kepala Polisi Kota Serov bersama dua orang wanita yang masing-masing berusia 20an dan 30an tahun. Pesawat biplane bermesin tunggal Antonov-2 diproduksi di Uni Soviet pada 1947. (vn)

Gempa 5,5 Skala Richter Guncang Filipina

CHINA amat marah dan menskors tiga pejabatnya serta minta maaf kepada seorang wanita yang telah dipaksa melakukan pengguguran kandungannya yang telah berusia tujuh bulan. Kasus itu telah menggemparkan China setelah sejumlah foto sang ibu dan janinnya yang mati setelah pengguguran kandungan itu beredar di jaringan online. Langkah tersebut tampaknya bertujuan untuk meredakan kemarahan publik sehubungan dengan kasus yang telah memicu berbagai kritikan baru sehubungan dengan kebijakan satu anak China. Kebijakan yang dimaksudkan untuk mengendalikan ledakan populasi negeri itu, telah menyebabkan selalu terjadi pengguguran paksa dan strelisasi ketika para penguasa menyeimbangkan quota kelahiran seperti yang ditetapkan Beijing. Feng Jianmei, 23, telah dipukuli oleh para pejabat dan dipaksa menggugurkan janinnya bayinya yang berusia tujuh bulan pada 2 Juni lalu karena keluarganya tidak dapat membayar denda 40.000 yuan (sekitar Rp59,3 juta) untuk memiliki anak kedua. Media China ramai memberitakan kejadian itu. Banyak foto Feng yang terbaring di tempat tidur rumah sakit dengan berlumuran darah bayinya. Pengguguran itu dilakukan dengan

menyuntikkan bahan kimia sehingga janin itu mati dan foto tentang itu banyak beredar melalui jaringan online, sehingga mengundang simpati dan kemarahan masyarakat terhadap penguasa China. Belakangan diketahui, pelaku dari aborsi paksa ini adalah petugas badan perencanaan keluarga China. Mereka saat ini dikabarkan dijatuhi hukuman skorsing. Dua di antaranya pejabat tinggi dari badan perencanaan keluarga China. Sementara satu lainnya adalah Kepala Pemerintah Kota setempat. Pemerintah Kota Angkang tempat Feng berdomisili selama ini mengaku bersalah atas kasus itu. Wakil Wali Kota Angkang pun berkunjung ke rumah sakit, tempat Feng dirawat di Provinsi Shaanxi. “Atas nama pemerintah, saya mengucapkan permintaanmaaf.Beberapapejabatterkaitmasalah ini akan diskors untuk menjalani proses penyelidikan,”jelasWakilWali Kota Du Shouping, seperti dikutip The Associated Press, Jumat (15/6). Tetapi banyak warga bersikap skeptis atas proses penyelidikan itu. Mereka yakin bahwa pemerintah tidak akan serius menghukum pelaku perbuatan keji ini. Banyak dari mereka melihat kasus ini akan berakhir tanpa penyelesaian dan terlupakan seperti kasus-kasus sebelumnya.(ap/mujo)

“Mereka sangat membutuhkan makanan dan karena hujan deras, dikhawatirkan kesehatan pengungsi akan memburuk sementara mereka tidak punya tempat naungan,” tambahnya. Angkatan bersenjata membawa ratusan etnis Rohingya ke desadesa Muslim di luar Sittwe guna memastikan keamanan mereka. Sementara itu, Aung San Suu Kyryangberbicarapadakonferensi Organisasi Buruh Internasional (ILO) di Jenewa — persinggahan pertamadalamkunjungankelima negaraEropa—mengungkapkan keprihatinannya pada kerusuhan yangterjadidinegaranyadanmengatakanhukumharusditegakkan untukmencegahkonfliksemacam itu terjadi kembali. Kekurangan pangan bisa berlangsung tiga sampai empat harikarenaburuknyakondisijalan dan infrastruktur menyebabkan tertangguhnya pengiriman pasokan dari organisasi-organisasi bantuan, kata Htun Myit Thein dari Wan Latt Foundation, yang mendirikan tiga kemp yang bisa menampungsekitar12.000orang di Sittwe.(m23/m10)

BEIRUT (AP): Kepala peninjau PBB di Syria mengatakan Jumat (15/6) satu peningkatan kekerasan yang akan menjungkalkan misi pemantauan, yang merupakan satu-satunya bagian yang berfungsi dalam rencana perdamaian internasional untuk menenangkan krisis yang terus meningkat di negeri itu. Mayjend. Robert Mood menyalahkan kedua belah pihak yang menyebabkan konflik tersebut berubah menjadi pertumpahan darah. “Kekerasan selama 10 hari terakhir telah meningkat dari kedua belah pihak, dengan kerugian signifikan pula dari kedua belah pihak dan risiko yang dihadapi tim peninjau juga akan ikut meningkat,” Mood mengatakan di Damaskus. Komentar itu diungkapkannya setelah Amerika Serikat mengaku memberikan peralatan komunikasi dan bantuan-bantuan lainnya kepada para anggota ‘oposisi damai’ di Syria. JurubicaraDepartemenLuarNegeriASVictoriaNulandmengatakan bantuan itu adalah bagian dari bantuan“non-tempur” kepada warga Syria yang tinggal di bawah pemerintah Presiden Bashar al-Assad, dan bagian dari usaha internasional untuk mendukung kebebasan Internet. Nuland menolak merinci mengenai bantuan itu, tetapi satu sumber yang dekat dengan usaha-usaha itu mengatakan bantuan itu termasuk barang-barang seperti perangkat lunak yang tidak disebut namanya, dan telepon-telepon satelit dengan kemampuan GPS ‘untuk mendokumen lokasi-lokasi kekejaman.’ Sementara dari Moskow dilaporkan bahwa Rusia Jumat mengatakan tidak melakukan pengiriman helikopter-helikopter tempur baru ke Syria dan hanya melakukan perbaikan helikopter yang dikirim ke sana beberapa tahun lalu. “Tidak ada pasokan helikopter serang baru buatan Rusia ke Syria,” kata kementerian luar negeri dalam satu pernyataan, dan menambahkan bahwa “perbaikan-perbaikan yang direncanakan adalah dilakukan sebelumnya pada helikopter-helikopter yang dipasok ke Syria tahun lalu.” (m10)

Presiden Intip Tahanan Mantan PM Yulia Tymoshenko KIEV (Waspada): Suami mantan PM UkrainaYuliaTymoshenko menuding Presiden Viktor Yanukovych melanggar hukum. Yanukovych dituduh memata-matai Tymoshenko dan berlaku cabul terhadapnya. OleksandrTymoshenkomarahbesardanmemprotespenahanan terhadap istrinya yang dilakukan oleh Yanukovych. Selama ini, aktivitas Tymoshenko di tahanan dan rumah sakit memang tidak luput dari pengawasan kamera intai yang dipasang oleh aparat keamanan. Dari masalah itulah Oleksandr yang berang melayangkan surat ke Yanukovych. “Kau (Yanukovych) memerintahkan penahanan terhadapYulia Tymoshenko, itu bukanlah rahasia. Ini sudah terpublikasi, ini adalah langkah baru dari evolusi kediktatoran,” ujar Oleksandr dalam suratnya, seperti dikutip Reuters, Kamis (14/6). “Setiaphari,sepertiseorangmaniakyangcabul,kaumenyaksikan aktivitas istri saya yang terbaring di rumah sakit lewat kamera intai,” imbuhnya. Kemarin,Yanukovych baru saja mengumumkan, Tymoshenkoterlibatdalamperistiwapembunuhanterhadapanggota Parlemen Ukraina Yevhen Scherban. Namun tuduhan itu sudah ditampik oleh Tymoshenko beberapa bulan yang lalu. OleksandrcukupyangsaatinimendapatsuakapolitikdiRepublik Ceko menilai,Yanukovych ingin melakukan balas dendam secara pribadi ke istrinya. Tymoshenko yang memimpin Revolusi Jingga pada 2004 menjadi tokoh oposisi Ukraina yang pernah merepotkan Yanukovych. Saat ini, perempuan berambut pirang itu divonis tujuh tahun penjara atas tuduhan korupsi dan penyalahgunaan kekuasaan. NamunTymoshenko menepis tuduhan-tuduhan itu dan mengatakan,Yanukovych memang berniat untuk menyingkirkannya. (vn)


WASPADA Sabtu 16 Juni 2012

Trio Sumut Perkuat Timnas U-14 Pagi Ini Terbang Ke Jepang JAKARTA (Waspada): Tiga pemain muda asal Sumut mendapat kepercayaan dari PSSI untuk masuk dalam skuad Timnas U-14 yang akan tampil di ajang invitasi sepakbola usia dini bertajuk The Japan-East Asia Network of Exchange for Students and Youth (JENESYS) di Osaka, Jepang, 18-24 Juni nanti. Ketiga pemain tersebut adalah M Fathurrahman (bek kanan), M Hilmi Dafa (stopper), dan Sanjen Prakes (gelandang). Sesuai rencana, skuad Garuda Muda berkekuatan 18 pemain termasuk tiga pemain asal Sumut tersebut akan didampingi M Zaenal (pelatih) dan ofisial tim menuju Osaka melalui Bandara SoekarnoHatta menggunakan pesawat Thai Air, Sabtu (16/6) ini. “Senang sekali bisa bermain untuk timnas. Ini memang impian saya. Mudah-mudahan tidak hanya kali ini bisa masuk timnas, tapi sampai senior nanti,” ujar Fathurrahman ditemui Waspada usai penglepasan resmi Timnas U-14 oleh Ketua Umum PSSI, Djohar Arifin Husin, di Kompleks Markas Besar

TNI di Cilangkap, Jakarta Jumat (15/6). Lebih lanjut, anak pasangan Azulaidin dan Syarifah ini menambahkan banyak hal positif yang diperoleh setelah dirinya terpilih masuk timnas. Salah satunya bisa membanggakan kedua orang tuanya di kampung halaman. “Teman-teman di sekolah pun sangat mendukung saya masuk timnas. Ini yang saya rasakan sejak mendapat panggilan untuk masuk pemusatan latihan,” tambah siswa kelas VII-3 SMPN 1 Tanjungmorawa itu. Hal senada disampaikan M Hilmi Dafa. Menurutnya, dengan masuk skuad timnas junior, dirinya berharap bisa terus konsisten mengenakan seragam timnas hingga senior. Siswa SSB Gumarang FC ini pun mengaku ingin tampil habis-habisan sekiranya mendapat kepercayaan pelatih. “Semua memang tergantung pelatih. Tapi jika saya diturunkan, saya akan berupaya tampil maksimal,” tegas Hilmi yang diamini Sanjes.

Ketua Umum PSSI, Djohar Arifin Husin, berharap semua pemain dan jajaran pelatih timnas U-14 bisa belajar banyak ilmu sepakbola di Negeri Matahari Terbit tersebut. Sebab sesuai undangan yang diberikan, ajang JENESYS tidak hanya mengikuti invitasi, tapi juga pelatihan alias kursus singkat. “Pemain akan diberikan pelajaran cara bermain sepakbola yang benar. Kita butuh pelajaran seperti itu, karena sepakbola Jepang memang lebih maju. Karena itulah, sangat diharapkan semua yang berangkat ke Jepang bisa pulang mengantongi oleholeh ilmu sepakbola,” beber Djohar. Ditambahkan, untuk memberikan pengalaman bertanding internasional dan mendongkrak posisi timnas Indonesia di peringkat FIFA, pihaknya memastikan akan mengirim tim dengan catatan ada undangan bagi Indonesia. “Beberapa waktu kita berangkatkan timnas ke Palestina. Dalam waktu dekat, kita juga akan penuhi undangan Swedia memberangkatkan Timnas U-12. Jika semua program bisa berjalan sesuai harapan, Insya Allah ke depan timnas kita lebih tangguh,” pungkas Djohar. Mengenai pemain asal Sumut yang ada di timnas, Djohar mengaku sangat mengharapkan terus bertambah. Karena itulah, ia pun menyampaikan pesan semua pelaku sepakbola di Sumut terus mengikuti kegiatan PSSI, terutama kompetisi usia dini yang menjadi fokus utama kepengurusan sekarang. (yuslan)

Greysia/Meiliana Tuntas JAKARTA (Waspada): Istora Senayan memang memiliki kekuatan magis untuk dukungan motivasi atlet Indonesia yang berlaga. Ribuan penonton bersorak kala Greysia Polii/Meiliana Jauhari sukses menghempaskan Miyuki Maeda/Satoko Suetsuna di babak 8 Besar Djarum Indonesia Open Super Series Premier 2012, Jumat (15/6). Dari empat pertemuan sebelumnya, Greysia/Meiliana selalu kalah dari ganda peringkat delapan dunia asal Jepang itu. Terakhir, duet yang akan tampil di Olimpiade 2012 ini kalah di Kejuaraan Dunia 2011 lalu. Namun, Greysia/Meiliani mampu menunjukkan performa terbaiknya dan menuntaskan dendam mereka dengan kemenangan straight set 21-13, 21-16. “Kami belum pernah menang, jadi kami terus berkonsentrasi merebut angka demi angka. Puji Tuhan kami bisa mengatasinya,” ujar Meiliana. Atas kemenangan ini, Greysia/Meiliana lolos ke semifinal dan sudah dinanti pasangan China, Qing Tian/Zhao Yunlei. Langkah Greysia/Meiliana ini menyusul sukses Simon Santoso yang berhasil mengalahkan Dionysius Hayom Rumbaka. Simon menang 21-17, 21-7 dan akan ditantang tunggal

India yang menumbangkan unggulan pertama Chen Long, Kashyap Parupalli. Tiket semifinal diraih Parupalli hasil mengalahkan Hans KristianVittinghus (Denmark) 22-20, 21-11. Setelah melibas pemainpemain terbaik di babak sebelumnya, Sony Dwi Kuncoro akhirnya kehabisan bensin dan terhenti di babak delapan besar. Penakluk Peter Gade (Denmark) dan Taufik Hidayat ini gagal meladeni unggulan delapan asal China, Du Pengyu. Dalam pertarungan sengit, Sony tumbang 14-21, 15-21. Indonesia juga meloloskan satu wakil ganda putra, yakni Markis Kido/Hendra Setiawan. Melawan juniornya, Rendra Wijaya/Rian Sukmawan, Kido/ Hendra unggul 18-21, 9-21. Untuk meraih tiket final, Kido/Hendra harus mengatasi unggulan kedua asal Korea Selatan, Jung Jae-Sung/Lee Yong-Dae.

Waspada/Danau Antariksa

GANDA putri Indonesia, Greysia Polii/Meiliana Jauhari, merebut kemenangan pertama atas Miyuki Maeda/Satoko Suetsuna di babak 8 Besar Djarum Indonesia Open Super Series Premier 2012, Jumat (15/6). Di ganda campuran, unggulan ketiga Tontowi Ahmad/ Liliyana Natsir mengungguli

rekannya sendiri, Markis Kido/ Pia Zebadiah Bernadeth. Dalam tempo 59 menit, jawara All Eng-


Waspada/Yuslan Kisra

TIGA pemain muda asal Sumut, M Hilmi Dafa, Sanjen Prakas, dan M Fathurrahman foto bersama Ketua Umum PSSI, Djohar Arifin Husin, usai penglepasan Timnas U-14 Indonesia menuju Jepang di Jakarta, Jumat (15/6).

Empat Juara Dunia Ke Indonesia WKF Premier League JAKARTA (Waspada): Beberapa juara dunia dipastikan hadir di Indonesia untuk mengikuti kejuaraan dunia karate WKF Premier League di Tennis Indoor, Gelora Bung Karno, Senayan, Jakarta, 23-24 Juni mendatang. Tak kurang dari empat juara dunia telah memastikan diri ikut ambil bagian pada kejuaraan ini. Mereka adalah juara dunia kata putra dan putri asal Venezuela, Antonio Diaz dan Yohana Sanchez, juara kumite -55 kg putri, Miki Kobayashi (Jepang), dan juara kumite kelas 61 kg putri, Kristina Mah (Australia). Keempat jawara kelas dunia karate tersebut memastikan siap bersaing memperebutkan supremasi di WKF Premier League pertama di Indonesia. “Saya pastikan kejuaraan ini sangat berkualitas, sebab diikuti karateka terbaik dari lima benua. Apalagi, banyak juara dunia karate juga ikut ambil bagian di ajang ini. Ini yang membuat turnamen ini makin berbobot,” ujar Ketua Umum PB Forki, Hendardji Soepandji, di Jakarta, Jumat (15/6). Ditambahkan, kejuaraan yang didukung bapak angkat karate, Bank BRI, Adaro Envirocoal, dan Artha Graha Peduli ini sarat karateka berkualitas. Selain event dunia WKF yang digelar pertama kali di Indonesia, mereka juga memburu poin demi menjadi karateka terbaik dalam peringkat dunia WKF. Karena itulah, sebanyak 227 karate dari 37 klub di 26 negara siap beradu. Selain juara dunia, para jawara Asia pun

bermunculan di Jakarta termasuk beberapa karateka peraih medali emas Asian Games 2010. Di antaranya Rika Usami (Jepang) yang menguasai nomor kata perseorangan dan peraih medali perunggu kejuaraan dunia 2010 di Beograde, Serbia. Selain itu, ada Hamad Al Noaeem (Kuwait) yang menguasai nomor kumite kelas -75 kg putra. Begitu juga, peraih medali emas kelas -61 kg putri, Yu Miyamoto, yang bertekad merebut medali emas di Premier League Indonesia. Hal sama disampaikan Zabihollah Poursheib (Iran) juga mengaku siap menjadi peserta terbaik dan mengulang sukses Asian Games 2010 saat merebut medali emas kumite kelas -84 kg dari tangan karateka andalan Indonesia, Umar Syarief. Sejauh ini, Indonesia sendiri sudah menoreh prestasi. Di Istanbul 2011, Indonesia meraih dua medali emas lewat kata beregu putra dan kata beregu putri. Bahkan, berkat pencapaian itu, Merah Putih mampu menempatkan posisinya sebagai peringkat ketiga terbaik dunia. Kini, Merah Putih berharap bisa mengulang sukses ajang tersebut. Apalagi, Indonesia kini berstatus tuan rumah. Manajer Tim Indonesia, Djafar Djantang, menambahkan Indonesia memang harus berjuang keras untuk menjadi yang terbaik di hadapan publik sendiri. Sebab, 227 karateka dari 26 negara yang akan tampil memang pilihan, sehingga bukan perkara mudah merebut gelar juara. (yuslan)

land 2012 itu membukukan kemenangan 21-15, 15-21, 21-11. (m33/yuslan)

Wibisono: PSMS Tak Pernah Kalah

Waspada/Edoard Sinaga

PEMBUKAAN turnamen bola voli Kapolres Simalungun Cup 2012 ditandai dengan penglepasan balon ke udara oleh Kapolres Simalungun, AKBP M Agus Fajar, Jumat (15/6).

16 Tim Bola Voli Bersaing

MEDAN (Waspada): Mantan striker PSSI dan PSMS Medan tahun 1960-an, Wibisono, meminta Yoseph Nico Malau cs merebut kemenangan atas Persib Bandung dalam lanjutan Indonesian Super League (ISL) di Stadion Teladan, Minggu (17/ 6) malam. “Ini saya sampaikan kepada pemain, karena melawan Persib sarat prestise. Lebih baik kalah dengan tim lain daripada Persib,” ujar Wibisono saat memberi pengarahan kepada pemain di sela-sela latihan PSMS di Stadion Teladan, Jumat (15/6). Wibisono, tidak saja terkenal di Indonesia tetapi juga di

Asia karena ketajamannya sebagai ditakuti lawan, mengaku sedih bila PSMS kalah dari Persib. Ini juga akan dirasakan publik sepakbola Medan dan Sumut. “Saya menemui pemain karena perlu mengingatkan untuk menjaga marwah kota dan sepakbola Medan. Bila kalah, nama besar PSMS sejak eranya almarhum Ramli Yatim cs hingga Sunardi B cs akan pupus,” ujar pelatih yang membawa PSMS juara nasional di tahun 1983 dengan mengalahkan Persib. “Curahkan tenaga dan kemampuan kalian semuanya untuk menghadapi musuh besar PSMS itu. Kalau bermain penuh semangat dan fanatik,

niscaya kehebatan Persib akan terkulai di kaki kalian,” kata pemain yang berhenti bermain bola setelah lututnya cedera itu. Wibi, panggilan akrabWibisono, juga bercerita saat PSMS tampil sebagai juara King’s Cup di Korea dan Agha Khan Cup di Paksitan, karena tampil tanpa mengenal takut dan lelah. Karena itu, Wibi meminta Zulkarnaen cs membuktikan kepada pecinta Ayam Kinantan untuk menyerupai performa tersebut. Tak lupa, CEO PSMS, Idris SE, juga memotivasi Novi Handriawan cs. “Buktikan kalian lebih baik dari pemain Persib,” katanya. (m17)

Kapolres Simalungun Cup PEMATANGSIANTAR (Waspada): Sejumlah 16 tim bola voli (10 putra dan 6 putri) asal Deli-serdang, Serdang Bedagai, Asahan, Kota Medan, Pematangsiantar, dan Simalungun bersaing pada kejuaraan Kapolres Simalungun Cup 2012 di Lapangan Aspol Polres Simalungun, 15-23 Juni 2012. “Event memperebutkan hadiah total senilai Rp25 juta ini sekaligus dalam rangka memeriahkan HUT Bhayangkara ke66,” ujar Ketua Umum Panitia HUT Bhayangkara Simalungun, Kompol S Keliat, dalam laporannya pada acara pembukaan turnamen, Jumat (15/6). Turnamen itu dibuka resmi Kapolres Simalungun, AKBP M Agus Fajar, dan dihadiriWali Kota Pematangsiantar Hulman Sitorus SE, Kapolres Pematangsiantar AKBP Alberd TB Sianipar, Dandim 0207/Simalungun Letkol Arh R Edi Setiawan, dan lainnya. Ke-10 tim putra yang bersaing adalah PU Deliserdang, Sidamanik, FKGOR Pelajar, Aqua Farm, Maritim (Pool A) dan Polres Simalungun, Dosin, Dogedoge, Hanura FC, Hadi FC (Pool B). Sedang enam tim putri, terdiri atas PU Deliserdang, Dosin, Sidamanik (Pool A) dan Polres Simalungun, Lib’s Bukit Sofa, FKGOR Pelajar (Pool B). (a30)

Problem Catur


Putih melangkah, mematikan lawannya empat langkah.

Jawaban di halaman A2 8







1 A





Waspada/Austin Antariksa

SEGENAP pemain PSMS Medan diminta merebut kemenangan saat menjamu Persib Bandung di Stadion Teladan, Minggu (17/6) besok.






1. Penyanyi dan pencipta lagu senior, menampilkan drama musik Semut Merah Semut Hitam (dua kata tanpa spasi). 5. Drama panggung yang dinyanyikan dengan iringan musik. 7. Kota di Prancis tempat festival filem internasional. 10. _____Sastro, aktris Indonesia menghadiri festival filem di Prancis. 11. Pemain piano. 12. Alat musik seperti piano. 14. Penyanyi bersuara antara sopran dan tenor. 15. Alat musik mirip biola berdiri. 17. Nada ke-7 tangga nada diatonik. 18. Nyanyian yang dilagukan dua orang. 20. ____Jagger, penyanyi gaek The Rolling Stones sejak 1970an. 22. Perusahaan besar produsen tv Jepang; ____Music Entertainment Indonesia, produsen musik. 24. Nama panggilan penyanyi grup Bimbo. 25. Nyanyian untuk paduan suara. 26. Pengarah dan penanggung jawab masalah artistik dan teknis pembuatan filem dsb. 28. Ragam suara yang berirama; Nyanyian. 29. Bentuk komposisi tembang macapat, biasanya untuk melukiskan kisah sedih,


HMPCI Chapter Medan menyalurkan bantuan kepada abang beca di kawasan Peringgan, Medan.

Honda MegaPro Club Berbagi Kebahagiaan Rayakan Ulang Tahun Ke-4 MEDAN (Waspada): Honda MegaPro Club Indonesia (HMPCI) Chapter Medan, komunitas motor sport yang dikenal solid, menunjukkan kepedulian sosialnya dengan membagikan bingkisan berupa paket sembako dan pakaian layak pakai kepada korban kebakaran di Gg. Aman, Kelurahan Sukaramai Medan. Paket sembako juga diberikan HMPCI kepada abang beca dan tukang sampah yang ada di jalanan Kota Medan. Aksi sosial itu mereka lakukan pada 13-14 Juni sebagai rangkaian perayaan ulang tahun ke-4 HMPCI, Sabtu (16/5) ini. Dengan menggunakan Honda MegaPro kebanggaan klub itu, mereka menyusuri jalanan Kota Medan, menghampiri abang beca, dan mengunjungi para korban kebakaran untuk berbagi kebahagiaan. Ketua HMPCI, Bambang Suwignyo (Mas Bro), didampingi Ketua Panitia, Jhony Bukit (Bro Jeje), Jumat (15/6) mengungkapkan, HMPCI Chapter Medan berharap bantuan mereka dapat bermanfaat dan membantu meringankan beban para penerimanya. Di hari ulang tahunnya, mereka pun akan mengadakan acara bertemakan “Satu Hati & Berbagi Dalam Kebersamaan” di Pelataran Parkir mempunyai bait lagu yang terdiri dari empat baris (Jawa).


1. Alat musik tiup berbentuk trompet panjang mempunyai alat sorong dan tarik. 2. Jalur pada disk dan disket tempat musik atau filem direkam. 3. Singkatan Panggung Wayang Gambar (artinya bioskop di Malaysia). 4. (Kata ulang) lagu dan tari populer asal Sulawesi Utara. 6. Adik (mengandung pengertian lebih hormat dan ramah), nama beberapa penyanyi. 8. ____Ramadhani, artis menantu Abu Rizal Bakrie. 9. Seri cerita (sinetron, filem dsb). 13. Alat mengunyah; Nama grup bandnya Armand Maulana. 16. ____Gaga, penyanyi bule, dilarang show di Jakarta. 17. Komposisi musik untuk instrumen tunggal (piano) atau ganda (piano dan biola). 19. Syair yang diberi berlagu; Nyanyian. 20. Pergantian naik turun suara secara teratur; Ukuran irama. 21. Kuno. 23. Tinggi rendahnya bunyi (lagu, musik dsb). 24. Bunyi yang dikeluarkan dari mulut, alat musik, dsb. 27. Musuh Jerry dalam filem kartun kucing dan tikus.

Plaza Millenium Medan. Acara diisi dengan kegiatan donor darah dan dimeriahkan beragam kegiatan menarik seperti Rolling City MegaPro, hiburan dan games. HMPCI juga akan mengundang 6 chapter lainnya yang tersebar di Sumatera Utara, yakni Lubuk Pakam, Perdagangan, Binjai, Kisaran, Kabanjahe, dan Sidikalang. “Anniversary nanti ikut dimeriahkan klubklub Honda lainnya yang berada di bawah naungan Sumut Honda Bikers. Tepat di hari ulang tahun keempat ini, kami juga akan menggelar pelantikan Pengurus HMPCI Chapter Medan periode 2012-2014,” beber Mas Bro. Arifin Posmadi, General Manager CV Indako Trading Co selaku main dealer Honda di wilayah Sumatera Utara mengatakan, klub-klub Honda sudah dianggap seperti keluarga sendiri, sehingga pihaknya selalu akan mendukung kegiatan mereka yang bersifat positif. “Selamat ulang tahun yang ke-4 buat HMPCI Chapter Medan. Tetap lah solid dan eksis dengan kegiatan-kegiatan yang bermanfaat bagi masyarakat,” ucap Leo Wijaya, Marketing Manager CV Indako Trading Co. (adv)

Sudoku 10x10 Isi kotak kosong dengan angka 0 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 5x2 bergaris tebal. Tingkat kesulitan: sulit (****), bisa diselesaikan dalam waktu kurang dari 15 menit. Jawaban di halaman A2 kolom 1.

1 7 4

3 4 6 1 8 2 4 8


2 1 5 6 8

0 9 7 4 1 6

0 4 2

9 6 1 7 3 8 0 5 1 9 9 3 2 5 ****36



WASPADA Sabtu 16 Juni 2012

Rusia Selalu Dominasi Yunani

Euro Grup A Malam Ini Di Warsawa :Yunani vs Rusia Di Wroclaw : Ceko vs Polandia *RCTI Live mulai pkl 01:45 WIB

WARSAWA, Polandia (Waspada): Yunani dan Rusia punya peluang sama untuk lolos, meski Negeri Dewa menempati posisi terakhir di klasemen Grup A dengan nilai satu. Namun menatap laga dinihari WIB nanti di Stadion Narodowy,Warsawa, Polandia, Rusia diuntungkan dengan nilai empat dari dua laga. Pasukan Dick Advocaat cukup bermain seri, sudah dijamin lolos ke perempatfinal. Posisi kritis justru dialami Yunani. Bermain 1-1 dengan Polandia dan kalah atas Ceko 1-2, menjadikan posisi skuad Fernando Santos wajib menang untuk melaju ke babak knock out. Itu juga mesti melihat hasil laga Polandia versus Ceko. Yunani mendapat problem dengan cederanya Giorgios Fotakis. Gelandang milik PAOK Saloniki itu cedera lutut kala mengikuti sesi latihan kemarin. Ini pastinya membikin

PARA pemain Yunani melakukan pemanasan dalam sesi latihan di Legionowo, 25 kilometer di utara Warsawa, Polandia, Jumat (15/6). pusing Santos dalam menentukan skuad yang akan diturunkan. Apabila Fotakis tak bisa pulih tepat waktu, pelatih asal Portugal itu mesti mencari rencana rotasi. Apalagi Ethniki tidak akan diperkuat kiper utama Kostas Chalkias, yang mengalami cedera saat melawan Ceko. Untungnya menurut Euro-

sport, Jumat (15/6), bek Sokratis Papastathopoulos sudah kembali tampil setelah menjalani hukuman satu pertandingan. Papastathopoulos mendapat kartu merah saat menghadapi Polandia di laga perdana. Di kubu Rusia, pelatih Dick Advocaat mengaku belum puas dengan kondisi pertahanan

Beruang Merah. Dalam dua laga, mereka kemasukkan dua gol, walaupun mereka agresif dalam menyerang dengan membuahkan lima gol. Advocaat pun mengaku akan mengubah strategi bertahan timnya saat menghadapi Yunani. Pasalnya, Rusia bermain baik namun lamban memba-

Pujian Buat Advocaat WARSAWA (Waspada): Kiper Rusia Vyacheslav Malafeev memuji pelatih Dick Advocaat, yang berhasil membawa mereka memimpin klasemen sementara Grup A Euro 2012. “Saya rasa Advocaat merupakan pelatih berkualitas dan dia menunjukkannya di momen yang sangat tepat. Kami mendapatkan hasilnya,” ucap Malafeev, Jumat (15/6). Tim Beruang Merah memulai pertandingan Grup A dengan membantai Republik Ceko 4-1. Pada laga kedua, Rusia meraih satu poin setelah bermain 1-1 dengan tuan rumah Polandia. “Saya rasa dia benar-benar tahu apa yang akan dilakukannya, Advocaat pelatih yang banyak pengalaman dan dia tahu setiap pemain yang bisa diandalkan tim,” puji penjaga gawang utama Rusia itu. “Advocaat sangat percaya kepada pemainnya, seperti yang dia katakan kepada kami,” tambah Malafeev, yang memang cukup mengenal karakter pelatih asal Belanda tersebut. Pasalnya, Malafeev, pernah bekerjasama dengan Advocaat saat masih melatih Zenit St Petersburg selama tiga musim 2006-2009. “Ketika Advocaat melatih Zenit, kami menghadapi berbagai tim di Liga Rusia, jadi dia tahu kualitas semua pemain yang ada. Dia tidak pernah punya masalah untuk beradaptasi dengan pemain,” klaim

Gekas Hercules Tanpa Gelar


Karier Klub 1998-2001 2001-2005 2005-2007 2006-2007 2007-2010 2009 2010 2010-2012 2012

Larissa (Yunani) Kallithea (Yunani) Panathinaikos (Yunani) VfL Bochum (Jerman) Bayer Leverkusen (Jerman) Portsmouth (Inggris) Hertha BSC (Jerman) Eintracht Frankfurt (Jerman) Samsunspor (Turki)

Karier Timnas 2005Yunani (senior) Debut vs Albania (30 Mei 2005) 60 caps/22 gol

Rusia Bakal Juara Grup A MEDAN (Waspada): Menang besar di laga pembuka atas Republic Ceko 4-1 dan sukses menahan tuan ruman Polandia 1-1, membuat Rusia diunggulkan oleh Sukariadi (foto) saat tim Beruang Merah menghadapiYunani di laga terakhir Grup A Euro 2012, Minggu (17/6) dini hari. “Prediksi saya, Rusia bakal menjadi tim terbaik di Grup A. Sejauh ini penampilan Andrei Arshavin dan kawan-kawan cukup stabil, termasuk saat menaWaspada/Dedi Riono han tuan rumah Polandia,” ujar siswa SMPN 2 Deli Tua, Deliserdang, Jumat (15/6). Gelandang tengah tim U-13 SSB Putra Famili di Turnamen Super Seri Piala Plt Gabsu 2012 yang saat ini sedang berlangsung itu, menilai Yunani pada Euro 2012 ini tampil di luar dugaan. Sebagai mantan juara tahun 2004, Yunani justru menjadi tim paling lemah di Grup A. “Sebelum Euro 2012 bergulir, jujur saya memprediksi Rusia dan Yunani bakal menjadi wakil Grup A. Namun ternyata Republik Ceko dan tuan rumah Polandia yang lebih berpeluang mendampingi Rusia,” ucapnya. Lantas, siapa juara Euro 2012? Dengan mantap, Sukariadi menjagokan Der Panzer Jerman. Dia menilai tim asuhan Pelatih Joachim Loew sudah sangat teruji untuk memenangi Euro 2012 setelah sukses menaklukkan tim kuat Portugal dan Belanda. (m42)

berpindah-pindah. Sejak 1998, Gekas sudah merasakan sembilan klub di empat negara berbeda. Karier sepakbolanya memang cukup unik, namun Gekas meninggalkan klub dengan catatan bagus dengan selalu mencetak gol kecuali untuk klub Inggris, Portsmouth. Untuk timnas, Gekas menjadi top skor di kualifikasi Euro 2008 dengan lima gol. Prestasi itu dilengkapi dengan merebut predikat pemain tersubur di Eropa pada kualifikasi Piala Dunia 2010 dengan 10 gol yang juga meloloskan Yunani ke Afrika Selatan. Di Piala Dunia 2010, Gekas menjadi pahlawan Yunani setelah berhasil membawa Ethniki (juukan timnasYunani) meraih kemenangan pertama di pesta sepakbola terakbar di bumi ini. BagiYunani, Gekas adalah pahlawan, seperti Hercules. Bahkan, naluri mencetak gol Gekas yang tinggi merupakan tumpuan Ethniki mengulang

Di fase grup Euro 2004 dan 2008, Beruang Merah sukses mengatasi Hellas, namun kekalahan di Euro 2004, tidak menghalangi Yunani menjadi juara. Yunani juga selalu kalah dari Rusia di kualifikasi Euro 1996. Terakhir kedua tim bertemu pada laga persahabatan Novem-

ber 2011. Saat ituYunani mampu menahan Rusia 1-1 di Piraeus, setelah sempat tertinggal lebih dulu. Gol Roman Shirokov dibalas oleh Kostas Katsouranis. Di Euro 2012 ini, Rusia mampu mencetak 5 gol dari total 7 shots on target. Striker Alan Dzagoev pun memimpin daftar top skor bersama bomber Jer-

0 1 0 1

Klasemen Grup B Jerman 2 2 0 Portugal 2 1 0 Denmark 2 1 0 Belanda 2 0 0

0 3-1 1 3-3 1 3-3 2 1-3

6 3 3 0

Klasemen Grup C Spanyol 2 1 1 Kroasia 2 1 1 Italia 2 0 2 Irlandia 2 0 0

0 5-1 0 4-2 0 2-2 2 1-7

4 4 2 0

Klasemen Grup D Ukraina 1 1 0 Inggris 1 0 1 Prancis 1 0 1 Swedia 1 0 0

0 0 0 1

3 1 1 0

5-2 3-5 2-2 2-3

2-1 1-1 1-1 1-2

4 3 2 1

Calon Top Skor 3 Gol: Alan Dzagoev (Rusia) Mario Gomez (Jerman) Mario Mandzukic (Kroasia) 2 Gol: Vaclav Pilar (Ceko) Andriy Shevchenko (Ukraina) Nicklas Bendtner (Denmark) Fernando Torres (Spanyol) Cesc Fabregas (Spanyol) man Mario Gomez dan penyerang Kroasia Mario Mandzukic (Kroasia), semuanya mengoleksi tiga gol. (m18/euro)

Pemenang Kuis Bigmatch Euro 2012 Periode I

Malafeev. “Advocaat juga dapat menciptakan sebuah strategi yang sudah kami usung selama dua tahun dan kami mencoba lebih baik setiap pertandingannya,” pungkas kiper berusia 33 tahun itu. Rusia akan menghadapi Yunani pada partai pamungkas babak penyisihan Grup A, hasil seri sudah cukup bagi mereka untuk meraih tiket ke babak delapan besar. Namun jadwal laga Euro 2012 yang ketat, menurut kapten Andrei Arshavin, telah membuat beberapa rekannya mengalami kelelahan. Faktor letih itu menjadi alasan Beruang Merah gagal mempertahankan keunggulan ketika menghadapi Polandia, 12 Juni lalu. “Kami memang sedikit mengalami kelelahan dan tidak mampu melakukan tekanan, seperti yang kami inginkan,” beber Arshavin. Rusia sempat memimpin lebih dulu, setelah bola tandukan Alan Dzagoev gagal diantisipasi kiper Przemyslaw Tyton menit 36. Namun Polandia berhasil menyamakan kedudukan lewat gol cantik Jakub Blaszczykowski menit 57. “Kami bermain sepakbola terbuka di babak kedua, yang mana memberikan kesempatan kepada pemain Polandia untuk melakukan serangan balik dan AP mereka mengambil keuntungan itu,” jelas PELATIH Dick Advocaat (kiri) menuai pujian Arshavin. (m15/okz/goal) dari skuad Rusia.

YUNANI terkenal sebagai Negeri Seribu Dewa, salah satunya pahlawan bernama Hercules. Ternyata, Gekas juga diidentikkan dengan Hercules yang menurut mitologi Yunani digambarkan sebagai sosok pahlawan hebat sebagai simbol keperkasaan. Sebagai putra dari dewa tertinggi, Zeus, Hercules diceritakan memiliki kekuatan luar biasa dan gagah berani. Sebagai salah satu anggota skuad Yunani, sosok Theofanis Gekas (foto) dapat dipandang sebagai reinkarnasi Hercules dalam dunia sepakbola negeri historis tersebut di masa kini. Hal yang ditunjukkan dalam laga melawan Republik Ceko, 13 Juni lalu. Pada laga tersebut, Gekas baru tampil di babak kedua. Begitu memasuki lapangan, Gekas langsung memberi hadiah gol kepada pendukungnya. Sayang, Yunani tetap kalah 1-2. Beruntung, Gekas cs masih berpeluang lolos ke fase knock out, dengan catatan mengalahkan Rusia alias skuad Beruang Merah malam nanti. Di level klub, Gekas dikenal sebagai pemain yang sering

ngun serangan. Akibatnya, beberapa kesempatan dibuang sia-sia, salah satunya kesempatan mencetak gol Alan Dzagoev. Ini ketiga kalinya secara beruntun, kedua tim tergabung satu grup di kompetisi Euro, dan Rusia selalu berhasil mendominasi Yunani.


