Page 1

Berastagi 20-30 0 C

R. Prapat 25-310C

Parapat 20-30 0C

P. Siantar 17-260C

Sibolga 22-31 0 C


Hujan guntur

WASPADA Demi Kebenaran Dan Keadilan

Prakiraan Cuaca Sabtu Medan 24-320C

BMKG Polonia

SABTU, Kliwon, 13 November 2010/6 Zulhijjah 1431 H

No: 23326 Tahun Ke-64

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

Terbit 24 Halaman (A1-12, B1-12)

Harga Eceran: Rp2.500,-



JUTAAN umat Muslim seluruh dunia memadati Masjidil Haram di Makkah, Jumat (12/11), untuk melaksanakan shalat Jumat terakhir serangkaian pelaksanaan ibadah haji tahun ini. Setiap tahunnya lebih 3 juta umat Muslim yang datang dari berbagai penjuru dunia melaksanakan ibadah haji di Makkah, Arab Saudi.

Penerimaan CPNS 20 Nov. MEDAN (Waspada): Pemerintah Provinsi Sumatera Utara (Pemprovsu) dan 31 kabupaten/kota di Sumut sepakat menyelenggarakan ujian penerimaan Calon Pegawai Negeri Sipil (CPNS) secara serentak. Pendaftaran CPNS dimulai 20 November4 Desember 2010.

Jamaah Haji Indonesia Paling Santun Dan Sabar JAKARTA (Antara): Pemerintah Kerajaan Arab Saudi memberikan penghargaan tinggi kepada jamaah haji Indonesia karena mereka dianggap paling santun dan sabar dalam melaksanakan rukun Islam kelima di tanah suci. “Karenanya, jamaah haji Indonesia dapat menjadi contoh bagi jamaah dari negaranegara lain sehingga pelaksanaan ibadah haji di tanah suci itu dapat berjalan dengan sebaik-baiknya,” kata Dubes Arab Saudi Abdulrahman Mohammed Amen Al-Khayyat kepada wartawan di Jakarta, Kamis (11/11) malam.

Pemerintah Kerajaan Arab Saudi juga telah meningkatkan pelayanan bagi jamaah haji Indonesia sejak pengurusan visa hingga pelayanan transportasi, kesehatan dan keamanan hingga saat mereka melaksanakan ibadah haji, kata Abdulrahman. Dalam hal transportasi, dia mengakui adanya “sedikit keterlambatan” keberangkatan pesawat Saudi Airlines yang membawa jamaah haji Indonesia ke tanah suci akibat sejumlah faktor, termasuk dampak debu vulkanik letusan Gunung Merapi.

Lanjut ke hal A2 kol. 6

Kesepakatan tersebut diambil dalam pertemuan antara Badan Kepegawaian Daerah (BKD) Sumut dan BKD kabupaten/kota wilayah Sumut di Hotel Madani Medan, Jumat (12/11). “Dalam pertemuan tersebut

telah disepakati jadwal tahapan penyelenggaraan seleksi CPNS di seluruh wilayah Sumut, selain Kota Tanjungbalai dan Kab. Toba Samosir yang tahun ini tidak menyelenggarakan seleksi CPNS,” kata Kepala BKD Sumut


Suherman, didampingi Kabid Pengadaan dan Pembinaan BKD Pandapotan Siregar, seusai pertemuan tersebut. Kuota resmi penerimaan CPNS 2010 Sumut bertambah dari sebelumnya 7.690 menjadi 8.375 dengan rincian tenaga

Waspada/Surya Efendi

RUAS Jl. Masjid Raya persimpangan Jl. SM Raja - Jl. Amaliun Medan merupakan kawasan wisata religius dan bersejarah dengan bangunan Masjid Raya Al Mashun di sebelah kiri dan Kolam Sri Deli di sebelah kanan serta diujung Jl. Masjid Raya – Jl. Sultan Makmoen Al Rasyid berdiri Istana Maimoon.

Kawasan Religius Dan Bersejarah Tak Terlupakan

MEDAN ( Waspada): 13 Anggota Polri dipecat dari kesatuan Polda Sumut karena terlibat narkoba. Mereka bagian dari 29 anggota Polri yang dipecat dengan berbagai kasus lain. Kapolda Sumut Irjen Pol. Oegroseno melalui Kabid Humas Kombes Pol. Baharudin Djafar kepada wartawan, Jumat (12/11), mengatakan, selain memecat 13 oknum polisi terli-

KETEGARAN tiga bangunan tua yang berada di satu kawasan saling berhubungan dalam jarak tempuh yang pendek ini tetap menampilkan kharismanya sendiri. Selalu ada pesona yang ditampilkan bangunan yang berumur rata-rata 100 tahun lebih tersebut, hingga tetap memikat pengunjung yang datang ke Medan, tetapi ikonnya mulai memudar di mata masyarakat lokal. Nuansa Islami sisa dari kekuasaan Sultan Makmun Al Rasjid Perkasa Alamsjah, pengua-

Lanjut ke hal A2 kol. 3

sa Kesultanan Deli dari tahun 1873 sampai 1924 yakni Masjid Raya Al Mashun-Taman Kolam Sri Deli-Istana Maimoon begitu kental mempengaruhi kawasan tiga serangkai bangunan tua yang menjadi situs bersejarah di Ibu Kota Provinsi Sumatera Utara ini. Tak heran di kawasan itu, Pemko setiap tahunnya mengucurkan dana miliaran rupiah untuk sebuah gawean besar di bulan Ramadhan melalui even Ramadhan Fair-nya. Lanjut ke hal A7 kol. 6

BC Teluknibung Gagalkan Penyelundupan 2 Kg Shabu TANJUNGBALAI (Waspada) : Petugas Bea Cukai pelabuhan Teluknibung Kota Tanjungbalai menggagalkan penyelundupan 2 kilogram shabu asal Malaysia, Jumat (12/11) malam. Psikotropika methamphetamine itu, dibawa oleh salah seorang penumpang fery speed Ocean Ekspres III rute pelayaran Portklang Malaysia-

Pelabuhan Teluknibung. Modus yang digunakan tersangka SNM, 23, warga Jalan Letjen Suprapto, Kel. TB Kota IV, Kec. Tanjungbalai Utara, Kota Tanjungbalai, shabu dikemasnya dalam 3 bungkusan alumunium foil dan dibalut karton lalu disembunyikan di celah-celah

Lanjut ke hal A2 kol. 6

dan Kepegawaian Nasional (BKN). Suherman menjelaskan, penerimaan 8.375 CPNS 2010 Sumut untuk pengadaan di 31 kabupaten/ kota serta Pemprov Sumut. Dibandingkan kuota sebelumnya dengan yang sudah

resmi ini, ada penambahan sebanyak 685 orang,” ucap Suherman. Lima besar kabupaten/ kota terbanyak yang membuka lowongan penerimaan CPNS 2010 Sumut masing-masing

Lanjut ke hal A2 kol. 2

Kuala Namu Takkan Selesai 2012

13 Polisi Dipecat Kasus Narkoba bat narkoba, pihaknya menangkap empat oknum TNI diduga terlibat narkoba. “Mereka sudah diserahkan kepada Denpom untuk proses lanjut. Untuk pemberantasan narkoba, termasuk penindakan kepada oknum Polri dan TNI yang terlibat dalam kasus ini, Poldasu berkordinasi dengan

guru 3.230 orang, tenaga kesehatan 2.254 orang dan tenaga teknis 2.891 orang. Seluruh kuota dengan rincian CPNS 2010 Sumut ini sudah disetujui Kementerian Negara Pemberdayaan Aparatur Negara (Kemenegpan) dan Ba-

JAKARTA (Waspada): Anggota Komisi V DPR RI Mangara Siahaan pesimis Bandara Kuala Namu bisa selesai tahun 2012, meskipun Komisi V sudah menyetujui anggaran pembangunan Bandara Kuala Namu sebesar Rp403 miliar. ‘’ Jika Pemprovsu tidak gencar melakukan langkah-langkah selanjutnya, saya pesimis Bandara itu selesai pada tahun 2012,’’ kata Mangara Siahaan, anggota F PDI Perjuangan menjawab Waspada di Jakarta, Jumat (12/11). Menurut Mangara, saat ini Komisi V DPR RI menunggu penyampaian Satuan 3 (perincian detail dari proyek yang akan dibangun) dari Kementerian


JEANNE Ralston, penumpang kapal Carnival Splendor dipeluk putrinya, sesaat setelah turun dari kapal pesiar mewah tersebut, Kamis (11/11) waktu setempat.

Kapal Pesiar Carnival Splendor “Titanic Kedua” SAN DIEGO (Berita): Para penumpang Carnival Splendor menyatakan lega bisa meninggalkan kapal pesiar mogok tersebut, setelah hampir tiga hari terkatung-katung Lanjut ke hal A2 kol. 3

Pemko Minta CBD Hentikan Pembangunan MEDAN (Waspada): Pemerintah Kota Medan akhirnya melayangkan surat kepada manajemen PT Central Business District (CBD), yang tengah

Lanjut ke hal A2 kol. 2

Cirus Sinaga Tersangka Pemalsuan Rentut Gayus JAKARTA(Antara): Jaksa Cirus Sinaga ditetapkan sebagai tersangka dugaan pemalsuan surat rencana tuntutan terhadap mantan pegawai Direktorat Jenderal Pajak, Gayus HP Tambunan. Kepala Pusat Penerangan Hukum (Kapuspenkum) Kejagung, Babul Khoir Harahap, menyatakan kejaksaan

agung pada 8 November 2010, telah menerima SPDP (Surat Pemberitahuan Dimulainya Penyidikan) nomor B/191/XI/ 2010/Dit Pidum tanggal 2 November 2010 dari Mabes Polri. “Setelah diterimanya SPDP itu, selanjutnya Direktur Pra Penuntutan pada Jaksa Agung

Lanjut ke hal A2 kol. 6

Tragedi Inzaghi

Suami Main Game, Istri Gantung Diri PANTAI LABU (Waspada): Uh Rawiyah, seorang ibu beranak satu berusia, 22, ditemukan tewas di dalam rumahnya di Dusun Mawar Baru, Desa Perkebunan Ramunia, Kec. Pantai Labu, Deliserdang, Jumat (12/11) sekira pukul 11:30. Hingga kini pihak kepolisian masih melakukan penyidikan guna mengetahui motif tewasnya Rawiyah. Dugaan sementara korban tewas gantung diri, ditandai leher korban ditemukan bekas jeratan, tak ada tanda kekerasan di tubuh korban. Sumber dihimpunWaspada, saat itu suami korban, Roy Candra, 24, tengah asik duduk Lanjut ke hal A2 kol. 3

Pekerjaan Umum (PU), kemudian tugas Pemerintah Sumatera Utara atau Pemerintah Pusat mencari investor untuk dimulainya pembangunan Ban-


SAAT mulai menemukan kembali ketajamannya, Filippo Inzaghi malah ditimpa bencana. Penyerang veteran AC Milan itu menderita cedera parah pada ‘cruciatum ligamen’ lututnya, sehingga terancam mengakhiri musim lebih dini. Ini tentu tragedi bagi Inzaghi, mengingat dirinya sedang berburu rekor pencetak gol terbanyak di Eropa. Bomber berumur 37 tahun itu, bersama striker Schalke Raul Gonzalez, saat ini berada Lanjut ke hal A2 kol. 6

dara Kuala Namu pengganti Polonia. Mangara Siahaan mengatakan, nasib Kuala Namu sekarang ini tergantung kemampuan lobi, apa itu bentuknya pendekatan atau meyakinkan Pemerintah Pusat dari pemimpin di daerah yang bersangkutan. “Pengalaman kepala daerah Sumut yang lalu, tidak mampu melobi Jakarta atau meyakinkan pihak yang terkait di Pusat, sehingga sampai akhir masa jabatannya tidak ada seperti lazimnya MoU pembangunan Kuala Namu. Sebaliknya Gubernur yang sekarang tidak bisa memperjuangkannya karena berada dalam tahanan,” ujarnya. Lanjut ke hal A2 kol. 3

Eks Karutan Brimob Terima Rp368 Juta JAKARTA (Waspada): Kompol Iwan Siswanto, mantan Kepala Rutan Mako Brimob Kelapa Dua mengaku menerima uang dari Gayus Tambunan sebesar Rp368 juta. “Estimasinya, setiap bulan diberikan Rp50 juta dan perminggu Rp5 juta. Sedangkan sejak September dan selanjutnya, Iwan menerima Rp100 juta per bulan,” kata Berlin Pandiangan, kuasa hukum Iwan Siswanto, saat ditemui di Mabes Polri, Jalan Trunojoyo, Jakarta, Jumat (12/11). Berlin membantah besaran dana yang diterima Iwan mencapai Rp500 juta. “Tidak benar karena hanya Rp368 juta,” tuturnya. Uang tersebut, lanjut Berlin, tidak diberikan Gayus kepada Iwan. “Melalui kuasa hukumnya,” tandasnya. Lanjut ke hal A2 kol. 6

erampang Seramp ang - Kata orang 2012 kiamat - He...he...he...

WASPADA Demi Kebenaran Dan Keadilan

Prakiraan Cuaca Medan 24-32 0C

P.Sidimpuan 20-300C

R.Prapat 25-31 0C

Penyabungan 20-30 0C

Berastagi 17-260C Berawan

Sibolga 22-310C Hujan guntur

BMKG Polonia

Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

SABTU, Kliwon, 13 November 2010/6 Zulhijjah 1431 H z No: 23326 * Tahun Ke-64

Terbit 24 Halaman (A1-12, B1-12) z zHarga Eceran: Rp 2.500,-

Penerimaan CPNS Sumut 20 November

Saudi Hentikan Transportasi Haji

MAKKAH (Antara): Pemerintah Arab Saudi menghentikan layanan transportasi bagi jamaah haji seluruh dunia mulai Jumat (12/11) karena semakin mendekatnya pelaksanaan wukuf di Arafah. Dengan keluarnya kebijakan Pemerintah Arab Saudi itu, Wakil Kepala Daker Makkah bidang Transportasi, Tatan Rustandi, Jumat mengatakan, Panitia Penyelenggara Ibadah Haji (PPIH) sudah tidak lagi memiliki kewenangan untuk mengatur masalah transportasi di Makkah. “Semuanya sudah diambil alih oleh Nakobah (organisasi angkutan) Arab Saudi. Kami sudah tidak bisa berbuat apa-apa lagi. Mulai hari ini (Jumat), jamaah sudah tidak bisa lagi menggunakan bus menuju Masjidil Haram,” kata Tatan di kantor Misi Haji Indonesia, Makkah. Kebijakan pemberhentian layanan transportasi itu akan berlaku hingga 20 November. Meski demikian pihaknya tetap berkeinginan bisa melayani transportasi jamaah haji. “Saya maunya begitu, tetap bisa layani jamaah,” katanya. Tatan mengingatkan jamaah yang akan ke Masjidil Haram agar memanfaatkan transportasi umum seperti taksi atau “omprengan” dengan membayar sendiri ongkosnya. Pihaknya juga meminta jamaah agar memaknai kebijakan pemerintah Arab Saudi tersebut secara positif, katanya. Menurut dia, jasa angkutan bus akan diistirahatkan untuk melakukan persiapan bagi mengangkut jamaah saat berada Armina. “Ini ada bagusnya, karena jamaah harus istirahat selama beberapa hari untuk persiapan wukuf di Arafah. Nantinya bus juga diistirahatkan untuk diperbaiki supaya lancar,” kata Tatan.

Harian Umum Nasional Terbit Sejak 11 Januari 1947


PENGHENTIAN OPERASIONAL BUS. Sejumlah jamaah haji berjalan melintasi terowongan dari Mahbaz Jin menuju Masjidil Haram. Pemerintah Arab Saudi mulai Jumat (12/11) memberlakukan penghentian operasional bus reguler jamaah haji di Kota Makkah. Para jamaah haji diharapkan dapat menjaga kesehatan mereka menjelang puncak ibadah haji di Arafah-Mina.

MEDAN (Waspada): Pemerintah Provinsi Sumatera Utara (Pemprovsu) dan 31 kabupaten/kota di Sumut sepakat menyelenggarakan ujian penerimaan Calon Pegawai Negeri Sipil (CPNS) secara serentak. Pendaftaran CPNS dimulai 20 November-4 Desember 2010. Kesepakatan tersebut diambil dalam pertemuan antara Badan Kepegawaian Daerah (BKD) Sumut dan BKD kabupaten/kota wilayah Sumut, di Hotel Madani Medan, Jumat (12/11). “Dalam pertemuan tersebut telah disepakati jadwal tahapan penyelenggaraan seleksi CPNS di seluruh wilayah Sumut, selain Kota Tanjungbalai dan Kabupaten Toba Samosir yang tahun ini tidak menyelenggarakan seleksi CPNS,” kata Kepala BKD Sumut Suherman, didampingi Kabid Pengadaan dan Pembinaan BKD Pandapotan Siregar, seusai pertemuan tersebut. Kuota resmi penerimaan Calon Pegawai Negeri Sipil (CPNS) 2010 Sumatera Utara bertambah dari sebelumnya 7.690 menjadi 8.375 dengan rincian tenaga guru 3.230 orang, tenaga kesehatan 2.254 orang dan tenaga teknis 2.891 orang. Seluruh kuota dengan rincian CPNS 2010 Sumut ini sudah disetujui Kementerian Negara Pemberdayaan Aparatur Negara (Kemenegpan) dan Badan Kepegawaian Nasional (BKN). Suherman menjelaskan, penerimaan 8.375 CPNS 2010 Sumut untuk pengadaan di 31 kabupaten/ kota serta Pemprov Sumut. Dibandingkan kuota sebelumnya dengan yang sudah resmi ini, ada penambahan sebanyak 685 orang,” ucap Suherman. Lima besar kabupaten/ kota terbanyak yang membuka lowongan penerimaan CPNS 2010 Sumut masing-masing Lanjut ke hal A2 kol 7

Cirus Dan Haposan Tersangka JAKARTA (Waspada): Kejaksaan secara resmi telah menerima Surat Perintah Dimulainya Penyidikan (SPDP) atas jaksa Cirus Sinaga dan pengacara Haposan Hutagalung. Keduanya diduga terlibat dalam dugaan pembocoran rencana tuntutan (rentut) bagi tersangka mafia pajak, Gayus Tambunan.

Haposan Hutagalung

“Keduanya sebagai tersangka,” kata Kepala Pusat Penerangan Hukum Kejaksaan Agung, Babul Khoir Harahap di Kejaksaan Agung, Jumat (12/11). Surat tersebut telah diterima tanggal 8 November 2010.

Berdasarkan surat tersebut, kata Babul, direktur Prapenuntutan Jaksa Agung Muda Tindak Pidana Umum menunjuk jaksa peneliti untuk berkoordinasi dengan pihak penyidik kepolisian. “Direktur prapenuntutan, telah menunjuk lima jaksa peneliti,” kata dia. Mereka adalah Tatang Sutarna, I Made Suwarjana, Asna Mukti, Ahmad

Usman, Wendy. Selanjutnya, kata dia, pasal yang disangkakan kepada keduanya adalah KUHP tentang pemalsuan surat dan menggunakan surat palsu. “Ancaman hukuman paling lama 6 tahun,” kata dia. Babul menambahkan, dalam SPDP tersebut belum ada permohonan cekal. “Memangnya Cirus mau kemana,”

imbuhnya. Kasus ini tengah ditangani Mabes Polri. Pengusutan kebocoran dan atau pemalsuan rencana tuntutan ini sendiri setelah ada laporan dari Kejaksaan Agung. Sementara pelaksana tugas Jaksa Agung Darmono juga menyatakan bahwa SPDP Cirus sudah diterima Kejaksaan Agung dari Mabes Polri.

Masyarakat 17 Desa Duduki Lahan Afd.1,2 Dan 3 PTPN IV Sosa SOSA (Waspada): Puluhan warga Peduli Masyarakat 17 Desa Kec. Sosa, Kab. Padang Lawas beberapa bulan belakangan tidak mendapat realisasi dana kompensasi dari PTP N IV Kebun Sosa sebagaimana yang disepakati bersama, sehingga warga menduduki lahan Perkebunan Afd.1,2 dan 3 kebun milik perusahaan BUMN itu, Jumat (12/11).

13 Polisi Dipecat Kasus Narkoba MEDAN ( Waspada): 13 Anggota Polri dipecat dari kesatuan Polda Sumut karena terlibat narkoba. Mereka bagian dari 29 anggota Polri yang dipecat dengan berbagai kasus lain. Kapolda Sumut Irjen Pol. Oegroseno melalui Kabid Humas Kombes Pol. Baharudin Djafar kepada wartawan, Jumat (12/11), mengatakan, selain memecat 13 oknum polisi terlibat narkoba, pihaknya menangkap empat oknum TNI diduga terlibat narkoba. Lanjut ke hal A2 kol 1

Aksi itu dilakukan warga menyusul dana konvensasi yang disepakati bersama dan telah dijanjikan pihak manajemen PTP N IV bebrapa tahun belakangan tidak direlisasi. Dimana telah ada kesepakatan bersama akan dana Kompensasi 30 persen dari hasil produksi setiap bulannya untuk warga 17 Desa kecamatan Sosa. Seperti disampaikan Pimpinan aksi Ahmadi Hasibuan, Ali Raja Lubis dan Jakbar Pasaribu ketika menyampaikan orasi di areal kebun PTP N IV. Sedang Pernyataan sikap masyarakat untuk disampaikan dipercayakan kepada Adil Makmur Pulungan dan Darman Paisal Lubis. Sedang tokoh masyarakat sebagai penanggung jawa adalah Surya Karta Hasibuan dan Zul Ihwan Lubis. Warga yang tergabung dalam aksi itu menyampaikan pernyataan sikap agar pihak PTPN IV perkebunan Sosa segera merealisasi dana kompensasi sebesar 30 persen untuk masyarakat 17 Desa, termasuk untuk 6 bulan terakhir ini. Lanjut ke hal A2 kol 1 Foto di halamanA2

Eksekutif Dan Legislatif Dituding ‘Rampok’ Dana Rakyat BANDA ACEH (Waspada): Di tengah menciutnya peluang kerja dan makin membengkaknya angka pengangguran di Aceh, 69 wakil rakyat di DPRA dan Gubernur Aceh menikmati dana aspirasi dana kerja gubernur senilai Rp413 miliar untuk tahun 2011. Di sisi lain, jumlah pengangguran di Aceh, posisi Agustus 2009 mendekati 170.000 orang dan angka ini membengkak dari tahun sebelumnya tercatat 164.600 orang, kata pejabat Dinas Tenaga Kerja dan Mobilitas Penduduk

Aceh, Drs Mahdi kepada pers beberapa waktu lalu. Meski jumlah orang miskin tahun ini belum terdata, diperkirakan angkanya juga mengalami peningkatan walau pemerintah pusat sudah menggelontorkan dana besar lewat Otsus dan Migas setiap tahunnya menyusul keluarnya UUPA No.11/2006. Buktinya Panitia Anggaran DPRRI, baru lalu telah memberikan kode bintang (*) pada mata anggaran Otonomi Lanjut ke hal A2 kol 2

“SPDP Cirus sudah kita terima dari Mabes Polri,” kata Pelaksana teknis (Plt) Jaksa Agung, Darmono di Jakarta, Jumat. Pasal yang disangkakan terhadap Cirus Sinaga dan Haposan Hutagalung adalah Pasal 263 ayat (1) dan atau ayat (2) KUHP tentang Pemalsuan Surat dengan ancaman enam tahun penjara. (VIVAnews/ant)

Cirus Sinaga

Kompol Iwan Terima Suap Dari Gayus Rp 368 Juta

Waspada/Zainuddin Abdullah

PERAGAKAN Kejadian: Petugas LP Kelas II Lhokseumawe memperagakan kembali adegan ketika petugas piket ditodong pria bersenjata api laras panjang yang berhasil membebaskan empat tahanan setempat, Kamis (11/11).


Seorang personil Polisi Polres Lhokseumawe memeriksa mobil Kijang Krista silver B 80 MS yang digunakan para tersangka bersenjata AK-56 untuk melarikan empat tahanan LP) Lhokseumawe,, Jumat (12/11).

Polisi Temukan Mobil Penyerbu LP Lhokseumawe Di Sawang LHOKSEUMAWE (Waspada): Hari pertama pengejaran terhadap penyerbu Lembaga Pemasyarakatan (LP) Lhokseumawe, pihak polisi baru menemukan kendaraan pelaku yang ditinggalkan di tengah jalan di kawasan Kec. Sawang. Kapolres Lhokseumawe AKBP Kukuh Santoso, melalui Kepala Pelaksna Harian Kasat Reskrim Ipda Cut Putri Amelia, Jumat (12/11) membenarkan pihaknya masih mengejar pelaku bersenjata api bersama empat napi Kelas II LP Lhokseumawe. Hasilnya Kamis (11/11), polisi baru menyita satu unit mobil pelaku di Desa Babah Buloh, Kecamatan Sawang Aceh Utara. “Sedangkan untuk mengetahui pemilik mobil, untuk sementara ini, hasil pemeriksa nomor plat Jakarta asli

yang digunakan. Karenanya masih terus mencoba mengetahui pemilik mobil sekarang karena tidak tertutup kemungkinan pemilik mobil pertama sesuai data, telah menjual ke pihak lain,” demikian Ipda Sut Putri Amelia. Akan tetapi pihak polisi juga belum dapat memberikan keterangan lebih soal perkembangan dalam pengejaran pelaku bersenpi laras panjang di kawasan pedalaman Kecamatan Sawang karena hingga berita ini diturunkan personel polisi masih fokus melakukan pengejaran pelaku. Hasil pengembangan, polisi hanya dapat memastikan plat mobil Kijang Kapsul warna silver yang digunakan pelaku adalah asli bernomor plat B 80 MS, sedangkan pemilik mobil masih ditelusuri. Lanjut ke hal A2 kol 2


Kawasan Religius Dan Bersejarah Tak Terlupakan KETEGARAN tiga bangunan tua yang berada di satu kawasan saling berhubungan dalam jarak tempuh yang pendek ini tetap menampilkan kharismanya sendiri. Selalu ada pesona yang ditampilkan bangunan yang berumur rata-rata 100 tahun lebih tersebut, hingga tetap memikat pengunjung yang datang ke Medan, tetapi ikonnya mulai memudar di mata masyarakat lokal. Nuansa islami sisa dari kekuasaan Sultan Makmun Al Rasyid Perkasa Alamsyah, penguasa Kesultanan Deli dari tahun 1873 sampai 1924 yakni Masjid Raya Al Mashun-Taman Kolam Sri Deli-Istana Maimoon begitu kental mempengaruhi kawasan tiga serangkai

Lanjut ke hal A2 kol 2

Waspada/Surya Efendi

KAWASAN RELIGIUS DAN BERSEJARAH: Ruas Jl. Masjid Raya persimpangan Jl. SM Raja - Jl. Amaliun Medan merupakan kawasan wisata religius dan bersejarah dengan bangunan Masjid Raya Al Mashun di sebelah kiri dan Kolam Sri Deli di sebelah kanan serta diujung Jl. Masjid Raya – Jl. Sultan Makmoen Al Rasyid berdiri Istana Maimoon. Foto diambil Kamis (11/11) dari Yuki Simpang Raya.

JAKARTA (Antara): Berlin Pandiangan, pengacara Kompol Iwan Siswanto (mantan Kepala Rutan Mako Brimob) mengatakan kliennya mengaku terima suap dari terdakwa Gayus HP. Tambunan karena faktor ekonomi. “Dia (Iwan, red) menerima suap dari Gayus karena faktor ekonomi, sebab istrinya sakitsakitan sudah sepuluh tahun dan sangat butuh biaya,” kata Berlin saat ditemui di Badan Reserse dan Kriminal (Bareskrim) Polri,Jakarta, Jumat (12/11). Iwan mengakui khilaf dan perbuatannya bertentangan dengan hukum, ujarnya. Berlin juga mengklarifikasi berita yang beredar yang mengatakan kliennya memiliki utang. “Iwan bukan punya utang, tapi pernah mau menjual rumah warisan dan sempat diterima oleh bank, tapi penjualan tidak jadi, sehingga uang harus dikembalikan,” katanya. Berlin mengatakan suap yang diterima Iwan dari Gayus jumlahnya bervariasi, dari bulan Juli hingga Agustus tiap bulan Rp 50 juta, per minggunya Rp5 juta, kemudian pada September hingga Oktober perminggunya berkurang jadi

Rp3,5 juta dan bulanannya Rp 100 juta, sehingga totalnya Rp 368 juta. “Suap yang jelas inisiatif dari Gayus, bukan Iwan, pak Iwan hanya memberi izin keluar tidak tahu kemana, yang jelas Gayus memohon berobat,” katanya. Berlin mengatakan untuk Lanjut ke hal A2 kol 1

Susno Dan Williardi Pernah Keluar Rutan Brimob JAKARTA (Antara): Mantan Kepala Badan Reserse dan Kriminal Polri, Komjen Pol Susno Duadji dan mantan Kapolres Metro Jakarta Selatan, Kombes Pol Williardi Wizar sempat keluar dari Rumah Tahanan Markas Komando Brimob selama ditahan. “Iwan mengatakan bahwa Susno dan Williardi pernah keluar dari Rumah Tahanan (Rutan) Mako Brimob,” kata Pengacara Kompol Iwan Siswanto, Berlin Pandiangan di Jakarta, Jumat (12/11). Lanjut ke hal A2 kol 7

Bupati Tobasa Lantik 5 Pejabat Eselon II BALIGE (Waspada): Bupati Toba Samosir Kasmin Pandapotan Simanjuntak melakukan pergantian jabatan setingkat kepala dinas (kadis) dengan melantik 5 pejabat eselon II B di aula kantor bupati di Balige, Jumat (12/11). Para pejabat yang dilantik tersebut yakni Liberty Manurung Biztel menjabat Kadis Pendidikan yang sebelumnya staf pada Bagian Perekonomian, Sangkap Pasaribu menjabat Kadis Sosial yang sebelumnya staf Dinas Sosial, Lisbet Rialam Siahaan menjabat Kepala Badan Lingkungan Hidup dan Pertambangan yang sebelumnya Sekretaris Badan Kesatuan Bangsa, Politik dan Perlindungan Masyarakat. Thamrin Simanjuntak menjabat Kepala Dinas Pendapatan, Pengelola Keuangan dan Kekayaan Daerah yang

sebelumnya staf Bagian Organisasi, Robert Pardede menjabat Kadis Kebudayaan dan Pariwisata yang sebelumnya hanya posisi staf pada dinas tersebut. Pejabat yang sebelumnya menduduki posisi tersebut, di antaranya Albert Marpaung, Hulman Sitorus, Resman Sirait, HL Silitonga, Lestari Manurung terhitung pelaksanaan pelantikan maka tidak mempunyai jabatan lagi (non job) dengan posisi staf. (a33)

Serampang - ‘Korban’ Gayus terus bertambah - He.... he....he....

Berita Utama

A2 Masyarakat 17 Desa ....

Mereka juga meminta agar pihak PTPN IV Kebun Sosa dapat menepati semua janji terhadap masyarakat 17 Desa. Jika Pihak PTPN IV Sosa tidak menepati janji, maka diharapkan pihak PTPN IV Sosa supaya mengembalikan tanah ulayat masyarakat seperti Afd.1,2 dan afdeling 3 kepada masyarakat. Dan sejak Jumat (12/11 ) lokasi Afd.1,2 dan 3 perkebunan PTPN IV Sosa dinyatakan dalam masalah dan sengketa. Bahkan selanjutnya akan menduduki lokasi sekaligus mengawasi kegiatan di areal afd.1, 2 dan afd 3, hingga ditemuinya jalan penyelesaian sesuai harapan masyarakat. Sejumlah tokoh masyarakat baik dari Desa Ampolu, Mananti Sosa Julu, Siginduang dan Desa Ramba menyatakan tidak terlibat dengan aksi tersebut. Begitu juga sejumlah tokoh masyarakat mengaku tidak ikut dengan gerakan tersebut. Tetapi sependapat persoalan realisasi dana kompensasi tersebut agar direalisasi secepatnya. Katanya, kami sangat sependapat mendesak PTPN IV segera merealisasikan

13 Polisi ....

“Mereka sudah diserahkan kepada Denpom untuk proses lanjut. Untuk pemberantasan narkoba, termasuk penindakan kepada oknum Polri dan TNI yang terlibat dalam kasus ini, Poldasu berkordinasi dengan Pangdam I/BB,” kata Baharudin. Dijelaskan, sejak 2004 hingga 2010, Poldasu mengungkap 17.234 kasus narkoba dengan jumlah tersangka 24.030 orang. Barang bukti disita; heroin 3.222 kg, ganja 1.964 kg, biji ganja 2.368 gram. Kemudian, putaw 0,44 gram, sabu 89 kg dan ekstasi 11.626 butir. Poldasu juga menangani kasus-kasus zat adiktif lainnya. “Selama 2010, ada 21 kasus yang sudah dilimpahkan ke jaksa dengan 18 tersangka. Barang bukti yang diamankan, pil leksotan 25 butir, happy five 95 butir, happy drink 29 butir, subute 1 butir, erimin 5 butir, erimin five 33 butir dan patrium borax 12 liter.” Selain mengungkap kasus narkoba, pihaknya juga menarik sejumlah merek jamu.

Macan Merapi Masuk Kampung

SLEMAN (Waspada): Bupati Sleman Sri Purnomo mengimbau kepada siapapun agar tidak membunuh macan Tutul yang berkeliaran turun dari puncak Gunung Merapi. Bupati berharap petugas berwenang mampu menangkap hewan itu secara hidup-hidup. “Saya berharap macan itu tidak dibunuh tapi dikembalikan ke habitatnya,” kata Bupati Sleman Sri Purnomo saat mengunjungi RS Sardjito, Jumat (12/11). (vivanews)

Kompol Iwan ....

pertama dan kedua, Gayus memang dikawal, tapi yang selanjutnya karena dianggap dipercaya, dan memang selalu kembali dengan jadwal ditentukan, Sembilan anggota yang ditahan diduga terlibat suap

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. ......, Gc7+. 3. Rh4, Me1+ (Jika 3. Rg5, Md8+mat). 4. Rg5, Me7+mat. Atau 4. Mg3, MxM+mat.

Jawaban TTS: Musik & Filem








Jawaban Sudoku: 2 0 7 9 5 6 4 3 1 8

1 4 5 6 7 3 2 8 9 0

3 9 0 8 4 1 5 6 7 2

5 7 2 4 9 8 0 1 6 3

6 8 1 3 0 2 7 9 5 4

0 1 8 5 6 7 3 2 4 9

Razia dilakukan bekerjasama dengan BPOM. Selain memecat, Kapolda juga memutasi 108 Perwira pertama (Pama) dan perwira menengah (Pamen) di jajaran Po l d a Su m u t , t e r m a s u k Pegawai Negeri Sipil dimutasi ke berbagai jajaran. Mutasi itu b e r d a s a r k a n Te l e g r a m Kapolda Nomor STR/530/XI/ 2010, yang diterima wartawan, Jumat (12/11). Dari jumlah itu, perwira pertama berpangkat Inspektur Dua (Ipda) sebanyak 25 orang, Inspektur Satu (Iptu) 24, Ajun Komisaris Polisi (AKP) 45, Komisaris Polisi (Kompol) 10 dan Ajun Komisaris Besar Polisi (AKBP) 1 orang. Selain itu berpangkat AKP di antaranya, Kasat Reskrim Polres Labuhanbatu AKP M Taufik yang pernah menjabat Kanit Reskrim Polsek Medan Kota dan Kasat Reskrim Polres Binjai menjadi Kasubag Sarpras Sumda Polres Pelabuhan Belawan. Jabatan lama Taufik dipercayakan kepada AKP Tito Travolta Hutauruk, sebelumnya Waka Polsekta Medan Sunggal. Selain itu, AKP Dony Alexander sebelumnya Kasat Reskrim Polres Pelabuhan Belawan dipercaya menjabat Kasat Reskrim Polres Langkat, AKP Josua Natal Andus Muara Tampubolon, Kanit Idik 1 Sat Reskrim Polresta Medan kini diangkat sebagai Kasat Reskrim Polres Tapanuli Utara. Satusatunya pangkat AKBP yang dipindahtugaskan, Ahmad Parlindungan sebelumnya Pamen Polda Sumut (pindahan Polda Sulsel) diangkat menjadi Tenaga Pendidik Sekolah Kepolisian Negara (Gadik SPN) Sampali. (m11) Gayus yakni Briptu Anggoco Duto, Briptu Bambang. S , Briptu Datu. A, Briptu Budi Hayanto, Bripda edi. S, Bripda J.Protes, Bripda Susilo, Bripda Bagus dan Kepala Rutan Kompol Iwan Siswanto. Kesembilan orang anggota yang terperiksa secara struktur berada di bawah Satuan Pengamanan Protokol (Satpamkol) Satuan Pelayanan Markas (Satyanma) Mabes Polri. Gayus yang keluar Rutan Brimob pada Jumat pagi (5/ 11), seharusnya balik kembali pada sore harinya, tapi sampai malam belum kembali.

Kawasan Relegius ....

2. g6+, Gxg6+.

TTS Topik

dana kompensasi terhadap masyarakat 17 Desa. Hanya saja menyangkut tekhnis jumlah dana kompensasi dan sistem pencairan masih harus di pertimbangkan secara adil dan proposional, katanya tegas. Sementara tokoh masyarakat Desa Hurung Jilok Patuan Humala Diatas Hasibuan yang juga anggota DPRD Palas dari Komisi B mengatakan bahwa apa yang disampaikan masyarakat itu hal yang wajar. Secara terpisah, manager PTPN IV Perkebunan Sosa Ir. Syafi’i Batubara diwakili Papam Perkebunannya Poniman,saat ditemui wartawan di Mess Afd.1 PTPN IV Perkebunan Sosa, dikatakan bahwa pihak perusahaan BUMN itu akan membayar dana kompensasi untuk masyarakat 17 desa tersebut. Bahkan pihak PTP N IV sudah mengalokasikan anggaran sebesar Rp12 miliar untuk kompensasi permanen, ditambah pembayaran kompensasi 30 persen yang tertinggal. Namun dana tersebut tidak bisa dicairkan begitu saja tanpa ada lembaga yang bertanggungjawab secara administrasi, katanya. (a32)

7 2 9 0 3 4 1 5 8 6

9 6 4 2 1 0 8 7 3 5

4 5 3 1 8 9 6 0 2 7

8 3 6 7 2 5 9 4 0 1

bangunan tua yang menjadi situs bersejarah di Ibu Kota Provinsi Sumatera Utara ini. Tak heran di kawasan itu, Pemko setiap tahunnya mengucurkan dana miliaran rupiah untuk sebuah gawean besar di bulan Ramadhan melalui even Ramadhan Fair-nya. “Sebenarnya tempat-tempat ini masih memiliki kharisma tersendiri dibanding tempat wisaata lainnya di Medan, karena bagi warga pendatang masih tetap menarik untuk dikunjungi, kata Juriah warga Aceh Selatan yang bertandang ke Istana Maimoon, Rabu (10/11). Menikmati tiga situs bersejarah itu seperti merasakan langsung keberadaan kota Medan sebenarnya, namun kesan semrawut sangat terasa di antara tiga lokasi tersebut,” katanya. Seperti kebersihan di sekitar lokasi dan banyak peralatan besi dan lainnya yang dipajang tak beraturan di sekitar Jalan Mahkamah ketika berjalan dari Istana Maimoon menuju Taman Kolam Sri Deli dan ke Masjid Raya.Sementara itu banyaknya pedagang bunga di lokasi halaman samping Istana Maimoon sudah selayaknya harus ditata rapi agar tidak mengganggu pemandangan pengunjung sehingga

WASPADA Sabtu 13 November 2010

PT Askes Cabang Sibolga Dituntut Beri Layanan Prima

Waspada/Idaham Butar butar

MASSA yang mengatasnamakan Masyarakat 17 Desa Kecamatan Sosa melakukan Aksi menduduki lahan Afd.1,2 dan 3 PTPN IV Perkebunan Sosa, Jumat (12/11).

Eksekutif Dan ....

GeRAK Aceh, KontraS Aceh dan LBH Banda Aceh, menuding telah terjadi barter dan perselingkuhan dalam menggolkan dua mata anggaran fantastik itu. “Ini perampokan uang rakyat secara legal,” kecam Pjs Gerakan Anti Korupsi Aceh, Askhalani kepada Waspada, Jumat (12/11). Kebijakan ini, menurut tiga lembaga tadi, diwarnai kongkalikong dan intrik politik antara dewan dan eksekutif. Karena kedua mata anggaran itu baru lahir setelah adanya kesepakatan ‘barter’ dan perselingkuhan politik yang saling menguntungkan. “Indikasi ini menunjukan dewan dan eksekutif telah melakukan suatu tindakan intrik politik anggaran kotor dalam perencanaan APBA 2011,” tulisnya. Terkait itu, Pjs. GeRAK Aceh, Askhalani, Koordinator KontraS Aceh Hendra Fadli dan Direktur LBH Banda Aceh, Hospi Novrizal Sabri, dalam pernyataan bersama yang Waspada terima, Jumat (12/ 11) minta alokasi dana aspirasi dan kerja gubernur itu harus kembali ditinjau ulang. Alasannya, menurut mereka, fakta telanjang hasil audit BPK-RI tahun 2009 menemukan indikasi adanya pelanggaran dalam proses pengajuan dan penempatan pos anggaran tersebut. Bahkan dugaan pelanggaran yang ditemukan dari hasil audit BPK-RI tahun 2009

melanggar atas aturan hukum peraturan Menteri Dalam Negeri (permendagri) No 13 tahun 2006 tentang pedoman pengelolaan keuangan daerah pada pasal 38 ayat 1 dan 2. Atas dasar itu, pengalokasian dana aspirasi dan dana kerja Gub/Wagub harus melalui mekanisme dan sesuai aturan hukum dan jika ini dipaksakan maka dewan harus bertanggungjawab atas dugaan tindak pidana yang terjadi dikemudian hari, ancam ketiga tiga lembaga tadi. Preseden Buruk GeRAK, LBH dan KontraS menegaskan, pengalokasian dana kerja gub/wagub serta dana aspirasi di Aceh sebuah preseden buruk yang terjadi di dunia legislatif di Indonesia dan tindakan ini tidak akan lahir jika dewan tidak memainkan tingkah pola dan prilaku politik anggaran dalam penyusunan dan perencanaan anggaran yang diusulkan. Mereka menuding, dana aspirasi bagi anggota dewan dan dana kerja gub/wagub sangat erat kaitanya dengan intrik politik golongan dan kepentingan partai politik menjelang Pilkada 2012. Sebab, berdasarkan hasil monitoring tahun anggaran 2009 dan 2010 diketahui dana aspirasi dan dana kerja gub/ wagub banyak dimamfaatkan serta digunakan untuk kepentingan pihak tertentu dengan mengajukan proposal atas nama lembaga “LSM-LSM”

fiktif dan proposal pemberdayaan ekonomi fiktif, dan diketahui bahwa tindakan ini hanyalah merupakan bagian dari upaya untuk memperkaya diri dan golongan serta koorporatif sehingga prilaku ini berpotensi merugikan keuangan negara dalam jumlah besar. Pernyataan sikap yang dinamakan gerakan respon hukum cepat (GRHN) menurut mereka tidak alergi atas pemberian dana bantuan kepada masyarakat Aceh baik dilakukan oleh gubernur maupun DPRA. Sepanjang mengikuti aturan hukum dan penempatan anggaran itu sesuai tupoksi dan kepentingan masyarakat miskin Aceh dan bukan berorientasi untuk kepentingan membantu kolega, golongan atau tim pemenang pemilu atau pilkada. Sebab berdasarkan fakta selama 2 (dua) tahun anggaran dikeluarkan indikasi dana aspirasi dewan dan dana kerja gub/wagub mengalir deras kepada kepentingan pihak tertentu dengan membuat proposal dan lembaga “LSMLSM” fiktif. Seharusnya dana kerja maupun dana aspirasi digunakan untuk kepentingan rakyat Aceh misalnya pemberian bantuan relokasi masyarakat korban bencana alam seperti air bandang dan lainnya di wilayah Aceh Selatan, Aceh Jaya, Aceh Barat, Gayo Lues, tulis GeRAK, LBH dan KontraS Aceh. (b02)

Dijaga Ketat Sementara pasca kejadian itu, petugas LP Kelas II Lhokseumawe mulai memperketat pengawasan dan meningkatkan pengamanan hingga melibatkan dua personel polisi bersenjata lengkap. Demikian Kepala LP Klas II Lhokseumawe Edy Teguh Widodo yang sempat melihat langsung adegan pembebasan empat napi oleh seorang pria yang menodongkan senjata api laras panjang membuat petugas tak berkutik. Namun di balik peristiwa itu, Eddy mengakui insiden ini bisa terjadi akibat faktor kelemahan dari sistem pengamanan yang mereka miliki terbatas dan tidak masuk katagori ketat. “Kalau insiden yang terjadi hingga meloloskan empat napi, akibat lemahnya sistem pengamanan. Pelakunya menggunakan senjata api laras panjang sedang petugas kami hanya pentungan,” cetusnya. Untuk mengantisipasi kejadian yang sama di masa mendatang terulang kembali, terang Edy, pasca kejadian kemarin pihaknya secara lisan dan tertulis telah meminta bantuan ke Polres Lhokseumawe.

Bantuan yang diminta adalah agar diperbantukan dua personel polisi bersenjata lengkap untuk melakukan penjagaan bersama di LP Lhokseumawe. “Termasuk hari ini kami telah mendatangi kembali ke Mapolres Lhokseumawe untuk mengajukan permintaan ini,” jelasnya. Selain itu, secara internal petugas LP juga telah menyiagakan seluruh sipir mengawasi dan memeriksa ketat terhadap para tamu yang berkunjung. Di samping itu terkait indikasi kasus pembebasan empat napi setempat membuktikan adanya komunikasi via telefon selular antara napi dengan pihak luar LP. Sehingga para napi terkesan bebas dan mudah menggunakan handphone untuk mengatur skenario dan strategi dengan orang luar sebelum peristiwa kabur terjadi. Sayangnya Eddy malah kembali mengulangi dan menggaris bawahi jawaban yang sama ini terjadi akibat adanya kelemahan dalam pengawasan di lingkungannya. Karena penertiban handphone dalam LP juga sering dilakukan petugas, setiap sepekan sekali menggelar razia khusus atau

pun razia men-dadak. Edy juga ikut menduga upaya pembebasan napi sudah direncanakan dengan baik, saat pelaku beraksi usai shalat zuhur. Saat itu para tahanan diberi waktu menemui keluarga yang membezuk atau pun hanya sekadar minum kopi di kantin LP. “Jadi dengan telah dibaca situasi ini, maka pelaku dapat bergerak dengan cepat, apalagi saat kejadian empat napi ini sedang santai, dua di ruang bezuk dan duduk di kantin,” tukasnya. Soal kemungkinan keterlibatan petugas LP, menurut Edy untuk sementara belum dapat mengarahkan pembicaraan dalam kontek tersebut. Apalagi dalam penyelidikan yang dilakukan polisi telah memintai keterangan terhadap tiga petugas, Yakni M. Nur saat kejadian berada di pintu PU2, serta dua sipr yang s e d a n g p i k e t , y a k n i B oy Adinata dan Puja. Untuk upaya penyelidikan secara internal, tambah Edy, sementara waktu ini belum dapat dilakukan, tapi dipastikan ke depan akan dilaksanakan secara jeli dan teliti. Termasuk mengikuti jalur sesuai prosedur, pasca kejadian seperti kaburnya taha-

nan, pihaknya hanya membuat laporan untuk atasan di provinsi hingga keputusan lebih lanjut. Berpegang dari keputusan provinsi, lalu pihaknya baru bisa memeriksa dengan memanggil dan menurunkan tim khusus yang melibatkan orang pusat dan provinsi. Di sisi lain Eddy juga mengulas tidak ada terlihat gerak-gerik mencurigakan dari empat napi sebelum kabur dan posisi mereka ditempatkan dalam kamar terpisah. Akan tetapi empat tahanan itu napi pembangkang dan membandal. Bahkan tiga di antaranya napi pindahan dari LP lain karena pernah mencoba kabur dari penjara. Ketiganya, Azhari pindahan dari LP Lhoksukon, Said Syarbaini pindahan dari LP Bireuen dan Yusrizal pindahan dari LP Langsa dan Yusrizal saat di Langsa, malah mencoba kabur dengan menyaru jadi pengunjung. Tapi aksi ini sempat diketahui petugas, sehingga akibat kasus ini dia dipindahkan ke LP Klas II Lhokseumawe. “Sedangkan untuk pengejaran kita berharap polisi dapat segera menemukan mereka kembali,” demikian Kalapas Klas II Lhokseumawe. (b15)

ketika melihat dapat berminat membeli bunga. Padahal kemegahan Istana Deli tersebut merupakan kebesaran masa lalu kota Medan yang dapat terlihat nyata saat ini di tiga situs bersejarah itu. Terlihat sebagian peralatan yang pernah digunakan di masa lalu masih berada balik istana tersebut, di antaranya cermin besar yang megah, kursi raja, lampu hias dari Eropa serta ornamen dan bahan bangunan yang telah berkualitas. Berwisata ke kawasan tersebut sangat nyaman dari segala sisi, baik dari suasana hati, biaya menikmati wisata kuliner di Taman Kolam Sri Deli yang murah setelah itu melakukan shalat di Masjid Raya Al Mashun yang teduh. Rasid warga Jalan Amaliun yang sedang menikmati rujak di sekitar Taman Kolam Sri Deli mengatakan, lokasi tersebut saat ini terkesan menjadi biasa saja karena sebagai situs sejarah terlihat biasa saja. Tidak menonjol lagi kesan klasiknya sebagai siasa masa lalu karena telah banyak dipoles dan beberapa bagian telah berubah bentuk, katanya. Sementara itu, Sekretaris U m u m Ya y a s a n S u l t a n Ma’Moen Al Rasyid T Mucrizad Fauziddin, Jumat (11/11), menuturkan, Istana Maimoon

peninggalan sejarah kesultanan Deli saat ini masih dikelola pihak keluarga istana. Untuk perawatan dan berbagai biaya lainnya seperti membabat rumput seluas 1,6 hektar berbiaya Rp1,2 juta dilakukan dua kali sebulan, berikut perbaikan kerusakan serta rekening listrik dan lainnya masih ditangulangi sendiri oleh yayasan. Yayasan yang dikelola pihak kerabat istana tersebut juga masih menanggung biaya beberapa sekuriti yang dikerjakan untuk menjaga taman halaman Istana Maimoon, agar tidak digunakan sembarangan oleh masyarakat sekitar. Setiap tahunnya biaya yang diperlukan untuk sekuriti, perawatan dan pelestarian lainnya menghabiskan dana Rp100 juta lebih ditambah untuk kesejahteraan petugas pengelola yang melayani pengunjung istana. Banyak yang dilakukan Yayasan Sultan Ma’Moen Al Rasyid untuk menjaga peninggalan kerajaan Deli tersebut agar ikonnya sebagai warisan budaya kota Medan tidak memudar, di antaranya tidak diperbolehkannya ruangan dalam istana untuk kegiatan umum. Agar lebih menarik minat pengunjung yayasan renca-

nanya akan membuat pajangan benda-benda pusaka Kesulatanan Deli di dalam Istana agar dapat dinikmati pengunjung, seperti piring yang digunakan dalam acara kebesaran kenegaraan, senjata dan lainya sehingga mirip museum. Selain itu, larangan dan berbagai bentuk yang akan ditampilkan untuk menjaga suasana dan aturan guna menjaga kelestarian budaya. Sedangkan Taman Sari Deli saat ini telah menjadi aset Pemko Medan sehingga pihak istana tidak dapat mencampurinya. Untuk Masjid Raya Al Mashun di kelola oleh badan kenaziran masjid (BKM) dari pihak kesultanan, namun manajemennya terpisah dengan pengelolaan Istana Maimun, sebut Mucrizad. Sedangkan biaya rutin yang diberikan pemerintah daerah untuk merawat dan menjaga istana sebagai situs bersejarah hingga saat ini tidak ada, namun istana pernah beberapa kali menerima bantuan dari pemerintah daerah untuk pengecatan bangunan dan lainnya. Un t u k m e n a n g g u n g beban tersebut yayasan menyewakan halaman untuk acara tertentu, serta menerima masukan dana dari penjualan tiket yang rata-rata perhari

jumlah pengunjung sampai 200 orang, sedangkan hari libur meningkat sampai 600 pengunjung setiap harinya. Meski ikon pada situs itu mulai memudar, tetapi tetap saja saat tertentu seperti akhir tahun Istana Maimoon juga kerap kedatangan tamu dari Eropa dan warga dari luar daerah terutama saat libur sekolah. “Sejarahnya itu sangat kental dan memang tidak ada yang lain bisa dijadikan ikon di kota ini, ya orang tetap dating menikmati tiga aset sejarah dan objek wisata ini,” kata Mucrizad. Dari literatur dan berbagai sumber, Istana Maimoon didesain seorang berkebangsaan asing dan dibangun oleh Sultan Deli, Makmun Al Rasyid Perkasa Alamsyah pada 1888 dengan luas 2.772 m2 memiliki 30 ruangan. Taman Sri Deli dibangun pada masa kesultanan Deli IX, Sultan Mahmud Al Rasyid Perkasa Alam, kira-kira tahun 1910 yang merupakan fasilitas komplek istana anakanak Sultan. Masjid Raya Al- Mashun dibangun tahun 1906 di atas lahan seluas 18.000 meter persegi, dapat menampung sekitar 1.500 jamaah dan digunakan pertama kali pada hari Jumat 25 Sya’ban 1329 H ( 10 September 1909). * Sahrizal

Khusus (Otsus), Aceh, Papua dan Papua Barat. Hingga Panggar DPRRI akan memanggil Gubernur ketiga provinsi tentang pemanfaatan dana otsus yang menggunaannya belum maksimal. Hal itu dibenarkan Wakil Ketua Panggar DPR-RI, asal Aceh, Mirwan Amir di Jakarta. Perselingkuhan Jumlah dana Ostus dan Migas yang cukup fantastik tersebut, ternyata “menggoda” pejabat eksekutif dan legislatif di Aceh. Sukses menggoalkan dana aspirasi dan kerja gubernur 2009 lalu, kini kedua institusi “kakap” di Aceh kembali mengalokasikan kedua mata anggaran itu yang nilainya Rp5 miliar/anggota dewan dan Rp68 miliar untuk kerja gubernur. Dana di dua mata anggaran itu hampir pasti didapat. Soalnya, Badan Anggaran DPRA dan Tim Anggaran Pemerintah Aceh telah memfinalisasi hasil pembahasan bersama mengenai Kebijakan Umum Anggaran (KUA) dan Prioritas Plafon Anggaran Sementara (PPAS) pada Rancangan Anggaran Pendapatan Belanja Aceh (RAPBA) tahun anggaran 2011, pekan lalu di DPRA. Skenario ‘perampokan’ uang rakyat secara legal ini kontan menimbulkan protes sejumlah lembaga anti korupsi dan elemen sipil lainnya. Bahkan, tiga lembaga yakni,

Polisi Temukan ....