Klasemen Grup A Rusia 2 1 1 Rep Ceko 2 1 0 Polandia 2 0 2 Yunani 2 0 1

pencapaian juara pada Euro 2004 silam. Ironisnya, kesuburannya di tingkat klub maupun timnas tidak pernah membawanya mengangkat trofi juara Eropa. Saat Yunani menjadi juara Euro 2004, Gekas belum menjadi bagian skuad Otto Rehhagel. Gagal di fase grup Piala Dunia 2010, Gekas memutuskan pensiun bersama Sotiris Kyrgiakos dan Ioannis Amanatidis. Tak sampai setahun, Gekas kembali membuat pengumuman mengejutkan dengan menarik keputusannya dan menyatakan siap berseragam ‘Biru-Putih’ khas Yunani di bawah asuhan Fernando Santos. Kembalinya Gekas ke Ethniki disambut seperti kepulangan seorang pahlawan. Di tengah krisis yang tengah dihadapi, sosok Gekas sebagai titisan Hercules tentu diharapkan menghibur bangsa yang merindukan sukses. (m33/afp/uefa)

1 Pemenang Rp1.500.000 - Ahmad Syukri, Jl Karya Jasa No.84 A Medan 2 Pemenang @Rp1.000.000 -Nur Cahaya, Jl Tuba I No.22 Medan -Syahputra Halim Nst, Jl AR Hakim Gg Langgar No. 39 Medan 5 Pemenang @Rp500.000 -Ilham Muhajir Lubis, Jl B Katamso Gg. Sempurna No.13 Medan -Sumantri, Dusun VII, Desa Limau Manis, Tanjungmorawa -RafiqahYusra Lubis, Jl Mandala By Pass No. 27 Medan Tembung -Ir Ranto Amin Aritonang, Jl Seksama No. 205 Medan -Palni Sami, Jl Teratai Pasiran No.27 Medan 10 Pemenang T-shirt -M Jaka Aditya, Jl Sei Musi No.22 A Medan -Rizki Aulia Bahri, Jl Karya Sembada No.228 -Robin Harahap, Jl Perjuangan Gg Wisma No.16 Medan -M Nur, Jl Sultan Iskandar Muda Bireuen-Aceh -M Hari Ramadhan, Karya Mesjid Sei Agul Medan -Endro Hariono, Jl Purwo Gg Reso Suka Makmur Deli Tua -Sehno, Jl Tapian Nauli No. 92 A -Wahyu Dinoto, Jl Sakti Lubis Gg Selamat No.59 Medan -Syaipul Amri, Jl SM Raja Gg Sepakat Medan Kota -M Yudin, Jl Deli Tua Gg Melur Dusun V Suka Makmur

Ahmad Syukri Raih Hadiah Utama Kuis Bigmatch Euro 2012 Periode I MEDAN (Waspada): Ahmad Syukri, penduduk Jalan Karya Jasa No.84A Medan, memenangkan hadiah utama Kuis Bigmatch Euro 2012 periode I berupa uang tunai senilai Rp1,5 juta. Pengundian kuis kemarin, terbuka untuk umum di pelataran parkir Kantor Harian Waspada Medan, Jumat (15/ 6) siang. Untuk hadiah utama, ku-

SEKRETARIS Panitia Kuis Bigmatch Euro 2012, Erwinsyah SE, membacakan kupon pemenang. -Waspada/Arianda Tanjung-

ponnya dicabut langsung oleh Pemimpin Umum PT Harian Waspada, Hj Rayati Syafrin. Kupon Syukri dianggap sah, karena telah benar menebak hasil laga antara laga Spanyol dan Italia yang berakhir imbang. Untuk dua pemenang hadiah masing-masing senilai Rp1 juta adalah Nur Cahaya, penduduk Jl Tuba I No. 22 Medan dan Syahputra Halim Nasution, warga Jl. AR Hakim Gg Langgar

Waspada/Arianda Tanjung

PEMIMPIN Umum PT Harian Waspada, Hj Rayati Syafrin, mencabut kupon hadiah utama Kuis Bigmatch Euro 2012 Periode I di pelataran parkir Kantor Harian Waspada Medan, Jumat (15/6). No.39 Medan. Kupon mereka dicabut oleh Wakil Pemimpin Perusahaan PT HarianWaspada, H Bahtiar Tanjung. Selain tiga pemenang di atas, juga masih ada lima pemenang masing-masing uang tunai Rp500.000 dan 10 pemenang tshirt timnas peserta Euro 2012 (lihat daftar pemenang), semua kuponnya dicabut oleh masyarakat umum. Hadiah bagi para pemenang

dapat diambil mulai Selasa (19/ 6) di Kantor Harian Waspada, Jl Letjen Suprapto/Brigjen Katamso No.1 Medan. Erwinsyah SE, selaku panitia Kuis Bigmatc Euro 2012, mengatakan pada periode pertama kemarin, pihaknya menerima kupon masuk sekira 110.000. Namun kupon yang benar dengan jawaban imbang, hanya sekira 20 persen saja. (m42)


WASPADA Sabtu 16 Juni 2012

Bagai Ngejar Bayangan


GDANSK (Waspada): Pelatih Republik Irlandia, Giovanni Trapattoni (foto), seakan terbangun dari ‘tidur panjang’ setelah anak asuhnya digunduli Spanyol 0-4 pada laga kedua babak penyisihan Grup C Euro 2012. Menurut Trap beserta beberapa anak asuhnya, permainan El Matador begitu luar biasa hingga membuat Irlandia bagaikan ngejar bayangan di PGE Gdansk Arena, Polandia. “Kami tak bisa melakukan apa-apa, jelas kami tahu lawan kami lebih kuat. Anda lihat kami kecolongan satu gol hanya dalam tiga menit awal pertandingan, banyak kesalahan yang kami buat,” ratap Trap dalam laman resmi UEFA, Jumat (15/6). Fernando Torres yang mencetak gol cepat Spanyol menit ketiga dan striker Chelsea itu memasukkan gol keduanya ke gawang kiper Shay Given menit 70. Dua gol La Roja lainnya dicetak David Silva menit 49 dan Cesc Fabregas menit 83. Akibat kekalahan dari sang juara bertahan, The Boys in Green pun menjadi tim pertama yang tersingkir dari Euro 2012. “Kami bagai mengejar bayangan, kami tidak bisa mendekati mereka. Spanyol tim fantastis,” ucap gelandang Irlandia, Keith Andrews. “Spanyol memang tim papan atas. Jika sedikit saja kehilangan konsentrasi, mereka bisa menyakiti Anda,” katanya lagi. Menurut kapten Robbie Keane, rekan-rekannya mesti mengambil pelajaran positif dari keganasan El Matador. “Ini merupakan peringatan. Mudahnya mereka mencetak gol malam ini sangatlah mengejutkan,” tutur Keane. (m15/vvn/uefa)

Bukti Del Bosque Bukan Anak Bawang GDANSK (Waspada): Vincente Del Bosque, entrenador Spanyol, mengklaim sukses skuadnya menggunduli Republik Irlandia 4-0 pada laga kedua Grup C Euro 2012, menjadi bukti bahwa dirinya bukan ‘anak bawang’ dalam meracik taktik. “Saya memilih pemain untuk mencetak gol. Saya tahu sepakbola dengan baik, saya bukan ‘anak bawang. Dan saya siap dikritik,” dalih Del Bosque, seperti dilansir Goal, Jumat (15/6). Mantan pelatih Real Madrid itu sempat menuai kritik, setelah memainkan formasi tanpa striker saat bermain 1-1 dengan Italia pada partai awal Grup C. Saat menghadapi Irlandia, Del Bosque melakukan perubahan dengan menurunkan sejak awal striker Fernando Torres. Hasilnya, Torres mencetak gol tercepat Spanyol sepanjang sejarah mengikuti Piala Eropa pada menit ketiga dan melengkapi aksinya dengan sumbangan gol kedua menit 70. Namun menurutnya, La Furia Roja akan tetap bermain bagus dengan atau tanpa pemain bernomor punggung 9 (striker) seperti Torres, Fernando Llorente, Alvaro Negredo, atau Pedro Rodriguez. Dia juga berjanji, timnya tetap tampil menekan saat melawan Kroasia



4 Skor Akhir 66% Penguasaan Bol 26 Tembakan Total 20 Tembakan Tepat 2 Penyelamatan 8 Sepak Pojok 6 Offsides 9 Pelanggaran 2 Kartu Kuning 0 Kartu Merah *Sumber ESPN

0 34% 6 4 11 2 1 16 3 0

pada partai pamungkas Grup C, 18 Juni mendatang. “Kami mempersiapkan tim untuk menang. Kami tampil bagus di lapangan, dan saya sangat bangga melihat permainan kami melawan tim Irlandia yang gigih,” tambah Del Bosque. Berkat kemenangan telak atas Si Bocah Hijau di Gdansk, Polandia, Kamis (Jumat WIB), Spanyol kini menjadi tim tersubur keempat dalam sejarah Euro dengan koleksi 43 gol. Juara Piala Eropa 2008 itu masih kalah dari Jerman (58 gol), Belanda (56 gol) dan Prancis (47 gol). La Furia Roja kini juga tak pernah kalah dari delapan laga putaran final Piala Eropa. Rekor terlama dipegang Belanda (1988-1996), Jerman Barat (1972-1984) dan Italia (19681988), semuanya dengan ca-


tatan sepuluh laga beruntun. Playmaker Xavi Hernandez pun ikut menciptakan rekor umpan terbanyak di Euro. Gelandang Barcelona itu melepas136 operan bola, 127 di antaranya tepat sasaran. Rekor sebelumnya dipegang legenda Belanda, Ronald Koeman, yang membuat 117 operan saat melawan Denmark di Piala Eropa 1992. “Kami bermain bagus dan hasil ini akan membangun kepercayaan diri tim. Kami senang, karena kami bermain sempurna, dan Spanyol yang luar biasa sudah terlihat,” jelas Xavi kepada AS. “Kemenangan melawan Kroasia akan membuat kami lolos sebagai pemuncak klasemen grup, tapi hasil imbang juga sudah cukup,” katanya lagi. (m15/okz/goal/as)

Azzurri Klaim Lebih Baik POZNAN, Polandia (Waspada): Cesare Prandelli, pelatih Italia, mengklaim skuadnya tampil lebih baik ketika bermain 1-1 dengan Kroasia pada laga kedua Grup C Euro 2012. “Penampilan kami lebih baik dibandingkan cara mereka (Kroasia) bermain bola. Tentu kami merasa kesal, karena dengan satu umpan silang bisa merusak segalanya,” klaim Prandelli, seperti diberitakan AFP, Jumat (15/6). Dalam laga di Municipal Stadium, Poznan, Kamis (Jumat WIB) tersebut, Gli Azzurri sempat unggul lebih dahulu melalui gol tendangan bebas spektakuler playmaker Andrea Pirlo menit 39. Skor 1-0 bertahan hingga turun minum. Italia mulai kehilangan pakem bermainnya sejak menit 61. Christian Maggio dan kawankawan, menurut Prandelli, memberi ruang yang terlalu jauh antara penyerang dan pemain

bertahan. Kroasia akhirnya mampu mencuri gol penyeimbang melalui Mario Mandzukic menit 72. Hasil seri itu memaksa Azzurri mesti menang telak atas Irlandia pada partai pamungkas Grup C, 18 Juni mendatang, guna memastikan tempat di babak perempatfinal. “Secara matematis kami masih ada di jalur turnamen, namun kami telah melewatkan sebuah kesempatan,” sesal Prandelli. Azzurri wajib menang dengan selisih tiga gol, supaya tak tergantung pada hasil Spanyol melawan Kroasia. “Kami tahu Spanyol akan berusaha memenangkan pertandingan, saya tidak pernah meragukan itu. Kita semua pemain profesional, dan sedang berada di Piala Eropa,” tutur gelandang Thiago Motta kepada Rai. Menurut kiper sekaligus kapten Gianluigi Buffon, Italia gagal mendulang kemenangan


Khalisdha Huraira

Rekor Torres GDANSK, Polandia (Waspada): Fernando Torres (foto) mengembalikan pamor Spanyol sebagai juara bertahan, Kamis (Jumat WIB), setelah menyumbang dua gol untuk keunggulan 4-0 atas Republik Irlandia.

Torres digantikan oleh Fabregas menit 74, dan gelandang Barcelona itu berhasil menutup pesta gol Spanyol sembilan menit kemudian. “Torres tahu cara mencari celah, ini laga yang sempurna. Banyak orang berpikir dia harusnya diturunkan di laga pembuka, tapi masalahnya bukan itu,” dalih Del Bosque. “Kami punya sistem dan membuktikan sistem itu bisa berjalan. Orang-orang berpikir bahwa penting untuk menurunkan striker, kami juga berpikir seperti itu. Tapi yang lebih penting adalah bagaimana cara untuk menang,” katanya lagi. Menurut playmaker Xavi Hernandez, pesta gol ke gawang The Boys in Green akan semakin menguatkan koneksi Del Bosque dengan Torres, yang dijuluki El Nino. “Hasil ini menyuntikkan rasa percaya diri bagi tim. Itu membuat bos dan El Nino jadi lebih tangguh, dan secara umum membuat kami menjadi lebih kuat,” jelas bintang Barcelona tersebut. (m15/ant/rtr/uefa/espn)

Dalam laga kedua babak penyisihan Grup C Euro 2012 di PGE Gdansk Arena tersebut, Torres malah menorehkan rekor gol tercepat Spanyol sepanjang mengikuti pagelaran Piala Eropa. Torres mencetak gol pertamanya ke gawang Irlandia ketika laga baru berjalan 3 menit dan 49 detik, sehingga memecahkan rekor gol Raul Gonzalez dengan 3 menit dan 53 detik saat El Matador mengalahkan Slovenia 2-1 di Euro 2000. Striker Chelsea itu kini juga telah mencetak 30 gol dari 95 kali membela La Furia Roja, melewati rekor mantan kapten Fernando Hierro (29 gol). Torres hanya kalah dari Raul (44 gol) dan David Villa (51 gol). Kemenangan 4-0 lewat dua kontribusi gol Torres, pun merupakan kemenangan terbesar La Roja selama tampil di Piala Eropa, mengungguli sukses mengalahkan Rusia dua kali dengan skor 4-1 dan 3-0 di Euro 2008. “Kami berhasil ‘menelan’ Irlandia di laga ini untuk melupakan hasil seri melawan Italia. Akhirnya Spanyol yang asli bisa memperlihatkan diri,” tegas mantan striker Liverpool dan Atletico Madrid itu, seperti dilansir Reuters, Jumat (15/6). Spanyol Vs Irlandia 4-0 “Perdebatan tentang Nomor 9 masih Stadion : PGE Arena, Poland akan berlanjut. Sistem itu sukses dilakukan Penonton : 39150 Orang malam ini, juga berhasil saat menurunkan Gol : Torres 4 & 70, Silva 49, Fabregas 83 Cesc. Keuntungan Spanyol adalah punya Wasit : Pedro Proenca (Portugal) banyak pemain yang bisa mengisi berbagai Kartu Kuning : Alonso 54, Martinez 76; Keane 36, Whelan 45, St. Ledger 84 posisi,” pungkas Torres. Bomber berumur 28 tahun itu Spanyol 1-4-3-3 Irlandia 1-4-4-2 diturunkan sejak awal melawan The Irish, 1 Iker Casillas 1 Shay Given setelah entrenador Vicente del Bosque 15 Sergio Ramos 2 Sean St. Ledger sempat membuat keputusan kontroversial 3 Gerard Piqué 5 Richard Dunne bermain tanpa striker saat Spanyol 18 Jordi Alba 3 Stephen Ward bermain 1-1 dengan Italia pada partai 17 Álvaro Arbeloa 4 John O’Shea perdana Grup A. 16 Sergio Busquets 8 Keith Andrews Torres pun membuktikan, dirinya layak 14 Xabi Alonso/Martinez 65 6 Glenn Whelan/Paul Green80 menjadi starter dengan membobol 8 Xavi Hernandez 7 Aiden McGeady gawang kiper Shay Given dua kali, menit 6 Andres Iniesta/Cazorla 80 11 Damien Duff/Mc Clean 76 ketiga dan menit 70. Dua gol El Matador 9 Fernando Torres/Fabregas 74 20 Simon Cox/Walters 46 lainnya disumbangkan David Silva menit 21 David Silva 10 Robbie Keane 49 dan Cesc Fabregas menit 83.




1 Skor Akhir 52% Penguasaan Bol 15 Tembakan Total 7 Tembakan Tepat 5 Penyelamatan 6 Sepak Pojok 3 Offsides 15 Pelanggaran 2 Kartu Kuning 0 Kartu Merah *Sumber ESPN

Italia Vs Kroasia 1-1

1 48% 10 8 4 3 1 22 1 0

Stadion Penonton Gol Wasit Kartu Kuning

: Miejski, Poznan (Poland) : 37096 Orang : Andrea Pirlo 39; Mandzukic 72 : Howard Webb (Inggris) : Motta 56, Montolivo 80; Schildenfeld 86

Italia 1-3-5-2 1 Gianluigi Buffon 16 Daniele De Rossi 3 Giorgio Chiellini 19 Leonardo Bonucci 5 Thiago Motta/Montolivo 62 8 Claudio Marchisio 21 Andrea Pirlo 13 Emanuele Giaccherini 2 Christian Maggio 10 Antonio Cassano/Giovinco 83 9 Mario Balotelli/Di Natale 69

PELATIH Slaven Bilic (kanan), mengkritik wasit Howard Webb yang memimpin laga Kroasia lawan Italia. AP-

Kroasia 1-4-4-2 1 Stipe Pletikosa 13 Gordon Schildenfeld 5 Vedran Corluka 2 Ivan Strinic 11 Darijo Srna 10 Luka Modric 8 Ognjen Vukojevic 20 Ivan Perisic/Pranjic 68 7 Ivan Rakitic 9 Nikica Jelavic/Eduardo 83 17 Mario Mandzukic/Kranjcar 90

Bilic Tuduh Wasit Memihak Italia


GELANDANG Italia Thiago Motta (kanan) jatuh bangun melawan pemain Kroasia di Poznan, Polandia. atas Irlandia dan sebelumnya Spanyol, disebabkan kurang ganasnya duet striker Antonio Cassano dan Mario Balotelli di garis serang. “Mestinya kami bisa menuntaskan lebih banyak peluang di babak pertama. Ber-

Matador Pertahankan Mahkota MEDAN (Waspada): Euro 2012 sudah lebih sepekan bergulir, jutaan pasang mata tertuju ke Polandia dan Ukraina untuk menikmati kompetisi tingkat tinggi antarnegara di Benua Biru itu. Tak terkecuali gadis manis yang satu ini, Khalisdha Huraira, yang menjagokan Spanyol sebagai calon jawaranya. Dara yang akrab disapa Ira ini, memprediksi Spanyol bakal mampu mempertahankan mahkota yang mereka raih pada empat tahun silam di Austria-Swiss. Kenapa? Karena menurutnya, dominasi permainan La Furia Roja dengan taka tiki-nya masih sulit dibendung para kompetitor. “Tidak hanya itu, selain ditangani pelatih berkelas seperti


Vicente del Bosque, Spanyol juga memiliki pemain dengan skill tinggi seperti Iker Casillas, Fernando Torres, Andres Iniesta, Cesc Fabregas, dan lainnya,” ujar mahasiswi semester enam jurusan Manajemen di USU itu Untuk meraih gelar juara, katanya, dibutuhkan kerja keras baik dari pemain dan pelatih. Dan hal itu telah ditunjukkan Spanyol saat menjuarai Piala Dunia 2010 di Afrika Selatan dan juara Euro 2008 di Austria-Swiss. “Dua prestasi itu membuktikan kalau El Matador memiliki mental juara. Sangat wajar kalau Spanyol kembali merengkuh gelar juara Euro 2012,” pungkas putri Khaidar Aswan, mantan gelandang PSMS Medan era 1980-an tersebut. *Arianda Tanjung

main bagus dan lebih beringas di depan gawang lawan, itu yang harusnya dilakukan ketika kami punya lebih banyak kesempatan,” kritik Buffon. (m15/afp/rai)

POZNAN (Waspada): Pelatih Kroasia, Slaven Bilic, menuduh wasit Howard Webb (Inggris) terlalu memihak kepada Italia, saat kedua negara bermain 1-1 pada partai kedua Grup C Euro 2012. “Banyak pelatih yang tak suka berkomentar soal wasit, tapi saya tak setuju. Mungkin saya tidak objektif, tapi seharusnya Nikica Jelavic mendapatkan penalti,” sindir Bilic. “Lalu, tendangan bebas Andre Pirlo. Seharusnya tidak ada tendangan bebas, karena tidak ada pelanggaran dari kami,” katanya lagi, sebagaimana dikutip dari Goal, Jumat (15/6). Dalam laga di PGE Gdansk

Arena, Polandia, Kamis (Jumat WIB) tersebut, bola tendangan bebas Pirlo dengan indah masuk ke gawang Kroasia menit 39. Kendati sempat tersentuh tangan kiper Stipe Pletikosa, bola itu tetap meluncur deras ke sisi kanan gawang Hrvatska. “Kami sangat tersiksa pada babak pertama. Tapi ini memang normal kalau Anda bermain lawan Italia,” beber Bilic, yang memasukkan Danijel Pranjic menggantikan Ivan Perisic di sektor sayap menit 68 guna menambah kuat daya serang skuadnya. Hasilnya ternyata manjur, Kroasia mampu mendominasi permainan kemudian menyamakan kedudukan melalui gol

Pilar Bagai Poborsky Muda DALAM dua pertandingan yang sudah dijalani Republik Ceko di pentas Euro 2012, ada sosok yang mencuri perhatian dunia. DialahVaclav Pilar, winger lincah berusia 23 tahun yang sudah menyumbang dua gol bagi negaranya di PolandiaUkraina. Satu gol dicetak ke gawang Rusia dalam kekalahan 1-4 dan satu lagi ke gawang Yunani saat Ceko menang 2-1. Kedua gol itu sedikit banyak memberikan asa kepada Tomas Rosicky cs untuk melaju ke perempatfinal. Kelebihan dari pemain pemilik tinggi 169 cm ini terletak dari kecepatan berlari plus penempatan posisi yang tepat di muka gawang. Gerakannya sulit dibaca lawan dan licin untuk dihadang. Bakat anak muda yang baru dipinang Vfl Wolfs-

burg ini seolah mengingatkan publik Ceko kepada sosok bintang timnas di era 1990an, yakni Karel Poborsky. Melawan Yunani, umpan akurat Pilar dan pergerakannya kerap menyebabkan pertahanan skuad Negeri Seribu Dewa kewalahan. Tak hanya itu, Pilar juga menyumbang gol hasil menyambut umpan Theo Gebre Selassie. Di laga pembuka, Pilar tak terpantau bel Rusia sehingga mencuri gol semata wayang bagi Ceko. Atas performa menawannya itu, Pilar menuai pujian termasuk dari legenda Real Madrid asal Kroasia, Davor Suker. Alhasil, Suker yang juga juri man of the match setiap laga Euro 2012 ini terkesima dan langsung menobatkan penghargaan tersebut kepada Pilar.

Suker juga berharap penampilan Pilar dapat memicu pemain muda lainnya untuk tampil all out di setiap kesempatan. Tak ayal, pelatih Michal Bilek berharap Pilar akan terus menunjukkan performa yang positif bagi negaranya sepanjang Euro. Apalagi mereka masih memiliki satu pertandingan penting di depan mata. Menghadapi tuan rumah Polandia, Ceko wajib meraih kemenangan agar mulus melangkah ke fase knock out. Karena itu, sudah pasti laga ketiga bagi kedua tim layaknya partai final. Menang, tiket lolos sudah pasti dikantongi, kalah berarti harus bersiap-siap menangis pilu karena tersingkir. Tak ingin pulang lebih cepat, Bicek terang-terangan akan bertumpu sekaligus mengandalkan

Mario Mandzukic menit 72. “Kami kemudian menekan, dan sebenarnya kami bisa saja memenangkan pertandingan. Tapi saya cukup puas dengan permainan kami,” ucap Bilic. Untuk partai pamungkas Grup C melawan tim favorit Spanyol di Gdansk, 18 Juni mendatang, Bilic mengaku, skuadnya masih punya problem. “Masalah kami berbeda, kami tidak memiliki mental kuat seperti Jerman atau Italia,” beber pelatih berusia 43 tahun itu. Namun bek sentral Vedran Corluka yakin, Hrvatska bakal mencuri angka dari El Matador untuk memastikan lolos ke babak delapan besar. “ Di laga terakhir kami akan

menghadapi tim terkuat Grup C, Spanyol. Bagaimanapun, saya yakin Kroasia bisa lolos,” klaim bek berumur 26 tahun tersebut. Sedangkan winger Ivan Perisic malah mengklaim, Azzurri masih lebih kuat dibanding La Roja. “Spanyol bukanlah lawan yang difavoritkan, saya pikir Italia lebih baik saat melakoni laga pertamanya,” ujarnya. “Kami akan siap untuk pertandingan selanjutnya usai analisis dari video dan taktik yang akan kami lakukan akhir pekan ini. Ada begitu banyak pilihan dan dari yang saya lihat Spanyol telah memimpin di sepuluh menit laga awal duel,” pungkas Perisic. (m15/okz/goal/espn)

Karier Klub 2009-2011 Hradec Kralove (Rep Ceko) 2011-2012 Viktoria Plzen (Rep Ceko) 2012VfL Wolfsburg (Jerman)

Karier Timnas 2005-2006 Rep Ceko U-18 2006-2007 Rep Ceko U-19 2010 Rep Ceko U-21 2011Rep Ceko (senior) Debut vs Peru (4 Juni 2011) 11 caps/3 gol Pilar sebagai penggedor. Ini tentu disebabkan cederanya sang jendral lapangan tengah mereka, Tomas Rosicky. Kendati masih berpeluang tampil memimpin rekan-rekannya, Bilek tidak terlalu memaksa Rosicky. Kenapa? Karena baginya Pilar sudah menjadi ‘pilar’ utama di timnas. (m33/uefa/afp)




WASPADA Sabtu 16 Juni 2012

Api Miami Kembali Panas

OKLAHOMA CITY, AS (Waspada): Kemenangan susah payah diraih Miami Heat dalam game kedua Final NBA 2012 di Chesapeake Energy Arena, Oklahoma, Jumat (15/6). Dipimpin LeBron James dan Dwyane Wade, Heat unggul 100-96 dan menyamakan seri 1-1. Ingin menebus kekalahan di game pertama, Heat langsung panas di awal pertandingan. Heat bahkan sempat unggul 182 pada 17 menit pertama, sebelum Thunder perlahan mulai memberi perlawanan dan menutup kuarter pertama 27-15 untuk tim tamu. Pada kuarter kedua, Heat masih bernafsu untuk terus mengungguli Thunder. LeBron

cs tampil ngotot dan tetap unggul. Di sini, Wade tampil on fire dan berhasil mencetak 13 poin dengan LeBron menyumbang 14 angka. Memasuki kuarter ketiga, Thunder enggan dipermalukan di hadapan pendukungnya sendiri. Alhasil, Kevin Durant cs terus menempel perolehan angka Heat. Sebaliknya, skuad besutan Erik Spoelstra juga

menjaga jarak dari kejaran Thunder. Kuarter ketiga ini pun berakhir 78-67 untuk Heat. Di 12 menit terakhir, pertandingan semakin ketat dan kejar-kejaran angka terus terjadi. Three point Durant membuat timnya hanya tertinggal empat angka, 86-90. Perbedaan bagi Heat adalah game kedua ini memainkan Chris Bosh setelah absen lama karena cedera. Bosh tampil apik dan menghasilkan 16 poin 15 rebound bagi Miami. Dua menit sebelum pertandingan berakhir, Chesapeake Energy Arena bergemuruh kala aksi dunk Russell Westbrook semakin memperkecil jarak menjadi tiga poin. Namun, kegembiraan itu tidak berlangsung lama karena Wade menjauhkan perolehan angka Heat menjadi 98-91. Durant sempat memberi

respon dengan menambah angka timnya. Sayangnya, usaha bertubi-tubi Durant tidak diimbangi rekan-rekannya. Bahkan usaha menyamakan kedudukan pada detik-detik akhir nyaris berbuah manis andai tembakan Durant tidak gagal. Secara keseluruhan, Durant menoreh 32 poin ditambah 27 angka dari Westbrook. Peraih gelar Sixth Man Award, James Harden, menambah 21 poin. Se-baliknya, Miami juga didukung performa bagus dari Shane Battier yang memberi donasi 17 angka. Namun bintang Heat tetap LeBron dan Wade yang masing-masing mengoleksi 32 dan 24 poin. Kemenangan ini membawa Heat memiliki modal penting sebelum menjamu Thunder di American Airlines Arena pada game ketiga, Senin (18/6). (m33/ap)

Sinyal Bahaya Dari Rossi SILVERSTONE, Inggris (Waspada):ValentinoRossimemimpin keperkasaan Ducati di sesi latihan awal MotoGP Inggris di Sirkuit

Silverstone, Jumat (15/6). Rossi juga menjadi peserta tercepat dengan mengungguli rekan setimnya, Nicky Hayden.

The Doctor menguasai free practice sesi pagi di atas lintasan basah dengan catatan waktu 2:19.328 detik atau lebih cepat


RIDER Ducati, Valentino Rossi (kiri), mengungguli Daniel Petrucci dan pesaing lainnya pada pelatihan bebas pertama MotoGP Inggris di Sirkuit Silverstone, Jumat (15/6).

Duo Unggulan Melaju Mulus HALLE, Jerman (Waspada): Tak sampai sepekan setelah meraih titel Prancis Terbuka, Rafael Nadal (foto) sudah beraksi lagi. Meski di permukaan berbeda, Nadal sukses melaju ke perempatfinal Gerry Weber Terbuka di Halle, Jumat (15/6). Tampil di atas permukaan rumput, Nadal belum mampu dihentikan penantangnya asal Slovakia, Lukas Lacko. Walau sempat kesulitan di set pertama, perlawanan Lacko berakhir dalam straight set 7-5, 6-1. “Perlawanan Lacko hebat di set pertama. Tapi di set kedua, permainan saya membaik,” tutur Nadal, Jumat (15/6). “Penampilan saya juga makin membaik di lapangan ini di tiap jamnya. Apalagi saya tak punya banyak waktu mempersiapkan diri di lapangan rumput. Saya senang bisa lolos dan itu yang terpenting,” tambahnya. Cerita serupa juga dialami Roger Federer. Namun, upaya Federer dirasa lebih ketat saat menghadapi Florian Meyer


(Jerman). Pertarungan sempat memanas di poinpoin akhir saat petenis Swiss itu membuang lima break point. Dari lima kesempatan, Federer hanya sukses mengkonversi satu break point. Beruntung, Meyer juga tak dalam performa bagus hingga akhirnya Federer menang 6-4, 7-6. Selanjutnya, FedEx sudah ditunggu Milos Raonic (Kanada). (m33/ap)

PEMBERITAHUAN Berdasarkan Keputusan RUPS tanggal 20 Mei 2012, sebagaimana diuraikan dalam akte Berita Acara Rapat Umum Pemegang Saham PT. Aceh Palma Industries tanggal 20 Mei 2012 nomor 23 dibuat oleh Eka Ermasyafpriza Handayani Firdaus, SH, MKn, Notaris di Pematang Siantar, per seroan terbatas PT. ACEH PALMA INDUSTRIES , berkedudukan di Langsa, telah dibubarkan dan telah diangkat sebagai likwidator : H. Joze Rizal Firdaus, SH, beralamat di Jalan Asrama Komplek Bumi Asri Block C 71 Medan, Helvetia. Kepada para kreditor diharapkan untuk melakukan penagihan disertai dengan bukti-bukti kepada likwidator dalam jangka waktu 60 (enam puluh) hari terhitung sejak pengumuman ini. Medan, 15 Juni 2012


PEMBERITAHUAN Berdasarkan Keputusan RUPS tanggal 20 Mei 2012, sebagaimana diuraikan dalam akte Berita Acara Rapat Umum Pemegang Saham PT. Nusantara Raya Global tanggal 20 Mei 2012 nomor 22 dibuat oleh Eka Ermasyafriza Handayani Firdaus, SH, MKn, Notaris di Pematang Siantar, perseroan terbatas PT. NUSANTARA RAYA GLOBAL, berkedudukan di Langsa, telah dibubarkan dan telah diangkat sebagai likwidator : H. Jose Rizal Firdaus, SH, beralamat di Jalan Asrama Komplek Bumi Asri Blok C 71 Medan, Helvetia. Kepada para kreditor diharapkan untuk melakukan penagihan disertai dengan bukti-bukti kepada likwidator dalam jangka waktu 60 (enam puluh) hari terhitung sejak pengumuman ini. Medan, 15 Juni 2012


0.077 detik dari catatan Hayden. Di sini, Ducati memang membuktikan bahwa trek basah menjadi favorit mereka, sehingga para rival dibuat tak berdaya. Terbukti, hampir sepanjang sesi berdurasi 45 menit tersebut, Rossi dan Hayden secara bergantian berada di depan sekaligus mengungguli pebalap Repsol Honda, Casey Stoner. Pebalap Australia itu sendiri akhirnya harus puas terpuruk di urutan keempat setelah digeser rider satelit Yamaha Tech 3, Andrea Dovizioso. Posisi kelima dihuni rekan setim Dovizioso, Cal Crutchlow, yang tertinggal lebih dari 1 detik. Crutchlow, naik daun musim ini, mengalahkan pebalap LCR Honda asal Jerman, Stefan Bradl. Sementara itu, Dani Pedrosa (Repsol Honda) tertinggal 3,385 detik dan berada di posisi tujuh atau di atas kompatriotnya yang merupakan jagoanYamaha, Jorge Lorenzo. Pebalap Gresini Honda, Alvaro Bautista, menduduki urutan sembilan dan Hector Barbera (Pramac Ducati) melengkapi komposisi 10 besar latihan bebas perdana. Satu-satunya pebalap tim pabrik, Ben Spies (Yamaha), terpuruk di luar 10 Besar alias peringkat 11. Bagi Rossi, musim lalu finish keenam dalam debutnya di Silverstone, ini merupakan hasil terbaik selama bergabung dengan Ducati tahun lalu. Ini juga menjadi sinyal waspada bagi rival Ducati, karena trek basah bukan mustahil membawa berkah bagi Rossi dan Hayden. Khusus Rossi, dirinya bertekad memperbaiki hasil ketika menjadi runner-up MotoGP Prancis, 20 Mei lalu. (m33/auto)

COMEBACK Chris Bosh (1) membawa berkah bagi Miami Heat yang mencuri game kedua Final NBA di kandang Oklahoma City Thunder, Jumat (15/6). -AP-

Pasang Iklan

Telp. 4528431 HP. 081370328259 Email:

EURO 2012

WASPADA Sabtu 16 Juni 2012


Celah Ceska SERI saja melawan Yunani di Warsawa, sudah cukup bagi Rusia untuk memastikan tempat di perempatfinal Euro 2012. Status juara Grup A, tergantung hasil pertarungan Ceko dengan Polandia, yang mentas bersamaan dinihari WIB nanti di Wroclaw. Kalah pun dengan skor 02, 1-3 atau 2-4, Kamerad bahkan tetap menjadi juara grup. Syaratnya, Ceko-Polandia bermain imbang, dan Yunani yang mengorbit sebagai runner-up. Begitulah besarnya peluang Beruang Merah dalam skenario perburuan tiket dari Grup A, sehingga awak menempatkan mereka pada posisi pole. Ethniki sudah tertinggal satu lap, tetapi menurut awak, Kamerad bakal terus menekan gas untuk mengamankan podium pertama. Sasarannya jauh ke depan, menghindari Jerman selaku calon kampiun Grup B di babak delapan besar. Podium kedua Grup A dengan demikian diperebutkan Republic Ceska dan tuan rumah Polish. Ceko (nilai 3) sekarang berada di depan Polandia (nilai 2), tapi mereka sepertinya bermasalah dalam sprint menuju

finish di Wroclaw. Setidaknya, ada dua celah Ceska yang bisa dimaksimalkan Robert Lewandowski dan kawan-kawan di Municipal Stadium. Paling mendasar, tingkat ketergantungan terhadap playmaker Tomas Rosicky. Alur serangan pasukan Michal Bilek memang sangat tergantung kepada sang kapten, sehingga resepnya sederhana saja untuk melumpuhkan mereka. Cukup matikan kreasi serta akselerasi gelandang Arsenal itu, berarti hilang kendali lah anak-anak Ceska. Rosicky sendiri sebenarnya diragukan untuk berbuat maksimal di Polandia-Ukraina 2012, karena datang dengan membawa cedera ringan ketika membela Gunners pada partai pamungkas Liga Premier. Cedera di kaki itu sepertinya kambuh lagi ketika Ceko mengatasi Yu-

Catatan Sejarah Pertemuan 12/03/97 28/04/99 06/02/08 11/10/08 10/10/09

Ceko vs Polandia Polandia vs Ceko Polandia vs Ceko Polandia vs Ceko Ceko vs Polandia

2-1 2-1 2-0 2-1 2-0

Persahabatan Persahabatan Persahabatan Pra Piala Dunia Pra Piala Dunia

Ulasan Khaidar Aswan Mantan Pemain PSMS nani 2-1 pada laga kedua Grup A. Jika masih dipaksakan Bilek untuk memotori permainan Ceska dinihari nanti, resiko besar bakal mengancam masa depan bintang berusia 31 tahun itu. Cederanya bisa lebih parah, sebab waktu pemulihan empat hari tidak akan cukup untuk mereperasi konstruksi otot para pemain yang sudah ‘berkepala tiga’. Ini bukan sekadar teori, melainkan telah menjadi hukum alam di dalam dunia sepakbola. Makanya, untuk cedera yang sama kadarnya, proses pemulihan pemain berusia 20-an bakal lebih cepat dibanding yang sudah 30-an. Rosicky berarti riskan untuk terlalu diharapkan Bilek, dampaknya bakalan signifikan. Ceska seperti yang terlihat di laga sebelumnya menghadapi Yunani

dan Rusia (1-4), kehilangan konsistensi dalam menekan dan menyerang lawan. Petr Jiracek cs tanpa sadar sering memberi ruang bagi musuh, celah itu tentu mengandung risiko besar untuk level permainan tingkat tinggi di Euro 2012. Apalagi lawan yang dihadapi adalah Polandia, yang sudah jelas mengusung sukses ganda, yakni sukses prestasi dan sukses sebagai penyelenggara. Dukungan semangat tak pernah berhenti dari mayoritas penonton di Municipal Stadium, pun akan berdampak luar biasa bagi motivasi tempur pasukan Franciszek Smuda. Jakub Blaszczykowski cs bakalan tiada habisnya, sebagaimana yang telah mereka demonstrasikan ketika memaksakan hasil 1-1 melawan Rusia, 12 Juni lalu. Keuntungan dan keunggulan non-teknis seperti itu, sejatinya hanya bisa diimbangi dengan keunggulan segaris dari sisi teknis. Sayangnya, kualitas Ceska selevel dengan Polish, setelah berakhirnya masa pengabdian generasi Pavel Nedved, Karel Poborsky, Vladimir Smicer, Jan Koller, dan Tomas Ujfalusi. Dari bawah mistar sampai ke garis serang, mutu kedua tim relatif seimbang. Kiper utama Ceko, Petr Cech (Arsenal), kelasnya setara dengan Wojciech Szczesny (Arsenal), penjaga gawang nomor satu Polandia yang posisinya kini rawan digeser Przemyslaw Tyton. Penyerang veteran Milan Baros, bomber andalan Bilek,

Szczesny Ingin Tebus Kesalahan PENJAGA gawang Polandia, Wojciech Szczesny (foto), mengungkapkan bahwa dirinya ingin kembali menjadi kiper utama. Hal tersebut ia inginkan setelah terkena kartu merah di laga pembuka melawanYunani dan absen di game kedua kontra Rusia. Maksud ingin memberi

pembuktian layak sebagai kiper utama timnas, Szczesny justru mengawali Euro kali ini dengan pahit. Lebih sial lagi, Przemyslaw Tyton yang mengambil tempatnya menjadi pahlawan Polandia dengan memblok penalti Giorgos Karagounis. Tuan rumah pun selamat dari kekalahan. Penampilan cemerlang


Tyton berlanjut di laga kedua. Sayang, Tyton tetap kebobolan terlepas tampil cukup apik di pertandingan melawan Rusia tersebut. Melihat kondisi tersebut, Szczesny mengaku siap mengambil kembali posisi kiper utama dan berlatih keras demi mengembalikan kepercayaan pelatih Franciszek Smuda. “Saya mengharapkan bisa kembali main dan membantu tim ini. Saya cukup lelah hanya dengan menyaksikannya. Semua ini pertandingan yang enak untuk dilihat, tapi saya merasa lebih mudah untuk bermain di dalamnya,” pungkasnya. Polandia berada di posisi ketiga dengan dua poin, sedangkan Ceko berada setingkat di atas dengan tiga poin. Tuan rumah wajib mengalahkan Tomas Rosicky cs di National StadiumWarsawa, Minggu (17/6) dinihari, jika ingin melenggang ke perempatfinal. Di Euro ini, Smuda memang mengutamakan Szczesny daripada Artur Boruc yang telah menghuni timnas sejak 2004 dan menjadi kiper utama sejak 2006 silam. Barulah setahun kemudian, Szczesny mengamankan posisinya di bawah mistar gawang Polandia. Keberadaan Szczesny di skuad Polandia juga mengingatkan Smuda kepada ayah Szczesny, Maciej. Kebetulan, Maciej pernah jadi pemain asuhan Smuda di klub Widzew Lodz. Karena hal inilah, Smuda ter-

Karier Klub 2009Arsenal (Inggris) 2009-2010 Brentford (Inggris) 2010Arsenal (Inggris)

Karier Timnas 2007-2010 PolandiaU-20 2009Polandia U-21 2009Polandia (senior) Debut vs Kanada (18 Nov 2009) 11 caps/0 gol kadang memanggil Szczesny dengan nama ayahnya. Di balik sosoknya sebagai pemain profesional, Szczesny ternyata pernah menjadi penari ballroom dan atlet lempar lembing. Sebagai pesepakbola, Szczesny memulai kariernya di klub Legia Warsawa sebelum bergabung dengan Arsenal pada Agustus 2007. Setelah berkembang pascadipinjam di Brentford, Szczesny kembali dipanggil Arsene Wenger untuk melakoni debutnya di Liga Premier pada Desember 2010. Di Liga Champions, Szczesny tampil gemilang bagi The Young Guns musim lalu. Meski demikian, 20 aksi penyelamatannya gagal menghindarkan kekalahan saat menghadapi AC Milan di 16 Besar. Kegagalan yang hendak ditebusnya bersama skuad negaranya. Itupun jika Smuda mengembalikan posisi kiper utama kepadanya, bukan Tyton, di laga penentu dinihari nanti. (m33/ap/uefa)

pun bukannya lebih tajam dibanding Lewandowski. Baros bahkan masih nihil gol, sedangkan Lewandowski sudah masuk buku sejarah sebagai pencetak gol pertama Piala Eropa 2012. Terkait sejarah tadi, awak pun ingin menyibak sedikit cerita reuni kedua negara. Setelah Ceko pecah kongsi dengan Slovakia (dulu Cekoslowakia-red), keduanya telah lima kali adu kekuatan. Hasilnya, Polandia menang tiga kali di kandang sendiri, namun takluk dalam dua kali kunjungannya ke Praha, ibukota Ceska.***** PELATIH Michal Bilek (kanan) terancam kehilangan Tomas Rosicky (kiri) pada partai pamungkas babak penyisihan Grup A Euro 2012. -AP-