SIBOLGA (Waspada): PT Askes Cabang Sibolga berkomitmen memberikan pelayanan prima kepada masyarakat berupa pembuatan kartu barcode dan akan menghentikan pemberlakuan kartu askes model lama pada akhir November ini. Demi kelancaran proses pelayanan administrasi kartu peserta baik di Puskesmas maupun di rumah sakit umum diharapkan peserta segera mengurus penggantian kartu pesertanya. “Sementara bagi peserta yang belum mendapat/ mengurus kartu askes barcode segera menghubungi kantor/instansi/satker di wilayah kerjanya masingmasing, jika belum ada nama untuk segera menghubungi kantor PT Askes Cabang Sibolga untuk diterbitkan kartu baru,” kata Kepala PT Askes Cabang Sibolga dr Zoni Anwar Tanjung melalui KPP Syabrino Sabirin, Jumat (12/11). Menurutnya, PT Askes (Persero) Kantor Cabang Sibolga membawahi 14 kabupaten/kota se-wilayah kerja kantor cabang dengan peserta askes sosial yakni kalangan PNS, pensiunan, veteran dan perintis kemerdekaan. “Dalam pemutakhiran data khusus penerima pensiun sipil/ABRI, veteran dan perintis kemerdekaan direncanakan mendistribusikan daftar isian peserta askes sosial melalui tempat pembayaran gaji (kantor pos dan bank),” terang Sabirin. Dijelaskan peserta diminta untuk dapat diisi dengan identitas terbaru disertai pasphoto ukuran 3x2 masingmasing satu lembar dan dikembalikan ke tempat pembayaran gaji (kantor pos dan bank) untuk selanjutnya dikirimkan ke PT Askes (persero) setempat. Dikatakan Sabirin, peserta dapat mengurus kartunya di PT Askes Kota Sibolga dan Kabupaten Tapteng di Jalan Dr FL Tobing, PT Askes Kota Padangsidempuan di Jalan Dr FL Tobing Komplek RSU P.Sidimpuan, PT Askes Kabupaten Tapsel, Palas dan Paluta di Jalan Batunadua, PT Askes Kabupaten Madina di komplek RSU Panyabungan, PT Askes Kabupaten Taput di Komplek RSU Swadana Tarutung, PT Askes Kabupaten Humbahas di Komplek Dolok Sanggul, PT Askes Kabupaten Nias, Gunungsitoli, Nias Barat dan Nias Utara serta PT Askes Kabupaten Nisel di Jalan Pelita Pasir Putih Teluk Dalam. Ditambahkan Sabirin, peserta Askes bagi kalangan pensiunan, veteran, veteran non tuye dan perintis kemerdekaan yang belum menerima kartu askes baru dapat menghubungi kantor askes setempat. (a34)

Suami Main Game, Istri Gantung Diri PANTAI LABU (Waspada): Uh Rawiyah, seorang ibu beranak satu berusia, 22, ditemukan tewas di dalam rumahnya di Dusun Mawar Baru, Desa Perkebunan Ramunia, Kecamatan Pantai Labu, Deliserdang, Jumat (12/11) sekira pukul 11:30. Hingga kini pihak kepolisian masih melakukan penyidikan guna mengetahui motif tewasnya Rawiyah. Dugaan sementara korban tewas gantung diri, ditandai leher korban ditemukan bekas jeratan, tak ada tandatanda kekerasan di tubuh korban. Sumber dihimpun Waspada, saat itu suami korban, Roy Candra, 24, tengah asik duduk di belakang rumahnya bermain game. Tak lama, anaknya yang masih berusia 2,5 tahun datang menghampiri dan memberikan isyarat kepada sang ayah, tentang keberadaan ibunya di dalam kamar. Sang ayah penasaran, lalu bergegas ke dalam kamar, dan betapa terkejutnya dia melihat istrinya tewas tergantung di dalam kamar. Kabar inipun diketahui warga sekitar yang dalam sekejab berbondong ke rumah korban. (a06)

Penerimaan ....

imbau dilakukan dengan PTN setempat melalui rektor, apakah dengan USU, atau Universitas Negeri Medan (Unimed),” ucap RE Nainggolan. Imbauan Pemprov Sumut kepada 31 kabupaten/kota tersebut dituangkan dalam Surat Edaran Gubsu tentang Pelaksanaan Penerimaan CPNS 2010 Sumut. Namun, RE Nainggolan mengaku imbauan tersebut tidak bersifat memaksa. Ditambahkan Suherman, selain penerimaan CPNS 2010 Sumut dengan formasi pelamar umum, tahun ini juga Pemprov Sumut akan menuntaskan penerimaan CPNS dari formasi tenaga honor dengan jumlah 223 orang. Suherman menjelaskan, kepastian 223 orang honor ini diterima menjadi CPNS, baru akan diketahui awal Januari 2011. “Saat ini, data-data 223 honor Pemprov Sumut itu masih digodok KemenegPAN dan BKN. Kemungkinan kepastiannya baru keluar per 1 Januari 2011, yang diserentakkan dengan formasi CPNS dari pelamar umum,” katanya. (m19)

Susno Dan ....

Tahanan Markas Komando Brimob, Kelapa Dua, Depok. “Sepengetahuan kami, Pak Susno keluar masuk penjara untuk hal tertentu seperti sidang atau pemeriksaan di Mabes,” kata pengacara Susno, Ari Yusuf Amir, saat dihubungi, Jumat (12/11). Sebelumnya, Berlin Pandiangan selaku pengacara mantan Kepala Rutan Brimob, Kompol Iwan Siswanto, mengungkapkan bahwa Susno Duadji juga suka keluar masuk tahanan. Selain itu, terdakwa kasus korupsi itu juga kerap memberikan sembako kepada para petugas rutan. “Susno juga pernah memberikan Rp10 juta kepada Kompol Iwan kaena iba terhadap keadaan istrinya yang sakit,” ujar Berlin. Ari menegaskan, pemberian sembako memang pernah diberikan oleh Susno. “Dari dulu Pak Susno suka memberi makanan kepada anak buahnya. Tapi itu diberikan bukan dalam rangka untuk menyuap,” ujarnya. Mengenai pemberian Rp10 juta, Ari membantahnya. “Pak Susno bukanlah orang yang berkelebihan uang,” ujarnya. (ant/vivanews)

Kabupaten Batu Bara (370), Kabupaten Padang Lawas dan Kota Sibolga (360), Kabupaten Nias Barat (340), Kota Medan dan Kabupaten Labuhanbatu Utara (324) serta Kabupaten Padang Lawas Utara (313). “Sedangkan Pemprov Sumut tetap pada permohonan semula 290 orang dengan jumlah yang pensiun dan meninggal untuk tahun 2010 sebanyak 340 orang,” beber Suherman. Pemprov Sumut diwakili Sekdaprovsu DR RE Nainggolan bersama Kepala BKD dari 31 kabupaten/ kota dalam rapat di Hotel Madani Medan bersepakat terhadap empat hal dalam penerimaan CPNS 2010 Sumut. Yakni, pengumuman penerimaan CPNS dilakukan 1630 November 2010, pendaftaran 20 November - 4 Desember 2010, ujian 15 Desember 2010 pada pukul 09:00, dilakukan serentak dan pengumuman hasil ujian pada 22 Desember 2010. “Menyangkut kerja sama dengan Perguruan Tinggi Negeri (PTN), kita tetap mengNamun, Susno dan Williardi keluar dari Rutan hanya sekali atau dua kali saja, tidak sering seperti terdakwa mafia pajak, Gayus HP. Tambunan. “Klien saya mengatakan bahwa Susno dan Williardi diijinkan keluar Rutan bukan dibayar, tapi karena mantan atasan, komandannya Iwan langsung satu korps,” kata Berlin. Susno dapat ijin keluar Rutan Mako Brimob, memberikan uang kepada Iwan sebesar Rp10 juta serta sembako kepada para penjaga, katanya. Susno dan Williardi mendekam di sel Rutan Mako Brimob berdekatan dengan sel Gayus. Susno terdakwa kasus dugaan gratifikasi penanganan PT Salma Arowana Lestari dan p e n g a m a n a n Pe m i l i h a n Umum Kepala Daerah Jawa Barat 2008. Sementara itu, Williardi terdakwa kasus dugaan pembunuhan Direktur PT Putra Rajawali Banjaran Nasrudin Zulkarnaen. Susno Beri Sembako Sementara pengacara Komisaris Jenderal Susno Duadji membantah bahwa kliennya suka keluar masuk dari Rumah

Berita Utama

A2 DOMPET PEDULI BENCANA MENTAWAI & GUNUNG MERAPI GEMPA dan Tsunami di Mentawai telah menyebabkan kedukaan yang mendalam bagi ribuan jiwa masyarakat. Meletusnya Gunung Merapi di Yogyakarta juga mengakibatkan Ratusan Ribu orang saat ini hidup didaerah pengungsian disebabkan rumah mereka rusak berat. Banyak korban tewas dan menglami luka parah. Untuk membantu saudara-saudara kita yang mengalami musibah di Mentawai dan Yogyakarta, LAZ Peduli Ummat Waspada membuka Dompet Peduli Bencana Mentawai & Gunung Merapi. Semoga amal kebaikan kita diterima Allah SWT.

Tranfer Bank :

- Bank Muamalat Cabang Medan No. Rek 211.00002.15 - Bank Syariah Mandiri Cabang Medan No. Rek. 006.000832.1 - Bank Central Asia (BCA) Cabang Medan No. Rek. 022.1750828 - Bank Mandiri Cabang USU No. Rek. 106-0002203803 - BNI Cabang Medan No. Rek. 0057504808 - Bank Sumut Cabang Medan No. Rek. Hubungi Kami : Lembaga Amil Zakat Peduli Ummat Waspada

Jl. Brigjen Katamso No. 1 Medan telp. 061-4511936 - 4150858 (evi) E-mail : Kota Medan, diatas Rp.300.000 dijemput ( 4511936 - 08126375062)



31. 32. 33. 34. 35. 36. 37. 38. 39. 40.

Rp 500,000 Rp 1,936,000 Rp 700,000 Rp 1,500,000 Rp 50,000 Rp 100,000 Rp 50,000 Rp 50,000 Rp 100,000 Rp 50,000

Hj. Mariani - Medan SMA Kartika 1.1 - Medan SMP Kartika 1.1 - Medan B. Tarigan - Medan Hamba Allah - Medan Hamba Allah - Medan Hamba Allah - Langkat Hamba Allah - Deli Serdang Hamba Allah - Perbaungan Hamba Allah - Binjai

Jumlah s/d Laporan ke-4


Pos Sumut Peduli Kumpulkan Rp1,076 Miliar MEDAN (Waspada): Pos Sumatera Utara Peduli berhasil mengumpulkan dana bantuan kemanusiaan Rp1,076.576.000. Dana yang dikumpul secara spontandaribeberapaSKPDPemprov Sumut, BUMN, BUMD dan sejumlah stakeholders pemerintah itu ditujukan untuk membantu korban bencana Gunung Sinabung (Tanah Karo), banjir dan longsor Wasior (Papua Barat), tsunami Mentawai (Sumbar) dan meletusnya Gunung Merapi (Jawa Tengah). Penggalangan dana kemanusiaan Pos Sumut Peduli yang digelar di Aula Martabe Kantor Gubernur Sumut, Medan, Jumat (12/11), dipimpin Wagub Sumut H Gatot Pujonugroho bersama Sekda Pemprov Sumut DR RE Nainggolan, MM. Sedangkan penyimpanan dana dilakukan oleh Biro Binsos Sumut pada PT Bank Sumut dengan nomor Rekening “Pemprov Sumut mengundang para dermawan dan donator di daerah ini untuk menyalurkan bantuannya kepada korban bencana di empat lokasi di tanah air yang terjadi sepanjang tahun 2010,” ucap RE Nainggolan saat memulai penerimaan donasi. Dari jumlah Rp1,076 miliar yang terkumpul dalam waktu 30 menit, penyumbang bantuan terbesar tercatat dari PTPN IIIdenganjumlahbantuanRp500 juta, PT Toba Pulp Lestari Rp100 juta,DinasPUBinaMar-gaSumut Rp60 juta, Gabungan Pengusaha Kepala Sawit Indonesia (Gapki) Sumut Rp50 juta, Dishub Sumut Rp30 juta dan beberapa SKPD se jajaran Pemprov Sumut. Sedangkan, wartawan unit

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. ......, Gc7+. 2. g6+, Gxg6+. 3. Rh4, Me1+ (Jika 3. Rg5, Md8+mat). 4. Rg5, Me7+mat. Atau 4. Mg3, MxM+mat.

Jawaban TTS: TTS Topik







Jawaban Sudoku: 1 4 5 6 7 3 2 8 9 0

3 9 0 8 4 1 5 6 7 2

Pemko Minta CBD ... membangun properti ratusan pertokoan dan hotel di eks LapanganGolf,untukmenghentikan seluruh aktivitas pembangunan. “Kita sudah layangkan surat ke pihak CBD untuk menghentikan pembangunan. Permintaan ini dilakukan menyusul adanya protes dari pihak Administrator Bandara (Adban) Polonia kepada Pemko,” kata Walikota Medan Rahudman Harahap kepada wartawan di Balai Kota Medan, Jumat (12/11). Menurut Rahudman, Pemko telah melayangkan surat ke pihak CBD untuk menghentikan pembangunan itu menyusul adanya surat Adban. “Jadi, untuk sementara, proyek properti itu harus dihentikan dan ditinjau ulang.” Dijelaskan Rahudman, protes dilayangkan pihak Adban karena pembangunan CBD mengganggu keamanan dan kenyamanan aktivitas Bandara Polonia. Pasalnya, jarak proyek CBD hanya berjarak 150 meter dari landasan pacu seharusnya 300 meter. Selain itu, bangunan dengan fasilitas hotel yang akan melebihi ketinggian 14 meter, melanggar ketentuan Kawasan Keselamatan Operasional Penerbangan (KKOP). (h10)

Calhaj Terlantar Laporkan PT Azizi Ke Polisi Biro Perjalanan Kembalikan Uang MEDAN (Waspada): Ratusan Calon Jamaah Haji Plus asal Medan, Sergai, Pontianak, Makassar, Bandar Lampung dan Riau yang terlantar di Hotel Sri Deli, beberapa hari ini karena gagal berangkat ke Tanah Suci melalui PT Azizi Kencana Wisata, Jumat(12/ 11), berangsur pulang ke daerah masing-masing. Mereka pulang setelah ada kesepakatan uang dikembalikan meski tidak seratus persen karena sudah tidak tahan lagi ditelantarkan. Kesepakatan itu dihasilkan setelah jamaah asal Medan melaporkan biro perjalanan haji dan umroh itu ke Polsekta Medan Timur. Pantauan Waspada, kemarin, setelah mereka melaporkan kasus itu ke polisi, pihak biro perjalanan buru-buru mengaku bertangungjawab kepada jamaah dengan perjanjian akan mengembalikan uang jamaah 100 persen.Tetapi pengemba-

lian uang itu waktunya hingga masa 6 bulan untuk pelunasan, sedangkan tahap awal diberikan beberapa persen. Di samping itu, pihak PT Azizi menawarkan kepada jamaah yang tetap akan melaksanakan ibadah haji, akan diberangkatkan tahun depan. “Saya berikan jalan keluar, pertama boleh mengambil uang 100 persen dikembalikan. Kedua, akan berangkat tahun depan. Bagi yang akan dikembalikan sebagian dulu dan sisanya dalam beberapa bulan kemudian. Demi Allah saya akan kembalikan uang jamaah tidak akan saya makan uang itu,” kata Nazla Lubis pimpinan Azizi Kencana Wisata ini. Menurut Nazla, terlantarnya para jamaah karena visa jamaah yang tidak dikeluarkan kedutaan Arab Saudi. Padahal pihaknya sudah memenuhi berbagai persyaratan yang diberikan pihak kedutaan. “Tidak ada penipuan, semua

karena visa yang tidak keluar. Saya kembalikan paling cepat 6 bulan diselesaikan, karena ada proses rivan dulu ke Bank Mandiri yang tidak mungkin berjalan cepat, diajukan dulu ke bank pembatalannya,” ucap Nazla menahan air mata. Jamaah yang ditelantarkan sempat melaporkan kasus ini ke Polsekta Medan Timur. Polisi, kemarin malam, menahan Dedi suami Nazla. Namun, polisi melepaskan kembali Dedi pukul 05.00 pagi. Sementara jamaah yang mengaku melaporkan kasus ini ke polisi hanya ingin meminta perlindungan kepada pihak berwajib atas kasus mereka. “Kami ke polisi untuk mohon perlindungan. Jika kemudian polisi menahan suami Nazla hingga pukul 05.00 dinihari,” ujar beberapa jamaah. Saat ditanyakan apakah mereka akan mencabut laporannya di polisi karena Pimpinan

Kapal Pesiar ...

bahkan tidak bisa menggunakan toilet, karena aliran air toilet tidak dapat bekerja tanpa bantuan listrik. Keadaan diperparah dengan udara panas yang menyelimuti sebagian besar kapal, karena pendingin udara yang tidak berfungsi optimal. Mekanik kapal sempat berusaha memperbaiki kerusakan dari mesin, namun gagal untuk mendapatkan tenaga cadangan. Terpaksa kapal penarik membawa kapal mewah yang berada sekira 241 kilometer dari San Diego ke Ensenada, Meksiko. Tidak ada yang terluka dalam insiden ini, namun beberapa penumpang terlihat panik atas insiden tersebut. Pihak operator kapal Carnival Splendor ini akan mengganti seluruh kerugian dari penumpang. Kapal Carnival Splendor

sendiri dalam perjalanan selama tujuh hari dan berangkat dari Long Beach, Amerika Serikat (AS). Setelah berlabuh di dermaga pada Kamis (11/11), para penumpang yang berkerumun di atas dek kapal bersorak ceria dan mendapat gemuruh sambutan dari warga yang berkumpul di atas dermaga menanti kedatangan mereka. Di sepanjang dermaga, para turis dan warga serta nelayan mengabadikan kepulangan mereka dengan berfoto-foto. Amy Watts, 25, asal Seattle, Washington mengatakan, waktu ituterlintasdipikirannyaiasedang mengalami kejadian serupa seperti insiden kapal Titanic. “Anda seolah berpikir tentang Titanic,” ujarnya, saat sang kapten mengatakan tidak perlu meninggalkan kapal yang saat itu lumpuh. (ap/rzl)

narnya tidak ada kendala teknis untuk pembangunan Kuala Namu, karena anggarannya sudah disetujui oleh Komisi V DPR RI. Karena itu,Wagub mestinya terus memperjuangkan dengan gencar pembangunan Kuala Namu supaya lebih cepat dimulai. ‘’Peranan wakil gubernur sekarang ini di Sumut sangat penting, misalnya melobi berbagai pihak dan pemerintah pusat,’’ ujar Mangara.Dia memberi contoh, ketika Pemda Jawa Timur tidak mampu menyelesaikan bagian tengah pembangunan jembatan Suramadu (Surabaya-Madura), karena kekurangan dana, gubernurnya dia melihat istrinya tewas tergantung di dalam kamar. Kabar ini pun diketahui warga sekitar yang dalam sekejab berbondong ke rumah korban. Selanjutnya mayat korban dievakuasi ke RSUD Deliserdang, menggunakan mobil patroli Bandara Kualanamu. Hingga kini polisi masih melakukan pengusutan. (a06)

gesit melakukan lobi ke Jakarta dan pro aktif mencari investor dan akhirnya mereka peroleh investor dari China, sehingga pembangunan itu bisa diselesaikan. “Karena itu jika Pemda Sumut tidak getol memperjuangkannya saya pesimis, rencana penyelesaian Kuala Namu akan miss lagi dari targetnya,” katanya. Begitupun, Mangara menggarisbawahi, rencana pembangunan Bandara Kuala Namu dari dulu tetap mendapat perhatian khusus dari Komisi V DPR, dan beberapa kali mengadakan rapat dengan Menteri Perhubungan, masalah ini selalu dibahas. “Rapat kerja pada persidangan berikutnya, kita akan pertanyakan lagi kepada Kementerian Perhubungan, karena anggaran untuk pembangunan bandara Kuala Namu sudah dialokasikan dalam APBN, mestinya target penyelesaian pembangunan bisa rampung sesuai dijadwalkan, yakni tahun 2012, ujar Mangara.(j07)

Pangdam I/BB,” kata Baharudin. Dijelaskan, sejak 2004 hingga 2010, Poldasu mengungkap 17.234 kasus narkoba dengan jumlah tersangka 24.030 orang. Barang bukti disita; heroin 3.222 kg, ganja 1.964 kg, biji ganja 2.368 gram. Kemudian, putaw 0,44 gram, sabu 89 kg dan ekstasi 11.626 butir. Poldasu juga menangani kasus-kasus zat adiktif lainnya. “Selama 2010, ada 21 kasus yang sudah dilimpahkan ke jaksa dengan 18 tersangka. Barang bukti yang diamankan, pil lekso-tan 25 butir, happy five 95 butir, happy drink 29 butir, subute 1 butir, erimin 5 butir, erimin five 33 butir dan patrium borax 12 liter.” Selain mengungkap kasus narkoba, pihaknya juga menarik sejumlah merek jamu. Ra-

zia dilakukan bekerjasama dengan BPOM. Mutasi Selain memecat, Kapolda juga memutasi 108 Perwira pertama (Pama) dan perwira menengah (Pamen) di jajaran Polda Sumut, termasuk Pegawai Negeri Sipil dimutasi ke berbagai jajaran. Mutasi itu berdasarkan Telegram Kapolda Nomor STR/ 530/XI/2010, yang diterima wartawan, Jumat (12/11). Dari jumlah itu, perwira pertama berpangkat Inspektur Dua (Ipda) sebanyak 25 orang, Inspektur Satu (Iptu) 24, Ajun Komisaris Polisi (AKP) 45, Komisaris Polisi (Kompol) 10 dan Ajun Komisaris Besar Polisi (AKBP) 1 orang. Selain itu berpangkat AKP di antaranya, Kasat Reskrim Polres Labuhanbatu AKP M Taufik yang pernah menjabat Kanit Reskrim Polsek Medan

Kota dan Kasat Reskrim Polres Binjai menjadi Kasubag Sarpras Sumda Polres Pelabuhan Belawan. Jabatan lama Taufik dipercayakan kepada AKP Tito Travolta Hutauruk, sebelumnya Waka Polsekta Medan Sunggal. Selain itu, AKP Dony Alexander sebelumnya Kasat Reskrim Polres Pelabuhan Belawan dipercaya menjabat Kasat Reskrim Polres Langkat, AKP Josua Natal Andus Muara Tampubolon, Kanit Idik 1 Sat Reskrim Polresta Medan kini diangkat sebagai Kasat Reskrim Polres Tapanuli Utara. Satu-satunya pangkat AKBP yang dipindahtugaskan, Ahmad Parlindungan sebelumnya Pamen Polda Sumut (pindahan Polda Sulsel) diangkat menjadi Tenaga Pendidik Sekolah Kepolisian Negara (Gadik SPN) Sampali. (m11)

‘’Menyangkut kerja sama dengan Perguruan Tinggi Negeri (PTN), kita tetap mengimbau dilakukan dengan PTN setempat melalui rektor, apakah dengan USU, atau Universitas Negeri Medan (Unimed),” ucap RE Nainggolan. Imbauan Pemprov Sumut kepada 31 kabupaten/ kota tersebut dituangkan dalam Surat Edaran Gubsu tentang Pelaksanaan Penerimaan CPNS 2010 Sumut. Namun, RE Nainggolan mengaku imbauan tersebut tidak bersifat memaksa. Ditambahkan Suherman, selain penerimaan CPNS 2010 Sumut dengan formasi pelamar umum, tahun ini juga Pemprov Sumut akan menuntaskan penerimaan CPNS dari formasi tenaga honor dengan jumlah 223 orang. Suherman menjelaskan, kepastian 223 orang honor ini diterima menjadi CPNS, baru akan diketahui awal Januari 2011. “Saat ini, data-data 223 honor Pemprov Sumut itu masih digodok

KemenegPAN dan BKN. Kemungkinan kepastiannya baru keluar per 1 Januari 2011, yang diserentakkan dengan formasi CPNS dari pelamar umum,” katanya. Pemko Buka 16 November Sementara itu, Pemko sudah membuka pendaftaran Selasa (16/11). Sistem pengiriman permohonan dapat melalui internet. “Pemko mulai buka pendaftaran 16 November dengan sistem internet,” kata sumber terpercaya di Badan KepegawaianDaerah(BKD)KotaMedan. Dijelaskannya, Pemerintah Kota Medan mempermudah penerimaan CPNS pada tahun 2010. Bagi pelamar cukup hanya melalui internet dan kelengkapan berkas diserahkan setelah dinyatakan lulus. “Untuk pelaksanaan pendaftaran cukup dengan membuka webset Pemko. Jadi, pelamar dapat mengirimkan permohonan melalui internet yakni seperti biodatanya ke Pemko Medan,” kata sumber itu.

Rincian Rincian penerimaan CPNS tersebut yakni, Pemprov Sumut (290 orang), Kota Medan (324 orang), Binjai (153 orang), Pematang Siantar (160 orang), TebingTinggi (171 orang), Padang Sidempuan (210 orang), Sibolga (360 orang), Gunung Sitoli (302 orang), Kabupaten Deli Serdang (287 orang), Serdang Bedagai (287 orang), Langkat (285 orang), Karo (196 orang), Dairi (238 orang), Simalungun (219 orang), Tapanuli Utara (203 orang), Pakpak Bharat (249 orang), Humbang Hasundutan (239 orang), Samosir (277 orang), Tapanuli Selatan (229 orang) Mandailing Natal (280 orang), Padang Lawas (360 orang), Padang Lawas Utara (313 orang),TapanuliTengah (236 orang), Asahan (250 orang), Batubara (370 orang), Labuhan Batu (219 orang), Labuhan Batu Selatan (299 orang), Labuhan Batu Utara (324 orang), Nias (256 orang), Nias Selatan (269 orang), Nias Utara (304 orang) dan Nias Barat (340 orang). (m19/h10)

tak bisa ke toilet, dilanda gelap gulita, berjejalan di kabin sempit dan makanan kaleng seadanya. Penderitaan 4.500 penumpang dan para kru kapal terjadi akibat kebakaran mesin di kapal pesiar tersebut. “Saya senang bisa kembali ke darat,” ujar Ken King, seorang penumpang berusia 42 tahun asal Los Angeles. Pengalaman mengerikan dialami para penumpang yang terpaksa menikmati perjalanan mereka tanpa pendingin udara, makanan panas, toilet dan layanan telefon. Asap memenuhi ruangan belakang kapal, dan bau asap tercium hingga galangan kabin di haluan kapal. Kondisi ini membuat para penumpang yang telah membayar mahal untuk sekali perjalanan, merasa kecewa. Mereka

Kuala Namu ... Karena itu lanjut Mangara, kita bisa optimis jika Wakil Gubsu berperan sekalipun desicion maker tetap dipegang oleh gubernur. “Tetapi kalau proyek itu mau di arrange (diatur lagi) Wakil Gubernur harus bolakbalik Medan –Jakarta, apa itu melakukan desakan kepada pusat atau menyamakan langkah apa yang harus dilakukan,’’ ujarnya . Setelah itu, lanjutnya, bisa diminta keputusan kepada Gubsu Syamsul Arifin selama beliau masih berwenang menandatangani keputusan. Menurut Mangara, sebe-

Suami Main Game, ... di belakang rumahnya bermain game. Tak lama, anaknya yang masih berusia 2,5 tahun datang menghampiri dan memberikan isyarat kepada sang ayah, tentang keberadaan ibunya di dalam kamar. Sang ayah penasaran, lalu bergegas ke dalam kamar, dan betapa terkejutnya

13 Polisi ...

Musik & Filem


2 0 7 9 5 6 4 3 1 8

Kantor Gubernur Sumut secara spontan memberikan donasi dengan cash money (uang kontan) sebesar Rp610.000. RE Nainggolan mengutarakan Sumut punya potensi cukup besar dengan berbagai sektor usaha, antara lain bidang perkebunan, pertanian, perikanan dankelautansertapertambangan. “Tahun 2009, Pos Sumut Peduli berhasil mengumpulkan dana sebesar Rp5.849.466.500,” kata RE Nainggolan. Kepala Dinas Kominfo Sumut, Eddy Syofian menambahkan, dana bantuan kemusiaan Pos Sumut Peduli tahun 2009 yang terkumpul sebesar Rp5,849 miliar, telah disumbangkan kepada korban bencana banjir bandang di Kabupaten Madina Rp2 miliar dan Rp3 miliar untuk korban bencana gempadiSumateraBarat.“Dengan sisa dana Rp849 juta lebih ditambah pengumpulan dana secara spontan pada Pos Sumut Peduli 2010 sebesar Rp1,076 miliar, dana terkumpul saat ini mencapai Rp1,9 miliar lebih. (m19)

5 7 2 4 9 8 0 1 6 3

6 8 1 3 0 2 7 9 5 4

0 1 8 5 6 7 3 2 4 9

7 2 9 0 3 4 1 5 8 6

9 6 4 2 1 0 8 7 3 5

4 5 3 1 8 9 6 0 2 7

8 3 6 7 2 5 9 4 0 1

Penerimaan CPNS ... Kabupaten Batu Bara (370), Kabupaten Padang Lawas dan Kota Sibolga (360), Kabupaten Nias Barat (340), Kota Medan dan Kabupaten Labuhanbatu Utara (324) serta Kabupaten Padang Lawas Utara (313). “Sedangkan Pemprov Sumut tetap pada permohonan semula 290 orang dengan jumlah yang pensiun dan meninggal untuk tahun 2010 sebanyak 340 orang,” beber Suherman. Pemprov Sumut diwakili Sekdaprovsu DR RE Nainggolan bersama Kepala BKD dari 31 kabupaten/ kota dalam rapat di Hotel Madani Medan bersepakat terhadap empat hal dalam penerimaan CPNS 2010 Sumut. Yakni, pengumuman penerimaan CPNS dilakukan 16-30 November 2010, pendaftaran 20 November - 4 Desember 2010, ujian 15 Desember 2010 pada pukul 09:00, dilakukan serentak dan pengumuman hasil ujian pada 22 Desember 2010.

WASPADA Sabtu 13 November 2010

PT Azizi mengatakan jika dirinya diproses secara hukum, maka akan terhambat upaya memenuhi janjinya pada jamaah. Terkait hal itu, baik Dongoran dan Lubis, jamaah yang terlantar, tetap sepakat untuk tidak mencabut laporanya karena mereka tetap ingin ada campur tangan pihak hukum. Meskipun mereka mengaku tidak merasa ditipu dan tetap ingin uangnya kembali. Seorang jamaah asal Lampung bernama Nadia yang ikut serta dalam rombongan ini mengaku akan memilih untuk meminta uangnya kembali. Dia menyebutkan, suaminya yang bekerja di instansi pemerintah tidak bisa mengambil cuti sesukanya. Kepulangan mereka ke Lampung memang kurang menyenangkan dan sangat kecewa. Sementara itu, Kapolsekta Medan Timur AKP Patar Silalahi mengakui jamaah haji yang gagal berangkat telah membuat laporan pengaduan ke Polsekta Medan Timur. Sedangkan yang membuat laporan pengaduan atas nama Ahmad Daud Pospos warga Jalan Tombak Medan. “Selain memeriksa saksi korban marga Pospos, kami masih memeriksa saksi-saksi lainnya terkait kasus penipuan. Dari hasil pemeriksaan saksi-saksi tersebut selanjutnya akan memeriksa unsur pimpinan PT

BC Teluknibung ... tas koper. Rencananya barang haram itu akan diedarkan di Kota Tanjungbalai. Pengakuan tersangka, dia hanya kurir yang mendapat imbalan dari pemiliknya di Malaysia. Kepala kantor BC Teluknibung Eko Darmanto melalui Kasi Penindakan dan Penyelidikan Tuahman Saragih mengatakan, penangkapan terjadi berkat kejelian petugas melihat gelagat tersangka yang mencu-

Cirus Sinaga ... Muda Tindak Pidana Umum (Jampidum) menerbitkan Surat Perintah Penuntutan Jaksa Penuntut Umum untuk mengikuti perkembangan penyidikan perkara tindak

Eks Karutan Brimob ... Sebelumnya, Iwan dicopot dari jabatannya setelah diketahui Gayus tertangkap kamera di Bali saat menonton pertandingan tenis. Bahkan, Iwan telah ditetapkan sebagai terperiksa dan kini sudah ditahan Propam Mabes Polri. (okezone)

Jamaah Haji ... “Keterlambatan itu masih sebatas kewajaran dan yang paling penting adalah Saudi Airlines dapat membawa jamaah haji Indonesia sampai ke tujuan dengan selamat pada waktu yang tepat,” katanya. Pada kesempatan itu, atas nama pemerintah Kerajaan Arab Saudi, Abdulrahman juga menyampaikan belasungkawa kepada pemerintah dan rakyat Indonesia terutama para korban bencana Merapi di Yogyakarta dan Jawa Tengah, serta tsunami di Mentawai, Sumatera Barat. “Kami mendoakan para keluarga korban bencana alam di Indonesia agar mereka tetap kuat dan sabar dalam menghadapi musibah tersebut,” katanya. Saudi Hentikan Transportasi Haji Pemerintah Arab Saudi menghentikan layanan transportasi bagi jamaah haji seluruh

Waspada/Anum Saskia

SUASANA kesepakatan calon jamaah haji plus PT Azizi Kencana Wisata dengan pimpinan Nazla Lubis (berjilbab) di ruang resto Hotel Sri Deli Jalan SM Raja Medan, Jumat (12/11). Azizi Kencana Wisata,” ujarnya. Pemerintah harus tegas Di tempat terpisah anggota DPD RI asal Sumatera Utara Darmayati Lubis menyebutkan, banyaknya calhaj asal Indonesia yang mengalami masalah batal berangkat ini membuktikan bahwa antusias masyarakat untuk menunaikan ibadah haji sa-

ngat tinggi. Karena itu, kata Darmayanti yang tergabung dalam Komite 3 Bidang Pengawasan Haji, sesuai dengan bentuk tugas konstitusional yang melakukan pengawasan terhadap implementasiUUNo13Tahun2008 ini, harus ada ketegasan dari pemerintah terhadap biro perjalanan haji dan umroh. (m36/cat)

Tenda Di Arafah Terbakar MAKKAH, Arab Saudi (Waspada): Kebakaran menghanguskan sejumlah tenda di Arafah Kamis (11/11), demikian menurut sejumlah pejabat. Regu pemadam kebakaran dari Pertahanan Sipil memadamkan api dan tidak ada korban jiwa atau pun korban cedera. “Segera setelah laporan tentang kebakaran diterima, tim Pertahanan Sipil bergegas ke lokasi kebakaran dan memadamkan api,” kata May. Abdullah Al-Harthi, jurubicara Direktorat Pertahanan Sipil untuk Haji, mengatakan kepada Saudi Press Agency. Penyebab kebakaran itu masih diselidiki, katanya menambahkan. (m07) rigakan. “ Tersangka gugup ketika turun dari fery, maka langsung kita periksa,” jelas Tuahman di dampingi anggota Customs Narkotica Teams (CNT) Hery Supomo. Hasil pemeriksaan melalui mesin X-ray, petugas melihat benda mencurigakan di tas koper milik tersangka. “ Tiga kali kita periksa, hasilnya sama, lantas kita lanjutkan pemeriksaan dengan membuka bungkusan itu, dan kemudian kita bawa ke kantor,” terang

Tuahman. Di kantor Bea Cukai, isi bungkusan itu kembali diperiksa melalui narcotest dan hasilnya positif shabu. “ Beratnya lebih 2 kilogram,” tambah Tuahman. Sampai berita ini dikirim, tersangka masih menjalani pemeriksaan intensif di kantor Bea Cukai. Rencananya, untuk penyelidikan lebih lanjut, tersangka dan barang bukti shabu 2 kilogram akan dilimpah ke Polres Tanjungbalai. (a37/crs/crm)

pidana umum atas nama tersangka Cirus Sinaga dan Haposan Hutagalung,” katanya, Jumat (12/11). Pasal yang disangkakan terhadap Cirus Sinaga dan Haposan Hutagalung adalah Pasal 263 ayat (1) dan atau ayat (2) KUHP tentang Pemalsuan Surat dengan ancaman enam tahun penjara. Pelaksana Tugas Jaksa Agung Darmono juga menyatakan, SPDP Cirus sudah diterima Kejaksaan Agung dari Mabes Polri. “SPDP Cirus sudah kita terima dari Mabes Polri,” kata Pelaksana teknis (Plt) Jaksa Agung, Darmono, di Jakarta, Jumat. Sebelumnya, Kejagung me-

laporkan Jaksa Cirus Sinaga dan oknum pengacara H ke Badan Reserse Kriminal (Bareskrim) Mabes Polri terkait dugaan pemalsuan rentut mantan pegawai Ditjen Pajak Gayus Tambunan, terdakwa kasus penggelapan pajak yang semula dituntut satu tahun percobaan namun kemudian dikeluarkan rentut dengan ancaman satu tahun penjara. Tim pemeriksaan internal Kejagung terkait dugaan pemalsuan rentut tersebut telah menyebutkan ada empat nama yang diduga terlibat pemalsuan rentut yakni jaksa FR, CS, pengacara H dan pegawai di Pidum Kejagung berinisial B.

dunia mulai Jumat (12/11) karena semakin mendekatnya pelaksanaan wukuf di Arafah. Dengan keluarnya kebijakan Pemerintah Arab Saudi itu, Wakil Kepala Daker Makkah bidangTransportasi,Tatan Rustandi, Jumat mengatakan, Panitia Penyelenggara Ibadah Haji (PPIH) sudah tidak lagi memiliki kewenangan untuk mengatur masalah transportasi di Makkah. “Semuanya sudah diambil alih oleh Nakobah (organisasi angkutan) Arab Saudi. Kami sudah tidak bisa berbuat apa-apa lagi. Mulai hari ini (Jumat), jamaah sudah tidak bisa lagi menggunakan bus menuju Masjidil Haram,” kata Tatan di kantor Misi Haji Indonesia, Makkah. Kebijakan pemberhentian layanan transportasi itu akan berlaku hingga 20 November. Meski demikian pihaknya tetap berkeinginan bisa melayani transportasi jamaah haji. “Saya maunya begitu, tetap

bisa layani jamaah,” katanya. Tatan mengingatkan jamaah yang akan ke Masjidil Haram agar memanfaatkan transportasi umum seperti taksi atau “omprengan” dengan membayar sendiri ongkosnya. Pihaknya juga meminta jamaah agar memaknai kebijakan pemerintah Arab Saudi tersebut secara positif, katanya. Menurut dia, jasa angkutan bus akan diistirahatkan untuk melakukan persiapan bagi mengangkut jamaah saat berada Armina. “Ini ada bagusnya, karena jamaah harus istirahat selama beberapa hari untuk persiapan wukuf di Arafah. Nantinya bus juga diistirahatkan untuk diperbaiki supaya lancar,” kata Tatan. Pihaknya sudah melakukan sosialisasi terkait dengan kebijakan pemberhentian layanan transportasi tersebut sejak dari tanah air hingga ke setiap sektor pemondokan, katanya.

Tragedi Inzaghi ... pada posisi teratas dengan koleksi 70 gol. Hebatnya, Inzaghi mampu mencetak empat gol mengesankan dalam empat laga terakhir bersama Milan, kendati sebagian besar turun sebagai pemain cadangan. Dua dari keempat gol itu justru dia lesakkan ke gawang Real Madrid, saat bermain imbang 2-2 pada matchday 4 Liga Champions, 3 November lalu. Kontribusi dan kesuburannya di Eropa, sebenarnya menjadi nilai tambah bagi penyerang kelahiran 9 Agustus 1973 itu untuk terus mendapat tempat di garis serang I Rossoneri. Inzaghi tetap eksis, kendati Milan dijejali striker berkelas bintang model Alexandre Pato, Ronaldinho Gaucho, Robinho, dan Zlatan Ibrahimovic. Berkat golnya ke gawang Madrid pula, alenatorre Massimiliano Allegri makin ‘jatuh hati’ kepadanya. Terbukti, Inzaghi terus mendapat menit bermain sejak itu, sampai kemudian mengalami cedera parah ketika baru turun 15 menit sebagai pemain pengganti saat Milan menggebuk Palermo 3-1, Rabu lalu. Hasil pemeriksaan, seperti dikutip dari AFP, Jumat (12/11), menyimpulakan Inzaghi membutuhkan operasi untuk memperbaiki kerusakan ligamen lututnya. Itu berarti, dia akan kehilangan sisa musim ini. Karirnya bahkan rawan berakhir, karena awal musim depan usianya sudah memasuki angka 38. Sejak gabung di San Siro tahun 2001 silam, Inzaghi mencatat 289 penampilan dan menyumbang 125 gol bagi Il Diavolo. Penyerang yang akrab dipanggil Pippo itu lahir sekaligus mengawali karirnya di Piacenza, kota kecil di Italia.

Setelah mencetak 13 gol dari 21 kali membela Piacenza di Seri C, tahun 1993 Inzaghi direkrut klub Seri B Verona. Ketajamannya makin terasah dengan mengoleksi 15 gol dari 15 partai. AC Parma pun tertarik memboyongnya pada 1995. Kurang berkembang selama semusim di Ennio Tardini, Inzaghi kemudian mandah ke Atalanta. Di sinilah sinar Inzaghi memancar, karena dia merebut gelar top skor Seri A dengan 24 gol dari 33 partai pada musim 1996/1997. Juventus langsung datang meminang dan duetnya bersama Alessandro Del Piero menghasilkan banyak prestasi bagi The Old Lady. Inzaghi menghasilkan 58 gol selama empat musim (1997-2001) membela Si Nyonya Tua. Pelabuhan dia berikutnya adalah Milan, tetapi sekali lagi di Kota Mode itu pula karirnya terancam tamat. “Pippo mengalami masalah pada lututnya, kami berharap yang terbaik untuknya,” ujar Allegri dalam FootballItalia. Hilanglah kesempatannya melampaui Raul sebagai pencetak gol tersubur Eropa, padahal peluang untuk itu sangat terbuka. Milan masih menyisakan dua laga babak penyisihan Grup G Liga Champions melawan Auxerre (23/ 11) dan Ajax Amsterdam (8/12). Pupus pula keinginan Inzaghi untuk menikmati lagi atmosfer panas derbi Milano melawan Inter besok malam di Seri A. Akhirnya, Allegri juga yang alergi dengan kondisi skuadnya, apalagi Pato pun bernasib sama dengan Pippo. “Sangat disayangkan, kami harus kehilangan dua pemain hebat seperti Pato dan Inzaghi yang telah menampilkan performa cantiknya. Mereka berdua harus absen untuk beberapa pertandingan,” keluh Allegri. * Jonny Ramadhan Silalahi

Medan Metropolitan

WASPADA Sabtu 13 November 2010


Protap Dan Sumtra Terganjal Persyaratan MEDAN (Waspada): Hasil kajian Departemen Dalam Negeri (Dedagri) RI, ternyata belum ada satu pun usulan pemekaran daerah, baik itu provinsi dan kabupaten/kota dari Sumut, seperti Provinsi Tapanuli (Protap) dan SumateraTenggara (Sumtra) yang memenuhi persyaratan. Hal tersebut disampaikan Ketua Komisi A bidang pemerintahan DPRD Sumut Hasbullah Hadi kepada Waspada melalui telefon selulernya, Kamis (11/11), seusai bertemu dengan Direktur Penataan Daerah, Otonomi Khusus dan Dewan Pertimbangan Otonomi Daerah (DPOD) Depdagri Susilo di Jakarta. Sejumlah anggota Komisi A DPRD Sumut yang ikut dalam pertemuan itu Nurul Azhar Lubis, Irwansyah Damanik, Taufik Hidayat, Syamsul Hilal, A l a m s y a h Ha m d a n i d a n

Marasal Hutasoit. Turut hadir, Asisten I Pemerintahan Pemprovsu, Hasiolan Sialen, Kepala Biro Otda, Bukit Tambunan. Hasbullah menjelaskan, dalam pertemuan itu, Susilo menjelaskan, ada 33 usulan pemekaran daerah yang dibahas Depdgari. Dari jumlah itu, hanya 12 daerah yang dinilai sudah memenuhi persyaratan. “Tidak ada satupun wacana pemekaran dari Sumut yang termasuk dalam 12 daerah itu,” katanya. Depdagri sendiri, menurutnya, tidak merinci jumlah usulan pemekaran daerah dari Sumut yang sudah masuk ke lembaga tersebut. Selain itu, Depdagri menegaskan, pembahasan persyaratan pemekaran tetap berdasarkan PP No.78/ 2007 tentang tata cara pembentukan, penghapusan dan penggabungan daerah. Begitupun, kata politisi

senior Partai Demokrat Sumut itu, Depdagri mengatakan semua usulan pemekaran daerah itu masih belum akan ditindaklanjuti, karena saat ini posisi pemerintah pusat tetap menunggu sampai grand design pemekaran daerah di sahkan. “Grand design ini menurut mereka sudah dipaparkan menteri ke DPR-RI. Kemungkinan besar baru akan disahkan pada akhir tahun ini. Jadi sebelum itu, semua tindaklanjut wacana pemekaran daerah masih jeda karena masih moratorium,” katanya. Meskipun posisi jeda, tambah Hasbullah, DPRD Sumut tetap akan melanjutkan agenda sidang paripurna pembahasan wacana pembentukan Protap dan Sumtra. “Jadi biarpun Depdagri dalam posisi jeda, mereka tetap mempersilahkan DPRDSU untuk membahas Protap dan Sumtra,” tambahnya. (h11)

Walikota Resmikan Gebyar SMK MEDAN (Waspada): Walikota Medan Rahudman Harahap meresmikan pagelaran unjuk kompetesi Gebyar SMK (Sekolah Menegah Kejuruan) yang diselenggarakan Dinas Pendidikan Kota Medan bersama Trans Kreasindo Production di lokasi PRSU Tapian Daya Medan, Kamis (11/11). Parhelatan akbar pendidikan SMK ini diharapkan menjadi momen pembuktian ‘SMK se-Kota Medan Bisa’ menjawab tantangan untuk pemenuhuan kebutuhan dunia kerja di dunia usaha (industri) yang saat ini semakin kompetitif. “Even ini sangat bermanfaat dan memberikan ruang kepada SMK Kota Medan untuk menunjukkan keunggulan kepada masyarakat luas,” kata Rahudman. Menurut Rahudman, banyak cara harus dilakukan Dinas Pendidikan Medan untuk mengangkat harkat dan martabat SMK di mata publik sebagai sekolah unggulan dan citra yang

sangat baik. Kedepan, kata Rahudman, seluruh jajaran institusi yang menangani pendidikan ini harus mampu melakukan berbagai terobosan dan program kerja, agar SMK lebih digemari oleh masyarakat luas sehingga nantinya menjadi pilihan utama bagi calon siswa-siswi. “Memang saat ini jumlah siswa SMK masih belum sebanding dengan SMA. Tercatat siswa SMK saat ini jumlah 33.000 orang sedangkan SMA sederajat mencapai 70.000 siswa. Inilah menjadi tantangan bagaiman siswa SMK kedepan harus lebih banyak lagi,” ujarnya. Rahudman didampingi Ketua DPRD Medan Amiruddin, Kadisdik Medan Hasan Basri, Kadisdik Sumut Syaiful Syafri, Wakil Ketua Tim Penggerak PKK Kota Medan Ny Dzulmi Eldin, Direktur UtamaTrans Kreasindo Production Didit Mahadi Kadar dan Kepada Bidang Kurikulum SMK Disdik Medan Zulhanif,

Kepala Bidang Pendidikan Masrul Badri, meninjau lokasi pameran SMK yang memadati pelataran parkir PRSU Medan. Rahudman juga melakukan interkasi dan dialog kepada kepala sekolah, siswa-siswi yang memadati stand dan lokasi pagelaran Gebyar SMK Kota Medan. Selain itu Walikota Rahudman Harahap didampingi Drs Hasan Basri MM bersama perwakilan dunia usaha CV Indako Trading Co, PT Suritama Mahkota Rencana, Tiara Hotel Medan, Wira Media Citra, PT Sumatera Utara Berlian Motor, Grand Aston City Hall, KPI, MUGI dan Telkomsel melakukan penandatangan MoU. Selama even Gebyar SMK 2010 berlangsung akan digelar kontes mekanik pada 11-13 November, table manner dan tata rias (12/11), lomba tari daerah tingkat SMP (12/11), lomba mewarnai TK dan pentas seni (14/11), lomba presentasi power point tingkat SMP (13/11). (h10)

Waspada/Surya Efendi

DIRIKAN LAPAK DI SUKARAMAI: Pekerja sedang mendirikan lapak sementara untuk menampung pedagang Pasar Sukaramai yang kiosnya terbakar beberapa waktu lalu, Kamis (11/11). Lapak sementara terbuat dari kayu dan papan, berdiri di badan Jalan AR Hakim– Jalan Sutrisno – Jl. Denai.

Pedagang Sukaramai Protes Kios Penampungan Dibangun Tak Punya Pintu MEDAN (Waspada): Ratusan pedagang korban kebakaran Pasar Sukaramai memprotes bentuk kios penampungan yang dibangun PD Pasar Medan karena tidak memiliki pintu dan membelakangi Jalan AR Hakim, sehingga mereka harus berjualan di belakang pedagang kaki lima (PKL). Menurut Ketua Pedagang Pasar Sukaramai Mardi Chan, Jumat (12/11), banyak pedagang menyampaikan protes kepadanya agar diteruskan kepada PD Pasar tentang bentuk kios penampungan yang

sedang dibangun sebanyak 120 unit di Jalan AR Hakim sekitar Pos Polisi. Saat ini sudah belasan kios yang dibangun PD Pasar bekerjasama dengan pihak kecamatan. Namun bentuknya meng-

hadap ke ruko yang di depannya telah ditempati PKL dan membelakangi jalan raya. Membahayakan Selain itu, kondisi kios yang tidak berpintu tersebut sangat membahayakan keselamatan barang dagangan milik pedagang karena penjaga malam akan kewalahan menjaga ratusan kios.“Jika barang dagangan harus dibawa pulang setiap hari seperti kain, sepatu, sayur mayur dan barang-barang klontong lainnya, maka akan menimbulkan biaya tinggi,” ujarnya. Terhadap keluhan tersebut

Tingkatkan Mutu Dan Kualitas PTS Kopertis Serahkan Izin Operasional


Walikota Medan Rahudman didampingi Kadisdik Hasan Basri dan perwakilan dunia usaha diabdikan bersama usai penandatangan MoU di Gebyar SMK di PRSU-Tapian Daya Medan Medan, Kamis (11/11).


Jangan Sepelekan Jamur Dan Alergi Pada Kulit MANDI dan gantilah pakaian Anda setiap hari. Jika tidak, siap-siaplah diserang penyakit kulit seperti tumbuhnya jamur di tubuh Anda, karena faktor yang menyebabkan si jamur ini tumbuh, adanya kelembapan yang tinggi di baju yang kita pakai. “Setiap hari kita berkeringat, apalagi panas terik. Jadi, segeralah mengganti pakaian yang lembabdanbasahtadi,”katadokter spesialis kulit dan kelamin RSUP H. Adam Malik Medan Kristo A. Nababan, kemarin. Kepada Waspada, Kristo menceritakan sedikit mengenai fungsi kulit, yakni sebagai pelindung, pengatur suhu dan sebagai indera perasa dan lainlain. Untuk itu, lanjutnya, menjaga kesehatan kulit sangatlah penting. “Jenis penyakit kulit juga banyak jenisnya, adanya penyakit kulit bersisik. Penyakit kulit ini tidak bisa sembuh seperti Januar (pasien penyakit

kulit-red), penyakit kulit ini bisa muncul lagi,” jelasnya. Untuk itu, lanjutnya, setiap orang harus membersihkan tubuh minimal dua kali sehari dan mengganti pakaian yang lembab karena keringat. Dengan begitu, media pertumbuhan jamur bisa dihilangkan. “Ada faktor dalam munculnya penyakit kulit, karena menurunnya daya tahan tubuh, penggunaan antibiotik yang tidak tepat atau memakan obat secara sembarangan,” ujarnya. Dokter kulit dan kelamin RSU dr. Pirngadi Medan Irwan Fachri Rangkuty juga menuturkan jenis penyakit lainnya, yaitu alergi yang terkait pada kulit atau disebut urtikaria. Menurutnya alergi merupakan suatu kelainan yang terjadi pada kulit yang tidak tahan pada bahan-bahan tertentu. Ada 2 jenis penyebab alergi, yaitu dermatitis kontak iritan

Waspada/Mursal AI

ANAMNESE: Dokter spesialis kulit dan kelamin RSU dr. Pirngadi Irwan Fachri Rangkuty (kiri) sedang melakukan anamnese (tanya jawab seputar penyakit-red) terhadap pasiennya di Ruang Poli Kulit RSU dr. Pirngadi Medan belum lama ini.

dan dermatitis kontak alergik. Dermatitis kontak iritan disebabkan efek kimiawi tertentu. Sedangkan dermatitis kontak alergik biasanya mengenai orang yang sensitif terhadap zat sehari-hari. Zat ini terdapat metal yang jika menempel pada kulit, terkadang menimbulkan alergi. Contoh, dari benda-benda yang mengandung zat tersebut antara lain perhiasan imitasi, karet, krim, salep, dan lainnya. Walaupun alergi merupakan penyakit yang umum dijumpai di tengah-tengah masyarakat, sampai saat ini kesadaran terhadap penyakit ini masih rendah. Padahal untuk mengatasi alergi diperlukan penanganan yang tepat sehingga alergi tidak menjadi penyakit yang akan menyebabkan timbulnya penyakit lain yang lebih berbahaya. Alergi itukan gatal, jika terus digaruk-garuk maka akan bernanah dan akan infeksi. Ini bisa berbahaya. Gejala-gejala alergi kulit atau urtikaria akan ditandai oleh bentol, kemerahan, dan gatal. Diperkirakan selama hidupnya sejumlah 15-25 persen masyarakat pernah mengalami urtikaria. Bila penyebabnya udah diketahui, maka hindari makanan atau benda penyebab timbulnya alergi kulit. Alergi memang bisa muncul kapan saja, karena pengobatannya hanya meringankan gejala dan mencegah, bukan menyembuhkan. Bahkan terkadang alergi kulit ringan tidak memerlukan pengobatan khusus. Gejala tersebut akan menghilang beberapa saat kemudian. * Mursal AI

MEDAN (Waspada): KopertisWilayah I Sumut-Aceh Zainuddin dalam hal ini diwakili Sederhana Sembiring menyerukan agar segenap Perguruan Tinggi Swasta(PTS)meningkatkanmutu dan kualitas masing-masing. Demikian disampaikan Sederhana yang juga Sekretaris Pelaksana KopertisWilayah I Sumut-Aceh dalam acara penyerahan izin operasional kepada 17 PTS yang telah memenuhi syarat di kantor Kopertis Wilayah I Jalan Setia Budi Tj Sari Medan, Jumat (12/11). Didampingi Kabag Akre-

ditasi dan Kelembagaan Abdulah Hari, Sederhana mengatakan perolehan surat izin operasional diberikan kepada PTS yang sudah memenuhi syarat antara lain melengkapi pelaporan semester (EPSBED). Kepada para PTS yang telah mendapatkan izin tersebut, Sederhana mengingkatkan agar meningkatkan mutu dan kualitas baik dari sektor dosen maupun mahasiswanya sekaligus taat kepada aturan-aturan yang sudah ditetapkan pemerintah. Selain itu, Kopertis Wilayah I juga menekankan pihaknya

terus memantau perkembangan PTS yang ada di wilayahnya serta memberikan pengarahan maupun bimbingan agar tercapainya kegiatan proses belajar mengajar yang baik plus terciptanya lulusan yang handal dan beretika. Salah satu dari penerima izin operasional itu adalah Sekolah Tinggi Ilmu Komunikasi “Pembangunan” (STIK-P) Medan. Kepada Waspada, Pembantu Ketua I Hj Nadra Ideyani Vita pun menyampaikan apresiasi kepada Kopertis Wilayah I Sumut-Aceh. (m33)

Waspada/Khairil Umri Batubara

Pembantu Ketua I STIK-P Medan Hj Nadra Ideyani Vita (kiri), menerima berkas izin operasional dari Kopertis Wilayah I Sumut-Aceh yang diwakili Sederhana Sembiring, Jumat (12/11).

pihaknya telah melaporkan secara lisan ke PD Pasar dan pihak kecamatan. Namun pihak kecamatan dan PD Pasar meminta agar pedagang bersabar dan berjanji akan melakukan pertemuan kembali dengan pedagang. Jika permintaan pedagang tidak diindahkan, lanjut Mardi, para pedagang siap membuka dinding belakang kios sehingga sisi depan akan menghadap ke jalan raya. Sedangkan pintu kios akan tetap dituntut kepada pihak PD Pasar agar segera dipasang. Kepala Pasar Sukaramai Juster Simarmata mengimbau para pedagang korban kebakaran agar bersabar karena kondisi kios penampungan saat ini sedang dibangun di Jln AR Hakim dan masih dalam tahap pengerjaan. “Mengenai pintu penutup kios tersebut masih dapat dibicarakan dan pihaknya berjanji kios yang dibangun tersebut dalam kondisi layak untuk ditempati pedagang sehingga tercipta keamanan menjalankan usaha,” ujarnya. Dana kas PD Pasar Sementara itu Direktur Umum dan Keuangan PD Pasar Maratua Simanungkalit menga-

takan, 120 unit kios yang dibangun tahap pertama saat ini menggunakan dana kas PD Pasar sebanyak Rp200 juta dan tidak menggunakan dana APBD dari Pemko Medan. Pengerjaan tahap pertama yang merupakan bagian dari rencana pembangunan 431 unit kios tersebut tidak dilakukan melalui tender pekerjaan karena dalam kondisi darurat akibat kebutuhan pedagang yang mendesak untuk berjualan secepatnya. “Sedangkan pengerjaan 311 unit kios penampungan lagi akan dibangun secepatnya melalui dana pinjaman dari Bank Sumut sebesar Rp700 juta lebih yang akan dikerjakan usai proses pencairan dan administarasi keuangan PD Pasar melalui Perubahan Rencana Kegiatan Anggaran Perusahaan (RKAP),” tambahnya. Pengerjaan 311 kios dilakukanmelaluitenderdenganrincian Rp600jutalebihuntukpengerjaan fisik bangunan sedangkan sisa pinjaman lainnya digunakan untuk proses administrasi, sosialisasidanpencabutannomor kios pedagang. (m40)

Pencuri Mesin Genset Dihajar Warga MEDAN (Waspada): Seorang remaja putus sekolah berinisial IS alias Samuel, 17, warga Jalan Tangguk Bongkar III, Kel. Tegalsari Mandala, Kec. Medan Denai, dihajar warga hingga babak belur, karena tertangkap mencuri mesin genset, Kamis (11/11) sekira pukul 16:30. Selanjutnya tersangka IS yang mencuri di rumah M Andri, 22, warga Jalan Gurila Ujung No 155, Kel. Sei Kera Hilir I, Medan Perjuangan, dijebloskan ke sel tahanan Mapolsekta Medan Timur, sedangkan kedua temannya berhasil melarikan diri. warga. Kejadian bermula, saat tersangka bersama kedua temannya dengan mengendarai beca bermotor (betor) mencari sasaran pencurian. Saatmelintas di Jalan Gurila Ujung, IS melihat mesin genset yang terletak halaman rumah mewah bercat kuning. Selanjutnya tersangka IS bersama seorang temannya mengendap masuk ke dalam rumah tersebut, lalu mencoba mengambil mesin genset itu. Namun, aksi keduanya keburu diketahui salah seorang warga diteriaki maling, sehingga mengundang massa dan langsung meringkus tersangka IS, sedangkan dua orang temannya yang identitasnya telah diketahui berhasil melarikan diri. Kapolsek Medan Timur AKP Patar Silalahi melalui Kanit Reskrim Iptu NA Simanjuntak mengatakan, tersangka IS kini menjalani pemeriksaan, karena dari pengakuannya akan diketahui identitas kedua kawannya yang melarikan diri itu. (cat)

Medan Metropolitan


WASPADA Sabtu 13 November 2010

Medan Utara

Diskriminasi Pembangunan Mulai Dari Buruknya Drainase PERSOALAN buruknya parit atau drainase, menjadi bahasan warga setiap hari yang hidup di empat kecamatan di wilayah Medan Utara, yakni Medan Labuhan, Medan Deli, Medan Marelan dan Medan Belawan; sebuah daerah yang dikerdilkan dengan diskriminasi pembangunan. Jika ditilik secara cermat, saat ini hampir semua drainase di kawasan Medan Utara bermasalah. Ada yang tumpat, rusak bahkan ada yang sudah rata dengan permukaan tanah akibat lama tidak disentuh pembangunan. Bahkan terdapat jalan yang belum memiliki parit seperti Jalan Yos Sudarso di kawasan Kelurahan Titi Papan. “Drainase sepanjang jalan mulai dari Medan hingga Belawan terputus-putus atau tidak menyatu. Semakin ke arah Belawan, drainase semakin hancur,” kata Camat Medan Deli Yusdalina, kemarin. Dari data yang dihimpun, daerah terparah yang selalu tergenang saat musim hujan adalah Kecamatan Medan Belawan disusul Medan Labu-

han, Medan Deli dan Medan Marelan. Medan Belawan Bahkan untuk Kecamatan Medan Belawan, hampir setengah daerah itu tergenang banjir jika musim hujan datang, seperti kawasan Kelurahan Belawan II, Sicanang dan Bagan Deli serta Belawan Bahagia. “Kami sekarang lebih baik diam. Sebab diadukan pun percuma. Pejabat sudah pekak. Mereka tidak bisa lagi mendengar kuluhan warga soal parit,” kata Jamaluddin warga Jalan Bandeng Kelurahan Belawan Bahagia. Medan Labuhan Untuk Kecamatan Medan Labuhan, daerah terparah sarana drainasenya di Kelurahan Besar, kawasan Simpang Kantor Kelurahan Pekan Labuhan dan Lingkungan II Kelurahan Sei Mati. Air yang tergenang bercampur air laut yang datang dari paluh. “Coba bayangkan kerugian kami akibat genangan air ini,” kata warga. Medan Deli Di Kecamatan Medan Deli, daerah terparah terdapat ada

di Kelurahan Mabar Hilir dan Kelurahan Tanjung Mulai. Bahkan jalan di daerah itu rusak parah sehingga pernah mengambil korban jiwa. “Jalan ini rusak karena selalu tergenang dan dilintasi kendaraan berat,” kata warga bermarga Simajuntak yang tinggal di Jalan Kayu Putih, Kelurahan Tanjung Mulai. Marelan Untuk Kecamatan Medan Marelan kawasan rawan banjir akibat parit bermasalah terdapat di Kelurahan Terjun dan Rengas Pulau. Sejumlah parit yang ada di kedua kelurahan itu banyak yang tumpat dan diperkecil untuk kepentingan pembanguan perumahan. Parit yang melintasi perumahan di belakang kantor camat itu diperkecil dan sejak perumahan itu daerah kami ini sering kebanjiran. Warga dan Muspika setempat sudah sering berusaha mengatasi masalah itu. Namun karena penanganannya tidak maksimal, air akan kembali mengenangi jalan dan rumah warga pada musim hujan berikutnya. “Inilah keadaan Medan

Utara sekarang, paritnya bermasalah di mana-mana,” ucap Nasir, warga Marelan. Klimaks dari permasalahan ini memunculkan kerusakan pada sejumlah ruas jalan, fasilitas umum, peralatan rumah tangga dan bangunan rumah serta kendaraan warga. Selain itu, kerugian dari sisi materi atau uang juga tidak terhitung.Warga terpaksa sering mencuci kendaraannya ke doorsmer setempat jika tidak ingin kendaraannya karatan. “Terkadang aku terpasa mencuci mobil ku satu kali selama tiga hari dengan harga Rp30 ribu sekali cuci. Kalau tidak kolongnya akan karatan karena bercampur luapan air laut,” ujar Amir, pegawai swasta di Belawan. Kecam Pemko Anggota DPRD Medan asal Belawan HT Bahrumsyah mengecam Pemko yang terkesan menutup mata terhadap permasalahan infrastruktur di Medan Utara. Sampai kini belum ada solusi yang sistematis terhadap persoalan ketimpangan pembangunan yang dirasakan

masyarakat Medan Utara dengan kecamatan di luar Medan Utara. Menurutnya, masyarakat tidak banyak menuntut dari pembangunan, asalkan parit dan jalannya baik, mereka sudah bersyukur. Kini, Pemko telah membuat rasa cemas dan kekaburan akan hak-hak masyarakat terhadap pembangunan. Misalnya, persoalan parit, tidak pernah tuntas dilakukan oleh Pemko dari masa ke masa dan sampai peralihan pemim-pin. Seharusnya, segera dilakukan perbaikan pada drainase primer yang dulu ada di sepanjang rel kereta api dan penyambungan alur parit agar mudah menuju Sungai Deli. Selain itu pembuatan drainase baru dengan ukuran yang jauh lebih besar dari yang ada sekarang. “Selama ini Pemko hanya melaksanakan proyek perbaikan parit. Padahal itu sudah ketinggalan dengan kondisi lingkungan dan pertumbuhan pendudukan dan lingkungan,” katanya. * Rustam Effendi

Rp100 M Dikhawatirkan Bocor Masyarakat Medan Utara Minta Bentuk Lembaga Pendamping MEDAN (Waspada): Masyarakat Medan Utara mengkhawatirkan bocornya dana bantuan APBN yang diterima Pemko sebesar Rp100 miliar untuk pembangunan perekonomian masyarakat berbasis budidaya perikanan (Minapolitan). Selain bocor, pengelolaan dana itu tidak tepat sasaran. Selama ini banyak kasus penggunaan anggaran yang tidak tepat digulirkan untuk masyarakat Medan Utara, seperti pengadaan 10 sampan bagi nelayan Belawan, pember-

dayaan lembaga masyarakat pesisir dan kredit karena tidak ada lembaga pengawas dan pendamping. Hingga kini semuanya tidak jelas. Padahal anggarannya menghabiskan

Pemprovsu Fokus Data Aset MEDAN (Waspada): Pemerintah Provinsi Sumatera Utara fokus melakukan inventarisir aset yang dimiliki. Bahkan, tahun ini ditargetkan seluruh aset Pemprovsu sudah memiliki sertifikat. Artinya, kepemilikannya jelas sehingga tidak menimbulkan gugatan yang mengakibatkan kehilangan aset tersebut. “Inventarisir ini terus dilakukan. Saat ini diprioritaskan mengenai kejelasan pemilikan aset yang ditandai dengan sertifikat hak atas tanah maupun bangunan,” kata Sekretaris Daerah Provinsi Sumatera Utara (Sekdaprovsu) RE Nainggolan kepada wartawan, Selasa (9/11). Menurut Nainggolan, inventarisasi akan bisa dirampungkan pada tahun ini. Pada tahun-tahun sebelumnya, lanjutnya, juga telah dipasang tanda berupa plank terhadap aset-aset yang dimiliki Pemprovsu.Pemasanganplankini,sebutnya,semakinmemperkuat kepemilikan Pemprovsu atas aset yang ada, tentunya dengan kelengkapan persyaratan dan dasar kepemilikan yang jelas. Ketika ditanyakan terkait gugatan Pemprovsu kepada Rahmat Shah terhadap kepemilikan aset, Sekda mengatakan, hal itu sepenuhnya telah dilimpahkan kepada Kejaksaan Tinggi Sumatera Utara (Kejatisu) sebagai kuasa hukum Pemprovsu dalam persoalan tersebut. (m19)

Kesbangpol-Linmas Dilatih Antisipasi Kerusuhan MEDAN (Waspada): Seluruh persoalan yang terjadi di tengah-tengah masyarakat harus dideteksi sedini mungkin, sehingga tidak menimbulkan gejolak yang akhirnya mengganggu suasana keamanan dan ketertiban masyarakat (Kamtibmas). “Dengan melakukan pendeteksian dini, maka persoalan yang seharusnya bisa menimbulkan gejolak, akhirnya bisa diredam,” kata Kepala Badan Kesatuan Bangsa Politik dan Perlindungan Masyarakat (Kesbangpol dan Linmas) Provinsi Sumatera Utara Darwinsyah seusai membuka acara Orientasi Dini, Deteksi Dini dan Cegah Dini bagi aparat Kesbangpol dan Linmas Provinsi, Kabupaten/Kota se Sumatera Utara di Hotel Royal Perintis Jalan Perintis Kemerdekaan Medan, kemarin. “Inilah tujuan dilaksanakannya acara ini agar Kepala Kesbangpol dan Linmas Kabupaten/Kota bisa melakukan upayaupaya deteksi sebelum timbul gejolak tersebut,” ujarnya. Terkait masalah ini, lanjutnya, pemerintah melalui Keputusan Menteri membentuk kelembagaan dengan masyarakat yakni Forum Komunikasi Deteksi Dini Masyarakat (FKDM) yang dibentuk hingga ke tingkat kelurahan/desa. Dengan adanya FKDM ini tentunya aparatur di Kesbangpol dan Linmas akan segera bertindak jika mendapatkan informasi dari FKDM dan bekerjasama untuk menuntaskan persoalan yang akan timbul. Sementara itu Kepala Bidang Pembinaan Kewaspadaan Nasional Kesbangpol dan Linmas Provinsi Sumut Kaiman Turnip menjelaskan kegiatan ini dilaksanakan selama tiga hari dimulai Rabu -Jumat (10-12) November diikuti seluruh Kesbangpol dan Linmas se Sumatera utara.(m39)

miliar rupiah. Kasus itu sempat ditangani Kejari Belawan tetapi penanganannya tidak tuntas. Program ini ketika itu dilaksanakan Wahid selaku Kepala Dinas Kelautan yang saat ini juga menjadi Kadis Dinas Pertanian dan Kelautan yang kembali akan mengelola anggaran dari pusat tersebut. Ketua Presidium Masyarakat Medan Utara Syaharuddin, kemarin, di Medan, meminta kepada Pemko untuk tidak memanfaatkan anggaran tersebut sebelum dibentuk lembaga-lembaga pendamping yang anggotanya harus diseleksi DPRD Medan. Jika tidak, lanjutnya, dana itu akan bocor ke kantong pejabat dan pemanfaatannya tidak tepat sasaran. “Kami menolak dana itu sebelum ada lembaga pendamping, karena hampir dapat dipastikan pengelolaanya tidak tepat sasaran.Dinasterkaitharusmempersiapkan sumber daya dan sistem regulasi yang mengawal program tersebut,” ujarnya. Dipanggil ke pusat Sebelumnya, Pemko khususnya Dinas Pertanian dan Kelautan Kota Medan mendapat suntikan dana dari APBN sebesar Rp100 miliar untuk pembangunan perekonomian masyarakat berbasis budidaya pe-

rikanan (Minapolitan) di Medan Utara. Program itu direncanakan mulai awal tahun 2011. “Kita baru dipanggil ke pusat oleh Kementerian PU Pusat yang meminta memprioritaskan sejumlah pembangunan yang diperlukan tahap pertama ini. Kita perkirakan akan dimulai pengerjaan fisik awal tahun depan dengan proses tender di pusat yang dimulai November tahun ini,” kata Kepala Dinas Pertanian dan Kelautan Medan Wahid kepada wartawan, Selasa (9/11), di Balai Kota Medan. Wahid menjelaskan, pihaknya sudah mengajukan sejumlah prioritas pembangunan berbagai sektor, yakni Perikanan Tangkap, Perikanan Budidaya dan Pengelolaan Hasil Perikanan di Medan Utara. Ketiga prioritas itu juga meliputi wilayah Pegatalan Nelayan Indah, Bagan Deli, Labuhan Deli, Sicanang hingga Belawan Bahari. “Kalau untuk Perikanan Tangkap akan kita mulai dari peninggian bantaran sungai dan beronjong sungai di Pegatalan, Nelayan Indah sampai Bagan Deli. Perikanan Budidaya akan dimulai merehab jembatan kayu dan beton ke arah tambak Labuhan Deli serta peninggian jalan beton,” ujarnya.

Fisik dikerjakan pusat Selain itu, lanjut Wahid, sekitar 400 hektar tambak udang di Sicanang akan mendapat bantuan rehab saluran irigasi tambak dan bubusan air melintang jalan di Belawan, Sicanang akan terealisasi. Untuk Pengelolaan Hasil Perikanan akan dilakukan rehab jalan dan rehab drainase di Belawan Bahari. “Semua pelaksanaan proyek itu bersumber dari Rp100 miliar lebih dari APBN dengan teknis pengerjaan fisik dilakukan Kementerian PU Pusat langsung dibantu tim Dinas Pertanian dan Kelautan. Sesuai Perpres 54/ 2010 tender bisa dilakukan dengan meng-gunakan anggaran 2011 itu di November tahun ini. Jadi, dapat kita pastikan pengerjaan akan dimulai tahun depan dan semuanya dari pusat. Kita tidak ada pegang anggaran Minapolitan ini,” katanya. Wahid juga menuturkan APBD Pemko 2011 juga akan bertambah Rp4,180 miliar yang bersumber dari Dana Alokasi Khusus (DAK) dari Kementerian Kelautan dan Perikanan RI. Selain itu, Distanla juga mendapat bantuan Tugas Pembantu (TP) dari pemerintah pusat untuk membeli dua unit kapal besar dengan anggaran Rp3 miliar dan Rp540 juta untuk budidaya perkotaan pada 2011. (cre/h10)

Khatib Idul Adha Diminta Serukan Peningkatan Ukhuwah MEDAN (Waspada): Kepala Kementerian Agama Provinsi Sumatera Utara Syariful Mahya Bandar, kemarin, meminta para khatib shalat Idul Adha agar dalam khutbahnya menyampaikan seruan peningkatan ukhuwah islamiyah. Hal ini dikatakannya serangkaian dengan penyambutan Hari Raya Idul Adha 1431 H diperkirakan jatuh pada 10 Zulhijjah mendatang. Syariful menyebutkan, bersamaan dengan Idul Adha ini umat Islam yang mampu hendaklah menyembelih hewan kurban, menjadikannya momen untuk meningkatkan ketaqwaan dengan memperbanyak takbir dan tahmid sejak

malam Idul Adha sampai dengan shalat ashar pada hari ketiga yangdisebutTasyrik(13Zulhijjah). Kemudian, lanjutnya, melaksanakan shalat Idul Adha pada 10 Zulhijjah di lapangan maupun di masjid dengan khusyuk dan tawaduk. Para khatib agar menyampaikan khutbah yang membawa kesejukan, menyerukan peningkatan ukhuwah islamiyah dan semangat berkurban serta kepedulian sosial membantu kaum duafa, juga menyerukan kaum muslimin untuk membantu saudara kita yang sedang ditimpa musibah gunung merapi maupun tsunami, kemudian berdoa agar bangsa ini dijauhkan dari berbagai musibah. Se-

lain itu, bagi yang melaksanakan takbir dan tahmid pada malam Idul Adha agar mempedomani peraturan penggunaan pengeras suara, agar suadara kita yang non muslim tidak terganggu, sehingga kerukunan umat beragama tetap harmonis. Dia juga mengingatkan agar kaum muslimin yang mampu agar berkurban dengan ikhlas mengharapkan ridho Allah membagikan daging kurban kepada masyarakat sekitar yang berhak, termasuk saudara kita yang di daerah sedikit penduduk muslimnya. Kemudian diharapkan untuk terus menumbuhkan semangat saling menghormati saat perayaan hari keagamaan. (m36)

Mahasiswa FIS Unimed Gelar Lomba Rakyat MEDAN (Waspada): Dalam rangka memperingati Hari Pahlawan 10 November 2010, Himpunan Mahasiswa Jurusan (HMJ) Pendidikan Sejarah Fakultas Ilmu Sosial (FIS) Universitas Negeri Medan (Unimed) menggelar berbagai perlombaan rakyat antar kelas di jurusan pendidikan sejarah, Rabu (10/11). Kegiatan yang bertema: “Perlombaan Rakyat Bernilaikan Historis” ini digelar di lapangan parkir auditorium dan FIS Unimed untuk menjalin kebersamaan dan silaturrahmi antar mahasiswa Jurusan Pendidikan Sejarah Unimed, serta membangkitkan rasa nasionalisme terhadap mahasiswa. Ketua HMJ Pendidikan Sejarah FIS Unimed Devika Rizki menyebutkan, kegiatan ini diikuti mahasiswa dari perwakilan kelas mulai dari stambuk 2008 sampai 2010. Perlombaan yang diadakan yaitu, lomba terompa, deklarasi puisi, penulisan katakata bijak sejarah, lomba makan kerupuk, lomba mengambil koin dalam tepung menggunakan mulut secara estafet, gerak jalan, memasukkan paku dalam botol dan sebagainya. Sementara itu, salah seorang mahasiswa, sangat antusias mengikuti kegiatan tersebut dan ikut ambil bagian dalam perlombaan memasukkan paku dalam botol. Dia mengaku sangat senang bisa menyemarakkan Hari Pahlawan Nasional ini dengan berbagai kegiatan perlombaan rakyat bernilai historis ini yang dapat menumbuhkan rasa nasionalisme. Karena dalam permainan ini dibutuhkan kerjasama dan kekompakan rekan-rekan mahasiswa. (m41)


Seorang mahasiswa mengikuti perlombaan mengambil koin dalam tepung, Rabu (10/11).

Waspada/ Rustam Effendi

DRAINASE di Jalan TM Pahlawan Kelurahan Belawan I mendangkal akibat jarang dikorek. Hampir seluruh paret di Medan Utara bermasalah yang mengakibatkan genangan air sering terjadi pada jalan dan lingkungan pemukiman warga. Foto diambil, Rabu (10/11).

Perubahan Arus Lalu Lintas Sebaiknya Dibatalkan MEDAN (Waspada): Jika rencana perubahan arus lalu lintas di seputaran Lapangan Merdeka tidak mempunyai kajian dan konsep yang sistematis, maka sebaiknya Pemerintah Kota Medan membatalkannya. Karena hanya akan menghamburkan anggaran. “Kita memang mendukung perubahan arus untuk mengurangi kemacetan di seputaran Lapangan Merdeka. Tapi, kalau hanya untuk coba-coba, maka sebaiknya dibatalkan saja,” kata Wakil Ketua Fraksi PAN DPRD Medan Bahrumsyah kepada Waspada, kemarin. Bahrum mengatakan, perubahan arus lalu lintas yang diprogramkan oleh Pemko sudah pasti disambut baik masyarakat, namun diharapkan dengan kajian atau konsep matang. “Jangan setelah dikritisi lalu membuat wacana yang sifatnya mendadak. Bila seperti ini dilakukan, maka dipastikan hasilnya tidak akan maksimal,” katanya. Menurut pengamatan Bahrum, kajian yang dibuat Pemko mengenai perubahan arus lalu lintas saat ini bisa dimungkinkan hanya mengatasi kemacetan yang sifatnya sementara, hasilnya juga akan tidak maksimal. “Yang kita butuhkan pengalihan arus lalu lintas itu bukan untuk

sementara, namun jangka panjang. Karena untuk program jangka pendek membutuhkan anggaran. Nanti kalau tidak cocok, maka dikembalikan lagi ke semula. Lalu buat wacana lagi yang selalu membuang anggaran,” ucapnya. Untuk itu, Bahrum mengungkapkan akan memantau rencana pengalihan arus tersebut. Adapun jalan-jalan yang hendak dialihkan adalah Jalan Raden Saleh dari mulai simpang Jalan Imam Bonjol sampai Jalan Balai Kota satu arah dari arah Barat ke Timur, Jalan Perdana mulai dari simpang Jalan Ahmad Yani sampai Jalan Imam Bonjol satu arah dari arah Timur ke Barat, Simpang Jalan Ahmad YaniVII sampai Jalan Perdana satu arah dari Utara ke Selatan, Simpang Jalan AhmadYani sampai Jalan Hindu satu arah dari Timur ke Barat. Selanjutnya, Jalan Balai Kota sampai Jalan Gudang satu arah dari Barat ke Timur, Jalan Gudang mulai dari Jalan HM Yamin sampai Jalan Perintis Kemerdekaan satu arah dari Selatan ke Utara, Jalan Perintis Kemerdekaan mulai dari Jalan Putri Hijau sampai Jalan Gudang satu arah mulai dariTimur ke Barat. Sebelumnya, Walikota Medan Rahudman Harahap menegaskan, perubahan arus lalu lintas dimulai pada 20 November. (h10)


Dai kondang Jefri Al Buchori berkunjung lokasi pengungsian merapi beberapa waktu lalu.

Extra Joss Kurban Rp1 M Serentak Di 100 Kota Sumbagut Di Delapan Kota MEDAN ( Waspada): Menyongsong datangnya hari raya Idul Adha 1431 Hijriyah, Extra Joss memberikan kurban sapi dengan total nilai Rp1 milliar secara serentak di 100 kota di seluruh Indonesia. Untuk wilayah Sumatera Bagian Utara, produk minuman energi yang berada di bawah naungan PT Bintang Toedjoe itu memberikan hewan kurban di delapan kota, Medan, Lubukpakam, Stabat, Kisaran, Pematangsiantar, Padangsidimpuan, Meulaboh dan Banda Aceh. Penyerahan sapi kurban jenis brahmana itu dilakukan secara simbolis Regional Sales Manager PT Bintang Toedjoe Sumut Sunaryo Wijaya kepada Pengurus Mesjid Agung Jami’ di Lubukpakam Deliserdang, Jumat (12/11). Turut hadir Arena Manager Medan PT. Bintang Toedjoe, Sugeng Hariadi, Anggota DPRD Deliserdang Latif Khan dan sejumlah tokoh agama dan masyarakat Deliserdang lainnya. Sugeng Hariadi dalam sambutannya mengatakan, program kurban sapi senilai Rp1 milliar tersebut merupakan rangkaian kegiatan kemanusiaan Extra Joss yang bertema Asah hati, Asah Semangat. Selain kurban, kata Sugeng, Extra Joss juga membangun posko-posko kesehatan dan menyalurkan bantuan sandang, pangan dan obat-obatan bagi para korban Letusan Gunung Merapi, banjir di Warsior dan Tsunami di kepulauan Mentawai. Dia juga mengajak masyarakat untuk mendoakan para korban bencana alam tersebut. Selain itu, tambahnya, Extra Joss juga memberikan bantuan beasiswa kepada mahasiswa korban bencana di tiga daerah itu. “Keseluruhan bantuan tersebut diperoleh dari menyisihkan sebagian hasil penjualan produk minuman energy Extra Joss dari 26 Oktober sampai 17 November 2010,” katanya. Menanggapi penyerahan kuban itu, anggota DPRD Deliserdang yang juga seorang penceramah Latif Khan dalam tausyiah singkatnya mengatakan, banyaknya bencana alam yang terjadi di Indonesia sebenarnya disebabkan ulah tangan-tangan manusia itu sendiri, seperti banjir di Warsior. Karena itu, menurut Latif Khan, hari raya Idul Adha harus dijadikan momentum untuk


Regional Sales Manager PT Bintang Toedjoe Sumut, Sunaryo Wijaya menyerahkan secara simbolois sapi kurban kepada Pengurus Mesjid Agung Jami’ di Lubukpakam Deliserdang, Jumat (12/11). mewujudkan kepedulian terdapat sesama umat manusia, terutama dalam hal saling memberi. Sementara Ketua Panitia Kurban Mesjud Agung Jami’ Lubukpakam, Ustad Helmi, dalam sambutannya mengucapkan terima kasih kepada Extra Joss yang telah menyumbangkan salah satu hewan kurban di masjid tersebut. Jamin sapi kurban sehat Sebelumnya, Humas Extra Joss, Aydi Jaya dalam siaran persnya kepada Waspada mengatakan, penyembelihan sapi kurban di 100 kota itu nantinya akan dilakukan ulama setempat. Kemudian dagingnya langsung dibagikan kepada masyarakat. Dia menjamin, sapi-sapi yang diserahkan Extra Joss itu telah memenuhi kriteria untuk dijadikan hewan kurban, seperti cukup dewasa dan kesehatannya sudah diteliti oleh dokter hewan dari dinas perternakan. Selain memberikan kurban, kata Aydi, mereka juga sudah mendatangkan dai kondang Jefri Al Buchori ke lokasi pengungsian merapi di Stadion Maguwoharjo Sleman, yang diharapkan mamapu menguatkan iman dan semangat korban letusan Merapi. (h11/rel)

Medan Metropolitan

WASPADA Sabtu 13 November 2010

Hari Ini IKMT Gelar Donor Darah MEDAN (Waspada): Ikatan Keluarga Muslim Taman Setia Budi Indah (IKMT) menggelar bakti sosial berupa donor darah bertempat di Polimas Kompleks Taman Setia Budi Indah (Tasbih) hari ini (Sabtu, 13/11). “Donor darah yang dilaksanakan setiap 3 bulan sekali ini merupakan kerjasama Hiwasbi, Arek-Arek Suroboyo dan warga Kelurahan Tanjung Rejo, Kecamatan Medan Sunggal,” kata dr. Syamsul A Nasution, SpOG di damping dr. Asfawati (Polimas), Cak Wiluyo (Arek Suroboyo) dan Agus Hadiono (Kelurahan Tanjung Rejo) kepada wartawan di Medan, Kamis (11/11). Syamsul mengharapkan para pendonor terdahulu bisa ikut kembali mendonorkan darahnya dan membawa rekan-rekan lainnya sebagai pendonor pemula. “Orang yang bisa mendonorkan darahnya, merupakan orang-orang yang sehat,” katanya. Sementara itu, Ketua IKMT Habib Nasution mengatakan, kegiatan donor darah ini sudah berlangsung selama 10 tahun dan akan terus dipertahankan. “Donor darah di Polimas Tasbih ini bertujuan untuk membantu sesama dan dimulai pukul 09:00 hingga 12:00,” ujar Habib di damping Sekretaris IKMT Khairul Mahalli.(m26)

Kepsek TK Minta Perlindungan Hukum MEDAN (Waspada): Kepala Sekolah Taman Kanak-kanak (TK) Anugrah Cemerlang, Sondang boru Saragih, 32, warga Jalan Bersama, Pasar III, Sunggal, mendatangi Mapolda Sumut meminta perlindungan hukum, terkait rencana penjualan Yayasan Anugrah Cemerlang, Rabu (10/11). Didampingi LSM Pusat Kajian dan Perlindungan Anak (PKPA) Sumut, Sondang diterima penyidik Unit Perlindungan Perempuan dan Anak (UPPA) Direktorat Reskrim Poldasu, Siti Ani boru Purba. Kepada penyidik, Sondang mengaku telah diintimidasi pihak PT EJS Agro Mulya Lestari yang mengklaim lahan yayasan seluas 19.000 meter. Bahkan, dia mengaku diminta mundur dari pengurusan TK Anugrah Cemerlang yang dipimpinnya sejak Oktober 2009-2010. “Selain diusir, saya juga diintimidasi untuk segerapindahhinggabataswaktupertengahanNovember,”ujarnya. Kasus ini bermula rencana menjual yayasan senilai Rp8 miliar lebih oleh tiga warga Korea (Park Myung Rul, Lee Myung Su dan Park Lee), yang mengaku pemilik yayasan. Namun guruguru dan orangtua murid menolak penjualan itu, sampai anakanak TK tamat. Namun itu tidak dihiraukan PT EJS sehingga terjadi kekisruhan. Sondang juga sempat dihadang beberapa petugas sekuriti yang sengaja didatangkan pihak yayasan. Dalam peristiwa itu, Sondang sempat dipegangi, namun karena protes terus akhirnya dilepas. “Saya dilarang masuk sesuai instruksi yayasan dan pimpinan PT EJS Agro Mulya Lestari. Saya diperlakukan kasar, padahal kesepakatan minggu lalu tidak ada lagi intimidasi terhadap guru-guru dan anak-anak diberi kenyamanan untuk belajar,” ujarnya.(m11)

Pencuri Kritis Dipukuli Massa MEDAN (Waspada): Seorang pencuri kritis dengan kondisi luka sobek di bagian kepalanya akibat dipukuli massa karena kepergok beraksi di rumah salah satu warga Jalan Tuamang Medan Tembung, Kamis (11/11) pagi. Pria yang belum diketahui identitasnya itu segera dilarikan ke Rumah Sakit Marthondi. Karena luka yang cukup parah, selanjutnya pria yang diperkirakan berusia 30 tahun tersebut dilarikan ke RS Bhayangkara oleh polisi. Kapolsekta Percut Seituan AKP M Simanjuntak mengatakan, pihaknya belum bisa memeriksa sekaligus memintai keterangan dari tersangka karena kondisi kesehatannya yang melemah dan terlalu banyak mengeluarkan darah dari bagian kepalanya. “Pelaku masih lemah dan terpaksa dibawa ke RS Bhayangkara untuk mendapat perawatan serius. Sedangkan identitas pelaku belum diketahui karena belum bisa diperiksa,” katanya AKP M Simanjuntak. (cat)

Waspada/Andi Aria Tirtayasa

Pelaku pencurian yang kepergok warga dan menjadi korban amuk massa terlihat terbaring lemah di kursi plastik sesaat akan dievakuasi ke rumah sakit, Kamis (11/11) sore.

Pembobol ATM Majikan Dibekuk MEDAN (Waspada): Mantan sopir sejumlah perwira Polri berinisial BIA, 25, dan seorang rekannya yang diduga terlibat kasus pembobolan ATM milik majikannya senilai Rp150 juta diamankan petugas Polsekta Medan Helvetia dari rumahnya Jalan Matahari Raya, Gg Solo, Kelurahan Helvetia Tengah, Selasa (9/11) siang. Selain mengamankan BIA, polisi juga menyita barang bukti berupa tanda pangkat Briptu, simbol Den Gegana, simbol Polri, simbol Taruna Polri tingkat III, topi perwira menengah, topi pet, empat pasang pakaian dinas, dua pasang pakaian olahraga Polri, sarung senjata api, senjata api mainan beserta enam butir peluru asli, gari (borgol), sepasang sepatu PDH dan lainnya. Kapolsekta Medan Helvetia AKP Sutrisno Hadi S didampingi Kanit Reskrim Iptu Zulkifli Harahap mengatakan, terkuaknya kasus ini berdasarkan informasi dari masyarakat bahwa BIA memiliki pakaian dinas Polri dan senjata api lengkap dengan amunisinya. Petugas melakukan penyelidikan selama tiga hari. Setelah mengetahui BIA berada di kediamannya, polisi langsung melakukan penggerebekan sekaligus mengamankan pria tersebut serta menyita sejumlah barang bukti. (m31)

Dihamili Mengadu Ke Polisi

APBD Dihamburkan Alokasi Anggaran Dewan Untuk ‘Pelesiran’ MEDAN (Waspada): Sekretaris Eksekutif Forum Indonesia untuk Transparansi (Fitra) Elfenda Ananda menyayangkan DPRD Medan yang lebih banyak mengalokasikan anggaran APBD untuk biaya ‘pelesiran’. Kondisi itu membuktikan politik anggaran wakil rakyat itu tidak berpihak kepada rakyat. “Kelihatan sekali DPRD tidak merasakan kepekaan sosial terhadap apa yang dialami masyarakat sekarang. Jadi, apa yang biasa disampaikan dewan dalam kampanye dan berbagai kegiatan lainnya, sangat kontradiktif dengan kenyataannya,” kata Elfanda kepada Waspada di Medan, Jumat (12/11). Menurut Elfenda, di saat himpitan ekonomi masyarakat yang semakin berat, ditambah kewajiban pembayaran pajak dan retribusi, seharusnya anggota dewan tidak mengalokasikan APBD untuk kegiatankegiatan studi banding yang sifatnya hanya ‘pelesiran’. Anggota dewan lebih baik mengalokasikan anggaran APBD untuk program-program yang bisa menjadi stimulus pembangunan ekonomi masyarakat. Apalagi menurutnya, kegiatan studi banding merupakan pemborosan, karena memang kegiatan itu tidak bisa diukur keberhasilannya. “Sebaiknya dewan menggantinya dengan program yang sifatnya sama-sama untuk menambah pengetahuan mereka, tapi lebih efisien dan efektif. Seperti memanggil langsung para ahli sehingga anggarannya tidak begitu besar,” kata Elfenda. Menurutnya, anggota DPRD semakin merusak citra legislatif, baik tingkat pusat dan daerah di Indonesia yang saat ini sudah rusak karena begitu banyaknya pemberitaan di media massa. “ Itu juga bukan medianya yang salah tapi memang kelakuan anggota dewannya yang me-nyalah,” sindirnya.

Elfenda mengatakan, sebenarnya besaran alokasi anggaran untuk kegiatan-kegiatan pemborosan sering dijumpai dalam penyusunan APBD di seluruh daerah di Indonesia. Bahkan sampai dalam penyusunan APBN. Hal itu, lanjutnya, dikarenakan proses penyusunan anggaran yang selama ini memang tidak terbuka sehingga memudahkan anggota dewan melakukan tawar-menawar dalam pengalokasian anggaran yang akhirnya sarat kepentingan pribadi. Separuh dihamburkan Sementara itu, tahun anggaran 2011, DPRD masih tetap berfokus pada penghamburhamburan dana. Buktinya, dari Rp21,9 miliar total anggaran sekretariat DPRD, lebih separuh digunakan untuk biaya‘pelesiran’ 50 anggota dewan. Kamis (11/11), Waspada memperoleh data anggaran sekretariat DPRD dari buku Kebijakan Umum Anggaran (KUA) APBD Medan tahun 2011, yangkinisedangdibahasbersama antara dewan dengan Pemko. Dari rencana APBD tahun 2011 senilai Rp2,8 triliun lebih, nilai anggaran sekretariat DPRD memang sangat kecil. Terlebih, dana untuk membiayai pelesiran anggota dewan yang lebih dari Rp11 miliar. Namun, dilihat dari peruntukannya, terkesan dana yang disusun murni untuk dihambur-hamburkan, karena program yang dilaksanakan tidak berbeda dengan tahun sebelumnya. Dari lebih Rp11 miliar dana yang dialokasikan untuk mendukung tugas-tugas dewan,

hanya dana kegiatan reses yang dinilai wajar, yakni Rp2,250 miliar. Disebutkan wajar, karena reses merupakan kewajiban yang harus dilakukan masingmasing anggota dewan sesuai peraturan. Dalam satu tahun anggaran, anggota dewan melakukan reses empat kali. Sama seperti tahun anggaran lalu, tahun ini dewan masih juga memasukkan biaya studi banding mereka yang nilainya Rp5,1 miliar. Artinya, dalam setahun setiap anggota dewan mendapat alokasi dana untuk pelesiran Rp100 juta lebih. Pertanyaannya adalah, daerah mana lagi yang akan dikunjungi para anggota DPRD Medan itu pada tahun depan? Judul lain Tidak berhenti sampai disitu, kegiatan jalan-jalan dewan masih juga dianggarkan dengan judul lain, yakni peningkatan kualitas pimpinan dan anggota DPRD senilai Rp2,7 miliar. Selain itu ada juga anggaran untuk bimbingan teknis implementasi peraturan perundang-undangan Rp611,7 juta. Kunjungan kerja pimpinan dan anggota DPRD di dalam kota juga dibayar. Untuk tahun 2011, anggarannya ditampung Rp900 juta. Selain itu masih ada beberapa item lagi pengeluaran anggaran yang tujuan akhirnya tidak jelas dan terkesan hanya untuk menghabiskan anggaran saja. Wakil Ketua DPRD Medan Ikrimah Hamidy yang ditanya wartawan di ruang kerjanya, Kamis (11/11), berusaha menjawab penggunaan seluruh anggaran itu wajar. Misalkan saja untuk dana yang paling disoroti publik, studi banding. Ikrimah, mengakui, logikanya setiap tahun dana studi banding makin berkurang, karena telah dilakukan pada tahun sebelumnya. Studi banding pada tahun ini, hanya melengkapi saja daerah-daerah yang belum sempat dikunjungi tahun sebelumnya. (h11/m17)

Pasca Bentrok Mahasiswa IAIN Islah MEDAN (Waspada): Pasca terjadinya bentrokan antara dua kelompok mahasiswa di Institut Agama Islam Negeri (IAIN) Sumatera Utara, kondisi kampus tersebut tetap aman dan kondusif. Bahkan kedua kelompok tersebutsudahmelakukanperdamaian dan tidak akan mengulangi terjadinya peristiwa itu. Pembantu Rektor III Lahmudin Lubis, Jumat (12/11), menyebutkan, kedua kelompok tersebut seusai bentrok langsung melakukan islah (perdamaian) dan menyatakan menyesal atas peristiwa tersebut. “Setelah datangnya pihak senior mahasiswa masing-masing termasuk alumni dari IAIN, setelah bertemu sore itu juga mereka menyatakan islah dan berjanji untuk saling memperbaiki dan menyesal atas kejadian itu,” katanya. Dia menyebutkan, Insya Allah peristiwa itu tidak akan

terjadi lagi. Bahkan kemarin malam pihaknya bertemu dengan beberapa mahasiswa dan mudah-mudahan tidak ada kejadian yang tidak diinginkan tersebut terjadi lagi. “Bahkan pada hari ini (Jumat-red) situasi IAIN tetap tenang dan dipantau tidak ada mahasiswa yang melakukan aksi,” jelasnya. Mengenai sanksi yang akan diberikan kepada mahasiswa yang dinilai melakukan pelanggaran tata tertib kampus IAIN, Lahmudin mengatakan, saat ini pihaknya akan mempelajari kasus tersebut, dan akan memanggil pihak-pihak yang terlibat dalam waktu dekat untuk dimintai keterangannya bagaimana peristiwa itu bisa terjadi. “Kita tidak mau akan berbuat sesuatu tanpa tahu persis apa yang sebenarnya terjadi, makanya kita akan pelajari dulu dan kalau memang benar-

benar terbukti bersalah sesuai dengan aturan yang berlaku, kita akan tindak. Seperti peringatan secara lisan, tertulis, mendatangi orangtua mahasiswa, bahkan sampai pemecatan (drop out). Selanjutnya kalau merusak aset IAIN yang merupakan aset negara, bisa ditindak berdasarkan hukum,” tegasnya. Sementara itu, Humas IAIN SU, Dra. Zainarti, MA menyebutkan, untuk melakukan penyidikan terhadap mahasiswa yang terlibat bentrok tersebut, pihak rektorat menyerahkan hal tersebut kepada masing-masing fakultas yang difasilitasi oleh para Pembantu Dekan (PD) III. Seperti diketahui, peristiwa tersebut terjadi pada saat pelaksanaan acara pengukuhan lima guru besar IAIN-SU di aula kampus tersebut, Jalan Willem Iskandar Medan Estate, Kamis (11/11). (m41)


SELEKSI CPNS BPN: Sejumlah peserta ujian melihat nomor ujian CPNS di lingkungan Kantor Badan Pertanahan Nasional Sumut di Jalan Sultan Ma’mun Al Rasyid, Kamis (11/11). Mereka ini dinyatakan lulus seleksi administrasi untuk mengikuti ujian hari ini Sabtu (13/11) di gedung serbaguna Tapian Daya Jalan Gatot Subroto Medan.

Habiskan Masa Tua Di Terali Besi BERDALIH menambah penghasilan dari jurtul togel, seorang kakek berinisial Sy, 67, warga Komplek Asrama Kowilhan Medan, bakal menghabiskan masa tuanya di balik tembok terali besi. Pasalnya Purnawirawan TNI ini diringkus petugas Sat Reskrim Polsek Medan Timur karena nekat menjadi juru tulis togel, Kamis (11/11) sore, di satu warung di Jalan HM Said Gang Kacung Medan. Tidak hanya Sy, pembelinya IA, 45, warga Jalan Letda Sujono Gang Becek, Medan Tembung, juga diringkus polisi karena tertangkap tangan saat memasang judi togel. Kinikeduanya diboyong ke Mapolsek Medan Timur untuk menjalani pemeriksaan. Jurtul dan pembeli judi togel ini diringkus polisi, Kamis (11/11) sekira pk 15:00 wib dari sebuah warung di kawasan Jalan HM Said, Gang Kacung, Kel. Sidorame Barat I Medan. Awalnya polisi menerima informasi di Gang Kacung Medan ada seorang pria tua yang menjadi juru tulis togel. Berbekal informasi singkat itu, polisi lalu melakukan penyelidikan. Hasilnya ternyata benar, Kamis sore, polisi menggrebek sebuah warung yang dijadikan sebagai sarang judi togel. Sy tertangkap basah saat melayani IA memasang judi tebak angka itu. Dari tangannya, polisi

menyita sejumlah barang bukti berupa, 1 HP, pulpen serta kertas rekapan judi togel. Guna pemeriksaan, jurtul dan pembeli judi togel tersebut diboyong ke Mapolsek Medan Timur. Di kantor polisi, tersangka Sy mengaku sudah dua bulan menjadi juru tulis togel . Aku sudah dua bulan jadi jurtul togel, dan setiap kali putaran aku memperoleh 20 persen dari jumlah omset yang aku dapat,” aku Sya di kantor polisi. Sy mengaku gaji pensiun yang setiap hari diperoleh tak mencukupi sehingga mencoba mencari penghasilan tambahan sebagai juru tulis togel. Sementara tersangka IA mengaku saat ditangkap dirinya tengah memasang judi togel. “Saat itu aku sedang memasang angka togel, tiba-tiba polisi datang menggrebek,” kata IA sembari mengatakan jika dirinya kerap memasang judi togel dengan tersangka Sy. Kapolsek Medan Timur AKP Patar Silalahi melalui Kanit Reskrim Iptu NA Simanjuntak ketika dikonfirmasi mengatakan Kedua tersangka masih menjalani pemeriksaan. “Jika terbukti, keduanya dijerat dengan pasal 303 KHUP tentang perjudian dengan ancaman hukuman di atas 5 tahun penjara,” jelas Iptu NA Simanjuntak. (cat)

Unpab Dukung Peduli Sadarilah MEDAN (Waspada): Universitas Panca Budi (Unpab) menyambut baik program peduli lingkungan yang digagas Kepala Badan Lingkungan Hidup Kota Medan Ir Purnama Dewi, MM dalam acara sosialisasi Sadarilah (Safari Daur Ulang Limbah), di Kompleks Unpab, Jumat (12/11). Bentuk dukungan Unpab terhadap program ini ditandai dengan penandatanganan MoU kerjasama penanganan lingkungan antara Dekan Fakultas Pertanian Ir Marahadi Siregar dan kepala Badan Lingkungan Hidup Purnama Dewi MM. Sosialisasi Sadarilah yang memasuki tahap akhir ini, selain dihadiri organisasi Komapal (Korps Mahasiswa Pecinta Lingkungan) juga turut diikuti para mahasiswa lain di kampus Unpab. Acara yang digagas oleh Kepala Lingkungan Hidup Ir Purnama Dewi mendapatkan sambutan positif dari pihak Unpab. Ini dapat dilihat dari adanya penandatanganan MoU antara Kepala Dinas Lingkungan Hidup kota Medan Purnama Dewi dan Dekan Fakultas Pertanian Unpab Ir Marahadi mengenai

penanggulangan permasalahan lingkungan yang harus lebih diperhatikan karena masih minimnya kesadaran terhadap kelestarian lingkungan. Tampil sebagai pembicara pada acara tersebut, Guru Besar USU Prof DR Ir Abdul Rauf MP, Ketua Hayati Drs Marwan Harahap dan praktisi lingkungan Hidup yang dikenal juga si Ratu Sampah Dewi Teruna Jasa Said. Acara yang dimulai dengan penadatanganan MoU oleh Kepala Badan Lingkungan Hidup Ir Purnama Dewidan Dekan Pertanian Unpab Ir Marahadi mengenai penanggulangan permasalahan lingkungan. Purnama Dewi menjelaskan, Unpab merupakan salah satu contoh universitas yang berbasis lingkungan dan Islami ini terlihat dari peraturan dan sanksi yang diberikan kepada pelajar yang kedapatan membuang sampah sembarangan ataupun merokok dikawasan Unpab. Pada kesempatan itu juga Badan Lingkungan Hidup Kota Medan menyerahkan bibit pohon, tong sampah, bor biopori kepada Unpab. (m41)

Tabur Bunga Di Laut BELAWAN ( Waspada): Pangkosek Hanudnas III Medan Marsekal Pertama TNI Chaeruddin Ray bertindak sebagai inspektur upacara tabur bunga Hari Pahlawan 10 November 2010 di Perairan Bouy I, Belawan, Rabu (10/11). Peserta upacara bertolak dari dermaga Lantamal I Rabu (10/11) pagi sekitar pukul 07.00

dengan menggunakan KRI Tarihu 824 yang dikomandoi Kapten Laut (P) Pantun Ujung, menuju Perairan Bouy I Belawan Upacara berlangsung khidmat tanpa ada kata sambutan di geladak KRI Tarihu 824. Bertintak selaku Komandan Upacara Kadisminpers Lantmal I Letkol laut (P) Ganda Permana. Hadir sejumlah Muspida

Plus Sumatera Utara dan Komandan Lantamal I diwakili Wadan Lantamal I Kolonel Marinir Suprayogi, Asop Danlantamal I Kolonel Laut (P) Tri Satriya Wijaya, Aspers Danlantamal I Kolonel Laut (P) Budi Jatmiko, Adpel Belawan Roesman Husen, Dirpol Air Sumut Kombes Thomas dan GM BICT di wakili Asmen Humas Suratman. (cre)

MEDAN (Waspada): Hermina Bawemene, 22, warga Jalan Mekatani, Desa Marendal, Kec. Patumbak, mengadukan kekasihnya berinisial Ar, 35, warga yang sama ke Polsekta Delitua, Rabu (10/11) sore, karena tidak bertanggungjawab atas kehamilannya. Dalam pengaduannya ke Polsekta Delitua, Hermina ditinggal pergi Ar. Padahal Ar sudah menghamili korban empat bulan. Bahkan, saat korban meminta pertanggungjawaban kekasihnya itu, dia menghilang dari rumahnya. Akhirnya korban mengadukan Ar ke Polsekta Delitua. Kanit Reskrim Polsekta Delitua Iptu S Sembiring mengatakan, korban masih menjalani pemeriksaan sekaligus akan memanggil saksi-saksinya. (cat)

Suami Istri Dianiaya MEDAN (Waspada): Gara-gara menegur agar mengurangi volume suara yang ditimbulkan pengunjung pakter tuak, Parulian Sinurat, 29, dan istrinya Rita Br Pandiangan, 31, dianiaya pemilik pakter tuak dan keluarganya di Jalan Punak Lorong Nauli, Kel. Sei Putih Timur I, Kec. Medan Petisah. Menurut Rita Br Pandiangan, Senin (8/11), pihaknya dianiaya pemilik pakter tuak maupun pengunjung di depan rumahnya sendiri, bahkan pagar rumah mereka terbuat dari bambu roboh. Tidak senang atas penganiayaan tersebut, korban membuat pengaduan ke Polsekta Medan Baru. Kapolsekta Medan Baru AKP Saptonoakan mengusut kasus ini dan sudah ada saksi dimintai keterangannya. (m31)


Waspada/Rustam Effendi

TABUR BUNGA: Pangkosek Hanudnas III Medan Marsekal Pertama TNI Chaeruddin Ray melepas pelarungan atau tabur bunga ke laut dalam rangka Hari Pahlawan, Rabu (10/11).


FOTO BERSAMA: Kaban Lingkungan Hidup Medan Ir Purnama Dewi, MM bersama Dekan Fakultas Pertanian Unpab Ir Marahadi Siregar foto bersama usai dilaksanakan sosialisasi Safari Daur Ulang Limbah (Sadarilah) di kompleks Unpab, Jumat.