Ceko Terancam Tanpa Rosicky WROCLAW, Polandia (Waspada): Republik Ceko terancam tanpa playmaker Tomas Rosicky pada partai pamungkas babak penyisihan Grup A Euro 2012 melawan Polandia dinihari WIB nanti di Stadion Municipal, Wroclaw. Rosicky didera cedera tungkai kaki saat memenangkan timnya 2-0 atas Yunani, 12 Juni lalu. Gelandang Arsenal itu absen dalam latihan tim pada 14 Juni, kepastian tampil atau tidaknya dia tergantung hasil pemeriksaan dan tes lebih lanjut. “Ketika Rosicky bermain, kami merasa sangat percaya diri. Dia punya kemampuan untuk mengalirkan bola,” beber David Limbersky, bek kiri Ceko, seperti dikutip dari situs resmi UEFA, Jumat (15/6). Jika benar-benar absen melawan Polandia, peran Rosicky kemungkinan digantikan Daniel Kolar. “Kolar mungkin bisa bermain bagus sebagai pengganti. Tapi suka tidak suka, saya harus bilang tim ini benar-benar membutuhkan Rosicky,” klaim Limbersky. Di kubu tuan rumah, bek Damien Perquis serta Eugen Polanski dan Dariusz Dudka, yang diragukan dapat mentas di Wroclaw. Keduanya menderita

cedera saat Polandia bermain 1-1 dengan Rusia pada laga kedua Grup A. “Perquis mendapat sobekan yang dalam di tulang keringnya. Polanski menderita memar pada lututnya, dan Dudka menderita ketegangan otot perut,” ungkap Tomasz Rzasa, Direktur Media Federasi Sepakbola Polandia. Ketiganya sudah menjalani pemeriksaan, Rabu lalu, dan absen dalam sesi latihan di markas Polish. “Dudka juga tidak ambil bagian pada latihan Kamis,” beber dokter tim, Mariusz Urban. “Cedera Dudka yang paling serius, kami terus memantau situasinya. Kami akan menilai setiap waktu apa yang dapat ditangani, sulit untuk berkata lebih jauh saat ini,” tambah Urban kepada kantor berita Polandia, PAP. Polandia asuhan pelatih Franciszek Smuda mesti mengalahkan Ceko untuk memastikan tiket ke perempatfinal. Kembalinya kiper Wojciech Szczesny dari masa skorsing juga menjadi dilema bagi Smuda. Dia berarti mesti memilih siapa yang akan turun sebagai starter di bawah mistar Polandia, Szczesny atau Przemyslaw Ty-

CEKO VS POLANDIA MALAM INI Stadion Kapasitas Live Ranking FIFA

: Municipal, Wroclaw : 40.000 Penonton : RCTI mulai pkl 01:45 WIB : Ceko 27, Polandia 62

PRAKIRAAN FORMASI PEMAIN Ceko 1-4-2-3-1 Usia 1-Petr Cech 30 2- Gebre Selassie 28 3-Michal Kadlec 27 6-Tomas Sivok 28 8-David Limbersky 28 13-Jaroslav Plasil 30 17-Tomas Hubschman 31 19-Petr Jiracek 26 10-Tomas Rosicky 31 14-Vaclav Pilar 23 15-Milan Baros 29 Pelatih: Michal Bilek ton, yang tampil cukup bagus ketika menghadapi Yunani dan Rusia. Tyton menjadi pahlawan l saat menggagalkan tendangan penalti Giorgos Karagounis, kapten Negeri Dewa, sehingga memaksakan hasil 1-1 pada partai perdana Grup A. “Saya senang, bukan saya yang harus membuat pilihan siapa yang akan menjadi nomor 1 saat menghadapi Republik Ceko. Sangat sulit memilih kiper

Polandia 1-4-4-1-1 Usia 22-Przemyslaw Tyton 25 20-Lukasz Piszczek 27 13-Marcin Wasilewski 32 15-Damien Perquis 28 2-Sebastian Boenisch 25 16-Jakub Blaszczykowski 26 7-Eugen Polanski 26 5-Dariusz Dudka 28 18-Adrian Mierzejewski 25 11-Rafal Murawski 30 9-Robert Lewandowski 23 Pelatih: Frantisek Smuda yang lebih baik, Szczesny dan Tyton, telah memperlihatkan skill mereka di banyak kesempatan,” ucapa Rafal Murawski, gelandang Polandia. “Kami punya dua kiper yang sangat baik, Wojciech dan Przemyslaw. Saya lega bukan saya yang harus memilih siapa yang akan menjadi pilihan pertama,” timpal pemain Polandia lainnya, Adam Matuszczyk. (m15/uefa/goal/espn)

Sumatera Utara

B2 Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:27 12:40 12:28 12:35 12:34 12:31 12:28 12:23 12:30 12:30

‘Ashar 15:54 16:07 15:54 16:02 16:01 15:57 15:54 15:50 15:57 15:56

Magrib 18:37 18:54 18:38 18:48 18:47 18:38 18:37 18:33 18:40 18:42



Shubuh Syuruq


19:52 20:09 19:53 20:03 20:02 19:52 19:52 19:47 19:55 19:57

04:43 05:52 04:43 04:47 04:48 04:51 04:44 04:40 04:46 04:44

04:53 05:02 04:53 04:57 04:58 05:01 04:54 04:50 04:56 04:54

L.Seumawe 12:33 L. Pakam 12:26 Sei Rampah12:25 Meulaboh 12:37 P.Sidimpuan12:24 P. Siantar 12:25 Balige 12:25 R. Prapat 12:22 Sabang 12:40 Pandan 12:26

06:14 06:24 06:15 06:19 06:20 06:23 06:16 06:12 06:18 06:16

Zhuhur ‘Ashar 16:00 15:53 15:52 16:04 15:51 15:52 15:52 15:48 16:07 15:53

WASPADA Sabtu 16 Juni 2012




Shubuh Syuruq


Zhuhur ‘Ashar




Shubuh Syuruq


18:46 18:37 18:36 18:48 18:31 18:35 18:34 18:30 18:55 18:34

20:01 19:51 19:51 20:03 19:46 19:49 19:48 19:45 20:10 19:48

04:45 04:42 04:41 04:52 04:45 04:42 04:44 04:41 04:51 04:46

04:55 04:52 04:51 05:02 04:55 04:52 04:54 04:51 05:01 04:56

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:26 12:28 12:38 12:30 12:27 12:34 12:22 12:33 12:26 12:25

18:34 18:37 18:51 18:39 18:38 18:46 18:32 18:43 18:34 18:35

19:48 19:52 20:06 19:53 19:53 20:01 19:47 19:57 19:48 19:50

04:46 04:45 04:50 04:49 04:43 04:48 04:40 04:49 04:45 04:41

04:56 04:55 05:00 04:59 04:53 04:58 04:50 04:59 04:55 04:51

Panyabungan 12:23 Teluk Dalam12:30 Salak 12:28 Limapuluh 12:24 Parapat 12:26 GunungTua 12:23 Sibuhuan 12:23 Lhoksukon 12:32 D.Sanggul 12:26 Kotapinang 12:21 AekKanopan 12:23

06:18 06:14 06:13 06:24 06:16 06:14 06:15 06:12 06:24 06:17

15:53 15:54 16:05 15:57 15:54 16:01 15:49 15:59 15:52 15:52

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

06:17 06:17 06:22 06:20 06:15 06:20 06:11 06:21 06:16 06:13

Zhuhur ‘Ashar 15:49 15:56 15:55 15:50 15:52 15:49 15:49 15:59 15:53 15:47 15:49




Shubuh Syuruq

18:29 18:36 18:37 18:34 18:35 18:30 18:29 18:45 18:35 18:29 18:32

19:43 19:50 19:51 19:48 19:49 19:44 19:43 20:01 19:49 19:43 19:46

04:44 04:52 04:46 04:40 04:43 04:43 04:43 04:45 04:45 04:40 04:41

04:54 05:02 04:56 04:50 04:53 04:53 04:53 04:55 04:55 04:50 04:51

06:16 06:23 06:18 06:12 06:15 06:14 06:15 06:17 06:16 06:12 06:12

Bukhari Kritis Ditebas Abang Kandung BESITANG (Waspada): Bukhari, 37, kritis akibat ditebas abang kandungnya dengan parang saat terjadi duel di dalam rumah orangtuanya di Dusun III, Desa Halaban, Kec. Besitang, Jumat (15/6) sore. Dalam kondisi tak berdaya, korban dilarikan ke RSU PT Pertamina P. Brandan guna mendapat pertolongan medis. Pantauan Waspada, luka menganga pada tengkuk korban terlihat cukup parah, begitu juga pada kakinya. Sejumlah petugas

medis berupaya memberi pertolongan untuk menyelamatkan jiwa pemuda itu. Menurut salah seorang petugas medis, korban

harus menjalani operasi. Kepala Dusun III Halaban Keude,Suparmono,yangditemui Waspada saat mengevakuasi korbankeRSUPTPertaminamengatakan, kedua bersaudara ini terlibat perkelahian, namun ia tidak tahu latar belakang keduanya sampai berkelahi sehingga membuat sang adik menderita luka serius. Ia menyatakan, warga baru mengetahuiterjadiinsidenberdarah ini setelah mendengar jeritan

ibukorban,Baren,65.Mendengar jeritan minta tolong, warga spontan berdatangan ke lokasi tempat kejadian perkara (TKP) untuk mencari tahu apa sebenarnya yang terjadi di dalam rumah itu. Masyarakat sangat terkejut begitu melihat tubuh Bukhari terkapardilantaibersimbahdarah. Untuk pertolongan pertama, warga membawa korban ke balai pengobatan terdekat, namun karena luka yang diderita pemuda berkulitputihitucukupserius,maka

ia dievakuasi ke RSU Pertamina. MenurutSuparmono,korban anak kedua dari lima bersaudara dansepengetahuannyakehidupan keluarga itu dari luar tampak harmonis.“Yangsayatahumereka rukun-rukun saja,” imbuhnya. Kasi Humas Polsek Besitang, Aiptu S. Nasution, dikonfirmasi Waspada menyatakan, pelaku Bu, sudah diamankan di Mapolsek. Menyinggung motif pembacokan, ia menyatakan masih dalam penyelidikan.(a02)

Deliserdang Kirim Utusan Ke Lomba Nasional

Waspada/Ibnu Kasir

BUPATI Langkat H.Ngogesa Sitepu,SH menandatangani prasasti peresmian Kantor BNN Kab. Langkat di Stabat.

Ingatkan Anak Tentang Bahaya Narkoba STABAT (Waspada): Segenap generasi muda bangsa harus dapat mempersiapkan dan membekali diri dengan ilmu pengetahuan danbudipekertisebaikmungkin,tentutanpapenyalahgunaannarkoba. “Sebagaiorangtua,hendaknyakerapmengingatkananak-anaknya akan bahaya narkoba,” kata Bupati Langkat H. Ngogesa Sitepu, SH pada syukuran peresmian Kantor Badan Narkotika Nasional (BNN) Kab. Langkat di Stabat, Kamis (14/6). Menurut Bupati, agar keberadaan kantor membawa harapan bagi rakyat Langkat agar terbebas dari penyalahgunaan dan peredaran gelap narkoba, sehingga dapat mendukung visinya mewujudkan masyarakat religius, maju, dinamis, sejahtera dan mandiri. Sementara Ketua DPRD H. Rudi Hartono Bangun, juga berharap agar dalam menjalankan tugas nantinya di Kab. Langkat, BNN selalu berkoordinasi baik di tingkat atas mau pun bawah karena pemberantasan narkoba juga tanggungjawab semua komponen, bukan hanya para aparat penegak hukum demi mewujudkan daerah Langkat terbebas dari narkoba. Sebelumnya Kepala Badan Narkotika Nasional Provinsi Sumatera Utara diwakili Kabid Pemberantasan Kompol Drs. Joko Susilo menyampaikan apresiasi kepada Pemkab Langkat di bawah kepemimpinan Bupati H. Ngogesa Sitepu SH, karena telah peduli dan menaruh perhatian yang besar terhadap misi P4GN (Pencegahan dan PemberantasanPenyalahgunaandanPeredaranGelapNarkoba),yang salahsatunyamemberipinjam-pakailahanuntukgedungkantorBNN.(a01)

LUBUKPAKAM (Waspada): Pemkab Deliserdang melalui Dinas Pendidikan, Pemuda dan Olahraga (Disdikpora) mengirim utusan untuk mengikuti perlombaan tingkat nasional, masingmasing Lomba Keterampilan Siswa Sekolah Menengah Kejuruan (LKS SMK) XX Tahun 2012 pada 18 s/d 22 Juni 2012 di Sasana Budaya Ganesha (Sabuga) ITB Bandung, dan lomba Apresiasi PTK-PAUDNI Berprestasi, 9 s/ d 11 Juli 2012 di Jakarta. Sebelum berangkat ke lomba tingkat nasional (Bandung dan Jakarta-red), peserta LKS SMK didampingi kepala sekolah dan koordinator LKS dan peserta Apresiasi PTK-PAUDNI mengadakanpertemuandenganBupati Deliserdang Drs. H. Amri TambunandiwakiliWabupH.Zainuddin Mars, di ruang rapat Lt II kantor bupati Deliserdang di Lubukpakam,Kamis(14/6)siang. Wabup H. Zainuddin Mars pada pertemuan dihadiri Kadis Pendidikan Pemuda dan Olah-

raga Hj. Sa’adah Lubis, SPd, M.AP, Kabid PLS Disdikpora Drs. H. Zul Syahrial, M.Pd, Kepala SMKN 1 Percut Seituan Drs. Kasni, M.Pd, KepalaSMKN1LubukpakamDrs. Kiniken, M.Pd, Koordinator LKS Tingkat Nasional Rakhmad Diatnmo dan sejumlah staf Disdikpora serta sembilan siswasiswi peserta LKS SMK (6 siswa SMKN 1 Percut Seituan, 2 siswa SMKN1Lubukpakamdan1siswa SMK PAB 1 Helvetia), bersama empat peserta lomba Apresiasi PTK-PAUDNI, menyatakan bangga atas prestasi yang dicapai hingga berhasil terpilih mewakili Sumut ke lomba tingkat nasional. “Pendidikan merupakan bagian terpenting bagi pembangunan bangsa,” ujar H Zainuddin Mars. Kepala SMK Negeri 1 Percut Seituan Drs. Kasni, MPd, menjelaskan pada LKS SMK tingkat Sumut,SMKDeliserdangberhasil meraih prestasi sebagai juara umum dengan menjuarai 9 mata lomba. Atas keberhasilan itu, sembilan siswa-siswa SMKN 1

Percut Seituan dan SMKN 1 Lubukpakam didampingi Kepala SMKN 1 Percut Seituan, Kepala SMKN 1 Lubukpakam dan KoordinatorLKSmewakiliSumut keLKSSMKXXtahun2012tingkat Nasional di Sabuga ITB Bandung. Ke sembilan siswa/i Handiarto (AutomobileTechnology), Niko Dharma Setiawan (Refrigration), M. Syahrial (Welding), Fajar Siddik(ProductionMachine),Violeta Charisman Saragih (Autocard), Rahmat Hidayat (Electronica Application), Nurhabil Ridwan(Joinery),CahayaJuniPurnawan(CabinetMaking)danNanda Libya Hasanah (Animation). Peserta lomba Apresiasi PTKPAUDNI, Nila Kesuma, S.Pd, (guru PAUD), Rosmaida Bancin SPd, (pengelola PAUD), Indra PrawiraST(pengelolaPKBM)dan Poniman Adyanto, S.Ag, (penilik PLS).Padakesempatanitu,secara simbolis Wabup H. Zainuddin Mars memberikan tali asih kepada seluruh peserta yang akan bertarung di tingkat nasional.(a06)


WALI KOTA Tangerang Selatan Hj. Airin Rachmi Diany, SH, MH, didampingi Wali Kota Tebingtinggi Ir. H. Umar Zunaidi Hasibuan, MM bersama Ketua DPRD kota Tangsel Bambang Rachmadi disambut tari persembahan.

Waspada/HM Husni Siregar

WABUP H. Zainuddin Mars (tengah) didampingi Asisten I H. Syafrullah, Kadisdikpora Hj. Sa’adah, Kabid PLS H. Zul Syahrial, Kabid Dikdasmenjur H. Idris, Ka. SMK 1 Percut Seituan Kasni, SMK 1 Lubukpakam Kiniken, diabadikan bersama para peserta lomba tingkat nasional.

Bupati DS: Budaya Adat Tapsel Perlu Dilestarikan PATUMBAK (Waspada): Di tengah derasnya arus globalisasi yang kini melanda Indonesia, budaya adat seperti budaya adat Tapanuli Selatan (Tapsel) sebagai khasanah kekayaan bangsa perlu dipertahankan dan dilestarikan dalam membangun semangat kebersamaan. Hal itu dikatakan Bupati Deliserdang Drs H. Amri Tambunan, dalamsambutantertulisnyadibacakan Staf Ahli Parlaungan Lubis pada deklarasi pendirian lembagaadatTapanuliSelatanMarindal sekitarnya, di Jalan Kongsi, Dusun IIIB,DesaMarindalI,Kec.Patumbak, Deliserdang, Minggu (10/6). Dikatakan Bupati, untuk meraihsuatukemajuandanprestasi, bukan terletak pada besarnya potensi sumber daya alam dan manusiayangdimiliki,melainkan semangat kebersamaan terus berjuang dengan memanfaatkan

setiap momentum yang dimiliki diaplikasikan melalui gerakan kebersamaan. Untuk itu, Pemkab Deliserdang akan terus memperhatikan danmendorongtumbuhnyalembaga-lembaga adat seperti lembaga adatTapsel, untuk dijadikan mitra kerja dalam upaya percepatan pembangunan daerah, khususnya di sektor seni dan budaya. Pemerintah juga berharap, agar seluruh lembaga-lembaga adatyangadadiDeliserdangterus bekerja keras, bahu membahu danbergandengtanganmemberi yang terbaik untuk percepatan pembangunan. Ketua lembaga adat Tapsel Marindal sekitarnya, H. Guntur HasibuandengangelarSutanParlindunganHasibuanmengatakan, pendeklarasian dan pendirian lembaga adat Tapsel Marindal sekitarnya guna mempertahan-

kan dan melestarikan budaya adat Tapsel yang kian memudar di kota-kota besar. Deklarasi pendirian lembaga adat Tapsel Marindal sekitarnya diawali lantunan onang-onang, dilanjutkan peletakan batu pertama Bagas Godang oleh Bupati Drs H. Amri Tambunan diwakili Staf Ahli Parlaungan Lubis dan ketua lembaga adat Tapsel Marindal sekitarnya H. Guntur Hasibuan,kemudianpembukaan selubung nama lembaga adat, dirangkai penanaman pohon penghijauan dan penyerahan 20 ribu bibit ikan lele kepada kelompok tani Desa Patumbak Kampung dan Desa Sigara-gara, disaksikan Camat Khairul Saleh Siregar, S.Sos dan seluruh staf, unsur Muspika, Kades se Kec. Patumbak, pengurus lembaga adat Tapsel Marindal sekitarnya dan masyarakat.(c02)

Wali Kota Binjai Wisuda Lulusan RA BINJAI (Waspada): Wali Kota Binjai HM Idaham, SH, M.Si dan KetuatimPenggerak PKK Ny. Lisa Andriani mewisuda lulusan Raudatul Afthal (RA), Rabu (13/6) di GOR Binjai. Wisuda diikuti 1.982 orang dari 85 sekolah RA di Kota Binjai, prosesnya dilaksanakan oleh Kemenag Kota Binjai. Wali Kota Binjai HM Idaham melakukan wisuda Rabu siang dan Ketua TP PKK, Ny. Lisa Andriani mewisuda lulusan RA pada sore hari.Wali Kota Idaham mengemukakan, perkembangan teknologi sangat berdampak terhadap akhlaq dan moral. Sebab itu anak sejak usia dini harus dibekali pendidikan berkarakter dan berakhlaq. “Saat ini orang pintar banyak, tapi orang berakhlaq dan berbudi pekerja sangat sedikit jumlahnya,” ujar Idaham di hadapan orangtua siswa. Wisuda siswa RA dihadiri Ka. Kemenang Binjai H. Al Ahyu, MA dan Ketua Iqra Siti Khadijah, S,Ag, Pengurus MUI Jafar Sidik, S.Ag, serta tokoh pendidikan dan agama di kota Binjai. Sementara Ketua TP PKK, Ny. Lisa Andriani berharap orangtua siswa, terus memperhatikan perkembangan anak, sehingga anak dapat melanjutkan pendidikan ke tahap lebih baik untuk masa depannya.(a04)

125 Siswa T. Tinggi Lulus PTN Jalur Undangan TEBINGTINGGI (Waspada): 125 Siswa SMA/ SMK Negeri dan swasta se Kota Tebingtinggi diterima berbagai Perguruan Tinggi Negeri (PTN) melalui jalur undangan Penelusuran Minat dan Prestasi (PMP). Untuk tingkat SMA total siswa yang diterima 111 orang, sedangkan SMK 14 orang. Demikian Kadis Pendidikan KotaTebingtinggi Drs. H. Pardamean Siregar, MAP, didampingi Kabid Pendidikan dan Pengajaran Drs. J Sitinjak, Jumat (15/6), di ruang kerjanya. Ditambahkan, dari 15 SMA Negeri dan swasta, SMA 2 menduduki ranking terbesar siswanya lulus di jalur PMP dengan total 34 siswa. Menyusul SMAN 1 sebanyak 21 siswa serta SMA Katolik Cinta Kasih 15 siswa dan SMAN 4 dengan 14 siswa. Berikutnya SMA RA Kartini meluluskan 12 siswa, SMAN 3 dengan tujuh siswa.

Sekolah lain yang meluluskan siswa di jalur PMP, yakni SMA Dipanegara 4 siswa, SMA Taman Siswa 3 siswa dan SMA Inti Nusantara dan SMA KF Tandean masing-masing 1 siswa. Sedangkan untuk SMK, SMKN 1 menduduki posisi tertinggi dengan kelulusan 7 siswa, SMKN 2 dan SMKYPD dengan 3 siswa, SMKN 3 dengan 1 siswa. “Mereka semua lulus di berbagai PTN,” ujar Pardamean. PTN yang berhasil mereka tembus, yakni UI, ITB, IPB, UNJ, UNAIR, STIPER, UNS, UNDIP, UDAYANA, Andalas, USU, Unimed, Unimal, Poltekmed, Poltekpos, Unibraw, Unsrat Mulawarman dan Unpad. Dari jumlah PTN itu, Unimed, IPB dan USU menduduki posisi tertinggi menyerap siswa Kota Tebingtinggi. Unimed 28 siswa, IPB 20 orang dan USU 18 orang. Kemudian Unibraw 12 siswa dan Stiper 10 siswa.(a09)

Dugaan Korupsi Rp34 M Diselidiki

Wako Tangsel Puji Kebersihan Dan Tata Ruang T. Tinggi TEBINGTINGGI (Waspada): Wali Kota Tangerang Selatan Hj. Airin Rachmi Diany, SH, MH, memuji kebersihan dan tata ruang kota Tebingtinggi yang tertata baik. Jalanan kota yang bersih serta bangunan yang tertata rapi, ujar Wali Kota Tangsel, menjadi daya tarik kota yang harus dipertahankan. Hal itu disampaikan Hj Airin Rachmi, kemarin, usai temu ramah dengan unsur MuspikoTebingtinggi di ruang data Sekretariat Pemko. Wako Tangsel bersama jajarannya, melakukan kunjungan balasan, setelah sebelumnya Wali Kota Tebingtinggi Ir. H. Umar Zunaidi Hasibuan MM, kunjungan kerja dan menanda tangani kerjasama antar kedua kota, April lalu. Paketkerjasamakeduakota,fokuspadabeberapahal,yaknisektor kesehatan,pendidikan,UMKMdanlingkunganhidup.Nantinya,instansi terkait akan melakukan berbagai kegiatan menindak lanjutinya. Wali Kota Tebingtinggi Ir. H. Umar Zunaidi Hasibuan, MM mengatakanadasejumlahpelajaranbisadiambildarikotapemekaran baru itu.Yakni peningkatan PAD yang sangat signifikan.Wali Kota juga menekankan akan melakukan kerjasama dalam memperkenalkan kedua kota.(a09)


PETUGAS medis RSU PT Pertamina memberi pertolongan kepada Bukhari yang kritis dibacok abang kandungnya.

Waspada/ Riswan Rika

WALI KOTA HM Idaham didampingi Ka. Kemenag H. Al Ahyu, MA bersama siswa RA yang diwisuda.

STABAT (Waspada): Kejari Stabat menyelidiki dugaan penyimpangan penyaluran DAK tahun 2010/2011 di Dinas Pendidikan Langkat senilai Rp34 miliar. Selain itu juga dilakukan penyelidikan atas dugaan korupsi hibah blogren berupa pengadaan alat-alat penunjang pendidikan seperti hardware dan software komputer Rp2,1 miliar. Demikian disampaikanKajariStabatAsepNana Mulyana didampingi Kasi PidWaspada/Abdul Hakim sus Chairun Parapat bersama KAJARI Stabat Asep Nana Mulyana didampingi Kasi Intel dan KasiIntelZulfahmi,dihadapan Kasi Pidsus memberi keterangan terkait perkembangan penyelidikan belasan mahasiswa yang ber- dugaan korupsi. unjukrasa menuntut Kadis Pendidikan Langkat, Syam Sumarno ditahan, kuat akan ditingkatkan ke tahap penyidikan. Kamis (14/6). Sementara jika tidak memiliki cukup data dan Khusus untuk penyelidikan dugaan korupsi bukti, maka proses peyelidikan akan dihentikan hibah blogren, ditambahkan Chairun Parapat dan kami siap mempertanggungjawabkannya,’’ pihaknya telah memeriksa 70 penerima bantuan, ujar Asep Nana Mulyana. semua dari kalangan kepala sekolah. Selain itu Pengunjukrasa minta penyidik serius menyebeberapa PNS Dinas Pendidikan seperti Kasi lidiki dugaan korupsi. Mereka tidak menginginkan Dikdas Legiman, penerima barang Rajianto ada oknum penyidik kejaksaan mengambil bahkan oknum kepala dinas telah dimintai kete- keuntungan dalam perkara tersebut. ‘’Jika benarrangan.‘’Penyelidikankinitahapmintaketerangan benar terlibat yang bersangkutan harus ditahan,’’ saksi ahli sebelum ditentukan kerugian negara. kata perwakilan pengunjukrasa. Mohon bersabar, mudah-mudahan dalam waktu Sehari sebelumnya, pantauan Waspada, dekat ada perkembangan penyelidikan,’’ kata beberapa PNS Dinas Pendidikan kembali diperiksa Chairun kepada wartawan. di ruang Pidsus Kejari. Salah seorang di antaranya Saat berdialog dengan pengunjukrasa, Kajari terlihat Kasi Pengadaan Dinas Pendidikan Langkat, menuturkan tidak ada sesuatu hal yang ditutupi Irawan. Dia mengenakan pakaian sipil. Dalam dalam penyelidikan ini, hanya saja ada poin-poin penyelidikan dugaan korupsi, oknum rekanan yang belum dapat disampaikan karena menyang- yang terlibat membeli barang juga beberapa kali kut kepentingan penyelidikan. ‘’Kami akan dipanggil penyidik. Beredar kabar, AP, rekanan sampaikan hasil penyelidikan. Jika memiliki bukti menghilang setelah beberapa kali diperiksa. (a03)

Warga Banten Dukung Amri Tambunan Jadi Gubsu TANJUNGMORAWA (Waspada): Ketua Paguyuban Banten Sumatera Utara (Pabansu) Kabupaten Deliserdang A Rivai, SH menegaskan, sosok Bupati Deliserdang Drs H Amri Tambunan pantas memimpin Sumut. Karena itu, warga Banten mendukung pencalonan AmriTambunan sebagai Gubsu. “Sudah saatnya warga Banten bersatu dan menentukan sikap. Jumlah warga Banten yang signifikan akan menentukan kemajuan Sumut ke depan,” ungkapnya seusai dilantik di Lapangan Sepakbola Kampung Banten, Desa Buntu Bedimbar, Tanjungmorawa, Minggu (10/6). Dikatakan, saat kini komunitas Banten sudah menunjukkan sikap mendukung program pembangunanyangbergulirdiDeliserdang,sebab proses pembangunan di daerah itu dengan mensinergikan tiga pilar kekuatan melalui gerakan Deliserdang membangun (GDSM), telah memberikan manfaat luar biasa bagi masyarakat. Sosok Amri Tambunan, lanjutnya, bukan orang asing bagi warga Banten. ‘Beliau adalah orangtua, warga Banten menjadi anak kandungnya’, dibuktikan bukan hanya saat pengurus Pabansu Deliserdang beraudiensi, tetapi juga di berbagai kesempatan lain. Hal senada ditegaskan Ketua DPP Pabansu

BaharuddinSyahputra.Menurutnya,darisejumlah Pabansu yang sudah terbentuk di kabupaten/ kota se-Sumut, kini anggota Pabansu sudah mencapai lebih 70 ribu kepala keluarga. Kekuatan besar tersebut, imbuh Baharuddin, harus menjadi hal yang diperhitungkan bagi siapa pun yang akan memimpin Sumut. Khusus di Deliserdang, 12 ribu warga Banten bergabung di Pabansu. “Mari bersatu menyamakan persepsi dan memperkokoh kebersamaan,” katanya. Pelantikan yang mengusung tema ‘Banten Bager, Banten Jawara, Sadulur Sampe ka Liang Kubur’ (Banten kuat, Banten jawara, bersaudara hingga ke liang kubur) itu, diharapkan menjadi tolok ukur bagi peningkatan silaturahmi demi persatuan dan kesatuan bangsa. Diharapkan pula, pengurusyangdilantikmampumenjalinkerjasama dengan Muspida, ormas, dan masyarakat luas. Bersamaan, Bupati Drs H. Amri Tambunan melalui Wakil Bupati Zainuddin Mars membanggakankebersamaanyangterjalinantarsesama warga Banten, apalagi masyarakat luas mahfum dengan keberadaan Banten yang berani. Meski kondisi keuangan pemkab sangat minim, namun kemajuanpembangunandicapaiberkatdukungan kalangan swasta dan masyarakat, tanpa terkecuali dukungan dari warga Banten.(c02)

Sumatera Utara

WASPADA Sabtu 16 Juni 2012


DPP IMA Madina Somasi PT Sorik Mas Mining MEDAN (Waspada): Dewan Pimpinan Pusat Ikatan Mahasiswa Mandailing Natal (DPP IMA Madina) melayangkan somasi terhadap PT Sorik Mas Mining (SMM) di Madina. Menurut mereka, keberadaan PT SMM tidak bermanfaat bagi masyarakat Madina, menyangkut kelangsungan hidup dan kemakmuran sejak dimekarkan dari Tapanuli Selatan. Ketua Umum DPP IMA Madina Ahmad Irwandi Nasution mengatakan itu kepada wartawan di Medan, usai menyampaikan surat somasi yang ditembuskan kepada Kapoldasu

Irjen Wisjnu Amat Sastro, Jumat (15/6). Dia didampingi Sekretaris RahmadRiskiRangkutidanKabid Lingkungan Hidup Irwan Lubis. Menurutnya, aspirasi masyarakat yang disampaikan

kepada PT SMM tidak pernah ditanggapi serius, termasuk kepemilikan saham Pemkab Madina sebagai perwakilan masyarakat untuk kepentingan program pembangunan, dengan proporsi PT SMM 49%, Pemkab 26%danPTAnekaTambang25%. “Dengan begitu proporsi saham Pemkab menjadi 51% dan modal asing49%.Itusalahsatupoinyang akandisampaikan,”kataNasution. Dikatakan, surat permohonan pinjam pakai kawasan hutan PT SMM No. 026/SM/IV/2010 tertanggal 16 April 2010 tentang permohonan izin pinjam pakai

kawasan hutan untuk kegiatan eksploitasi emas dan mineral pengikutnya di proyek Sihayo penyambung wilayah kontrak karya PT SMM dan administrasi lainnya, diterbitkan pada saat status areal kontrak karya masih dalam areal kawasan Taman Nasional Batang Gadis yang cacat hukum, sehingga sangat patut dibatalkandantidakmenerbitkan surat rekomendasi baru. “Poin ini sudah disampaikan pada rapat dengar pendapat gabungan dengan Komisi B, Komisi D, Dinas Pertambangan dan

EnergiProvsu,BadanLingkungan Hidup (BLH) Provsu dan Dinas Kehutanan pada 17 April 2012 di DPRD Sumut,” ujarnya. Sekretaris DPP IMA Madina Rahmad Riski Rangkuti menambahkan, Bupati Madina Hidayat Batubara juga sudah menyurati Menteri ESDM untuk melibatkan Pemda dalam proses perizinan lanjutan PT SMM sebagaimana digariskan dalam UUNo.04/2009tentangMinerba. Danhalini,katadia,sudahdisampaikan pada rapat dengar pendapat di DPRD Sumut.(m27)

Ancaman Longsor Jalan Nasional P.Siantar-Parapat Makin Serius SIMALUNGUN (Wapada): Ancaman longsor jalan nasional menghubungkan Pematangsiantar – Parapat, persis di Km 22, Kec. Dolok Panribuan, Kab. Simalungun, semakin serius. Kondisinya bahkan sudah mengancam keselamatan pengguna jalan, karena longsor sudah menyentuh sepertiga badan jalan. AmatanWaspada di lapangan, longsor semakin hari semakin melebar dan kini sudah menyentuh hingga separuh badan jalan. Akibatnya membuat para pengemudi kendaraan yang akan melintas harus ekstra hati-hati. Terlebih di saat kendaraan saling

berpapasanharusdilakukansecara bergantian.Sedangkantanda-tanda jalan tersebut sedang mengalami kerusakandibuathanyasederhana dengan mema-sang gundukan tanah di sisi jalan yang longsor. Ironisnya, meski rawan kecelakaan akibat kerusakan ruas jalan tersebut, tidak satupun petugas baik dari Dinas Perhubungan maupun kepolisian yang terlihat melakukan pengamanan di sekitarnya. Jika kerusakan ruas jalan nasional tersebut tidak segeradiperbaiki,sangatdikhawatirkan menyebabkan terputusnya ruas jalan tersebut, dan mengganggu hubungan transportasi

Taksi Kita Bersama Belum Santuni Korban Kecelakaan P. SIDIMPUAN (Waspada): CV. Taksi Kita Ber-sama (TKB), angkutan umum jenis L300 dengan trayek antar kota antar provinsi yang berkantor pusat di Kota Padangsidimpuan, hingga kini belum menyantuni korban tewas akibat kecelakan mobil BB 9111 LR di Lubuk Sikaping, Prov. Sumatera Barat. “Sampai sekarang belum ada, padahal kecelakaan itu terjadi 20 Mei kemarin,” ujar Rika Deni Putri dan Sofyan, istri dan abang ipar almarhum Mahdum Fadli, 29, kepada wartawan di Padangsidimpuan, baru-baru ini. Kenapa TKB yang memberi santunan dan bukan Jasa Raharja. Katanya, mobil BB 9111 LR yang kecelakaan tersebut sama sekali tidak terdaftar di Jasa Raharja. Sehingga semua akibat yang timbul dalam perjalanan merupakan tanggungjawab perusahaan angkutan tersebut. Menurut Sofyan, almarhum Mahdum Fadli merupakan pegawai negeri sipil (PNS) di KPU Kota Padangsidmpuan dengan jabatan terakhir Plt. Kasi Umum. Saat kecelakaan, Minggu (20/5) pukul 03:00, korban sedang dalam perjalanan pulang menuju P.Sidimpuan usai kuliah pasca sarjana di Padang. Ketika ditemui, dia dan istri almarhum baru saja mengurus administrasipengurusanTaspenalmarhumdiKPUPadangsidimpuan. Ketika itulah mereka mengungkapkan bahwa hingga saat ini ahli waris belum mendapat kepastian apakah CV. TKB akan memberikan santunan atau tidak. Secara terpisah Kacab TKB, Faisal, ketika dikonfirmasi waratwan via selular mengatakan, pihaknya telah mempertemukan keluarga almarhum dengan pemilik mobil. Si pemilik mobil minta tenggang waktu 10 hari untuk memberikan santunan kepada ahli waris. (a27)

Warga Batahan Minta Pemkab Perbaiki Jalan Dan Jembatan PANYABUNGAN (Waspada): Warga Kec. Batahan meminta Pemkab Mandailing Natal (Madina) segera memperbaiki badan jalan melewati jalur Kubangan Tompek, karena jalur tersebut merupakan transportasi alternatif menghubungkan Batahan dengan Kec. Natal, karena jaraknya hanya sekira 18 km. Selain perlunya perbaikan jalan, sarana jembatan berada di titik penyeberangan Sari Kenanga, juga sudah sepantasnya mendapatkan perhatian dari pemerintah daerah setempat. Romadi sebagai salah seorang tokoh pemuda Batahan mengatakan Sabtu ( 9/6), selama ini ada dua jalur yang bisa digunakan masyarakat dari Batahan menuju Natal. Pertama, jalur transmigrasi unit III dan IV dan satu lagi jalur Kubangan Tompek. Menurutnya, untuk melewati jalur transmigrasi harus menempuh perjalanan sekira 30 km. “ Pada tahun-tahun sebelumnya, warga selalu melewati jalur itu karena kondisi jalannya masih baik dan beraspal. Tapi kini, warga tidak lagi menggunakan jalur itu akibat kondisinya hancur dan dipenuhi lumpur bahkan di sana ada jembatan yang putus ,” ungkapnya. Sebagai pilihan realistis, katanya, warga saat ini hanya melalui jalur Kubangan Tompek yang jarak tempuhnya 18 km. Meski kendaraan tetap kesulitan melintasinya akibat kondisi badan jalan yang masih tanah merah dan keberadaan jembatan di titik Sari Kenanga terbuat dari batang kelapa, jalur tersebut tetap menjadi alternatif bagi masyarakat. Karena itu, ia berharap agar Pemkab Madina sesegera mungkin membangun jalan dan jembatan berada di jalur itu. “ Harapan masyarakat inicukupberalasan,karenasangatpentingdalammobilisasi perekonomian Batahan. Apalagi daerah kami memiliki sumber daya alam yang luar biasa seperti potensi laut, perkebunan dan pertanian, tetapi pengangkutannya selalu terkendala akibat sarana insfrastrukturjalandanjembatanyangkurangmendapatkanperhatian dari pemerintah,” tururnya.(a28)

darat dari Pematangsiantar ke sejumlahdaerahdiwilayahpantai barat Sumatera Utara seperti, Tobasa, Tapanuli Utara, Sibolga, dan Tapanuli Tengah. Terkait dengan keadaan itu, pihak Pemkab Simalungun melalui Kabag Humas Mixnon Andreas Simamora mengatakan, Pemkab Simalungun sudah menyampaikan kerusakan ruas jalannasionaldikilometer22,Kec. Dolok Panribuan kepada pemerintah provinsi untuk diteruskan

ke pemerintah pusat. “Pemkab Simalungun hanya bisa menyampaikan informasi kerusakan ruas jalan nasional tersebut dan mengharapkan penanganannya, karena penanganan ruas jalan nasional merupakan kewenangan pemerintah pusat,” ujar Simamora. Anggota DPR RI, AliWongso Sinaga mendesak pemerintah pusat untuk segera menangani kerusakan ruas jalan nasional menuju Parapat,sebelum kon-

Bocah Tewas Korban Tabrak Lari disinyasemakinparahdanmengganggu hubungan transportasi darat ke sejumlah daerah di wilayah pantai barat. “ Kita akan pertanyakan ke kementerian pekerjaan umum, mengapa ruas jalan nasional menujuParapatbelumditangani, dankitaakandesaksupayasegera ditanggulangi, sehingga transportasi darat dari Pematangsiantar menuju sejumlah daerah di wilayah pantai barat tidak terputus,” tegas Sinaga.(a29)

Tewas, Kaki Dan Tangan Terikat PEMATANGSIANTAR (Waspada): Sesosok mayat pria yang diduga korban pembunuhan, ditemukandengankondisikedua tangan dan kaki diikat tali sepatu serta hidung mengeluarkan darah, pelipis kiri luka memar dan leher seperti bekas dijerat pakai talidisatulokasiperkebunandiwilayah hukum Polres Simalungun. Korban dalam keadaan sudah meninggal pertama kali ditemukan seorang karyawan perkebunan, Heriansyah di sela-sela pohon kelapa sawit perkebunan PTPN 3 di Dusun Ulu, Desa Sei Mangkei, Kecamatan Bosar Maligas, Kabupaten Simalungun pada Jumat (15/6) pukul 07:00. Mayat pria yang belum diketahui identitasnya itu memiliki ciri-ciri tubuh tegap dengan tinggi lebih kurang 160 cm dan memiliki kulit warna sawo matang. Saat ditemukan, korban

mengenakan baju kaos berwarna putih, celana pendek merk Lee serta di dekat tubuh korban ditemukan kantongan plastik kresek berisi sepasang pakaian pria, sepatu kulit warna coklat dan HP merk Nokia yang tidak ada kartunya. Penemuan mayat itu segera dilaporkan ke Polsek Bosar Maligas, dan Kapolsek Bustami SH bersama personelnya segera mendatangi tempat kejadian. Sesudah melakukan olah tempat kejadian serta memfoto mayat korban, Kapolsek bersama personelnya membawa mayat korban ke RSUD Dr. Djasamen Saragih untuk diotopsi guna mengetahui penyebab kematian korban. Kapolres Simalungun AKBP M. Agus Fajar H, S.Ik, saat dikonfirmasi melalui Kasubbag Humas AKP H. Panggabean SH, Kasat Reskrim AKP M. Adenan AS, SH,