Polda Belum Tahan Gindo MEDAN (Waspada): Penyidikan dugaan korupsi senilai Rp38,8 miliar di Dinas Bina Marga Medan ketika dipimpin Kadis Gindo Maraganti Hasibuan tampaknya belum ada kemajuan. Sejak kasus itu bergulir pada pertengahan tahun 2009, belum ada tanda-tanda tersangka akan ditahan. Sementara, Kabid Humas Poldasu Kombes Pol. Baharudin Djafar ditanya kasus itu mengatakan, penyidik masih menunggu hasil audit Badan Pemeriksa Keuangan dan Pembangunan (BPKP) Sumut. “Masih menunggu terus dari BPKP,” kata Bahruddin kepada wartawan di Mapoldasu, kemarin. Dia membantah penyidikan kasus tersebut tidak ada kemajuan, karena menurutnya, Tipikor telah melakukan pemeriksaan ulang terhadap Gindo Hasibuan selaku Kuasa Pengguna Anggaran, Ahmad Buhari Siregar sebagai Pejabat Teknis Kegiatan (PPTK), Utuh Januar Sitompul, Mardian Habibi Gultom, Suwito dan Gindo Purba serta Ketua Panitia Pemilihan Langsung (PL) Eddy Zalman Saputra. Sebelumnya, Penyidik Tipikor dan BPKP juga sudah melakukan audit investigasi dengan turun langsung ke lapangan guna mengetahui

kondisi proyek normalisasi/pemeliharaan saluran drainase/gorong-gorong, dengan sumber dana P- APBD tahun 2009. Penyidik juga menyita barang bukti dokumen dari 9 rekanan terkait proyek itu, dimana diketahui proyek dibagi menjadi 495 paket yang terletak di 21 kecamatan di Medan, dengan pagu sebesar Rp38.810.760.150.“Namun yang dikerjakan dinas Bina Marga hanya 436 paket yang tertuang dalam dokumen penggunaan anggaran,” ujarnya. Polda juga telah mewawancarai tertulis terhadap tujuh subjek (terlapor) yang dianggap bertanggungjawab dalam pengerjaan proyek. Penyidik juga telah mengumpulkan sejumlah dokumen seperti fotocopy surat perjanjian kontrak, surat pengangkatan Kuasa Pengguna Anggaran (KPA), PPTK dan Panitia Pengadaan Barang dan Jasa. Dalam pengerjaan proyek yang dilakukan dengan penunjukan langsung (PL) itu, penyidik menemukan keterlibatan 9 perusahaan dalam pengerjaan proyek tersebut, yaitu, CV Rahmat Abadi, CV Mustika Cemerlang, CV Rifki Faldo Abadi, CV Surya Gemilang, CV Mitra Anugrah, CV Rahmat, CV Wiraspati Kencana, CV Sumber Rezeki dan UD Perdana. (m11)



WASPADA Sabtu 13 Nopember 2010

Universitas Dan Kerjasama Internasional TAJUK RENCANA

Buruh Menunggu Upah Layak


erwakilan pengusaha, pekerja dan pemerintah provinsi Sumut sepertinya sudah punya deal di angka berapa upah minimum provinsi akan ditetapkan. Jika mengikuti kata hati pengusaha maka upah tak perlu naik. Namun jika mendengar aspirasi buruh mereka ingin gaji minimal Rp2 juta per bulan. Maka wajar kalau kemudian Pemrovsu-lah yang akan mewakili. Biasanya menjelang akhir tahun memang seperti itu. Pihak buruh dan pengusaha selalu tegang menghitung berapa besaran upah yang akan dikeluarkan. Apalagi sepanjang tahun ini beberapa faktor membebani biaya hidup seperti tarif listrik dan kenaikan harga bahan pokok secara keseluruhan. Sebenarnya pun penetapan Upah Minimum Provinsi (UMP) Sumut tahun 2011 tinggal menunggu persetujuan Gubernur Sumut Syamsul Arifin. Asosiasi Pengusaha Indonesia (Apindo) Sumut sudah mengungkap hasil pertemuan antara unsur pekerja, pengusaha dan pemerintah setelah melalui survei yang dilakukan Dewan Pengupahan Daerah telah diusulkan kepada Gubsu untuk disetujui. Penetapan UMP berdasarkan hasil survei Kebutuhan Hidup Layak (KHL) yang dilakukan diseluruh Kabupaten/kota sehingga dapat mendapatkan rumusan dalam melakukan hitungan UMP. Selain KHL prediksi inflasi tahun depan juga menjadi salah satu menghitung rumus penetuan UMP. Kita masih akan melihat apakah hitung-hitungan UMP ini memang akan sesuai yang dituntut buruh. Bukan standar hidup minimum tapi standar hidup layak. Kalau menghitung standar hidup layak pasti akan berbeda-beda di tiap kota. Sehingga rumusan UMP masih Intisari akan direvisi pemerintah daerah. Kenaikan UMP 2011diperkirakan sekitar Paling tidak standar hi- 6 persen hingga 8 persen dari UMP dup layak itu adalah versi sebelumnya yang berkisar Rp965.000 per bulan. buruh dan pengusaha yang Hasil survei yang sudah dilakukan sudah disusun secara ma- Pemprvo Kabupaten Sergai memiliki KHL yang paling rendah yakni Rp999. nusiawi. 082 per bulan dan yang tertinggi Nias Selatan sekitar Rp1.578.736 per bulan, disusul Gunung Sitoli Rp1.345.665 per bulan, Labuhanbatu Selatan mencapai Rp1.300.366 per bulan, Deli Serdang Rp1.318.366 per bulan serta Medan mencapai Rp1.218.090 per bulan. Jika di 2010 upah minim adalah Rp965 ribu maka kemungkinan tahun depan akan menjadi Rp1.094.500. Masalahnya adalah perwakilan buruh sebenarnya tidak pernah terima dengan kenaikan upah yang digalang secara bersama walau kemudian menyetujuinya. Tingginya biaya hidup membuat daya beli pekerja semakin berkurang. Sejak lima tahun lalu perwakilan buruh memang sudah meminta paling tidak UMP berada di level Rp1,9 juta per bulan. Untuk tahun depan pun perwakilan buruh menghitung biaya kebutuhan rata-rata Rp70.000 per hari atau menjadi sekira Rp2,1 juta per bulan. Sebab kenaikan harga kebutuhan pokok dan tingginya inflasi tak membuat kenaikan upah selama ini bisa dirasakan pekerja. Penentuan kenaikan upah ini memang harus bijaksana. Jangan sampai menimbulkan persinggungan antara buruh dan pengusaha. Kita tidak ingin tragedi 1994 terulang lagi. Buruh dan pengusaha harus duduk bersama dan bersepakat kira-kira di level berapa angka upah layak. Memang tidak akan ada angka pas. Terjadi tawar menawar. Itu tak terhindarkan. Hanya saja semua harus mau ke jalan tengah. Kalau upah pun terlalu tinggi pengusaha pasti akan keberatan. Usaha yang mereka lakoni belum tentu menguntungkan sejumlah persentase kenaikan upah. Dipaksakan pun mereka akan mengambil langkah rasionalisasi karyawan. Kata kasarnya PHK (pemutusan hubungan kerja). Kesepakatan apa pun yang diambil itu sudah harus mewakili aspirasi semua pihak. Kenaikan yang terlalu kecil juga bisa mengakibatkan persinggungan di kalangan buruh. Mereka pasti tak akan sanggup mengikuti harga kebutuhan pokok yang terus saja naik. Paling tidak standar hidup layak itu adalah versi buruh dan pengusaha yang sudah disusun secara manusiawi.*

Hubungi kami KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN � Bumi Warta Jaya Jalan Kebon Sirih Timur Dalam No. 3 Jakarta 10340 Tel: (021) 31922216, Faks: (021) 3140817. � Jalan Ratu Syafiatuddin No. 21 C Banda Aceh 23122 Tel & Faks: (0651) 22385 � Jalan Iskandar Muda No. 65 Lhokseumawe Tel: (0645) 42109 � Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412

Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 Percetakan: PT Prakarsa Abadi Press Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 6612681 Isi di luar tanggung jawab percetakan Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan hitam-putih Rp. 33.000,Halaman depan berwarna Rp. 90.000,Ukuran kolom: 40,5 mm E-mail Iklan:

Salam Perspektif Baru, Kali ini kita masuk ke topik yang rasanya belum pernah dibawakan pada acara ini. Topik ini akan diminati oleh orang yang berminat pada pendidikan tinggi dalam suasana internasional dan dengan pola yang sedikit berbeda, baik pola akademis atau pola praktis maupun gabungan keduanya. Tamu kita adalah Ezmieralda Melissa, seorang staf pengajar di Swiss German University (SGU), Serpong, Banten. Dia juga menjabat Sekretaris Departemen di Departemen Komunikasi dan Public Relations di SGU. Menurut Ezmieralda Melissa, SGU mengambil bentuk university of applied sciences seperti perguruan tinggi di Jerman, Swiss, dan Austria. Dalam hal ini mahasiswa tidak hanya diberikan teori di dalam kelas, tetapi juga diharuskan untuk mengikuti internship. Di SGU, mahasiswa pada semester tiga harus internship di perusahaan-perusahaan nasional. Sedangkan pada semester enam harus internship di Jerman atau di negaranegara lain. Di Indonesia memang ada beberapa universitas yang menawarkan program serupa tapi kebanyakan internshipnya dilakukan hanya secara nasional saja, yaitu program magang hanya di dalam negeri. Magang di luar negeri memberikan kesempatan kepada mahasiswa untuk melihat bagaimana cara kerja masyarakat internasional. Hasilnya, setelah pulang dari internship di luar negeri mahasiswa terlihat semakin dewasa dari sebelumnya. Mereka paham terlambat satu menit saja akan merugikan mereka. Berikut wawancara Wimar Witoelar dengan Ezmieralda Melissa. Wawancara lengkap dan foto narasumber dapat pula dilihat pada situs Lewat situs tersebut Anda dapat memberikan komentar dan usulan.

WW: Apa ciri spesifik perguruan tinggi yang memiliki ciri situasi internasional? EM: Mungkin yang perlu diberitahukan pertama adalah kita bukan sekolah internasional. Untuk menjadi sekolah internasional, kita harus mengadaptasi kurikulum dari luar. Sementara kalau kita mengadaptasi kurikulum dari luar, DirektoratJenderalPendidikanTinggitidak akan memberikan wewenang untuk meluluskan mahasiswa. Jadi kurikulum masih menggunakan kurikulum yang diperbolehkan oleh Direktorat Jenderal PendidikanTinggi. Namun, kita berusaha untuk menampilkan strandarisasi pendidikan internasional. Caranya, pertama, dengan menggunakan buku-buku yang berbahasa Inggris dan buku-buku yang digunakan di universitas-universitas di mancanegara.Kedua,dalamprosesbelajar mengajar kita sehari-hari menggunakan bahasa Inggris, di samping juga para mahasiswa mendapatkan dua bahasa tambahan yaitu bahasa Mandarin dan bahasa Jerman yang bisa mereka pilih. WW: Apakan Anda pribadi punya background internasional? EM:Pendidikansaya.Sayapernahsatu tahun sebagai mahasiswa pertukaran pelajar di Swiss. Sedangkan pendidikan strata satu (S1) dan strata dua (S2) saya di Australia. S1 saya di Bond University, Gold Coast. Sedangkan S2 di University of Melbourne. Keduanya dalam bidang komunikasi. WW: Ada satu lagi ciri SGU ini yang kemarin saya lihat menonjol yaitu sifatnya sebagai politeknik, betulkah? EM: Iya, benar. Para pendiri SGU berasal dari Jerman, Austria, dan Swiss. Di ketiga negara ini politeknik atau di negara mereka disebut dengan university of applied sciences yaitu mahasiswa tidak hanya diberikan teori di dalam kelas, tetapi juga diharuskan untuk mengikuti internship. Di SGU, mahasiswa pada semester tiga harus internship di perusahaanperusahaan nasional. Sedangkan pada semester enam harus internship di Jerman atau di negara-negara lain. WW:Apaituinternshipdanmengapa harus melakukan itu? EM: Internship adalah program magang yang dilaksanakan sekitar empat bulan per kali magangnya.Tujuan internship pada semester tiga untuk mengetahui bagaimana operasional industri di dalam negeri. Itu kesempatan bagi mahasiswa kitauntukmelihatsecaralangsung,sehingga dia tahu ingin terjun dalam industri sepertiapasaatlulusnanti.Internshippada semester enam terkait karena kita mempersiapkanmahasiswauntukbekerjatidak hanya di dalam negeri tapi juga di luar negeri sehingga mahasiswa melakukan magangnya di luar negeri, terutama di Jerman dan Swiss kalau mereka ingin mendapatkan double degree dari negara tersebut. Kalau mahasiswanya tidak menginginkan di kedua negara tersebut maka bisa melakukannya di negara lain tapidenganketentunanmerekatidakakan mendapatkan double degree. WW:Apakahinternship di luar negeri tersebut atas biaya mahasiswa sendiri? EM:Termasuk dalam biaya kuliahnya. Jaditetapsajadihitungsebagaibiayakuliah dantentunyaatasbiayamahasiswasendiri.

WW: Internship tidak ada uang kuliah.Jadi,apabiayayangharusdisediakan oleh mahasiswa? EM: Tiket pesawat, akomodasi dan biaya hidup sehari-hari. Sekali lagi, saya ingin membenarkan bahwa mahasiswa yang internship di Jerman dan Swiss akan mendapatkan double degree karena mereka akan mengikuti kelas di universitasuniversitasdisana.Ituhanyaberlakuuntuk yang di Jerman dan di Swiss saja. WW: Seharusnya ada tuition (biaya pendidikan). Apakah itu tidak dibayar terpisah? EM: Sepengetahuan saya tuition dibayarkan ke universitas yang ada di Indonesia. WW:ApakahsemuamahasiswaSGU membayar uang kuliah atau mendapat beasiswa? EM: Untuk sekarang ini beasiswa diberikan pada mahasiswa yang berprestasi dimulai pada semester kedua. Prestasinya yang dinilai terutama prestasi akademik yang dilihat dari Grade Point Average (GPA) atau Indeks Prestasi. Bila GPA memenuhi kualitas tertentu maka akan mendapat beasiswa sebesar 100%. WW: Berapa kualifikasinya? EM: Seingat saya kalau GPA di atas 3,8 maka akan mendapatkan beasiswa 100%. WW:Apakahadayangmencapai3.8? EM: Ada yang mencapai dan kalau tidak salah kebetulan anaknya pernah internship di InterMatrix Communications. Anak tersebut berhasil mendapatkan beasiswa selama kurang lebih empat semester berturut-turut sebesar 100% . WW:Sayamenangkapbahwainternship merupakan bagian yang penting. Apakah program itu memang tidak ditawarkan di sekolah lain di Indonesia? EM: Di Indonesia setahu saya ada beberapa universitas yang menawarkan program serupa tapi kebanyakan internshipnya dilakukan hanya secara nasional saja, yaitu program magang hanya di dalam negeri. Mungkin kelebihan kita adalah memberikan kesempatan kepada mahasiswauntukmelihatbagaimanacara kerja masyarakat internasional. Itu yang tidak ditawarkan sama program lain. WW: Apakah mahasiswanya bebas memilih untuk melakukan internship? EM: Mereka bebas memilih, tapi karena mungkin sebagian besar mahasiswa tidak mempunyai kontak dengan perusahaan-perusahaan di luar negeri maka kami membantu untuk mencarikannya. WW: Kita bertemu di sini karena saya melihat memang ada suatu peristiwa penting tahun ini yaitu sepuluh tahun SGU. Bagaimana sepuluh tahun pertama tersebut menjadi acuan untuk sepuluh tahun berikutnya, apa rencana selanjutnya yang akan dikembangkan? EM: Kita universitas baru, jadi yang paling signifikan adalah kita baru saja pindah ke kampus baru yaitu di kawasan Edutown Bumi Serpong Damai (BSD). Sebelumnya kami di German Center jadi kami sekarang mempunyai gedung sendiri. Otomatis dengan adanya gedung ini maka kesempatan untuk

melakukan riset dan juga mengembangkan kegiatan-kegitaan mahasiswa, serta kegiatan lainnya akan lebih berkembang ke depannya. Pada tahun ini yang lebih ditekankan adalah restrukturisasi untuk lebih mengedepankan bidang riset. Sebelumnya memang riset masih minim. Di Indonesia juga riset masih minim. Itu yang ingin kami kembangkan lebih lanjut. Sebagai contoh, kita mewajibkan setiap dosen yang penuh waktu untuk melakukan riset paling tidak satu per semester dengan melibatkan mahasiswa. Selain itu juga memberikan fasilitas-fasilitas yang lebih mendukung kepada mahasiswa. WW: Apa mata kuliah yang Anda ajarkan? EM: Untuk sekarang saya mengajar mata kuliah introduction to public relations dan event management. WW: Apa bidang studi yang merupakan kekuatan SGU? EM: Saya pikir karena terkait mindset orang Indonesia bahwa yang namanya Jerman pasti berhubungan dengan teknik. Jadi yang paling populer pun, programprogramstuditersebut.Yangpalingpopuler mekatronika (Mechanical Engineering Electronic Engineering/Mechatronic) dan life sciences. Minat terhadap program itu sangat banyak, padahal untuk mekatronika, SGU baru menawarkan program tersebut. Kalau tidak salah baru SGU dan ITB yang menawarkan program tersebut. Universitas lain belum ada. WW:Kalau program studi komunikasi, kita melihat perkembangannya karenasekarangkomunikasidanindustri komunikasi semakin berkembang.Kami juga melihat ada signifikasinya dengan jumlah mahasiswa kami yang lebih banyak di program studi komunikasi,tetapi kekuatanya di mekratonika dan life sciences. EM: Apakah ada hubungan kerjasama dengan industri, perguruan tinggi atau pemerintah di Jerman? WW:Kebetulan pendiri dan Board of GovernorsSGUadalahorang-orangyang mewakili perusahaan atau pemerintah Jerman, Swiss dan Austria. Apabila mahasiswasemesterenaminginmelakukan program magang di Jerman, kita ada kerjasama dengan universitas di Jerman yaitu University of Ilmenau. Bentuk universitas tersebut seperti kita yaitu university of applied sciences. EM: Selain itu kami melakukan kerja sama dengan perusahaan di Jerman, baik di dalam negeri maupun di luar negeri. Itu juga alasan mengapa kampus SGU sebelumberlokasiditempatyangsekarang berada German Centre. Itu karena di tempat tersebut terdapat link perusahaan Jerman yaitu Alcatel, Siemens, dan lainlain. WW: Apakah sudah dipantau orang-orang yang kemudian membentuk karier di perusahaan Jerman? EM: Program studi kami kebetulan lulusannya baru satu angkatan. Dari anak-anak yang lulus dari program studi kami memang tidak memilih bekerja di perusahaan Jerman. Tapi kalau dari jurusan Mekatronika ataupun life sciences dan teknologi informasi, banyak dari mereka yang bukan saja memutuskan untuk bekerja dalam perusahaan Jerman di lingkup perusahaan internasional, tetapi juga kembali ke Jerman setelah internship mereka. Itu karena mereka mendapatkan contact person saat melakukan program internship di Jerman. WW: SGU merupakan sekolah di Indonesia yang mempunyai kerja sama akrab dengan luar negeri bahkan yang menggabungkan prioritas pendidikan kurikulum yang lazim di sini dengan kurikulum internasional. Apakah itu sudah ada penerimaan penuh dalam sistem pendidikan kita atau masih harus berjuang untuk keabsahannya? EM: Sepengetahuan kami, tidak ada batasan dari pemerintah untuk melakukan internship dalam program studi selama mata kuliah-mata kuliah inti yang diwajibkan dari pemerintah tetap kami laksanakan. Itu juga yang menjadi alasan mengapa kami tidak bisa mengatakan bahwa kami universitas internasional. WW: Apakah pendanaan operasional SGU didukung juga oleh yayasan, pemerintah atau development agency dari Jerman? EM: Board of Governors kami bekerjasama dengan Kedutaan Besar Jerman, Austria dan Swiss, saya kira mungkin sedikit banyak ada bantuan berupa soft loans, pembangunan, atau riset dan lain-lain. Selain itu, yayasan yang ada di kami hanya Yayasan Swiss Jerman. WW: Oh ya, para founder SGU banyak berasal dari orang industri Jerman. Lalu, bagaimana untuk orang industri dan pemerintah Indonesia,siapa saja yang aktif di sana? EM: Setahu saya, kebanyakan kami didukung oleh orang-orang industri. Itu sebabnya kami mengadaptasi kurikulum applied of sciences karena bagi

orang-orang industri tidak cukup mahasiswa hanya diberikan teori-teori tanpa adanya pengetahuan bagaimana cara operasional profesi tersebut dalam industri. WW: Mengapa SGU memakai bahasa pengantar bahasa Inggris? EM: Orang pasti berpikir harus memakai bahasa Jerman. Sepengetahuan saya, kalau sekolah dengan standar internasional di Indonesia hanya menggunakan bahasa Inggris sebagai bahasa sehari-hari. Kita juga tahu bahwa bahasa Inggris adalah bahasa internasional yang paling umum yang dibutuhkan oleh masyarakat internasional. Nama Swiss-German itu sendiri tidak mengacu bahwa ini adalah pendidikan Jerman, tetapi para founding fathers kami adalah orang-orang dari negara tersebut. WW: Rektor atau dekannya itu memang orang yang datang dari Jerman, atau orang Jerman yang sudah punya pengalaman di Indonesia? EM: Kebanyakan orang Jerman yang sudah punya pengalaman di Indonesia. Misalnya, rektor sebelumnya yaitu Prof. Dr. Peter Pscheid dan yang sekarang menjabat yaitu Prof. Jurgen Gruneberg adalah orang-orang Jerman yang berpengalaman untuk menjadi pejabat di universitas di negara tersebut, tetapi mereka sudah lama berkecimpung dalam bidang pendidikan di Indonesia. WW: Apakah mereka tidak memiliki masalah untuk menghayati mahasiswa dan sebagainya? EM: Kalau saya pikir tidak masalah. Mereka sudah lama di Indonesia. Mungkin dibandingkan saya, mereka lebih mengerti budaya pendidikan di Indonesia. WW: Bagaimana bila melihat orang terlambat? EM: Kalau masalah disiplin, universitas kami sangat concern dengan hal itu. Itu bukan hanya mahasiswanya saja, kamipun sebagai pengajar dan staf harus sangat disipilin. WW: Apakah ada kesulitan untuk membawa orang yang memiliki 100% pengalaman di Indonesia ke dalam disiplin yang internasional itu? EM: Untuk mahasiwa kami di semester satu maka dia akan mengatakan, “Oh, miss ini sangat sadis ya. Terlambat satu menit saja tidak bisa masuk kelas.” Tetapi pada saat mereka melakukan internship, apalagi di luar negeri maka itu akan terasa sekali manfaatnya. WW: Bagaimana pengalaman mereka internship di luar negeri? EM: Sebagian besar mahasiswa setelah pulang dari internship di luar negeri terlihat semakin dewasa dari sebelumnya. Mereka mengatakan, “Ternyata benar miss, kalau saya terlambat satu menit saja, kereta di sana sudah berangkat meninggalkan saya.” WW: Berapa perbandingan mahasiswa dan staf pengajar di SGU saat ini? EM: Maksimum satu pengajar untuk 35 mahasiswa. Itu terutama untuk program studi yang banyak. Kalau di program studi kami paling tidak satu kelas 35 mahasiswa. Kalau lebih dari 35 maka kami akan pisah menjadi dua kelompok. —oo000oo—-

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan dilengkapi CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Walikota hibur duka pedagang pasar sore - Asal jangan bertambah duka * Runway Bandara Kualanamu harus tender ulang - Tak pernah selesai masalah * Otorita Bandara diminta surati Pemko - Lebih cepat kirim SMS, he...he...he


D Wak


Dewan Redaksi: H. Prabudi Said, H. Teruna Jasa Said, H. Azwir Thahir, H. Sofyan Harahap, H. Akmal Ali Zaini, H. Muhammad Joni, Edward Thahir, M. Zeini Zen, Hendra DS. Redaktur Berita: H. Akmal Ali Zaini. Redaktur Kota: Edward Thahir. Redaktur Sumatera Utara: M. Zeini Zen. Redaktur Aceh: Rizaldi Anwar. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara & Features: Gito Agus Pramono. Plt. Redaktur Opini: Dedi Sahputra. Redaktur Ekonomi: Armin Rahmansyah Nasution. Redaktur Olahraga: Johnny Ramadhan Silalahi. Redaktur Minggu/Humas: Hendra DS, Redaktur Agama: H. Syarifuddin Elhayat. Asisten Redaktur: Rudi Faliskan (Berita) Zulkifli Harahap, Muhammad Thariq (Kota Medan), Feirizal Purba, H. Halim Hasan, Diurna Wantana (Sumatera Utara), T. Donny Paridi (Aceh), Armansyah Thahir (Aceh, Otomotif), Austin Antariksa (Olahraga, Kreasi), Syafriwani Harahap (Luar Negeri, Popular, Pariwisata), Hj. Hoyriah Siregar (Ekonomi), T. Junaidi (Hiburan), Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zein (Remaja), Anum Purba (Keluarga)), Hj. Ayu Kesumaningtyas (Kesehatan). Sekretaris Redaksi: Hj. Hartati Zein. Iklan: Hj. Hilda Mulina, Rumondang Siagian (Medan), Lulu (Jakarta). Pemasaran: H. Subagio PN (Medan), Zultamsir (Sumut), Aji Wahyudi (NAD). Wartawan Kota Medan (Umum): H. Erwan Effendi, Muhammad Thariq, Zulkifli Harahap, David Swayana, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Feirizal Purba, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, M. Ferdinan Sembiring, M. Edison Ginting, Surya Effendi, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Hasanul Hidayat, Aidi Yursal, Rustam Effendi. Wartawan Kota Medan (bidang khusus): H. Syahputra MS, Setia Budi Siregar, Austin Antariksa, Dedi Riono (Olahraga), Muhammad Faisal, Hang Tuah Jasa Said (Foto), Armansyah Thahir (Otomotif), Dedek Juliadi, Hajrul Azhari, Syahrial Siregar, Khairil Umri (Koran Masuk Sekolah/KMS). Wartawan Jakarta: Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian W, Aji K. Wartawan Sumatera Utara: H. Riswan Rika, Nazelian Tanjung (Binjai), H.M. Husni Siregar, Hotma Darwis Pasaribu (Deli Serdang), Eddi Gultom (Serdang Bedagai), H. Ibnu Kasir, Abdul Hakim (Stabat), Chairil Rusli, Asri Rais (Pangkalan Brandan), Dickson Pelawi (Berastagi), Muhammad Idris, Abdul Khalik (Tebing Tinggi), Mulia Siregar, Edoard Sinaga (Pematang Siantar), Ali Bey, Hasuna Damanik, Balas Sirait (Simalungun), Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan (Batubara), Nurkarim Nehe, Bustami Chie Pit, Sapriadi (Asahan), Rahmad Fansur Siregar (Tanjung Balai), Indra Muheri Simatupang (Aek Kanopan), H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan (Rantau Prapat), Hasanuddin (Kota Pinang) Edison Samosir (Pangururan), Jimmy Sitinjak (Balige), Natar Manalu (Sidikalang), Arlius Tumanggor (Pakpak Bharat)Parlindungan Hutasoit, Marolop Panggabean (Tarutung), Zulfan Nasution, Alam Satriwal Tanjung (Sibolga/Tapanuli Tengah), H. Syarifuddin Nasution, Balyan Kadir Nasution, Mohot Lubis, Sukri Falah Harahap (Padang Sidimpuan), Sori Parlah Harahap (Gunung Tua), Idaham Butarbutar, Syarif Ali Usman (Sibuhuan), Iskandar Hasibuan, Munir Lubis (Panyabungan), Bothaniman Jaya Telaumbanua (Gunung Sitoli). Wartawan Aceh: H. Adnan NS, Aldin Nainggolan, Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid (Banda Aceh), Iskandarsyah (Aceh Besar), Bustami Saleh, M. Jakfar Ahmad, Jamali Sulaiman, Arafat Nur, M. Nasir Age, Fakhrurazi Araly, Zainal Abidin, Zainuddin Abdullah, Maimun (Lhokseumawe), Muhammad Hanafiah (Kuala Simpang), H. Syahrul Karim, H. Ibnu Sa’dan, Agusni AH, H. Samsuar (Langsa), Musyawir (Lhoksukon), Muhammad H. Ishak (Idi), HAR Djuli, Amiruddin (Bireuen), Bahtiar Gayo, Irwandi (Takengon), Muhammad Riza, H. Rusli Ismail (Sigli), T. Zakaria Al-Bahri (Sabang), Khairul Boang Manalu (Subulussalam), Zamzamy Surya (Tapak Tuan), Ali Amran, Mahadi Pinem (Kutacane), Bustanuddin , Wintoni (Blangkejeren), Khairul Akhyar, Irham Hakim (Bener Meriah), Tarmizi Ripan, Mansurdin (Singkil), Muhammad Rapyan (Sinabang).

� Semua wartawan Waspada dilengkapi dengan kartu pers. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �


WASPADA Sabtu 13 November 2010

A7 Kunjungan Obama Bagian Dari Usaha AS Hempang China JAKARTA (Waspada): Kunjungan Presiden AS Barack Obama ke Indonesia bagian dari usaha AS menghempang laju perdagangan China ke Indonsia. Sebab AS sadar bahwa saingan terkuatnya saat ini adalah China. “AS saat ini tidak punya kekuatan penuh, karena kini China menjadi saingan berat. Hal ini disadari AS, dan kedatangan Obama bagian dari mencegah makin kuatnya perdagangan China ke Indonesia,” ujar pengamat politik lulusan program pascasarjana Universitas Gadjah Mada Yogyakarta, Sanggam Hutapea menjawab Waspada, kemarin, di Jakarta. Kalau kunjungan Obama memberi efek bagi Indonesia, menurut Sanggam, itu akan terlihat jangka panjang, bukan terasa langsung saat Obama berada di Indonesia. Sanggam yakin, ke depan AS akan lebih membina hubungan makin harmonis dengan Indonesia, sebab AS tahu betul bahwa perdaga-

ngan Indonesia-China jika tidak dihempang mulai sekarang, ke depan akan lebih kuat. AS sudah melihat kenyataan bahwa perdagangan antara Indonesia-China akan lebih menguatkan China, karena dalam perdagangan Indonesia devisit. Artinya Indonesia lebih banyak impor barang China daripada mengekspor ke China. “Saya yakin AS tidak akan membiarkan hubungan perdagangan Indonesia akan membuat CHina lebih kuat,” ujar Sanggam. Sementara, Wakil Ketua DPR Pramono Anung berpendapat bahwa Indonesia tidak bisa berharap mendapatkan perlakuan istimewa luar biasa dari Obama, hanya karena semasa kecilnya Obama pernah tinggal dan sekolah di Indonesia. “Kita tidak bisa melihat secara historis bahwa dia pernah tinggal di Indonesia selama empat tahun, kemudian akan memberikan privilege luar biasa kepada pemerintahan kita, tidak bisa dilihat seperti itu,” ujarnya.(aya)

WFH Belanda Sudah 5 Tahun Bekerjasama


MULAI BERAKTIVITAS: Beberapa warga membersihakan abu vulkanik dari atap rumah di Desa Srumbung, Muntilan, Jateng, Jumat (12/11). Desa Srumbung yang beberapa waktu lalu kosong ditinggal mengungsi akibat erupsi Merapi, kini beberapa warga mulai kembali beraktivitas membersihkan rumah.

Calo CPNS Ditindak Tegas Jakarta (Waspada) Menteri Pendayagunaan Aparatur Negara dan Reformasi Birokrasi (Menpan dan RB) AA Mangindaan mengingatkan proses penerimaan Calon Pegawai Negeri Sipil (CPNS) agar tidak terjadi percaloan. Jika ada calo yang bermain dalam proses penerimaan dan pelaksanaan ujian CPNS akan di proses secara hukum. “ Siapapun calo yang berani akan kita tindak tegas dan diajukan ke Polisi untuk diproses secara hukum,” tegas Mangindaan di Jakarta, Jumat (12/11). Kementerian PAN dan RB

sendiri menyediakan sarana untuk siapa saja yang ingin mengadukanpersoalanpenerimaan CPNS, utamanya terkait praktik KKN. Masyarakat bisa mengadu ke tromol pos 5000 yang dikelola Kementerian PAN dan RB atau ke Komisi Ombudsman. Untuk itu, Mangindaan pun meminta pihak provinsi sebagai penanggung jawab pelaksanaan ujian CPNS di daerah harus bersih dari KKN. Dia yakin, karena pihak provinsi sebagai penanggungjawab pelaksanaan ujian CPNS di daerah sudah mengikutsertakan pihak yang dianggap sangat independen, yakni Per-

guruan Tinggi Negeri (PTN) setempat maka harapannya terjaring CPNS-CPNS unggulan. Mangindaan mengakui banyak keluhan yang sampai kepada pemerintah pusat terkait praktik KKN dalam sistem penerimaan CPNS. Karena itu, dia mengimbau agar daerah mengumumkan secara transparan siapa saja yang lulus dan tidak lulus dalam uji seleksi yang dilakukan pihak PTN. “Transparansi dan akuntabilitas ini yang sangat diharapkan sebagai sebuah langkah awal pemerintahan yang bersih, “ tandasnya. Anggota Komisi II DPR-RI

Putihkan Utang Pengusaha Kecil Korban Bencana JAKARTA (Waspada): DPP Kerukunan Usahawan Kecil dan Menengah Indonesia (Kukmi) meminta pemerintah putihkan utang para pengusaha kecil dan menengah korban bencana tsunami Mentawai dan korban letusan Gunung Merapi. “Kukmi minta kepada pemerintah supaya utang-utang mereka diputihkan saja. Musibah yang mereka alami itu adalah force majeure atau di luar kemampuan manusia. Dan Kukmi meminta supaya setelah pulih para pengusaha kecil dan menengah itu supaya dibantu pinjaman agar bisa menumbuhkan perekonomian mereka lagi,” ungkap Ketua Umum Kukmi Azwir Dainy Tara di Jakarta Rabu (10/11). Namun demikian Azwir mengingatkan, supaya yang dibantu nanti benar-benar usaha mikro yang betul-betul korban bukan pura-pura korban. Dalam keterangannya Azwir beserta pengurus DPP

Kukmi lainnya mengatakan, kebijakan pemerintah terhadap pengusaha yang masuk dalam kategori Usaha Kecil dan Menengah (UKM) belum sepenuhnya bisa dirasakan. Dari dana APBN yang disediakan Rp20 triliun untuk UKM, faktanya tidak semua bisa diserap. “Kendalanya akibat Bank Pelaksana penyalur KUR masih dengan kebijakan harus ada jaminan dari pengusaha jika ingin memperoleh KUR. Padahal pemerintah sudah memberikan jaminan 70 sampai 80 persen. Itupun tidak diacuhkan oleh bank-bank pelaksana terhadap pengusaha UKM di daerah-daerah yang membutuhkan dana segar,” ungkap Azwir. “Direksi bank-bank pelaksana yang mempersulit penyaluran kredit usaha rakyat supaya dicopot saja, mereka tidak becus mendukung program pemerintah,” kata Azwir. Ketua Umum Kukmi itu tidak membantah pihaknya

membidangi Pendayagunaan Aparatur Negara dan Reformasi Birokrasi Yassona H. Laoly mengharapkan proses seleksi CPNS 2010 agar lebih diperketat guna meminimalisir dan menghapus keberadaan sistem percaloan yang kerap terjadi. Wakil rakyat dari daerah pemilihan Sumut mengakui akan memantau secara terus menerus proses penerimaan CPNS, khususnya di Sumut. “ Mudah-mudahan tahun ini tidak ada permainan calo sebab kita harapkan penerimaan CPNS kali ini harus bersih sehingga mendapatkan CPNSCPNS yang handal sekaligus

sebagai ujung tombak untuk reformasi birokrasi,” ujar Laoly. Politisi dari PDI Perjuangan ini berpendapat untuk mereformasi birokrasi yang utama menyangkut cara berpikir yang harus komprehensif dan sejak dini sudah menentukan kebutuhan SDM aparatur yang dibutuhkan lima tahun ke depan,” tukasnya. Laoly juga sepakat agar perubahan kelembagaan yang saat ini sedang dilakukan atas dasar PP No 41 Tahun 2007, ditinjau ulang, sebab perubahan kelembagaan itu berdampak luas bagi aparatur di daerah.(dianw/aya)

mendapat laporan penyaluran dana milik pemerintah itu belum merata, misalnya di Sumatera Barat, tercatat baru Bank Rakyat Indonesia (BRI) yang hanya mengucurkan KUR. Padahal bank pelaksana KUR adalah Bank Mandiri, BNI 46, Bukopin, Bank Pembangunan Daerah di seluruh Indonesia serta BRI sendiri. Bank-bank itu tidak boleh mempersulit penyalurannya. Karena dana tersebut dari APBN seharusnya jangan satu bank saja sebagai pelaksana penyaluran KUR di setiap daerah. Menurut politisi Partai Golkar ini, pemerintah harus mengeluarkan jaminan KUR itu 100 persen, sehingga semua tercakup. Bila perlu, dibuat payung hukumnya seperti Keppres. “Dengan demikian, bank pelaksana tidak macammacam,”kata Azwir seraya menambahkan, KUR sebesar Rp 20 triliun/tahun kata dia masih tergolong kecil. (j07)

Waspada/Edi Saputra

H Abdul Wahab Dalimunthe didampingi Ketua DPRD Sergai, H Azmi Y Sitorus, Staf Ahli DPRRI Tumpal Pangabean dan Ketua Fraksi Partai Demokrat Sergai Drs Hartoyo, ketika menyampaikan materi sosialisasi UUD 1945 di Meeting Room Sonia Café , Perbaungan, Rabu (10/11).

H Abdul Wahab Dalimunthe Narasumber Sosialisasi UUD 1945 masyarakat tidak apatis terhadap negara RI. “Selain itu sosialisasi ini juga sebagai ajang menjaring aspirasi masyarakat, mencari buah fikiran yang baru terkait UUD 45 dan Amandemen yang diharapkan menjadi sebuah rekomondasi dan menjadi pemba-hasan kami di DPR-RI dalam menyempurnakan UUD 45 pada akhirnya bertujuan bagi kepentingan kemaslahatan masyarakat,” tambahWahab Dalimunthe. Sebelumnya Ketua DPRD Sergai H Azmi Y Sitorus, MSP mengatakan, menyambut baik dan memberikan apresiasi yang tinggi atas kegiatan sosialisasi UUD 1945 di Sergai yang difasilitasi LDSI sebagai upaya untuk

Dengan kerja sama itu, katanya, produksi air yang tadinya 80 liter per-detik meningkat menjadi 120 liter per-detik selama lima tahun melalui PT.Tirta Sumut yang dilakukan melalui pola kerjasama ; Rahabilitasi, Dioperasikan dan Diserahterimakan atau disebut juga (ROT: Rehabilitation, Operate and Transfer) dengan kepemilikan saham, 51 % dari WFH dan 49 % PDAM Tirtanadi. Dari Dewan Pengawas PDAM Tirtanadi, Rajamin Sirait, SE dan Ghazali Syam menyampaikan rasa terima kasihnya kepada pihak WFH, dimana diharapkan kerjasama ini juga dapat dikembangkan lagi, terutama untuk penambahan produksi air minum untuk masyarakat Kota Medan dan sekitarnya. Hal itu, kata Rajamin, telah menjadi prioritas utama meng-ingat saat ini PDAM Tirtanadi sangat membutuhkan tamba-han produksi air minum yang baru untuk memenuhi pertam-bahan sambungan baru air minum yang dari waktu ke waktu terus meningkat. Dia berharap ke depan agar kerjasama itu tidak hanya sebatas MOU (Momerandum Of Understanding) tetapi juga bisa diimplementasi secara menyeluruh. Di akhir pertemuan, Mr. Bert Jansen menyampaikan bahwa Pemerintah Belanda siap untuk memberikan bantuan berupa hibah/grand sebesar 35 % untuk pembiayaan Investasi pembangunan Instalasi baru untuk Pengolahan Air Minum 1000 liter per-detik melalui program OREO. Selain itu Pemerintah Belanda dan jugaWFH berencana akan melakukan penambahan produksi 60 liter per-detik di PDAM Tirtanadi Deli Serdang untuk mendukung penambahan sambungan rumah yang terus meningkat di Kota Lubuk Pakam dan sekitarnya. (m23)

Beda Pendapat Keberangkatan SBY Ke Korsel

Priyo: Lebih Baik Konsentrasi Tanggulangi Bencana JAKARTA (Waspada): Pimpinan DPR RI berbeda pendapat soal keberangkatan Presiden Yudoyono untuk menghadiri pertemuan G20 di Korea Selatan. Wakil Ketua DPR Priyo Budi Santoso (F-PG) meminta Wakil Presiden Boediono saja yang berangkat. Sebaliknya Wakil Ketua DPR dari F-PDIP, Pramono Anung meminta Presiden memprioritaskan pertemuan G20 tersebut. Menurut Priyo, Presiden biar konsentrasi untuk menanggulangi bencana Merapi, Mentawai maupun Wasior. Karena situasi bencana membutuhkan konsentrasi penuh untuk penanganan serius. Keberadaan Presiden diharapkan dapat mengambil sejumlah keputusan penting di tengah situasi tanggap bencana. “Bahwa keberadaan presiden di luar negeri tidak mendesak, sehingga cukup mewakilkan wapres. Jadi, presiden sebaiknya konsentrasi terhadap penanggulangan bencana,” tandasnya kepada wartawan, Kamis (11/11). Sebaliknya, Pramono Anung meminta Presiden SBY memprioritaskan pertemuan G20. Presiden diminta memercayakan sepenuhnya penanganan bencana kepada BNPB dan komponen pemerintah di tanah air. “Saya kira Presiden sudah punya pertimbangan menuju G20, saya termasuk mendukung presiden memprioritaskan G20. Tidak perlu presiden harus menunggu bencana, yang penting cukup arahkan dan apabila ada hal krusial cukup diputuskan disini,” ujarnya. Kata politisi PDIP itu, masuk menjadi anggota G20 tidaklah mudah. Karena itu, Presiden harus memperjuangkan sepenuhnya dalam pertemuan di Korsel untuk kemajuan perekonomian Indonesia.(j07)

Tak Ada Alasan Kekurangan Dana Bantu Korban Bencana

PERBAUNGAN (Waspada): Anggota DPR-RI asal Sumatera Utara H AbdulWahab Dalimunthe menjadi narasumber utama seminar nasional sosialisasi Undang-undang Dasar 1945 (UUD 45) dan ketetapan MPRRI (Amandemen), yang diselenggarakan Lembaga Studi Demokrasi Indonesia (LDSI) , Rabu (10/11) di meeting room Sonia Café Kec. Perbaungan. Dalam pemaparannya Wahab mengatakan, selaku anggota DPR-RI yang juga MPRRI sudah menjadi tugas untuk mensosialisasikan UUD 1945 yang asli dan yang sudah diamandemen (perubahan) karena masih banyak pihak yang belum memahaminya, sehingga

MEDAN (Waspada): Water Fund Holland (WFH) dari Belanda berhasil memberikan kontribusi yang sangat positif dalam upanya meningkatkan layanan pendistribusian air kepada masyarakat pelanggan melalui kerja sama yang sudah lima tahun terjalin dengan pihak PDAM Tirtanadi. Hal itu diungkapkan Mangindang Ritonga,SE, MM, Pjs. Direktur Perencanaan & Produksi merangkap Pjs. Direktur Administrasi & Keuangan PDAM Tirtanadi dalam penjelasannya saat menerima kunjungan Presiden Komisaris WFH Mr.Berth Jansen yang didampingi Finance Manager Mr.Simon dan Abdi Sucipto, ST, Direktur PT.Tirta Sumut Selasa (9/11), di kantor pusat PDAM Tirtanadi, Jl. SM Raja Medan. Dalam kunjungan kepada Dewan Pengawas PDAM Tirtanadi yang diwakili Rajamin Sirait, SE dan H.A.Ghazali Syam, Mangindang juga menjelaskan bahwa kontribusi positif yang bisa dilihat dari hasil kerja sama itu adalah peningkatan jumlah pelanggan di PDAM Tirtanadi Cab. Deli Serdang dengan 15.000 sambungan rumah. Perkembangan itu, kata Mangindang yang turut didampingi Kepala Divisi Public Relation Ir.H.Delviyandri, M.Psi serta beberapa Kepala Divisi lainnya, cukup signifikan meng-ingat kerjasama ini menganut sistem “ No Profit, No Losse”, yang artinya pihak WFH tidak mengharapkan keuntungan dalam berinvestasi, namun melaksanakan rahabilitasi demi peningkatan produksi dimaksud. Hal ini dikarenakan pihak Pemerintah Belanda memberikan hibah (grand). Sementara itu, pihak WFH menyampaikan bahwa kerjasama ini sudah dimulai dari tahun 2005 dimana sasaran utamanya adalah peningkatan produksi air minum di Instalasi Air Minum (IPA) Sei.Ular.

lebih memasyarakatkan UUD 1945 itu. Ketua Panitia Faisal Riza MA dalam laporannya mengatakan kegiatan ini bertujuan bagaimana UUD 1945 tersosialisasi dengan baik di tengah-tengah masyarakat yan telah diamandemen sebayak 4 kali, terangnya. Selain Wahab Dalimunte, sosialisasi juga didisi Staf Ahli DPR-RITumpal Pangabean yang dihadiri anggota DPRD Fraksi Demokrat, Labuhan Hasibuan SAg, Fery Haryanto, Drs Hartoyo, Riady dan Junaidi Purba SE serta puluhan peserta sosialisasi terdiri dari utusan guru, tokoh agama, masyarakat, organisasi kepemudaan, pengusaha, serta pelajar. (ces)

JAKARTA (Waspada): Wakil Ketua DPR RI Priyo Budi Santoso menegaskan, tidak ada lagi alasan pemerintah menyatakan kekurangan dana karena DPR RI telah menyetujui penggunaan anggaran baik untuk dana tanggap darurat dan pasca bencana. Yang jelas pada 5 November lalu, DPR telah menyetujui Rp150 miliar untuk dana tanggap darurat, dan Rp1,9 triliun untuk pasca bencana. Oleh sebab itu tidak ada alasan lagi bagi pemerintah kekurangan dana dalam menangani berbagai bencana maupun pasca bencana di Merapi, Mentawai maupun Wasior, ungkap Priyo saat melepas 5 mobil DPR Peduli berisi bantuan para anggota DPR RI dan Kesekjenan DPR RI untuk korban Merapi di halaman Gedung DPR RI Jakarta Rabu (10/11). “Bantuan DPR ini terdiri dari dua tim dan tim kedua akan diberangkatkan pada 12-14 November sesuai kebutuhan pengungsi Merapi. Semoga saja bantuan ini mendapat ridho Allah SWT,” tandas Ketua DPR RI Marzuki Alie. Sumbangan yang telah terkumpul sampai 9 November Rp520 juta terdiri dari; dana bencana alam DPR (I) Rp100 juta, dana bencana alam DPR (II) Rp350 juta, dari karyawan DPR Rp60 juta dan dari koperasi karyawan setjend DPR RI Rp10 juta. (j07)

PT Masih Tarik Menarik JAKARTA (Waspada): Proses penyusunan dan pembahasan UU Paket Politik masih belum rampung terjadinya tarik-menarik menyangkut penentuan parliamentary threshold (PT) antara 2,5 persen dan 5 persen. “Soal PT masih tarik-menarik, ada yang meminta 2,5 persen, ada yang 3 persen, dan ada yang 5 persen. Kita masih akan cari yang tepat,” kata Ketua Badan Legislasi DPR RI, Ignatius Mulyono dalam dialog kenegaraan di Gedung DPD, Jakarta, Rabu (10/11). Diakuinya, Baleg DPR masih berupaya mencari formula tepat dan masih mengumpulkan masukan untuk mendesain UU yang pas dengan kondisi perpolitikan Indonesia. Namun dia berjanji RUU Paket Politik selesai paling lambat Juli 2011. “Ini sudah menjadi komitmen kami,” ujarnya. Ignatius menekankan kesadaran dan kemauan dari fraksi menjadi modal penting menyelesaikan RUU Paket Politik. Pengamat politik, Cecep Effendi yang juga pembicara dalam diskusi itu memperkirakan angka ambang batas parlemen (PT) yang akan diberlakukan ke depan adalah 3 persen. Kalau ada kesepakatan sampai 5 persen, itu luar biasa. (aya)


FOTO BERSAMA DARI KIRI KE KANAN: Ir. H. Delviyandri, M.Psi (Kadiv. Public Relations), Mangindang Ritonga, SE, MM (Pjs. Dir. Adm/Keu & Dir. Perencanaan/Produksi), Mr. Simon (Finance Manager WFH), H. Ahmad Ghazali Syam (Dewan Pengawas PDAM Tirtanadi), Mr. Berth Jansen (Presiden Komisaris WFH), Rajamin Sirait, SE (Dewan Pengawas PDAM Tirtanadi), Abdi Sucipto, ST (Direktur PT. Tirta Sumut), Irsan Effendi Lubis, S.sos, MM (Kadiv. Umum).

Kawasan Religius... “Sebenarnya tempat-tempat ini masih memiliki kharisma tersendiri dibanding tempat wisaata lainnya di Medan, karena bagi warga pendatang masih tetap menarik untuk dikunjungi, kata Juriah warga Aceh Selatan yang bertandang ke Istana Maimoon, Rabu (10/11). Menikmati tiga situs bersejarah itu seperti merasakan langsung keberadaan kota Medan sebenarnya, namun kesan semrawut sangat terasa di antara tiga lokasi tersebut,” katanya. Seperti kebersihan di sekitar lokasi dan banyak peralatan besi dan lainnya yang dipajang tak beraturan di sekitar Jalan Mahkamah ketika berjalan dari Istana Maimoon menuju Taman Kolam Sri Deli dan ke Masjid Raya. Sementara itu banyaknya pedagang bunga di lokasi halaman samping Istana Maimoon sudah selayaknya harus ditata rapi agar tidak mengganggu pemandangan pengunjung sehingga ketika melihat dapat berminat membeli bunga. Padahal kemegahan Istana Deli tersebut merupakan kebesaran masa lalu kota Medan yang dapat terlihat nyata saat ini di tiga situs bersejarah itu. Terlihat sebagian peralatan yang pernah digunakan di masa lalu masih berada balik istana tersebut, di antaranya cermin besar yang megah, kursi raja, lampu hias dari Eropa serta ornamen dan bahan bangunan yang telah berkualitas. Berwisata ke kawasan tersebut sangat nyaman dari segala sisi, baik dari suasana hati, biaya menikmati wisata kuliner di Taman Kolam Sri Deli yang murah setelah itu melakukan shalat di Masjid Raya Al Mashun yang teduh. Rasid warga Jl. Amaliun yang sedang menikmati rujak di sekitar Taman Kolam Sri Deli mengatakan, lokasi tersebut saat ini terkesan menjadi biasa saja karena sebagai situs sejarah terlihat biasa saja. Tidak menonjol lagi kesan klasiknya sebagai sisa masa lalu karena telah banyak dipoles dan beberapa bagian telah berubah bentuk, katanya. Sementara itu, Sekretaris Umum Yayasan Sultan Ma’Moen Al Rasjid T Mucrizad Fauziddin, Jumat (11/11), menuturkan, Istana Maimoon peninggalan sejarah Kesultanan Deli saat ini masih dikelola pihak keluarga istana. Untuk perawatan dan berbagai biaya lainnya seperti membabat rumput seluas 1,6 hektar berbiaya Rp1,2 juta dilakukan dua kali sebulan, berikut perbaikan kerusakan serta rekening listrik danlainnyamasihditangulangisendiriolehyayasan. Yayasan yang dikelola pihak kerabat istana tersebut juga masih menanggung biaya beberapa sekuriti yang dikerjakan untuk menjaga taman halaman Istana Maimoon, agar tidak digunakan sembarangan oleh masyarakat sekitar. Setiap tahunnya biaya yang diperlukan untuk sekuriti, perawatan dan pelestarian lainnya

menghabiskan dana Rp100 juta lebih ditambah untuk kesejahteraan petugas pengelola yang melayani pengunjung istana. Banyak yang dilakukan Yayasan Sultan Ma’Moen Al Rasjid untuk menjaga peninggalan kerajaan Deli tersebut agar ikonnya sebagai warisan budaya kota Medan tidak memudar, di antaranya tidak diperbolehkannya ruangan dalam istana untuk kegiatan umum. Agar lebih menarik minat pengunjung yayasan rencananya akan membuat pajangan benda-benda pusaka Kesulatanan Deli di dalam Istana agar dapat dinikmati pengunjung, seperti piring yang digunakan dalam acara kebesaran kenegaraan, senjata dan lainya sehingga mirip museum. Selain itu, larangan dan berbagai bentuk yang akan ditampilkan untuk menjaga suasana dan aturan guna menjaga kelestarian budaya. Sedangkan Taman Sari Deli saat ini telah menjadi aset Pemko Medan sehingga pihak istana tidak dapat mencampurinya. Untuk Masjid Raya Al Mashun di kelola oleh badan kenaziran masjid (BKM) dari pihak kesultanan, namun manajemennya terpisah dengan pengelolaan Istana Maimoon, sebut Mucrizad. Sedangkan biaya rutin yang diberikan pemerintah daerah untuk merawat dan menjaga istana sebagai situs bersejarah hingga saat ini tidak ada, namun istana pernah beberapa kali menerima bantuan dari pemerintah daerah untuk pengecatan bangunan dan lainnya. Untuk menanggung beban tersebut yayasan menyewakan halaman untuk acara tertentu, serta menerima masukan dana dari penjualan tiket yang rata-rata perhari jumlah pengunjung sampai 200 orang, sedangkan hari libur meningkat sampai 600 pengunjung setiap harinya. Meski ikon pada situs itu mulai memudar, tetapi tetap saja saat tertentu seperti akhir tahun Istana Maimoon kerap kedatangan tamu dari Eropa dan warga dari luar daerah terutama saat libur sekolah. “Sejarahnya itu sangat kental dan memang tidak ada yang lain bisa dijadikan ikon di kota ini, ya orang tetap datang menikmati tiga aset sejarah dan objek wisata ini,” kata Mucrizad. Dari literatur dan berbagai sumber, Istana Maimoon didesain seorang berkebangsaan asing dan dibangun oleh Sultan Deli, Makmun Al Rasjid Perkasa Alamsjah pada 1888 dengan luas 2.772 m2 memiliki 30 ruangan. Taman Sri Deli dibangun pada masa Kesultanan Deli IX, Sultan Mahmud Al Rasjid Perkasa Alam, kirakira tahun 1910 yang merupakan fasilitas kompleks istana anak-anak Sultan. Masjid Raya Al- Mashun dibangun tahun 1906 di atas lahan seluas 18.000 meter persegi, dapat menampung sekitar 1.500 jamaah dan digunakan pertama kali pada hari Jumat 25 Sya’ban 1329 H ( 10 September 1909). *Sahrizal


Luar Negeri

WASPADA Sabtu 13 November 2010

Polisi: Pengebom Bunuhdiri Serang Daerah Pinggiran Kabul

Pesawat Bersama 36 Orang Jatuh Di Sudan, 2 Orang Tewas

KABUL, Afghanistan (AP): Seorang pengebom bunuhdiri melakukan serangannya di kawasan pinggiran Kabul, ibukota Afghanistan, Jumat (12/11), kata polisi. Belum ada laporan tentang korban. Sasaran pengebom itu tidak diketahui, namun perwira polisi Kabul Mohammed Jamshid mengatakan pengebom mengenai kendaraan lainnya di pinggiran sebelah baratdaya kota itu. Koalisi pimpinan AS mengatakan peristiwa itu kini sedang diselidiki. Meski serangan bom bunuhdiri menjadi biasa di bagian selatan dan timur Afghanistan, di mana NATO berperang melawan Taliban, keamanan telah ditingkatkan di ibukota yang jarang mengalami serangan. Di selatan, sekurang-kurangnya 15 pemberontak terbunuh dalam satu rangkaian bentrokan di provinsi Helmand dan 15 militan lainnya ditangkap selama operasi tiga malam yang bertujuan menangkap para pemimpin Taliban di seluruh Afghanistan, kata NATO Jumat. Perang sengit terjadi Kamis di distrik Sangin setelah seorang anggota patroli gabungan Afghanistan dan NATO dihantam bom rakitan, kata koalisi. Para pemberontak melanjutkan serangan ketika helikopter koalisi mengevakuasi korban. (m07)

KHARTOUM, Sudan (AP): Satu pesawat yang mengangkut 36 orang jatuh saat mendarat di daerah barat Darfur yang mene-waskan sekurang-kurangnya dua orang dan mencederai empat lainnya, demikian menurut pejabat penerbangan Sudan. Abdel Hafiz Abdel Rahim, jurubicara untuk Dinas Penerbangan Sipil Sudan mengatakan pesawat Antonov 26 buatan Rusia itu jatuh di bandara kecil Zalingei, patah dua akibat terhempas dalam pendaratan itu. “Syukurlah sebagian besar penumpang selamat,” katanya kepada The Associated Press. Pesawat milik Tarco Airline berada dalam satu jadwal penerbangan dari Khartoum, ibukota Sudan. Abdel Rahim mengatakan sebab kecelakaan itu masih diselidikinamundiamenjelaskanvbahwabandaratersebutbelumsempurna dan buruk aspalnya. “Di sana banyak pasir dan batu-batu kecil dan belum dipersiapkan untuk penerbangan,” katanya. Tarco Airline adalah salah satu dari sejumlah perusahaan penerbangan kecil yang beroperasi di Sudan yang selalu menggunakan pilot dari Uni Soviet. Sudan memiliki catatan keselamatan penerbangan yang buruk. Mei 2008 lalu, satu pesawat jatuh di satu daerah terpencil di selatan Sudan, yang menewaskan 24 orang, termasuk sejumlah anggota penting pemerintah selatan Sudan. Juli 2003, satu pesawat Boeing 737 milik Sudan Airways dalam penerbangan dari Port Sudan ke Khartoum jatuh tidak lama setelah lepas landas, yang menewaskan semua orang yang ada di dalamnya berjumlah 115. (m07)

10 Tewas Akibat Kebakaran Di Panti Jompo Korsel SEOUL, Korea Selatan (Antara/Reuters): Sekitar sepuluh wanita tewas akibat kebakaran yang menghanguskan panti jompo swasta, Jumat (12/11) dinihari di kota pelabuhan Pohang, di Korea Selatan bagian tenggara, demikian ujar pejabat setempat. Departemen Pemadam Kebakaran Kota mengatakan selain tujuh orang mengalami cedera, kebanyakan korban jiwa merupakan pasien usia lanjut yang tidak dapat berjalan cepat sehingga tidak bisa menyelamatkan diri.”Saat itu saya sedang tidur dan keluar karena melihat cahaya dan api berkobar dari kantor,” ujar perawat jaga pada malam hari, Choi.

Mantan PM Israel Yang Masih Koma Dipindahkan Dari RS JERUSALEM (AP): Mantan PM Israel, Ariel Sharon, yang menderita koma dari tahun 2006 dipindahkan dari rumahsakit ke rumahnya Jumat (12/11). Setelah hampir lima tahun dalam keadaan tanpa daya akibat serangkaian stroke ketika masih menjabat sebagai PM, tim medis mengeluarkan mantan pemimpin Israel itu dari unit rawat intensif dan membawanya dengan ambulans menuju rumahnya di bagian selatan Israel. Kondisinya tidak membaik. Pemindahan dari RS itu merupakan hasil pemikiran medis modern bahwa pasien yang telah lama sakit sebaiknya dirawat‘di masyarakat’ daripada di RS, kata Dr. Shlomo Noi, pejabat dari Rumahsakit Tel Hashomer. Walau Sharon memperlihatkan ‘respon kecil’, tidak ada indikasi dia akan bangun dari koma, kata Noi kepada radio Israel Jumat. “Kami cuma bisa berharap,” katanya. Mantan PM itu, yang punya dua putra, akan dirawat staff medis di rumah. Namun, dia juga akan terus menjalani pemeriksaan teratur di RS. (m18)

Pesawat Mata-mata Korsel Jatuh, 2 Pilotnya Tewas SEOUL, Korea Selatan (AP): Satu pesawat mata-mata jatuh Jumat (12/11) dalam latihan rutin dan kedua pilotnya diperkirakan tewas dalam kecelakaan militer kedua yang melanda Korsel ketika negara itu menjadi tuan rumah KTT G20, kata pejabat AU. Korseldalamkeadaansiagatinggiuntukmenghadapikemungkinan provokasi dari negara tetangga Korut ketika berlangsung KTT G-20 selama dua hari, namun tidak ada indikasi keterlibatan Korut dalam kecelakaan pesawat atau tenggelamnya kapal AL berbobot 150 ton Kamis (11/11). Pesawat patrol RF-4C menabrak gunung di Jeonju, 210 km sebelah selatan Seoul, sekitar pukul 12:30 siang, kira-kira 40 menit setelah lepas landas dari pangkalan di Suwon, tepat di bagian selatan Seoul, kata pejabat itu. Dua jenazah yang diyakini pilot pesawat itu ditemukan di gunung tersebut, kata pejabat, sambil menambahkan tidak ada korban sipil di daratan. PihakAUmelancarkanpenyelidikanuntukmemastikanpenyebab kecelakaan, dan butuh waktu untuk mengambil kesimpulan akhir, katanya. Korsel mengoperasikan sekitar 20 pesawat bekas RF-4C buatan AS setelah membeli mereka dari AU AS, menurut AU Korsel. Kecelakaan pesawat itu terjadi sehari setelah satu kapal AL Korsel tenggelam setelah bertabrakan dengan kapal penangkap ikan di perairan sebelah baratlaut Pulau Jeju.(m18)

Perkawinan Kerajaan, Kini Semua Mata Tertuju Ke William Dan Kate YATTENDON, Inggris (AP): Mereka telah bertemu pada orangtuasatusamalain.Mereka bahkan telah pergi berburu denganorangtuasatusamalain. Kini, masyarakat di desa yang sangat Inggris ini mengatakan, saatnya sekarang untuk Pangeran William (kiri pada gambar kiri) dan gadis lokal Kate Middleton (kanan pada gambar kiri) untuk membuat renAP cana mereka secara resmi. Pangeran muda Inggris yang amat berhati-hati itu telah putussambung berkencan dengan Middleton selama delapan tahun, setelah keduanya bertemu di Universitas St. Andrews. “Kami senang,” kata Pru Shepheard, yang berbelanja hariannya di pertokoan desa tersebut di mana Middleton juga sering berbelanja, yang sering ditemani olehWilliam. “Tindakan mereka akan disebut kegilaan kalau mereka tidak kawin.” Masyarakat yang menantikan saat perkawinan kerajaan itu mengatakan memburu undangan merupakan satu cara untuk menyambut gadis kelas menengah Middleton yang akan menempatkan dirinya ke kelas paling tinggi masyarakat Inggris. Middleton bukan keturunan ningrat: Orangtuanya bekerja di British Airways sebelum mendirikan Partai Piece. Namun latar belakang dapat diterima pada saat monarkhi Inggris bersiap untuk melakukan modernisasi.Ada spekulasi tentang tempat pernikahan, banyak orang mengatakanWilliam menentang Kathedral St. Paul’s, di mana orangtuanya menikah dulu. (m07)


The Associated Press

Satu pemandangan dari kerusakan yang disebabkan oleh serangan bom Kamis malam yang menewaskan 15 orang dan menyebabkan banyak korban lainnya cedera di Karachi, Pakistan, Jumat (12/11). Militan Islam yang menyerang satu fasilitas kepolisian di jantung kota paling besar Pakistan itu melakukan usaha tersebut guna membebaskan sejumlah teman mereka yang ditahan di tempat itu, demikian menurut seorang menteri senior.

Kantor Polisi Karachi Diserang, 18 Tewas KARACHI, Pakistan (Antara/AFP): Kelompok garis keras bersenjatakan senapan dan sebuah bom truk menghancurkan kompleks polisi yang digunakan untuk menahan para tersangka teror di kota Karachi, menewaskan 18 orang dan mencederai 130 orang lainnya. Taliban Pakistan Kamis (11/ 11) mengaku bertanggung jawab atas serangan yang jarang terjadi terhadap pasukan keamanan pemerintah di Karachi, kota yang dilanda ketegangan politik dan berpenduduk 16 juta di Pakistan Selatan itu jauh dari pangkalan-pangkalan kelompok garis keras di barat daya. Karachi adalah pusat ekonomi Pakistan, tempat pasar bursa dan pelabuhan Laut Arab tempat pasokan NATO dibongkar dan dimasukkan ke truktruk untuk mendukung lebih dari 150.000 tentara pimpinan AS yang memerangi gerilyawan Taliban di Afghanistan. Para penyerang menargetkan Departemen Penyelidikan Kejahatan (CID) yang dijaga sangat ketat di tengah kota Karachi tidak jauh dari jaringan hotel bintang lima yang sering dikunjungi warga Barat, konsulat AS dan kantor-kantor pemerintah Pakistan. Satu kelompok penyerang yang melepaskan tembakan, mulai terlibat baku tembak dengan polisi sebelum meledakkan bom mereka dalam satu se-

rangan yang paling tidak menurut seorang pejabat sama dengan serangan tahun 2008 terhadap hotel Marriot berbintang lima di Islamabad yang menewaskan 60 orang. Polisi yang sedang tidak berdinas Mohammad Arshad, 32, menyebut suasananya mengerikan setelah dia berhasil menyelamatkan diri dari ledakan bom itu. “Saya mendengar suara ledakan keras. Saya lari ke arah lokasi itu dan melihat mayat-mayat dan mereka yang cedera tergeletak di lapangan,” katanya kepada AFP dan menambahkan darah terdapat di seluruh tubuhnya. Kompleks itu digunakan untuk menahan para penjahat dan para tersangka teror, dan terdapat satu kantor polisi. “Ada 25 wanita dan 20 anakanak cedera. Sejumlah 130 orang yang cedera telah dibawa ke dua rumah sakit,” kata Hamid Parhiar, ahli bedah dari kepolisian untuk provinsi Sindh, Pakistan Selatan yang ber ibukota Karachi itu, di rumah sakit tersebut kepada AFP. Dokter Semi Jmali di rumah

sakit Jinnah mengkonfirmasikan lebih 100 orang cedera dan mengatakan seorang polisi wanita termasuk di antara mereka yang tewas. Kaca-kaca yang pecah bertebaran sampai sejauh dua kilometer dari lokasi bom itu. “Gedung itu hancur seluruhnya. Saya melihat ada satu lobang berdiameter lima meter,” kata perwira polisi Tariq Razzaq Dharejo kepada AFP. Komandan polisi Sindh mengatakan 18 orang tewas dan para penyerang menghancurkan pagar keamanan di departemen itu dengan melepaskan tembakan terhadap polisi. “Ada baku tembak antara polisi dan para penyerang. Kemudian disusul dengan ledakan bom yang ada di sebuah truk,” kata Salahuddin Babar Khattak kepada wartawan di lokasi itu. Gedung CID digunakan untuk menahan para tersangka teror, katanya tetapi tidak ada tersangka penting ditahan saat ledakan tersebut. Sharmilla Farooq, juru bicara pemerintah Sindh mengatakan lima polisi termasuk diantara mereka yang tewas. Kerjaan Taliban Taliban mengatakan mereka melakukan serangan itu. “Kami bertanggung jawab atas serangan ini. Mereka menggunakan tempat itu untuk menahan dan menyiksa para rekan kami di

sini. Kami akan mentargetkan siapapun yang melakukan ini dengan cara yang sama,” kata juru bicara Taliban Azam Tatriq kepada AFP dari satu lokasi yang tidak diketahui. Serangan-serangan bunuh diri dan bom dituduh dilakukan Taliban dan kelompok garis keras lainnya yang menewaskan sekitar 3.800 orang di seluruh Pakistan, sejak pasukan pemerintah menyerbu satu masjid kelompok garis keras di Islamabad tiga tahun lalu. Serangan bom di Karachi itu terjadi seminggu setelah satu serangan bom bunuh diri terhadap sebuah masjid yang banyak dihadiri jemaah di Pakistan barat laut menewaskan 68 orang. Karachi telah mengalami aksi kekerasan politik terburuknya dalam berapa tahun belakangan ini, dengan lebih dari 150 orang tewas sejak Agustus. Mayoritas penduduk kota itu berbahasa Urdu, dan para migran Pashtun saling menyalahkan atas aksiaksi kekerasan itu. AS sering menyerukan Pakistan meningkatkan perangnya terhadap kelompok garis keras yang menurutnya meningkatkan pemberontakan pimpinan Taliban di perbatasan Afghanistan. Anggota Komite Hubungan Luar Negeri Senat AS Kirsten Gillibrand yang kini berada di Islamabad,mengulangipesanitu.

Pendukung Suu Kyi Persiapkan Penyambutan Pembebasannya YANGON, Myanmar (AP): Ratusan pendukung pemimpin pro-demokrasi Myanmar, Aung San Suu Kyi berkumpul di markasbesar partai politiknya Jumat (12/11) ketika salah seorang pemimpinnya mengatakan satu perintah pembebasannya telah ditandatangani oleh penguasa junta. Tahanan rumah Suu Kyi secara resmi berakhir Sabtu namun desas-desus tersebar diYangon menyebutkan dia kemungkinan dibebaskan Jumat pagi. Pemenjaraan dan penaha-

nan rumahnya selama lebih dari 15 tahun dari 21 tahun kepulangannya ke Myanmar, penerima Hadiah Nobel Perdamaian itu telah menjadi simbol bagi perjuangan untuk menyingkirkan pemerintahan militer selama beberapa dasawsarsa di negeri itu. “Beberapa sumber saya mengatakan bahwa perintah pembebasannya telah ditandatangani,” kata Tin Oo, wakil ketua partai Suu Kyi. “Saya berharap dia akan dibebaskan segera.” Dia tidak mengatakan kapan Suu

Kyi dibebaskan atau bila perintah tersebut ditandatangani. Kira-kira 300 orang berkumpul dengan penuh harap untuk dapat melihat pembebasan Suu Kyi di markasbesar Liga Nasional untuk Demokrasi, sebagian mengenakan kaos oblong yang bertulisan, “Kami berdiri bersama anda.” “Tidak ada hukum untuk menahab (Suu Kyi) sehari lagi. Masa penahanannya berakhir Sabtu dan dia segera dibebaskan,” kata pengacaranya Nyan Win kepada para wartawan.

Negara itu telah melakukan pemilihan pertama dalam masa dua dasawarsa Minggu lalu dalam apa yang disebut junta satu langkah besar menuju demokrasi, namun Suu Kyi dilarang ambil bagian dan para pengeritiknya menyebut pemungutan suara itu suat hal yang memalukan yang bertujuan memperkuat kekuasaan militer. Media pemerintah mengumumkan Kamis bahwa partai politik pro-junta telah memenangkan satu mayoritas di dua majelis Parlemen.(m07)

TOKYO, Jepang (Antara/AFP): Tokyo akan mengirim sekitar 100 tentara ke sebuah pulau Jepang yang terpencil di Laut China Timur,ditengahkecemasanyangmeningkatkarenakegiatanangkatan laut China, demikian menurut laporan. Tentara-tentara darat itu akan digelar di pulauYonaguni, di ujung paling barat Jepang, untuk melakukan patroli pantai dan pengawasan pada kapal-kapal angkatan laut China, kata beberapa pejabat pertahanan Jepang seperti dikutip oleh kantor berita Jiji. Tokyo akhirnya merencanakan untuk menggandakan jumlah tentara yang ditempatkan di Yonaguni, yang kira-kira 100Km di timurTaiwan, kata laporan itu. Menteri PertahananToshimi Kitazawa Kamis (11/11) menekankan pentingnya untuk meningkatkan pertahanan di daerah-daerah pulau, termasuk Yonaguni, pada pertemuan komisi keamanan Dewan Perwakilan Rakyat, lapor Jiji. Kementerian pertahanan meminta 30 juta yen (kira-kira AS$365.000) dari anggaran tahun depan untuk “riset persiapan” mengenai masalah itu, kata laporan tersebut. Militer Jepang secara tetap telah mengirim pesawat patroli ke wilayah itu tapi tidak memiliki fasilitas pengawasan tetap di Yonaguni. Aktivitas angkatan laut China yang meningkat telah memicu pemikiran kembali pertahanan di mana Jepang telah mempertimbangkan pengiriman lagi pasukan ke pulau-pulau selatannya yang tersebar dan jauh dari pangkalan era Perang Dingin di Utara dekat Rusia.

Pertemuan Clinton-Netanyahu Tidak Hasilkan Terobosan NEW YORK (AP): Menlu AS Hillary Rodham Clinton dan PM Israel Benjamin Netanyahu mengadakan satu pertemuan Kamis waktu NewYork (Jumat 12/11WIB) namun gagal membuat terobosan untuk menembus kebuntuan perundingan damai Timur Tengah. Setelah pertemuan yang dilakukan berulangkali selama tujuh jam, Clinton dan Netanyahu mengatakan dalam satu pernyataan bersama bahwa mereka ‘telah memiliki satu pertukaran pandangan yang bersahabat dan produktif mengenai kedua sisi’ dan ‘ sepakat mengenai pentingnya dilanjutkan perundingan langsung untuk mencapai tujuan-tujuan kami.’ Namun tidak ada isyarat bahwa perundingan Israel-Palestina, yang telah terhenti sejak pertengahan September sehubungan dengan berlanjutnya pembangunan pemukiman. Pernyataanitumengatakankeduanyasetujumengenai‘pentingnya kelanjutan perundingan langsung,’ namun mereka tidak memberikan keterangan upaya untuk keluar dari kebuntuan mengenai pendirian bangunan oleh Yahudi di Tepi Barat dan Jerusalem Timur. Warga Palestina menolak berunding kepada Israel hingga larangan permukiman dijalankan kembali. Saat menjelang perundingan, Presiden Barack Obama dan Hillary memicu pengecaman dunia kepada rencana terbaru Israel untuk membangun 1.300 tempat tinggal di kawasan jajahan Jerusalem timur dimana warga Palestina merencanakan untuk mendirikan ibu kota negara mereka di wilayah itu. Pengumuman pekan ini menyarankan Presiden Palestina Mahmoud Abbas untuk menyeru kepada Dewan Keamanan PBB dalam mendesak penentangan pendirian bangunan Israel yang memperumit AS. (m07)

Studi: Masalah Jerawat Boleh Jadi Tingkatkan Risiko Bunuhdiri LONDON, Inggris (AP): Masyarakat dengan jerawat yang berlebihan kemungkinan berisiko lebih tinggi untuk melakukan bunuhdiri, demikian menurut satu studi baru. Para peneliti Swedia di Institut Karolinka mendata dari hampir 6.000 orang yang berlangganan obat-obatan, isotretinon, antara tahun 1980 sampai 1989. Pengobatan itu secara umum telah menjadi langganan untuk merawat serius jerawat sejak 1980an. Para ilmuwan membandingkan informasi pasien sampai ke catatan keluar rumah sakit dan daftar kematian dari 1980 sampai 2000. Menurut catatan itu, 128 dari orang yang disurvei dimasukkan ke rumah sakit setelah dia berusaha bunuhdiri. “Jerawat parah bukan kondisi yang dapat disepelekan,” kata Anders Sundstrom dan sejumlah rekannya. “Hal ini terkait dengan peningkatan risiko percobaan bunuhdiri.” Para pakar menemukan jumlah usaha bunuhdiri meningkat antara kira-kira satu dan tiga tahun setelah mulai menjalani perawatan. Namun risiko paling tinggi nampaknya dalam enam bulan setelah perawatan berakhir. Pengobatan biasanya berlangsung beberapa bulan, dengan beberapa pasien membutuhkan therapi berulang, demikian kata laporan itu. Ada pasien yang jerawatnya membaik setelah menjalani perawatan, namun dia masih kecewa jika dia tidak mencatat perbaikan besar didalam kehidupan sosialnya. Sundstrom dan sejumlah rekannya menegaskan bahwa usaha bunuh diri yang ada hubungan dengan jerawat merupakan suatu kejadian langka: ada kira-kira satu usaha bunuhdiri bagi setiap 2.300 orang yang menggunakan obat-obatan perawatan jerawat. (m07)


WASPADA Sabtu 13 November 2010


Sekaranglah Saatnya Impian Itu Diraih

Waspada/Austin Antariksa

Vagner Luis (tengah) harus siap diganti pemain asing lain jika dokumennya belum rampung jelang kompetisi Divisi Utama nanti.

PSMS Siap Ganti Pemain Asing MEDAN (Waspada): Manajer Tim PSMS Medan untuk Divisi Utama, Idris SE, menegaskan pihaknya siap menggantikan pemain asing apabila hingga menjelang dua atau tiga hari berlangsungnya kompetisi pada 19 November mendatang, belum kunjung siap dokumennya. Dihubungi di Mess Kebun Bunga Medan, Jumat (12/11), Idris mengakui hingga kini dokumen trio asing Jose Sebastian, Vagner Luis dan Gaston Castano masih tanda tanya walau sudah menandatangani kontrak. “Sebenarnya ini urusan agen pemain masingmasing yang ternyata tidak mau mengurusnya apabila PSMS tidak menambah 5 persen lagi uang kontrak dari jumlah kontrak ketiganya,” terang Idris. Manajemen sendiri menolak permintaan dari agen Sebastian, Luis dan Gaston karena tidak tercantum dalam isi kontrak. Sebaliknya, manajemen akan balik menuntut agen sean-

dainya Gaston cs kembali ke agennya. Menanggapi masalah ketiga legiun asingnya itu, Pelatih PSMS Zulkarnaen Pasaribu siap mendukung rencana manajemen mencari pemain lainnya. “Kalau manajemen sudah membuat keputusan seperti itu, pihaknya siap mendatangkan pemain asing yang lebih baik,” katanya. Sementara itu, Asisten Manajer Drs Benny Tomasoa secara terpisah mengaku telah berkoordinasi dengan agen ketiga pemain tersebut. Namun hingga saat ini dokumen mereka belum selesai. “Dokumen ketiganya memang belum siap. Saya terus berkordinasi dengan agen ketiganya atas instruksi manajer tim. Kita pun berharap dokumen Sebastian, Luis dan Gaston bisa siap sebelum berlangsungnya kompetisi nanti,” ujar Benny menambahkan pihaknya belum mengirimkan nama pemainnya ke PSSI akibat masalah tersebut. (m24)

Kesempatan Berguru Ke Uruguay PSSI Sumut Jaring Pemain Muda MEDAN (Waspada): Pengprov PSSI Sumut dipercaya menggelar penjaringan pemain muda kelahiran 1994 dan 1995 yang nantinya akan ‘berguru’ di Uruguay dalam pembentukan tim baru program Uruguay Project 2011. Selain Sumut, penjaringan pemain muda juga dilakukan di beberapa daerah di tanah air. Untuk Sumut, seleksi akan digelar dalam dua tahap. Tahap pertama berlangsung 27-28 November nanti di Stadion Teladan Medan untuk menjaring 66 pemain yang selanjutnya berhak seleksi tahap kedua pada 30 November-1 Desember mendatang. “Seleksi pemain tahap kedua akan dipandu tim Badan Pembinaan dan Pengembangan Pemain Usia Muda (BPPUM) PSSI yang terdiri dari Direktur Teknik PSSI Sutan Harhara, Manajer Pemandu Bakat Usia Muda Yeyen Tumena dan Asisten Pelatih SAD Indonesia Wilson Espina (Uruguay),” ujar Plt Ketua Umum PSSI Sumut Erwis Edi Fauza Lubis didampingi Sekum Choking Susilo Sakeh, Jumat (12/11). Dikatakan, nantinya tim BPPUM sendiri yang menentukan pemain yang layak mengikuti seleksi

tingkat nasional di Jakarta, 13-18 Desember 2010. Seleksi tahap akhir yang menentukan pemain berlatih di Uruguay dipantau langsung Pelatih SAD Indonesia, Cesar Payovich Perez (Uruguay). “Kita sangat berharap nantinya ada beberapa pemain Sumut yang terpilih mengikuti seleksi tingkat nasional dan kembali terpilih berlatih ke Uruguay,” ujar Erwis. Ada pun kriteria pemain yang diharapkan mengikuti seleksi adalah memiliki daya tahan, power dan kecepatan yang tinggi serta karakteristik pemain yang memiliki teknik, bakat, daya juang dan perilaku positif. “Selain itu, tidak kalah penting pemain harus memiliki tinggi badan minimal 175 cm (kiper/ bek), minimal 170 cm untuk posisi sayap/striker dan 166-170 cm untuk gelandang,” pungkas Erwis. Bagi calon peserta seleksi tersebut dapat mendaftar ke Sekretariat Pengprov PSSI Sumut Jl. Sekip Baru Medan dengan membawa ijazah asli, kartu keluarga serta fas foto ukuran 3x4 (4). Untuk informasi lebih lanjut, dapat menghubungi 081362122264/085262133507. (m42)

Waspada/Dedi Riono

Tim Eksekutif Bank Sumut (atas) diabadikan bersama tim Bank Indonesia usai menjuarai Turnamen Piala Bank Sumut di Stadion Mini USU, Jumat (12/11).

Kalahkan BI, Bank Sumut Juara

SEKARANGLAH saatnya impian membawa PSMS Medan melangkah ke Liga Super. Kalau tidak, sulit lagi untuk mengupayakannya karena belum tentu kekuatan tim lebih bagus yang ada sekarang. Manajer PSMS Idris SE bersama asistennya Drs Benny Tomasoa dan pelatih Zulkarnaen Pasaribu menyadari walau kickoff baru bergulir pekan depan, aroma euforia di kubu PSMS mulai terasa. Bermaterikan pemain yang lebih baik dari musim lalu, impian promosi Liga Super musim depan optimis dicapai. Ketiganya yang ditemui

di Stadion Kebun Bunga Medan, Jumat (12/11), mengisyaratkan proses pemusatan latihan yang dilakoni sejak Agustus lalu menjadi bukti keseriusan tim Ayam Kinantan. Bahkan, dari 24 pemain yang ada di PSMS, lima pemain musim lalu yang bertahan telah memulai persiapan sejak kompetisi musim lalu berakhir. Materi pemain yang ada saat ini juga menurut ketiganya lebih siap. Kehadiran bek-bek tangguh untuk menopang tiga kiper yang relatif punya skill berimbang semakin menjelaskan soliditas di lini pertahanan. “Saya memang tidak tahu

persis kekuatan tim rival, tapi dengan kesiapan lini bawah yang digawangi tiga kiper terbaik serta bek berkemampuan relatif berimbang, saya rasa lini ini merupakan barisan terkuat PSMS saat ini,” ungkap Idris. Selama masa persiapan, Rachmat, Novi Hendriawan, Rifki Firdaus, Hary Syahputra, M Parlin dan bek Brazil Vagner Luis telah menunjukkan kemampuannya. Mereka bahkan berperan besar menjaga rekor 18 kemenangan tanpa kalah yang dibukukan PSMS selama ujicoba. Di lini tengah, kemampuan merata Faisal Azmi, Zulkarnain

disokong pengalaman M Affan Lubis serta playmaker Jose Sebastian tidak perlu diragukan. Tidak itu saja, Idris mengaku optimis dengan kemampuan lini depan The Killer pasca hadirnya Kurniawan Dwi Julianto, Gaston Castano dan Rinaldo. “Kompetisi nanti paling tepat menjadi ajang pembuktian bagi lini depan. Saya optimis dan masih berharap banyak kepada penyerang kami. Mudah-mudahan mereka tidak mengecewakan,” harap Idris. Asisten Manajer PSMS Benny Tomasoa mengungkapan hal senada dengan mengaku cukup puas dengan performa yang

ditunjukkan 24 punggawa PSMS. “Seiring waktu, persiapan tim semakin matang. Itu terlihat dari semakin baiknya hasil ujicoba. Dari sisi persiapan, tim kami termasuk tim yang cukup lama menggelar persiapan,” sebut pria berdarah Ambon ini. Di lain pihak, Zulkarnain Pasaribu mengaku timnya siap menyongsong bergulirnya kompetisi. “Tidak mungkin tidak siap, tapi saya tidak ingin terlalu banyak bicara dulu, takut dibilang omong besar. Pembuktiannya nanti saat bergulirnya kompetisi,” tegas Bang Zul. *H Syahputra MS

Teladan Pentingkan Non Olahraga PSMS Batal Tanding MEDAN (Waspada): Laga ujicoba PSMS Medan kontra Arjuna FC terpaksa dibatalkan setelah Stadion Teladan yang sedianya diplot sebagai lokasi pertandingan dipergunakan untuk kegiatan non olahraga. Alhasil, pembatalan ujicoba ini mengecewakan banyak pihak terutama warga Medan yang berniat menyaksikan laga pemanasan ke-19 dari skuad Ayam Kinantan tersebut, khususnya kubu Arjuna FC yang telah tiba di stadion. Menurut Pelatih Arjuna FC, Jumadi, dirinya baru mendapatkan informasi pembatalan dari PSMS pada pukul 17.00 WIB. Dikatakan, rombongan tim telah berangkat sejak pukul 16.00 WIB. “Tadi pihak PSMS telah konfirmasi batalnya pertandingan karena Stadion Teladan dipakai acara lain. Kami sengaja

Waspada/M Hamdani Wibowo

Laga ujicoba PSMS Medan batal digelar di Stadion Teladan Medan, Jumat (12/11) malam, akibat kegiatan yang tidak berkaitan dengan olahraga. berangkat dari Marelan sejak pukul 16 guna menghindari macet,” ujarnya. Meski begitu, pihaknya tidak menyalahkan PSMS selaku tuan rumah. “Kita maklum karena pemilik stadion kan bukan PSMS yang juga tidak menyangka Teladan dipakai untuk kegiatan lain,” tukas Jumadi lagi. Saat dikonfirmasi kepada

Biranta FC Tekad Ulangi Sukses MEDAN (Waspada): Biranta FC berterkad mengulangi sukses menghadapi Putra Buana FC pada pertandingan kedua grup B kompetisi Pengcab PSSI Medan di lapangan kompleks Sekolah Harapan 3, Jl Karya Wisata Johor Permai, Minggu (14/11) nanti. Demikian disampaikan Ketua Umum Biranta FC IrYose Rizal didampingi Sahrul, manajer tim M Yacob dan pelatih Setujuono kepada Waspada, Jumat (12/11). Dikatakan, kemenangan perdana 4-1 melawan Sinar Belawan pekan lalu membuat kepercayaan diri Budi Santoso cs semakin tinggi. “Diharapkan pada laga melawan Putra Buana, pemain Biranta dapat lebih meningkatkan daya gedornya, memperketat barisan bawah serta memberi suplai akurat dari lini tengah,” pinta Yose Rizal. “Saya sudah memberikan suntikan semangat kepada pemain, agar lebih konsisten dalam serangan dengan tidak memberi kesempatan lawan mengolah bola terlalu lama. Tidak ada alternatif lain bagi Rony Syahputra cs kecuali memenangkan partai kedua sebagai upaya menambah kekuatan mental jelang partai berikutnya,” kata Yose yang juga Direktur PT Jorindo Agung. Pada kompetisi Pengcab PSSI Medan, Biranta FC berada di grup B bersama Perisai Pajak, Kinantan, Bintang Utara, Sinar Belawan dan Putra Buana. Untuk mencapai target, Biranta FC harus lolos dari grup. (m25)

Sekretaris Tim PSMS, Fityan Hamdi, pembatalan ini memang tiba-tiba karena pihaknya sendiri baru mendapat kabar dari Dinas Pertamanan pada pukul 17.30 WIB. Kekecewaan juga dialami masyarakat Medan yang bermaksud menyaksikan langsung laga ujicoba tersebut. Kendati begitu, para pecinta PSMS pu-

lang dengan kecewa dalam keadaan tertib. Sebaliknya, di dalam stadion terlihat sejumlah panitia sibuk menata panggung untuk persiapan acara yang kabarnya mengundang salah satu artis top Indonesia. “Kita tahunya dari koran kalau PSMS main malam ini, tapi ternyata batal. Cukup mengecewakan lah,” ujar Rizki, salah se-

orang fans setia PSMS yang datang bersama rekan-rekannya. Selain Rizki, banyak warga Medan lainnya yang hilir mudik dan cukup heran dengan kondisi stadion yang biasanya riuh oleh suara penonton justru terlihat adem ayem. “Udah siap mainnya? Loh, nggak jadi ya?!” tanya salah seorang warga. (m33)

Tolak Lapangan Kuala Bekala Jadi Arena Pasar Malam MEDAN (Waspada): Sejumlah pengurus klub HMP FC Medan menolak lapangan sepakbola Kuala Bekala, Jl Luku I Medan, dijadikan arena hiburan rakyat pasar malam hingga akan mengganggu proses pembinaan pemain. “Selain HMP FC, lapangan itu juga menjadi tempat latihan puluhan siswa SSB HMP Jaya dan sangat disayangkan kegiatan latihan mereka terhenti karena pasar malam,” ujar Ketua Umum HMP Suradi LS dan Ketua Harian Terkelen Sembiring di Medan, Jumat (12/11). Dikatakan, bukan saja menghentikan kegiatan latihan,

dampak dari kegiatan pasar malam juga besar terhadap kerusakan lapangan. “Selama ini lapangan Kuala Bekala kita rawat dengan dana swadaya pengurus HMP. Sangat disayangkan lapangan yang sudah bagus kembali rusak gara-gara pasar malam,” katanya. Untuk itu, lanjut Suradi, kita meminta kepada pihak Kecamatan Medan Johor serta Kelurahan Kuala Bekala mempertimbangkan pemberian izin terhadap acara pasar malam yang rencananya digelar dalam waktu dekat sekaligus menyambut Tahun Baru 2011. Koordinator pelatih HMP

Sakino Nugroho menambahkan, setiap tahunnya lapangan Kuala Bekala telah dijadikan arena pasar malam dan ironisnya tidak ada upaya pembenahan kembali terhadap lapangan yang rusak baik dari penyelenggara maupun pemberi izin. “Kita berharap mulai tahun ini tidak ada lagi kegiatan pasar malam di lapangan Kuala Bekala, karena sesuai fungsinya lapangan itu untuk kegiatan olahraga,” ujar Sakino seraya mengatakan timnya Sabtu (13/11) ini di Stadion Kebun Bunga akan melakukan tanding ujicoba dengan PSMS Medan besutan Suharto. (m42)

Sepakbola Eksekutif MEDAN (Waspada): Bank Sumut menjuarai Turnamen Sepakbola Eksekutif Piala Bank Sumut setelah di final mengalahkan Bank Indonesia (BI) 3-2 di Stadion Mini Universitas Sumatera Utara (USU), Jumat (12/11). Tanpa diperkuat H Gus Irawan SE Ak MM yang juga Dirut PT Bank Sumut, permainan menyerang tim “Oranye” merepotkan barisan pertahanan BI. Gol penentu Bank Sumut sendiri dicetak HM Yahya yang juga Direktur Umum PT Bank Sumut pada dua menit menjelang pertandingan berakhir. Sebelumnya, Yahya membuka gol pertama Bank Sumut saat pertandingan belum genap satu menit. Gol kedua dilesakkan Hadi Susanto,

sedangkan angka balasan BI dicetak Winter dan Surianto. Dalam laga itu, Bank Sumut menurunkan Hendro, HMYahya, Jendi, TM Zefry, Hasanuddin, Hadi Susanto, Fredy Hutabarat, Syahrul, Ismail Warta, Syamirdan, Abdul Rahman, Suardi dan Supianto. Bank Indonesia bermaterikan Joni, Mulkan, Fery Charles, Setia Budi Kuncoro, Erwin M, Indra Bakti, Hery Aprianto, Irwan Mahmud, Winter, Hanafi, Arya Hadi, Rahim Damasir dan Surianto. Turnamen sepakbola dalam rangka memperingati HUT Bank Sumut ke-49 masih berlanjut dengan kategori prestasi yang dijadwalkan berakhir Rabu (24/11) mendatang. (m20)

Problem Catur Hitam melangkah, mematikan lawannya empat langkah.

Jawaban di halaman A2.



Mendatar 1. Kepanjangan Jupe, penyanyi dangdut yang diadukan Dewi Perssik ke polisi karena kena cakar. 7. Kepanjangan Depe, penyanyi dangdut yang masuk grupnya Ahmad Dhani. 8. Nama panggilan istri Raul Lemos yang berseteru dengan penyanyi Krisdayanti. 10. Instrumen di dalam rumah atau mobil untuk mendengar siaran musik. 11. Tokoh boneka karya Kak Seto yang pernah tampil di tv. 12. Salah satu aliran musik, singkatan dari populer. 14. Lagu (Inggris). 16. Nama kota di Jawa Barat yang disebut dalam lagu perjuangan tentang peristiwa 29 Maret 1946. 18. Jaringan melalui saluran telefon untuk mendownload filem dan lagu ke komputer. 19. Grup beberapa pemain instrumen musik. 21. Singkatan instrumen musik saxophone, mengabadikan nama penciptanya Adolphe _____, asal Belgia. 23. Alat musik tiup, terbuat dari buluh. 25. Peran utama; Karangan berupa cerita sandiwara dengan percakapan langsung. 26. Penyanyi Indonesia, dikenal dengan lagu Lidah Tak Bertulang dan Widuri.

Menurun 1. Aktris Amerika yang melakukan syuting filem di Bali, nama panggilannya sama dengan kepanjangan “Ju” dari Jupe. 2. Judul filem serie anak-anak produksi Walt Disney, kisah kerjasama tim enam super hero dalam menghadapi setiap tantangan.Masing-masing dikenali dari warna seragam besinya, disiarkan tv dunia, termasuk Indosiar. 3. Genre musik, bagian dari gaya hidup hip-hop. 4. Tokoh legenda berbaju hitam dan bertopeng, menulis huruf Z dengan pedang olahraga anggar di tangannya usai memberantas kejahatan. 5. Orang yang mencipta, memimpin atau menampilkan musik. 6. Hasil memindahkan suara ke dalam pita kaset atau disk. 9. Bergaya modern; Mengetren. 13. _____ Burnama, aktor senior Indonesia yang meninggal barubaru ini. 15. Gendang besar; Tambur. 17. Tiruan bunyi genderang. 20. Nikita Purnama ______, artis sinetron RCTI. 22. Jenis saxophone lebih kecil dari tenor dan lebih besar dari so prano. 24. Gerakan musik; Tempo, dari bahasa Inggris beat.

Sudoku 10x10

Isi kotak kosong dengan angka 0 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 5x2 bergaris tebal. Tidak ada keterlibatan matematika, hanya perlu pertimbangan dan logika. Jawaban di halaman A2 kolom 1.

5 1 0 4 9 5 0 4 9 9 8 4 0 8 6 1 9 7 0 3

4 6 5 3 4 3 0 7 3 4 1 9 7 0 3 2 0 6 7 7

3 0 2 7

5 6 7 3


A10 Sabtu, 13 November (GMT) Newcastle v Fulham (1500) Tottenham v Blackburn (1500) Wigan v West Bromwich (1500) Wolverhampton v Bolton (1500) Aston Villa v Man United (1245) *Global Live pkl 19.45 WIB West Ham v Blackpool (1500) *Global Live pkl 22.00 WIB Man City v Birmingham (1500) *MNC Tv Live pkl 22.00 WIB Stoke City v Liverpool (1730) *MNC Tv Live pkl 00.30 WIB

Minggu, 14 November

Everton v Arsenal (1400) *Global Live pkl 21.00 WIB Chelsea v Sunderland (1610) *MNC Tv Live pkl 23.00 WIB

Klasemen Liga Premier Chelsea 12 9 1 2 Man United 12 6 6 0 Arsenal 12 7 2 3 Man City 12 6 3 3 Newcastle 12 5 2 5 Bolton 12 3 7 2 Tottenham 12 4 4 4 Sunderland 12 3 7 2 Liverpool 12 4 4 4 Aston Villa 12 4 4 4 West Brom 12 4 4 4 Everton 12 3 6 3 Blackburn 12 4 3 5 Blackpool 12 4 2 6 Fulham 12 2 7 3 Stoke 12 4 1 7 Birmingham 12 2 6 4 Wigan 12 2 5 5 Wolverhampton 12 2 3 7 West Ham 12 1 5 6

28- 5 28 24-13 24 24-11 23 15-10 21 21-16 17 18-17 16 14-15 16 12-13 16 13-15 16 13-16 16 16-21 16 13-11 15 13-14 15 19-26 14 13-13 13 13-18 13 14-17 12 9-21 11 11-20 9 11-22 8

Sabtu, 13 November (GMT) Ath Bilbao v Almeria (1700) *TVOne Live pkl 00.00 WIB Atl Madrid v Osasuna (1900) *TVOne Live pkl 02.00 WIB Barcelona v Villarreal (2100) *TVOne Live pkl 04.00 WIB

Minggu, 14 November Hercules v Sociedad Malaga v Levante Santander v Espanyol Mallorca v Deportivo Zaragoza v Sevilla *TVOne Live pkl 23.00 WIB S Gijon v Real Madrid *TVOne Live pkl 01.00 WIB Valencia v Getafe *TVOne Live pkl 03.00 WIB

(1600) (1600) (1600) (1600) (1600) (1800) (2000)

Klasemen Liga Primera Real Madrid Barcelona Villarreal Espanyol Valencia Sevilla Sociedad Atl Madrid Mallorca Ath Bilbao Getafe Osasuna S Gijon Santander Deportivo Almeria Hercules Levante Zaragoza Malaga

10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10

8 8 7 6 5 5 5 4 4 4 4 3 2 3 2 1 2 2 1 2

2 1 2 0 2 2 1 2 2 1 1 3 4 1 4 6 3 2 4 1

0 1 1 4 3 3 4 4 4 5 5 4 4 6 4 3 5 6 5 7

27- 5 26 22- 7 25 21- 8 23 9-13 18 14-11 17 16-16 17 13-12 16 13-12 14 11-12 14 18-18 13 15-16 13 11-10 12 10-16 10 9-16 10 8-15 10 8- 9 9 9-15 9 10-18 8 10-17 7 14-22 7

WASPADA Sabtu 13 November 2010

Sabtu, 13 November (GMT) Fiorentina v Cesena Juventus v AS Roma

(1700) (1945)

Minggu, 14 November SS Lazio v Napoli Bari v AC Parma Bologna v Brescia Cagliari v Genoa Palermo v Catania Sampdoria v Chievo Udinese v Lecce Inter Milan v AC Milan

(1130) (1400) (1400) (1400) (1400) (1400) (1400) (1945)

Pencetak Gol Terbanyak 8 Samuel Eto’o (Inter Milan) Edinson Cavani (Napoli) 6 Marco Di Vaio (Bologna) Fabio Quagliarella (Juventus) Alexandre Pato (Milan) 5 Alessandro Matri (Cagliari) Zlatan Ibrahimovic (Inter) Marco Borriello (Roma)

Klasemen Liga Seri A AC Milan Lazio Napoli Inter Milan Juventus AS Roma Sampdoria Chievo Palermo Catania Genoa Udinese Fiorentina Lecce Cagliari Parma Brescia Bologna Cesena Bari

11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11 11

7 7 6 5 5 5 3 4 4 3 4 4 3 3 2 2 3 2 3 2

2 1 3 5 4 3 6 3 2 5 2 2 3 3 5 5 2 5 2 3

2 3 2 1 2 3 2 4 5 3 5 5 5 5 4 4 6 4 6 6

20-11 13- 9 18-11 13- 6 22-12 14-14 11- 9 11-10 17-16 9- 8 9-11 9-12 12-13 8-18 11-10 7-10 10-14 10-15 8-14 9-18

23 22 21 20 19 18 15 15 14 14 14 14 12 12 11 11 11 11 11 9

Sabtu, 13 November (GMT) Monaco v Arles-Avignon Bordeaux v AS Nancy Montpellier v Toulouse Marseille v Racing Lens Stade Brest v Sochaux Valenciennes v Etienne Caen v LOSC Lille

(1800) (1800) (1800) (1800) (1800) (1800) (2000)

Minggu, 14 November Auxerre v St Rennes FC Lorient v Paris SG Olympique Lyon v Nice

(1600) (1600) (2000)

Pencetak Gol Terbanyak 8 Youssef El Arabi (Caen) Dimitri Payet (St Etienne) 6 Kevin Gameiro (Lorient) Moussa Sow (Lille) Antonio Nene (Paris SG) Gregory Pujol (Valencs) 5 Benoit Pedretti (Auxerre) Gervinho (LOSC Lille)

Klasemen Ligue 1 Prancis Brest Rennes Paris SG Marseille Lille St-Etienne Toulouse Montpellier Lorient Bordeaux Lyon Nice Auxerre Valenciennes Sochaux Caen Nancy Monaco Lens Arles-Avignon

12 6 3 3 12- 7 21 11 5 5 1 13- 6 20 12 5 4 3 18-11 19 11 5 3 3 19-13 18 12 4 6 2 17-13 18 12 5 3 4 16-14 18 12 5 3 4 14-13 18 12 5 3 4 11-12 18 12 5 2 5 13-12 17 12 4 4 4 12-12 16 12 4 4 4 14-15 16 12 4 4 4 11-14 16 12 3 6 3 17-14 15 12 3 6 3 13-12 15 12 4 2 6 19-17 14 12 3 5 4 13-15 14 12 4 2 6 13-22 14 12 2 7 3 13-11 13 12 3 4 5 11-18 13 12 1 2 9 7-25 5 (jonny/espn/ap)

Saat Tepat Lampard TUNTASLAH sudah penantian panjang gelandang Chelsea Frank Lampard. Setelah dua bulan lebih menjadi pesakitan, Si Nomor 8 itu bakal tampil lagi besok malam menjamu Sunderland.

Pemain Parma Francesco Valiani (kanan) melepas tendangan salto saat ditempel pemain Sampdoria Andrea Poli di Stadion Ennio Tardini, Jumat (12/11) dinihari WIB. -AP-

Di Carlo Marah Samp Kalah ROMA (Waspada): Sampdoria kalah 0-1 melawan tim papan bawah AC Parma pada pertandingan berkabut, Kamis (Jumat WIB) di Liga Seri A. Tanpa partisipasi striker Italia Antonio Cassano, Samp mandul di Ennio Tardini. Bomber Bulgaria Valeri Bojinov memastikan kemenangan tuan rumah melalui golnya enam menit menjelang pertandingan usai. Bos Samp Domenico Di Carlo, marah besar atas kekalahan Andrea Poli cs. Terutama mengenai penampilan dan daya juang pasukannya. “Malam ini, saya menurunkan para pemain yang tidak menunjukkan performa terbaiknya. Secara fisik, mereka tidak merespon apa yang saya inginkan,” sesal Di Carlo dalam Sky

Sports, Jumat (12/11). Duel ketat sempat terjadi, terutama sepanjang babak pertama yang berakhir tanpa gol. Kebutuan bahkan baru terpecahkan menit 84, saat Bojinov menjebol gawang kiper Gianluca Curci. “Akhir pekan lalu, kami tidak terlihat lelah sedikitpun. Tapi malam ini, kesalahan berlebihan telah kami lakukan,” kecam Di Carlo. Parma pun naik dari dasar klasemen, sehingga mengurangi tekanan terhadap pelatih Pasquale Marino, yang sudah mendapat peringatan pemecatan dari ketua klub. Il Samp hanya memasukkan satu gol dalam empat laga, terhitung sejak Cassano dihukum karena bertengkar dengan presiden klub Riccardo Gar-

rone. Mantan penyerang Bari, AS Roma dan Real Madrid itu meresponnya dengan menolak untuk menghadiri acara makan malam penyerahan penghargaan. Setelah menyadari kelakuannya yang kekanak-kanakan, Cassano sempat beberapa kali meminta maaf. Garrone belum menjawab, tetapi Samp jelas memerlukan suntikan semangat dan ketajaman Cassano. “Kami butuh menaikkan ritme permainan, tapi di sisi lain kami tidak bisa menyebabkan bencana bagi lawan,” tutur Di Carlo. “Sekarang, kami mesti menatap partai berikutnya melawan Chievo Verona (14/11) untuk mengobati kekalahan ini,” katanya menambahkan. (h01/sky/rtr)

Lampard absen bermain sejak akhir Agustus lalu, terkait pemulihan pasca menjalani operasi hernia. “Saya pikir dia baik-baik saja dan dapat tampil melawan Sunderland,” ucap Ancelotti. Gelandang elegan Inggris itu kembali pada saat yang sangat tepat untuk melawan Sunderland, mengingat lapangan tengah The Blues dipastikan kehilangan gelandang Michael Essian. “Lampard sudah memulai latihan dengan tim utama. Dia tidak merasakan sakit dan juga menunjukan kepercayaan diri,” puji Ancelotti, seperti dikutip dari laman Si Biru, Jumat (12/11). “Saya harap dia benar-benar siap dan bisa tampil selama 90 menit pada pertandingan nanti,” tambah mantan pelatih AC Milan, Juventus dan Parma tersebut. Lampard absen dalam 14 laga terakhir The Blues pada semua kompetisi. Tapi efeknya belum berpengaruh pada kinerja Si Biru, yang masih memuncaki klasemen Liga Premier. Hanya saja kehadirannya langsung bermakna, akibat absennya Essien yang terkena skorsing FA. Essien mencetak gol tunggal kemenangan 1-0 Chelsea atas Fulham, Rabu lalu,

tapi kemudian diusir wasit dengan kartu merah karena menerjang Clint Dempsey. “Wasit sudah mengambil keputusan dan saya tidak suka dengan keputusannya. Saya bisa mengatakan itu mungkin bukan kartu merah, karena Essien berkesempatan mengambil bola, bukan menghadang lawan,” bela Ancelotti. Gelandang Ghana itu berarti mesti absen melawan Sunderland, Newcastle United dan Birmingham City di Liga Premier. “Saya tak pernah berpikir


Dunia 2010 ke Real senilai 18 juta euro, karena pelatih Quique Sanchez Flores tidak menyukainya. “Tidak ada masalah antara Quique dan Forlan, hubungan mereka sempurna. Ketika (Forlan) mulai mencetak gol, tidak seorang pun akan mengatakannya lagi,” papar Cerezo. Bomber berumur 31 tahun itu juga dilaporkan, telah membuat tertarik Tottenham Hotspur dan Juventus untuk memindahkannya dari Vicente Calderon.

Malas Komentari Sukses Getafe MADRID (Waspada): im dari divisi empat Portugalete menahan 0-0 finalis 2007 dan 2008 Getafe pada leg kedua babak 32 besar Copa Del Rey, Jumat (12/11) dinihari WIB. Tuan rumah Getafe tetap lolos berdasarkan agresivitas gol tandang, setelah bermain 1-1 pada leg pertama di markas Portugalete dua pekan lalu. Tetapi, cara sukses seperti membuat pelatih Michel (foto) malas mengomentarinya. “Pada situasi seperti ini, pelatih lebih bernilai bila tidak mengucapkan kata apa pun ketimbang harus berbicara,” dalih Michel, setelah Getafe mandul di Coliseum Stadium. “Kami sudah menjalani lima laga tanpa kemenangan. Banyak hal yang harus diperbaiki, ini merupakan tanggung jawab pelatih dan tidak ada orang lain yang salah,” tegas Michel. Pada pertandingan lainnya, Valencia mengalahkan tim tier ketiga Logrones 4-1 di Stadion Mestalla, sehingga lolos dengan agregat 7-1. Real Mallorca imbang 2-2 di kandang Sporting Gijon untuk melaju dengan agre-

gat 5-3. Sedangkan Malaga menandai debut pelatih Manuel Pellegrini secara dramatis ketika menang 3-2 atas Hercules. Striker Uruguay Sebastian Fernandez, mencetak gol penentu kemenangan jelang bubaran di Rosaleda. Hercules sempat bangkit dari ketertinggalan dua gol untuk membuka peluang lolos dengan agresivitas gol. Keduanya bermain imbang 0-0 pada leg pertama. Mantan pelatih Real Madrid dan Villarreal Pellegrini, menggantikan posisi Jesualdo Ferreira minggu lalu. Dia langsung dihadapkan dengan perlawanan tak kenal lelah dari anak-anak Hercules. Malaga membuka keunggulan menit 10 melalui gebrakan Eliseu. Rekannya dari Portugal Edinho menjaringkan bola lima menit kemudian. Hercules membalas ketika Javier Portillo menggebrak setelah bekerjasama Olivier Thomert di rusuk kiri menit 30. Abel Aguilar membuat tensi meningkat lewat gol penyeimbang ke-

tindakannya konyol. Tidak seharusnya dia mendapatkan kartu merah,” tambah Ancelotti. Tapi tampilnya lagi Lampard, tentu mengobati luka hati Ancelotti serta seluruh punggawa Chelsea. Faktor Lampard juga jaminan bagi Si Biru untuk menerapkan prinsip, pertahanan terbaik adalah dengan menyerang ketika menjamu The Black Cats. Dengan gaya main ofensif seperti itu pula, gawang kiper Petr Cech sepertinya bakalan sulit dikoyak anak-anak Kucing

Hitam di Stamford Bridge, London. Cech sudah sembilan kali clean sheet di depan publik London Blues seusai menaklukkan The Cottagers, sehingga menyamai rekor kiper Chelsea yang tercipta tahun 1927 silam. Kiper Ceko itu berarti telah di ambang pintu untuk melampaui rekor steril gol yang kini telah memasuki angka 1.024 menit di liga, syaratnya jangan sampai kecolongan melawan Sunderland. “Sangat menyenangkan

dudukan yang dia cetak 62. Sayangnya, Aguilar mendapat kartu kuning kedua beberapa saat kemudian. Tekanan pun bertambah kepada tim tamu dan Jesus Gamez memberi umpan kepada Fernandez yang kemudian melesakkan gol penentu kemenangan. Leg pertama babak 16 besar dijadwalkan berlangsung 22 Desember 2010. Kontestannya adalah Valencia, Getafe, Mallorca, Malaga, Sevilla, Villarreal, Atletico Madrid, Levante, Deportivo La Coruna, Almeria, Real Madrid, Real Betis, Barcelona, Athletic Bilbao, Espanyol, dan Cordoba dari Segunda B. (h01/ant/rtr/uefa)

*Jonny Ramadhan Silalahi

Copa America


Franz Beckenbauer ingin menghabiskan waktu bersama istrinya Heidi.

Kaisar Mundur Demi Istri BERLIN (Antara/AFP): Legenda sepakbola Jerman Franz Beckenbauer mengaku, tidak akan ikut lagi dalam pemilihan kepengurusan komite eksekutif badan sepakbola dunia FIFA tahun depan. Tokoh berusia 65 tahun itu yang menjadi kapten dan pelatih Jerman ketika menjuarai Piala Dunia 1974 dan 1990, Kamis (Jumat WIB), melalui media mengatakan alasannya mundur karena ingin lebih dekat dengan keluarga. Pria berjulukan Der Kaizer itu ingin menghabiskan waktunya bersama istrinya Heidi serta anaknya Joel dan Francesca. “Sukar mencari orang yang memiliki jalan hidup yang begitu sibuk seperti saya. Saya bahagia dan berharap dapat menikmati sisa hidup ini dalam waktu yang lama,” ungkapnya. Kaisar terpilih sebagai anggota komite eksekutif FIFA pada Januari 2007, tetapi setelah bulan lalu genap berusia 65 tahun, dia ingin mundur dari hingar-bingar si kulit bundar. “Saya memiliki hubungan baik dengan kolega saya di komite eksekutif serta Presiden FIFA Sepp Blatter dan Presiden UEFA Michel Platini. Saya minta maaf atas keputusan saya ini,” tutur Beckenbauer.