S.Ik,MH,danKapolsekBosarMaligas AKP Bustami SH, menyebutkan penemuan mayat itu masih dalam penyelidikan. Menjawab pertanyaan, Kapolsek menyebutkan ada dugaan korban dibunuh sesuai keterangan pihak rumah sakit dan pembunuhan itu diduga dilakukan di tempat lain pada malam sebelum korban ditemukan di lokasi perkebunan pada pagi harinya. Korban diduga lebih dulu dipukul dan selanjutnya lehernya dijerat dengan sejenis tali hingga meninggal. Kemudian, kedua tangan dan kakinya diikat dengan talisepatudanseterusnyadibuang ke lokasi perkebunan. Saat ini, mayat pria itu masih di RSUD Dr. Djasamen Saragih menunggu keluarga atau pihak-pihak yang mengenal korban.(a30)

SKPD Gunungsitoli Berkomitmen Tanggulangi Kemiskinan GUNUNGSITOLI (Waspada): Beberapa Satuan Kerja Perangkat Daerah (SKPD) Kota Gunungsitoli bersama lintas sektoral dalam program pemberdayaan masyarakat memperkuat koordinasi dan komitmen untuk menanggulangi pengentasan kemiskinan di daerah itu . Salah satu langkah dalam pengentasan kemiskinan di daerahKotaGunungsitolidengan menggelar seminar lokakarya (semiloka) antara SKPD yang langsung terlibat dalam program PNPM–MandiriPedesaanseperti Badan Pemberdayaan Masyarakat (BPM), Dinas Pemberdayaan Perempuan Keluarga Berencana (PPKB) dan Bagian Pemerintahan Desa Setda Kota Gunungsitoli bertempat di Aula SamaeriLantai II KantorWali Kota Gunungsitoli, Kamis (14/6). Kepala Badan PemberdayaanMasyarakatKotaGunungsitoli, Oimonaha Waruwu pada laporannya mengatakan semiloka yang digelar berdasarkan surat Dirjen Pemberdayaan Masyarakat dan Desa, Kemendagri tentang petunjuk teknis perihal pencairan dana urusan bersama PNPM-MP. Selain itu Semiloka bertujuan untuk memperkuat koordinasi lintas sektoral dalam

program pemberdayaan masyarakat maupun dalam penanggulangan kemiskinan di Kota Gunungsitoli. Oimonaha menjelaskan dalampenyelenggaraanSemiloka tersebut, ada 3 materi yang akan dipaparkanolehnarasumberyang berasaldariDinasSosial,BPM,DInas PPKBdanPemdessertaBankBRI Cabang Gunungsitoli. Materi yang dibawa adalah strategi penanggulangan kemiskinanmelaluidanabantuansosial oleh Kepala Dinas Sosial, Tenaga Kerja dan Transmigrasi Kota Gunungsitoli, materi tentang kemitraan dunia perbankan dalam mendukung ekonomi kerakyatan oleh Pimpinan Cabang PT. Bank BRI Gunungsitoli dan Proyek PNPM-MP oleh Kepala BPM, PP, KB dan Pemdes Kota Gunungsitoli. Sementara beberapa hal yang menjadi sasaran capai yang diharapkan pada Semiloka tersebut adalah untuk menguatkan komitmen SKPD dalam penanggulangan kemiskinan dan pemberdayaan masyarakat di Kota Gunungsitoli. Menguatkan komitmen SKPD dalam mengembangkansistempembangunan daerah melalui sistem anggaran yang berpihak pada rakyat

miskin serta meningkatkan pemahaman SKPD di Kota Gunungsitolidanseluruhpihakyang terlibat dalam PNPM, agar mampu memberikan kontribusi dandapatmelaksanakankegiatan secara terintegrasi di dalam pembangunan daerah. DitempatyangsamaWaliKota Gunungsitoli diwakili Sekretaris Daerah Kota Gunungsitoli, Drs. Firman Harefa S.Pd, M.Si, yang membuka Semiloka tersebut mengatakan program PNPM Mandiri Pedesaan adalah salah satu program pemerintah dalam penanggulangankemiskinandan pemberdayaan masyarakat. KotaGunungsitolisebagaidaerah otonomibaru,telahmemfasilitasi pelaksanaan PNPM Mandiri Pedesaanselamaduatahunberturut turut dan hasilnya telah dinikmati oleh masyarakat. Pada bagian lain Firman Harefamenjelaskantahun2012,Kota Gunungsitoli kembali mendapat sumbangsihdanaPNPM-MPdari pemerintah pusat sebesar Rp12.240.000.000 dan dana daerah untuk urusan bersama yang bersumber dari dana APBD Kota Gunungsitoli TA 2012 sebesar Rp1.360.000.0000, sehingga keseluruhan berjumlah Rp13,6 milliar.(a25)

Tes Kesemaptaan Syarat Naik Pangkat PEMATANGSIANTAR (Waspada): Untuk memenuhi persyaratan usul kenaikan pangkat periode 1 Oktober 2012, para prajurit jajaran Korem 022/PT harus melaksanakan tes kesamaptaan jasmani. Tes kesamaptaan jasmani itu langsung dipimpin Kajasrem 022/ PT Kapten Inf Margana dan dilaksanakan di lapangan sepakbola Makorem 022/PT, Jalan Asahan, Pematangsiantar, baru-baru ini. Sebelum pelaksanaan tes kesamaptaan jasmani, para peserta lebih dulu melaksanakan pemeriksaan kesehatan dari Tim Kesehatan Denkesyah 01.04.01 Pematangsiantar. Itu dilakukan, selain sebagai salah satu syarat sebelum pelaksanaan kesamaptaan, juga mencek kesehatan para peserta dan sekaligus mencegah hal tidak diinginkan. Kapenrem 022/PT Mayor Caj Drs. Prinaldi menegaskan kenaikan pangkat bagi seorang prajurit bukanlah hal mudah, tapi harus melalui penilaian yang objektif serta melalui tahap–tahap yang sudah ditentukan seperti melaksanakan samapta. Menurut Kapenrem, kemampuan dan keterampilan prajurit akan teruji bila samaptanya baik, dimana jasmani merupakan tolak ukur bagi prajurit serta dengan jasmani yang prima, tugas apapun yang diberikan negara bagi prajurit akan mampu diemban. “Selain itu, tes kesegaran jasmani merupakan salah satu syarat untuk kenaikan pangkat dan pendidikan bagi seorang prajurit. Nilai minimal bagi yang menjabat staf yakni 61 dan bagi menjabat komandan nilainya 65. Bagi personel yang tidak memenuhi nilai standaritu,tidakakandiusulkanuntukkenaikanpangkatnya,termasuk untuk usul pendidikannya,” ujarnya. (a30)

Waspada/Dede Basri Hasibuan

GAGAL PANEN PADI: Warga Desa Batu Karang sudah empat tahun terakhir gagal panen padi, disebabkan hama atau virus yang hingga sekarang masyarakat yang tersebar sebagai petani padi di Kab. Karo tidak juga mendapat solusi dari Pemkab setempat. S alah satu warga sedang menunjukkan padi miliknya yang gagal panen, dengan kerugian sekira puluhan juta rupiah.

Waspada/Edoard Sinaga

TES kesamaptaan jasmani sebagai persyaratan usul kenaikan pangkat prajurit Korem 022/ PT dilaksanakan di lapangan sepakbola Makorem 022/PT, Jalan Asahan, Pematangsiantar.

SIMPANG EMPAT (Waspada): Marcel Perangin-angin, 5, warga Desa Surbakti, Kec. Simpang Empat, Kab. Karo tewas di Rumah Sakit Umum (RSU) Kabanjahe Rabu (13/6), setelah ditabrak lari sebuah mobil. Mobil yang menabrak bocah ini di Desa Ndokum Siroga, Kec. Simpang Empat, masih terus diburu Satuan Lantas (Sat Lantas) Kabanjahe. Amatan Waspada di lokasi, uang recehan serta darah segar masih terlihat di sisi jalan Desa NdokumSironga,yangmenghubungkankeDesa Surbakti hingga sampai Kec. Payung. Isak tangis bibi korban tidak bias terbendung, saat berhadapan dengan Kapolsek Simpang Empat, AKP Kandar yang terjun langsung ke lokasi. “Dia (korban) datang bersama ibunya ke rumah saya, untuk melihat kondisi saya yang baru ke luar dari rumah sakit. Saya dan ibu korban asik mengobrol di dalam rumah, hingga

sampai ketiduran. Entah bagaimana ceritanya, korban ke luar dari rumah, dan tiba-tiba teriakan tetangga mengejutkan kami, akibat ada korban yang ditabrak lari oleh sebuah mobil, antara mobil KijangKapsul,danPantherwarnahgelap.Menurut warga sekitar yang melihat, mobil langsung melaju kencang ke arah Kecamatan Payung,” terang bibi korban, Erni, dengan isak tangis kepada petugas, dan Waspada. Informasi diperolehWaspada, tabrak lari yang terjadi sekira pukul 11:30 hingga korban tewas di RSU Kabanjahe, sekira pukul 13:00, sorenya dibawa pulang oleh pihak keluarga, ke rumah duka. Kasat Lantas AKP Radu ketika dikonfirmasi Waspada mengatakan, dia bersama personel Sat. Lantas Kabanjahe, sedang mencari mobil yang nomor platnya sudah disampaikan berapa warga kepada petugas. (c19)

Aparatur Pemkab Samosir Diminta Taati SE Bupati SAMOSIR (Waspada): Surat Edaran Bupati Samosir No 166 Tahun 2011 tanggal 17 Februari 2011 seiring dengan Reformasi Birokrasi dan untuk mewujudkan tahun 2011 menjadi tahun pemantapan kinerja yang berdisiplin dan berbudaya di antaranya mengevaluasi disiplin waktu bekerja mempedomani dan melaksanakan PP RI no53tahun2010danperaturanBKNRIno21tahun 2010 tentang disiplin pegawai negeri sipil. PantauanWaspada,Jumat(15/6)hinggapukul 14:00 beberapa pimpinan SKPD di antaranya Kepala Inspektorat, Kepala Kesbang Linmas dan beberapa Kabag Setdakab Samosir tidak berada di kantor sehingga pelayanan publik sesuai Surat Edaran Bupati Samosir terabaikan. Di samping itu, beberapa pimpinan SKPD

PemkabSamosiryangseringkeluardaerahdengan alasan tugas luar tidak ada meninggalkan surat yang menjadi sumber informasi bagi publik. Seperti halnya Kepala BKDTombor Simbolon yang hendak ditemuiWaspada, Jumat (15/6) tidak di kantornya, namun salah seorang stafnya mengatakansedangtugasluartanpamenyebutkan kemana tujuannya. Bupati Samosir Ir. Mangindar Simbolon diminta lebih menyarankan penegakan disiplin waktu untuk kepentingan pelayanan publik yang lebihprimadisampinguntukmenghindarikorupsi waktu pada jam kerja sesuai petunjuk dari Kementerian PAN dan Reformasi Birokrasi, ujar pemerhati sosial Pardamean Naibaho di Pangururan. (c11)

Pencetakan Sawah Baru Di Madina, Terobosan Di Bidang Pertanian PANYABUNGAN (Waspada): Kepala Dinas Pertanian dan Peternakan Madina Taufik ZulhandraRitongamengatakan,adanyaprogram pencetakan sawah baru di berbagai kecamatan di Kabupaten Mandailing Natal, merupakan terobosan maupun langkah paling tepat untuk memajukan bidang pertanian di daerah itu. “Artinya penambahan areal persawahan di Madina sangat dibutuhkan guna mengimbangi alihfungsilahanlahanyangsemulaberfungsisebagai media bercocok tanam (pertanian), berangsurangsurberubahmenjadimultifungsipemanfaatan ,” katanya di Panyabungan, Minggu (10/6). Menurutnya,programDinasPertanianuntuk menambah areal sawah baru seluas 600 hektar di DesaTunas Karya Sikarakara Kecamatan Natal dan Banjar Aur Utara Kecamatan Batahan pada tahunlalu,merupakanlangkahpalingtepatuntuk menjamin ketersediaan dan kebutuhan pangan rakyat di sana. Masyarakat di pantai barat katanya, sangat membutuhkan lahan untuk usaha pertanian dan diharapkan bisa dikontribusikan di kawasan transmigrasi. Perananannya tidak hanya untuk ketahanan pangan, tapi juga peningkatan pendapatan masyarakat. Begitujugahalnyakucurandanayangditerima dari pemerintah pusat pada tahun 2012 ini, yang akan dialokasikan untuk pencetakan sawah baru seluas 700 hektar di Kecamatan Siabu dan Lingga Bayu, sangat dibutuhkan untuk keperluan peningkatan ketahanan pangan di daerah ini. “Pencetakan sawah baru diharapkan dapat

meningkatkan produksi beras untuk Madina, karena akan bisa menghasilkan produksi 5-6 ton per hektar untuk panen perdana. Program ini juga bertujuan untuk meningkatkan partisipasi petani demi meningkatkan kesejahteraan masyarakat dengan produksi tani ,” terangnya. Di sisi lain menurutTaufik Zulhandra Pemkab MadinamelaluiDinasPertaniantelahmenargetkan harus tetap mampu mempertahankan swasembada beras. Sehingga perlu diupayakan penambahan luasan lahan sawah guna menghindari rawan pangan serta ketergantungan beras dari daerah lain, dengan cara memamfaatkan lahanlahan potensial. Madina telah menjadi ikon sebagai sentra produksi padi. Sebagai salah satu sentra penghasil gabah di Sumut, tentu harus dipertahankan, bahkan lahan yang dikembangkan harus terus bertambah dengan mengembangkan sarana pertanian agar lahan-lahan yang terlantar bisa diolah dan produktif kembali. “Program pencetakan sawah baru sendiri merupakan salah satu upaya ke arah itu. Yang jelas, cetak sawah baru bertujuan untuk mengimbangi pengurangan lahan terjadi setiap tahunnya,” jelasnya. Taufik juga menuturkan, jika cetak sawah baru terlaksana tahun ini, maka pada tahun depan sawah-sawah tersebut bisa berkontribusi kepada produksi beras di kedua kawasan akan tersedia. “ Pencetakan berkelanjutan perlu dilaksanakan guna menjadikan wilayah Madina tetap sebagai salah lumbung padi di Sumut ,” terangnya.(a28)

Plt Bupati Palas Diminta Mutasi Pejabat Tak Proaktif SIBUHUAN (Waspada): Plt Bupati Padang Lawas (Palas), H Ali Sutan Harahap (TSO) diminta segera mutasikan pejabat yang tidak pro aktif menjalankan tugas dan fungsinya dalam mewujudkan visi misi pemerintah kabupaten Padanglawas. “Jangan ragu-ragu melaksanakan memutasi jabatan di lingkungan Pemkab Palas demi percepatan pembangunan,” ujar aktivis Gerakan RakyatBerjuangKabupatenPalas,MardanHanafi Hasibuan SH kepada wartawan, Senin (11/6). Menurutnya, Plt Bupati Palas tidak perlu ragu-ragu membuat kebijakan jika memang diperlukan melakukan mutasi jabatan untuk penyegaranbirokrasidilingkunganpemerintahan Kabupaten Palas. Karena sudah hampir dua bulan pemerintahan Padanglawas dipercayakan Mendagri melalui Gubsu kepada Plt Bupati, H Ali Sutan Harahap untuk memimpin pemerintahan Padanglawassepertinyamasihdiwarnaikeraguan, sehingga pemerintahan tidak dapat berjalan dengan baik. Dengan ditunda-tundanya pelaksanaan mutasi jabatan, secara fsikologis sangat berdampak terhadap kinerja Satuan Kerja Perangkat Daerah (SKPD). “Sejak awal seharusnya jangan sampai ada isu akan dilakukan mutasi ataupun usulan mutasi jabatan kalau memang merasa ragu, karena

kesannya tidak baik dalam proses pemerintahan itu sendiri, apalagi masa jabatan Plt Bupati sangat singkat tinggal 1 tahun 2 bulan lagi,” kata Mardan. Menyusul situasi pemerintahan yang terkesan masih ada keraguan, program pemerintahan tentu tidak bias berjalan baik yang secara otomatis akan merugikan masyarakat. Untuk itu diminta agar Plt Gubsu dan Mendagri jangan terlalu mempersulit atau mengintervensi akibat tekanan oknum-oknum tertentu yang tidak menginginkan daerah Kab. Palas kondusif. “Sepertinyasaatinitelahterjadirekayasapolitik yang dilakukan oknum tertentu untuk menuju Kursi Palas 1 pada Pilkada 2013 mendatang, yang seharusnya tidak perlu terjadi mengingat situasi daerah Palas sebagai daerah otonom baru, “ jelasnya. Melihat kondisi daerah Palas saat ini, menurut dia, solusinya Plt Bupati harus melakukan mutasi pejabat dan pimpinan SKPD yang tidak pro aktif dan berkualitas. Sebab saat ini yang sangat dibutuhkan masyarakat tidak lain adalah berjalannya proses pelaksanaan pembangunan demi peningkatan kesejahteraan masyarakat. Menurut sumber di BKD Palas, ada sekira 32 pejabat eselon II, III dan IV di lingkungan Pemkab Palas yang akan dimutasi, namun hingga saatiniusulanmutasijabatanitubelumtahusejauh mana realisasinya. (a33)

Sumatera Utara


Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu Lusia Damayanti (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: Edward Thahir. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Armin R. Nasution. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Sinur Manik (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi). Wartawan Kota Medan: Umum: Zulkifli Harahap, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Dedek Juliadi, Hajrul Azhari Ritonga. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebingtinggi: Muhammad Idris, Abdul Khalik. Pematangsiantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanafiah, Hasanul Hidayat. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Bustanuddin, Wintoni. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan WASPADA dilengkapi dengan kartu pers. Tidak dibenarkan menerima uang dalam bentuk apapun. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan WASPADA tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan: hitam-putih Rp. 33.000,-, berwarna Rp. 90.000,Ukuran kolom: 40,5 mm. E-mail Iklan: Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Sabtu 16 Juni 2012

Perusahaan Setujui Tuntutan Warga

Tak Tahan ‘Makan’ Abu, Warga Blokir Jalan KAMPUNGRAKYAT (Waspada): Sejumlah perusahaan perkebunan kelapa sawit yang beroperasi di wilayah Kec. Kampungrakyat, Kab. Labuhanbatu Selatan (Labusel) menyepakati tuntutan warga untuk menjaga infrastruktur jalan dan menyalurkan dana CSR. Kesepakatan itu tercetus dalam mediasi yang dilakukan Muspika Kecamatan Kampungrakyat antara warga yang tergabung dalam Aliansi Pemuda dan Mahasiswa Peduli Labusel (APMPL)dengansejumlahperusahaan perkebunan di kecamatan tersebut, di Desa Tanjung Medan, Kamis (14/6). Pada mediasi yang dipimpin Camat Kampungrakyat Marasaktiitu,perusahaanyangdihadiri antara lain PT. Nubika Jaya, PT. Herfinta, PT. ATM, dan agen pengumpul TBS pada kesempatan itumenyatakankesanggupannya memenuhi tuntutan warga yakni melakukan penyiraman badan

JalanTolan -Tanjung Medan yang rusak adan berabu akibat dilintasi truk perusahaan yang melebihi tonase tiga kali sehari, memperbaiki badan jalan yang berlubang, memberdayakan pemuda setempat untuk bekerja, dan mencairkan dana CSR. “Kami dari perusahaan pada dasarnya sepakat,” kata Sangkot salah seorang perwakilan perusahaan. Menanggapi itu Koordinator APMPLAndiSyahputradanYusuf Afriansyah yang mewakili masyarakat mengaku senang dengan sikap perusahaan. Namun mereka berharap agar keputusan itu tidak hanya di bibir saja. “Kami akan lihat terus tindak lanjutnya.

Kalau perusahaan ingkar, maka kami akan kembali blokir jalan,” kata Andi. Camat Kampungrakyat, Marasakti kepadaWaspada mengatakan, mediasi itu merupakan tindak lanjut dari aksi blokir jalan yang dilakukan APMPL, Kamis 31 Mei lalu. Aksi itu sebagai protes terhadap Pemkab Labusel dan Perusahaan Minyak Kelapa Sawit (PMKS) yang ada di daerah itu yang dituding tidak peduli. Sementara itu, di hari yang sama, sejumlah warga yang bermukim di Dusun Padangbulan, Desa Tanjung Medan, Kec. Kampungrakyat melakukan aksi spontan memblokir jalan.Warga meletakkan kayu, bangku, dan sebagainyadibadanjalandidepan rumah mereka masing-masing. Wargamelakukanitukarenatidak tahan ‘makan’ abu. Truk perusahaan terpaksa melintas dari ruas jalan perkebunan PT. Tolan Tiga agar dapat lewat. (c18)


67 Mahasiswa Fakultas Keguruan dan Ilmu Pendidikan Universitas Asahan, mengerjakan tugas setelah mendengar penjelasan Kepala Perwakilan Waspada Kisaran (Asahan, Batubara dan Tanjungbalai) Nurkarim Nehe, saat praktik lapangan ilmu jurnalistik.

Mahasiswa UNA Kunjungi Perwakilan Waspada Kisaran KISARAN (Waspada): Mahasiswa Fakultas Keguruan dan Ilmu Pendidikan (FKIP) Universitas Asahan mengunjungi kantor perwakilanWaspada Kisaran,untukmenambahpemahamandalamilmu jurnalistik, Jumat (15/6). Kunjungan itumerupakan tahapan pembelajaran dan praktik lapangan mendalami ilmu jurnalistik, dengan peserta 67 mahasiswa.Kemudian,dilanjutkankekantorKONI Asahanuntukmengumpulbahanmembuatberita. Kepala PerwakilanWaspada Kisaran (Asahan, BatubaradanTanjungbalai)NurkarimNehesebagai dosen pembimbing didampingi PR III UNA Muhammad Saleh Malawat dalam arahannya mengatakan, bahasa jurnalistik adalah salah satu memperkaya bahasa Indonesia, dengan mempo-

pulerkan bahasa daerah ke publik. “Dengan demikian bahasa bertambah kaya, hal itu bertujuan agar memberikan pemahaman bagi pembaca dalam menyampaikan informasi. Seperti kata ‘menyomak’ kini mulai populer di kalangan pembaca,” ujar Nehe yang juga Ketua Umum KONI Asahan. Oleh sebab itu para mahasiswa diharapkan bisa memahami cabang ilmu jurnalstik, sehingga mampu menuliskan informasi dengan baik dan lugas. “Ilmu Jurnalistik itu tergolong penting, terutamadalamduniatulis-menulis,karenadalam disiplin ilmu itu memuat beberapa ketentuan dalam merangkai kata dalam menyampaikan informasi,” ujar Nehe. (a15)

Siswa SMK Perikanan Tewas Di Selokan

Waspada/Bustami Chie Pit

JAJARAN Kodim 0208/AS dan Batalyon 126/KC bersama Camat Kota Kisaran Barat M. Ajim melakukan karya bakti di jalan Tusam, Kisaran, Asahan.

Gotroy Sambut HUT Kodam I/BB KISARAN (Waspada): Jajaran Kodim 0208/AS bersama Batalyon 126/KC mengadakan karya bakti/gotong-royong dalam rangka menyambut HUT Kodam I/Bukit Barisan ke-62, Rabu (20/6). Pimpinan Karya Bakti E. Munthe yang juga Danramil 06 Kota Kisaran kepada Waspada, Jumat (15/6) mengatakan, karya

bakti ini melibatkan personel TNI Kodim dan Batalyon 126/KC 96 orang, masyarakat 100 orang, aparat pemerintahan daerah 50 orang, dan Polri 20 orang. Camat Kota Kisaran Barat M. Ajim SE, MM, yang ikut dalam gotong-royong mengatakan karya bakti ini sangat positif bagi masyarakat yang ada di wilayah Kodim 0208/AS ini.

Dandim 0208/AS Letkol Inf Muhammad Ali menambahkan dalam rangka HUT Kodam I/BB selain karya bakti jajaran TNI Kodim 0208/AS dan Batalyon 126/ KC juga mengadakan kegiatan donordarah,anjangsana/berkunjung ke panti asuhan dan rumah jompo, ziarah ke makam pahlawan, sepakbola eksekutif, dan melaksanakan syukuran. (a31)

Truk PT. IA Hancurkan Jalan Warga Mengadu Ke Bupati BATUBARA (Waspada): 66 Kepala keluarga (KK) warga Dusun II, I, III Desa Mesjidlama Kec. Talawi, Batubara, melalui surat tanggal 7 Mei 2012 mengadu ke BupatiBatubaratentangtrukroda sepuluh melintasi jalan Bandeng mengangkut muatan dari PT.IA Surat pengaduan itu diketahui Kades Mesjidlama Rusli, Ketua BPD Mirwan Uzir, Ketua LPM Nasri dengan tembusan KetuaDPRDBatubara,Kadishub, KadisPU,CamatTalawi,Kapolsek Labuhanruku Isi surat laporan antara lain, jalan Bandeng dibangun 1980 oleh Pemkab Asahan, perawatan terakhir lapem, membangun turap kiri kanan jalan tahun 2010 dilaksanakan Pemkab Batubara. Jalan sepanjang 1.250 meter itu

dimanfaatkan warga Desa Mesjidlama dan Bandar Rahmad Tanjungtiram pergi melaut, kondisi jalan labil saat dilintasi truk roda sepuluh membawa muatan melebihi kapasitas, rumah penduduk bergetar dan ada yang retak-retak. “KamimintaBupatiBatubara dapat membangun portal atau rambu larangan masuk truk ukuran berat di jalan Bandeng tersebut,” begitu bunyi surat laporan warga Mesjidlama Ketua BPD Mesjidlama, Mirwan Uzir, Kamis (14/6) mengatakan warga sudah melayangkan surat kepada Bupati Batubara, DPRD Batubara, Dinas PU, Dishub minta dibangun portal dan rambu lalin larangan masuk kendaraan ukuran berat “Selain

rumah warga bergetar dan retak, jalan desa tambah hancur, beram jalan terancam runtuh,” sebut Mirwan. Menurut dia, sebulan lalu nyaris terjadi hal tak diinginkan, warga menahan truk tronton masukmaumengangkutmuatan PT. IA, ternyata pengusaha PT. IA tidak mau datang menyelesaikan, akhirnya warga melepas truk tersebut, warga kesal sudah sebulan dilaporkan belum mendapat jawaban atas usulan masyarakat membangun portal dan rambu larangan tersebut. “Kami herankan prah roda sepuluh itu lewat pada tengah malam dan tidak jelas apa jenis muatan yang diangkut. Apa mungkinisinyatepungikan?”ujar Mirwan bertanya. (a12)

Tak Benar Calhaj Harus Manasik Di KBIH Nur Ibrahimy RANTAUPRAPAT (Waspada): Tidak benar laporan masyarakat yang menuding bahwa jemaah calon haji (Calhaj) Kabupaten Labuhanbatu harus mengikuti manasik haji di Kelompok Bimbingan Ibadah Haji (KBIH) Nur Ibrahimy Rantauprapat. Kepala Kantor Kementerian Agama (Kakan Kemenag) L.Batu Drs H Azaman Harahap menyampaikan itu saat temu pers yang dihadiri anggota DPRD L.Batu Syaiful Usdek dan Akhyar Simbolon di Kantor Kemenag setempat, Selasa (12/6). MenurutAzaman,pernyataannyaitumerupakanklarifikasikepada pengelola KBIH Nur Ibrahimy yang sebelumnya dituduh dengan cara dilaporkankeKantorKemenagRIdiJakarta,laludariKemenagRIditurunkan keKemenagsudanselanjutnyaolehKakanKemenagsumemerintahkan Kantor Kemenag L.Batu untuk menindaklanjutinya. Oleh Kemenag L.Batu kemudian dibentuk tim yang terdiri dari Drs H Darajar Siregar M Pd, Drs H Al I Umar dan Ibrahim Sihombing, SH MAP untuk mengklarifikasi Hamid Zahid pada tanggal 21 Februari 21012. Surat Kakan Kemenagsu itu bernomor Kw.02/4-a/Hj.09/504/2012 tanggal 17 Februari yang menindaklanjuti Surat Direktur Pembinaan Haji dan Umroh Kemenag RI No. Dt.VII.I/1/Hj.09/3622/2011 tanggal 20Desember2011perihalLaporanmasyarakatL.BatutentangKeharusan Mengikuti Manasik Haji pada KBIH Nur Ibrahimy. Kesimpulan Kakan Kemenag L.Batu atas klarifikasi itu adalah, tidak ditemukan kebenaran bahwa Hamid Zahid membuat edaran kepada masyarakat dengan kop surat dan stempel Kantor Kemenag L.Batu untuk mengikuti manasik haji pada KBIH Nur Ibrahimy. Juga tidak benar Hamid Zahid melaksanakan pengacakan kepada Calhaj yang akan berangkat tahun 2011 dengan keharusan membayar Rp 2 juta. KBIH Nur Ibrahimy pun adalah salah satu KBIH yang telah mendapat rekomendasi dari Kantor Kemenag L.Batu. (a18)


Waspada/Helmy Has

JALAN Bandeng menghubungkan Mesjidlama -Bandar Rahmad/Bogak terancam hancur.

TANJUNGBALAI (Waspada): Seorang siswa kelas II SMK Negeri Perikanan Kota Tanjungbalai ditemukan warga mengapung di selokan di jalan HusniThamrin, Lingk.VI, Kel. Pahang, Kec. Datukbandar, Kamis (14/6) siang. Sebelum tewas, korban Syafrizal Sinaga, 18, warga Seikepayang, diduga mengendarai sepedamotor dengan kecepatan tinggi menuju Simpangtiga Lemang, Kec. Simpangempat, Kab. Asahan. Saattikunganmanis,pelajaritutidakdapatmengendalikan kendaraannya sehingga masuk ke parit dan menabrak palang penyangga. Nenek korban, Nur Gayah, 62, di rumah sakit menuturkan, cucu kesayangannya itu malam sebelum kejadian, pamitan hendak pergi ke rumah temannya di Simpangempat. Namun, hingga tengah malam korban tak kunjung pulang bahkan kabar pun tak ada. Sementara Abdi, 18, teman sekolah korban

menceritakan bahwa sesuai informasi yang didengarnya, Syafrizal pergi ke Simpangempat bersama temannya mengendarai sekitar empat sepedamotor. Namun setelah melewati TKP, korban tidak lagi terlihat dan temannya menduga Syafri telah pulang ke rumah. Direktur RSUD Kota Tanjungbalai Dr. Diah WRetno didampingi dokter forensik dr. Rismawati dan kepala instalasi jenazah Warsito serta staf Ilham Sinambela mengatakan tidak ditemukan tanda penganiayaan. Hanya saja, mata merah dan daun telinga kanan berdarah akibat terbentur dinding selokan. Kapolres Tanjungbalai AKBP EP Sirait melalui Kapolsek Datukbandar AKP H. Sihite didampingi KasubbagHumasAKPYSinulinggamembenarkan kejadian itu. Diterangkan, korban ditemukan tak bernyawa di parit bersama sepedamotor Honda Vario warna me-rah tanpa plat nomor polisi. (a32)

Pemkab Labuhanbatu Siapkan Rp8 M Untuk Program Pendidikan Gratis RANTAUPRAPAT (Waspada): Pemerintah Kabupaten Labuhanbatu menyiapkan anggaran Rp8 miliar untuk program pendidikan gratis, yang akan dilounching bulan depan. “Dalam program peningkatan mutu pendidikan ini, setiapanakakanmendapatkan subsidi dari dana APBD Kabupaten Labuhanbatu ratarata Rp580.000 per semester. Jadi, setiap tahun Pemkab Labuhanbatuakanmensubsidi setiap anak Rp1.600.000,” ujar Waspada/Budi Surya Hasibuan Bupati Labuhanbatu dr. H. BUPATI dr. H .T.igor Panusunan Siregar SpPD, (tengah) beserta TigorPanusunanSiregarSpPD. Sekdakab H. Ali Usman Harahap SH, (kanan) dan Prof. DR. Solly Pernyataan itu disampai- Lubis SH, (kiri). kannya saat membuka secara resmi Bimbingan Teknik (Bimtek) Legal Draft- Labuhanbatu,baikyangadadikotamaupundipeloing Pembentukan Produk Hukum Daerah di sokdesamendapatfasilitaspendidikanyangsama. “SayaberkeinginananakyangsekolahdiSungai Kabupaten Labuhanbatu di ruang data dan karya Berombangtidakkalahdengananakyangbersekokantor bupati, Rabu (13/6). “Dengan demikian diharapkan pada tahun- lah di SMA Plus Rantauprapat. Anak di Sei tahun berikutnya akan lebih banyak lagi anak Berombang tidak perlu ke Rantauprapat, karena Labuhanbatu yang masuk ke perguruan tinggi mutu dan fasilitas pendidikan di Sei Berombang dengan di Rantauprapat sudah sama”, tegas Tigor. negeri,” harapnya. Ketua panitia pelaksana Siti Hapsah Silalahi Terkait dengan program pendidikan gratis ini,kataTigor,PemkabLabuhanbatutelahmenyiap- dalam laporannya mengatakan, Bimtek tersebut kan sistem jaringan internet di seluruh sekolah dilaksanakan dua hari 13-14 Juni 2012 diikuti 90 SMA lengkap dengan laboratorium komputernya. orang peserta dari seluruh SKPD Kabupaten Hal ini dimaksudkan agar seluruh anak SMA di Labuhanbatu. (c07)

Desa Rintis Berpeluang Jadi Desa Terbaik Sumut SILANGKITANG (Waspada): Desa Rintis, Kec. Silangkitang, Kab. Labusel berpeluang menjadi desa terbaik Sumatera Utara (Sumut) dalam Lomba DesaTerbaik tahun 2012. KetuaTim Penilai Lomba, berkunjung untuk melakukan penilaian terhadap kondisi Desa Rintis di aula desa tersebut, Rabu (13/6). Sebelum melakukan evaluasi, Kepala Badan Pembangunan Masyarakat (Bapemas) Sumut Drs. Rusli Abdullah yang merupakan Ketua Tim Penilai beserta rombongan dari Pemerintah Provinsi Sumut lebih dahulu mendengarkan eksposDesadanPKKDesaRintisyangdisampaikan Kepala Desa Muliaman dan sejumlah pengurus PKK Desa Rinstis. Pemenang lomba akan disampaikan pada upacara kenegaraan 14 Agustus mendatang di Jakarta. Camat Silangkitang, Khalil Jufri Harahap mengatakan,DesaRintissebelumnyatelahberhasil menjadi Desa Terbaik dari 53 desa se Labusel. Untuk itu dia berharap, desa tersebut mampu menjadi desa terbaik Sumut 2012. Menurutnya, prestasi yang dicapai selama ini berkat peran serta masyarakat dalam berbagai kegiatan di desa. Drs. Rusli Abdullah saat melakukan penilaian mengaku kagum dengan profil desa tersebut. Sebab berbagai kegiatan kemasyarakatan dan PKK warga setempat berperan aktif. Dia berharap peransertamasyarakatitudapatterusditingkatkan. “Ini penilaian final desa dan kelurahan Sumut. Kemarin saya ke Kabupaten Simalungun, Tebing Tinggi, besok di Asahan kemudian Deliserdang,” katanya kepada wartawan usai kegiatan itu. Menurutnya, Desa Rintis berpeluang menjadi kandidat desa terbaik Sumut, mengingat banyaknya keistimewaan yang ada di desa

tersebut. Pertama, kata dia, partisipasi masyarakat untuk pembangunan desa luar biasa, sebab pembangunan yang ada lebih banyak dilakukan secara gotong royong daripada yang dibiayai pemerintah. Selain itu di desa ini juga ada arisan PKK yang sangat membantu masyarakat, sebab dana arisan digunakan untuk membangun rumah warga secara bergulir. Hingga 2012 tercatat sudah 50an rumah warga dibangun dari sistem arisan tersebut. “Ini sangat luar biasa. Selain itu di sini juga ada koperasi wanita, ekonomi kerakyatan, desa punya kas desa, juga ada yayasan pendidikan desa, dan ada lagi kolam desa. Ini nggak ada di desalainyangsayakunjungisebelumnya,”katanya. Berdasarkan kriteria tersebut, dia yakin Desa Rintis mampu bersaing dengan desa lainnya di Sumatera Utara. Sebab dasar penilaian mereka masuk dalam delapan indikator yakni, ekonomi kerakyatan, pendidikan masyarakat, kesehatan, partisipasi masyarakat, kesadaran berbangsa, penguasaan lembaga desa, dan tata laksana pemerintahan desa. Dijelaskan, tujuan perlombaan tersebut yakni sebagai pembinaan agar desa mempunyai kinerja yang bagus dalam rangka pelaksanaan pemerintahan desa. Untuk merangsang kinerja desa tersebut, menurutnya mereka selama ini rutin melakukan pembinaan seperti pelatihan Kades, Sekdes, LKMD, BPD dll. Bahkantahun2012iniPltGubernurSumutGatot Pujo Nugroho sudah mulai mengucurkan Rp50 jutaperdesasecarabertahapuntuk1.000desa.Untuk programini,Pemprovsutelahmengalokasikandana Rp50 miliar. Khusus untuk Labusel, 24 desa menerima bantuan tersebut. (c18)

Ekonomi & Bisnis

WASPADA Sabtu 16 Juni 2012


Armin Nasution


Redaktur Ekonomi

Yang Tak Terungkap Di RUPSLB PENANTIAN para wartawan terhadap rapat semuanya memiliki aturan. Dalam hal ini, umum pemegang saham luar biasa (RUPSLB) semua harus mematuhi peraturan Bank InBank Sumut patut diapresiasi. Mereka harus donesia. Tapi ya sudah lah. Tak didengar juga menunggu hasil rapat itu hingga 12 jam. Rapat oleh pemegang saham pengendali, saya sudah marathon yang melicapek,” ujarnya. batkan Plt gubernur Bupati daerah Sumut dan para keSatu hal lagi pengangkatan direksi lain yang ditanya juga pala daerah baru bermenyatakan hal senadari luar Bank Sumut sama saja akhir sekira pk.22.30. da. Hanya saja dia engmenghambat karir generasi Setelah melihat gan berkomentar jauh. porsi yang diturunkan Dia hanya meminta BI penerus di Bank Sumut setingkat semua media terbitan selaku regulator dan kepala divisi dan kepala cabang Medan pada dasarnya pengawas perbankan inti berita sama. Perbisa melihat hasil RUPyang layak mengemban jabatan gantian Direktur UtaSLB ini dengan cermat. tersebut. Wajar kalau kemudian ma Bank Sumut dari Semoga BI bisa melihat Gus Irawan Pasaribu ini dengan baik. Kami mereka menolak orang dari luar kepada Rizal Fahlevi selaku pemilik saham Bank Sumut. Hasibuan. minoritas berharap Setelah mengikuti Bank Sumut lebih maju pemberitaan yang terlagi ke depan, bukan bit edisi Jumat saya sebaliknya. menyimpulkan RUPSLB Bank semua mengambilnya Sumut memunculkan dari siaran pers. Basejumlah hal diluar kegaimana tidak nyaris biasaan. Terutama dapoint dan kondisi yang lam penetapan direksi. berlangsung digamUntuk menetapkan barkan sama persis. direksi seharusnya Bahkan ada sesuai PBI (peraturan beberapa media yang Bank Indonesia) titik dan koma penumereka yang diangkat lisan sama. Saya berjadi direksi harus sudah fikir itu hal yang wajar mengikuti fit and karena mungkin dikeproper test di BI. jar deadline dan keletihan setelah menunggu Namun yang jadi caretaker diketahui belum lama, maka jalan pintas adalah menurunkan melakukan fit and proper test layaknya liputan sederhana dengan porsi sama. penetapan direksi bank. Memang direktur Tidak ada yang aneh sebenarnya dari semua utama yang ditunjuk sudah melakukan fit and berita itu. Tapi fakta yang sesungguhnya bahwa proper test tapi untuk jabatan komisaris RUPSLB berlangsung alot benar-benar terjadi. independen bukan direktur utama. Sekira pk.24.00 masih ada dua orang bupati Dan konteks yang lazim adalah untuk yang menghubungi saya. memutuskan jajaran direksi harusnya Bank Mereka bercerita begitu alotnya penentuan Sumut sudah lebih dulu memiliki komisaris jabatan direksi di Bank Sumut. Dalam rapat baru. Kemudian komisaris ini bersama divisi tersebut banyak sekali permintaan muncul. kepatuhan dan divisi SDM dari Bank Sumut Si kepala daerah menggambarkan:“Kami punya menjaring calon direksi. 100 permintaan tapi yang dibatalkan pemegang Setelah penjaringan dilakukan diajukan saham pengendali 101 permintaan. Bagaimana ke BI untuk mengikuti fit and proper test. Ketika bisa. Bagaimana bisa nyambung.” lulus di BI kemudian dibawa ke RUPSLB untuk Dari informasi yang diberikan para kepala ditetapkan siapa direktur utama dan direktur daerah itulah saya ambil catatan-catatan kecil. lain. Namun mekanisme itu tidak berlaku di Setelah rapat 12 jam akhirnya RUPSLB hanya RUPSLB Bank Sumut. memutuskan tiga caretaker memimpin Bank Para kepala daerah yang hadir sebagian Sumut. meminta agar BI lebih memperhatikan Bahkan pemegang saham pengendali PT persoalan ini ke depan, terutama jika para Bank Sumut yaitu Pemprovsu pun melakukan direksi caretaker itu akan diangkat definitif. veto atas keputusan walaupun beberapa daerah Bupati dan beberapa kepala daerah tadi malam menginterupsi dan menganggap keputusan hanya bisa mengomel mengomentari tersebut tidak tepat. Sebenarnya dalam RUPSLB keputusan pemegang saham pengendali. terjadi ‘keribut-an kecil’ karena ada daerah yang Padahal mereka ingin direksi Bank Sumut tidak komplain atas keputusan itu. Bupati Dairi KRA dicampuri kepentingan politis. Johny Sitohang misalnya merupakan orang Satu hal lagi pengangkatan direksi dari luar yang memprotes RUPSLB. Bank Sumut sama saja menghambat karir Di akhir RUPSLB dia sempat berbicara generasi penerus di Bank Sumut setingkat kepada wartawan menyinggung betapa kepala divisi dan kepala cabang yang layak banyaknya ketidaksesuaian (kalau mau disebut mengemban jabatan tersebut. Wajar kalau pelanggaran) yang terjadi. “Kami sudah kemudian mereka menolak orang dari luar menyampaikan apa yang kami pahami. Bahwa Bank Sumut.

Kemendag Tertibkan Impor Tekstil, Mainan Anak & Ponsel MEDAN (Waspada): Kebijakan pengaturan kembali impor untuk produk tekstil, mainan anak, dan telepon selular, murni dilakukan untuk melindungi konsumen dari barang-barang yang mengandung zat berbahaya. Peningkatan pengaturan ini seiring maraknya temuan produk tekstil, ponsel, dan mainan anak yang tidak sesuai dengan standar keamanan yang ditetapkan pemerintah. Dirjen Perdagangan Luar Negeri Kementerian Perdagangan (Kemendang) Arlinda mengungkapkan, kebijakan ini dimaksudkan melindungi anakanak dan keluarga dari konsumsi barang-barang yang tidak memenuhi standar keamanan konsumsi “Tekstil, mainan anak dan ponsel ini kan sangat dekat dengan masyarakat saat ini, khususnya anak-anak. Apa kita mau mereka jadi korban,” tanya

dia saat berbincang di Medan, Jumat (15/6). Pengaturan kembali kebijakan impor terhadap ketiga komoditas tersebut bukan pembatasan maupun pengetatan. Kebijakan ini hanya sebatas memastikan produk yang diimpor telah terbebas dari unsur berbahaya. “Ini hanya pengaturan. Biar para importir lebih tertib dan masyarakat lebih terlindungi,” tambah dia. Menurutnya, pengaturan kebijakan tidak ada kaitannya dengan semakin maraknya serangan produk tekstil, mainan anak maupun ponsel dari China. “Pengaturan kembali ini berlaku secara menyeluruh terhadap tiga komoditas itu, baik untuk China maupun negara lainnya,” tegas dia. Sementara itu, Kepala Dinas Perindustrian dan Perdagangan Sumatera Utara Darwinsyah mengaku volume impor ketiga

komoditi itu terbilang cukup besar saat ini. Namun dia tak dapat menunjukkan data pasti berapa besarannya. Meski begitu, dia memastikan dari ketiga produk tersebut, China merupakan negara asal importasi terbesar. “Iya besar memang volumenya, tapi enggak pula kita bawa kemana-mana volume totalnya,” tutur dia. Selain itu, Darwinsyah membantah ketiga produk tersebut diperdagangkan dengan sertifikat impor namun di bawah kualitas yang ditetapkan pemerintah. “Semua produk impor yang punya sertifikasi perdagangan dari kita, tentunya sudah sesuai dengan Standar Nasional Indonesia (SNI), kalau enggak punya mana lah mungkin bisa kita ijinkan beredar. Tapi kalau produk yang tidak memiliki sertifikasi perdagangan, mungkin ada tapi kita gak taulah,” tutupnya.(okz)

Infrastruktur Pelabuhan Perlu Pembenahan Serius JAKARTA (Waspada): Bank Dunia (World Bank) menaikkan peringkat logistic perfomance index (LPI) Indonesia pada 2012. Peringkat Indonesia naik dari posisi 75 pada 2010 menjadi posisi 59 pada 2012 dengan kenaikan indeks 2,76 menjadi 2,94. Meski demikian, banyak perbaikan yang harus dilakukan. Direktur SDM dan Umum PT Pelabuhan Indonesia II (Persero), Cipto Pramono, menjelaskan hal yang menjadi catatan serius dari LPI 2012 adalah masih belum adanya perbaikan di indikator bidang infrastruktur fisik. “Disebutkan di awal, perbaikan signifikan yang diraih berada dalam area soft infrastructure. Sedangkan pada hard infrastructure, kualitas fisik infrastruktur pendukung logistik seperti pelabuhan, jalur kereta api, maupun jalan-jalan utama, masih dinilai Bank Dunia belum menunjukkan perbaikan berarti,” ungkap dia dalam siaran persnya di Jakarta, Jumat (15/6).

Namun, karena mahal, maka membuat hard infrastructure membutuhkan waktu lama. Sebelumnya, World Bank telah merilis data LPI pada 2012. Dalam data tersebut Indonesia berhasil naik peringkat dari posisi 75 pada 2010 menjadi posisi 59 pada 2012 dengan kenaikan indeks 2,76 menjadi 2,94. Sekadar informasi, keberadaan sistem ini tentu sebagai bagian transformasi layanan Pelabuhan Indonesia II dalam mengelola pelabuhan-pelabuhannya agar semakin mengefisiensikan sistem logistik di Indonesia. Nantinya, pemilik barang akan dapat mengetahui di mana barangnya saat ini berada, proses administrasi apa yang harus dilengkapi, dan berapa yang harus dibayar. Semuanya dapat diakses secara mudah dan transparan. Pelabuhan Tanjung Priok juga telah menerapkan layanan berthing window bagi kapalkapal yang akan melakukan bongkar muat. Layanan ber-

thing window berarti tiap kapal yang mau sandar di dermaga telah mendapatkan kepastian jam dan lama sandar. Sehingga di wilayah kerja Tanjung Priok, tidak ada lagi antrean kapal yang disebabkan oleh ketidakjelasan waktu sandar. Beberapa kapal yang terlihat menunggu di sekitar pelabuhan memang disebabkan menunggunya kapal tersebut untuk bisa sandar sesuai jam yang ditentukan, atau kapal itu terlambat datang dan harus menunggu slot kosong berikutnya. Dalam dua tahun ke depan, sistem ini direncakan mampu diterapkan di semua pelabuhan yang dikelola oleh Pelabuhan Indonesia II termasuk pelabuhan-pelabuhan baru yang akan dibangun. Terkait efisiensi layanan bongkar-muat ini, Bank Dunia pun mencatat kenaikan efisiensi pengapalan internasional, dari 2,82 menjadi 2,97 dengan efektivitas waktu logistik dari 3,46 ke 3,61. Bank Dunia juga memberi catatan pada kenaikan tipis indikator pelayanan bea cukai di Indonesia.(okz)



Menteri Negara BUMN Dahlan Iskan (2 kanan) mencoba memasukan gula pasir ke dalam karung saat sidak di Pabrik gula Tjoekir, Jombang, Jawa Timur, Jumat (15/6). Meneg BUMN meminta agar pabrik gula yang ada di Jombang bisa mengatasi masalah limbah supaya tidak mencemari lingkungan sekitar dan melihat perubahan serta kebersihan pabrik gula dibanding saat sidak pertama sebelum musim giling.

Rapat Dari Pagi

BI Medan Bungkam Soal Bank Sumut MEDAN (Waspada): Sampai saat ini pihak Kantor Perwakilan Bank Indonesia Wilayah IX Sumut dan Aceh belum mau memberikan keterangan tentang hasil Rapat Umum Pemegang Saham (RUPS) dan Rapat Umum Pemegang Saham Luar Biasa (RUPSLB) Bank Sumut yang menetapkan pelaksana tugas (Plt) direksi bank tersebut pada Kamis (14/6) malam. Beberapa wartawan dari media yang ada di Medan, Jumat (15/6) sekira pk.11.00 telah berkumpul di Kantor Perwakilan Bank Indonesia Medan untuk mendapatkan informasi terkait hasil RUPS dan RUPSLB Bank Sumut tersebut, namun tidak satupun pejabat yang berkompeten bisa ditemui karena sedang mengadakan rapat sejak pagi hingga petang. Selama menunggu hingga pk.17.00, wartawan hanya ditemani Humas BI Medan Syamsir Alam yang berusaha membantu wartawan untuk menjumpai pejabat yang bisa memberikan keterangan, namun selama penantian, pihaknya juga belum bisa menemui pejabat tersebut, karena masih melakukan rapat internal BI dalam waktu yang tidak dapat ditentukan kapan selesainya. Seperti pemberitaan media

massa di Medan, RUPSLB memutuskan sejumlah hal, di antaranya memberhentikan dengan hormat Direksi PT Bank Sumut periode 2008-2012 mulai 16 Juni 2012 atas nama Gus Irawan Pasaribu selaku Direktur Utama, Zenilhar selaku Direktur Pemasaran dan M Yahya selaku Direktur Umum. Selain itu, RUPSLB juga mengangkat Pelaksana tugas direksi untuk memimpin Bank Sumut sampai ditetapkannya direksi defenitif yaitu Plt Dirut PT Bank Sumut Rizal Fahlevi Hasibuan, Plt Direktur Umum Zenilhar dan Plt Direktur Pemasaran Rudi Dogar Harahap. Berdasarkan Peraturan Bank Indonesia (PBI) Nomor:12/23/PBI/2010 tentang Uji Kemampuan dan Kepatutan (Fit And Proper Test) pada Bab III Uji Kemampuan dan Kepatutan Terhadap Calon Anggota Dewan Komisaris dan Calon

Tiket Mario Teguh & Gus Irawan Di Unimed Diborong MEDAN (Waspada): Sebagai motivator nomor wahid di Indonesia, Mario Teguh begitu diidolakan, tidak saja dari kalangan pengusaha atau pebisnis, masyarakat umum juga ternyata sangat mengaguminya “Meski sudah sering tampil di layar televisi, kehadiran sosok Mario Teguh tetap dinanti kalangan pengusaha dan perbankan serta masyarakat awam,” kata Ketua Bengkel Studi Demokrasi Sumatera Utara Agustin Sastrawan Harahap, Jumat (15/6). Dia mengatakan Bengkel Studi Demokrasi Sumut akan menghadirkan Mario Teguh dalam seminar nasional sehari bertema: “be a leader and entrepreneur with golden way” di Universitas Negeri Medan (Unimed). Acara berlangsung 23 Juni 2012. “Begitu keran penjualan tiket pada 15 Mei 2012 di buka, tiket VIP terus habis terjual. Pembelinya didominasi kalangan pengusaha dan perbankan,” tegas Harahap. Kondisi ini, tambahnya, membuktikan sosok Mario Teguh memang begitu diidolakan kebanyakan masyarakat Indonesia, begitu juga di Sumut, tegasnya. Dia menjelaskan 150 tiket VIP disediakan panitia habis terjual.”Ini membuktikan minat kalangan pengusaha dan perbankan begitu besar menghadiri acara seminar nasional dan hal itu, sudah kami prediksi sebelumnya,” ujarnya. Apalagi, lanjutnya, Sumut dan khususnya Medan memiliki banyak bibit-bibit pengusaha yang tentunya membutuhkan motivasi untuk terus mengembangkan usaha. Namun, katanya, sasaran seminar ini bukan hanya pengusaha, melainkan juga kalangan mahasiswa agar termotivasi berani terjun ke dunia bisnis. Dalam seminar tersebut, kata Harahap, Mario Teguh disandingkan dengan mantan Dirut Bank Sumut Gus Irawan Pasaribu yang sangat populer dalam pemberdayaan usaha kecil mikro dan menengah. “Kehadiran Mario Teguh dan Gus Irawan Pasribu dalam seminar nasional ternyata sangat ditunggu banyak pihak, terbukti, secara keseluruhan tiket sudah terjual 80 persen,” tegasnya. Katanya, tingginya animo masyarakat mengikuti acara itu maka tiga menjelang acara seminar pada tanggal 23 Juni 2012, Bengkel Studi Demokrasi Sumut merencanakan menaikan harga tiket menjadi dua kali lipat dari harga sebelumnya.(m49)

Anggota Direksi, pada Pasal 16 disebutkan dalam ayat 1: Calon anggota dewan komisaris dan calon anggota direksi wajib memperoleh persetujuan dari Bank Indonesia sebelum men-jalankan tugas dan fungsinya dalam jabatannya, dan ayat 2: Calon anggota dewan komisaris dan/

atau anggota direksi bank yang belum mendapat persetu-juan Bank Indonesia dilarang melakukan tugas sebagai anggota dewan komisaris dan/ atau anggota direksi walaupun telah mendapat persetujuan dan diangkat oleh RUPS. Namun sejauh ini, belum ada pejabat BI Medan yang mau

memberikan keterangan terkait pengangkatan pelaksana tugas direksi untuk memimpin Bank Sumut tersebut apakah sudah mendapat persetujuan dari BI atau belum. Ada kesan pejabat berkompeten BI menghindar dari wartawan yang mem-butuhkan informasi terse-but.(m41)

Sulitnya Naikkan Harga BBM Subsidi Tahun Ini JAKARTA (Waspada): Pemerintah mengaku sulit menaikkan harga bahan bakar minyak (BBM) tahun ini. Hal ini karena harga minyak dunia atau Indonesia Crude Price (ICP) terus mengalami penurunan. “Dengan kecenderungan harga minyak mentah Texas hampir mendekati 80 dolar AS per barel dan Nymex dan Brent sekira 90 dolar AS per barel, maka akan sulit untuk memenuhi persyaratan untuk menaikkan harga BBM,” kataWakil Menteri Energi Sumber Daya Mineral (ESDM) Rudi Rubiandini di Kantor ESDM, Jakarta, Jumat (15/6). Dengan kondisi seperti itu, pemerintah harus tetap waspada. Salah satunya dengan melakukan program penghematan BBM yang bertujuan menjaga APBN agar tidak defisit. “Pemerintah tidak boleh tinggal diam, salah satu caranya adalah yang hari ini kita resmikan program penghematan dengan melakukan penghematan dan efisiensi energi. Pemerintah harus melakukan beberapa langkah penghematan agar anggaran APBN-P 2012 tidak

jebol,” tambah dia. Rudi mengakui, pemerintah perlu melakukan penyesuaian harga BBM yang bukan hanya dimaksudkan untuk menjaga anggaran tetapi untuk membuka jalan berkembangnya energi lain. “Ini penyesuaian, jangan disalahartikan kalau menaikkan harga BBM. Itu penting dilakukan pemerintah untuk memberikan jalan atau kesempatan energi lain selain minyak lebih banyak digunakan,” tegas Rudi. Penghematan, ditambahkan Rudi, juga bukan hanya dilakukan pada penggunaan bahan bakar tetapi juga dilakukan pada penggunaan listrik atau air. “Contoh yang harus diubah, saat selesai menggunakan keran di kamar mandi, biasanya sering lalai menutup rapat keran air sehingga masih menetes airnya, tiap satu detik satu tetesan, dikali sejam, seharian. Bayangkan kalau jutaan rumah terjadi seperti itu, berapa banyak energi dan air yang kita buang per harinya,” tutup Rudi. Pertamax Naik 8 Persen Kementerian Energi dan

Sumber Daya Mineral (ESDM) menyatakan adanya kemajuan dalam penjualan BBM nonsubsidi pertamax sebesar 8,4 persen pasca diwajibkannya mobil dinas menggunakan premium. “Hari ini bukan sosialisasi, tetapi kami laporkan kemajuannya, kita saling mengisi, apa yang kurang. Contoh stiker banyak yang ditempel tidak pada tempatnya, yang kecil di depan kiri, yang besar di belakang mobil. Dari 1-10 juni ada penurunan penjualan premium,” kata Dirjen Minyak dan Gas Kementerian ESDM Evita Legowo di kantor ESDM, Jakarta, Jumat (15/6). Dari data yang diterima, ada penurunan penjualan premium sebanyak 2,4 persen dan kenaikan pertamax mencapai 8,4 persen.“Pengurangan premium 2,4 persen, penjualan pertamax naik 8,4 persen,” ungkap Evita. Sebagai informasi, Permen ESDM No 12 Tahun 2012 tentang Pengendalian Penggunaan BBM. Aturan itu melarang kendaraan dinas menggunakan premium mulai 1 Juni 2012 untuk wilayah Jabodetabek. (okz)

Larangan Premium Bagi PNS Cuma Simbolis JAKARTA (Waspada): Adanya aturan bagi para pegawai negeri untuk menggunakan Bahan Bakar Minyak (BBM) nonsubsidi dinilai tidak berdampak pada penghematan BBM bersubsidi. Aturan tersebut, memaksa mobil pelat merah seperti BUMN, BUMD tidak mengonsumsi BBM bersubsidi. “Saya rasa cara ini tidak cukup efektif untuk menghemat BBM subsidi. Jumlah mobil dinasnya juga kan sedikit,” ungkap Pengamat Ekonomi, Drajad Wibowo, Jumat (15/6). Drajad melanjutkan, jika ada penghematan dari wacana tersebut, penghematannya tidak akan cukup signifikan. “Jumlah mobil dinas itu dibandingkan dengan mobil lainnya kan masih sedikit, lagian mobil dinas masih ada juga yang pelat hitam,” paparnya. Menurutnya, hal tersebut hanya sebagai simbolisasi peng-

hematan semata. “Sementara kalau realisasinya menurut saya tidak akan berpengaruh terlalu banyak,” tukasnya. Sebelumnya, pemerintah pada Jumat 1 Juni 2012 kemarin mulai memberlakukan program pembatasan BBM bersubsidi bagi mobil dinas pemerintah, Badan Usaha Milik Negara (BUMN), dan Badan Usaha Milik Daerah (BUMD). Mereka dilarang membeli BBM bersubsidi dengan tujuan untuk meredam lonjakan konsumsi BBM bersubsidi agar tidak terlalu jauh melampaui kuota. Pemerintah yang mengeluarkan beberapa peraturan dalam penghematan energi, khususnya BBM bersubsidi ditargetkan akan menghemat cukup besar. Salah satu dari aturan tersebut, adalah pelarangan kendaraan dinas pemerintahan, BUMN dan BUMD di

wilayah Jabodetabek yang diklaim mampu menghemat hingga 135 ribu kilo liter (kl). Sementara, Menteri ESDM JeroWacik mengaku telah melakukan pertemuan dengan para sekretaris menteri dan perwakilan pemerintahan lainnya sebagai pihak yang bertanggung jawab mengkoordinasi jajarannya, terkait pelarangan mobil dinas mengkonsumsi BBM subsidi dengan stiker. Dia menambahkan jika Pegawai Negeri Sipil (PNS) masih melakukan kenakalan dengan gunakan BBM bersubsidi akan ada tindakan tegas dan langsung dikeluarkan. “Jika itu PNS berani berbuat nakal dimana masih menggunakan BBM bersubsidi maka nanti akan ada tindakan dengan teguran tertulis dan kemudian izin m o b i l n y a d i c a b u t ,” pungkasnya beberapa waktu lalu.(okz)

B6 1 CM 2 CM


Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000


AUTOMOTIVE Informasi Pembaca

Bursa Automotive

A C : Air Condition BR : Ban Radial CL : Central Lock ND : Nippon Denso DB : Double Blower


: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

DAIHATSU Xenia Th. 2007 Famili VVTi 1000cc. BK. Hrg. 107Jt. Nego. Wrn Hitam. Hub. HP. 0813 6212 2339 ALL NEW XENIA (BARU) 1300cc, AC DB, Sensor Parking, CD, MP3, USB, Alarm, Central Lock, Angs. 2.333.100. Terios Angs. 2.747.000. Pick Up Ang. 2.339.000. Hub. ASTRA DAIHATSU 0812 6340055 PIN 274CA61C

DAIHATSU Espass MB Rooling Door Thn.96. Mdn AC, Tape, VR 1.3. Mobil cantik luar dalam.Body kaleng2.Alamat Jl. Perdamean No. K.17. Helvetia Zipur. HP. 0812 6424 995 DAIHATSU Feroza Th. 1994. BK Mdn Asli. Warna biru ban baru, AC, Tape, VR, BR, Mulus dan sehat. Hub. 0813 6139 1011. Harga damai.

5 CM 6 CM

Rp. 65.000 Rp. 78.000

TOYOTA Kijang LGX Solar W. Biru met, BK Medan asli Th. 2001. Lengkap, siap pakai. Rp. 125Juta Nego. Hub. 0813 6227 1115. Jl. Amaliun. Dpn SD Kartini No. 146 Toko ULGA


Mobil sehat luar dalam. Komplit semua. body mulus. VR 16. Warna hitam mulus. Hub. 0812 6338 3979 - 0813 6162 4975


Avanza, Innova, Fortuner Purba: 08139 789 4633

TOYOTA Twin Cam 1600cc Thn. 89. Abu2. AC, Tape, VR, 15 Inc. Baru. Msn/Body cantik. Pjk 1 thn. 061.8456676 / 0815 3316 8155 TOYOTA Kijang Commando Thn. 90 Short. Abu Tua. AC, Tape, VR, BR, Baru 6 Speed. Msn/Body Bagus Pjk. 1 thn, 46,5Jt. 061.8456676 / 0815 3316 8155


DAIHATSU Zebra 1,3 Long. thn. 95/94. Minibus, 5 Speed, Biru met. BK Mdn, cat mulus, mesin sehat. Harga 25,5Juta. Hub. 0852 6144 3096 - 0813 7015 4503

Fortuner, Innova, Avanza, Rush, Yarris. Proses Cepat (Cash / kredit). Hub. 0813 7033 3221

DAIHATSU Zebra Prima 21 Th. 95, warna biru AC, Tape, H. 26Jt Nego. Hub. 0813 7060 6200

TOYOTA LGX Solar thn. 2000 Dijual. Akhir Bln Desember Biru Mika. Mesin ok. Body, cat original, siap pakai, mulus. Harga Rp. 117,5Jt. Nego. Hub. 0823 6883 9561

HONDA Maestro (sedan) Thn. 90 Dijual. Wrn hitam met, VR, BR, AC, PW, TP CD Power, Remote, BK 2 Angka, pjk panjang, siap pakai nggak kecewa. Hrg. 45Jt Nego. Hub. 0813 7030 1442

TOYOTA Kijang Krista Th. 2002. Bensin BK Panjang. Warna biru. Hub. 0852 7087 2307 - 0813 7589 1111

HONDA Jazz V-VTi Thn. 07, Matic Wrn abu2 metalik, Velg Racing, Ban radial, mls sekali, Km. 50xxx. 1 tangan dari baru Rp. 148Jt/BU. Jl. SM. Raja No. 200. Hub. 0821 6767 7000 / 7851402


HYUNDAI Atoz 2000 W. Hitam. Siap pakai. Pjk panjang. Harga Rp. 58Jt/ Nego. Hub. Komp. Veteran Blok B 68. 0812 630 60005 - 0853 7190 1971 OPEL Blazer Lt Injection Biru met Th. 97. Mulus, terawat sekali, AC Dingin, Full sound. Pake TV, Hrg. 46 Jt. Nego. Hub. 0812 6949 9450


L300 PU, Colt Diesel, Pajero, Fuso Hub. MAZMUR. 081 269 901 133

MERCY / E230 Th. 89. Manual, model Boxer, Wrn merah Rp. 33 Jt/BU. Hub. 0852 6260 3333

BURSA BUTUH DANA Jaminan apa saja Sertifikat Tanah mobil & Sp. Motor. Segala tahun. Hub. 061-8222774 HP. 0853 6199 1500



Dijual 1 Unit Sp. Motor Minerva Thn. 2009 Akhir. Dan 1 Unit Meja Billyar. Hub. HP. 0813 70456 330. BU BURSA


MITSUBISHI L200 Double Cabin GLS Th. 06. Warna hitam mutiara Silver, BK Cantik, mobil cantik Rp. 220Jt. Hub. 0813 6089 4043 SUZUKI Carry Thn. 91. Adiputro 1.0 Warna merah, Velg Racing. Tape. Mobil siap pakai. Harga 26Jt. Nego. Hub. 0821 6399 9191

TOYOTA Kijang Super Commando Longs. Th. 1998. BK Medan / Pjk . 9. Warna biru gelap. 6 Speed. Harga 48 Nego. 0813 9633 5982

Carry Pick Up - Ertiga / APV DP Murah, Angsuran Ringan Hub. 0852 6111 7724 0852 7084 7017 Terima Tukar Tambah


SIM A dan C, KTP. ATM BCA, dll. atas nama Taufik Siregar, STNK Kereta Mio CW. BK, 6525 AAH. Hilang disekitar Jl. Mesjid, Sukamulia samping D. Toba Htl, Imam Bonjol. Dpn sklh imanuel, Sudirman, msk Jln. W. Kota tembus Pardede Hotel langsung ke rumah.

TERCECER/HILANG Surat Tanah SK Gubernur KDH Sumatera Utara tanggal 10-11-1973 No. SK 202/DA/HML/ LB/1973 A/n. HERMAINI yang terletak di Negeri Lama Kec. Bilah Hilir L. Batu.


11 CM Rp. 165.000 12 CM Rp. 180.000

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000


Apabila anda mencurigai sesuatu, silahkan hubungi kami di 061-4576602




- 09 Hr Umroh Reguler - 09 Hari Awal Ramadhan - 11 Hari Awal Ramadhan - 12 Hari Tengah Ramadhan - Lailatul Qodr/Akhir Ramadhan - 1 Bulan Ramadhan & Puasa 6





0813 6147 0812

Jl. Gatot Subroto Medan Ada Garansi


ELEKTRONIK REPARASI AC, KULKAS, MESIN CUCI Kompor Gas, Dispenser H & C TV, M. Pompa Air Sanyo

Hub. SURYA TEKNIK SERVICE Telp.66482216 - 0813 7589 8757 Siap Ketempat

KANTOR MULTAZAM = SEAT TERBATAS Jl. Titi Papan/ Pertahanan No. 10 Sei Sikambing Medan Telp. (061) 457.6116 - 7731.3385 HP. 0813.6137.2321 - 0812.6495.8456



Dibutuhkan Supir Toko, syarat: 1. Berpengalaman 2. Rajin 3. Domisili di Medan 4. Bertanggung jawab



Informasi Pembaca Bursa Property

G R : Garasi LB KM : Kamar Mandi LT KP : Kamar Pembantu RM KT : Kamar Tidur RT SHM: Sertifikat Hak Milik

: Luas Bangunan : Luas Tanah : Ruang Makan : Ruang Tamu

RUKO Dijual Komp. Bumi Asri (SHM) Hub. 0852.9675.7303 - 0852.9768.3236


Di Villa Mutiara Johor II Blok C12A Type 45, Luas Tanah 113m² Luas Bangunan 45m² H u b . 0813.6409.9905 / 0812.602.9460 RUMAH DIJUAL/ MAU PINDAH

Over kredit KPR BTN 6x15m, Type 45, 3 KT, 2 KM, Atap genteng, Full keramik, PAM, PLN, Telp, Bebas banjir, Sejuk, Kembali DP 120 Jt, Sisa angsuran 794.000 x 9 Thn, Almt: Perumahan Pesanggrahan Tjg. Selamat Blok C-3 Jl. Arkeologi dekat Pasar Melati Medan Hub. Pemilik lsg: 0812.8641.0172 - 0815.3347.780

Uk. ±30x400 (Sertifikat Hak Milik), Lokasi Desa Aek Kota Buntu Kec. NA. IX-X, untuk Sumatera Hub HP. 0813.9646.3253, Maaf TP



QSE QUANTUM SMART EDUCATION Jika Anda/Anak Anda: 1. Menghadapi Kesulitan Dalam Belajar & Nilai Rendah 2. Tidak Fokus/ Konsentrasi (Mudah Beralih Perhatian) 3. Tidak mengetahui jurusannnya....dll Untuk SUKSES di Tahun Ajaran Baru







: 25 Juni 2012 s/d UMB Juli 2012 : Standar QSE (15 Org/Kelas)+Metode Belajar QSE+Modul/Model Soal + Try Out (3x) + Konsultasi Belajar & Jurusan BIAYA : Rp. 500.000,WAKTU BELAJAR : Setiap Hari/15.00-18.30 WIB DISKUSI : Setiap Hari/13.30-20.30 WIB TARGET LULUS : Di Atas 90%

Keterangan lebih lengkap silahkan hubungi:

T ELPON : 061 - 4576602 F AX : 061 - 4561347

* Format: JPG - TIFF (Photoshop)



1. Jl. ISKANDAR MUDA 107 PRINGGAN MEDAN Telp. 451.9922 2. JL. BUDI KEMASYARAKATAN 11-C (depan SMAN3) MEDAN Telp. 6969.5533



brgkt tgl 02, 04, 09 Juli brgkt tgl 14 Juli brgkt tgl 21 Juli brgkt tgl 25 Juli brgkt tgl 11 Agust brgkt tgl 28 Juli




Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput


Pelanggan Yang Terhormat

TERCECER BPKB No. 9275836-B. a/n. Imam Herianto. Jl. Sei Tuntung Baru dalam No. 21 Medan. 1 Bh Surat Kiosk No. 169 Lt. II Thp. II Psr Petisah. T. Berjualan No. A Pinggiran Escalator Lt. II Thp II Psr. Petisah. An. Melva Br. Sitanggang.


HA TI-HA TI terhadap penipuan yang mengatas HATI-HA TI-HATI namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk TI-HA TI apabila membeli produk anda, dan HA HATI-HA TI-HATI anda ingin melakukan transaksi jual beli melalui transfer. Segala akibat yang terjadi diluar tanggung-jawab

Telah tercecer 1 (satu) buah Surat Penyerahan Perlepasan Hak/Ganti Rugi No. 592.23/001/1991 tertanggal 15 Januari 1991 di sekitar Jalan H.T. Rizal Nurdin Pantai Cermin Kec. Pantai Cermin Kab. Serdang Bedagai pada tanggal 21/05/2012. Demikianlah Pernyataan ini kami perbuat dengan sebenarnya an. Ahli Waris. Tengku Haji Mawardi Arifin Tengku Ari Zumairi Arifin


9 CM Rp. 126.000 10 CM Rp. 140.000



TOYOTA BARU 100% Ready Stock Avanza, Fortune, Innova, Yaris, Rush, Hilux, Dina, Bisa Tukar Tambah. Hub. 0813 6120 1719 / 6878 3325


HILANG/TERCECER TELAH TERCECER BPKB Sepeda motor. Atas Nama: SUTRISNO. BK: 6713 CP. Alamat: Jl. Tinta No. 62A. Merk: Honda 125. No. Rangka: MH.IJB81187 KO 18260. No. Mesin: JB81E - 1024501


TOYOTA BARU 2012 Bunga 3,35 %. Proses Cepat & Data Dijemput. Hub. Predy Simatupang. 0853 6207 2000 - 0813 6165 1801

TOYOTA Kijang Kapsul Thn. 2001. Silver, LGX Tape, VR, VR. Hub. 0812 6057 832

Rp. 91.000 Rp. 104.000



DEALER RESMI SUZUKI MOBIL Carry PU 1.5 FD DP 10Jt-an Angs. Rp. 2.663.000. Ertiga Ready: Pesan sekarang juga Hub. 0852 6222 6789 / 77722121

TOYOTA Kijang LGX New Model 1.8 EFITh. 2004 Sgt orisinil. Mulus luar dalam. Complit, sound sytem pake TV 3 Unit. Hrg. 155Jt. Nego. Hub. 061.6967 9753

7 CM 8 CM

Sabtu, 16 Juni 2012

Be A Smart Generation of Indonesia UNTUK INFO & REGISTRASI


TANAH DIJUAL Jl. Kiwi Gg. 6 No. 72E Siskambing B P. 30m, L.9½m HP. 0813.7507.1252


1. Jl. ISKANDAR MUDA 107 PRINGGAN MEDAN Telp. 451.9922 2. JL. BUDI KEMASYARAKATAN 11-C (depan SMAN3) MEDAN Telp. 6969.5533


Antarlamaranke:TOKO ANGKASA GYPSUM Yg beralamat di Jl. Setia Budi No. 272B dengan membawa Foto copy KTP, Serta Kartu Keluarga atau hub. 0812.6050.8773/ Bpk. Suirwan


PT. yg berdimisli di Jkt membuthkan kpla (Chief) Secrurity (C1) & Wkl Kpla Secrity (C2), (L), Min-S1 (C1) D3 (C2)/ exTNI/Polri (C1), Pnglmn 5 thn di posisi yg sama, bs bhs inggrs, komputer, usia max 45” ditempatkan di NAD, kirim ke :, cntmkan kode posisi di subject email


PT yg berdomisili di Jkt membutuhkan Kodrd. Wilyh (KW), (L), Min. S1/ExTNI/ Polri, Pnglmn 7thn, Bs Bhs Inggris, Komputer, Memiliki jaringan luas, Usia max. 50th Di tempatkan di NAD, Lamaran kirim ke: cntmkn kode posisi disbjct email

Ingin Promosikan Produk Anda Harian

WASPADA Media yang Tepat untuk Iklan Anda








Spring Bed 6 kaki 2 lapis Rp. 1.150.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun

Hub Telp. (061) 661.8116 - (061) 661.6802 - 7653.2188

Anda Butuh Perabot Jepara Asli?


Hubungi: Jl. Bilal No. 90 P. Brayan Medan Telephone Toko : 661.6285 Rumah : 661.1540 Fax : 661.6285 (061) Jl. K.L. Yos Sudarso depan SMA Negeri 1 Tebing Tinggi Telp. (0621) 24243



Tanaman investasi umur 7 thn bisa panen, Puluhan Juta, yg butuh bibit Gaharu, Obat suntik gaharu & mau jual isi batang gaharu, serta mau pesan bbt yg lain, yg bersertifikat Hub. Pak Jamal di Limau Manis Tanjung Morawa HP. 0813.7091.2113



PERABOT TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 7653.2188





Jl. Sutomo No. 436 Medan 20231 (samping Bank Maspion) Telp. (061) 452.2588 - 415.7504 - 455.7204 - 455.7194 Fax. (061) 415.7504 SUMUT - INDONESIA




Membuka peluang keagenan / reseller di kota anda untuk penjualan seluruh tiket pesawat domestik-internasional, paket wisata dan umrah. Layanan on-line 24 jam, Anda tertarik jadi Agent ? Hub 0274-8222181 Call/ sms 085747067888






Lembaga Riset Publik ( LARISPA) Indonesia membuka lowongan kerja untuk 4 orang pria dan wanita untuk posisi (AK) serta 2 orang untuk posisi (WM) dengan keterangan sebagai berikut : 1. Staf Administrasi Konsultasi Pendidikan (AK) 2. Web Master (WM) Syarat-syarat; 1. Tamat Diploma (D3) dan Sarjana (S1) (AK)/(WM) 2. Mahir Microsoft Office dan Internet (AK) 3. Memiliki Pengalaman Tenaga Administrasi (AK) 4. Siap Bekerja dengan Tim (AK) 5. Siap ditugaskan ke daerah luar kota seperti, Sidempuan, Rantauprapat, Nias, Aceh, Riau, Madiun dan Solo (AK) Fasilitas: 1. Gaji Pokok, Insentif dan bonus akhir tahun 2. Perlindungan Jamsostek 3. living cost (biaya hidup di daerah ditanggung) 4. Net book dan modem Lamaranlengkapsebelum30Juni2012,diantarlangsungataumelalui pos ke alamat Jln. Sei Mencirim Komplek Lalang Green Land I Block: C 16 telp 061-7771 30 25 atau melalui E-mail: , Web Iklan ini dapat dilihat pada Harian Waspada dan Analisa pada hari Senin Tanggal 18 Juni 2012 Hanya mereka yang memenuhi syarat yang akan di panggil interview LARISPA.............., lebih baik dalam metodologi lebih unggul dalam Moral. dan jangan Lupa..., Teliti Dulu baru Bicara.


Pemasangan Depot Air Minum Isi Ulang paling murah Sesuai kemampuan anda 1. Depot RO 40 s/d 400 Galon/ hari 2. Depot Air Mineral/ Pegunungan 3. Jual alat-alat depot isi ulang Terima siap untuk jualan

UD. RIZKY ABADI JAYA Jl. Veteran Psr. 10 (dpn Mesjid Al-Hidayah) Helvetia Telp. (061) 685.3334 HP. 0813.7580.8866



Dahsyaatt, Hanya 16 Juta bisa buka usaha laundry kiloan + diajarkan Cry clean + Spa helm, kami yg termurah, terprofesional di dunia, maukan penghasilan halal minimal 300 ribu - 1 juta tiap hari seumur hidup? 0852.6298.7114



WASPADA Media yang Tepat untuk Iklan Anda


WASPADA Sabtu 16 Juni 2012

07:30 Doraemon Dan Nobita 08:30 Dahsyat Weekend 11:00 Intens 12:00 Seputar Indonesia Siang 12:30 Looney Tunes 14.30 Tom & Jerry 15.00 Cek & Ricek 16.00 Seputar Indonesia 16:30 The Biggest Game Show 19:00 Mega Sinetron : Tukang Bubur Naik Haji 20:30 Mega Sinetron : Karunia 22:30 Box Office Movie


07.00 SCTV Musik : Inbox 09.00 Hot Shot 10:00 SCTV FTV Pagi 12:00 Liputan 6 Siang 12.34 Film Layar Lebar 16.00 Liputan 6 Terkini 16.30 Status Selebriti 17.00 Liputan 6 Petang 17.30 FTV ANak Istimewa 19.30 Putih Abu Abu 20.30 SCTV Sinetron : Badil Dan Blankon Ajaib 21.30 Si Biang Kerok 22.00 SCTV FTV 22.30 Liputan 6 Terkini 22.33 SCTV FTV

07:30 Semangka 08:30 Serial Pilihan 09:30 Kisah Unggulan 10:30 Kribo 11:00 Sidik 11:30 Lintas Siang 12:00 Layar Kemilau 13:30 I Drama 15:00 Starlite 15:30 Lintas Petang 16:00 Animasi Spesial 16:30 Indonesia Beraksi 17:30 Animasi Spesial : Shaun The Sheep 18:30 Aladdin 19:30 Dewi Bintari 22:00 Putri Nabila 23:00 Dangdut Never Dies 00:00 Sport Mania 00:30 Obat Malam 01:00 Lintas Malam

07:30 Fresh & Fun 08:00 Friends 09:00 Fenomania 09:30 Kisah Sukses UMKM 10:00 Bread, Love an Dreams 11:30 Topik Siang 12:00 KLIK! 13:00 Tom & Jerry 13:30 Tom & Jerry 14:00 Duckula 14:30 Woody Wood Pecker 15:00 Indonesia Super League 2011-2012 17:30 Topik Petang 18:00 Pesbukers 19:30 Keluarga Selebritis 20:30 Glory Jane 21:30 Pilih-pilih Mantu Pedekate 22:30 Sinema Aksi 00.30 Topik Malam

07:00 KISS Pagi 08:00 Bango Cita Rasa Nusantara 08:30 BKKBN 09:00 Belanja Murah Bersama Alfa Midi 09:30 Jelita 10:00 Sinema TV Pagi 11:30 Patroli 12:00 Sinema Siang 14:00 Aseli Indonesia 15:00 KISS Sore 16:00 Fokus 16:30 Mitos 17:00 Sinema Tv Gita Cinta 19:00 Gebyar BCA 20:00 Tutur Tinular 22:00 Flash Point

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

07.05 Editorial Media Indonesia 08.05 Jendela Rumah 09.05 Starbuzz 09.30 VOA Snapshot 10.05 Untuk Buah Hati 10.30 Metro Xin Wen 11.05 Oprah Winfrey 12.05 Metro Siang 13.05 Spirit Football 13.30 Eagle Documentary 14.30 Travelista 15.05 Inovator 15.30 Young On Top 16.05 Oprah Winfrey Show 16.30 Oprah Winfrey Show 17.05 Metro Hari Ini 18.05 Metro Hari Ini 18.30 Metro Highlights 20.05 Metro Files 21.05 Top Nine News


07:30 Gula Gula 08:00 Griya Unik 08:30 Ceriwis Pagi Manis 09:45 Ala Chef 10:30 Insert 11:30 Koper Dan Ransel 12:00 Benu Buloe 12:30 Ngulik 13:00 Bingkai Berita 14:00 Sang Juara 15:00 Sketsa 16:00 WIsata Kuliner 16:30 Insert Investigasi 17:15 Reportase Investigasi 17:45 Jika Aku Menjadi 18:30 Pengabdian 19:15 Super Trap 20:15 Wayang Bandel 21:15 Bioskop TransTV 23:15 iND!GO 00:15 Bioskop TransTV

09:00 Sarapan Pagi 09:30 Ujung Negeri 10:00 Mutumanikam 10:30 Soccer One 11:00 Prediksi 12:00 Live News Kabar Siang 13:00 Damai Indonesiaku 15:00 Manusia Indonesia 16:00 Walk The Talk 16:30 Live News Kabar Petang 19:00 Bukan Jalan Jalan Biasa 20:00 Nama dan Peristiwa 21:00 Apa Kabar Indonesia Malam 22:00 Live News Kabar Malam

08:00 Tom & Jerry 08:30 Auto B Good 09:30 Big Movies 11:30 Tamu Gokil 12:00 Berita Global 12:30 Awas Ada Sule 13:30 Gadis Petualang 14:00 Before 30 14:30 Genie 15.00 100 % Ampuh 16:30 Fokus Selebriti 17.00 Spongebob Squarepants 18:15 Big Movies 23:00 Big Movies

07:00 Hip Hop 07:30 Selebrita Pagi 08:00 Selamat Pagi 09:00 She Can Tupperware 09:30 Sang Kreator 10:00 Wollipop 10:30 Spotlite 11:00 RAN 11:30 Redaksi Siang 12:00 Selebrita Siang 12:30 Galeri Sepak Bola 13:30 Highlights Otomotif 14:00 Basecamp 14:30 Mancing Mania 15:30 Super Jail 16:30 Redaksi Sore 17:00 John Lenong 18:00 Ketok Palu 19:00 Opera Van Java 21:00 Pas Mantab 22:30 (Masih) Dunia Lain 23:30 Kualifikasi MotoGP **m31/G

Kristen Stewart Berperan Sebagai Wanita Penggoda KRISTEN Stewart terlihat begitu elegan berjalan di karpet merah ketika pemutaran perdana film barunya On The Road di festival film Cannes. Berjalan di karpet merah dengan anggun bintang film The Twilight ini menjadi perhatian semua orang yang hadir di lokasi itu. Pada pemutaran perdana film itu hadir juga Robert Pattison yang merupakan pasangan main Stewart. Namun keduanya sengaja menghindar untuk dicepret bersama-sama para wartawan. Keduanya seolah-olah tidak akrab, cuek aja satu dengan lainnya. Robert Pattison lebih suka di foto sendirian, sedangkan Stewart berpose dengan bintangbintang pembantunya dalam film gress yaitu bersama Garret Hedlund, Kirsten Dunts, Viggo Mortensen dan Tom Sturridge.