BUENOS AIRES (Waspada): Tamu spesial Jepang gabung tuan rumah Argentina juga Kolombia serta Bolivia di Grup A, sesuai hasil pengundian Copa America 2011, Juli mendatang. Pelatih Sergio Batista (foto), yang mengambil alih tim Tango dari Diego Maradona setelah disingkirkan Jerman pada perempatfinal Piala Dunia 2010, mengaku pasukannya mesti kerja keras untuk menjadi pemenang. “Kami akan melakukan apapun yang kami bisa untuk memenangi Copa America, sudah lama Argentina tidak memenangi apapun. Maka ini adalah turnamen penting bagi kami,” ucap Batista. “Semua tim berat, termasuk Jepang yang datang dengan hebat seperti yang mereka tunjukkan pada Piala Dunia lalu,” akunya lagi, seusai acara pengundian, Jumat (12/11). Pemegang gelar Brazil gabung Paraguay, Ekuador dan Venezuela di Grup B. Grup C terdiri atas semifinalis Piala Dunia 2010 Uruguay, Chile, Mexico dan Peru. Selecao memenangi dua edisi terakhir pada 2004 dan 2007. Sedangkan Tim Tango mengharapkan peruntungan yang lebih baik di kandangnya,


setelah tidak pernah meraih trofi senior sejak juara Copa America di negeri sendiri pada 1993. Argentina dan Uruguay memenangi rekor 14 kali juara, mengungguli Brazil yang baru menang delapan kali. “Bermain di Argentina adalah tekanan tambahan bagi kami, maka kami mesti menyiapkan diri untuk maju dan menang,” tekad Batista.

Bayern Berharap Trio AP

mempunyai rekor tersendiri. Saya sangat senang, tapi yang paling menyenangkan buat saya adalah kami kembali mendapatkan gelar,” ucap Cech dalam AP. Dengan status Blues sebagai penyandang gelar, upaya dimaksud justru teramat berat menurut Cech. “Musim ini kami sebagai juara bertahan, setiap lawan pasti memiliki motivasi berlebih untuk mengalahkan kami,” katanya lagi.

Tango Akui Jepang Hebat

Atletico Bantah Obral Forlan MADRID (Antara/AFP): Atletico Madrid membantah berita, mereka mengobral striker Uruguay Diego Forlan (foto) kepada rival sekotanya, Real Madrid. “Saya tidak pernah punya membicarakan ini. Dalam kasus Forlan, tidak ada yang terjadi, kami tidak tahu apa-apa,” tegas Presiden Atletico Enrique Cerezo, seperti dikutip AFP, Jumat (12/11). Sebelumnya koran Marca edisi Rabu menyebutkan, Atletico telah menawarkan untuk menjual Pemain Terbaik Piala


Frank Lampard kembali saat Chelsea kehilangan gelandang Michael Essien .

BERLIN (Waspada): Harapan Bayern Munich akan meningkat karena bek Diego Contento, gelandang Franck Ribery dan Mark van Bommel, kembali tampil untuk menjamu Nuremberg besok malam di Allianz Arena. “Menyenangkan dan rasa-

Sabtu, 13 November (GMT) Kaiserslautern v Stuttgart FC Koeln v M’Gladbach St.Pauli v B Leverkusen VfL Wolfsburg v Schalke W Bremen v E Frankfurt FSV Mainz v Hanover

(1430) (1430) (1430) (1430) (1430) (1730)

Minggu, 14 November Hoffenheim v Freiburg B Munich v Nuremberg

(1430) (1630)

nya gembira kembali lagi dalam pelatihan. Saya belum 100 persen fit dan saya perlu berlatih lebih banyak,” beber Ribery, seperti dilansir AFP, Jumat (12/ 11). Juara bertahan Bayern terpuruk di urutan sembilan klasemen Bundesliga, setelah mengawali musim dengan kurang mengesankan. Kegentingan di Munich tidak tertolong dengan cederanya playmaker kunci asal Belanda Arjen Robben dan Ribery. Untungnya, pemulihan winger Prancis itu dari cedera pergelangan kaki yang dideritanya sejak September lalu, berjalan dengan baik. Ribery pun bisa bermain lagi akhir pekan ini. Begitu juga kaptenVan Bom-

Jepang akan bertanding dalam turnamen tersebut untuk kedua kalinya setelah debutnya pada 1999 di Paraguay. Saa itu Tim Sakura gagal memenangi satu pertandingan pun. Turnamen itu akan dimulai 3 Juli 2011 dan Stadion Monumental, Buenos Aires. Dua tim teratas pada masing-masing grup dan dua tim urutan ketiga terbaik akan maju ke perempatfinal. (h01/ant/afp)

Klasemen Bundesliga


Kembalinya Mark van Bommel (tengah) dan Franck Ribery membangkitkan semangat FC Hollywood. mel setelah istirahat empat pekan karena cedera lutut, dan Contento yang absen selama enam pekan akibat masalah

kunci paha. Pelatih Bayern Louis van Gaal mengatakan, trio dimaksud bisa keluar dari bangku pemain

Dortmund 11 9 FSV Mainz 11 8 Leverkusen 11 6 Frankfurt 11 6 Hoffenheim 11 5 Hamburg 11 5 Nuremburg 11 5 Freiburg 11 6 B Munich 11 4 Hanover 11 5 W Bremen 11 4 VfL Wolfsburg 11 4 St. Pauli 11 4 VfB Stuttgart 11 3 Kaiserslautern 11 3 FC Schalke 11 2 FC Koeln 11 2 M’Gladbach 11 1

1 0 3 1 3 3 3 0 4 1 2 1 1 1 1 3 2 4

1 3 2 4 3 3 3 5 3 5 5 6 6 7 7 6 7 6

27- 7 19-11 22-16 20-11 22-15 17-15 17-15 17-18 15-13 13-20 19-27 18-19 12-18 22-19 14-21 13-17 13-22 17-33

28 24 21 19 18 18 18 18 16 16 14 13 13 10 10 9 8 7

untuk melawan Nuremberg. FC Hollywood pun berharap banyak pada trio tersebut dalam usaha mengejar ketertinggalannya. (h01/ant/afp/dpa)


WASPADA Sabtu 13 November 2010


Indonesia Urutan 10 Antara

LATIHAN SIMON: Pebulutangkis Indonesia, Simon Santoso, melakukan peregangan otot saat latihan resmi di Tianhe Gymnasium, Guangzhou, China, Jumat (12/11). Bulutangkis masih menjadi cabang andalan Indonesia untuk meraih medali emas pada Asian Games XVI Guangzhou.

Kans China Sapu Bersih Bulutangkis GUANGZHOU (Waspada): Favorit utama China berpeluang besar melakukan sapu bersih medali cabang bulutangkis Asian Games XVI, kendati para pemain top dunia akan turun lapangan di negara mereka. Bahkan pemain nomor satu putera Lee ChongWei menebar kemungkinan akan menghentikan permainan bintang China, Lin Dan. Lin yang dianggap sebagai pebulutangkis terbaik sepanjang masa, turun memimpin timnya untuk pertandingan nomor beregu yang dimulai Sabtu (13/ 11) ini. Tetapi ketika dikonfirmasi mengenai kans sapu bersih tersebut, Lin mengaku; “Kepala saya pusing setiap kali ditanya tentang prospek saya di Asian Games. “Begitu banyak saingan kuat yang akan turun. Sebenarnya, pemain terbaik dunia berasal dari negara Asia, jadi rasanya tidak ada bedanya dengan permainan di Olimpiade,” tambah bintang 27 tahun itu. Bulutangkis menandingkan nomor perorangan dan beregu dengan menyuguhkan tujuh medali emas. “Sehingga rasanya lebih kompetitif,” ucap pelatih kepala tim China, Li Yongbo, seperti dikutip dari AFP, Jumat

JADWAL PERTANDINGAN INDONESIA, SABTU (13/11) - Renang : Triady Fauzi Sidiq 200 meter gaya kupu-kupu putra - Bulutangkis : Penyisihan beregu putri babak satu vs India Perempatfinal putra vs Taiwan/India - Biliar : Ricky Yang vs Do Hoang Quan (Vietnam). Irsal A Nasution vs Prince M Billah (Brunei) - Catur : Putra Susanto Megaranto, putri Irene Kharisme - Tenis : Beregu putri (babak pertama) vs India - Voli Indoor : Beregu putra penyisihan Grup C vs Turkmenistan - Angkat Besi : Kelas 56 kg putra Jadi Setiadi - Wushu : Ivana Ardelia Irmanto (Nanquan dan Nandao) (12/11). “Itulah makanya Asian Games merupakan arena paling unik. Kalau mereka bermain habis-habisan untuk tim, maka mereka akan keteter di nomor perorangan,” katanya lagi. Negeri Tirai Bambu memperagakan penampilan mengesankan di kejuaraan dunia Agustus lalu. Namun menurut Lee ChongWei, tidak hanya Malaysia yang dapat menghancurkan harapan tim tuan rumah. “Korea kelihatannya menjadi tantangan besar bagi China,” tuturnya. Korea Selatan juga ancaman besar partai ganda. Indonesia dan Hongkong pun harus diperhitungkan sebagai ancaman, kendati keduanya kini tidak lagi

sekuat seperti sebelumnya. Jika Simon Santoso cs mampu memainkan performa terbaiknya, maka Indonesia bisa saja dapat bagian medali emas nomor putra. Pemain India Saina Nehwal, pun sedang menikmati masa bersinarnya tahun ini, terutama pada paruh kedua tahun 2010. Dia bahkan berada pada urutan tiga terbesar dunia. Bintang berusia 20 tahun dari Hyderabad itu menjadi putri pertama India memenangi turnamen Super Series. Nehwal datang ke Guangzhou setelah meraih medali emas pesta olahraga negara Persemakmuran di negaranya sendiri baru-baru ini. (h01/ant/afp)

Waspada/Setia Budi Siregar

Ketua Umum KONI Sumut H Gus Irawan SE Ak MM (kanan) dan Ketua Panpel Cabang Tenis Meja Drs Joni Walker Manik (kiri) diabadikan bersama juara ganda campuran tenis meja Porprovsu di GOR Angsapura, Jl Logam Medan, Jumat (12/11).

Sergai Juara Umum Tenis Meja MEDAN (Waspada): Serdang Bedagai (Sergai) tampil sebagai juara umum cabang tenis meja pada Pekan Olahraga Provinsi Sumatera Utara (Porprovsu) di GOR Angsapura, Jl Logam Medan, Jumat (12/11). Sergai mendominasi cabang tenis meja dengan perolehan 3 medali emas dan 2 perunggu. Labuhanbatu menyusul di posisi kedua dengan 2 emas, 2 perak dan 1 perunggu, kemudian Medan di posisi ketiga hasil meraih 1 emas, 4 perak dan 1 perunggu. Posisi keempat ditempati Deli Serdang (1-1-2) diikuti Asahan (0-0-4), Langkat (0-02), Binjai (0-0-1) dan Sibolga juga dengan 1 perunggu. Hadir dalam upacara penghormatan pemenang (UPP) didampingi Ketua Harian John Ismadi Lubis, Ketua PB Porprovsu Drs Chairul Azmi MPd dan Ketua Panpel Drs Joni Walker Manik, Ketua Umum KONI Sumut H Gus Irawan SE Ak MM

mengatakan ini bukan merupakan akhir dari sebuah tujuan, namun awal memperoleh hasil yang lebih baik di masa datang Gus juga tak lupa berpesar kepada pemenang agar tidak berpuas diri dan tetap giat berlatih. Begitu juga sebaliknya bagi yang belum berhasil prestasi. Dari tenis meja, Sergai meraup tiga emas dari beregu putra,Wijanarko(tunggalputra)danganda M Nasser/Wijanarko. Dua perunggu diperoleh dari M Nasser dan Fadhli Syatar di tunggal. Labuhanbatu memperoleh emas di tunggal putri berkat Putrisia Sabrina Nagawan dan ganda Putrisia/Rizki Ratu Sartika. Perak dipesembahkan beregu putri dan tunggal putra Husni Hidayat, sedangkan perunggu didapat ganda Husni Hidayat/Mahlud. Medan memperoleh satu emas dari ganda campuran Asep/Juliani Indah Pratiwi. Empat perak dihasilkan beregu pu-

tra, Juliani Indah Pratiwi (tunggal putri), Af’al Muqarrabin/Sugianto Jurdi (putra) dan Juliani Indah P/Eva Waruwu (putri), sementara perunggu direbut ganda campuran Sugianto Jurdi/Elfa Frida. Empat perunggu Asahan diperoleh dari beregu putri, Khairun Niqmah (putri), Afridho Amin/Oki Akbar (putra), Khairun Nisaaq/Khairun Niqmah (putri). Dua perunggu Langkat dihasilkan Yuwen K/Wardah Hilwani (putri) dan beregu putri. Binjai dan Sibolga berbagi satu perunggu dari beregu putra. Ketua Panpel Cabang Tenis Meja Drs Joni Walker Manik menyebutkan, cabang tenis meja Porprovsu diikuti 12 kabupaten/kota yang merupakan hasil pelaksanaan Porwil I Wilayah I-IV. Tenis meja yang digelar 9-12 November itu mempertandingkan nomor beregu, tunggal, ganda dan ganda campuran. (m20)

Final Sepakbola Tutup Porprovsu MEDAN (Waspada): Final pertandingan sepakbola antara Deli Serdang versus Asahan menjadi aksi pamungkas perhelatan Porprovsu 2010, yang akan ditutup Sabtu (13/11) ini di Stadion Teladan Medan. Demikian Ketua Umum PB Porprovsu Drs Chairul Azmi Hutasuhut MPd didampingi Sekretaris H Sakiruddin SE MM, kemarin di Medan. “Tidak ada masalah lagi. Kegiatan pihak MLM juga tidak akan mengganggu, sebab acara mereka digelar Sabtu malam dan penutupan Porprovsu telah selesai sore hari,” kata Chairul. Dia pun tidak mempermasalahkan tempat pelaksanaan harus dipakai bersama. Terpen-

ting, tambah PR II Unimed itu, tidak ada pihak yang dirugikan. Bahkan Chairul berharap kebersamaan ini memberi keuntungan bagi kedua pihak. Pada acara penutupan nanti, kegiatan didahului final sepakbola antara Deli Serdang versus Asahan mulai pkl 14.00 WIB, diiringi penampilan artis ibukota Judika, runner-up Indonesia Idol 2009. Langkat perunggu Medali perunggu sepakbola direbut Langkat, setelah mengalahkan Sergai 4-2 (3-0) di Stadion Teladan Medan, Jumat (12/11). Ini kemenangan kedua Langkat atas Sergai, setelah menang 2-0 pada babak penyisihan Porwilsu di Stabat.

Bambang Hardianto membuka gol pertama Langkat menit 26 dan mencetak gol kedua menit 43. Dua gol tambahan Langkat dicetak Luis Irfandi menit 45 dan Ibrahim menit 90. Sergai ditangani pelatih Arifin Sinaga membalas dua gol melalui Rinaldi Sanjaya menit 82 dan Ricky 89. Sergai mendapat hadiah penalti pada babak pertama, namun Rinaldi Sanjaya gagal menyelesaikan tugasnya dengan baik. Untuk final antara Asahan melawan DS, Ketua Panitia Pelaksana Azzam Nasution mengharapkan masyarakat bisa beramai-ramai memberikan dukungan kepada tim favoritnya. (m20)

GUANGZHOU (Waspada): Kontingen Indonesia urutan kesepuluh di belakang kontingen India dan di depan Iran pada defile peserta upacara pembukaan pesta olahraga Asian Games ke-16 di Guangzhou, China, Jumat (12/11) malam. Atlet boling putra peraih medali emas Asian Games 2006 Doha, Qatar, Ryan Lalisang, dipilih menjadi pembawa bendera Merah Putih. Semula tugas ini akan diemban atlet bola voli pantai putra Ade Chandra R, karena dia merupakan atlet termuda, pelapis seniornya Andy Ardiansyah dan Koko Prasetyo Darkuncoro. Ade baru berusia 18 tahun diharapkan dapat menjadi ikon kebangkitan generasi muda atlet Merah Putih. Indonesia menyertakan 60 atlet dan ofisial pada upacara pembukaan yang berlangsung mulai pukul 20.00 waktu setempat atau pukul 19.00 WIB. Delapan dari 60 atlet dan ofisial naik perahu yang merupakan bagian dari atraksi upacara pembukaan. Artis film Zhang Ziyi dan pianis dunia Lang Lang melakukan pertunjukan bersama untuk menyemarakkan pesta pembu-


Kontingen Indonesia defile dengan perahu hias di Zhujiang (Pearl) River pada acara pembukaan Asian Games 2010 di Guangzhou, China, Jumat (12/11). kaan. Perdana Menteri (PM) China Wen Jiabao ikut menghadiri, sedangkan para atlet datang konvoi menggunakan perahu. Ini merupakan perubahan besar dibanding kebiasaan sebelumnya. Baru kali ini upacara pembukaan pesta akbar olahraga memilih tempat di pulau Pearl River ketimbang di dalam stadion. Sekitar 10.000 atlet dan 5.000 ofisial dari 45 negara dan kawasan berkumpul untuk merebutkan 476 keping medali emas, berlangsung sampai 27

November mendatang. Penyelenggara mempertunjukkan permainan sinar (laser) terbesar dalam sejarah olahraga, berdasar atas tema yang diangkat dari kebudayaan lokal Lingnan. Perahu yang dinaiki kontingen Indonesia dan 44 perahu kontingen negara lainnya, melintasi Sungai Mutiara dalam defile peserta. Anggota kontingen Indonesia lainnya berdefile di darat, yaitu di Pulau Haixinsha. Upacara pembukaan ini berlang-

sung di dua panggung, yakni di sungai dan di darat. Delapan anggota kontingen Indonesia naik perahu dengan mengenakan pakaian adat dari delapan provinsi di tanah air. Di antaranya pakaian adat Aceh, Sumsel, dan Betawi. Sedangkan anggota kontingen Indonesia yang berdefile di darat, mengenakan baju putih, jas biru, celana panjang krem, dengan peci hitam. Rombongan peserta defile memasuki tempat upacara pembukaan pkl 20.25, urutan-

nya disusun berdasarkan abjad. Di urutan terdepan kontingen Afghanistan, diikuti Bahrain dan Bangladesh. Indonesia urutan kesepuluh, tuan rumah China pada urutan 45 atau yang terakhir. Puncak acara ditandai penyulutan kaldron dengan api yang telah diarak keliling daratan China pada pkl 21.42. Upacara pembukaan juga dimeriahkan dengan atraksi budaya yang menampilkan tari dan lagu, lantas ditutup dengan atraksi kembang api. (yuslan/ant)

Voli Medan Kawinkan Emas DS Minta Reformasi PBVSI Sumut MEDAN (Waspada):Tim voli Kota Medan berhasil memenuhi ambisinya mengawinkan medaliemasputradanputripada Pekan Olahraga Provinsi Sumatera Utara (Porprovsu) 2010. Pada partai final yang digelar di Gedung Serbaguna Unimed, Jumat (12/11), Medan mengalahkan putra putri Deliserdang. Tim putra menang 3-2, sedangkan putri 3-1. “Anak-anak sudah bermain maksimal, namun keberuntungan belum berpihak kepada kami,” kata pelatih tim voli putri DS, Elvian, didampingi asisten Sudarianto dan Herry Susanto. Elvian juga mengungkapkan kekecewaannya terhadap perangkat pertandingan terutama wasit, yang bermuara pada pentingnya reformasi kepengurusan PBVSI Sumut, yang sekarang statusnya tidak jelas. “Sudah saatnya kita melakukan reformasi Pengprov PBVSI Sumut. Sekarang status pengurusnya kan tidak jelas dan tak aktif lagi, sehingga perubahan peraturan dalam pertandingan voli tidak bisa disosialisasikan,” jelas Elvian. Dia pun mencontohkan beberapa perubahan peraturan sejak Juni 2010 lalu, tetapi tidak diperlakukan pada pertan-

dingan voli Porprovsu 2010. “Sesuai peraturan baru, baju pemain menyentuh net atau melewati garis tengah masih dibolehkan, selama ada kontak badan. Perubahan ini sudah diterapkan pada Popwil I di Bangka Belitung, yang berakhir awal bulan ini,” ujarnya lagi. Elvian yang menjadi manajer tim voli Sumut pada Popwil tersebut, mengaku telah menjelaskan kepada wasit mengenai hal dimaksud.“Wasit final Porprovsu justru tak tahu. Kualitas mereka masih lemah, tapi itu tak terlepas dari vakumnya PBVSI Sumut,” tambah Elvian. Soal penampilan timnya pada final lawan Medan, Elvian menilai sudah maksimal. Srikandi DS Heria Riski, Nurdiana Nasution, Nadia Pratiwi, Ria Junita P, Oki Latinova, Tri Maulani serta Jolanda T Siregar, menurutnya, hanya kurang beruntung saja hingga gagal mendulang emas. Medan dengan para pemain Yuni Regar, Ella Dwi Khirah, Dina Herwina, Halimah, DianWijayanti, Lisma Patty serta Wahyu Juliati Tanjung sebagai libero dengan pelatih Budi S, menundukkan DS 3-1 (26-24, 25-21, 17,25, 25-22) dalam pertandingan yang alot.

Waspada/Khairil Umri Batubara

Tim voli putri Medan merayakan sukses mengalahkan Deliserdang pada partai final di Gedung Serba Guna Unimed, Jumat (12/11). Tim putra Medan yang diarsiteki Sudirman SE, menyusuli suksesYuni Regar cs. Dalam duel yang sangat ketat, Medan mengalahkan putra DS dengan skor 3-2 (21-25, 25-16, 24-26, 25-23, 15-10). Akibat kurang tegasnya wasit yang memimpin pertandingan, sempat terjadi saling protes pemain dan pelatih, untung ada hakim pertandingan yang dapat menenangkan suasana. “Final kan pakai reli poin. Jadi kalau soal baju pemain me-

nyentuh net atau garis tengah terkena fault, itu tentu sangat merugikan. Padahal, wasit yang nggak ngerti peraturan terbaru,” sesal Elvian. Ruzrali yang menukangi tim putra DS, menurunkan Ari Suhendra, Hendra Wijaya, Bambang Hermanto, Santo, Evan Trianda, Ricky Kartono serta Doni sebagai libero. Sedangkan Medan mengandalkan Arif Arjuanda Lubis, Dedi SP, Bagus Mukti R, Edi Purwanto, Dimas Redy Sofyan,

M Taufik dan libero Didit Prasetyawan. Pada perebutan medali perunggu, putra P Siantar menundukkan Asahan 3-0 (28-26, 25-21, 25-17). Di kelompok putri, tim Langkat mengalahkan Tebing Tinggi 3-1 (26-2, 25-21, 17-25, 25-22). Ketua KONI Kota Medan Drs Zulhifzi Lubis menyambut gembira sukses tim voli Medan mengawinkan emas, apalagi itu memang sudah menjadi target. (h01/m20)

Kroser Sumut Tolak Sesumbar

Waspada/Armansyah Th

Juara kelas 69 kg cabang tinju putra Porprovsu 2010 Daniel Pasaribu (dua kiri) bersama Ketua Umum KONI Medan Drs Zulhifzi Lubis usai upacara penghormatan pemenang di Medan, Jumat (12/11) malam.

Dominasi Tinju Tegaskan Sukses Medan MEDAN (Waspada): Cabang tinju kontingen Medan memperlihatkan dominasinya di arena Porprovsu 2010, setelah Jumat (12/11) berhasil menambah delapan medali emas lagi para partai final yang dimainkan di Gelanggang Remaja Medan. Tambahan delapan emas itu membuat cabang tinju total merebut 11 medali emas dari 18 yang diperebutkan sekaligus menegaskan sukses Medan sebagai juara umum Porprovsu 2010 dengan total raihan 41 medali emas. Kontingen tinju Labuhan Batu merebut dua medali emas dengan Samosir, Padangsidimpuan, Langkat, Sergai dan Asahan masing-masing merebut satu medali emas. Medan memulai panen emas di hari kedua

final ketika Zakaria Pasaribu mengatasi Pardamean S (Tapsel) di kelas 54 kg diikuti sukses Aditya Surbakti mengalahkan Syarifudin (P Sidimpuan/57 kg). Petinju andalan putri Sadarmawati memenangkan duel sesama Medan melawan Dinda Siregar di kelas 46 kg dan Josua Manullang menang mudah karena Jhon Nyoto undur diri di kelas 64 kg. Partai puncak kelas 69 kg juga mempertemukan sesama petinju Medan antara Daniel Pasaribu versus Romadhon yang akhirnya dimenangkan Daniel. Dua petinju lain, Siti Aisyah di kelas 60 kg putri dan Benget Simorangkir (75 kg) juga terlalu tangguh atas Amnisah (Labusel) dan Samsir Nasution (Asahan). Sukses Medan ditutup keme-

nangan Jhoni Simanjuntak di kelas berat 91 kg yang menang WO atas Turiono (Samosir). Satu-satunya finalis yang gagal adalah Kristina Simarmata pasca dinyatakan kalah angka dari Esmiliana Simangunson (Labuhanbatu). Di final hari pertama, Medan mengantongi tiga medali emas lewat Rumiris Simarmata (48 kg putri), Nurmala Dewi (51 kg putri) dan Maduma Simbolon (57 kg putri), sementara Labuhan Batu mengoleksi medali emas dari Jhoni Herman (81 kg putra). Perebut medali emas lain Elpiarni Sijabat (Samosir/44 kg putri), Abdullah Siregar (P Sidimpuan/45 kg), M Ramadhani (Langkat/48 kg), Maniur Sidabutar (Sergai/51 kg) dan Feriansyah (Asahan/60 kg). (h09)

JAKARTA (Waspada): Ambisi tim andalan asal Sumut, Dumasari Bonoharto Racing Team, tampil sebagai yang terbaik di ajang 12 Motoriders Powercross 7 Championship Series 2010 selangkah lagi terpenuhi. Itu sekiranya kroser Kale Makeham mampu menjaga konsistensi penampilannya di seri penutup yang digelar di Sirkuit Hayam Wuruk, Denpasar, Sabtu (13/11) ini. Peluang merengkuh gelar juara bagi kroses Dumasari asal Australia tersebut cukup terbuka, karena telah mengantongi poin tertinggi dan sementara memimpin klasemen. Meski begitu, kepastian kroser terbaik di ajang bergengsi lomba ketangkasan di atas lintasan reli roda dua ini baru akan ditentukan di seri penutup. Dua wakil Indonesia, Agi Agassi dan Aldi Lazaroni, tetap mengancam. Agassi mengantongi 94 poin dan terpaut 16 angka dari Makeham, sedangkan Lazaroni menduduki peringkat ketiga dengan 92 poin yang membuat pimpinan Dumasari, Aldi Bosar Harahap, tidak ingin sesumbar mengenai peluang timnya. “Dari segi poin, kroser kami masih memimpin tapi peluang gagal masih terbuka sebab perolehan poin kroser lain cukup dekat,” kata Harahap saat dihubungi Waspada, Jumat (12/11). Untuk menjaga peluang juara tersebut, pihaknya akan menginstruksikan krosernya untuk tampil aman agar bisa menyelesaikan lomba dengan baik. Selain persaingan antar kroser di ajang powercross, seri pamungkas Surya 12 Motoriders Powercross 7 Championship Series 2010 juga dimeriahkan oleh Kejuaraan Internasional Freestyler yang baru kali pertama digelar di Indonesia. (yuslan)

4 Pebiliar L.Batu Ikut Kejurda RANTAUPRAPAT (Waspada): Empat pebiliar dari Persatuan Olahraga Biliar Seluruh Indonesia (POBSI) Kabupaten Labuhanbatu mengikuti Kejurda Biliar Sumatera Utara 2010 seri I pada 1214 November ini di Tebingtinggi. Ketua POBSI L.Batu Arifin Chen/Akuang, di Rantauprapat, Jumat (12/11) mengatakan, empat pebiliar L.Batu yang akan mengikuti Kejurda Biliar Sumut 2010 ini merupakan hasil seleksi POBSI setempat. Keempat pebiliar yang dikirim ke Kejurda Sumut 2010 adalah Beni yang akan turun di kelas 10 Ball, Sastriawan Saputra/Mimin (10 Ball), Guruh Agung Gumelar (9 Ball) dan Hendrik (9 Ball). Dikatakan, Guruh dan Hendrik masih pelajar. Seri II Kejurda Biliar Sumut 2010 ini akan berlangsung di Kabupaten Langkat pada 19-21 November dan seri III di Kota Medan pada 26-28 November mendatang. Para pebiliar ini sebelum bertarung di Kejurda telah mengikuti pelatihan intensif di rumah biliar AK Club 9 Ball Rantauprapat dengan pelatih Hendra/Gerot serta Joni K. (a27)



WASPADA Sabtu 13 November 2010

Hamilton Oke Hasil free practice II Lewis Hamilton Sebastian Vettel Fernando Alonso Mark Webber Robert Kubica Felipe Massa Vitaly Petrov Jenson Button Vitantonio Liuzzi Nico Rosberg Michael Schumacher Nico Hulkenberg Adrian Sutil Kamui Kobayashi Rubens Barrichello Nick Heidfeld Jaime Alguersuari Sebastien Buemi Heikki Kovalainen Timo Glock Jarno Trulli Lucas di Grassi Christian Klien Bruno Senna

(Inggris/McLaren-Mercedes) (Jerman/Red Bull-Renault) (Spanyol/Ferrari) (Australia/Red Bull-Renault) (Polandia/Renault) (Brazil/Ferrari) (Rusia/Renault) (Inggris/McLaren-Mercedes) (Italia/Force India-Mercedes) (Jerman/Mercedes GP) (Jerman/Mercedes GP) (Jerman/Williams-Cosworth) (Jerman/Force India-Mercedes) (Jepang/Sauber-Ferrari) (Brazil/Williams-Cosworth) (Jerman/Sauber-Ferrari) (Spanyol/Toro Rosso-Ferrari) (Swiss/Toro Rosso-Ferrari) (Finlandia/Lotus-Cosworth) (Jerman/Virgin-Cosworth) (Italia/Lotus-Cosworth) (Brazil/Virgin-Cosworth) (Austria/Hispania-Cosworth) (Brazil/Hispania-Cosworth)

1:40,888 detik 1:41,145 1:41,314s 1:41,315 1:41,576 1:41,583 1:42,096 1:42,132 1:42,203 1:42,222 1:42,246 1:42,449 1:42,535 1:42,768 1:42,914 1:42,950 1:43,128 1:43,584 1:45,180 1:45,259 1:45,612 1:46,053 1:47,210 1:47,434

ABU DHABI (Waspada): Lewis Hamilton (foto) mengalahkan Sebastian Vettel pada latihan kedua GP Abu Dhabi, Jumat (12/11) malam. Dalam sesi kedua tes hari pertama di Sirkuit Yas Marina, Hamilton mencatat waktu 1 menit 40,888 detik atau unggul 0,257 detik atas Vettel. Tak seperti pada latihan pertama di mana Red Bull Racing dan McLaren tampil dominan, latihan kedua menampilkan Ferrari ikut meramaikan persaingan. Kubu Scuderia berhasil menempatkan pembalap nomor satunya, Fernando Alonso, di posisi ketiga. Meski demikian, Red Bull memberikan sinyal menjadi tim yang harus diwaspadai pada balapan pamungkas nanti. Pasalnya, tim berlambang banteng ini menempatkan MarkWebber di urutan empat dan Vettel di belakang Hamilton. Di belakang keempat pem-

Performa Heat Masih Labil MIAMI, AS (Waspada): Boston Celtics membuktikan diri lebih baik dari Miami Heat. Terbukti, trio dahsyat Celtics mencuri kemenangan 112-107 atas tuan rumah Heat 112-107 di American Airlines Arena, Jumat (12/11). Adalah Ray Allen yang menjadi bintang buat Celtics. Mantan punggawa Seatle SuperSonics ini mencatat angka tertinggi, yakni 35 poin. Hebatnya, Allen melesatkan tujuh lemparan three point dari sembilan kali percobaan. Sebenarnya LeBron James juga tampil gemilang. Mantan bintang Cleveland Cavaliers ini mengemas 35 poin 10 rebound, namun belum cukup membendung Heat dari kekalahan. Celtics sendiri tampil beringas sejak kuarter pertama. Paul Pierce menambah 25 angka bagi Celtics yang juga mendapat torehan 16 poin 13 rebound dari Kevin Garnett dan delapan angka 16 assist hasil sumbangan Rajon Rondo. Dua bintang Heat lainnya, Chris Bosh dan Dwyane Wade, masing-masing mengoleksi 15 dan delapan poin. Di Pepsi Center, kesempurnaan Los Angeles Lakers akhirnya terhenti di angka delapan. Pasalnya, tuan rumah Denver Nuggets memberikan kekalahan perdana bagi sang juara bertahan NBA tersebut. Carmelo Anthony tampil menjadi bintang Nuggets usai mengemas 32 poin 12 rebound untuk membawa tim tuan rumah unggul 118-112. Sementara itu, Kobe Bryant

tetap menjadi top skor Lakers dengan 34 angka. Di United Center, Chicago Bulls memuaskan hati pendukungnya setelah mengatasi perlawanan ketat dari Golden State Warriors 120-90. (m33/ap) Shooter Boston Celtics, Ray Allen (20), tidak terpengaruh kawalan LeBron James (6) dan Udonis Haslem saat dijamu Miami Heat dalam laga NBA di American Airlines Arena, Jumat (12/11). -AP-

balap tersebut yang akan bersaing ketat merebut gelar juara dunia F1 2010, ada Robert Kubica (Renault), Felipe Massa (Ferrari), Vitaly Petrov (Renault), Jenson Button (McLaren), Vitantonio Liuzzi (Force India) dan Nico Rosberg (Mercedes GP) melengkapi komposisi 10 besar. GP Abu Dhabi ini menjadi seri terakhir kalender 2010. Persaingan ketat hingga garis finish dipastikan seru, karena menjadi momen penentuan juara antara Alonso di puncak klasemen, Webber (terpaut delapan poin), Vettel (tertinggal


15 angka) dan Hamilton yang tetap berpeluang kendati harus berharap keajaiban. Sebelumnya,Vettel jadi pembalap tercepat di SirkuitYas Marina. Driver asal Jerman ini

mencatat waktu 1:42,760 menit dan mengungguli duet McLaren. Selain Vettel, Webber menduduki posisi keempat dan Alonso hanya ada di peringkat enam. (m33/ap)

Llodra Lanjutkan Kejutan PARIS (Waspada): Petenis Prancis Michael Llodra melanjutkan kejutan yang dilakukannya di Turnamen Paris Masters, Jumat (12/11). Petenis non unggulan ini juga terus “membunuh� para raksasa tenis dunia, sehingga menapaki semifinal. Setelah menaklukkan juara bertahan yang juga unggulan kedua, Novak Djokovic, Llodra menyingkirkan petenis Rusia Nikolay Davydenko. Dalam laga yang berlangsung di depan publiknya, Llodra menang 7-5, 6-1 atas unggulan kesepuluh tersebut. Selanjutnya, Llodra kembali menghadapi lawan berat yang juga salah satu favorit juara, Robin Soderling. Petenis Swedia yang merupakan unggulan keempat itu lolos dengan menyingkirkan unggulan delapan dari Amerika Serikat, Andy Roddick, 7-5, 6-4. Dengan hasil ini, Llodra memperbaiki rekor pertemuannya dengan Davydenko menjadi 4-2 di mana dua kemenangan tersebut diraih pada pertemuan terakhir. Sebelum Paris, Llodra mengalahkan Davydenko di ABN AMRO Championship 2008. Partai perempatfinal lainnya akan mempertemukan unggulan utama Roger Federer melawan unggulan 11 dari Austria, Jurgen Melzer, serta unggulan ketiga dari Inggris Andy Murray kontra unggulan 12 Gael Monfils. (m33/ap)

Sumatera Utara

WASPADA Sabtu 13 November 2010

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:11 12:24 12:11 12:18 12:18 12:15 12:11 12:07 12:14 12:13

‘Ashar 15:33 15:46 15:33 15:40 15:40 15:37 15:33 15:29 15:36 15:35

Magrib 18:11 18:21 18:11 18:16 18:17 18:17 18:12 18:08 18:14 18:12



Shubuh Syuruq


19:21 19:33 19:22 19:27 19:28 19:28 19:23 19:19 19:25 19:23

04:42 04:57 04:42 04:51 04:50 04:43 04:42 04:37 04:44 04:45

04:52 05:07 04:52 05:01 05:00 04:53 04:52 04:47 04:54 04:55

L.Seumawe 12:17 L. Pakam 12:10 Sei Rampah12:09 Meulaboh 12:21 P.Sidimpuan12:08 P. Siantar 12:09 Balige 12:09 R. Prapat 12:06 Sabang 12:24 Pandan 12:10

06:09 06:25 06:10 06:19 06:18 06:10 06:09 06:05 06:12 06:13

Zhuhur ‘Ashar 15:39 15:32 15:31 15:43 15:30 15:31 15:31 15:28 15:46 15:32





Shubuh Syuruq


Zhuhur ‘Ashar




Shubuh Syuruq


18:15 18:10 18:09 18:20 18:11 18:10 18:10 18:08 18:21 18:12

19:26 19:21 19:20 19:31 19:22 19:21 19:21 19:18 19:32 19:23

04:49 05:41 04:40 04:52 04:36 04:39 04:38 04:35 04:57 04:39

04:59 04:51 04:50 05:02 04:46 04:49 04:48 04:45 05:07 04:49

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:10 12:12 12:21 12:14 12:11 12:18 12:06 12:17 12:10 12:09

18:12 18:12 18:19 18:16 18:11 18:17 18:07 18:17 18:11 18:09

19:23 19:23 19:30 19:27 19:22 19:28 19:18 19:28 19:22 19:20

04:39 04:41 04:54 04:43 04:42 04:50 04:36 04:47 04:38 04:39

04:49 04:51 05:04 04:53 04:52 05:00 04:46 04:57 04:48 04:49

Panyabungan 12:07 Teluk Dalam12:14 Salak 12:12 Limapuluh 12:08 Parapat 12:10 GunungTua 12:07 Sibuhuan 12:06 Lhoksukon 12:16 D.Sanggul 12:10 Kotapinang 12:05 AekKanopan 12:07

06:17 06:08 06:07 06:20 06:04 06:07 06:06 06:02 06:25 06:06

15:32 15:34 15:43 15:36 15:33 15:40 15:28 15:39 15:32 15:31

06:06 06:09 06:22 06:11 06:10 06:17 06:04 06:14 06:06 06:07

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

Polres Binjai Kembangkan Kasus Penipuan Via HP BINJAI (Waspada): Setelah Polres Binjai mengamankan pelaku penipuan gaya baru dengan menggunakan HP yang berinisial A alias Agus alias Aan, polisi terus mengembangkan kasus ini apakah mempuyai sindikat atau beroperasi perorangan. Demikian Kasat Reskrim Polresta Binjai AKP Roni Bonic, Selasa (9/11) di halaman Mapolres Binjai. Pihaknya masih mengembangkan terus dan diakuinya selain mengamankan tersangka juga mengamankan barang bukti untuk pengusutan selanjutnya. Ketika disinggung tentang dikenakan pasal berapa terhadap tersangka kasus penipuan itu, Roni mengatakan, tersangka dikenakan dalam kasus penipuan. (a04)

Polres Sergai Tangkap Jurtul KIM Dan Togel SEIRAMPAH (Waspada): Dua orang juru tulis (jurtul) KIM danTogel ditangkap petugas Polres Serdang Bedagai di dua tempat terpisah. Tersangka pertama yang ditangkapWS, 47, warga Dusun Sukatani, Desa Suka Dame, Kec. Sei Bamban, Kab.Serdang Bedagai. Pria yang sehari-harinya bekerja sebagai petani itu ditangkap petugas ketika sedang menunggu pembeli di sebuah warung dekat rumahnya, Minggu (7/11) sekitar pukul 22:45. Dari tangannya petugas mengamankan barang bukti berupa uang tunai Rp186 ribu, 1 buku, rekapan, pena dan ponsel. Sementara itu penangkapan kedua terjadi, Senin (8/11) pukul 12:00, petugas kembali mengamankan tersangka yang masih dibawahumurdanberstatuspelajarRS,13,wargaPondokHombing, Desa Silau Dunia, Kec. Silau Kahean, Kab.Simalungun. Tersangka ditangkap di Dusun I Cemara, Desa Dolok Sagala, Kab.Serdang Bedagai. Kasat Reskrim Polres Sergai AKP Lili Astono didampingi Kasubag Humas Iptu ZN Siregar, Selasa (9/11) membenarkan. (a07)

Polsek Binjai Utara Ringkus Pemilik SS BINJAI (Waspada) : Polsek Binjai Utara dipimpin Kanit Res Iptu Lintas Pasaribu, Rabu (10/11) meringkus seorang pedagang pemilik 1 paket shabu FW, 37, warga Lingkungan I, Kel. Damai, Kec. Binjai Utara, terangka diringkus di pinggir di Jalan MT Haryono, Kec. Binjai Utara seusai membeli sabu tersebut dari agen. Guna penyidikan selanjutnya tersangka bersama barang bukti 1 paket hemat sabu, 8 buah pipet, 1 buah kaca piret, 5 buah plastik kosong, 1 buah tutup minuman ringan yang diduga mau digunakan untuk menyabu diamankan polisi. Kapolres Binjai AKBP Rina sari Ginting melalui Kapolsek Binjai Utara AKP Kuasa Purba ketika dikonfirmasi tentang diringkusnya pedagang pemilik sabu tersebut membenarkan. (a04)

RSU Dr Djoelham-Hypermat BSM Gelar Donor Darah BINJAI (Waspada) : RSU dr Djoelham Binjai dan Hypermat Binjai Super Mall (BSM) menggelar aksi donor darah, Rabu (10/ 11). Direktur RSU Binjai Susyanto didampingi manajer Hypermat Hery mengemukakan, program donor darah di BSM dalam memperingati HUT ke-3 Hypermat dan hari Pahlawan. Donor darah diikuti 200 orang, baik dari karyawan Binjai Super Mall dan masyarakat. Susyanto menjelaskan, keperluan darah untuk pasien di Medan dan Binjai diperhitungkan 50 sampai 100 kantong setiap hari. Keperluan kesehatan masyarakat yang memerlukan darah yangcukuptinggi,karenanyaRSUdrDjoelhamBinjaidanHypermat sepakat memprogram donor darah di BSM per triwulan. DirekturRSUBinjaiSusyantomenyebutkan,diRSUdrDjoelham kini sudah tersedia darah. Sebagai biaya pengganti ditetapkan Rp265.000 per kantong. (a03)

Napak Tilas Hari Pahlawan SEI RAMPAH(Waspada): DPD KNPI Serdang Bedagai bersama Pemkab melaksanakan napak tilas 30 km mulai dari kantor Desa Sei Buluh, Kec. Teluk Mengkudu, Sergai dan berakhir di Wisma Juang Perbaungan, Senin (9/11) malam. Guna memperingati Hari Pahlawan 10 November 2010, Peserta yang mengikuti Napak Tilas Sergai 2010 itu sebanyak 17 regu terdiri dari utusan OKP seperti IPK,Pemuda Pancasila, AMPI,Karang Taruna, Rempala, Bhaladika Karya dan lainnya juga dari pelajar SMA, Pramuka dan dari Polres Sergai sebanyak satu regu, dilepasWakil Bupati Sergai H.Soekirman dengan menempuh rute Desa Sei Buluh, Desa Lubuk Bayas, Desa Lubuk Rotan, Desa Bengkel keluar menuju ke Desa Sukaberas, KelurahanTualang dan Perbaungan. Hadir dalam acara pelepasan, Ketua beserta unsur pengurus KNPI Sergai Drs Indra Syahrin, MSi, Kapolsek Teluk Mengkudu AKP J.Simbolon, Dan Ramil/TM Kapten Inf.JB Simanjuntak,Camat Teluk Mengkudu Saparwin Siregar dan Kasat Samapta Polres Sergai AKP Man Fitrawansyah serta utusan Veteran RI. (a07)

Empat Ibu RT Berjudi Ditangkap BINJAI (Waspada) : Polsek Binjai Utara dipimpin Kanit Res Iptu Lintas Pasaribu, kemarin meringkus empat ibu rumah tangga bermain judi dengan taruhan uang menggunakan kartu domino. Mereka masing-masing R br Seregar, 44, warga Jalan MT Haryono, Lingkungan III, Kelurahan Jati Karya, Binjai Utara, TB, 40, warga Jalan Danau Balida, Binjai Timur dan E br M, 39, warga Pasar Empat, Binjai Utara serta R br P, warga Jati Makmur, Kecamatan Binjai Utara. Kapolres Binjai AKBP Rina Sari Ginting melalui Kapolsek Binjai Utara AKP Kuasa Purba ketika dikonfirmai kasus itu berawal ketika dirumah R br S di Jalan MT Haryono, dijadikan lapak judi oleh keempat ibu RT itu. Informasi ini langsung ditindaklanjuti dan petugas meluncur ke lokasi dan berhasil diringkus. (a04)

Pelajar Di Batangserangan Bantu Korban Merapi BATANGSERANGAN (Waspada): Para pelajar SD, SMP, dan SMA di Kec. Batangserangan, Langkat menggalang dana dengan menyisihkan uang jajan untuk membantu korban musibah gempa bumi dan tsunami di Mentawai dan korban letusan Gunung Merapi di Sleman, Yogyakarta. Koordinator lapanganWahyu Pranoto, Rabu (10/11) mengatakan, aksi penggalangan dana sosial yang dimotori Pramuka di Batangserangan ini berhasil mengumpulkan dana sebesar Rp7 juta berikut 150 potong pakaian bekas layak pakai. Menurut dia, aksi ini akan terus berlangsung dan para pelajar membuka pos bantuan di pinggiran jalan untuk mencari dana dari masyarakat yang melintas. “Kami berharap, nilai dana yang tak seberapa besarnya ini dapat membantu meringankan beban para korban yang tertimpa musibah,” ujarnya.(a02)

Zhuhur ‘Ashar 15:29 15:36 15:34 15:30 15:32 15:29 15:28 15:38 15:32 15:27 15:29




Shubuh Syuruq

18:10 18:17 18:13 18:08 18:10 18:09 18:09 18:14 18:12 18:07 18:08

19:21 19:28 19:24 19:19 19:21 19:20 19:20 19:25 19:23 19:18 19:19

04:34 04:41 04:41 04:38 04:39 04:35 04:34 04:49 04:39 04:34 04:36

04:44 04:51 04:51 04:48 04:49 04:45 04:44 04:59 04:49 04:44 04:46

06:02 06:09 06:09 06:05 06:07 06:02 06:02 06:16 06:07 06:01 06:04

Fatwa MUI T.Tinggi:

Foto Berangkulan Pra Wedding Haram TEBINGTINGGI (Waspada): Komisi Fatwa Majelis Ulama Indonesia (MUI) Kota Tebingtinggi, menetapkan foto pra wedding (foto bersama calon pengantin sebelum menikah) berpelukan, baik yang terlihat di kartu undangan maupun berbingkai, dihukumkan haram. Namun, foto pra wedding yang keduanya saat difoto tidak berpelukan dihukumkan mubah. Fatwa itu merupakan keputusan yang disampaikan Komisi Fatwa MUI KotaTebingtinggi, dipimpin Ketua Drs. H. Nizar Rangkuti dan Sekretaris Drs.Abdul Hafizun, MA, di sela-sela kegiatan MusdaVIIMUIKotaTebingtinggi, Kamis (11/11), di Gedung Hj. Sawiyah Nasution. HadirKetuaMUISumutProf. DR. H. Abdullahsyah, MA bersama Sekum Prof DR. H. Hasan Bakti Nasution, MA. Pj.Walikota Drs.H.Eddy Syofian, MAP dan jajaran Muspida serta kalangan ulama dan pimpinan Ormas Islam. Difatwakan juga, foto pra wedding yang berangkulan karena trik kamera maupun set-

ting fotografer, dihukumkan lebih besar mudharatnya daripada manfaatnya. Sedangkan kegiatan fotografi sendiri dihukumkan mubah sepanjang tidak bertentangan dengan hukum syara’. Alasan penetapan fatwa itu, menimbang belakangan ini banyaknya ditemukan foto bersama calon pengantin pada kartu undangan. Memberi kepastian hukum dalam syariat Islam, MUI memandang perlu mentapkan fatwa tentang hukum foto bersama calon pengantin pada kartu undangan. Fatwa itu ditetapkan, mengingat firman Allah: “Dan jangan lahkamumendekatizina,sesungguhnyazinaadalahsuatuperbuatan yang keji dan suatu jalan yang buruk.” (Q.s. Al Isra :32). Serta firmanAllah:“Merekamenanyakan kepadamu (Muhammad) tentangkhamardanjudi.Katakanlah, pada keduanya terdapat dosa besar dan beberapa manfaat bagi manusia. Tetapi dosanya lebih besar dari manfaatnya ...” (Q.s Al Baqarah:219). Fatwa itu juga mengutip sejumlah hadist Rasulullah serta pendapatparaulama,diantaranya pendapat Syeikh Muhammad Bakhit Al Mu’thi yang dikutip DR. Yusuf Qardhawi dan pendapat ulama besar Universitas Al Azhar Mesir DRYusuf Qardhawi sendiri. Penyebab Bencana Sebelumnya, Ketua MUI Su-

mut Prof DR.H. Abdullahsyah, MA dalam taushiyahnya mengingatkan, terdapat hubungan antara terjadinya kerusakan di muka bumi dengan akhlak manusia.Dikatakan, AllahSWTtidak akan menurunkan bencana kepada suatu kaum/daerah/kota jika mereka tidak berbuat zhalim. Perbuatan zhalim itu, kata profesoremeritusIAINSU,itubisa dilihat dari tingkah laku manusia dalam kehidupannya. Mengutip pujanggaMesirSyauqiBek,sesungguhnya teguhnya suatu umat itu karenaakhlaknya,makahancurnya suatuumatjugakarenaakhlaknya, kata Ketua MUI Sumut itu. Dalam posisi demikian, tugas ulama adalah membimbing manusia agar berperilaku sesuai dengannilai-nilaisyara’danpatuh terhadap perintah dan larangan Allah. Sesungguhnya, manusia yang paling takut kepada Allah adalah ulama, kata Abdullahsyah mengutip ayat Al Qur’an. Hasil Musda VII MUI Kota Tebingtinggi, Ketua/Wkl. Ketua : H Ahmad Dalil Harahap, H Ibrahim Harahap, H Akhyar Nasution, H Ghazali Saragih, H Nizar Rangkuti, Hj Naziah, Bachrum, H Abu Hasyim Siregar, H Agussul Khair, H. Haznam Siregar. Sekretaris/Wkl. Sekretaris Khairil Anwar Nasution, Zulkarnain, H. Sujarno Alamsyah. Bendahara, H Sahrial Malik dan Hj Nurliza Kartika.(a08)

Tebingtinggi Jadi Lokasi Pencincangan Mobil Curian T.TINGGI (Waspada) : Pelaku sindikatpencuriankenderaanbermotor (curanmor-red) hingga kini masih diburu petugas gabunganPolresTebingtinggibekerjasa sama dengan Polsek Medan Sunggal.Pelakukejahatandengan membongkar mesin bersama sejumlah perkakas mobil yang tercincang sempat digerebek petugas, namun berhasil kabur. Menurut informasi yang diperoleh, Jumat (12/11) sindikat pencurian kenderaan bermotor (curanmor) diketahui dengan ditemukanya satu unit mobil KijangInnovayangsudahdicincang mesin, body, bersama perkakas mobil yang sudah dicincang, Selasa (9/11) sekira pukul 17:30 di Kafe Ula Lupa di Jalan Letda SujonoKel.PinangMancung,Kec. Bajenis, Tebingtinggi. Di kafe yang sudah lama dikontrak pemiliknya itu, warga mendadak terkejut saat melihat sejumlah petugas menerobos lokasidanmenemukansatumobil Kijang Innova yang sudah berantakanmesindanbodymobil. Dari

sana petugas menemukan mobil Kijang Innova BK 9701 YJ yang sudah tak utuh. Pengontrak kafe ketika hendak ditemui sudah tak berada ditempat. Didugapelakupencurianmobil mewahini,membawamobilhasil curiannya ke lokasi kafe guna dirombak seluruh perwajahan mobilbaikrangka,mesinmaupun body,Saatditemukan,nomormesin sudah dikraft serta bangku mobil dan pintu sudah dibongkar. Menurut petugas Panit ReskrimPolsektaMedanSunggal,Iptu Hendrik yang tiba di Mapolres Tebingtinggimengatakan,korban pencurian mobil adalah keluarga mendiangT.Silitongamantanmanajer Kebun Negeri Lama Kebun Socfindo, Labuhanbatu Utara. Saat kejadian. istri almarhum T. Silitonga , S br Pardede,50, warga Jalan Bunga Mawar Padang Bulan, Medan Selayang pergi undangan pesta perkawinan ke salah satu wisma di Medan tanggal 28 Oktober 2010 lalu. Setelah pulang sekira pukul 16:00. dilihat jendela samping rumah sudah

dibongkar pencuri. Pelaku diperkiran masuk dengan mencungkil pintu kamar, tempat kunci mobil serap di dalam laci. Kemudian dengan cepat membawa kabur mobil kijang Innova BK 1981 HD yang sedang parkir di garasi . ‘’Pelaku sengaja memanfaatkan waktu saat rumah ditinggal pemiliknya, akibat kejadian itu korbanmengalamikerugianmencapai ratusan juta rupiah karena sejumlahuangdanperhiasanjuga turut diambil. Sedangkan mobil yanghilangituawalnyabernomor BK 1981 HD, saat diketemukan sudah berubah menjadi nomor BK 9101YJ,’’ ungkap Iptu Hendrik. SedangkankorbanSbrPardede mengucapkan terima kasih kepada pihak polisi yang telah menemukan mobilnya. Mobil itu nantinyaakandiperbaikidibengkel. Kapolres Tebingitnggi ketika dikonfirmasimelaluiKasatReskrim AKP. Arifin Said Ritonga, SH.Sik, ketikadikonfirmasiwartawanmengatakanpihakpekerjsamadengan Polsek Medan Sunggal menemukan mobil hasil curian. (a09)

Waspada/Muhammad Idris

DAGANG KURSI KELILING: Berniaga perabotan rumah tangga seperti kursi santai yang terbuat dari bahan bambu ternyata tidak mesti memerlukan tempat khusus, dapat juga dilakukan secara berkeliling dengan menggunakan gerobak roda dua yang ditarik dari depan. Seperti yang dilakukan Warsito, 28, pedagang perantauan asal Pulau Jawa ini, dengan berjalan kaki memasarkan produk kursi santai (kursi malas) itu ke lokasi perumahan di Kota Tebingtinggi dengan harga Rp200.000 hingga Rp 600.000 per set.Bahan baku didatangkan dari Pulau Jawa yang dirakit di Pematangsiantar, lalu dibawa ke Tebingtinggi untuk dipasarkan. Foto direkam, Selasa (9/11) di Jalan Jendral Sudirman Kota Tebingtinggi, persis ditanjakan jembatan Sei Padang.