Aktris cantik berusia 22 tahun ini mengenakan gaun Balenciaga dengan hiasan bordir bunga yang indah dipadu tali pinggang berwarna hitam dan mengenakan sepatu hak tinggi. Tak ada asesoris lain menempel di tubuh Stewart kecuali satu kalung yang melingkar di lehernya. Meskipun sudah menjadi aktris populer, tak ada nampak penampilan Stewart begitu glamor dan mewah. Ia berpenampilan sederhana saja, namun terlihat tetap cantik. Stewart berperan sebagai Marylou, wanita penggoda yang masih berusia belia dalam film gress yang diadaptasi dari novel Jack Kerouac. Sementara dalam film Twilight Saga, Stewart berperan sebagai Bella Swan. Dalam film baru ini Stewart berperan menjadi wanita tomboi dan broken home, ia menggunakan obat-obat terlarang dan terlibat dalam group-group orang muda yang melakukan

Kristen Stewart/ seks bebas. Namun gadis berusia 22 tahun ini mengatakan, ia menyenangi peran itu karena penuh tantangan. Stewart mengaku bahwa ia ingin memainkan semua peran agar lebih lebih matang dan berpengalaman di dunia akting. “Jika melakonkan satu peran saja tentu kita tidak bisa menghayati peran lainnya. Ka-

rena dalam dunia film kita harus memerankan semua lakon yang dibutuhkan skenario agar bisa terus eksis. Jika tidak demikian tentu kita akan tenggelam,” ujar Stewart. Festival Cannes sekaligus dijadikan Kristen Stewart untuk mempromosikan film barunya. Ia berharap film On The Road dapat menggapai sukses seperti Twilight Saga.

Walaupun pada pemutaran film barunya di festival Cannes, Stewart tampak tidak peduli dengan Robert Patttison, tapi ketika acara usai gadis ini pulang besama aktor ganteng pasangannya dalam film Twilight Saga. On The Road dirilis pada September mendatang. Nur/

Pagelaran Seni Budaya Warnai PembukaanJelajahDuniaAstra PAGELARAN seni budaya Indonesia mewarnai pembukaan Jelajah Dunia Astra di Medan International Convention Centre, Jumat (15/6). Berbagai tarian yang dipersembahkan menampilkan seluruh budaya dan etnis Sumatera Utara. “Jelajahi Dunia Astra di Medan dipersembahkan untuk warga Medan dan sekitarnya dalam rangkaian peringatan HUT ke 55 Astra. Kehadiran Jelajahi Dunia Astra diharapkan membuat warga Medan khususnya dan Sumatera pada umumnya lebih mengenal kiprah Astra sebagai salah satu entitas bisnis yang selalu ikut serta mengambil bagian dalam perkembangan ekonomi dan sosial di Indonesia,” ujar Direktur PT Astra International Tbk Gunawan Geniusahardja. Selain itu, lanjutnya, tampilan seni budaya di seluruh etnis Sumatera Utara ini merupakan tampilan bagaimana kontribusi Astra dalam membangun empat pilar program tanggungjawab sosial didalam bidang pendidikan, lingkungan, kesehatan dan pemberdayaan ekonomi masyarakat melalui Grup Astra dan 8 yayasan, lanjutnya kembali. Dalam pembukaan pagelaran seni budaya Indonesia Jelajahi Dunia Astra ditandai dengan dengan pemukulan Timpani oleh Gubernur Sumatera Utara Gatot Pujo Nugroho ST, Direktur PT Astra International Tbk Gunawan Geniusahardja, Kepala Kepolisian Daerah Sumatera Utara Irjen Pol Wisjnu Amat Sastro, Walikota Medan, Drs H. Rahutman Harahap, Chief of Corporate Communication PT Astra International Tbk Arief Istanto, Chief of Corporate Human Capital Development FX Sri Martono, dan Koordinator Wilayah Grup Astra Medan Gusyandri. Usai pembukaan dilanjutkan dengan kunjungan ke area pameran Grup Astra yang menampilkan produk terkini dan program tanggungjawab sosial (Corporate Social Responsibility – CSR) dari Grup Astra. (m38)

Waspada/Hamzah Pagelaran seni budaya dengan menampilkan tarian seluruh etnis di Sumatera Utara mewarnai pembukaan Jelalah Dunia Astra di Medan, International Convention Centre yang akan dilaksanakan mulai (15 s/d 17 Juni) di Hotel Santika, Medan.



Dengan H. TEJA SAEFUL Cucu Asli Mak Erot Bersama



I z i n D i n ke s N o. 4 4 8 H a k Pat e n N o. 00.2004.09965.10041 KHUSUS PRIA: - Ejakulasi dini - Impotensi - Memperbesar “Alvit” - Memperpanjang “Alvit” - Keras dan tahan lama dll KHUSUS W ANIT A: ANITA: - Ingin punya keturunan - Memperkencang & memperbesar payudara - Mengobati keputihan dll KONSULTASI UMUM: - Buka Aura - Cari Jodoh - Sesama jenis - Pelaris - Memikat lawan jenis - Besar PYDR


Sarah Nainggolan Siap Mengorbit

Hanya Tempat Kami Klinik Mak Erot Jl. Laksana No. 55J masuk dari Jl. Amaliun Yuki Simpang Raya Medan (Praktek Tetap) HP .0812.4038.333

Setelah sukses di propinsi di Papua, kini hadir di kota Medan, pengobatan nyata luar biasa, bila anda ingin perkasa, ingat jangan salah informasi disini yang pasi ±30 menit kami akan buktikan alat vital menjadi besar dan perkasa. Dengan metode pengurutan disekitar alat vital melalui totok urat-urat kejantanan. Kami tidak mengumbar janji belaka. Tdk ada efek samping, bebas utk semua agama. Bukan janji tapi bukti ditempat Penanganan khusus pria: - Memperbesar, panjang, keras, kuat dan tahan lama - Kencing manis, diabetes, L. syahwat - Ejakulasi dini/ impotensi Khusus Wanita: - Memperbesar/ kencang payudara - Ingin punya keturunan/ gurah vagina - Ingin kembali perawan/ keputihan Konsultasi umum - Ajian semar mesem/ buka aura - Penglaris/ penghasihan/ cari jodoh - Pasang susuk, karir/ jabatan DIJAMIN 100% Alamat Jl. Halat / Masuk Jl. Senam No. 19C. Belakang Makam Pahlawan HP. 0821.6655.3222

WASIRI (Untuk Ambeien)

Wasiri berani menjamin kesembuhan tuntas ambeien/wasir anda. Sangat berkhasiat dan cepat menghilangkan ambeien. Wasir yang menonjol maupun yang tumbuh di dalam. Redakan rasa sakit, perih dan menghentikan pendarahan waktu buang air besar, mencegah infeksi dan panas dalam serta melancarkan buang air besar. Dpt Diperoleh di Sumatera - Aceh Hub: (061) 7365429 - 7362887



Merawat kejantanan secara alami (tidak ada efek samping) besar dan panjang, permanen dan cukup sekali datang Alamat: Jl. SM. Raja masuk Jl. Sempurna No. 18 (samping UISU SM. Raja) HP. 081311196331 No. Izin Kejaksaan, Nomor: B12/DSP.5/01/2012 Metode: Penanganan dari ujung kaki sampai pada pangkal alat vital untuk membetulkan urat yang tersumbat dan melancarkan peradaran darah membetulkan aliran sperma. kemudian dikusuk/ terapy untuk penambah ukuran besar dan panjang tidak ada efek samping, permanen, bebas pantangan dan untuk semua agama.

PRIA - Panjang: 10 - 12 - 14 - 16 - 18 - Besar: 3 - 4 - 5 - 6 - 7 - Sperma encer - Lemah syahwat - Ejakulasi dini - Impotensi

WANITA: - Memperindah payudara - Menjadikan G-spot, seperti perawan kembali - keturunan

DIJAMIN BERGARANSI KONSULTASI UMUM: - Susuk semar asih - Ajian tali raga - Susuk Ratu Malam - Bedak aura kinasih - Ajian pemutus & penyambung cinta - Pelet tuyul

Justin Bieber Bikin Lagu Buat Ibunya Justin Bieber merilis track baru berjudul Turn To You khusus dipersembahkan memperingati Hari Ibu beberapa waktu lalu. Justin Bieber meluncurkan tembang khusus untuk wanita yang sangat penting dan dicintai dalam kehidupannya yaitu ibunya. Sukses melantunkan lagu gress Boyfriend, Justin menembang tribut untuk ibunya, Pattie Mallette dengan menulis sendiri lirik-lirik tembang Turn To You. Mallette adalah wanita sangat khusus dalam kehidupan penyanyi top remaja itu. Ibunya sangat menyanyangi dan memperhatikan Bieber sejak ia masih kecil. Mallette mendukung karir putranya sampai menjadi penyanyi terkenal seperti sekarang ini. Bieber mengaku, akan membuat bangga ibunya dengan melanjutkan studinya ke perguruan tinggi. Meskipun sudah menjadi bintang pop muda, ibunya menginginkannya menjadi sarjana. Bieber meyakinkan sang ibu melanjutkan sekolahnya di sela-sela kesibukan rekaman dan tur musik. “Melanjutkan pendidikan ke jenjang yang lebih tinggi adalah keinginan ibu saya terbesar. Selain menjadi penyanyi terkenal, ibu menginginkan saya menjadi sarjana yang berguna untuk masa depan nanti. Saya berjanji mewujudkan keinginan ibu, agar ia bahagia,” aku Bieber. Justin Bieber bukan merupakan satu-satunya penyanyi pop mendedikasikan track album untuk ibu tercinta mereka. Taylor Swift dan Christina Aguilera merilis tembang manis menonjolkan pujian pada ibu mereka. Pada tahun 1996, group cewek centil Spice Girls juga mempopulerkan track Mama menduduki posisi terhormat lagulagu top Inggris dan nongkrong di rangking teratas tembangtembang hit dunia. Nur/

SATU lagi penyanyi potensial masa depan berdarah Batak, siap mengorbit di industri musik nasional. Dia adalah Sarah Elizabeth Nainggolan,24, semifinalis ajang “NANT Music Audition” (NMA) 2012. Lajang kelahiran Jakarta, 26 Juni 1988 ini, bersama 19 peserta terpilih dari seluruh Indonesia, tinggal selangkah lagi berebut 10 tempat di babak final ajang pencarian bakat penyanyi dimana proses audisinya lewat video nyanyi peserta di upload ke situs Youtube dan malam puncaknya bakal digelar di Balai Sarbini Jakarta, 19 Juni men-datang. “Saya berharap bisa lolos ke babak final NMA karena 10 peserta terbaik akan dibuatkan album kompilasi dan diorbitkan produser Nant Adi Pariwara sebagai penyanyi profesional di industri musik nasional,” papar Sarah Elizabeth Nainggolan kepada Waspada menjelang bersaing di babak semifinal NMA ‘2012 di Score Cafe – Cilandak Town Square, Jakarta Selatan, baru-baru ini. Menurut putri kedua dari delapan bersaudara pasangan A Nainggolan dan J Siahaan ini, berbekal pengalaman menjadi runner-up ajang pencarian bakat penyanyi yang hampir sama yakni proses pendaftaran dan audisi peserta lewat media jejaring sosial situsYoutube - “@ America Idol” gelaran Music School of Indonesia dan Kedubes AS di Jakarta, akhir Februari 2012 lalu, dirinya optimis bisa melangkah ke babak final NMA. “Apalagi di babak semifinal Sarah akan mengusung lagu favorit saya berjudul Apakah Arti Menunggu milik penyanyi Raisa. Semoga aksi panggung saya di hadapan dewan juri nanti bisa tampil prima dan optimal hingga mampu masuk finalis sepuluh besar dan langsung magang sebagai penyanyi

Sarah Nainggolan profesional lewat rekaman single yang dikemas dalam album kompilasi,” harap Sarah. Ajang perdana NMA 2012 disponsori Hyundai Mobil Indonesia dan PT Indofood Sukses Makmur, diikuti lebih dari 600 calon penyanyi profesional dari seluruh Indonesia. Selain memberi kesempatan kepada 10 finalis magang dan mengorbit di industri musik nasional lewat album kompilasi, ajang yang proses pendaftaran dan audisi awal sangat simpel serta memaksimalkan teknologi terkini lewat situs Youtube ini,

juga memberi hadiah mobil bagi pemenang pertama. “Hadiah mobil kami maksudkan untuk memicu semangat para vokalis untuk menampilkan karya terbaik. Yang lebih utama, lewat ajang ini Nanti Musik bisa berperan sebagai fasilitator bagi para calon penyanyi untuk meraih cita-cita menjadi Next Rising Star di blantika musik Indonesia,” harap Muhammad Hananto Wibowo, Executive Produser seraya menambahkan rekaman aksi panggung 10 finalis NMA akan disiarkan tunda di Indosiar. * (AgusT)



Harapan Bank Sumut Ke Depan


T Bank Sumut baru saja menggelar rapat umum pemegang saham luar biasa (RUPSLB) Kamis lalu. Hasilnya tentu saja mencengangkan banyak kalangan. Terutama para pemegang saham yang terdiri dari Pemprovsu, pemerintah kabupaten dan kota. RUPSLB itu memutuskan bahwa direktur utama adalah Rizal Pahlevi Hasibuan, kemudian Rudi Dogar Harahap, direktur pemasaran dan Zeinilhar, direktur umum. Keputusan itu diambil langsung oleh pemegang saham pengendali atau Pemprovsu. Bank kebanggaan masyarakat Sumut itu memang selama 12 tahun sudah dipimpin sosok yang low profile namun punya prestasi tinggi. Gus Irawan Pasaribu, direktur utama Bank Sumut, tiga periode walau mengaku tidak menorehkan tinta emas namun setidaknya bukan tinta merah yang ditinggalkannya. Bank Sumut di tahun 2000 yang dikomandoinya dari modal Rp60 miliar dan utang Rp300 miliar sekarang menjelma dengan aset Rp20 triliun. Berbagai penghargaan sudah diperoleh bank tersebut. Termasuk dalam kategori bank sehat dan berkalikali mendapat apresiasi dari InfoBank dan lembaga pemeringkat lain. Tangan dingin Direktur Utama yang mampu membawa Bank Sumut ke jalur yang benar memang wajar dipertahankan. Berbagai harapan memang muncul dari kelompok masyarakat, nasabah dan karyawan Bank Sumut agar kelak ini bisa menjadi proyek percontohan sebagai regional champion. Mampu menjadikan Bank Sumut sebagai aset berharga Sumatera Utara serta punya nama di tingkat nasional. Dalam berbagai kesempatan Gus Irawan Pasaribu selalu mengaku bahwa dia memang ingin mengakhiri masa jabatannya di periode ketiga. Alasannya bukan karena hal teknis dan Intisari kinerja yang tak mumpuni. Tapi ingin memberi kesempatan kepada kader yang Gus Irawan Pasaribu se- dibawahnya untuk maju menjadi direktur dan direksi. Di bawahnya ada sekitar benarnya telah meletak- utama 10 orang yang bisa menjadi kandidat itu. kan fondasi yang sangat Selain kelada divisi juga para kepala Gus Irawan mengaku tak ingin kuatdalamhalkebersama- cabang. seperti Moammar Khadafi. Baru turun an di Bank Sumut semasa setelah rakyatnya tak suka. Gus Irawan kepemimpinannya.Tidak mengambil langkah saat masih manisdan dipuja-puji lalu berani turun ada bagian terpisah di da- manisnya dari singgasana. Namun melihat hasil RUPSLB yang lamnya.Denganmasuknya pemegang saham harapan Gus kandidat dari luar wajar dilakukan Irawan itu seperti bertentangan. Bagaimana kalau kemudian pecah tidak, yang terpilih bukanlah kader Bank belah di dalam bisa terjadi. Sumut yang sudah dijaring oleh komisaris dan divisi kepatuhan serta divisi SDM. Tiga nama yang muncul menjadi direktur utama dan direksi lain seperti turun dari langit dan hanya diputuskan dalam satu hari saja. Ini kemudian yang memicu kontroversi. Otomatis yang mengerti aturan pasti tak membiarkan Bank Sumut diperlakukan seperti itu. Konteksnya adalah harusnya perusahaan yang sudah sehat dikelola dengan baik dan dipertahankan. Bukan dengan menempatkan orang yang kemudian asal-usulnya tidak jelas. Memang track record direktur utama yang sekarang adalah mantan direktur kepatuhan di Bank Sumut. Tak sampai menghabiskan periodenya di Bank Sumut waktu itu, kemudian pindah ke bank lain. Begitupula dengan Rudi Dogar juga mantan direksi Bank Sumut. Yang membuat karyawan Bank Sumut kecewa sebenarnya karena estafet kepemimpinan telah membuat mekanisme tidak berjalan normal. Lalu banyak yang memberi argumen Bank Riau saja misalnya diambil direksinya dari luar. Yang memberi argumen seperti itu kemudian tak melihat kondisi Bank Riau yang sesungguhnya. Dan belum sepenuhnya layak dibandingkan dengan Bank Sumut. Kita pasti melihat sisi positif dari semua persoalan. Andai pun RUPSLB itu disahkan namun yang menempatkan mereka yang dari luar Bank Sumut otomatis tak mengakui orang dalam yang selayaknya bisa memimpin bank tersebut. Memang ini bukan bagian dari like and dislike. Tapi yang pasti para karyawan dan jajaran pemimpin divisi terhambat haknya untuk melanjutkan estafet kepemimpinan. Apalagi yang meragukan adalah hasil fit and proper test untuk menjadi direksi di Bank Sumut belum diumumkan BI. Wajar kalau keraguan banyak kalangan akan terjadi krisis kepemimpinan di Bank Sumut. Gus Irawan Pasaribu sebenarnya telah meletakkan fondasi yang sangat kuat dalam hal kebersamaan di Bank Sumut semasa kepemimpinannya. Tidak ada bagian terpisah di dalamnya. Dengan masuknya kandidat dari luar wajar kalau kemudian pecah belah di dalam bisa terjadi. Padahal semua berharap Bank Sumut ke depan bisa menjadi lebih baik.*

56 Tahun KAA & Konflik Libya Oleh Arfan Adha Lubis Semangat KAA tak lagi seperti dulu.Gaungnya semakin redup seakan pudar dimakan zaman. Eksistensi negara KA semakin mandul melawan arogansi sang mono adidaya.


Tahun silam Sukarno menyerukan persatuan dan persaudaraan di negara-negara konferensi Asia – Afrika (KAA). Gelora pidato Sukarno membahana, menegaskan semangat KAA untuk menghapuskan penjajahan dan meredakan ketegangan dunia akibat persaingan negara adikuasa. Hanya dengan persatuan dilandasi semangat kebersamaan negara Asia Afrika menjadi merdeka menentukan nasib masa depan bangsanya. Rasa solidaritas senasib sepenanggungan merupakan ruh negara KAA terlepas keberagaman budaya, bahasa serta ideologi. Negara Asia – Afrika harus menjadi negara berdaulat, bermartabat yang merupakan hak setiap bangsa. Untuk itu diperlukan kerjasama berdasarkan prinsip saling menghargai diantara negara KAA dalam melawan penjajahan. Sejatinya negara KAA bekerjasama bahu-membahu menciptakan tatanan masyarakat dunia yang etis dan egalitarian. 5 Negara Pemrakarsa Konferensi Asia – Afrika berlangsung di Gedung Merdeka Jalan Asia – Afrika, Bandung. KAA dilaksanakan 18 – 25 April 1955 diprakarsai 5 negara yaitu Indonesia diwakili Perdana Menteri Ali Sastroamijoyo, India (Pandit Jawaharlal Nehru), Birma (Perdana Menteri UNU), Pakistan (Perdana Menteri Mohammad Ali), dan Sri Langka (Perdana Menteri Sir John Kotelawala). Berawal pertemuan 5 perdana menteri di Kolombo, Sri Langka tanggal 28 Aril – 2 Mei 1954 untuk membuat suatu pertemuan yang dihadiri negara-negara Asia – Afrika. Kemudian ditindaklanjuti dengan konferensi Panca Negara (konferensi Bogor) tanggal 28 – 31 Desember 1954 untuk membahas persiapan penyelenggaraan Konferensi Asia – Afrika (Warsito, dkk, 1997: 30). Pertemuan itu membuahkan kesepakatan: 1. Mengadakan Konferensi Asia – Afrika di Bandung pada bulan April 1955, 2. Menetapkan kelima negara peserta konferensi Bogor sebagai negara-negara sponsor, 3. Menetapkan jumlah negara Asia – Afrika yang akan di undang, 4. Menetapkan tujuan pokok Konferensi Asia – Afrika. Tujuan diselenggarakannya KAA adalah: a) memajukan kerjasama antar bangsa Asia dan Afrika, b) Membicarakan masalah-masalah menyangkut ekonomi, sosial dan kebudayaan,

Faks 061 4510025

Facebook Smswaspada

+6282168040028 PBB muncul, kerena untuk penghentian/meniadakan penjajahan dimuka bumi ini. Bukan ikut campur dalan negara orang. Peran PBB terlalu jauh. Sudah cukup, PBB berperan, menghilangkan penjajahan. Dengan cara biarkan setiap negara menproduksi setiap barang/benda. Baik alat untuk perang maupun yang lainnya. Ketika negara itu, mau nyerang negara lain. Baru disini PBB beraksi. +6282168844955 Kepada yang terhormat KAPOLRES ACEH TENGGARA...tolong dong di tindak tegas pengendara-pengendara sepeda motor yang memakai knalpot recing suaranya cukup mengganggu tidak lama lagi bulan puasa tiba jadi butuh ketenangan,semoga pihak kepolian punya keberanian untuk mengambil tindakan,kita tunggu aksinya...thx...WASPADA +6285373660712 Hai.. Apa Kabar? +6282166523150 HAPUSKAN KORUPSI .’ +6287744832383 Pak kadis batu bara kapan lagi uang sertifikasi kami dicair kan? +628126329716 REDAKSIWASPADA, Saya pelanggan SETIAWASPADA di Lsk ingin menanyakan:Tebak Juara Euro, apakah 1 kupon 1 kaleng Teangin? karena di kupon tsb kurang jelas dan Pelanggan yg dari Aceh apakah bisa kirim dengan armada WASPADA ?. +628126329716 Redaksi WASPADA Yth, Pertanyaan masalah kuis Tebak Juara Euro tsb mohon jawaban dari Redaksi, trimks semoga WASPADA tetap JAYA sepanjang masa. +6287766240518 TAK ada Gunanya Hukum Dinegeri Ini Contoh Banyak Kasus Korupsi yg Dilakukan Bupati Atau Walikota Yg Berada Di Sumut Atau Kota Medan Pemerintah Tak Berani Menangkapnnya +6285763811181 ASSALAMUAILAIKUM WR.WB, Pertama tama marilah kita panjatkan puji syukur kepada tuhan yang maha esa. Disini saya ingin ucapkan kepada KEZIA and STEFANI karena mereka sudah menjadi personil CHERRYBELLE yg baru! Semoga Cherrybelle semangat dan ISTIMEWA ea ! Salam buat kawan2 cherrybelle... Trims untuk koran WASPADA. +6285370172899 ASLLAMUALAIKUM WASPADA,TOLONG DITULIS DAFTAR TOPSKOR EURO 2012 TIAP HARI, TERIMAKASIH. +6281263749562 Rhythm king udah tampil.great seision,kapan wapemred ?.awak rindu. +6281370980427 Si ompung awak manolah mungkin ditukar.,jd tok yg ini samo gubsu non aktif ada kesamaan ala sama2 anak kolong, sama2 pernah tinggal di glugur darat medan.

c) Membicarakan masalah-masalah menyangkut kedaulatan nasional, rasialisme (pembedaan ras), dan kolonialisme (penjajahan), d) Meninjau kedudukan bangsa-bangsa Asia – Afrika untuk memajukan perdamaian dunia (Warsito, dkk, 1997: 31). Pernah Membahana Munculnya kekuatan negara-negara Asia – Afrika memberikan kontribusi bagi perdamaian dunia. Manfaat itu antara lain ketegangan dunia akibat perang dinging berkurang. Puncaknya perang dingin berakhir dengan bubarnya Blok Timur dan runtuhnya Uni Soviet tahun 1991. Amerika tampil sebagai kampiun polisi dunia sekaligus pencipta neokolonialisme baru di muka bumi. KAA berperan menumbuhkan semangat bangsa-bangsa Asia – Afrika yang masih terjajah untuk bangkit berjuang memerdekakan diri dari belenggu penjajah. Negara-negara Asia – Afrika merdeka setelah KAA antara lain Maroko, Tunisia, Sudan (1956), Ghana (1957), serta Mauritania, Mali, Nigeria, Togo, dan Kamerun (1960). Hasil KAA memberikan andil besar bagi berdirinya gerakan Non Blok di kemudian hari. KAA berhasil merumuskan sepuluh asas dikenal dengan Dasasila Bandung. Kesepuluh asas itu adalah, 1) Menghormati hakhak dasar manusia sebagai termuat dalam Piagam PBB, 2) Menghormati kedaulatan dan keutuhan wilayah semua negara, 3) Mengakui persamaan semua ras dan bangsa, baik besar maupun kecil, 4) Tidak melakukan campur tangan terhadap urusan dalam negara lain, 5) Menghormati hak setiap bangsa untuk mempertahankan diri secara sendirian ataupun bersama-sama, sesuai dengan Piagam PBB, 6) Tidak melakukan tekanan terhadap negara lain, 7) Tidak melakukan agresi ataupun tindakan kekerasan terhadap negara lain, 8) Menyelesaikan segala perselisihan Internasional secara damai, 9) Memajukan kerjasama untuk kepentingan bersama, 10) Menghormati hukum dan kewajiban-kewajiban internasional. KAA Dan Konflik Libya Semangat KAA tak lagi seperti dulu. Gaungnya semakin redup seakan pudar dimakan zaman. Eksistensi negara KA semakin mandul melawan arogansi sang mono adidaya. Negara KAA seakan tak punya nyali, kehilangan solidaritas rasa persaudaraan di antara sesama anggotanya. Libya notabene negara KAA

ditinggal sendiri menghadapi gempuran Zionisme global. Tripoli dibiarkan porakporanda, dibombardir Zionis yang berlindung di balik Resolusi Dewan Keamanan PBB. Negara-negara KAA, kehilangan kesejatian dirinya dalam menentang kebrutalan dan kehegomonian mono adidaya. Tidakkah terbersit bagi anggota negara-negara KAA, Liga Arab, OKI (negara-negara Islam) untuk menyadari suatu kerugian besar kalau Libya jatuh dan dikuasai Amerika bersama sekutunya. Seyogyanya negara KAA memainkan peranan, menunjukkan sikap solidaritas terhadap Libya, terlebih bagaimana nanti nasib Libya pasca transisi? Akankah Libya jatuh ke tangan Yahudi dan koalisi yang begitu bersyahwat menguasai Tripoli. Sudah seharusnya negara KAA dari awal mengambil sikap, melakukan protes keras menentang agresi kebiadaban Amerika ke Libya. Walau kita sepakat rezim Khadafi melakukan pelanggaran hukum internasional dengan menembaki rakyat sipil. Bahkan Khadafi mempersenjatai rakyat pro pemerintah, untuk dijadikan tameng melawan pasukan koalisi maupun kaum pemberontak di dalam negeri Libya. Akan tetapi aksi terkutuk Amerika ke Libya tidak bisa ditolerir dengan dalih apapun. Terlebih serangan koalisi mengabaikan hukum internasional serta menyimpang dari

mandat resolusi PBB. Serangan sekutu mengakibatkan tewasnya rakyat sipil dan membumihanguskanTripoli negara Muslim di kawasan utara Afrika. Di balik manuver invansi ke Libya, Amerika dan sekutu mempunyai agenda rahasia untuk memecahbelah negaranegara Islam menjadi negara-negara kecil, sehingga mudah dikuasai. Hal ini dilihat bagaimana Yaman, Suriah, dan Bahrain dipecah-belah dengan politik adu domba. Terlebih negara-negara Islam kaya minyak itu mempunyai isme kesukuan yang sangat tinggi. Peluang ini kesempatan Amerika untuk masuk yang tentu didramatisir dengan political bomb (bom politik) Zionisme global. Penutup Semangat persaudaraan di antara negara KAA sejatinya digemakan sepanjang masa. Karena bangsa-bangsa Asia – Afrika punya catatan manis dalam lembaran sejarah. Terlebih mempunyai ikatan dan kedekatan secara geografis. Namun sayang, semangat KAA kini semakin menghilang. Bahkan materi negara KAA di buku pelajaran semakin jarang didapatkan. Semakin dilupakan atau ditinggalkan. Atau mungkin coba menghilangkan jasa dan pemikiran Sukarno. Semoga saja tidak!!! Penulis adalah Dosen STMIK LOGIKA Medan, Kandidat Magister PPs Ilmu Hukum UMSU.

Manfaat Matematika Dalam Oleh Sariyati


WASPADA Sabtu 16 Juni 2012

Bagaimana cara agar siswa termotivasi belajar matematika? Salah satunya adalah dengan memberitahu bahwa matematika itu dekat dengan dirinya dan bermanfaat bagi kehidupannya.


enulis sering mendengar percakapan antar siswa yang mengatakan bahwa pelajaran yang paling tidak disukai adalah matematika. Ia akan melanjutkan ke sekolah yang tidak ada matematikanya. Benarkah ada sekolah (jenjang pendidikan) yang tidak ada matematikanya? Benarkah matematika itu susah? Mengapa matematika begitu menakutkan bagi sebagian siswa? Pertanyaan itu sering penulis utarakan pada siswa dan jawaban mereka tentu bermacammacam. Ada yang mengatakan matematika sulit dipelajari, sulit menghafal rumus, kalaupun hafal ia tidak dapat menggunakannya untuk menyelesaikan soal, ada juga yang mengatakan tidak suka angka-angka. Untuk jawaban yang terakhir penulis merasa lucu karena setiap hari siswa tersebut selalu bergelut dengan angka-angka, misalnya uang saku maupun nomor HP teman-temannya. Ketika penulis utarakan hal itu dengan cepat siswa tersebut menjawab,”itukan lain bu!” Pernah juga penulis mendengar (ini sangat jarang terjadi) pelajaran yang paling disukai adalah matematika. Menurut siswa tersebut satu rumus yang dikuasai dapat digunakan untuk menyelesaikan banyak soal. Terlepas dari suka atau tidak suka matematika adalah sesuatu yang pasti diperlukan dalam kehidupan sehingga siswa tidak dapat menghindarinya. Bagi siswa yang menyukai, pelajaran matematika tentu menyenangkan. Namun bagi siswa yang tidak suka tentu pelajaran matematika merupakan beban. Untuk kelompok siswa yang tidak suka matematika tentu sulit memahami atau mempelajari matematika sehingga perlu dicarikan jalan keluar agar kelompok ini termotivasi untuk belajar matematika. Bagaimana cara agar siswa termotivasi belajar matematika? Salah satunya adalah dengan memberitahu bah-

wa matematika itu dekat dengan dirinya dan bermanfaat bagi kehidupannya. ?Kehadiran matematika di sekolah maupun dalam kehidupan sehari-hari sangat bermanfaat karena dapat digunakan untuk berhitung , berdagang, mengolah data, dan berkaitan dengan bidang studi lain seperti; IPA, IPS, Agama, B.Indonesia, AgroIndustri, maupun senimusik. Manfaat Dalam Bidang Studi Manfaat matematika dalam bidang studi IPA sudah jelas, karena hampir semua materi melakukan hitungan. Contoh: a)Jarak 2 buah kota 120 km ditempuh dalam waktu 2 jam 30 menit, maka kecepatan kendaraan itu adalah 125 km : 2,5jam = 50 km/jam. b)Seorang ibu rumah tangga ingin tahu berapa biaya yang harus dikeluarkannya untuk biaya listrik setiap bulan jika ia menggunakan 4 buah lampu 25 watt, 2 buah lampu 60 watt.TV 100 watt, kulkas 150 watt, dan kipas angin 75 watt. Setiap harinya peralatan tersebut digunakan selama 10 jam, sedangkan biaya listrik Rp.500/kwh. Masalah ibu di atas dapat diselesaikan dengan menggunakan matematika yaitu: Daya; P = (4 x 25) + (2 x 60) + 100 + 150 + 75 = 545 watt = 0,545 kw.Waktu;t=30x10h=300h.Berartienergi listrik yang digunakan w = P x t = 0,545 kw x 300h = 163,5 kwh sehingga biaya listrik 1 bulan = 163,5 x Rp.500,- = Rp81.750. c)Amuba hewan bersel satu membelah diri setiap 10 menit. Berapa banyak amuba setelah 1 jam ?Hal ini dapat diselesaikan dengan menggunakan bilangan berpangkat, yaitu: 10 menit pertama amuba yang terjadi 21= 2,10 menit ke dua 22 = 4, sehingga setelah 1 jam amuba yang terjadi adalah 26 = 64 amuba. Manfaat dalam Bidang studi IPS seperti pada materi geografi sering menggunakan matematika antara lain peta. Pada atlas kita sering menjumpai skala misalnya 1 : 2.000.000. Artinya

1 cm pada peta = 2.000.000 cm jarak sebenarnya. Jika jarak 2 kota 5 cm itu artinya 5 x 2.000.000 cm = 10.000.000 cm = 100 km. Pada materi ekonomi, matematika lebih sering digunakan antara lain untuk menghitungbungabank.Contoh:PakAmir menyimpan uang di bank sebesar Rp.2000.000 dengan bunga 12 % pertahun. Berapakah jumlah uang Pak Amir setelah 9 bulan? Penyelesaian: Bunga 9 bulan = x x Rp.2000.000 = Rp.180.000,- Sehingga uang Pak Amir setelah 9 bulan adalah = Rp.2000.000,- + Rp.180.000,- = Rp.2.180.000,Manfaat matematika dalam bidang studi AgroIndustri misalkan dalam pembuatan kue bolu memerlukan tepung terigu 250 gram, gula putih 250 gram, mentega 250 gram, telur 6 butir, dan baking powder 1 sendok teh. Atau pada pembuatan kue nenas memerlukan tepung terigu 1kg, gula putih kg, tepung susu kg, rum boter kg, mentega kg dan telur 10 butir. Pada pembuatan kue bolu satuan yang digunakan adalah gram, sedangkan pada pembuatan kue nenas menggunakan satuan kg. Dalam hal ini siswa dituntut untuk dapat melihat hubungan antara kilogram dan gram. Semua hal dia atas tentu saja diperoleh siswa dalam pelajaran matematika. Dalam bidang studi Agama Islam manfaat matematika adalah pembagian warisan. Dalam pembagian warisan ada beberapa ketentuan seperti tercantum dalam Surat Annisa ayat 11 dan 12. Misalkan seorang laki-laki meninggal dunia, ia mempunyai seorang istri, tiga anak laki-laki, dua anak perempuan. Laki-laki tersebut meninggalkan harta senilai Rp100 juta, hutang Rp10 juta dan wasiat untuk anak angkat Rp5 juta. Maka ketentuan pembagian warisan adalah: Harta yang dibagi = Rp100 juta - Rp10 juta - Rp5 juta = Rp85 juta. Bagian istri = x Rp85 juta = Rp10,625,000 (karena mempunyai anak). Bagian anak laki-laki =Rp85 juta = Rp42,500,000. Maka Bagian 1 orang anak laki-laki = x Rp42,500,000 = Rp.14,166,667. Bagian anak perempuan = x Rp42,500,000 = Rp.21,250,000 (bagian anak perempuan = dari anak laki-laki). Maka Bagian 1 orang anak perempuan = x Rp21,250,000 = Rp10,625,000. NbbSisa

uang sebesar Rp10,625,000 boleh diberikan pada keluarga, anak yatim atau diinfakkan ke masjid. Pada pelajaran Bahasa Indonesia juga diperlukan matematika, yaitu ketika membaca grafik maupun membuat skema denah suatu daerah dengan menggunakan skala. Dalam bidang studi Seni Musik juga memerlukan matematika yaitu ketika mengubah not angka menjadi not balok. Dengan mengetahui manfaat matematika dalam bidang studi yang lain diharapkan siswa lebih mencintai matematikadanmenggunakannyakelaksetelah mereka terjun ke masyarakat. Semoga! Penulis adalah ?Guru SMP Negeri 31 Medan.

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di Media manapun.Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Sekda Madina pergoki banyak PNS mangkir - Salah siapa, dosa siapa? * 60 persen pekerja konstruksi lulusan SD - Lulusan SD, kemampuan insinyur * Deliserdang paling sedikit miliki warga miskin - Maklum banyak tuan kebun, he...he...he


D Wak


WASPADA Sabtu 16 Juni 2012

Dandim 0116 Nagan Raya Hadiri Program Ketahanan Pangan Panen Raya

45 Mobil Bermasalah Diamankan LHOKSUKON (Waspada) : Jajaran Kepolisian Resort Aceh Utara mengamankan 45 mobil bermasalah sejak 2010 lalu. Mobil ini rata-rata ditahan karena tidak memiliki dokumen lengkap dan ditangkap dalam razia rutin yang digelar Satlantas. “Siapa saja yang merasa kehilangan mobil, silakan melihat ke Mapolres Aceh Utara,” papar Kapolres Aceh Utara AKBP Farid BE usai pemeriksaan barang bukti mobil di depan gedung Tri Brata, Mapolres Aceh Utara, di Lhoksukon, Jumat (15/6). Didampingi Kepala Satuan Tahanan dan Barang Bukti (Tahti) Ipda Zam Zami, Kapolres merincikan, 45 mobil tersebut masingmasing 6 unit Kijang kapsul, 21 Avanza, 3 Xenia, 2 Blazer, 1 Pajero, 1 Honda Stream, 6 Innova, 1 Taft, 2 APV, 1 panther pick-up dan 1 unit kijang pick-up.(b19)

NAGANRAYA (Waspada) : Komandan Kodim 0116 Nagan Raya Letkol InfantriYunardi menghadiri program ketahanan pangan panen raya jagung Pos Ramil Tripa Makmur dan Kelompok Tani Maju Bersama Desa Leung Kebu Jagad. Menjadi harapan besar ke depan kelompok tani tersebut mendapat binaan lebih baik untuk meningkatkan hasil panen. Sehingga dapat meningkatkan perekonomian masyarakat setempat maupun anggota Kelompok Tani Maju bersama. Kelompok Tani Maju Bersama itu sendiri di bawah binaan Komandan Pos Ramil Tripa Makmur Serma Darwin Harahap. Saat ini, kelompok tersebut telah mengolah 10 hektare lahan dengan jumlah anggota 35 orang dengan Ketua Kelompok Hasbi HR. Tidak menutup kemungkinan pula ke depan untuk dibina menjadi suatu kelompok tani yang lebih baik lagi. Dandim Nagan Raya Letkol Inf Yunardi dalam arahannya mengatakan, agar anggota

Polres Pidie Tangkap Penjudi Togel SIGLI (Waspada): Polres Pidie menangkap 7 pelaku judi togel (toto gelap) yang berstatus sebagai bandar dan kurir. Polisi mengamankan barang bukti uang hasil judi angka tersebut berikut handphone dari pelaku. Kapolres Pidie AKBP Dumadi melalui Kasatreskrim AKP Raja Gunawan mengatakan, pelaku ditangkap di tiga lokasi terpisah, Rabu (13/6), setelah petugas menerima laporan. Dikatakan, penangkapan terhadap keempatnya berawal dari penangkapan Abdullah Bin Kaoy, 50, warga Gampong Mesjid Keumangan, Kec. Mutiara Barat. “Dia ditangkap di sebuah warkop di Pasar Bernuen dan selama ini warga sudah mengetahui dia agen togel sehingga melaporkannya,” kata AKP Raja Gunawan, Jumat (15/6). Menurut Raja, selang setengah jam kemudian sekira pukul 14:30 dari hasil pengembangan, petugas kembali menangkap Samsuddin Abbas, 48, warga Gampong Rambayan, Kec. Peukan Baro. Adapun dua tersangka lain yang ditangkap, Abdul Bin Thaleb, 37, dan Nurdin Bin M Husin, keduanya warga Gampong Lingkok Busu, Mutiara Barat, Pidie. Disebutkan Raja, sebelumnya 3 pelaku judi togel juga ditangkap di Pidie Jaya. Mereka yakni, Fadli, warga Gampong Manyang Cut, Iskandar Abd, 29, warga Gampong Numpun,Kec. Meredue dan Ismail Risyad, warga Dayah Pangwa, Tringgadeng. (cb06)

PMI Kota Lhokseumawe Kampanye Donor Darah LHOKSEUMAWE (Waspada) : Sekitar 40 relawan Palang Merah Indonesia (PMI) Kota Lhokseumawe melakukan kampanye donor darah pada peringatan World Blood Donor Day 2012. Selain melakukan long march di pusat kota, mereka juga membagikan brosur dan stiker kepada masyarakat, Kamis (14/6). Kampanye donor darah, menurut ketua panitia Sugito Tassan, sengaja dilakukan untuk memberikan pengetahuan tentang manfaat donor darah bagi masyarakat. Menurut dia, kebutuhan darah semakin tinggi di Lhokseumawe, sementara pendonor masih kurang. “Kita menyampaikan kepada masyarakat manfaat dari kegiatan donor darah,” ungkapnya. Sementara PMI Aceh Utara pada peringatan hari donor darah sedunia tersebut juga melakukan donor darah di Taman Riadah, Lhokseumawe. Selain itu, panitia juga melakukan donor darah di ibu kota Aceh Utara, Lhoksukon pada 18 Juni mendatang. (b15)

Waspada/Zainal Abidin

RELAWAN PMI Kota Lhokseumawe melakukan long march dalam rangka mengkampanyekan donor darah pada peringatan World Blood Donor Day 2012, Kamis (14/6)

Guru TK Uswatun Hasanah Pertanyakan Testing BIREUEN (Waspada) : Sebanyak 12 guru honorer Taman Kanak-kanak Uswatun Hasanah Bireuen yang sudah diumumkan lulus dalam database buku putih mempertanyakan jadwal bagi mereka menjadi untuk mengikuti testing guru PNS. Jaswani, guru honorer TK Uswatun Hasanah didampingi sejumlah guru honorer lainnya alumni Sekolah Pendidikan Guru (SPG) di selasela wisuda dan perpisahan murid TK di aula Setdakab Bireuen, Kamis (14/6) mengaku sudah mengabdi menjadi guru honorer di TK Uswatun Hasanah Bireuen sejak tahun 2004 dengan masa kerja delapan tahun sudah mendapat pengumuman lulus dalam database buku putih. Namun hingga saat ini jadwal, kapan mereka akan mengikuti testing menjadi guru PNS masih mengambang. Nasib yang sama tidak hanya dialami Jaswani, juga dialami 11 guru honorer lainnya di TK Uswatun Hasanah Bireuen lulusan PGTK yang rata-rata sudah mengabdi lima tahun, juga sudah mendapat pengumuman lulus dalam database buku putih. (b12)

Radio Swasta Off-Air Jam Shalat Jumat SIGLI (Waspada) : Sebanyak empat stasiun radio siaran swasta di Kabupaten Pidie menghentikan jadwal siarannya (off air) setiap menjelang ibadah shalat Jumat. Kondisi ini sudah berlangsung sejak tahun 2000 sampai sekarang. “Setiap menjelang shalat Jumat kami memang menghentikan segala kegiatan siaran. Hal ini kami lakukan untuk menghormati masyarakat yang melaksanakan shalat Jumat, selain juga memberikan waktu kepada karyawan atau penyiar yang melaksanakan shalat,” kata Pimpinan Umum PT Radio As Fm Sigli Asmansyah Asri, Jumat (15/6). Kendati begitu, jadwal siaran pada setiap hari Jumat seperti biasa. Yaitu Radio As FM Sigli mengudara dari pukul 06:00i dan tutup siaran (off air) sementara jam 12:00 sampai selesai sholat jumat. Radio As kembali mengudara pada pukul 13:46 dan tutup siaran pukul 24:00. (b10)

Waspada/Muhammad Riza

ERIKA danYana Al-Fansury, dua penyiar Radio As Fm Sigli sedang bertugas membawa siaran Lacag (Lagu Aceh Geutanyoe) disponsori Pt Capela Dinamik Nusantara, Jumat (15/6).

B9 kelompok maupun masyarakat yang merasa membutuhkan binaan maupun bantuan seperti pupuk dan racun dapat menyampaikan langsung, tentunya guna disampaikan pada pemerintah daerah. Camat setempat Abdul Kadir yang juga hadir pada kegiatan itu mengaku memperdayakan kelompok tani adalah kegiatan positif bagi masyarakat. Tentunya program tersebut harus dibina. Tentunya tidak terlepas dari peran Pemda melalui Dinas Pertanian. Staf yang hadir mewakili Kadis Pertanian Ali Basya mendukung tiap program yang ada pada kelompok tani, tidak hanya pada penanaman jagung. Tentunya melalui permohonan yang dibuat kelompok tani masyarakat. Anggota kelompok tani berharap, pada penyaluran bantuan, Pemda menyerahkan langsung pada kelompok tani.“Kami berharap pemerintah dapat menyalurkan langsung bantuan apapun kepada kelompok tani yang ada,” ungkapnya. (cda)

Waspada/Mahadi Pinem

PASANGAN calon Bupati-Wakil Bupati Agara nomor urut 2, Hasanuddin B-Ali Basrah usai menyampaikan visi dan misi di gedung DPRK Agara, Jumat (15/6).

Visi Misi Cabup-Cawabup

Wujudkan Agara Maju Dan Bermartabat KUTACANE (Waspada) : Ruang sidang gedung DPRK Agara di Kutacane, Jumat (15/6) menjadi pusat perhatian masyarakat Aceh Tenggara, pasalnya tujuh pasang calon Bupati/Wakil Bupati Agara tampil bergantian menyampaikan visi dan misi yang merupakan bagian dari tahapan dimulainya kampanye Pilkada Agara. Penyampaian visi dan misi itu dipandu Ketua DPRK Agara Salim Fakhri, didampingi 2Wakil ketua yakni Syahbuddin BP dan Nazaruddin, juga duduk di kursi pimpinan Samsul Bahri, Wakil Bupati Agara. Pasalnya Bupati Agara Incumbent H Hasanuddin B ikut maju Pilkada sehingga terhitung mulai Jumat (15/6) Hasanuddin B resmi cuti sesuai surat pemberian cuti dari Gubernur Aceh ditandatangani pejabat Gubernur Aceh Tarmizi A Karim, tertanggal Kamis (14/ 6) sebagaimana disampaikan Ketua KIP Agara Dedi Mulyadi Selian ST. Pantauan Waspada, tujuh pasang kandidat dalam penyampaian visi dan misi dimulai dari pasangan nomor urut 1 Raidin Pinim-Muslim Ayub memaparkan tentang lapangan kerja, pendidikan, anti KKN serta menegakkan Syariat Islam.

Sedangkan pasangan Bupati Incumbent nomor urut 2,pasangan Hasanuddin B-Ali Basrah dalam visinya memaparkan tujuan terwujudnya Aceh Tenggara yang maju dan bermartabat dan misi yang diemban ke depan meningkatkan sistem tata kelola pemerintahan yang baik, mengembangkan perekonomian rakyat di semua sektor untuk kemajuan daerah. Meningkatkan pembangunan infrastruktur, memajukan pendidikan dan meningkatkan SDM, meningkatkan kesehatan masyarakat serta meningkatkan kerukunan hidup antar umat beragama. Sementara dalam acara visi dan misi yang dihadiri muspida plus, KIP dan Panwaslu serta tim sukses pasangan calon Bupati Agara ini dilanjutkan calon nomor 3 Rajidin – Sarim Sembiring yang menekankan pada penegakan Syariat Islam serta pembangunan pertanian. Sedangkan pasangan Armen Desky–Tgk Appan Husni, lebih spesifik menyampaikan tentang perjuangan melahirkan provinsi. Dan calon Marthin DeskyKamasiah menekankan pada pemerintahan yang bersih serta kesejahteraan guru. Kandidat nomor urut 6 pasangan Amriko –M Ridwan menyampaikan soal perluasan lapangan kerja dan mengutamakan profesionalisme PNS dan kandidat pasangan Riduan – Erwin Sihombing menge-

mukakan soal peningkatan pendapatan per kapita serta membangunan Agara dengan mengedepankan nilai-nilai akidah. Pada penyampaian visi dan misi d igedung DPRK itu sempat terjadi insiden yakni ketika penyampaian visi dan misi pasangan calon, panitia dari sekretariat membagikan buku visi dan misi pasangan Sanu –Ali Basrah. Hal itu mendapat protes dari salah seorang warga yang hadir, namun hal itu dapat diatasi panitia sehingga tidak berakhir dengan hal yang tidak diinginkan. Terkait soal ini, Hamdan dari Panwaslu Agara mengaku tidak ada yang salah membagikan buku visi dan misi kandidat, pasalnya semua kandidat boleh melakukan karena tahapan hari itu telah masuk dalam tahapan kampanye visi dan misi dan insiden ini dilihat hanya salah pengertian saja, bukan merupakan pelanggaran. Namun di luar pagar gedung DPRK Agara terjadi unjuk rasa puluhan mahasiswa UGL yang menyampaikan orasi soal tindaklanjut permasalahan pegawai honorer, namun aksi aktivis kampus ini tidak sampai mengganggu agenda daerah di ruang sidang dewan itu. Sementara mulai hari ini, Sabtu (16/ 6) para calon Bupati –Wakil Bupati Agara serempak melakukan kampanye terbuka. (b25)

Waspada/Didit Arjuna

ANGGOTA Kelompok Tani Maju Bersama foto bersama Komandan Kodim 0116 Nagan Raya Letkol Inf Yunardi, Camat Tripa Abdul Kadir, Danpos Ramil Tripa Serma Darwin Harahap setelah melakukan panen bersama.

Seminar Partisipasi Pemilih Agara KUTACANE (Waspada) : KIP Agara menggelar seminar bertema partisipasi masyarakat dalam penyelenggaraan Pilkada Bupati/Wakil Bupati Aceh Tenggara 2012 di gedung kesenian, Kamis (14/6) menghadirkan nara sumber dari Unimal Lhokseumawe T Kamal Fasha yang akrab dengan lingkungan aktivis dan dipandu Masri Amin, mantan Ketua Mahasiswa Aceh Nusantara. Juga hadir sebagai pemateri seminar dari kalangan intelektual muda Qarnain Musra dari KIP Dedi Mulyadi Selian, Ketua KIP, dari Panwaslu Hamdan, moderator Masri Amin dan pemateri tamu T Kamal Fasha diikuti ormas pemuda bersama KNPI, kalangan akademisi serta kelompok perempuan Agara. Seminar itu sendiri, kata Ketua KIP Agara, bertujuan untuk pendidikan politik, sebab tanpa adanya pendidikan politik yang baik, maka tidak akan pernah dihasilkan pemilih yang baik. Qarnain Musra mengupas soal tipe pemilih,

pemilih militan biasanya dari kelompok partai politik itu yang nampak hanya di PDIP dan PKS secara umum, kemudian pemilih kritis, tipe ini jumlahnya hanya sedikit dan yang paling dominan tipe pemilih termasuk di Agara adalah tipe emosional, yang dicirikan dengan faktor kekerabatan, faktor fisik kandidat dan faktor iming-iming politik uang. T Kamal Fasha menyampaikan, faktanya hingga saat ini hampir di semua daerah belum terlalu siap menghadapi demokrasi liberal. Akibatnya di banyak pilkada yang dilakukan hanya melahirkan seorang bupati, namun nol dalam etika politik. Hal ini disebabkan otonomi individu di dalam memilih tidak ada, karena dikaitkan faktor kekerabatan. “Ini sangat memprihatinkan, padahal barometer untuk memilih seorang pemimpin itu bukan soal kedekatan, tetapi ditinjau dari visi dan misi kandidat,” ujar T Kamal Fasha. (b25)

Manulife Serahkan Beasiswa 50 Siswa BANDAACEH (Waspada) : Dalam rangka Anniversary ke27 Manulife Indonesia, Yayasan Manulife Peduli (YMP) melalui kegiatan Coorporate Social Responsibility (CSR) memberikan beasiswa kepada 50 siswa dari dua sekolah binaan mereka di Aceh, yakni SDN 25 dan SDN 28 Banda Aceh. Kegiatan yang dilaksanakan di SDN 25 Lampriet, Banda Aceh, Kamis (14/6) dihadiri Vice President Director Manulife In-

donesia, Nelly Husnayati, Head Of Partnership Bussiness, Mr Hans DeWaal serta Kepala Kantor Pemasaran Banda Aceh Teuku Muzis, dan undangan lainnya. Menurut Nelly, kegiatan ini merupakan agenda tahunan pihaknya sebagai wujud perhatian dan kepedulian terhadap sekolah-sekolah binaan Manulife Indonesia. “Selain dalam bidang pendidikan, kita juga tetap konsisten memberikan

bantuan di sektor kesehatan dan komunitas,” katanya. Tahun ini, Manulife Indonesia memberikan beasiswa kepada 125 siswa dari lima sekolah binaan, masing-masing untuk SDN 25 dan SDN 28 Banda Aceh, SDN Winongo Manulife di Bantul. Yogyakarta, serta SDN Simpenan Manulife dan SDN Pondok Tusuk Manulife di Sukabumi, Jawa Barat, masing-masing 25 siswa. (b04)

Waspada/Mahadi Pinem

NARASUMBER dari kanan; Hamdan dari Panwaslu, Dedi Mulyadi ST, Ketua KIP Agara, Masri Amin (tengah) sebagai moderator, T Kamal Fasha dari Unimal dan paling kiri Qarnain Musra, Kamis (14/6) di gedung kesenian Agara dalam acara seminar pendidikan politik bagi pemilih.

Nurhayati, 40 Tahun Jualan Goreng Pisang Kini 10 Anaknya Sudah Sukses KREP-krop-krep-krop... demikian terdengar dari kumpulan remaja tanggung di sudut SMPN 1 Julok, Aceh Timur. Ternyata, pelajar yang sebagian berdiri dan sebagian lainnya duduk sedang menikmati pisang goreng yang dijajakan Nurhayati, Rabu (6/6) di sebuah kios sederhana yang terbuat seadanya dan ditutupi dengan kain spanduk. “Sibuk ya buk,” tanya Waspada memulai wawancara, “Enggak, biasa saja,” jawabnya setelah menyebutkan namanya Nurhayati 65 tahun. “Sudah lama bu menjajakan pisgor dan jajanan lain,” tanya Waspada lagi, “Iya, lebih kurang sudah 40 tahun, dan 10 anak saya bisa sekolah dengan biaya dari hasil jualan pisang goreng,” kata Nurhayati. Selama 40 tahun menjadi penjualan pisang goreng ketika aktivitas sekolah berlangsung. Dia menikah dengan Kadimin yang kini sudah berusia 82 sejak 45 tahun yang silam. Nurhayati membesarkan anak-anaknya di sebuah rumah yang dibangun bersama suami-

Waspada/Muhammad H Ishak

NURHAYATI dibantu anaknya Safaruddin sedang menjajakan pisang goreng di kiosnya di SMPN 1 Julok, Desa Blang Paoh Sa, Kecamatan Julok, Aceh Timur, Rabu (6/6). nya di Desa Blang Paoh Sa, Kec.Julok. Setahun setelah menikah, Nurhayati langsung menjadi penggoreng pisang dan jajanan lainnya di sudut SMPN 1 Julok. Bahkan dia mengaku, selama 40 tahun tersebut sudah

berpindah-pindah tempat (lapak) mengelilingi gedung sekolah, karena pihak pemerintah kerap membangun gedung sekolah di lokasi Nurhayati berjualan jajanan. Meski hanya menjadi pen-

jual pisang goreng dan mi goreng, namun Nurhayati bangga karena telah mampu menyekolahkan anak-anaknya hingga sukses sesuai dengan cita-citanya. Selama 40 tahun, Nurhayati bersama Kadimin dianugerahi 10 putra-putri yang kini seluruhnya sudah bekerja, kecuali hanya si bungkus yang kini masih duduk di bangku kuliah. “Dulu per hari keripik ubi yang laku mencapai 20 kilogram per hari dan mi goreng capai 20 kilogram juga,” katanya. Meski keuntungan yang didapatkan pas-pasan, namun Nurhayati sepakat dengan Kadimin untuk ditabung sebagian keuntungan, karena dNurhayati memiliki cita-cita anaknya sukses seluruhnya. “Alhamdulillah, berkat kios sederhana ini saya mampu menyekolahkan anakanak,” kata Nurhayati lagi. Anak-anaknya, Hj Eliati, kini sudah bekerja sebagai Pengawas/Penilik Sekolah di wilayah UPTD Simpang Ulim. Hahafiah, kini menjadi Dosen di Universitas Budiluhur Medan. Hasballah, mahasiswa di Uni-

versitas Samudra Langsa dan aktif bekerja di media nasioal sebagai kontributor. Siti Hajar kini bekerja sebagai staf di salah satu Kantor Camat di Palembang. Selanjutnya, anak kelima dari pasangan Nurhjayati – Kadimin yakni Bustami, tapi Bustami kini sudah almarhum. Dan anaknya yang keenam Safaruddin, kini aktif sebagai advokat dan mantan Kuasa Hukum Wakil Gubernur Aceh Muhammad Nazar periode 2007-2012. Selanjutnya Fitriani, aktif sebagai guru di SDN Blang Siguci dan Rahmad, Wakil Kepala SMKN Kelautan dan Perikanan Julok. Kemudian Siti Mahyani, kini bekerja sebagai Konselor di Pusat Pelayanan Terpadu Perempuan dan Anak (P2TPA) di Aceh Timur dan anaknya yang bungsu yakni Yudistira Maulana kini masih kuliah di Unmuha Banda Aceh. Hasil usahanya menjadi penjual pisang goreng tidak seberapa, namun berkat doa dan usaha serta tawakkal kepada Sang Pencipta kini cita-cita anaknya sudah tergolong terca-

pai seluruhnya. Ketika 40 tahun yang silam, Nurhayati tidak punya pilihan lain selain menjadi penjual pisang goreng untuk anak-anaknya bersekolah, karena rumahnya berdekatan dengan gedung SMPN 1 Julok yang berada di pinggiran jalan nasional. Meski Nurhayati sudah mampu menyekolahkan anakanaknya, tetapi menjadi penjual pisang goreng masih tetap ditekuninya. Pekerjaan itu, kata Nurhayati, akan terus dilakukan semasih kesehatannya mendukung. Nurhayati, adalah sosok wanita yang gigih. Suaminya terkadang membantu Nurhayati berjualan. Bahkan anak-anaknya ketika pulang kuliah dan pulang kerja ikut membantu Nurhayati. Sosok Nurhayati patut dan wajar ditiru, ternyata tidak hanya anak orang berada yang mampu menyekolahkan anakanaknya, tapi sosok penjual pisang goreng juga mampu memenuhi semua cita-cita anakanaknya. Muhammad H Ishak



ACEHUTARA (Waspada) : Program jaminan persalinan (Jampersal) bantuan pemerintah pusat belum banyak diketahui masyarakat Aceh Utara. Kondisi itu mempersulit upaya menekan angka kematian ibu melahirkan dan bayi. Angka kematian ibu hamil dan bayi di Aceh Utara masih tinggi. Hasil penelusuran LSM Bumoe Malikussaleh (LSM-BM) Aceh Utara menjelaskan, sampai Juni 2012 sebanyak 9 ibu melahirkan meninggal dunia. Sementara pada 2011, jumlahnya mencapai 20 orang. Bayi meninggal pada 2011 sampai 73 orang, sedangkan tahun ini sampai Juni, tercatat 20 bayi yang meninggal. “Umumnya, penyabab ibu melahirkan meninggal karena terlambat penanganan medis,” jelas Amirul Fuadi, Koordinator LSMBM yang bergerak di bidang kesehatan masyarakat, usai kegiatan penguatan bidan desa (Bides) dan kader Posyandu, Jumat (15/6). Faktor utama keterlambatan penanganan medis, karena pihak keluarga korban terlambat mengambil keputusan. Mereka masih dibebani dengan mahalnya biaya medis terhadap proses melahirkan yang membutuhkan operasi.

SIGLI (Waspada): Polres Pidie menggelar bhakti sosial khitanan massal kepada 63 anak dari keluarga kurang mampu yang pusatkan di aula Kantor Camat Kembang Tanjong, Kab.Pidie, Kamis (14/6). Kegiatan itu dilakukan dalam rangka menyambut HUT ke-66 Bhayangkara. Kapolres Pidie AKBP Dumadi mengatakan, untuk mensukseskan kegiatan bhakti sosial tersebut masing-masing polsek mengirim dua anak dari keluarga kurang mampu untuk dikhitan. Dengan adanya kegiatan khitanan massal ini diharapkaan anak-anak dari keluarga kurang mampu dapat terbantu. Selain dikhitan secara gratis hingga sembuh, para peserta khitanan massal juga mendapatkan bingkisan kain sarung dan uang sebagai tali asih dan penambah semangat bagi anakanak yang dikhitan. Acara tersebut turut dihadiri Kapolres Pidie AKBP Dumadi, Penjabat Bupati Pidie HT Anwar, dan sejumlah tokoh masyarakat setempat. (b10)

Tabung Gas Meledak, Rumah Janda Terbakar BLANGBLADEH (Waspada) : Nasib naas menimpa seorang janda Ti Hawa, warga Desa Blang Seupueng, Kecamatan Jeumpa, akibat tabung 3 kg di rumahnya meledak, mengakibatkan rumah konstruksi kayu beserta seluruh harta benda di dalam rumah itu hangus dilalap api, Kamis (14/6) pukul 10:30. Komandan Regu A pemadam kebakaran Bireuen Hamdani bersama M Yunus dan anggota regu A lainnya begitu mendapat telepon dari masyarakat desa pergunungan Blang Seupueng dengan menggunakan dua unit mobil pemadam meluncur ke TKP untuk memberi pertolongan. Namun lantaran harus menempuh jarak ke TKP sekitar 10 kilometer rumah kontruksi kayu milik janda Ti Hawa tidak tertolong sudah duluan hangus di lalap api. Dalam kebakaran itu tidak ada korban jiwa, kecuali uang tunai sebesar Rp8,5 juta, lima mayam emas hasil usaha tani dan seluruh perabotan rumah tangga hangus jadi abu. (b12)

Jaringan Telkomsel Di Bireuen Terganggu BIREUEN (Waspada) : Sejumlah palanggan kartu Telkomsel di Bireuen mengatakan gangguan jaringan komunikasi perusahaan tersebut sekarang ini semakin parah. Buktinya, pada saat menghubungi sebuah nomor orang yang dikenala, namun anehnya tersambung ke nomor lain yang tak dikenalnya. “Saya beberapa kali menghubungi nomor suami saya, namun masuk ke nomor lain dan itu saya lakukan berulangulang, demikian juga suami saya ketika menghubungi saya, masuk ke pelanggan lain,” kata Wati, seorang pengguna kartu SimPati Telkomsel, Rabu (13/6). Menurut Wati, gangguan komunikasi lewat kartu selular Telkomsel sudah lama terjadi, namun dalam dua hari ini gangguannya sudah parah dan pantas dipertanyakan warga. Seorang pelanggan di Peusangan sengaja mencoba menghubungi ke nomor lain secara jarak dekat, namun anehnya ada yang masuk ke luar Aceh. General Manajer Authorized Distributor (GMAD) Telkomsel wilayah Bireuen, Aceh Tengah dan Bener Meriah, Haris Nasution, Rabu (13/6) mengatakan, ada perangkat keras yang rusak di salah satu tower Telkomsel di Bireuen. Untuk memperbaikinya butuh waktu lama. (cb02)

Semen Langka Di Pantai Timur Aceh LHOKNIBONG (Waspada) : Semen, khususnya Semen Andalas, langka di wilayah Pantai Timur Aceh sejak sebulan lalu. Pedagang menerima alasan beragam dari distributor. Sementara harganya mulai naik dari Rp44 ribu per zak menjadi Rp52 ribu per zak. Di sejumlah toko bangunan di Lhoksukon, ibukota Kabupaten Aceh Utara, Pantonlabu, Kec. Tanah Jambo Aye, Aceh Utara, dan Lhoknibong, Kec. Pante Bidari, Aceh Timur, Jumat (15/6), stok semen rata-rata sudah habis. “Kata distributor, kapal tidak bisa berlayar dari Banda Aceh ke Lhokseumawe, karena cuaca di laut tak menentu. Kalau diangkut lewat darat, ongkosnya terlalu mahal,” kata Tgk Bukhari, 38, pedagang bahan bangunan di Lhoknibong. Sementara Zulkifli, 22, pedagang bahan bangunan di Pantonlabu mengaku tak tahu pasti mengapa semen langka di kota yang dijuluki kota Pisang Sale itu. “Yang jelas, pasokan dari distributor terhenti sejak dua pekan lalu,” tutur Zulkifli. Informasi berbeda disampaikan Zulhilmi, pedagang bahan bangunan di Lhoksukon. Menurutnya, semen langka sejak sebulan lalu. Berdasarkan kabar dari distributor, bahan baku bangunan tersebut sulit didapat karena pabrik semen di Banda Aceh, sedang rusak. (b19)

Hari Pasar Tumbuhkan Semangat Wirausaha BIREUEN (Waspada) : Untuk menumbuhkan semangat berwirausaha sejak usia dini, Taman Kanak-kanak Islam Terpadu Azkya Bireuen menggelar Market Day (Hari Pasar) pameran bazar sehari di sekolah TK setempat, Sabtu pekan lalu. Pameran bazaar wirausaha murid-murid TK IT Azkia berlangsung semarak turut dihadiri ratusan wali murid dan masyarakat umum berbelanja dengan menampilkan kreativitas karya anak-anak dan guru. Bartang-barang hasil karya anak-anak dan guru TK IT Azkya yang dipasarkan antara lain pakaian anak-anak khas Azkya, pakaian orang dewasa, foto-foto kegiatan, bingkai foto, bros, pembatas buku, gantungan kunci, balon gas, ikan hias, kotak pensil, buku cerita dan kreativitas dari flannel. Kepala TKIT Azkya Bireuen Sari Dewi mengatakan, kegiatan pameran wirausaha bagi anak-anak TK sejak usia dini sebagai memperkenalkan dunia usaha bagi anak-anak untuk menumbuhkan semangat kemandirian di masa mendatang. (b12)

Penerbangan Di Bandara SIM Banda Aceh Berangkat (flight, tujuan, waktu)

GA 142 Jakarta/Medan GA 146 Jakarta/Medan

10:40 15:50

GA 143 Medan/Jakarta GA 147 Medan/Jakarta

11:25 16:45

Y6 555 Jakarta * Y6 537 Jakarta/Medan

19:05 12:30

Y6 556 Jakarta** Y6 538 Medan/Jakarta

07:05 12:30

JT 304 Jakarta JT 396 Jakarta/Medan

11:35 20:00

JT 397 Medan/Jakarta JT 307 Jakarta

06:40 12:15

SJ 010 Jakarta/Medan


SJ 011 Medan/Jakarta


Batavia Air Lion Air

Sriwijaya Air Air Asia

AK 305 Kuala Lumpur *** 12:20

AK 306 Kuala Lumpur*** 12:45

FY 3401 Penang ****

FY3400 Penang ****

Fire Fly


* Setiap Selasa, Kamis, Minggu. ** Setiap Senin, Rabu, Jumat. *** Setiap Senin, Rabu , Jumat dan Minggu. **** Setiap Selasa, Kamis dan Minggu.

Sabtu 16 Juni 2012

Program Jampersal Kurang Sosialisasi

Polres Pidie Gelar Khitan Massal

Tiba (flight, asal, waktu) Garuda Indonesia



“Dari hasil telusuran kami, mereka takut biaya persalinan di rumah sakit mahal. Padahal, pemerintah pusat sudah menyediakan bantuan untuk ibu melahirkan melalui program Jampersal,” tambahnya setelah penutupan penguatan Bides yang bekerjasama dengan ExxonMobil di Landing, Lhoksukon, Aceh Utara. Sejumlah 18 Bides dan kader Posyandu dari gampong lingkungan perusahaan Migas itu mendapat pembinaan agar lebih tegas dalam mengambil tindakan ketika membantu proses persalinan. Kegiatan itu juga melibatkan petugas dari Dinkes Aceh Utara dari Bidang Kesehatan Ibu dan Anak (KIA) dan Bidang gizi. Kadis Kesehatan Aceh Utara, Muhammad Nurdin mengatakan, pihaknya sudah melakukan sosialisasi Jampersal melalui Puskesmas di setiap kecamatan. Menurut dia, setiap bidan desa yang membantu persalinan dibiayai pemerintah Rp350.000. Begitu juga dengan proses melahirkan yang membutuhkan operasi, juga gratis biaya rumah sakit. “Rumah sakit yang kita tunjuk, Rumah Sakit Cut Mutia dan Rumah Sakit PMI,” jelas Muhammad Nurdin. (b15)

Daya Tampung Siswa Baru Di Bireuen Waspada/Muhammad Riza

PENJABAT Bupati Pidie HT Anwar ZA didampingi Kapolres Pidie AKBP Dumadi menyaksikan proses khitan terhadap 63 anak di aula Kantor Camat Kembang Tanjong, Pidie, Kamis (14/6).

Protes Kepala SMPN 2 Lhokseumawe Diganti LHOKSEUMAWE (Waspada) : Kalangan wali murid dan komite sekolah SMPN 2 Lhokseumawe memprotes kepala sekolah itu diganti. Mereka menilai, pemindahan kepsek itu terlalu buru-buru. Fauzi, salah seorang wali murid kelas dua, Kamis (14/6) menyebutkan, pemindahan kepsek lama Tarmizi ke SMPN 10 Lhokseumawe suatu tindakan ceroboh PenjabatWali Kota Lhokseumawe serta dinas terkait. Satu sisi para siswa tidak ingin Kepsek Tarmizi dimutasi. Pemindahan itu, kata wali murid, tidak terkait menolak kepala sekolah baru, tapi wali murid masih menginginkan Tarmizi memimpin sekolah itu. Tarmizi dinilai selama dua tahun kepemimpinannya sukses membangun SMPN 2 Lhokseumawe. Hal senada disampaikan Sulaiman. Dia menilai pemindahan itu merugikan para siswa kelas tiga, karena saat ini ijazah

Syamsul M Daud, Ketua Komite SMPN 2 Lhoksuemawe mereka belum ditandatangani karena masih dalam tahapan Ujian Nasional. Jadi, persoalannya Tarmizi diganti dengan Saifullah dari SMPN 4 Lhokseumawe secara tiba-tiba. “Kami tetap memperjuangkan dia jangan dipindahkan dan menempuh jalan musyawarah, kalau kebijakan ini tidak dicabut juga, jangan salahkan komite sekolah bila wali murid melakukan demo ke kantor wali kota,” tutur Ketua Komite Sekolah Syamsul M Daud.

Menurut Kadis Pendidikan Pemuda dan Olahraga Lhokseumawe Syarifuddin, pergantian Kepala SMPN 2 Lhokseumawe dari Tarmizi kepada Saifullah sudah sesuai aturan yang belaku. Dan pihak dinas tidak berkewajiban memberikan alasan pergantian tersebut kepada pihak komite sekolah dan wali siswa. “Pergantian Pak Tarmizi merupakan hasil rapat antara pihak Baperjakat, Dinas Pendidikan dan Pj wali kota, beliau dipindahkan ke SMPN 10 tujuannya untuk memajukan sekolah tersebut, karena sebelumnya sudah berhasil memajukan SMPN 2 menjadi sekolah unggul,” ujar Syarifuddin, Jumat (15/6). Ia juga menjelaskan, wali murid dan pihak Komite sekolah tidak berwenang mengintervensi kebijakan pemerintah dalam hal pergantian atau mutasi pejabat di lingkungan dinas, karena itu merupakan penuh kewenangan pemerintah, sementara hubungan komite sekolah hanya sebatas dengan sekolah. (cmk)

Demo Minta Kaji Kembali Keputusan PAW BANDAACEH (Waspada) : Ratusan orang pendukung Darmuda, mantan anggota DPRA Aceh yang di-PAW, Dewan Pimpinan Aceh Partai Aceh (DPAPA) menggelar demo di halaman Pengadilan Negeri Banda Aceh, Kamis (14/6). Massa yang mengaku perwakilan masyarakat pendukung Darmuda, berasal dari Kota Banda Aceh, Sabang dan Aceh Besar itu meminta Dewan Pimpinan Aceh (DPA) Partai Aceh untuk mengkaji dan mempertimbangkan kembali keputusan penggantian antar waktu (PAW) terhadap Darmuda. Demo yang dijaga ketat

aparat kepolisian Poltabes Banda Aceh itu berjalan aman. Koordinator demo Helmi Rizal mengatakan, mereka mendesak Partai Aceh untuk membuka kesempatan seluasluasnya kepada masyarakat Aceh untuk memberikan pendapat sebagai masukan kepada Partai Aceh dalam mengambil kebijakan dan keputusan terhadap Darmuda. “Jika PA masih menghargai kami sebagai pemilih dan pendukung Darmuda pada pemilu legislatif 2009 lalu, maka kami meminta DPA-PA untuk mengkaji dan mempertimbangkan kembali secara bijaksana SK

rintah belum mampu menciptakan kesejahteraan ekonomi bagi warganya. Konon lagi pembangunan mental masyarakatnya. Melaksanakan pembangunan mental jauh lebih rumit dari melaksanakan pembangunan fisik. Sebagai informasi, generasi muda Aceh saat ini berada di ambang kehancuran. Sebagian kawula muda Aceh dengan sadar dan ikhlas menghancurkan diri mereka sendiri, dengan mengonsumsi narkoba jenis ganja, sabu-sabu dan bahkan mungkin heroin. Narkoba yang paling gencar beredar di Aceh ganja dan sabu-sabu. Di era tahun 1970-an, masyarakat awam sama sekali tidak pernah mendengar nama sabusabu. Namun pada 2012, semua masyarakat baik tua maupun muda tahu sabu-sabu itu adalah narkoba, yang dapat merusak saraf-saraf manusia. “Perang senjata api memang telah berakhir di Aceh, namun saat ini Indonesia khususnya Aceh sedang menghadapi perang candu yang luar biasa. Jika perang ini tidak segera diatasi, dampaknya sangat besar. Masyarakat Aceh harus melawan kelompok-kelompok yang

32 siswa per ruang belajar untuk menjaga pemerataan penerimaan di tiap sekolah jangan ada anggapan masyarakat memasukkan anaknya ke SD favorit. Kabid Dikmenjur Nasir dapat menjelaskan secara rinci berapa jumlah daya tampung penerimaan murid baru 71 SMP/MTs, 29 SMA/MA dan 10 SMK di Bireuen. M Nasir menjelaskan, sesuai ketetapan standar penerimaan siswa baru kelas biasa SMP, MTs, SMA, MA dan SMK ditetapkan 20 – 36 siswa per ruang belajar. (b12)

Kuta Timu Gampong Terbaik 2012 SABANG (Waspada) : Gampong Kuta Timu, Kecamatan Sukakarya yang terpilih sebagai gampong terbaik tingkat Kota Sabang, telah dinilai tim penilai tingkat Provinsi Aceh dalam penilaian lomba gampong tingkat Provinsi Aceh, Rabu (13/6). Ketua tim penilai tingkat Provinsi Aceh Hasanuddin mengatakan, penilaian gampong yang dilakukan untuk mengetahui sejauhmana program pembangunan, baik dalam bidang pemerintah gampong, pembangunan, kesehatan, pendidikan dan sosial masyarakat. Dari keseluruhan kabupeten/kota di Aceh yang dilakukan seleksi administrasi, Gampong Kuta Timu termasuk sepuluh besar yang akan dinilai pada lomba gampong tingkat Provinsi Aceh.

Penjabat Wali Kota Sabang Zulkifli HS mengatakan, berdasarkan penilaian yang dilakukan secara komprehensif terhadap 18 gampong di Sabang, Gampong KutaTimu ditetapkan sebagai pemenang lomba gampong tingkat Kota Sabang. Kegiatan penilaian gampong mendapat respon positif dari semua pihak baik dari jajaran pemerintah daerah dan didukung seluruh elemen masyarakat, dukungan ini terlihat dari motivasi dan semangat kerja yang tinggi yang ditunjukan masyarakat. Tim penilai dari Provinsi Aceh diharapkan dapat memberikan penilaian yang se-objektif mungkin sehingga hasil penilaian yang diberikan dapat dijadikan kebanggaan bagi masyarakat Gampong Kuta Timu secara khusus dan Sabang pada umumnya. (b31)

Merah Sakti Minta Dipahami LONGKIB (Waspada) : Soal seringnya keluar daerah meninggalkan Kota Subu-lussalam,Wali Kota Subulussalam Merah Sakti meminta seluruh komponen masyarakat memahaminya. Persoalannya, keluar daerah, seperti ke Jakarta, Banda Aceh maupun daerah lain, menurut Sakti, semata-mata untuk kepentingan daerah dan masyarakat Subulussalam. Permintaan itu disampaikan Wali Kota Merah Sakti di hadapan sejumlah kepala dinas, badan dan kantor, Muspika Longkib, kepala desa terkait dan sejumlah elemen yang hadir pada penyerahan bantuan masjid, perbaikan gizi dan bantuan masyarakat penyakit kronis, Kamis (14/6) di Masjid Baiturahman di Desa Darul Aman, Kec. Longkib, Subulussalam.