Minta Izin Dan Mohon Doa Ke Orang Tua Ditemukan Tewas Gantung Diri TEBINGTINGGI (Waspada) Kusnadi, 35, ditemukan warga tewas gantung diri di bawah pohon coklat milik warga yang tidak begitu jauh dari rumahnya di Jalan Setia Budi, Ling.IV, Kelurahan Brohol, Kec. Rambutan,Tebingtinggi Jumat (12/11) sekira pukul 10:00. Sebelumnya korban datang ke orang tuanya untuk meminta ijin dan mohon doa. Menurut informasi yang dihimpun di lokasi saat itu menyebutkan, Korban tewas pertama kali ditemukan warga yang ingin melihat kebun coklat di samping rumah, ketika itu melihat sesosok orang dalam keadaan jongkok di samping pohon coklat. Semula dia mengira orang itu sedang membuat air kecil, namun setelah ditunggu beberapa saat tidak bergerak-gerak. Setelah didekat ternyata orang yang sedang gantung diri dan korbannya dikenal adalah warga setempat. Kejadian tersebut dilaporkan

kepada orang tua korban yang berjarak sekitar 100 meter dari lokasi kejadian. Mengetahui kejadian tersebut, ratusan warga sekitar ramai berdatangan menyaksikan lokasi kejadian. Kapolsek Rambutan, AKP M. Simarmata ketika dikonfirmasi mengatakan, setelah mendapat informasi dari masyarakat pihaknya melakukan olah tkp. Setelah dilakukan identifikasi dan pemeriksaan di tubuh korban tidak ditemukan tanda-tanda bekas penganiayaan. Atas permintaan keluarga korban, mayat korban tidak diotopsi. Jenazah korban selanjutnya dibawa pulang untuk disemayamkan dan dikebumikan. Ketika ditanya penyebab kematian korban, Kapolsek mengatakan, masalah bisnis dan keluarga diperkirakan menjadi penyebabnya, dimana korban sudah berumah tangga 13 tahun belum mendapat keturunan dan binisnya dalam keadaan macet. (a09)

Panglima Talam Jangan Manyomak, Marilah “Menyimak” MASIH jelas dalam ingatan kita (masyarakat Labura) bagaimana geliat dari tiga pasangan Cabup/Cawabup Labuhanbatu Utara menjelang pelaksanaan Pilkada pada 27 September 2010. Untuk memperoleh kemenangan, para pasangan itu melakukan perpanjangan corong politiknya dengan membentuk tim sukses acap disebut TS. TS di himpun dari partaipartai politik pendukung dan tak kalah pentingnya para pasangan Cabup/Cawabup merangkul orang-orang berpengaruh dalam satu wilayah. Para tokoh masyarakat pun turut berperan untuk meraup lumbung-lumbung suara di Labura yang tersebar di 8 kecamatan yakni Merbau, Na IX-X, Aek Kuo, Aek Natas, KualuhHulu,KualuhHilir,Kualuh Selatan dan Kualuh Ledong. Akhir perjuangan pun terjawab saat Pilkada 27 September 2010, dimana pasangan Cabup/ Cawabupnomorurut1Kharisma yakni Khairuddin Sitorus dan Syahminan Pasaribu mengalahkan 2 pasangan lainnya. Hampir 50 persen pasangan Kharisma meraup suara masyarakat Labuhanbatu Utara. Kharismakianmemantapkan posisinya sebagai Bupati danWakil Bupati Labura periode 20102015. Dan jabatan politis ini pun dikuat secara konstitusi dalam pelantikan yang berlangsung Se-

nin 15 November 2010 di gedung DPRD Labuhanbatu Utara. Sebagai anak perantau, awak (saya-red) sekadar mengingatkan Bang Buyung dan Bah Menan, bukan mengajari Lamoduk (nama ikan di Sungai Kualuh-red) Balange (bahasa Kualuh artinya berenang-red), dimana pasca Pilkada akan bermunculan sosok “bermukadua”atau lagi-lagidisebut “Panglima Talam”. Memang sepintas keberadaan para penjilat politik ini kita jadikan bahan tertawaan kecil dalam hati saat melihat perilaku yang mereka tampilkan pasca Pilkada. Tak jarang mereka mengaku-ngaku sebagai sosok yang berperan besar dalam mengkonsumsibendaharasuaralsaatmenjelang hingga berlangsungnya Pilkada. Awas keberadaan“Panglima Talam” menimbulkan konflik horizontal, khususnya di Kabupaten Labuhanbatu Utara, selama ini sudah dikenal memegang teguh tatanan adat dan budaya, bahkan keduasisteminilebihdiutamakan menyelesaikan konflik, tatkala terjadi di masyarakat Labura. Agaknya ini yang disebut “Basimpul Kuat Babontuk Elok”. Ada contoh beberapa daerah yang kepala derahnya semringah akibat ulah-ulah panglima talam. Seperti di daerah Aceh, seorang kepala daerah akhirnya mengun-

durkan diri akibat ulah segelintir orang yang datang dengan modal cakap mengaku telah berbuat banyak untuk kemenangan saat Pilkada, sehingga mereka tak jarang meminta konpensasi untuk kepentingan pribadi. Halinimenimbulkankecemburuan sosial, yang akhirnya menimbulkan pengkotak-kotakan. Kiranya ini jangan sampai terjadi di Labuhanbatu Utara. Sekadar mengingatkan kembali, kalau kemenangan pasangan Bang Buyung dan Bah Minan bukan kememangan golongan atau kelompok tertentu, tapi tampilnya

KharismasebagaiBupatidanWakil Bupati Labura adalah kemenangan seluruh rakyat Labuhanbatu Utara. Pro dan kontra sudah pasti ada saat menjelang Pilkada. Namun pasca Pilkada kiranya prokontra itu berubah menjadi proaktif bagi masyarakat Labura untuk memberikan gagasan dalam membangun Labura di tangan Kharisma. Mari kita menyadari, kalau perjuangan pemekaran Kabupaten Labuhanbatu Utara berangkat dari niat tulus dan mulia tokoh masyarakat Labura yang

terpencar di 8 kecamatan. Ini merupakan perjuangan seluruh lapisan elemen masyarakat. Coba renungi, pantaskah kita menodai aspirasi masyarakat untuk mewujudkan Labura yang lebih baik di masa mendatang, sebagaimanatujuandaripemekaran dari kabupaten induk Labuhanbatu. Tepiskan keinginan meraup kepentingan pribadi setelah terwujudnya pemekaran dan terpilihnya Bupati dan Wakil Bupati Labuhanbatu Utara, Bang Buyung dan Bah Minan yang kita yakini mampu membaca situasi munculnyapihakyangtampilbak pahlawan kesiangan cenderung menimbulkan polemik di masyarakat Labura. Tak bisa kita mengarahkan jari telunjuk “itulah sosok Panglima Talam” namun anda harus tampil untuk menepis kata hati dari orang di sekeliling kita yang menyebut diri kita sebagai Panglima Talam. Bila ditanya taklah mungkin ada orang yang mengaku dirinya sebagai PanglimaTalam, tapi tanpadisadari,adakalanyakehadiran sesorang membuat ‘risih’ akibat ucapannya terkesan tampil sebagai pahlawan kemenangan pasangan Cabup/Cawabup saat kampanye hingga pasca Pilkada. Jikapun ada PanglimaTalam, janganlah manyomak, tapi “me-

nyimak” langkah-langkah apa yang dilakukan Bang Buyung dan Bah Minan, apakah keduanya mampu mewujudkan orasi politiknyasaatdipanggungkampanye jelang Pilkada, kiranya tak hanya sebagai Lips Service untuk merebut BK Nomor 1 di Kabupaten Labura. Mari kita semua masyarakat Labura, jangan menimbulkan kesenjangan, namun buktikan diri anda sebagai masyarakat yang kritis dan menjadi sosial kontrol terhadapKharismadalammenjalankan roda pemerintahan di Labura. Begitu juga dengan pihak legislatif Labura, kiranya menujukkan peran aktif dalam melakukanlobypolitikbaikkepusatmaupun kepada pihak lainnya untuk memberikan stimulus bagi pihak eksekutif yang secara formal diawasi yudikatif, semuanya untuk kemajuan sektor strategis hingga meningkatkan Pendapatan Asli Daerah (PAD) Labuhanbatu Utara. “Untuk kemajuan Labuhanbatu Utara ke depan, sepanjang masih dalam koridor hukum, bantelah (buatlah sesuatu) Bang Buyung dan Bah Minan. Selamat dansuksesataspelantikanKharisma sebagai Bupati danWakil Bupati Labuhanbatu Utara periode 2010-2015, Senin (15/11). Hotma “kekeng’ Darwis Pasaribu

B2 Polres Tanjungbalai Musnahkan Ganja Dan SS TANJUNGBALAI (Waspada) : Satuan Narkoba PolresTanjungbalai musnahkan narkoba jenis ganja seberat sembilan kilogram dan 542,1 gram sabu-sabu di halaman Mapolres, Kamis (11/11). Kapolres Tanjungbalai AKBP Puja Laksana melalui Kasat Narkoba AKP D Pinem menjelaskan, barang bukti narkoba tersebut merupakan hasil tangkapan petugas beberapa waktu lalu, namun kasusnya masih dalam tahap penyelidikan. Dikatakan Pinem, barang bukti ganja tersebut disita dari tersangka pasangan suami istri J alias S alias M dan EM Warga jalan M Idris Gang Famili Sei Putih, Kelurahan Medan Petisah yang ditangkap di Terminal Terpadu Kota Tanjungbalai, Senin (13/9) lalu. Sementara,barangbuktisabu-sabudiperolahdaritigatersangka yakni, Ma, Sy, dan, MI semuanya warga Aceh ditangkap petugas Bea dan Cukai Pelabuhan Teluknibung. Dikatakan Pinem, dalam memberantas peredaran narkoba di Tanjungbalai, pihaknya tetap berkomitmen namun dirinya mengharapkan kerjasama antara masyarakat dengan pihak kepolisian. (crs)

Pelantikan Kadis Pendidikan Labusel Gegabah MEDAN (Waspada): Formulabsel (Forum Komunikasi PemudadanMahasiswaLabuhanbatuSelatan)menilaiPjBupatiLabusel terkesan gegabah melantik kembali RM sebagai Kadis Pendidikan tanpa memperhatikan kasus yang menjerat Kadis bersangkutan. Ketua FormulabselYusuf Siregar didampingi Sekretaris Amin Harap menyatakan itu kepada Waspada di Medan, belum lama ini. “Seharusnya Pj Bupati Labusel mengangkat Kadis yang lebih baik dari pada yang baik,” tegas Yusuf. MenurutYusuf, secara prosedur pelantikan yang dilakukan sudahbetul,akantetapimenyinggungsoalsosok,harusnyaPjBupati mencari figur yang lebih baik bukan mereka yang sudah pernah menjadi tersangka dalam dugaan kasus korupsi. (m14)

Sumatera Utara

Setiap Bulan DBD Renggut Satu Nyawa Di L.Batu RANTAUPRAPAT (Waspada): Akibat endemik penyakit demam berdarah dengue (DBD), hampir setiap bulan, seorang warga Labuhanbatu meninggal karena penyakit yang ditularkan gigitan nyamuk aedes aegypti ini. Untuk Oktober, tercatat sepuluh warga yang terdata positif DBD oleh Dinkes L.Batu dengan penyebaran di sekitar Kota Rantauprapat. “Memang hampir setiap bulan ada yang meninggal karena DBD,” ujar Kasi Pemberantasan

Penyakit Menular (P2M) Dinkes L.Batu dr Rahmad Ramadhan kepada wartawan di ruang kerjanya, Kamis (11/11). Dijelaskan, dalam setiap bulan sejak Februari 2010 satu orang meninggal karena penyakit ini. Seperti contoh mulai Februari hingga April, sebanyak 16 orang mengidap DBD dan tiga orang dari 16 penderita meninggal dunia. “Setelah mendapat laporan dariPuskesmas setempattentang adanya DBD, pihak Dinas Kesehatan menurunkan tim pembasmi nyamuk dengan melakukan pengasapan (Fogging). Laporan terbaru menyebar di lingkungan Gajahmada, Gelugur dan Aek Siranda dan sudah kita fogging lokasinya,” kata Kasi P2M ini lagi. Dijelaskan Rahmad, upaya

fogging tidak terlalu efektif untuk memberantas penyakit DBD, jika tidak dibarengi dengan perilaku kehidupanmasyarakatyangtidak perduli dengan kebersihan lingkungan. Apalagi jentik nyamuk DBDhanyahiduppadagenangan airbersih.Rahmadmenyarankan, digalakanyakegiatanJumatbersih di lingkungan masing-masing lebih efektif untuk mencegah DBD. Untuk L.Batu sendiri, terdapat tiga zona merah penyebaran DBD yakni Kota Rantauprapat, Sigambal dan Negeri Lama. Sementara kawasan pesisir L.Batu lebih didominasi menyebarnya penyakit malaria. Dari data yang dimiliki Dinkes sudah tiga jenis penyakit menular yang menjangkiti masyarakat kepada mereka yakni DBD, malaria dan kusta. (a27)

Permata Galang Bantuan Korban Tsunami Mentawai TANJUNGBALAI (Waspada) : Persatuan MahasiswaTanjungbalai (Permata) melakukan aksi penggalangan bantuan korban tsunami Mentawai, Sumatera Barat. Koordinator mahasiswa Ade Chandra melalui rekannya Penentuan Marliza mengatakan, aksi tersebut dilakukan sebagai bentuksolidaritasdankepedulianmahasiswaTanjungbalaiterhadap nasib saudara sesama anak bangsa yang tengah tertimpa musibah, Rabu (10/11). DikatakanPenentuan,gempayangdisertaitsunami26Oktober lalutelahmeluluhlantakkansejumlahdesadiKepulauanMentawai dan mengakibatkan ratusan penduduk meninggal dunia dan hilang. Sedangkan ribuan jiwa lainnya kini berada di penampungan pengungsi dengan kondisi yang memprihatinkan danmembutuhkanbantuanmakanan,obat-obatansertapakaian. “Penggalangan bantuan ini dilakukan sejak 1 November lalu dan akan kita kirim malam ini juga menuju lokasi terjadinya musibah menggunakan truk colt diesel pengangkut bantuan serta mobil dinas DPRD Tanjungbalai membawa 15 relawan,” ucap Penentuan. Ditambahkannya, sampai Rabu 10 Oktober, terkumpul bantuan dalam bentuk uang sekitar Rp7.850.000, kemudian mi instan sejumlah 42 kotak, Beras 650 kilogram serta pakaian 20 goni ukuran besar. (crs)

Sipil Bersenjata Api Diyakini Ilegal BINJAI(Waspada): PengakuanKadisporaBinjaiDmempunyai senjata dinilai KetuaYayasan Putra Binjai HT Indra Bungsu sebagai pernyataan pelanggaran pidana yang diumumkan ke publik. Menurut Indra Bungsu, Selasa ( 9/11), izin kepemilikan senjata api sudah tidak dipernjang dan pemiliknya wajib menyerahkan kepada Polri, sesuai instruksi Kapolri tiga tahun lalu.Berarti masyarakat sipil yang punya senjata api saat ini diyakini ilegal dan Polres Binjai harus menindaknya. Masalah kepemilikan senjata oleh Kadispora Binjai D, sebenarnya sudah pernah diproses Polres Binjai, ketika ada pengaduan wartawan ketika melakukan konfirmasi kepada D di sebuah kafe miliknya di Jalan T.Amir Hamzah Binjai. Tiga wartawan sudah diminta keterangannya di Polres Binjai,ternyata kasusnya mengendap.Kini Kadispora Binjai kembali menyatakan iapunyasenjatadanPolresBinjaiharusmenelitistatuskepemilikan, sebab Kapolri sudah memerintahkan tidak memberikan izin pemakaian senjata kepada sipil. (a03)

Perseteruan Mantan Sekdako Segera Ke Pengadilan BINJAI (Waspada) : Perseteruan mantan Sekdako Binjai Drs H Ali Syafril, MAP dengan Gito Affandi, oknum mengaku Direktur Eksekutif LSM Wanacakra Binjai bakal bergulir ke pengadilan. ‘’Saat ini pihak Polresta Binjai telah memproses kasus pencemaran nama baik dan perasaan tidak menyenangkan ini,’’ ujar Ali Syafril ketika dikonfirmasi wartawan, Minggu (7/11) melalui telefon selular. Selain mengadu, Ali Syafril sudah diperiksa dan pemeriksaan saksi akan dilanjutkan kembali dengan memintai keterangan Kabag Umum, Litbang dan Kabid Asset Pemko Binjai, ujar sumber. SedangkanGitoAffandi saatdikonfirmasi Minggu(7/11) mengatakan siap kalau masalah ini sampai ke pengadilan dan dikatakan tidak ada hak mantan Sekda binjai memakai mobil dinas milik Pemko Binjai, karena tidak dibenarkan oleh Peraturan Daerah (Perda). Sementara itu Zulhamfiar Hasibuan yang diketahui selama ini selaku Direktur Eksekutif LSMWana Cakra ketika dikonfirmasi wartawan, Senin (8/11) terkejut dengan pernyataan Gito Affandi yang mengaku atau mengklaim dirinya sebagai Direktur Eksekutif LSM Wanacakra Binjai. Kalau memang ada pergantian jabatan di LSM ini seharusnya saya tahu atau dirapatkan terlebih dahulu, sehigga ada legitimasinya.’’Gito Affandi yang saya ketahui hanya sebagai Wakil Sekretaris di LSMWanacakra ini, papar Zul. (a04)

Panitia Muktamar II AMK Temui Pj Walikota T. Tinggi MEDAN (Waspada): Panitia Muktamar II AMK beraudiensi dengan PjWalikotaTebingtinggi dan PW Muhammadiyah Sumut, kemarin. Dalam audensi itu panitia Muktamar II AMK diterima Pj Walikota Tebingtinggi Drs H Edy Sofyan MAP di ruang kerjanya. Pada kesempatan itu Edy mengharapkan agar Muktamar II AMK bisa menjadi pendidikan politik bagi generasi muda Islam dalam menciptakan iklim yang demokratis kondusif. Edy juga menyampaikan pelaksanaan Muktamar II AMK diSumutyangdiikutiolehpengurusAMKseIndonesiamerupakan kehormatan yang paling berharga sebab dengan datanganya pengurus AMK ke Sumut tentunya akan menjadi penilaian sendiri bagi peserta Muktamar.”Selamat dan Sukses Muktamar II AMK di Sumut,” demikian Eddi Syofyan Sementara itu, Ketua PW Muhammadiyah SumateraUutara, Drs H Dalail Ahmad, MA meminta agar pelaksanaan Muktamar II AMK dijadikan sebagai ibadah dan jangan sekedar perebutan kekuasaan yang memutus hubungan silaturrahim sesama kader pemuda Islam. Hal itu disampaikan Dalail Ahmad ketika menerima audensi Panitia Muktamar II AMK di Kantor PW Muhammadiyah Sumut Jalan Sisingamangaraja Medan.(m39)

Waspada/Iwan Has

BERUBAH FUNGSI : Tidak hanya hutan Mangrove/pantai di Kabupaten Batubara yang menjadi sasaran para perambah untuk dialihfungsikan menjadi perkebunan kelapa sawit, namun hutan sungai turut menjadi sasaran tanpa mengindahkan lingkungan sekitar. Kondisi itu mengakibatkan terjadinya simentasi pendangkalan dan banjir yang menggenangi pemukiman penduduk saat musim pasang laut tiba. Terlihat kawasan pinggiran sungai di Batubara berubah fungsi menjadi perkebunan kelapa sawit yang sebelumnya areal tanaman nipah atau sagu (rumbiah). Foto direkam, Jumat (12/11).

Berburu Telur Tuntung Tinggal Kenangan BERBURU telur Tuntung di hamparan pasir Sungai Barumun tinggal sebuah kenangan, akibat induk Tuntung kini sudah punah di sungai itu. Induknya ini mungkin perlu dilestarikan kembali karena habitatnya selama ini ada di Sungai Barumun. Selain itu telur tuntung rasanya lezat dan bisa menambah gizi buat masyarakat sekaligus melestarikan satwa langka dan menjadikan ciri khas dari Kotapinang. Dulu hamparan pasir di Sungai Barumun Kotapinang, Labuhanbatu Selatan (Labusel) adalah tempat bertelurnya induk Tuntung itu. Tahun 1970-an, Kotapinang di Kab.Labuhanbatu Selatan ) terkenal dengan telur penyu (telur tuntung bahasa setempat-red). Dinamakan telur Penyu (telur tuntung-red) karena ratusan penyu hidup dan menyimpan ribuan telurnya di hamparan pasirdiSungaiBarumun.Namun kiniinduktuntungitutelahpunah, sekarang tak sebutir pun telur tuntung dapat ditemukan di pasir Sungai Barumun, bahkan induknya juga tak pernah ditemukan lagi. Munculnya gundukan pasir di Sungai Barumun dalam sebulanterakhirhanyamenjadisebuah panoramaindahdijadikansarana hiburan dadakan oleh warga sekitar. Padahal dulunya, setiap kemunculan pasir, kawasan itu berubah jadi kawasan terlarang untuk dimasuki sembarang orang. Sebab ratusan penyu akan bertelur di keheningan malam di dalam pasir. Keesokan hari barulah warga datang menggali pasir untuk mengambil telur tuntung itu. Namun kini tradisi berburu telur tuntung itu telah tiada.Tuntung yang dulu banyak di Sungai Barumun telah punah. “Dulunya kawasaniniadalahtempatperburuantuntung,dikalaSungaiBarumun surut muncul pasir putih dapat membawa berkah bagi warga,” kata Imam Parapat, 53, wargaJalanLabuhanLama,barubaru ini. Menurutnya, tuntung merupakan sebutan masyarakat se-

tempat terhadap sejenis hewan penyu yang ukuran postur tubuhnya jauh lebih besar dari penyu biasa. Ukuran dan bentuk telurnyapunlonjongsebesartelur bebek, sedangkan penyu biasa telurnya bulat sebesar bola tenis meja. Penyudulunyabanyakhidup di sepanjang daerah aliran Sungai Barumun yang berpasir di KabupatenLabusel,namunkinihewan langka itu benar-benar sangat sulit ditemui. “Kayak sekarang ini,meskisudahadapasir,namun induk penyu itu tak terlihat lagi,” katanya. Diceritakan, dulunya ketika pasirsudahtampakdikalaSungai Barumun surut, warga sekitar Barumun menancapkan bendera di tengah hamparan pasir itu. Bendera itu merupakan pertanda, sudah ada semacam panitia pengelola. Jikatuntungnantinyabertelur di tempat itu, maka kawasan di hamparan pasir itu sudah ada pengelola dan sudah mendapat rekomendasi dari kepala desa setempat.Kawasanitu pundijaga warga kampung, agar tak ada pencuri yang masuk. Di keheningan malam tak satupun suara terdengar, kecuali suara jengkrik, suasana begitulah disenangi induk penyu itu membuat ratusan ekor penyu berpostur tubuh seperti kuali terbalik dari dalam air Sungai Barumun mulai mendarat dengan empat kakinya ke hamparan pasir. Penyumulaiberaksimenggali lubang dengan kakinya, kedalaman lubang bervariasi hingga kedalaman 60 cm, sedangkan diameter lubang 20 -30 cm. Setelah itu hewan langka inipun meletakkan puluhan telurnya ke dalam lubang, bahkan hingga seratusan butir telur setiap satu lubang. Usai bertelur, penyu itupun menutup lubang dan lubang itu dipadatkan dengan cara membantingkan badannya, sehingga bekas lubang itupun kembali padat, namun bekas jejak kakinya tampak jelas diatas pasir itu, dari jejak kakinya itulah warga bisa menebak dimana Penyu itu menanam telurnya. Namundikalamusimhujan bekas jejak kakinya tidak tampak lagi, hal ini terkadang membuat pencari telur sedikit agak kewalahanmenebaklobangtelur,bahkan banyaktakdapatditemukan. Jika terjadi hal seperti ini, warga pemburu telur tuntung-pun menyediakan sebatang besi sebesar batang rokok panjang 1 meter,

diberi gagang mirip dengan pompa tangan. Besi itupun ditancapkan kedalam pasir, dari situ bisa diketahui apakah ada tidak telur di dalam pasir. Telur tuntung sebesar telur bebek dan lonjong itu kulitnya warna putih, sedangkan isi terdiri dari putih telur dan kuning telur. Setelah telur tuntung dikumpul di bawah tiang bendera, kemudianolehpengurus/panitiadibagi rata kepada semua pengunjung yang hadir saat itu, setelah menyisihkan bagian pekerja, kemudian oleh ketua panitia mengantarkan telur tuntung itu untuk bagian kepala desa dan camat. Begitulah seterusnya setiap hari silih berganti saat musim telur tuntung itu, membawa berkah kepada masyarakat dan meningkatkan gizi masyarakat. Umaruddin, warga di tempat itu mengatakan, telur tuntung dapatdikonsumsimentahdengan membuang putih telurnya terlebih dahulu, kemudian ada juga langsung merebusnya serta dengan cara asinan, tak obahnya seperti telur asin. Dulu telur tuntung ini pernah dijadikan cendramata khas dari Kotapinang. Namun sejak akhir era 1980-an, hewan bertelur itu hilang dan satu butir telurnya pun tak ditemui. “Dulu kalau orang keKotapinangyangdicariitutelur tuntung untuk oleh-oleh,” katanya. Rusaknya Lingkungan SayurMatuaBulungHarahap kini Camat Kotapinang menceritakan kepada Waspada, Rabu (10/11),duluketikadiamasihkecil berada di Kecamatan Halongonan,Paluta,masihmengingatsaat itu dia selalu menikmati lezatnya telur tuntung kiriman dari Kotapinang, namun sayang ketika dia menjadi Camat di Kotapinang saat ini telur tuntung itu sudah tidak ada lagi. Belakangan, banyak warga yang justru memburu induk tuntunguntukdijadikanmakanan dan komoditi ekspor. Karena konondagingtuntungitulembut. Itulah menurutnya pemicu punahnya tuntung di Sungai Barumun. Kondisi itu, tambahnya, diperparah lagi dengan rusaknya ekosistem lingkungan di sekitar Barumun akibat masuknya limbah pabrik yang beroperasi, limbah cair dibuang ke anak sungai dan semuanya bermuara ke Sungai Barumun. Deni Syafrizal Daulay/ Hasanuddin Harahap

WASPADA Sabtu 13 November 2010

Wainem, Wanita Uzur Taat Pajak AEKLEDONG, Asahan (Waspada) : Kendati berusia uzur dan jalan pun dibantu tongkat, namunWainem, warga Desa Aekledong Barat, Kec. Aekledong, Kab.Asahan, tetap tepat waktu membayar pajak setiap tahun. Menurut wanita renta berusia 108 tahun ini, membayar pajak merupakan kewajiban setiap warga negara yang harus dipenuhi. Ketaatannya membayar pajak tepat waktu, sudah menjadi kebiasaan sejak masa mudanya. “Dulu aku membayarnya langsung ke kantor desa, tapi sekarang dijemput petugas ke rumah,” tutur Wainem kepada Waspada, Kamis (11/11). Menurut Wainem, meski belum jatuh tempo, diatelahmemikirkanagarpajaknyasegeradilunasi. “Membayar pajak itukan kewajiban,” tutur istri alm H Jiworejo itu. Pajak yang disetorkanWainem ke Pemerintah, berasal dari tanah seluas 15 rante yang ditanami kelapa sawit, kelapa kampung dan rambutan. Kebun yang tidak seberapa itu dikelola anakanaknya. KepatuhanWainem membayar pajak diakui anak keempatnya, Saniyem. “Si Mbok ini selalu ingat bayar pajak, kalau belum bayar dia selalu gelisah,” ujar Saniyem. Dan menurut Saniyem, ibunya tidak pernah mewakilkan kepada anak-anaknya untuk membayarkan pajaknya. “Si Mbok kurang percaya sama kami untuk menyetorkan pajaknya. Malah semasa bapak masih hidup, lebih patuh lagi mem-

Waspada/Rahmad F Siregar

TAAT PAJAK: Kendati usianya sudah mencapai 108 tahun, Wainem tetap tepat waktu membayar pajak kepada pemerintah. Bayar pajak tepat waktu, merupakan kebiasaannya sejak muda. bayar pajak. Jatuh tempo masih lama, tapi pajak sudah dilunasi,” ungkap Saniyem. Camat Aekledong Evi Zarnita memberikan apresiasi tinggi terhadapWainem.“Patut diacungi jempol,meskipunsudahtuatapitetappatuhmembayar pajak. BuWainem merupakan wanita ulet, gigih dan punya kesadaran tinggi terhadap pentingnya membayar pajak,” kata Evi. (a37/crm)

UPK PNPM-MP T. Balai Tak Konsisten T.BALAI, Asahan (Waspada) : Unit Pengelola Kegiatan Program Nasional Pemberdayaan Masyarakat Mandiri Pedesaan (UPK PNPM-MP) Kecamatan Tanjungbalai, Kabupaten Asahan dinilaitidakkonsistendalampelaksanaankegiatan. Demikiandikatakansupliermaterialbangunan Syahren M, Selasa (9/11). Menurut Syahren, UPK, telah melanggar surat yang diedarkannya terkait persyaratanpendaftaranmenjadisuplierpengadaan material untuk jenis perorangan. “Saya melihat administrasi UPK terkesan amburadulsehinggaterjadipenundaanpelaksanaan jadwal pembukaan dokumen lelang,” kata Syahren. Dalam surat edaran yang disampaikan UPK kepadaTim Pelaksana Kegitan (TPK) Desa menyebutkan, persyaratan pendaftaran bagi suplier perseorangantidakmencantumkannomorpokok wajib pajak (NPWP). Akan tetapi, saat penyerahan dokumen pelelangan pada Selasa (9/11), UPK baru menyatakan pendaftar perseorangan wajib memiliki NPWP. Namun, kata Syahren, sampai saat ini UPK tidak bisa menjelaskan dasar hukum terhadap kewajiban melampikan NPWP bagi supplier perseorangan. “Jika suplier dari perusahaan, memang setahu kita harus melampirkan NPWP sesuai dengan peraturan ada, sedangkan untuk perse-

orangan tidak jelas aturannya dari mana,” kata Syahren. Persoalanlainnya,kataSyahren,UPKmeminta kepadaTPK Desa Kapias BatuVIII yang juga ketua panitia pelelangan Zaharuddin agar bersedia menerima suplier yang mendaftar pada Selasa (9/11), padahal masa penutupan telah berakhir pada Senin (8/11) pukul 15:00. Akan tetapi, kata Syahren, Zaharuddin menolak permintaan tersebut kecuali jika UPK memberikan rekomendasi penerimaan pendaftar di luar jadwal yang ditentukan agar dirinya tidak dipersalahkan. Namun, menurut Syahren, sampai saat ini pihak UPK tidak bersedia memberikan rekomendasi yang diminta TPK. Ketua TPK PNPM-MP Desa Kapias BatuVIII Zaharuddinmembenarkan.MenurutZaharuddin, dirinya mengaku mengetahui adanya penambahanpadapersyaratanNPWPbagisuplierperseorangan, setelah ia dipanggil ke sekretariat UPK PNPM –MP Kecamatan Tanjungalai, Selasa (9/11). Sekretaris UPK PNPM –MP Kecamatan Tanjungbalai Darwin mengatakan, pihaknya baru mengetahui penambahan persyaratan tersebut dari FK PNPM-MP KecamatanTanjungbalai pada Selasa (9/11) saat jadwal penyerahan dokumen pelelangan. (crs)

Kejari T.Balai Tetapkan Direktur PT BG Tersangka Proyek Rp2,5 M TANJUNGBALAI (Waspada) : Kejaksaan Negeri Tanjungbalai menetapkan Direktur PT BG sebagai tersangka proyek peningkatan jalan dan pemasangan tembok penahan tanah sepanjang 4 km di Desa Sei Pasir sampai Desa Sarang Helang, Kec. SeikepayangTimur, Kab. Asahan senilai Rp2,5 miliar lebih. Kepala Kejaksaan Negeri Tanjungbalai Herry Sunaryo didampingi Kasi Pidsus PDE Pasaribu dikonfirmasi Waspada mengatakan, penetapan BG sebagai tersangka dilakukan setelah Tim Kejari Tanjungbalai memeriksa sejumlah saksi dan instansi terkait yang terlibat dalam pengerjaan proyek tahun anggaran 2009 itu, Kamis (11/11). Dari hasil pemeriksaan, kata Kajari, ditemukan kejanggalan dalam pengerjaan proyek tersebut yang belum selesai dikerjakan secara keseluruhan hingga akhir masa kontrak yakniTA 2009. Namun diduga, dana yang dicairkan melebihi volume

fisik yang dikerjakan. “Menyangkut pencairan dana terhadap volume fisik yang dikerjakan, kita masih menunggu hasil pemeriksaan BPK,” kata Kajari. Setelah menetapkan Direktur PT BG sebagai tersangka, lanjut Kajari, Tim Kejari Tanjungalai yang diketuai Kasi Pidsus PDE Pasaribu didampingi Kasi Datun Samian, Saman D Munthe dan MRahmadmelakukanpenyitaanterhadapdokumen yang berkaitan pengerjaan proyek tersebut dengan Surat Penyitaan No.Print-1970/N.2.15/ Fpk.1/11/2010 yang ditandatangani Kajari. Lebih lanjut dikatakan Kajari, 30 dokumen berupa berkas mulai dari SK Pejabat Pembuat Komitmen, berita acara pelaksanaan proyek hingga menyangkut pencairan dana disita dari Sekretaris Dinas PU Asahan Ahmad Subari disaksikan staf Syahrum dan Hj Nidawati.(crs)

Pengadaan Komputer Online Diduga Sarat Rekayasa LIMAPULUH(Waspada): Dugaan rekayasa pengadaan komputer sistem online di 93 desa se-Kab. Batubara mulai terbongkar, mark up peralatan untuk KTP online itu sarat rekayasa oleh asosiasi kepala desa. Demikian diungkapkan Ketua Massa Penggerak Penegak Pembangunan (MP3) Bajaya Kab. Batubara Dahwir Munthe kepada Waspada, Rabu (10/11). Hasil investigasi yang dilakukannya dan pengakuansalahseorangkepaladesamengatakan, konsep pesanan barang, faktur tagihan dan berita acara pemeriksaan barang, berita acara serah terima barang, penghitungan pembayaran dilakukan oleh kordinator kecamatan yang telah ditandatangani di atas materai oleh Direktur CV BJ inisial EJ. Uniknya ditemukan perjanjian antara kepala desa (pihak I) dan CV.BJ (pihak II) diadakan tanggal 15 Desember 2009 sementara konsep penghunjukan oleh kades kepada CV BJ tanggal 23 Desember 2009.” Artinya janji dahulu baru diunjuk,” terang Dahwir. Kecacatan lainnya dari administrasi pengadaan barang itu pajaknya dibayar oleh kepala desa dengan nama wajib pajak CV.TB bukan

CV BJ melalui kantor pos pada 18 Oktober 2010. “ Indikasi manipulasi data pelaporan (SPJ) yang harus ditanggung jawabi oleh perangkat desa atau tim pelaksana kegiatan ADD desa didalangi oleh oknum asosiasi, pernyataan ini kami terima secara tertulis dari salah seorang kepala desa di Batubara, MP3 akan adukan hal ini ke pihak instansi hukum agar proses penegakan hukum dan pemberantasan korupsi berjalan di Batubara,” ujar Munthe. Ia juga mengecam BPKP, Inspektorat dan BPMD yang lalai atau memang berpura-pura tidak tahu akan kecurangan yang berpotensi merugikan keuangan daerah bersumber dari rakyat. Kamaludin, anggota BPD Desa Empat Negri, Kec. Limapuluh menjelaskan, penggunaan dana APB Desa sangat mencurigakan, sebab BPD tidak disertakan dalam perencanaan dan pengeluaran APB Desa itu. “ Kami sangat yakin kasus yang terjadi di desa kami juga dialami desa-desa lainnya di Batubara, Kepala desa tidak ada membicarakan anggaran desa dengan BPD sebagaimana yang seharusnya diatur oleh pemerintah,” beber Kamaludin. (a31)

FKIP UNA Harus Segera Dapatkan Akreditasi MEDAN (Waspada): Fakultas Keguruan Ilmu Pendidikan Universitas Asahan (FKIP-UNA) Kisaranharussecepatnyamendapatkanakreditasi, guna memenuhi ketentuan ditetapkan Dirjen Pendidikan Tinggi Departemen Pendidikan Nasional RI. Penegasan disampaikan Rektor UNA, Prof Dr. Ir H Darma Bakti, MS pada pelantikan Dekan FKIP UNA periode 2010-2014, Drs Dailami ,MPd dan Ketua Lembaga Penjamin Mutu UNA, Dr Abdul Murad, MPd, Sabtu (6/11) di Aula Fakultas Ekonomi UNA Kisaran. DemikiansiaranpersFKIPUNAKisaranditerima Waspada, di Medan, Selasa (9/11). Disebutkan Darma Bakti, FKIP sebagai fakultas termuda di lingkungan UNA harus segera mendapatkan akreditasiuntukmensejajarkandiridenganfakultas yang ada, dan terpenting memenuhi ketentuan dari Dirjen Dikti.

Selain melantik Dekan FKIP dan Ketua Lembaga Penjamin Mutu UNA, dalam kesempatan sama, Rektor UNA juga melantik pejabat di lingkungan FKIP UNA antara lain Pembantu Dekan Bidang Akademik Drs Awaluddin Sitorus, Pembantu Dekan Bidang Administrasi dan Keuangan Drs Abdul Aziz Rambe, MPd, Pembantu Dekan Bidang Kemahasiswaan Drs Ahmad Kusnin, M.Hum. Ketua Prodi Matematika Imannur, SPd.MPd, SekretarisTiopan Rahmat Siregar, SPd.MSi , Ketua Prodi Bahasa Inggris M.Yani, S.Pd.MM, Sekretaris M.Reza, S.Pd, M.Hum, Ketua Prodi Bahasa Indonesia Drs Masdar, M.Pd, Sekretaris Drs. Surono Zamroni, MMLs, Ketua PPM Eni Muliawati, S.Pd, MPd, Sekretaris Dra Hj Heni Subagiharti, M. Hum, Kepala UPPL, Drs H Edi Sucipto dan Sekretaris Bambang Hermanto, SPd. (m34/rel)

WASPADA Sabtu 13 November 2010

Sumatera Utara


Hajar Teman Di Cafe Sampai Babak Belur P. SIANTAR (Waspada): Seorang pria, FS, 50, warga Jalan Manunggal,KelurahanPematangMarihat,KecamatanSiantarMarihat, Kota Pematangsiantar tega menghajar temannya di satu cafe hingga babak belur. FS menghajar Wiwidaningsih, 42, warga Jalan Sriwijaya, Gang Khalsa, Kelurahan Melayu, Kecamatan Siantar Utara, Pematangsiantar di cafe Siantarmen, di Jalan Seribudolok, Kecamatan Panombean Pane, Kabupaten Simalungun pada Selasa (9/11) pukul 01:00. Korban diduga dihajar FS ketika keduanya sedang duduk minumminum. Diduga, FS karena terlalu banyak minum dan dipengaruhi minuman keras berusaha berbuat tidak senonoh terhadap korban. Kapolres Simalungun AKBP Drs Marzuki saat dikonfirmasi melalui Kasubbag Humas Iptu Sulaiman Simanjuntak dan Kasat Reskrim AKP Nasrun Pasaribu di Mapolres, Rabu (10/11) menyebutkan, pengaduan korban masih dalam penyelidikan dengan meminta keterangan korban dan para saksi. (a14)

Kakek Jurtul Judi Togas Diringkus BINJAI (Waspada) : Seorang pria tua A, 54, warga JalanTA Hamzah Gang Amal, Kecamatan Binjai Utara menjadi Jurtul (juru tulis) judi Togas kemarin, diringkus Sat Reskrim Polsek Binjai Utara dibawah pimpinan Iptu Lintas Pasaribu ketika sedang menunggu pembeli tebakan di salah satu warung kopi. Polisi selain mengamankan pria tersebut, juga mengamankan barang bukti uang Rp5.000 diduga uang tebakan dan satu lembar kertas berisi nomor tebakan dan jumlah uang pasangan serta alat judi lainnya. Kapolres Binjai AKBP Rina Sari Ginting melalui Kapolsek Binjai Utara AKP Kuasa Purba ketika dikonfirmasi tentang diringkus pria jadi Jurtul judi Togas tersebut membenarkannya. (a04)

Pengolahan Garam Di Lubuk Kertang Akan Dibangun P.SUSU (Waspada): PT Permata Senayan Properti Jakarta selaku bapak angkat direncanakan akan membangun Industri Pengolahan Garam yang lokasi strategisnya di Desa Lubuk Kertang Kec. Brandan Barat Langkat. Demikian Arbain,52, Warga Desa Lubuk Kertang dusunV klapa 6 Kec. Brandan Barat baru-baru ini kepada Waspada di P.Brandan. Dikatakan,usahaini,katapegawainegerisipil(PNS)daripendidikan itu sudah merintis usaha ini sejak tahun 2000. Sample air bulan Januari 2010 sudah diambil konsultan dari PT Permata Senayan Property. Selaku Pimpinan Hj Anggraini, SH.MBA berencana berinvestasi Rp 2,5 M. Pengolahan garam ini akan menyerap tenaga kerja berkisar 600 orang. Industri Pengolahan Garam yang direncanakan lokasinya diwilayah dusun-II Lubuk Kertang, tepatnya ditepi paluh nipah yang bermuara ke laut Tanjungbalai (Kwala-Brandan ) Arbain kepada Waspada mengatakan sangat disesalkan rekomendasi perizinan melalui Kades setempat tidak menandatanganinya. Harapannya Bupati Langkat Ngogesa Sitepu serta dinas terkait segera merealisasikan industri ini sehingga menambah PAD daerah tambahnya. (c02)

Ribuan Kader Nasional Demokrat Binjai Selatan Siap Berkarya BINJAI (Waspada): Ribuan kader Nasional Demokrat (Nasdem) di Kecamatan Binjai Selatan siap berkarya kepada masyarakat sesuai dengan cita-cita Nasdem yang harus dekat dengan masyarakat, sehingga keberadaan Nasdem dirasakan masyarakat di sekitarnya, bukan untuk menakut-nakuti masyarakat. Penegasan ini disampaikan Edi Nelson Sembiring (Acong), kader Nasdem Kota Binjai yang juga tokoh pemuda di kota rambutan ini dan sebagai penasihat DPC Laskar Merah Putih Kota Binjai, Rabu (10/11). Lebih lanjut dikatakan Edi Nelson Sembiring yang akrab dipanggil Acong yang juga tokoh pemuda Binjai, kehadiran Nasional Demokrat Binjai yang bakal dikukuhkan oleh DPW Nasdem Sumut, ternyata menuai simpati ribuan masyarakat yang ingin bergabung ke organisasi masyarakat (Ormas) ini dan bahkan untuk Kecamatan Binjai Selatan ribuan simpatisan telah menyatakan siap bergabung ke Nasdem ini. (a04)

Bupati Sergai Serahkan Penghargaan Dan Tali Asih Kepada Veteran PERBAUNGAN (Waspada): Berbeda dengan tahun-tahun lalu, peringatan Hari Pahlawan tingkat Kab. Serdang Bedagai yang dilaksanakan di bantaran Sungai Ular Kec. Perbaungan, Rabu (10/ 11) ditandai penyerahan penghargaan dan pemberian tali asih kepada sejumlah tokoh dan anggota veteran. Peringatan Hari Pahlawan di tempat bersejarah itu dipimpin langsung Bupati Sergai HT Erry Nuradi dan dihadiri Ketua DPRD Sergai H Azmi Yuli Sitorus, SH. MSP, Kapolres Sergai AKBP Drs Eri Safari,Wakil Bupati H Soekirman, Sekdakab Drs H Haris Fadillah, MSi, mewakili Dandim 0204/DS, mewakili Kajari Sei Rampah,Wakil Ketua TP PKK Ny Hj Marliah Soekirman, Ketua DWP Ny Hj Imas Haris Fadillah, para veteran, pemuda, pimpinan SKPD, Muspika Perbaungan dan sejumlah Camat se-Kabupaten Sergai. Upacara yang berlangsung penuh khidmat dan diakhiri tabur bunga ke Sungai Ular itu diikuti barisan dari unsur TNI Batalyon 122/TS, Polri, PNS, pemuda, pelajar dan ratusan pemuda peserta napak tilas perjuangan pada Selasa malam (9/11). Penerimapenghargaanatasprestasidankeikutsertaannyamenjaga kamtibmas di Kabupaten Sergai yang langsung diserahkan Bupati HT Erry Nuradi yakni Muspika dan beberapa warga Kec. Dolok Masihul serta warga Kec. Sipispis. (a07)

DPD RI-Pemkab Sergai Sosialisasi Empat Pilar Kehidupan SEIRAMPAH (Waspada): Empat pilar kehidupan berbangsa dan bernegara yaitu Pancasila, UUD Negara Republik Indonesia, Negara Kesatuan Republik Indonesia (NKRI), Bhinneka Tunggal Ika dan Ketetapan MPR RI disosialisasikan di hadapan jajaran staf Pemkab dan unsur pemuda Kabupaten Serdang Bedagai. Sosialisasi yang dilaksanakan atas kerjasama anggota Dewan Perwakilan Daerah (DPD) RI DR H Rahmat Shah dengan Pemkab Serdang Bedagai itu diselenggarakan di aula Sultan Serdang kantor Bupati Sergai di Seirampah, Selasa (9/11) dihadiri Bupati Sergai HT Erry Nuradi, Kapolresta Tebingtinggi AKBP Robert Haryanto Watratan,Wabup H Soekirman, mewakili Dandim 0204/DS, mewakili KapolresSergai,mewakiliKajariSeirampah,WakilKetuaPNTebingtinggi Deli, para camat, Kacabdisdik kecamatan, pimpinan SKPD dan ketua organisasi kepemudaan di Sergai. Anggota DPD Rahmat Shah didampingi DR Marzuki Lubis selaku narasumber dalam kesempatan itu menjelaskan, sosialisasi keempat pilarkehidupanberbangsadanbernegaraitubertujuanuntukmemberikan pemahaman terhadap empat materi sosialisasi termasuk perubahan beberapa pasal yang terdapat dalam UUD 1945. Diungkapkan Rahmat Shah, alasan dipilihnya Kabupaten Sergai sebagai lokasi sosialisasi karena kabupaten ini dinilainya merupakan daerahpemekaranyangberhasildanprosespercepatanpembangunan yang dilaksanakan jajaran pemerintahan bekerjasama dengan masyarakat di daerah ini terus mengalami peningkatan yang cukup signifikan. (a07)

NARASUMBER: Ketua PWI Cabang Sumut, Drs Muhammad Syahrir bersama Redaktur Pelaksana Harian Waspada, H Sofyan Harahap tampin sebagai narasumber pada Bimbingan Teknis Kehumasan dan Kewartawanan Lingkup Pemkab Nias bertempat di Ruang Oval Lantai III Kantor Bupati Nias, Jumat (12/11). Waspada/Bothaniman Jaya Telaumbanua

Warga Batubara-Simalungun Tuntut Penuntasan Kasus Korupsi MEDAN (Waspada): Sejumlah warga tergabung dalam Aliansi Masyarakat Peduli Batubara (AMPERA) dan elemen masyarakat Simalungun, Kamis (11/11) mendatangi Kejatisu, menuntut penuntasan kasus korupsi di daerah mereka. Massa AMPERA diterima Kajatisu Sution Usman Adji didampingi Asintel Kejatisu Andar PW, KasiPenkumEdiIrsanKurniawan Tarigan dan Kasi Prosarin Intel Kejatisu Ronald Bakara di Lt 2 ruang kerja Kajatisu. Kasi Penkum Edi Irsan KurniawanTarigan mengatakan, kehadiran massa AMPERA LSM itu mempertanyakan sekaligus menuntut penuntasan sejumlah kasus dugaan korupsi yang dilapor-

kan sebelumnya dan kini sedang ditangani Pidsus Kejatisu, antara lain kasus pengadaan tanah dan pembangunan tujuh kantor SKPD Pemkab Batubara yang diduga tidak sesuai kontrak dan bestek serta penggunaan DAK yang diduga menyimpang. Kata dia, beberapa bulan lalu sejumlah kasus dugaan korupsi itu dilaporkan ke Kejatisu, termasuk kasus penggunaan dana APBD di Bappeda terkait rencana tata ruang dan tata wilayah, kasus pengadaan SIAK/komputer untuk 95 desa, kasus penggunaan DAK TA 2009 sekitar Rp20 miliar untuk sekolah pada Disdik Batubara. Sedang pembangunan tujuh SKPD pada Dinas PU dan kasuspengadaantanahpadaSek-

retariat Daerah Batubara. Mereka meminta Kejatisu serius menangani kasus tersebut, apalagi selama ini sejumlah pejabat terkait seperti asisten, kadis, kepalaBKD,termasukSekdaPemkab Batubara dan para rekanan sudah dipanggil Kejatisu untuk diperiksa. Kasi Penkum Edi Irsan menanggapi kehadiran elemen masyarakat itu, Kajatisu menginformasikan penanganan kasus itu masih berjalan di Pidsus. Sebelumnya, Kejatisu juga menerima warga Simalungun yang meminta Kejatisu menindaklanjuti dugaan KKN antara lain soal DAK Pendidikan 2009 di Simalungun dan di Dinas Pertanian Simalungun. (h05)

Kapolsek Di Karo Diminta Serius Berantas Judi KABANJAHE (Waspada) : Kapolres Tanah Karo AKBP Drs Ig Agung Prasetyoko menginstruksikan seluruh Kapolsek yang berada di wilayah hukum Kabupaten Karo serius untuk memberantas segala bentuk permainan dan bandar judi yang semangkin merebak di daerah itu, Kamis(11/11). Kini telah dikumpulkan 10 Kapolsekyangtersebardi17kecamatan di Kabupaten Karo agar lebih serius menggelar Operasi

Pekat, termasuk berantas judi sesuai instruksi dari Kapolri dan Kapolda Sumut yang disampaikan Kapolres Tanah Karo AKBP Ig Agung Prastyoko didampingi Kasat Reskrim AKP Lukmin Siregar kepadaWaspada dihalamanMapolres Karo. Menurut Kapolres, sesuai dengan instruksi dari Kapolda Sumut, pihaknya tetap serius untuk memberantas segala bentuk penyakit masyarakat (pekat) di antaranya judi maupun narkoba,

sehingga apabila Kapolsek tidak serius memberantas judi di wilayahhukumnya,masyarakatdapat menyampaikan melalui call center di Mapolres Karo. Kapolresjugamenambahkan lebih serius menindak tegas Kapolsekdanseluruhanggotakepolisian yang terlibat judi. Apabila hal ini sampai terjadi, Kapolres tak segan-segan akan mengadukannya ke Kapoldasu agar dicopot dari jabatannya. (cmm/a17)

Belanja Daerah Pemko P.Siantar Bertambah Rp47 Miliar P. SIANTAR (Waspada): Belanja daerah Pemko Pematangsiantar bertambah dari Rp47.967. 089.848,49 atau naik 9,90 persen dari APBD indukTA 2010 sebesar Rp484.336.467..450,-hinggamenjadi Rp 352.303.557.298,49. Walikota Pematangsiantar Hulman Sitorus menjelaskan secara umum gambaran beberapa perubahan angka struktur APBD TA 2010 yang diajukan dalam pengantar nota keuangan RPAPBD TA 2010 saat rapat paripurna

DPRD di ruang sidang DPRD, Rabu (10/11) sore. Rapat dipimpinWakil Ketua DPRD Zainal Purba dan Timbul M Lingga, dibantu Plt Sekretaris DPRD Mahadi Sitanggang, tanpa dihadiri Ketua DPRD Marulitua Hutapea, dihadiri Sekda Donver Panggabean, para asisten, kepala badan, dinas, kantor dan camat Pemko. Sedang pendapatan daerah, menurut walikota bertambah Rp35.321.472.158 atau naik 7,71

persen dari APBD induk TA 2010 Rp457.936.467.450hinggamenjadi Rp493.257.939.608danpembiayaan daerahberupapenerimaanpembiayaan daerah berambah Rp14. 971.655.622,49ataunaik49,91persendariAPBDindukTA2010Rp30 miliar hingga menjadi Rp44.971. 655.622,49.Se-mentarapengeluaran pembiaya-an daerah bertambahsebesarRp2.326.037.932 atau naik 64,61 persen dari APBD indukTA 2010 sebesar Rp 3,6 miliar menjadi Rp5.926.037.932. (a14)

Mayat Wanita Di Dalam Karung KABANJAHE (Waspada): Warga Kutarayat di Kecamatan Namanteran, Kab. Karo dikejutkan dengan penemuan sesosok mayatwanitayangdibungkusdalam karung di rawa-rawa, Kamis (11/11). Temuan yang menghebohkan pertama kali diketahui 2 anak yang bermain di rawa-rawa dan tak sengaja melihat bungkusan

karungbesardisangkaberisibotot. Saat evakuasi mayat wanita yang ditemukan di rawa-rawa, petugas menemukan batu yang berada di dalam karung mayat. Sementara diketahui warga yang ikut melihat jalanya evakuasi ternyata salah seorang warga mengenali mayat itu bernama Amelia S br Sitepu,18, warga Kutarayat,

Kec. Namanteran, Karo. Polsek Simpang Empat AKP Eddwart Simamora yang ditemui Waspada di RSU Kabanjahe mengatakan, pihaknya belum mengetahui motir penemyan mayat itu dan pihaknya akan mengusut pelaku pembuangan mayat wanita yang diperkirakan sudah tiga hari tersebut. (cmm/a17)

Sampai Meninggal, Istri Tidak Pernah Dijenguk Suami P. SIANTAR (Waspada): Sampai meninggal akibat menderita sesuatu penyakit, seorang istri, Melvin Monica Lubis, SE, 26, diduga tidak pernah dijenguk suaminya, JJP, SH, 28, PNS, warga Perumnas Batu Enam, Jalan Kedondong Raya, Kelurahan Sitalasari, Kecamatan Siantar, Kabupaten Simalungun. Keterangan dihimpun dan pengaduan orangtua korban di Polres Simalungun, Kamis (11/ 11) menyebutkan JJP mengantarkan korban dari rumah mereka, Perumnas Batu Enam, Jalan KedondongRaya,KelurahanSitalasari, Kecamatan Siantar ke rumah mertuanya pada Selasa (15/ 6) pukul 09:00. JJP mengantarkan istrinya itu ke rumah mertuanya yang tidak berapa jauh dari rumah mereka, karena istrinya itu menderita

sesuatu penyakit. Namun, sejak diantarkan ke rumah mertuanya itu, JJP tidak pernah menjenguk korban apalagi membawanya berobatdanmemberikannafkah. Korban yang menderita sesuatu penyakit yang cukup kronis itu akhirnya meninggal dunia baru-baru ini, namun JJP tetap tidak mau melihat istrinya itu hingga mertuanya kehilangan kesabaran dan akhirnya mengadukan JJP ke Polres. Peristiwa isteri ditelantarkan suami diduga turut dialami korban Niarti, 26, ibu rumah tangga, warga Huta Sidorejo, Nagori Sitalasari, Kecamatan Siantar, Simalungun. Korban dalam pengaduannya di Polres Simalungun, Kamis (11/11) menyebutkan suaminya Mar, 29, wiraswasta, warga Perumnas Batu Enam, Jalan Maka-

dame Raya, Kelurahan Nusa Harapan, Kecamatan Siantar diduga menelantarkan istrinya sejak Selasa 1 Desember 2009 pukul 20:00. Menurut Niarti, suaminya Mar menggugat cerai dirinya ke Pengadilan Agama, namun Mar tidak datang saat sidang ikrar sertatidakmenafkahikorbanlahir dan bathin. Kapolres Simalungun AKBP Drs Marzuki, MM saat dikonfirmasi melalui Kasubbag Humas Iptu Sulaiman Simanjuntak dan Kasat Reskrim AKP Nasrun Pasaribu, SIK di Mapolres, Jumat (12/ 11) menyebutkan JJP dan Mar diduga melakukan tindak pidana kekerasan dalam rumah tangga (KDRT) terhadap istri mereka dan melanggar Undang-undang RI Nomor 23 tahun 2004 tentang penghapusan KDRT.(a14)