Sakti mengaku gerah dengan sinyaleman yang sering kali mempolitisir sikapnya meninggalkan daerah dengan penilaian negatif demi kepentingan tertentu.“Tidak pernah turun bantuan tanpa dimohonkan atau jemput bola,” kata Sakti meminta masyarakat lebih peka dengan persoalan itu. Selain menyerahkan bantuan para dermawan kepada pengurus masjid terkait, secara simbolis Sakti menyerahkan paket bantuan bagi anak yatim di Kec. Longkib dan Penang-galan. “Dari 230 paket bantuan, 77 di antaranya untuk anak yatim di Kec. Longkib,” terang Anharuddin, Penjabat Kadis Sosial Subulussalam. (b28)

Pilkada Bukan Ajang Bermusuhan

pemberhentian dan PAW Darmuda, karena tidak sesuai aturan hukum yang berlaku di NKRI,” papar Helmi. Usai melakukan demo, para pendukung Darmuda itu menuju ruang sidang Pengadilan Negeri Banda Aceh untuk mendengarkan proses sidang gugatan Darmuda terhadap DPAPA. Kuasa hukum tergugat Amrisaldin cs dalam duplik yang dibacakan, pada intinya mengatakan, PN Banda Aceh tidak berwenang mengadili, karena menyangkut internal Partai Aceh sesuai AD/ART Partai Aceh Pasal 56 ayat (2). (b02)

Sayang...Atau Pura-Pura Sayang SETELAH penandatanganan MoU Helsinki, Finlandia, antara Pemerintah Republik Indonesia dengan Angkatan Gerakan Aceh Merdeka, konflik bersenjata yang telah terjadi lebih dari 30 tahun di Provinsi Aceh berakhir damai di atas meja perundingan. Sejak saat itu pula kedua belah pihak sepakat untuk membasmi senjata ilegal milik GAM. Berbagai jenis senjata api milik GAM telah dimusnahkan. Tidak ada lagi suara dentuman bom atau letusan senjata api, juga tidak ada lagi bunyi mesin mobil Reo. Kondisi Aceh saat ini benar-benar damai. Semua warga Aceh dapat beraktivitas dengan leluasa, baik pada siang maupun di malam hari. Masyarakat tidak khawatir lagi akan adanya sweeping di jalanan. Kini saatnya Pemerintah Aceh memanfaatkan kondisi yang damai ini sebagai momentum untuk melaksanakan berbagai pembangunan, baik pembangunan fisik maupun pembangunan mental. Meskipun usia perdamaian telah mencapai lima tahun, namun kedua jenis pembangunan tersebut belum terlihat jelas. Pasalnya, hingga kini peme-

BIREUEN (Waspada) : Daya tampung penerimaan siswa baru 230 unit SD dan 58 unit MI, kelas 1 di 11 UPTD 17 Kecamatan di Kabupaten Bireuen tahun ajaran 2012-2013 sebanyak 8.053 siswa terdiri dari 5.289 murid SD dan 2.764 murid MI. Pendaftarannya dimulai 18–26 Juni 2012, usia minimal 6 tahun dan tiap sekolah tidak dibenarkan menerima siswa tidak melebihi 32 orang per ruang belajar. Kadis Dikbudpora Bireuen Asnawi melalui Kabid Dikdas dan Luar Biasa Abdullah menjelaskan, Kamis (14/6), penetapan maksimum

mengedarkan narkoba di daerahnya. Masyarakat tidak boleh diam, demi untuk menyelamatkan generasi,” papar Zainal Abidin Badar alias Jimbron, Direktur Eksekutif Lembaga Swadaya Masyarakat Reuncong Aceh, Kamis (14/6). Kata Jimbron, dia telah berjumpa dengan semua lapisan masyarakat bahkan dengan pihak pemerintah. Dari setiap pertemuan tersebut, dia selalu menyampaikan persoalan itu. Semua orang yang mendengar cerita itu keningnya mengernyit sebagai sinyal seseorang itu menyesalkan hal tersebut. Hal sama diperlihatkan pihak eksekutif dan legislatif dan bahkan ada di antara mereka yang sempat mengucapkan kata-kata “Sayang sekali kondisi generasi kita saat ini”. Namun anehnya, hingga kini belum ada seorangpun di antara mereka yang mau melakukan tindakan nyata untuk membasmi peredaran narkoba di Aceh. Padahal saat ini narkona jenis sabu-sabu telah dikonsumsi sebagian pelajar kelas menengah ke atas. Alasannya itu merupakan tanggungjawab polisi. Maimun Asnawi

BIREUEN (Waspada) : Pelaksanaan Pilkada Bireuen periode 2012-2017 sudah memasuki tahap kampanye. Di mana, para kandidat menawarkan visi dan misi di tempat umum kepada masyarakat. “Hanya saja dalam penyampaian visi dan misi itu dengan menggunakan gaya bahasa yang berbeda-beda, ini lumrah di alam demokrasi. Makanya mari kita semua agar jangan melakukan hal-hal yang anarkis, Pilkada bukan ajang untuk saling bermusuhan,” ucap politisi di Bireuen, Armia, Jumat (15/6). Dia menyebutkan, perbedaan pendapat menjelang hari pemungutan suara pada pesta demokrasi adalah lumrah dan itu tidak hanya

terjadi di Bireuen, karena masing-masing pasangan calon kepala daerah tersebut memiliki simpatisan tersendiri. Karenanya, Armia mengharapkan, perbedaan pendapat ini jangan sampai berlanjut hingga usai pilkada nanti. “Sekarang boleh beda pandangan, tapi setelahnya kita semua harus berjabat tangan dan sama-sama bekerja dan berpikir untuk kepentingan Bireuen,” papar mantan anggota DPRK Bireuen itu. Menurutnya, siapapun yang terpilih menjadi pemimpin Bireuen lima tahun ke depan adalah cerminan dari hasrat masyarakatnya. “Memilih siapa saja yang dikehendaki itu merupakan suatu keadilan,” tegas Armia. (b17)

Somasi Dukung Usut Kasus Bansos Bibit Sapi TAPAKTUAN ( Waspada) : Solidaritas Masyarakat Anti Korupsi (Somasi) Aceh Selatan mengapresiasi Kapolres Aceh Selatan AKBPSigit Jatmiko mengusut kasus dugaan penyelewengan bantuan sosial (bansos) 35 ekor bibit sapi. Bibit hewan ternak itu disalurkan kepada kelompok tani Padang Kawat, Gampong Ladang Tuha, Kecamatan Meukek. “Kita memberi apresiasi dan mendukung sikap tegas Kapolres mengusut kasus dugaan korupsi, khususnya menyangkut dugaan kasus penyelewengan bansos bibit sapi itu karena dampaknya merugikan petani,”kata Koordinator Somasi Aceh Selatan, Syaiful Bismi, Jumat (15/6) di Tapaktuan. Bansos dana jemputan pusat lengkap dengan pembangunan bak permentasi pupuk itu, rumah kompos dan kandang sapi, senilai Rp350 juta dari APBN 2011, diluncurkan dalam rangka menunjang kegiatan Unit Pengelolaan Pupuk Organik (UPPO). Namun pelaksanaan-

nya terindikasi menyimpang. Kapolres Aceh Selatan AKBP Sigit Jatmiko didampingi Kasat Reskrim Iptu Susilo mengakui pihaknya sedang mengusut kasus tersebut. Sebab, berdasarkan spesifikasi teknis, bibit sapi tersebut seharusnya berumur minimal 18 bulan atau 1,5 tahun. Tetapi yang dipasok diperkirakan berumur empat sampai sepuluh bulan, dengan jumlah seharusnya 35 ekor, tetapi yang diserahkan hanya 34 ekor. Dugaan penyimpangan itu diakui Petugas Pendamping Teknis Proyek Bansos di Dinas Pertanian dan Peternakan Aceh Selatan drh Muhammad, ketika dikonfirmasi secara terpisah. Kualitas bibit sapinya rendah, tidak sesuai spesifikasi. Proyek ini sifatnya non tender dan pengelolaannya langsung dilaksanakan kelompok tani didampingi pendamping teknis. “Tetapi langsung ditangani pihak Dinas Pertanian dan Peternakan, tanpa melibatkan petugas teknis,” ujarnya. (b30)

Rumah Salahuddin Ludes Terbakar BIREUEN (Waspada) : Diduga akibat korslet arus listrik, rumah Salahuddin, 50, penduduk Desa Blang Kuthang, Kecamatan Makmur, Bireuen, Jumat (15/6) dini hari ludes terbakar. Kendati demikian, tidak ada korban jiwa dalam musibah ini. Informasi yang diperoleh, kebaka-ran yang menghanguskan rumah berkontruksi kayu ukuran sekira 10 X 8 meter persegi itu terjadi sekitar pukul 03:00. Di mana saat delapan orang penghuninya tertidur. Menurut warga sekitar, Salahuddin baru mengetahui petaka itu manakala anaknya berteriak minta tolong. Kemudian seisi rumah terbangun. Kegaduhan ini membuat tetangga

korban juga terbangun. Mereka berusaha melerai api dengan peralatan seadanya, namun kobaran api tidak berhasil dipadamkan. Sementaradi tempat terpisah Ketua Palang Merah Indonesia (PMI) Ranting Makmur, Faisal Ali mengatakan, empat unit pemadam kebakaran Pemkab Bireuen tiba di lokasi kejadian. “Petugas tidak dapat berbuat banyak, karena rumah sudah rata dengan tanah,” ucapnya. Akibat kejadian tersebut, korban mengalami kerugian materi mencapai puluhan juta rupiah. ”Padi, ijazah, dan pakaian sekolah anakanak juga ikut terbakar,” ucap warga lainnya seraya menyebutkan, untuk sementara keluarga korban mengungsi ke rumah tetangga. (cb02/b17)


WASPADA Sabtu 16 Juni 2012

Mahasiswi Universitas Islam Antar Bangsa Ke Banda Aceh

Pol Air Polres Langsa Terima Bantuan Kapal LANGSA (Waspada) : Pol Air Polres Langsa menerima bantuan satu unit kapal patroli tipe C2 150 cc dari Markas Besar Polri RI. Bantuan tersebut tiba di Polres Langsa, Rabu (13/6) yang kemudian diserahkan ke PolAir di Kuala Langsa. Kapolres Langsa AKBP Hariadi didampingi Kasat Pol Air AKP Kasnap, Jumat (15/6) seusai melakukan uji coba mengatakan, kapal patroli ini untuk memperkuat PolAir dalam menjaga keamanan di wilayahnya. Kapal patroli ini memiliki kapasitas satu regu atau 10 personil. Menurut Kapolres, selama ini PolAir Polres Langsa memiliki dua unit kapal patroli, tapi hanya satu yang bisa digunakan, karena satunya lagi masih dalam perbaikan.(b20)

Umat Islam Mulai Lupa PHBI IDICUT (Waspada) : Mayoritas umat Islam—khususnya di Aceh—belakangan mulai lupa dengan Peringatan Hari-hari Besar Islam (PHBI). Padahal, arti dan makna yang terkandung dalam kegiatan PHBI itu sangat tinggi, lebih-lebih mampu mempertebal keimanan muslim-muslimah. “Jika umat Islam mulai lupa dengan PHBI, maka siapa lagi yang akan mengingatkannya? Padahal PHBI seperti Isra’ Mi’raj sangat tinggi kandungan dan umat Islam yang tipis iman akan meragukan kejadian yang luar biasa ini,” papar Tgk Idris yang akrab disapa Abu Rih dalam Khutbah Jumat di Masjid Baitul Muttaqin Idi Cut, Aceh Timur, Jumat (15/6). Dia mengatakan, PHBI perlu digalakkan kembali oleh umat Islam dan seluruh komunitas sekolah dari berbagai tingkatan hingga ke perguruan tinggi. “Mari kita galakkan kembali PHBI di desa-desa, kecamatan-kecamatan hingga ke level nasional,” jelas Abu Rih. Ketua BKPRMI Idi Cut, Tgk Aswadi usai ibadah shalat Jumat meminta agar seluruh umat Islam untuk menggalakkan kembali PHBI, seperti 27 Rajab (Isra’ Mi’raj), 1 Muharram (Tahun Baru Islam), 17 Ramadhan (Nuzulul Quran) dan hari-hari besar Islam lain. (b24)

Pengedar SS Asal Medan Tertangkap Di Subulussalam SINGKIL (Waspada) : Jajaran Sat Narkoba Polres Singkil menangkap Julkifli ,36, warga Jalan Karya Medan, pengedar narkotika jenis sabu- sabu di Hotel Grand Mitra, Subulussalam, Jumat (15/6) sekira pukul 06:30. Kapolres Aceh Singkil AKBP Bambang S melalui AKP Sutrisman Kasat Narkoba mengatakan, penangkapan tersangka sabu – sabu itu dilakukan dengan cara menyamar. Dimana tersangka Julkifli diminta untuk mengantar barang haram itu kepada pembeli yang merupakan anggota Polres Aceh Singkil dari tim sat Narkoba, selanjutnya setelah barang haram itu diantar kepada pembeli langsung dilakukan penang-kapan. Setelah digeledah polisi menemukan paket barang haram narkotika jenis sabu seberat 2,25 gram dari tangan tersangka dan untuk penyelidikan lebih lanjut tersangka dan barang bukti diamankan di Mapolres Aceh Singkil. (cdin/b28)

Polisi Kantongi Nama Pelaku Pembunuhan SIGLI (Waspada) : Misteri terbunuhnya Ainul Mardiah, 46, pegawai Tata Usaha (TU) SMP Negeri III Tangse mulai menemui titik terang. Polisi dari Satuan Reserse Kriminal (Reskrim) Polres Pidie telah mengantongi nama pelaku pembunuhan wanita tersebut. ”Kami telah mengetahui nama pelaku pembunuhan Ainul Mardiah, PNS TU SMP Negeri III Tangse. Insya Allah dalam waktu singkat ini kita akan menangkap pelaku,” tegas Kapolres Pidie AKBP Dumadi didampingi Kasat Reskrim AKP Raja Gunawan di Mapolres Pidie, Jumat (15/6). Menurut Dumadi, dalam mengungkapkan kasus pembunuhan ini, polisi sangat berhati-hati dalam bertindak. Sebab tersangka yang saat ini masih dalam kawasan Provinsi Aceh tidak kabur ke daerah lain sehingga menyulitkan polisi menangkap pelaku pembunuhan tersebut. ”Tersangka saat ini masih di Aceh. Kalau kita gegabah dan tidak hati-hati bertindak, kita khawatirkan dia akan kabur sehingga sulit melakukan penangkapan,” jelas Dumadi. (b10)

Togel Marak Di Pidie SIGLI (Waspada) : Kasus judi togel (toto gelap) masih merajai berbagai kasus di Sigli, Kab. Pidie maupun Pidie Jaya. Lemahnya penerapan sanksi ditengarai menjadi penyebab tak kunjung jeranya pelaku meski kepolisian terus melakukan penindakan. Kabag Humas Mahkamah Syariah Pidie Said Safnizar mengatakan, hingga periode Juni 2012 sebanyak 3 kasus telah diputuskan dan berkekuatan hukum. Sedang tahun 2011 sebanyak 12 kasus yang rata perkara perjudian juga berkekuatan hukum karena telah diputus. “Klasifikasi hukuman itu antara 3 hingga 12 kali cambuk sesuai fakta persidangan. Rata-rata didominasi kasus maisir terutama yang tahun 2011,” kata Said Safnizar kepada wartawan, Jumat (15/6). Said menuturkan, jumlah tersebut hanya perkara yang masuk ke Mahkamah Syariah setelah proses penyelidikan di kepolisian dan jaksa. Dikatakan, lemahnya hukum beracara dalam qanun tersebut membuat proses penanganan tidak tuntas. “Kewenangan yang dimiliki masih terbatas, misalnya untuk menahan pelaku maisir yang tidak dimiliki Satpol PP dan WH maupun jaksa. Belum lagi eksekusi yang tidak berjalan,” kata Said. (cb06)

Waspada/Ibnu Sadan

KAPOLRES Langsa AKBP Hariadi ketika berada dalam kapal patroli bantuan Mabes Polri saat melakukan uji coba.

Tarmizi Pastikan Gubernur Aceh Dilantik 25 Juni BANDAACEH (Waspada) : Penjabat Gubernur Aceh Tarmizi A Karim mengatakan, pasangan calon Gubernur dan Wakil Gubernur Aceh terpilih dr Zaini Abdullah dan Muzakir Manaf akan dilantik Senin, 25 Juni mendatang di gedung Dewan Perwakilan Rakyat Aceh (DPRA) di Banda Aceh.

“InsyaAllah sesuai harapan Bapak Mendagri pelantikan Gubernur Aceh pada 25 Juni 2012 ini,” ucap Tarmizi A Karim usai pembukaan kongres nasional Perhimpunan Peneliti Penyakit Tropik dan Infeksi Indonesia (PETRI) XVIII, Jumat (15/6) di Banda Aceh. Tarmizi yang bertemu dengan Mendagri Gamawan Fauzi, Kamis kemarin, menambahkan bahwa pelantikan tersebut akan berlangsung pada pukul 14:00 di gedung DPRA. “Pelan-

tikannya siang dan Mendagri dijadwalkan tiba di Banda Aceh Senin pagi,” ujar mantan Penjabat Gubernur Kaltim ini. Kepastian pelantikan tersebut, karena Keputusan Presiden (Keppres) tentang pengangkatan Zaini Abdullah dan Muzakir Manaf sebagai Gubernur dan Wakil Gubernur Aceh sudah ditandatangani Presiden sebagaimana diungkapkan Djohermansyah Djohan, Dirjen Otonomi Daerah Kementerian Dalam Negeri. (b06)

Petani Kawasan Eksplorasi Gas Minta Ganti Rugi LHOKSEUMAWE (Waspada) : Sejumlah petani di kawasan eksplorasi gas alam di Nisam, Aceh Utara meminta biaya ganti rugi tanaman bernilai ekonomis yang rusak akibat kegiatan operasi seismik (pemetaan) dari Zaratex NV. Sementara upaya Kamar Dagang dan Industri (Kadin) setempat untuk melakukan audiensi dengan perusahaan asing tersebut diabaikan. Ketua Kadin Aceh Utara Teuku Moni Alwi, Kamis (14/6) menjelaskan, perusahaan eksplorasi gas alam yang sedang melakukan operasi seismik di Aceh Utara terlalu tertutup. Bahkan permintaan Kadin untuk melakukan audiensi dengan perusahaan tersebut diabaikan. “Sudah tiga kali kami surati secara resmi, namun tidak pernah mendapat tanggapan,” jelas Teuku Moni. Surat pertama disampaikan pada Oktober 2010, tidak mendapat respon. Dalam surat bernomor: 075/KAU/EX/X/2010, dewan pengurus Kadin memohon kesediaan Zaratex NV untuk meluangkan waktu membahas berbagai persoalan di lapangan. Akhir tahun 2011, Kadin kembali mengirim surat senada, namun tetap tidak di-

tanggapi. Bahkan pada Februari 2012, surat dari Kadin Aceh Utara kembali menyusul surat mereka sebelumnya. “Sampai sekarang kami juga belum mendapatkan jawaban,” ungkap Moni. Kadin Aceh Utara mengaku, pihaknya perlu melakukan audiensi seputar permasalahan dengan warga sekitar kegiatan seismik. Di antaranya, permasalahan perkebunan warga Nisam yang rusak belum mendapat ganti rugi. Selain itu juga tentang akses dari kegiatan pengeboran lepas pantai Lapang yang merugikan nelayan setempat. Begitu juga dengan tenaga kerja lokal yang kurang dilibatkan. “Namun kami tak bisa membahas masalah ini, karena tidak ada kesempatan untuk audiensi,” jelasnya kembali. Sementara hasil telusuran Waspada di Kecamatan Nisam, Gerakan Persatuan Mahasiswa Nisam (Gapman) telah menerima berbagai keluhan petani. Mereka di antaranya mengaku belum mendapat ganti rugi kerusakan tanaman. “Petani dari Gampong Alue Sijingkai mengeluh 86 batang pepaya yang mulai berbuah tumbang,” ungkap Koordinator Gapman Bustami. Selain itu, 31 batang kelapa sawit

petani lainnya juga terbakar karena kelalaian para pekerja seismik. Humas Zaratex NV, Eri Wahab mengatakan, kerusakan kebun warga di kawasan seismik sudah ditangani tim yang melibatkan Dinas Pertanian dan Perkebunan Aceh Utara. Sehingga kerusakan tersebut diganti sesuai kerugian hasil penilaian tim yang mendapat SK Gubernur Aceh. Tanaman yang tumbang selain karena operasi seismik, tidak akan diganti. “Semuanya sesuai hasil penilaian tim,” tegas Eri. Terkait permintaan audiensi Kadin Aceh Utara, Eri Wahab mengakui tidak mengetahuinya. Mungkin Kadin langsung menyurati Zaratek di Jakarta. Padahal, kegiatan eksplorasi gas di Aceh Utara dilakukan perusahaan main-con (kontraktor utama). Sehingga Kadin bisa langsung melakukan audiensi dengan main-con di Lhokseumawe. Eri juga mengatakan, maincon sudah banyak mempekerjakan tenaga lokal. “Sekitar tiga perusahaan sub-con (sub kontrak-red) yang bekerja sekarang berasal dari Aceh Utara dan Aceh Timur,” jelas Eri Wahab. (b15)

STIKes Idi Gelar Donor Darah IDI (Waspada) : Sekolah Tinggi Ilmu Kesehatan (STIKes) Bina Nusantara Idi Rayeuk, Kab. Aceh Timur mengumpulkan 57 kantong darah dalam kegiatan donor dayah yang dipusatkan di Kampus STIKes Idi, Kamis (14/6). Koordinator kegiatan donor darah STIKes Idi, Ismuhadi menjelaskan, kegiatan itu dilaksanakan berkaitan dengan Hari Donor Darah Sedunia tahun 2012. Dalam kegiatan itu juga, STIKes bekerjasama dengan Unit Donor Darah (UDD) Palang Merah Indonesia (PMI) Cabang Aceh Timur. “Kegiatan ini merupakan bagian dari Tri Dharma Perguruan Tinggi yaitu pengabdian masyarakat. Mudah-mudahan kegiatan tersebut berguna masyarakat luas,” kata Ismuhadi. Ketua STIKes Bina Nusantara Idi Rayeuk, dr Zulfikri menambahkan, kegiatan tersebut adalah bagian dari bentuk kepedulian mahasiswa STIKes Bina Nusantara Idi terhadap masyarakat yang membutuhkan darah. “Kita harapkan ke depan masyarakat bisa juga melakukan hal yang sama, baik secara massal dengan memusatkan di sebuah titik ataupun melakukan donor secara sukarela di Kantor UDD PMI Aceh Timur di Peudawa,” ujar Zulfikri. (b24)

Waspada/Muhammad H Ishak

SISWA SMA ikut donor darah yang diselenggarakan STIKes Bina Nusantara di Kampus STIKes BN Idi Rayeuk, Aceh Timur, Kamis (14/6).

B11 BANDAACEH (Waspada) : 26 Mahasiswi dari University Islam Antar Bangsa Malaysia mengunjungi Kota Banda Aceh, Rabu (13/6) dalam rangka sharing dengan Pemko Banda Aceh menyangkut budaya, pendidikan dan khususnya penerapan Syariat Islam di Aceh. Para mahasiswi dari negeri serumpun itu diterima Sekda Kota Banda Aceh Ramli Rasyid, Kadis Syariat Islam Kota Banda Aceh SaidYulizal, Kadis Pariwisata dan Kebudayaan Kota Banda AcehRezaPahlevidanbeberapatokohpendidikan. Sekda Kota Banda Aceh Ramli Rasyid dalam arahannya mengatakan, Banda Aceh merupakan kota tua yang sekarang telah mencapai 807 tahun. Kata dia, Banda Aceh ini adalah kota pemerintahan, kota pendidikan dan kota jasa, yang penduduknya sangat ramah terdiri dari berbagai suku bangsa. “Dengan datangnya adik-adik mahasiswi ke Banda Aceh, itu akan dapat memberikan mo-tivasi kepada anak-anak didik kita yang akan melanjutkan ke perguruan tinggi, baik di Indonesia maupun nantinya yang melanjutkan ke Malaysia,” tutur Ramli. Ramli juga menambahkan, Kota Banda

Aceh ini adalah BandarWisata Islami Indonesia. Beda dengan wisata di Bali. Di Banda Aceh masjid merupakan objek wisata, begitu juga situs-situs makam bersejarah jadi objek wisata, selain dari panorama alam dan objek kuliner lainnya yang bertebaran. Turut juga memberikan arahan Kadis Syariat Islam Kota Banda Aceh SaidYulizar yang menjelaskan panjang lebar tentang penerapan Syariat Islam. Intinya, sesuai undang-undang pemerintah Aceh setiap pemeluk agama Islam di Aceh wajib menaati dan mengamalkan Syariat islam. Sedangkan mewakili mahasiswi Universitas Islam Antar Bangsa Malaysia Nur Amalina binti Hasan mengatakan, rombongan mahasiswi akan berada di Aceh selama enam hari. Sebelum ke Banda Aceh rombongan juga telah mengunjungi Aceh Tengah. Kata Nur Amalina, pihaknya juga dalam kunjungan tersebut ada memberikan bantuan kepada anak-anak SD dan panti asuhan berupa baju putih, buku dan alat-lat tulis. Para mahasiswi itu juga mengunjungi IAIN Ar-Raniry Banda Aceh dan Universitas Syiah Kuala. (b02)

Perjelas Status PNS Ikut Pilkada SINGKIL (Waspada) : Penjabat Bupati Aceh Singkil Razali diminta segera memperjelas status Pegawai Negeri Sipil yang ikut dalam Pemilihan Kepala Daerah (Pilkada) yang telah dilaksanakan Komisi Independen Pemilihan (KIP) setempat. Pasalnya hingga saat ini tercacat sebanyak tujuh calon bupati dan wakil bupati yang ikut Pilkada Aceh Singkil hingga saat ini belum masuk kantor bertugas sebagaimana PNS biasa, padahal izin cuti yang diberikan telah lama berakhir sejak ditetapkannya calon bupati dan wakil bupati terpilih oleh KIP Aceh Singkil. Permintaan itu disampaikan Irwansyah Putra, mahasiswa Banda Aceh, Jumat (15/6). Menurut Ketua KMPA Aceh Singkil itu, sebagai PNS para calon bupati dan wakil bupati yang ikut pilkada pada 9 April sudah melanggar PP nomor 53 Tahun 2010 tentang disiplin PNS, sebab sampai hari ini mereka tidak pernah

masuk kantor, padahal dalam PP tersebut telah diatur, apabila dalam waktu 45 hari tidak masuk kantor tanpa alasan yang jelas, maka PNS tersebut dapat dipecat. Untuk itu diminta ketegasan Penjabat Bupati Aceh Singkil Razali agar memperjelas status mereka sebagai PNS sehingga penerapan disiplin bagi PNS tidak tebang pilih, apalagi Pemkab Aceh Singkil telah berkomitmen untuk menegakkan disiplin PNS yang telah ditandatangani bersama, sebagai dampak rendahnya disiplin PNS di Aceh Singkil . Kepala BKPP Aceh Singkil Syamsul Bahri mengatakan, Penjabat Bupati Aceh Singkil Razali telah merencanakan untuk memanggil seluruh Calon Bupati dan Wakil Bupati Aceh Singkil yang ikut pilkada untuk menyampaikan beberapa hal terkait status mereka sebagai PNS pasca pilkada, namun rencana tersebut tertunda mengingat kesibukan pj bupati. (cdin)

Supermoon Lenyapkan Belasan Ha Tambak IDI (Waspada) : Akibat supermoon—purnama penuh—yang terjadi sepekan silam di pesisir pantai timur Aceh telah melenyapkan belasan hektare area tambak milik warga di kawasan Kuala Peudawa Puntong, KecamatanIdiRayeuk,AcehTimur. Tak hanya tambak yang hancur dan pematangnya yang patah, akibat kencangnya ombak yang menghantam dan tingginya air laut naik ke darat dengan radius 200 meter membuat meluapnya tambak hingga mengakibatkan ikan piaraan petani tambak dan budidaya udang keluar dari tambak. Meski belum terdata Waspada/Muhammad H Ishak secara rinci, diperkirakan WARGA menunjuk ke arah tambak yang pematangnya mengalami akibat supermoon warga di kerusakan saat terjadi supermoon, Rabu (13/6). Idimengalamikerugianmencapai puluhan juta rupiah. “Kita belum ada data rinci terkait kerugian Camat Idi Rayeuk, Zulkhaidir membenarkan akibat supermoon sepekan lalu mem- warga khususnya di kawasan pesisir akibat buat petani tambak merugi. Tak hanya dari segi supermoon, tapi petani tambak dan warga yang tambak yang rusak dan pematang yang am- berdomisili di kawasan pesisir saat itu sempat bruk, tetapi ikan dan udang siap panen juga mengungsi akibat rumahnya rusak dihantam ikut hanyut dibawa pasang purnama penuh. ombak,” kata Zulkhaidir. (b24)

6 Kecamatan Pertanyakan Status Minapolitan IDI (Waspada) : Nelayan dari enam kecamatan di Aceh Timur mempertanyakan status Pelabuhan Pantai Perikanan (PPP) Idi yang telah diusulkan Kota Ikan (minapolitan). Keenam kecamatan yang termasuk dalam kawasan minapolitan yakni Kecamatan Idi Rayeuk, Darul Aman, Idi Timur, Peudawa, Peureulak Barat dan Kecamatan Peureulak Kota. “PPP Idi telah diusulkan ke Menteri Kelautan dan Perikanan agar ditetapkan sebagai kawasan minapolitan yang berbasis perikanan tangkap dan pengolahan, tapi sampai sekarang belum jelas statusnya,” kata Sofyan, warga Idi, Jumat (15/6). Kata dia, PPP Idi dicanangkan sebagai minapolitan adalah konsep pemerintah pusat dalam meningkatkan perekonomian di daerah

dalam sektor kelautan dan perikanan. “Tujuannya adalah dari penerapan konsep minapolitan untuk meningkatkan perekonomian daerah,” papar Sofyan lagi. Menurut dia, konsep minapolitan ini dirasakan baik oleh masyarakat, karena dapat menjaga stabilitas harga berbagai jenis ikan dan menjaga kontunitas produk dengan penyimpanan (cold storage) serta menciptakan iklim perdagangan yang lebih dinamis dan terarah. Hal yang sama disampaikan Dahlan alias Tgk Bagok. Dia mengatakan, pencanangan minapolitan di Idi sangat baik untuk masyarakat.“Pengembangan desa-desa kawasan minapolitan meliputi sarana jalan, sekolah, pasar dan tempat ibadah dalam enam kecamatan,” katanya. (b24)

1.450 Peserta Ikut SPMB-PTAIN 2012 Waspada/Muhammad H Ishak

GEDUNG Magnet Shcool (Sekolah Islam Berbasis Teknologi) tampak sepi di Desa Dama Tutong, Kec.Peureulak Kota, Aceh Timur, Rabu (13/6).

Gedung Senilai Rp34 M Terbengkalai PEUREULAK (Waspada) : Gedung Magnet School yang dibangun menggunakan dana yang utang Islamic Development Bank (IDB) senilai Rp34 miliar, meski pembangunannya sudah rampung, tetapi gedung sekolah agama Islam berbasis teknologi yang terletak di Desa Dama Tutong, Kecamatan Peureulak, Aceh Timur itu terancam jadi rumah hantu. Pantauan Waspada, tidak hanya sekadar mubazir, namun gedung sekolah kini terancam rusak sebelum dimanfaatkan. Pasalnya, pembangun gedung Magnet School di atas tanah persawahan itu sama sekali tidak memiliki pagar keliling se-

hingga pintu dan jendela mengalami kerusakan di bagian belakang gedung. Sejumlah gedung utama dan ruang pembelajaran serta mushalla kini telah siap dikerjakan oleh pihak rekanan. Tetapi jalan menuju ke gedung dan jalan antar gedung sama sekali belum tersedia. Dalam beberapa bulan terakhir terlihat gedung tersebut sepi dari aktivitas pembangunan, kecuali hanya binatang ternak yang berkeliaran. “Seharusnya gedung Magnet School ini sudah diserahterimakan awal Januari 2012 sehingga fasilitas yang belum tersedia bisa dikendalikan da-

lam beberapa bulan dan tahun pelajaran 2012-2013 ini bisa terima siswa baru. Tapi kita sesalkan anggaran puluhan miliar rupiah tidak dimanfaatkan dan kini terancam jadi rumah hantu, apalagi letaknya di tengah persawahan,” kata Ketua LSM Komunitas Aneuk Nanggroe Aceh (KANA) Muzakir, Kamis (14/6). Sekda Aceh Timur Syaifannur mengatakan, seharusnya tahun ajaran ini Magnet Shcool— Sekolah Terpadu—sudah bisa difungsikan sebagaimana rencana awal, namun karena terjadi kendala terkait cara pengelolaan sekolah tersebut sehingga penerimaan siswa terkendala.(b24)

LANGSA (Waspada) : Sampai Jumat siang tercatat 1.450 orang telah mendaftar untuk mengikuti jalur Seleksi Penerimaan Siswa Baru (SPMB) Perguruan Tinggi Agama Islam Negeri (UIN/IAIN/STAIN) tahun 2012 yang dilaksanakan di SekolahTinggi Agama Islam Negeri (STAIN) Zawiyah Cot Kala Langsa, Jumat (15/6). Pembantu Ketua I Bidang Akademik STAIN Cot Kala, Basri Ibrahim, mengatakan, 1.450 pendaftar tersebut akan mengikuti ujian tertulis pada 19 Juni mendatang di kampus STAIN Cot Kala di Gampong Meurandeh, Kec.Langsa Baroe. Dia mengambahkan, dari 7 program studi yang ditawarkan STAIN Cot kala, Prodi Muamalat di Jurusan Syariah mendapat paling banyak peminat mencapai 463 orang, diikuti prodi

Matematika di Jurusan Tarbiyah sebanyak 313 orang, peminat sementara prodi Al-Ahwal AlSyakhsiyyah tercatat paling sedikit peminat, hanya 48 orang. Basri menyambut gembira melihat minat lulusan dari satuan pendidikan SMA/MA/SMK/ MAK/Diniyah Ulya (Mu’adalah)/Pendidikan Kesetaraan Paket C yang mendaftar di STAIN Cot Kala mencapai jumlah kuota yang diberikan yang hanya 1.200 kursi. Basri mengatakan, sejauh ini panitia SPMBPTAIN 2012 STAIN Cotkala telah mempersiapkan lokasi serta para pengawas ujian yang terdiri dari para dosen yang bertugas di STAIN yang bertugas mengawas ujian yang dilaksanakan 19 Juni mendatang. (b22)

Baitul Mal Salurkan ZIS Rp1 Miliar BIREUEN (Waspada) : Baitul Mal Kabupaten Bireuen kembali menyalurkan bantuan kepada masyarakat fakir miskin Rp1 miliar lebih yang berasal dari zakat, infaq, dan sadaqah (ZIS) yang terkumpul periode Januari-April 2012. Penyaluran ZIS ini dilaksanakan, Jumat (15/ 6) di aula Sekdakab lama. Kepala Baitul Mal Kabupaten Bireuen, Ahmad Ajady dalam laporannya mengatakan, saat ini penerimaan kas Baitul Mal Bireuen untuk periode I Januari hingga April 2012 mencapai Rp1.013.767.000. Di mana jumlah dana tersebut bersumber dari zakat Rp331.183.000

dan infaq sekitar Rp682.584.000. Lebih lanjut dia menjelaskan, kumpulan zakat disalurkan antara lain untuk bantuan modal usaha masyarakat fakir Rp37.830.000, modal usaha masyarakat miskin Rp17.500.000. Selanjutnya, bantuan beasiswa fakir miskin tingkat SMP Rp90.150.000, SMA/SMK Rp105.400.000, beasiswa tingkat SD Rp26.200.000. Selain itu, bantuan biaya untuk muallaf Rp20.883.000, bantuan untuk Gharimin Rp16.700.000, serta untuk ibnu sabil Rp9.000.000. Sedangkan dana yang bersumber infaq pada tahap ini mencapai Rp682.584.000. (b17)



WASPADA Sabtu 16 Juni 2012


CALON mahasiswa mengikuti Ujian Seleksi Nasional Masuk Perguruan Tinggi Negeri (SNMPTN) 2012 di Universitas Negeri Medan, Selasa (12/6) lalu. Ujian SNMPTN yang berlangsung serentak di Indonesia tersebut memperebutkan 106.363 kursi yang disediakan oleh 61 Perguruan Tinggi Negeri (PTN).

Jangan Sampai Salah Jurusan! SUDAH menjadi tradisi setiap tahunnya bagi siswa yang lulus SLTA, langkah pertama yang diambil adalah mengikuti Seleksi Nasional Masuk Perguruan Tinggi Negeri (SNMPTN). Nah, kalo udah ikut SNMPTN, langkah selanjutnya adalah memilih jurusan.


PESERTA Seleksi Nasional Masuk Perguruan Tinggi Negeri (SNMPTN) Jalur Undangan 2012 melakukan registrasi di Balairung Universitas Indonesia, Depok, Selasa (12/6). SNMPTN Jalur Undangan merupakan program seleksi melalui nilai rapor sekolah. Selama dua hari registrasi, UI menerima 1800 calon mahasiswa baru dari Jalur Undangan.

Apa Yang Baru Dengan Gunung Uturuncu?

Terkadang kebanyakan orang bingung mau pilih jurusan apa? Hal ini karena mereka ikut SNMPTN hanya karena ikut-ikutan atau sekadar mencoba. Memilih jurusan itu seperti membangun rumah yang megah, tinggal di mana Anda memposisikannya. Anda bisa saja membangun rumah mewah di tepi jurang atau padang pasir. Namun Anda harus bisa membayangkan tempo rumah itu bertahan. Sama halnya dengan memilih jurusan di perguruan tinggi. Biasanya saat SNMPTN, ada dua jurusan yang harus kalian pilih dan

kebanyakan jurusan yang paling diminati atau sukai. Lalu jika berbicara minat dan suka, artinya itu kemungkinan besar diminati juga oleh sebagian besar peserta SNMPTN lainnya. Dengan kata lain, jurusan favorit. Beberapa jurusan dengan grade tertinggi, untuk jurusan Ilmu Pengetahuan Alam (IPA) adalah Ilmu Kedokteran, Teknik Informatika, Teknik Elektro, Teknik Kimia, dan Farmasi. Untuk jurusan Ilmu Pengetahuan Sosial (IPS), biasanya Akuntansi, Ilmu Hubungan Internasional, Ilmu Hukum, Ilmu

Ekonomi, dan Ilmu Komunikasi. Jika kedua pilihan jurusan kita semuanya favorit, artinya kita bersaing dengan banyak orang. Berbicara peluang, maka otomatis peluang kita semakin kecil dan sedikit banyaknya berharap pada keberuntungan. Kalo salah pilih jurusan, bukan tidak mungkin nantinya Anda gagal menyelesaikan perkuliahan hingga akhirnya drop out alias DO. Akibatnya, Anda rugi biaya, waktu, dan semuanya sia-sia belaka. Memilih jurusan di perguruan tinggi bukan urusan mudah dan sepele. Memilih secara tergesa-gesa tanpa memperhitungkan segala sesuatu kemungkinan akan berakibat fatal. Mudah mendapat pekerjaan dan uang merupakan alasan yang paling banyak dipusingkan. Bagi siswa yang sudah mengetahui bakat dan minatnya serta

terbiasa mengambil keputusan sendiri, mungkin tidak banyak kendala memilih jurusan. Namun, bagaimana bagi mereka yang tidak tahu akan bakat dan minatnya? Ditambah lagi ikutikutan agar punya teman saat kuliah atau juga karena pacar. Ada pula sikap orangtua yang memaksakan anak memilih jurusan yang telah ditentukan, bukan kemauan dan minat anaknya sendiri. Memang butuh pertimbangan dan kematangan dalam memilih jurusan yang tepat. Jadi, sebaiknya kita selektif dan memahami terlebih dahulu arah program studi yang hendak ditekuni. Seperti kata pepatah, pikir dahulu baru bertindak… Itulah yang harus kalian lakukan sebelum memilih jurusan. Good luck guys… *Hajrul Azhari Ritonga/ Arianda Tanjung

Ukir Prestasi Lewat Kerja Keras Prime One School Ikuti RCS 2012

Puncak kembar Uturuncu

PRIME ONE School kembali menunjukkan prestasinya di pertengahan tahun 2012. Kali ini, tim Robotic Prime One School mengukur prestasi gemilang di acara yang digelar oleh Mikroskil Robotic Centre, Sabtu (9/6) lalu. Robotic Competition for School (RCS) 2012 merupakan event kompetisi lokal se-Kota Medan. Di ajang ini, sejumlah siswa dari berbagai sekolah di Kota Medan dan sekitarnya


BOLIVIA Gunung Uturuncu

Samudera era a Pasifikk

Amerika Selatan




turuncu, gunung api besar di Bolivia, sudah bertahun-tahun membuat penasaran ahli-ahli vulkanologi. Selama 20 tahun terakhir, lerengnya yang sepanjang 64 kilometer mengembang ke arah luar dengan pertambahan kira-kira 50 mm setahun. Pembengkan itu disebabkan penggelembungan kantong magma di bawah permukaan dan bisa berarti letusan akan terjadi. Terakhir kali Uturuncu meletus 300.000 tahun lalu, sehingga menurut skala waktu geologi pembengkakan yang relatif cepat dalam 20 tahun terakhir itu tidak akan menaikkan levelnya ke tingkat kritis dalam waktu dekat. Namun, perkembangan itu menunjukkan Uturuncu sedang membentuk dirinya menjadi gunung api super yang mampu mengeluarkan letusan dahsyat. Satu dari tiga puluhan gunung api super meletus setiap kira-kira 100.000 tahun, yang terakhir meletus adalah gunung api super Toba

74.000 tahun lalu. Kabar buruknya uknya adalah, ketika gunug api super meletus menghancurkan puncaknya, akibatnya luar biasa. Selain menciptakan Danau Toba, letusan dahsyat itu diduga menciptakan musim dingin vulkanik selama bertahun-tahun dan menyebabkan musnahnya banyak kehidupan di muka bumi. Ilmuwan memperkirakan, bila Uturuncu meletus, letusannya akan seribu kali lebih kuat dibanding letusan Gunung St. Helen di Washington pada1980. Namun, karena hanya ada sepuluh gunung api super yang kini aktif, kemungkinan terjadinya letusan besar dalam waktu dekat ini kecil sekali. Bila Uturuncu mencapai status “bintang rock” vulkano dan dianggap sebagai super vulkano (gunung api super), dia berada di lingkungan yang tepat. Enam gunung api super lainnya terletak di Argentina, Bolivia dan Chile. Bolivia punya hampir 200 gunung api, tapi tak sampai 20 di antaranya yang aktif.

Bill Bi Bil ill Pitz tzzerr - wm mpi mp piitze tzer@i r@ @info nfoart nf aarrrtz.ccom m•C Copy opyyrig opyrig ig ght ht © 2012 012 TTh he Ne ew wY Yor ork Time o me m es S Synd yn ic ynd ica ica cate te

jumlah peserta, yakni sekira 40 tim. Tim Prime One School sendiri didampingi oleh dua pelatihnya, Surya Chandra dan Adrian George T Lim. Pada RCS tahun ini, mereka berhasil menyabet juara I dan II tingkat SLTA. Tim juara diwakili Ivy Icasia, Fernando, dan Citra Putri, sedangkan Ardent, Juanita, dan Fanny menjadi runner-up. Sementara, tingkat SD juga mengikuti jejak

seniornya dengan merebut dua gelar tertinggi. Juara I SD terdiri atas Trezvandrey, Asyila, dan Lady Joey, sedangkan juara II diraih Reynardo, Jannis, dan Junior Tanaya. Atas prestasi itu, Surya Chandra mengatakan bahwa kemenangan ini adalah hasil kerja keras dan persiapan yang sudah mereka lakukan lebih kurang selama dua bulan. *Arianda Tanjung



ditantang berkreativitas menciptakan robot-robot canggih. Pemenang dari kompetisi RCS ini berhak mengikuti kompetisi robotik tingkat nasional bertajuk “Indonesian Robot Olympiad” di Jakarta dalam waktu dekat. Tim Prime One School mengirimkan beberapa tim untuk berlaga di tiga kategori di tingkat SD, SLTP, dan SLTA. Terlihat jelas antusiasme peserta dengan meningkatnya

SISWA Prime One School yang mengikuti ajang RCS 2012 pekan lalu foto bersama.


Waspada, Sabtu 16 juni 2012  

waspada daily

Read more
Read more
Similar to
Popular now
Just for you