Humas Dan Pers Menjadi Ujung Tombak Penyebaran Informasi GUNUNGSITOLI (Waspada): Peran Humas suatu lembaga bekerjasama wartawan media massa menjadi sangat strategis dalam penyebaran informasi kepada seluruh lapisan masyarakat. Untuk itu Humas harus terus membenahi diri dalam menyajikan informasi melalui pemberitaan sesuai dengan karakter dan gaya media massa yang akan dijadikan sebagai mitra dalam menyebarkan informasi publik dimaksud. Demikian antara lain hasil rekomendasi pada pelaksanaan BimbinganTeknis(Bimtek)Kehumasan dan Kewartawanan Lingkup Pemkab Nias yang berlangsung selama dua hari dan dibuka dan ditutup secara resmi oleh BupatiNiasdiwakiliAsistenPemerintahan dan Kesra Kab. Nias, Samson P. Zai, SH, MH di Ruang Oval Lantai III Kantor Bupati Nias, Kamis (11/11). Pada penyelenggaraan Bimtek yang difasilitasi oleh Bagian Humas Setda Kab Nias, tampil sebagai pembicara di antaranya, Ketua PWI Cabang Sumut, Drs Muhammad Syahrir, Redaktur Pelaksana Harian Waspada, H Sofyan Harahap, Asisten Pemerintahan dan Kesra Kab Nias, Samson P. Zai, SH.MH, Kadis Kependudukan Kab Nias. Drs Fanolo Hulu, M.Si. Sedangkan peserta Bimtek terdiri dari staf dari masing-masingSKPDdiLingkungan Pemkab Nias serta seluruh wartawan baik media cetak maupun elektronik di wiliayah Nias. Tampil sebagai pembicara pertama pada pelaksanaan Bimtek, Samson P. Zai, SH.MH memaparkan Tentang UU. No. 14 Tahun 2008 Tentang Keterbukaan Informasi Publik dan PengelolaanInformasidanDokumentasi Pemerintahan Daerah Berdasarkan Permendagri No. 35 Tahun 2010. Samson Zai menyebutkan dalam UU No. 14 Tahun 2010 ini Tentang Keterbukaan Informasi Publik masingmasing pihak baik Badan Publik maupun Pemohon atau Pengguna Informasi Publik memiliki hak dan kewajiban yang diatur se-suai undang-undang tersebut. Sementara Kadis KependudukanDanCatatanSipilKabNias, Drs Fanolo Hulu, MSi memaparkan topik Peranan Humas Dalam Membangun Citra Positif Pemerintah atau Lembaga Non

Pemerintah. Dalam hal ini peranan Humas dapat dilakukan dengan expert preciber communication (tenaga ahli preciber komunikasi), problem solving process facilitator (fasilitator dalam proses pemecahan masalah), communication facilitator (fasilitator komunikasi) dan technician communication (teknisi komunikasi). PadakesempatanlainnyaKetua PWI Cabang Sumut, Drs MuhammadSyahrirmenyampaikan makalah tentang Kebebasan Pers dan Kode Etik Jurnalistik serta Opini Publik Yang Konstruktif dan Citra Positif Pers. Syahrir menyebutkan kebebasan pers pada saat ini sudah sangat jauh berbeda sebelum era reformasi terutama sikap pemerintah terhadap keberadaan pers. Sebelum era reformasi peran pemerintah sangatmenyolokdenganmelakukancontrolterhadapperssementara pada era reformasi justru perslebihindependendalammelakukan control terhadap pemerintah. Sementara dalam pembentukan opini publik, pers mempunyai posisi yang sangat strategis dalampembentukanopinipublic. Fungsi pers adalah sebagai jembatan antara pemerintah dengan masyarakat maupun sebaliknya, atau masyarakat dengan masyarakat. Pers juga berperan dalam perkembangan demokrasi di Indonesia, bahkan pers disebutkansebagaipilarkeempatpembangunan dan demokrasi setelah eksekutif, legislatif dan yudikatif. Stigma Negatif Sedangkan Redaktur Pelaksana Waspada, H Sofyan Harahap mengangkat topik Peranan Pers dan KEJ serta Teknik Penulisan dan Peliputan Berita. Sofyan Harahap mengungkapkan saat ini masih banyak pihak yang member stigma negatif merasa sulit menjalin kerjasama dengan mediamassakalautidakmemakai uang.Padahalstigmanegatif adalah salah besar sebab dalam Kode Etik Jurnalistik karena menerima uang dari nara sumber atau objek berita yang terkait masalaha adalah satu dari empat pelanggaran berat atau perbuatan tak termaafkan buat insan pers. Keempat pelanggaran berat bagi jurnalis tersebut masing-masing menerima suap, mebocorkan narasumber, membuat berita bohong dan

melakukan plagiat. Dalamkaitantugasjurnalistik, peran utama pers adalah menyebar luaskan informasi, mendidik,, melakukan kritik (social control) terhadap hal-hal yang bertentangandenganhukumdannormanorma yang berlaku di masyarakat dan lembaga negara, hiburan dan sebagai mediasi. Wartawan profesional dalam penulisan dan peliputan berita tentunya harus mengikuti tahapan baku yang ada sehingga apa yangmenjadikaryajurnalistikdari seorang wartawan sudah memenuhi syarat sebagai berita yang layak dipublikasikan oleh media massa tempatnya bekerja. Setiap berita yang menjadi satu karya jurnalistik dari seorang wartawan harus memenuhi syarat 5W + 1H yang artinya What, Apa yang terjadi,Who, Siapa yang terlibat, Where, Dimana terjadi, When, Kapan terjadi, Why, Mengapa terjadi dan How, Bagaimana bisa terjadi.Jikahalinisudahterpenuhi maka karya junalistik yang dibuat wartawan sudah layak menjadi satu berita yang memiliki nilai. Pada bagian lain, Sofyan Harahap memaparkan Humas suatulembagadapatbekerjasama dengan media massa dengan prinsip saling menguntungkan. Ada beberap tips agar petugas Humas dapat sukses menjalin kerjasamadankemitraandengan media massa yakni mennetukan jenis media yang tepat dan sesuai dengan bidang yang kita kelola, karena segmen pasar masingmasing media berbeda. Petugas Humas harus dapat mengenali pimpinan dan staf dari media tersebut karena biasanya kalau sudah saling mengenal maka halhal yang awalnya terasa sulit menjadi lebih mudah. Kalau ingin berita dari suatu lembaga dimuat di media massa terlebih dahulu harus mempelajari karakteristik dan memenuhi ketentuan atau kriteria yang diinginkanmasing-masingmedia massa.PetugasHumasharusbisa membuat satu informasi yang penting buat media massa yang menyangkut hajat hidup orang banyak. ‘’Kalau unsur pentingnya kurang, sebaiknya Humas membuat berita dengan poin yang menarik dan unik sehingga menarik perhatian dari publik itu sendiri,’’pungkasSofyanHarahap. (a35)

Jelang Idul Adha, Penjualan Hewan Kurban Belum Meningkat STABAT (Waspada): Hari Raya Idul Adha semakin dekat, namun belum berpengaruh dengan tingkat penjualan hewan kurban di Sambirejo, Kec. Binjai, Kab. Langkat yang terdapat sentral penjualan domba, dan tingkat penjualannya tidak melonjak, bahkan menurut pedagang menurun dari tahun sebelumnya. ‘’Rata-rata hanya tujuh hingga sepuluh domba yang terjual setiap hari untuk kurban, sementara tahun sebelumnya lebih banyak dari jumlah itu,’’ kata Tugiono, salah seorang penjual hewan kurban, Rabu (10/11). Dia dan beberapa penjual lainnya menilai calon pembeli sekarang ini lebih berminat membeli sapi daripada kambing, sebab jika sapi yang dikurbankan, dalam ajaran Islam dapat berbagi dengan tujuh orang dan dewasa ini banyak sistem pembayaran bertahap yang dibuat masing-masing kelompok, disamping faktor daging jelas lebih banyak. Di sentral penjualan hewan kurban di Sambirejo, harga domba per ekor bervariasi mulai dari Rp700.000 – Rp1,5 juta. Sementara untuk sapi berdasarkaninformasiyangdiperoleh berkisar Rp7 juta – Rp8 juta. (a38)

Waspada/Abdul Hakim

HEWAN KURBAN: Jelang Idul Adha, transaksi jual beli hewan kurban meningkat dari hari-hari biasanya, meskipun diakui pedagang menurun dari tahun sebelumnya. Gambar direkam di sentral penjualan domba di Desa Sambirejo Kec. Binjai, Kab. Langkat, Rabu (10/11).

B4 119 Desa Di Palas Gelar Pilkades Serentak SIBUHUAN (Waspada): Sebanyak 119 desa yang tersebar di sembilan kecamatan di Padanglawas melakukan pemilihan kepala desa (Pilkades) serentak. Asisten I Pemerintahan Sekretariat Kantor Bupati Padanglawas Saiful Bahri Siregar, Kamis (11/11) mengatakan, partisipasi warga mengikuti pemilihan di tiap desa diperkirakan rata-rata di atas 90 persen. Namun dia tidak membantah adanya sedikit persoalan di Kec.Barumun Tengah dan Huristak, namun hal itu tidak berkaitan dengan pelaksanaan pilkades. “Diduga ada unsur ketidaksenangan di antara warga, sehingga hari H Pilkades ada keributan yang mengganggu jalannya pemilihan,” ungkapnya. Kabag Tapem Ramal Guspati Pasaribu menyatakan, peran serta warga untuk menggunakan hak suaranya cukup antusias. Dari jumlah daftar pemilih tetap (DPT), yang tidak ikut memilih hanya sekitar 7 persen. Camat Barumun Harjusli Fahri Siregar mengakui, jumlah DPT di 16 desa yang melaksanakan Pilkades tercatat 6.194 orang, dengan suara sah sebanyak 5.876, suara tidak sah 318 dan 10 suara tidak ikut memilih. Pencapaian persentase pelaksanaan lebih dari 90 persen. Camat Batanglubu Sutam Rahmat Hasibuan menyatakan, keca-matan yang dipimpinnya tergolong berpenduduk rendah. Sedangkanyangmelaksanakanpilkades16desadenganperolehan pencapaian sebesar 91 persen. Sesuai dengan rekapitulasi yang dilaporkan, jumlah DPT sebanyak 3.741 orang, suara sah 3.242 dan suara tidak sah 121, sementara tidak ikut memilih 378 orang. Sementara Camat Hutaraja Tinggi GT Hamonangan Daulay menyatakan, partisipasi warga di kecamatan tersebut rata-rata 94 persen, tiap desa dari 13 desa yang melaksanakan pilkades dengan jumlah DPT 8.558 suara, perolehan suara sah 8.304 dan tidak sah 254 suara. (crif)

Anggota Dewan PAW Dilantik PANYABUNGAN (Waspada ) : DPRD Kabupaten Mandailing Natalmelaluisidangparipurnaistimewa,Kamis(11/11)melantikan sekaligus pengambilan sumpah/janji anggota dewan Pengganti Antar Waktu ( PAW ) dari H Abdurrahman Musthafa Nasution (alm) kepada Hj Riadoh br Rangkuti. Pelantikandisaksikanolehpejabateksekutif,yudikatif,legislatif, pengurus teras PKB serta undangan lainnya. Hj Riadoh Rangkuti telah ditetapkan sesuai dengan Keputusan DPRD dan Gubsu Samsul Arifin Nomor 188.44 / 638 / KPTS / tahun 2010 tertanggal 8 November 2010. DalamkesempatanituKetuaDPRDMadinaAsImranKhaitamy Daulay mengharapkan Hj Riadoh boru Rangkuti bergabung untuk mengabdi dan berjuang membangun Kabupaten Mandailing Natal sesuai dengan tugas yang dibebankan sebagai anggota DPRD PAW. (a24)

Kejari Binjai Kembali Sidik Korupsi Aladin 2009 BINJAI (Waspada) : Kejaksaan Negeri Binjai yang selama ini dinilai lamban mulai aktif memeriksa tindak pidana korupsi atap, lantai dan dinding(aladin) tahun anggaran 2009. Kasipidsus Kejari Binjai FKJ Sembiring menyebutkan, Rabu (10/11), pihaknya sudah memanggil untuk diminta keterangan panitia lelang projek Aladin 2009 J. Namun J masih belum memenuhi panggilan Kejari Binjai. Disebutkan selain J, juga ada lagi diminta keterangannya, namun Sembiring enggan menyebutkan inisial. Kejari Binjai menjadwalkan J dipanggil lagi, Senin (15/ 11). Tindak pidana korupsi projek Aladin tahun anggaran 2009 oleh Kejari Binjai sebelumnya sudah menetapkan tiga tersangka yaitu ZA selaku PPK, dua kontraktor SP dan HN. Beberapa saksi sudah diminta keterangan oleh Kejari Binjai. FKJ Sembiring menyebutkan, tiga tersangka yang sudah ditetapkan Kejari Binjai berkurang tak mungkin, tetapi bertambah besar kemungkinan. Projek Aladin tahun anggaran 2009 dilaksanakan di lima kecamatan dengan lima kontraktor, sementara beberapa pelaksanaan projek juga sudah diminta keterangannya di Kejari Binjai. (a03)

Sumatera Utara

Aktivitas Galian C Liar Marak Di Barumun SIBUHUAN ( Waspada): Aktivitas galian C ilegal marak di Kec.Barumun, Kab.Padanglawas yang cenderung mengakibatkan kerusakan di bibir pantai pada sejumlah sungai dan sekaligus membuat keprihatinan warga dan banyak pihak lainnya. “Saat ini 13 pengusaha penambang galian C yang belum mempunyai izin (liar) beroperasi mengeruk batu dan pasir di Barumun,” ungkap Camat Barumun Harjusli Fahri Siregar dalam rapat penertiban galian C ilegal di Aula Kantor Bupati Palas di Sibuhuan, Kamis (11/11). Dikatakan, aktivitas penambangan ilegal seperti di Sungai Siabu Barumun Selatan, Sungai Mandurana Barumun Barat dan di sepanjang aliran Sungai Baru-

mun sudah berlangsung lama. Akibatnya lingkungan di wilayah penambangan liar semakin hari semakin rusak parah. “Degradasilingkunganakibat penambangangalianCberlebihan dantidakberwawasanlingkungan ini terlihat saat peninjauan langsung,” ujarnya Yang paling mengkhawatirkan, lanjut camat, penambangan liar di Desa Saba Otang, para penambang mengeruk pasir dan kerikil (koral) di sekitar rambin titi gantung Saba Otang tanpa memikirkan akibatnya terhadap satu-satunya sarana perhubungan ke desa yang berpenduduk 200 KK. “Bila tidak segera dihentikan, paling lambat 3 tahun lagi rambin bisa rubuh, karena mereka me-

ngerukhinggakebawahnya,”ujar Harjusli. Camat Ulu Barumun Abdul Amri Hasibuan dalam rapat mengungkapkan, rusaknya badan jalan arah Sosopan akibat tonase yang berlebihan pada pengangkutan material galian C yang diperoleh dengan ilegal. “Sejumlah ruas badan jalan di Sosopan sepanjang ke Ulu Barumunrusakakibatbebankendaraan yang berlebihan saat mengangkut pasir,” ungkapnya. Rapat dipimpinWakil Bupati PadanglawasHAliSutanHarahap dihadiri Kepala Badan Perizinan Burhanuddin Harahap, Kepala Badan Dampak Lingkungan Zulkifli Harahap, Camat se-Kab. Padanglawas dan seluruh Muspika. (crif)

Pimpinan Komisi DPRD DS 2010-2011 Tersusun LUBUKPAKAM (Waspada): Rapat paripurna DPRD Deliserdang menyetujui perubahan pertama susunan pimpinan dan keanggotaankomisi-komisimasa kerja tahun 2010-2011, dihadiri Asisten I Setdakab Deliserdang HM Iqbal Nasution, unsur Muspida dan sejumlah pimpinan SKPD sejajaran Pemkab Deliserdang, Selasa (9/11). Dalam keputusan rapat paripurnamenetapkansusunanpimpinan dan keanggotaan komisikomisi DPRD Deliserdang 20102011 masing-masing Komisi A (membidangi hukum, pemerintahan dan pertanahan) Benhur Silitonga (Ketua), Mikhail TP

Purba (Wakil Ketua) dan H Abdul Latif Khan (Sekretaris) dibantu sembilan anggota. Komisi B (membidangi tenaga kerja dan perekonomian) Pdt Parlon Sianturi STh (Ketua), M Ramli (Wakil Ketua) dan Suryani (Sekretaris) dibantu tujuh anggota. Komisi C (membidangi keuangan, investasi dan perizinan)ABudi(Ketua),HerwanNafil (Wakil Ketua) dan H Syarifuddin Rosha (Sekretaris) dibantu delapan angota. KomisiD(pembangunandan kesejahteraan rakyat) Jaresman Sitanggang (Ketua), Timur Sitepu (Wakil Ketua) dan Supardi (Sekretaris) dibantu sepuluh anggota

Aksi Pencurian Pipa Cubing Sumur Merajalela P.BRANDAN (Waspada): Pipa cubing sumur minyakT.143 eks peninggalan kolonial Belanda di DesaTelagasaid, Kec. Sei Lepan dibongkar maling dan sejumlah 40 joint pipa produksi penyalur minyak ukuran 2 3/8" sepanjang 250 meter di bawah permukaan laut,Rabu(10/11)pukul07:30raib dibawa kabur. Unsur manajemen PT EksindoTelaga Said Darat (ETSD) selakuTACPTPertaminaEPbegitu mendapat informasi tentang aksi pencurian ini langsung turun ke lokasi bersama sejumlah aparat kepolisian dari Mapaolsek P.Brandan termasuk aparat TNI, namun pelaku telah keburu menghilang. Ada dugaan aksi pencurian terhadap aset vital milik negara ini melibatkan orang dalam yang bekerjadiPTETSD.“Sayaadamenerima informasi salah seorang pekerja terlihat bersama pelaku,” kata seorang sumber yang belum bersedia merinci nama orang

dalam yang dimaksud. Humas TAC Pertamina ETSDBinsarSimatupangmengatakan, aksi pencurian sudah merajalela, tidak hanya pipa cubing, tapi juga crude oil. Dalam sehari,lanjutnya,rata-rataminyak yang curi mencapai 3-4 ton. Aksi pencurian crude oil (minyak mentah) di lokasi sumur sudah berlangsung sejak tahun 2009 hingga sekarang. Dampak dari merajalelanya aksi pencurian ini, kata Binsar, pencapaian produksi minyak mentah PT ETSD sebagaimana yang disyaratkan PT Pertamina semakin tidak tercapai. Kapolsek P.Brandan HM Kosim Sihombing mengatakan, kasus pencurian pipa produksi penyalur minyak (cubing) di lokasi sumurT.143 sedang dalam proses penyelidikan. “Saat ini anggota sedang melakukan cek tempatkejadianperkara,”ujarnya. (a02)


Galang Dana Pada kesempatan itu 50 anggota DPRD Deliserdang menggalangdanauntukdisumbangkan untuk membantu korban Gunung Merapi di Jogya dan tsunami Pulau Mentawai. Setiap anggota dewan menyisihkan Rp 200 ribu dan penyalurannya diserahkan melalui PMI . Bantuan dana tersebut merupakanbentukkemanusiaandan kepedulian anggota dewan atas musibahyangdialamiwargadidua daerah Jogja dan Mentawai.(a05)

WASPADA Sabtu 13 November 2010

Pemkab Madina Ajukan 14 Ranperda PANYABUNGAN ( Waspada ) : Pemerintah Kabupaten Mandailing Natal (Pemkab Madina) mengajukan 14 Rancangan Peraturan Daerah ( Ranperda ) kepada Dewan Perwakilan Rakyat Daerah ( DPRD). Pj. Bupati Madina Aspan Sofian dalam sidang paripurna,Kamis(11/11)menyerahkanRanperda itu.14 Ranperda tersebut empat bagian,masingmasing Ranperda tentang organisasi perangkat daerah,pembentukan desa-desa baru hasil pemekaran desa,perubahan status desa menjadi kelurahan dan pengahapusan kelurahan. Kemudian, Ranperda tentang pajak daerah dan retribusi daerah serta penetapan dan pengaturan lainnya. Enam dari 14 Rancangan yang kami sampaikan, kata bupati, berisikan rancangan penataan atas keberadaan susunan organisasi dan tata kerja kerja perangkat daerah ( Suorta SKPD) Madina. Ke- 14 Ranperda yang disampaikan Pj.Bupati

Aspan Sofyan tersebut masing-masing perubahan kedua atas Perda No. 39 tahun 2007 tentang pembentukan susunan organisasi tata kerja ( Suorta) Sekretariat Daerah, Sekretariat DPRD dan staf ahli. Perubahan pertama atas Perda nomor 10 tahun 2010 tentang pembentukan Suorta Badan Penanggulangan Bencana Daerah. PembentukanSuortaDinasDaerah,pembentukan Suorta lembaga teknis daerah, pembentukan Suorta kecamatan dan kelurahan, pembentukan Suorta kantor pelayanan perizinan terpadu, pembentukan desa-dea baru hasil pemekaran desa, perubahan status desa menjadi kelurahan dan penghapusan kelurahan di daerah itu. Selanjutnya, pajak daerah, retribusi jasa usaha, retribusi jasa umum, retribusi perizinan tertentu, pengelolaan panas bumi, penetapan nama-nama jalan di ibu kota kabupaten dan pendirian perusahaan. (a24)

SKPD Madina Dirampingkan Jadi 12 PANYABUNGAN (Waspada) : Reformasi birokrasi terus digulirkan Pj Bupati Mandailing Natal, Aspan Sofian Batubara. Rancangan peraturandaerahtentangpenciutanjumlahSKPD(Satuan Kerja Perangkat Daerah) bersama rancangan peraturan tentang retribusi daerah diajukan pada rapat paripurna DPRD Madina, Kamis (11/11). Jumlah dinas daerah yang selama ini 18 unit akan dukurangi menjadi 12 unit saja dengan cara menggabungkan dinas-dinas yang sejenis secara fungsi. Kebijakan ini tetap berpedoman pada Peraturan Pemerintah Nomor 41 Tahun 2007 TentangOrganisasiPerangkatDaerahAspanSofian dalam nota pengantar ranperda itu menyatakan penciutan jumlah SKPD ini berdampak pada penghematan belanja sekitar Rp6,5 miliar per tahun dari sisi tunjangan jabatan struktural. Penghematan itu belum termasuk dari sisi pembiayaan dan belanja kantor. Beberapa dinas yang digabung meliputi penggabungan Dinas Kependudukan Catatan Sipil, Dinas Kesejahteraan Sosial, Dinas Tenaga Kerja Transmigrasi menjadi satu. Dinas Pekerjaan Umum digabung dengan Dinas Cipta Karya.

Kemudian Dinas Perindustrian Perdagangan Penanaman Modal, Dinas Koperasi UKM dan Dinas Pasar menjadi satu. KemudianDinasPemudaOlahRagadigabung denganDinasPariwisataSeniBudaya.DinasPertanian digabung dengan Dinas Peternakan. Sementara itu, Dinas Pertambangan Energi dibentuk setelah selama ini hanya berposisi sebagai sub dinas di Dinas Pekerjaan Umum. Lainnya adalah, perubahannomenklaturdanpenamba-hanfungsi pada Dinas Perhubungan sehingga menjadi Dinas Perhubungan, Informasi dan Komunikasi. Sementara itu, jumlah Asisten di sekretariat daerah yang selama ini berjumlah 4 Asisten menjadi 3. Yakni Asisten Tata Praja, Asisten Ekonomi dan Kesejahteraan, Asisten Administrasi. Asisten Pembinaan Hukum dan Sosial dihapus. Masih di sekretariat daerah, jumlah Bagian yang selama ini berjumlah 10 unit dikurangi menjadi 7 unit. Bagian Pemerintahan Umum dan Bagian Pemerintahan Desa digabung jadi satu. Bagian Hukum dan Bagian Organisasi digabung jadi satu. Bagian Humas, Sandi dan Telekomunikasi menjadi satu. (a24/cpin)


WASPADA Sabtu 13 November 2010


Bupati Absen, DPRK Aceh Tengah Ribut TAKENGEN (Waspada): Sidang paripurna DPRK Aceh Tengah membahas penetapan anggaran 2010, berlangsung panas. Pro dan kontra absennya Bupati Aceh Tengah Ir. Nasaruddin, MM, memicu beberapa anggota DPRK keluar dari persidangan. Sidang yang dipimpin wakil ketua DPRK, Nazar, Kamis (11/11) diwarnai hujan interupsi. Namun interupsi anggota DPRK ini ada yang tidak diakomodir pimpinan siding. Pimpinan siding justru bersikap keras dan tegas. Awal mula persidangan yang dihadiri Wabup Aceh Tengah, Drs. Djauhar Ali, sudah terlihat banjir pertanyaan dan interupsi. Sirajuddin anggota DPRK menanyakan, mengapa Bupati Aceh Tengah Ir. Nasaruddin, MM, lebih memilih kunjungan kerja ke Kecamatan Pegasing, daripada mengikuti persidangan DPRK? Absennya orang nomor satu di daerah dingin itu menuai protes. Namun ada juga anggota dewan yang mendukung sikap bupati karena sudah ada wakil bupati. “Bukan persoalan orangnya yang hadir, tetapi lembaganya,” sebut Nazar. Namun Sirajuddin keberatan karena banyak persoalan yang urgen, wakil bupati tidak berkompeten menjawabnya. Mulailah banjir interupsi dari anggota dewan lainnya. Nampak DPRK terpecah, antara yang mendukung bupati dengan yang tidak setuju. Sementara Ketua DPRK Aceh Tengah Zulkarnain, dalam persidangan itu absen. Sidang yang dipimpin Nazar terasa kaku karena Nazar tidak menyerahkan flour untuk memutuskan. Banjirnya interupsi membuat Nazar mengeluarkan kata keras sambil berteriak, “Sidang hana nge ini (Sidang apa udah iniBahasa Gayo Red).” Halidin, ketua Badan Kehormatan DPRK Aceh Tengah menyebutkan, seharusnya pimpinan sidang tidak bersikap seperti itu. “Kalau persidangannya seperti ini, kami keluar,” sebut Halidin. Mendapat tantangan itu, pimpinan siding spontan menyambutnya, “ Kalau mau keluar silakan”. Halidin meminta pimpinan untuk bersikap dewasa. Agar permintaan anggota dewan ditampung terlebih dahulu, baru diputuskan oleh forum, jangan pimpinan sidang yang memutuskan. Halidin terlihat emosi ketika meninggalkan

kursi DPRK. Beberapa anggota dewan lainnya juga ikut keluar. Keluarnya Halidin membuat persidangan di DPRK Aceh Tengah itu terlihat tegang. Kepala Dinas dan Camat yang hadir di sidang, terdiam menyaksikan ‘perpecahan’ di lembaga terhormat itu. Halidin yang terlihat emosi itu diamankan di ruang Sekwan DPRK Aceh Tengah. Waspada yang turut ke ruang Sekwan itu, walau Halidin sudah disuguhi kopi, namun masih terlihat nada bicaranya meninggi. Di ruang sidang, walau suasananya sudah kurang enak, sidang tetap dilanjutkan, tetapi tidak lama. Kemudian pimpinan siding menyekor siding. Seharusnya persidangan itu ada pandangan umum dan jawaban bupati. Sidang dilanjutkan, Jumat (12/11). Beberapa anggota dewan menjadi mediasi agar persoalan itu tidak meruncing sehingga menggangu aktivitas dan kenyamanan di dewan. Setelah dilobi dengan pihak yang panas itu, diambil kesimpulan mereka yang berbeda pendapat itu harus saling memaafkan. “Sudahlah, tidak perlu dilanjutkan, enggak enak ujungnya, nanti kita yang malu. Kan biasa dalam sebuah demokrasi kita berbeda pendapat. Bukan karena perbedaan pendapat itu lantas menimbulkan perecahan,” sebut Saeb Nosarios, anggota dewan lainnya yang menjadi mediasi. Akhirnya perbedaan pendapat yang menjurus emosional itu didamaikan di ruang kerja ketua DPRK Aceh Tengah. Nazar dan Halidin serta anggota dewan lainnya yang keluar dalam persidangan itu saling berjabat tangan. Sebelumnya DPRK Aceh Tengah juga pernah melakukan aksi duduk minum kopi di warung, karena bupati tidak hadir ke persidangan. Bupati ketika itu mengadakan kunjungan kerja ke lapangan. Namun ketika giliran bupati menyampaikan pidatonya, setengah angota dewan dari 30 anggota, justru yang tidak hadir. Kali ini persoalan Nasar uddin tak hadir ke persidangan, kembali mencuat, bahkan menimbulkan perbedaan pendapat. Sukesi Pilkada yang akan digelar di Aceh Tengah tahun depan, dimana Nasaruddin disebut- sebut akan maju lagi sebagai incumbent, telah membuat suasana politik di DPRK Aceh Tengah semakin hangat. Ada perbedaan dukungan di sana.(b18)

Maling Ternak Potong Di Tempat Marak BAGOK, Aceh Timur (Waspada): maling ternak potong ditempat marak di sejumlah kecamatan di Kabupaten Aceh Timur. Setelah sepi beberapa saat, kasus terakhir terjadi di Desa Teupin Pukat, Kecamatan Nurussalam— Bagok. Tiga ekor kambing milik warga lenyap dipotong dikandang, Rabu (10/11) sekira pukul 02:00 dinihari. Menurut pengakuan masyarakat, maling ternak dengan modus potong di kandang kian marak terjadi di kawasan Kecamatan Nurussalam. Dalam proses penyembelihan, para sindikat maling meninggalkan perut dan usus ternak yang dipotong persis di dekat kandang milik warga. Hal itu sebagaimana dialami A. Thalib, 54. Tiga ekor kambing miliknya di Desa Teupin Pukat, berhasil disikat maling pada malam hari. Padahal rencana awal, kambing jantan itu direncanakan dijual untuk Qurban Idul Adha tahun ini. Thalib amat terkejut, melihat tiga usus kambingnya tergeletak dengan darah berserakan. Sementara tiga kambing jantan miliknya yang seharga per ekor Rp700.000, hilang seketika. “Ketika saya bangun pagi tiga ekor kambing raib dari kandang dan disamping kandang isi perut dan darah berserakan,” ujarnya.

Selain Thalib, hal yang sama juga di alami Sulaiman, 32, warga Dusun Rawamas, Desa Teupin Pukat. Dua ekor kambing jantan miliknya juga mengalami hal yang sama, hanya perut dan usus yang ditinggalkan. Menurut A. Thalib, tokoh masyarakat Bagok, kejadian kehilangan kambing dengan modus potong di kandang, kian kerap terjadi di kawasan itu. Tidak hanya kambing miliknya yang hilang dan raib dari kandang, namun sejumlah warga lain juga mengalami hal yang sama. “Kita perkirakan kambing yang dicuri itu usai disembelih langsung dijaual dalam bentuk daging kiloan, karena para pencuri itu takut menjual ke pasar hewan karena ke dapatan,” tandasnya. Kapolres Aceh Timur, AKBP Drs Ridwan Usman melalui Kapolsek Nurussalam, Iptu Arniman Yusuf, kepada Waspada kemarin mengaku, pihaknya belum menerima laporan terkait modus maling ternak di wilayah kerjanya. Namun, jika hal itu benar terjadi pihaknya akan melakukan kordinasi dengan aparatur desa. “Kita belum terima laporan terkait marak pencuri ternak, namun kita harapkan masyarakat nantinya bisa bekerjasama dengan polisi dalam mengungkap kasus tersebut,” tandas Arniman. (cmad)

Waspada/Muhammad H. Ishak

PUTUS: Pelajar SMA terpaksa mendorong sepeda motor dengan ekstra hati-hati melintasi jembatan utama Julok – Alue Ie Mirah, Kab. Aceh Timur, Jumat (12/11) pagi. Jembatan itu ambruk akibat normalisasi sungai dan hantaman banjir yang melanda kawasan itu dalam beberapa hari terakhir.

Tiga Jembatan Ambruk Dihantam Banjir Arus Julok – Alue Ie Mirah Putus JULOK, Aceh Timur (Waspada): Dua jembatan utama yang menghubungkan Kecamatan Julok—Kuta Binjei dengan Kecamatan Indra Makmur—Alue Ie Mirah, Kab. Aceh Timur, Jumat (12/ 11) dinihari, ambruk dihantam banjir. Akibatnya, arus transportasi putus. Selain dua jembatan utama, sebuah jembatan yang terletak di Desa Labuhan, kecamatan sama, dengan panjang 4 meter, ikut ambruk akibat hantaman banjir dadakan. Kedua jembatan utama tersebut yakni, jembatan Buket Panyang dan jembatan Blang Jambee, letaknya diperbatasan Blang Bideun

dengan Blang Jambee. Ketiga jembatan yang ambruk itu kondisinya kini persis, yakni ambruk penahan di bagian ujung jembatan hingga mencapai 4 meter lebih. Menurut pengakuan warga setempat, kedua jembatan itu ambruk sekira pukul 05:00 pagi, di mana ketika itu banjir kiriman memuncak. Selain itu, sungai Julok merupakan aliran sungai Alue Ie Mirah, juga meluap. Tak lama setelah sungai meluap, jembatan yang baru saja selesai pengerukan terjadi abrasi secara besar hingga membuat jembatan ambruk ke sungai. Selain tiga jembatan yang telah ambruk akibat dihantam banjir, dua jembatan lainnya masing-masing jembatan Teupin Raya dan jembatan Blang Mideun, juga dalam kondisi

nyaris ambruk. Kedua jembatan itu masih dapat dilalui, namun kondisinya mulai dikikis banjir yang terus melanda kawasan itu. Amatan Waspada kemarin, selain jembatan Labuhan, dua jembatan utama lintasan Julok – Alue Ie Mirah, kini tidak dapat dilalui kendaraan, baik roda dua maupun empat. Namun untuk memasukkan logistik terhadap ribuan warga di puluhan desa dalam Kecamatan Indra Makmur dan sebagian warga di Kecamatan Julok, pihak kecamatan berinisiatif menghubungkannya dengan papan seadanya. Jembatan lintasan utama itu putus total disebabkan kuatnya hantaman banjir. Selain tersangkutnya sampah di kaki dan tiang jembatan, pengerusakan diseputaran sungai juga menjadi salah satu faktor jembatan

yang masuk kepada tubuh seseorang. Untuk itu dia menghimbau bila melakukan perobatan jarum suntik, pasien harus benarbenar teliti memastikan jarum suntik yang disuntikan ketubuhnya dalam kondisi steril. Begitu halnya pangkas sebaiknya silet yang digunakan steril. Acara yang dipusatkan di SMUN 1 Teupah Barat, mendapat perhatian dari para siswa. Diperkirakan tidak kurang dari 150 siswa/I mengikuti kegiatan hingga akhir. Sementara itu selain panitia dan dari Dinkes juga hadir di acara itu Koordinator Manajemen Program Percepatan Pembangunan Daerah Tertinggal & Khusus (P2DTK) Kabupaten Simeulue, Januar, SKM. Kemudian Koordinator Pendidikan P2DTK Simeulue, Ol Simbolon, dan dari Bappeda Maimun, ST. Acara ini menurut ketua panitia disponsori oleh P2DTK.(cmr)

Waspada/Muhammad Rapyan

Siswa/I SMUN 1 Teupah Barat mengikuti sosialisasi HIV/AIDS, Selasa (10/11).

Aceh di Banda Aceh. “Kondisi Aceh Timur, dalam beberapa hari terakhir, telah kita sampaikan ke Banda Aceh, termasuk beberapa jembatan yang ambruk akibat hantaman banjir di Julok,” ujar Ikbal seraya mengatakan, dalam hal ini pihaknya akan terus melakukan koordinasi dengan sejumlah instansi terkait, termasuk pimpinan di Aceh Timur. Bupati Aceh Timur, Muslim Hasballah usai Peringatan HKN di Pendopo Idi, mengatakan, terkait jembatan yang ambruk di kawasan Julok, pihaknya telah menurunkan tim dari Dinas Pekerjaan Umum (PU) Aceh Timur, guna menggulangi kondisi yang terbaik. “Intinya, kita arahkan arus transportasi arus normal, karena itu jembatan sentral yang mengubungkan dua kecamatan,” tandasnya. (cmad)

Bupati Minta Jurnalis Bersinerzi Bangun Daerah

Dinkes Simeulue Sosialisasi HIV/AIDS, 5 Positif SIMEULUE (Waspada): Dinas Kesehatan (Dinkes) Kabupaten Simeulue, Selasa (9/11) melakukan sosialisasi penyakit mematikan HIV/AIDS kepada para remaja. Hari perdana difokuskan di SMUN Kecamatan Teupah Barat. Ketua Panitia kegiatan Nila Surmani didampingi Pemegang Nota Dinas Kadiskes Simeulue, dr. Armidin Rihad menyatakan, kegiatan itu berlangsung selama delapan hari, satu kali di setiap 8 kecamatan di Simeulue. Armidin Rihad menyatakan sejauh ini di Simeulue sudah 5 orang yang terindetifikasi positif tertular penyakit HIV/AIDS. Dari lima orang itu satu di antaranya sudah meninggal dunia, sedang 4 lagi masih dalam perawatan. Armidin Rihad dalam kegiatan itu menjelaskan, penularan HIV/AIDS terjadi akibat seks bebas yakni melalui ubungan intim, oral seks. Kemudian HIV/AIDS juga dapat terjangkit melalui darah orang yang terjangkit

ambruk. “Jika tidak ditanggulanagi sepepatnya, maka ribuan jiwa akan terkurung,” ujar Hasballah, tokoh pemuda Julok. Camat Julok, Amiruddin Nyak Nafi, SH, kepada Waspada di lokasi mengatakan, terkait ambruknya jembatan pihaknya telah menyampaikan secara lisan dan tulisan ke instansi terkait, termasuk pimpinan di daerah itu. Menurutnya, kedua jembatan itu harus segera dibangun kembali, sehingga arus lalu lintas Julok – Indra Makmur, normal. Kepala Badan Penanggulangan Bencana Daerah (BPBD) Aceh Timur, M. Ikbal H. Ishak, S.Pd, kepada Waspada secara terpisah mengaku, pihaknya juga telah menerima laporan dari pihak kecamatan. Langkah selanjutnya, pihak BPBD telah menyampaikannya ke BPBD

Waspada/Syahrul Karim

Pada gambar kelihatan Kepala Dinas Kesehatan Dr Herman sedang menyerahkan hadiah kepada pemenang lomba dalam rangkaian kegiatan Hari Kesehatan di Kota Langsa.

SINGKIL (Waspada): Bupati Aceh Singkil meminta kepada kalangan jurnalis yang bertugas didaerahnya untuk bersinerzi membangun daerah dengan mengedepankan Kode Etik Jurnalis, sehingga pemberitaan yang disampaikan tidak mengada–ngada dan berimbang. Demikian H. Makmursyah Putra pada acara malam pisah sambut Ketua Mahkamah Syariyah Aceh Singkil dari pejabat lama Drs. Khairil Jamal kepada pejabat baru Drs. H. Abd Hafiz yang berlangsung Selasa (9/11) malam di Gedung Serba Guna Pulau Sarok Singkil. Menurutnya selama ini wartawan yang bertugas di Aceh Singkil kurang memberikan konstribusi kepada pembangunan daerah, hal ini dapat dilihat dari berbagai pemberitaan yang hampir 70 persen menyoroti kekurangan dan kritikan. Padahal yang diberitakan tidak semuanya benar. Misalnya, masalah izin pendiririan gereja, yang akibat dari pemberitaan itu bupati mengaku sering mendapat telefon dari gubernur terkait keabsahan berita yang ditulis wartawan tersebut. Seolah–olah di Aceh Singkil sudah terjadi kristenisasi, padahal harus diakui sejak kabupaten ini berdiri sudah hampir 600 orang masyarakat yang memeluk agama Kristen di Aceh Singkil sudah masuk dan memeluk agama Islam.(cb02)

HKN Diperingati Di Pemko Langsa GAMBA GEUTANYO

LANGSA (Waspada): Hari Kesehatan Nasional (HKN) ke 46 tahun 2010 di peringati di Pemerintahan Kota (Pemko) Langsa. Walikota Langsa Drs Zukifli Zainon, MM bertindak sebagai pembina upacara sekaligus menyampaikan amanat tertulis Menteri Kesehatan RI. Dalam acara yang berlangsung di halaman kantor Walikota Langsa, Jumat (12/11), turut dihadiri unsur-unsur Muspida, pimpinan dinas/intansi, jajaran pejabat kesehatan dan undangan lainnya termasuk mahasiswa Akper-Akbid-SPK. Dalam kaitan memeriahkan HKN itu, Kepala Dinas Kesehatan Kota Langsa Dr. Herman didampingi ketua panitia Dr. Soraya Masyitah menjelaskan kepada Waspada, panitia menggelar sejumlah kegiatan seperti donor darah, lomba bayi sehat, olahraga dan beberapa kegiatan sosial lainnya. Pada kesempatan itu, Walikota Langsa Zulkfli Zainon

meminta aparatur jajaran kesehatan untuk memberikan pelayanan kesehatan secara maksimal kepada masyarakat. Keluhan-keluhan masyarakat dalam

bidang pelayanan kesehatan selama ini, hendaknya segera diantipasi dengan merespon pemberian pelayan secara lebih baik. (b26)

> Neu poto keujadian meunarek ngon kamera HP 3,2 mega piksel, kirem ngon MMS keu 08192110147. Na imbalan pulsa 20 ribee keu poto nyang di peuteubit.


065122385 064542109


Bak kata pepatah, “Untung tak dapat diraih, malang tak dapat ditolak.” Demikianlah kiasan yang dialami Azhar alias Ompeng (foto) warga Desa Ujung Tinggi, Kecamatan Simeulue Timur ini. Warga yang hidup di bawah garis prasejahtera ini sangat mengharap bantuan semua pihak khususnya pemerintah untuk membantu perobatan penyakit yang dideritanya. Pengirim Rahmad, Simeulue. Hp 0852 6107 87xx



WASPADA Sabtu 13 November 2010

Ruang Inap Puskesmas Jangka Buya Terbengkalai

Dua Pelaku Illegal Logging Ditangkap BIREUEN (Waspada) : Tim Resmob Polres Bireuen belum lama ini, saat menggelar operasi babat rencong memberantas aktivitas perambahan hutan atau illegal logging, menangkap MH, 42, asal Kecamatan Juli, Bireuen dan MY, 29, asal Gandapura, kabupaten yang sama karena diduga sebagai pelaku illegal logging. Dari keduanya ikut disita 81 keping papan dan 53 batang kayu kusen. Kapolres Bireuen AKBP H.R Dadik Junaedi S.H melalui Kasatreskrim AKP Khairul Saleh SH Sik, kepada wartawan, Jumat (12/11), mengungkapkan, kedua tersangka sudah menjadi target operasi, diamankan dari dua lokasi terpisah, bersama barang bukti. “MY dan 81 keping papan jenis kayu KRC itu, diamankan di rumahnya di kawasan Gandapura. Begitu juga MH, 53 batang kayu berkelas diduga jenis semantok dan masih berada dalam mobil colt diesel BK 9042 BL, kita amankan dari rumahnya di wilayah Juli,” terang Kasat Rekrim AKP Khairul Saleh SH Sik. Kedua tersangka, lanjutnya, sudah ditahan dan barang bukti kayu tidak dilengkapi dokumen resmi itu, sudah diamankan di Polres Bireuen. “Kedua tersangka sudah kita tahan dan tetap diproses, saat ini sedang kita lengkapi berkas pemeriksaannya,” sebutnya didampingi anggota. Menurutnya, akibat perbuatan itu, keduanya dijerat pasal 50 ayat 3 huruf a, Jo Pasal 78 ayat 2,5 dan 7 UndangUndang Republik Indonesia Nomor 19 tahun 2004.Tentang perubahan Undang-Undang Republik Indonesia Nomor 41 Tahun 1999. “81 keping papan jenis kayu rimba campuran itu, dari keterangan tersangka untuk keperluan membangun rumah itu, diamankan dari rumah tersangka MY di kawasan Gandapura. Sedangkan 53 batang kayu untuk membuat kusen itu, disita dari rumah MH, bersama satu unit truk colt diesel, akhir pekan lalu,” katanya, seraya menghimbau masyarakat di Bireuen, untuk semua jenis kayu berada di kawasan hutan produksi, hutan lindung maupun hutan negara. jika ditebang harus ada izin resmi dari dinas terkait, dalam hal ini Dinas Kehutanan.(amh)

Kotak Infak Dilarikan Maling BIREUEN (Waspada): Kotak infak yang diperkirakan isinya jutaan rupiah milik Meunasah Desa Bireuen Meunasah Blang, Kec. Kota Juang, Kab. Bireuen, dilaporkan dilarikan maling Kamis (11/10) sekira pukul 03.00WIB dini hari. Menurut informasi diperoleh Waspada Jumat (12/ 11), peristiwa itu bukan yang pertama kali terjadi, bahkan sebelumnya juga disebut-sebut ada oknum warga setempat yang tega mengambil harta milik agama yang telah disedekahkan warga. “Isi celengan yang diambil maling itu rencananya untuk biaya tambahan pembangunan kubah meunasah kami yang sedang dibangun,” kata Maimun tokoh pemuda setempat, Jumat (12/11). Maimun juga membenarkan hilangnya uang celengan ini bukan untuk pertama kali, bahkan sebelumnya uang celengan juga sampai hati mengambil harta agama dengan cara dhalim seperti itu. “Sebelumnya juga ada kehilangan namun warga menduga ada oknum warga desa kami yang mengambilnya,” ungkapnya seraya menambahkan seluruh pengurus ikatan pemuda desanya mengutuk keras aksi dhalim seperti itu. Sementara Sekdes Bireuen Meunasah Blang, Ahmad Yani yang ditanya terpisah kemarin, membenarkan hilangnya kotak infak itu. “Sebenarnya celengan itu sedekah masyarakat dan akan digunakan untuk meneruskan pembangunan kubah Meunasah, tapi tega diambil, apakah maling sekarang tak tahu lagi dikutuk Allah,” katanya geram. (amh)

H A Gani Nyaris Kehilangan Rumah JULI, Bireuen (Waspada): H.A.Gani,73, warga Desa Teupien Mane, Kec. Juli, Kab. Bireuen, Jumat (12/11) sekira pukul 01.45 WIB nyaris kehilangan rumahnya. Untungnya, kobaran api membakar yang belum diketahui asalnya saat melalap dinding dan atap dapur rumahnyaitu,cepatdipadamkanwargayangdibantupetugas pemadam yang tidak lama datang kekdiamannya itu. Menurut Syamsudin anak dari H A Gani, keluarganya tidak tahu persis bagaimana api memakan seluruh rumah yang beratap rumbia milik orang tuanya di lintas BireuenTakengon Km 10,5 itu, karena saat itu anggota keluarganya termasuk dirinya sedang lelap tidur. “Ibu saya sering bangun malam untuk masak kue dagangannya, kemungkinan sumber api dari percikan bara api karena masaknya pakai kayu dan atap dapur juga dari daun rumbia,” ujarnya menduga. (amh)

Waspada/Muhammad Riza

BANGUNAN RUANG INAP: Inilah bangunan ruang inap Puskesmas Jangka Buya, Pidie Jaya. Bangunan ini setahun lebih telah ditelantarkan, dan hingga kini belum difungsikan melayani masyarakat, Jumat (12/11).

MTsS Tgk Chiek Ditunong Dibakar OTK PANTONLABU, Aceh Utara (Waspada): Gedung kantor Madrasah Tsanawiyah Swasta (MTsS) Teungku Chiek Ditunong, di Desa Lhokbeuringen, Kecamatan Tanah Jambo Aye—Pantonlabu, Aceh Utara, Kamis (11/11) dinihari dibakar orang tak dikenal (OTK). Beruntung, api padam sendiri dan hanya menghanguskan sebagian dinding serta beberapa perabot kantor. “Yang hangus dan rusak total, antara lain, tiga jendela termasuk kozen, sofa di ruang tamu, lemari berisi belasan tropi, dan sejumlah meja dan kursi dewan guru. Sedangkan lemari berisi dokumen penting, selamat, meski sempat pula dilumuri minyak dan disulut api oleh pelaku. Lemari itu hangus bagian luarnya saja,” kata Drs Amiruddin, Kepala MTsS Teungku Chiek Ditunong, Jumat (12/11). Berdasarkan bukti yang terlihat di lokasi kejadian, Amir menduga pembakaran itu melibatkan lebih dari satu orang pelaku. Mareka masuk lewat jendela belakang, setelah sebelumnya memotong kaca jendela dengan pisau khusus pemotong kaca, lalu pacokan kunci jendela tersebut dibuka dari luar. “Begitu berhasil masuk, mareka langsung mengguyur dinding dan seisi ruangan kantor dengan minyak. Dari

baunya, minyak itu seperti campuran bensin dan solar. Setelah semua bagian ruangan tersiram minyak, pelaku baru keluar sambil menyulutnya dengan api, lalu kabur,”terka Amiruddin seraya menambahkan, pelaku meninggalkan beberapa barang bukti, termasuk sebuah jerigen minyak dan potongan kaca jendela. Masih menurut Amiruddin, peristiwa itu pertama kali diketahui penjaga sekolah, Mawardi, 34, warga setempat, saat hendak membuka kantor sekolah tersebut, Kamis (11/11) sekitar pukul 07:00 WIB. Mawardi kemudian memberitahu kepala sekolah dan tak lama berselang kasus ini dilaporkan secara resmi ke Mapolsek Tanah Jambo Aye. “Diperkirakan pelaku beraksi dinihari. Bisa jadi, pelaku sengaja memilih waktu tersebut karena saat itu warga sedang tertidur pulas. Target mareka, semua bangunan kantor harus ludes, supaya tidak tertinggal barang bukti. Namun Tuhan berkehendak lain. Api padam sendiri sebelum sempat menghanguskan seluruh bangunan dan apinya tidak sampai menjalar ke bangunan lain,” kata Amir lagi. SMS Ancaman Ditanya apakah ada latar belakang masalah serius antara masyarakat dengan keluarga besar MTsS Teungku Chiek Ditunong? Amiruddin mengatakan, selama ini pihaknya berhubungan baik dengan seluruh elemen masyarakat sekitar, termasuk dengan kalangan pemuda. Kendati demikian, ia mengakui, belakangan ini ada segelintir orang yang tidak senang

Pengadaan Mobil Dinas Bupati Salahi Kontrak Dan Keppres 80 LHOKSEUMAWE (Waspada): Sidang kasus pengadaan mobil dinas bupati Aceh Utara menghadirkan saksi ahli pengadaan barang dan jasa. Menurut saksi ahli, Rismawan Bentara, pengadaan yang didanai APBK TA 2007 tersebut telah menyalahi kontrak. Di depan majelis hakim Rismawan, Kamis (11/11) menjelaskan, penyerahan dua unit monil yang dilakukan pihak dealer kepada kuasa pengguna anggaran (KPA) tidak menyalahi. Menurutnya yang penting dalam berita acara serahterima barang terdapa tanda tangan KPA dan perusahaan rekanan. “Jadi dalam kasus ini, secara deyure sudah sah,” jelas Rismawan. Namun karena penyerahan dilakukan di atas tanggal yang telah ditetapkan (24 Juli 2007) sehigga pengadaan ini menyalahi isi kontrak. Seperti diberitakan sebelumnya, kasus pengadaan dua unit mobil bupati dan Wabup Aceh Utara telah dilimpahkan ke Pengadilan egeri Lhokseumawe karena bermasalah. Dalam sidang itu juga terungkap pengadaan aset pemerintah daerah itu tidak disertai dengan BPKB. Dalam sidang kemarin juga terungkap pihak KPA telah melakukan kelalaian, sehingga disinyalir merugikan negara. Kesalahannya, meskipun rekanan belum menyelesaikan kontrak sampai 100 persen, namun KPA telah membayar penuh. Selain itu, pihak KPA juga tidak pernah menyita agunan perusahaan rekanan, kendati pengadaan tidak diselesaikan sesuai dengan kontrak. Dewan hakum yang di ketua Syamsul Kamar, SH, MH dan hakim anggota Sadri, SH dan M. Jamil, SH dalam kesempatan itu juga meminta petunjuka tetang pelanggaran yang dilakukan KPA dan rekanan. Rismawan Bentara menjelaskan, keduanya telah menyalahi Keppres No 80 Tahun 2008, tentang pengadaan barang dan jasa.(b17)

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu):

Garuda Indonesia GA 146 Jakarta/Medan

Lion Air

JT 304 Jakarta JT 396 Jakarta/Medan

Sriwijaya Air

SJ 010 Jakarta/Medan

Air Asia

AK 305 Kuala Lumpur *


Berangkat (flight, tujuan, waktu):

15:45 GA 147 Medan/Jakarta


11:35 JT 397 Medan/Jakarta 20:00 JT 307 Jakarta

06:40 12:15

12:55 SJ011 Medan/Jakarta


12:20 AK 306 Kuala Lumpur *


FY 3401 Penang ** 14:10 FY 3400 Penang “” * Setiap Senin, Rabu, Jumat dan Minggu. ** Setiap Selasa, Kamis dan Minggu.



DIPOTONG OTK: Kepala MTsS Teungku Chiek Ditunong, Drs Amiruddin, Jumat (12/ 11) siang, menunjukkan bagian kaca jendela kantor sekolahnya yang dipotong OTK dengan pisau pemotong kaca, Kamis (11/11) dinihari.

kepadanya karena sentimen pribadi. “Sekitar 1,5 bulan yang lalu, seseorang menghubungi Pak Munzir, atasan saya di Kantor Kementerian Agama Aceh Utara di Lhokseumawe. Melalui SMS atau pesan singkat, orang itu mendesak saya dipindahkan ke sekolah lain dengan alasan banyak kesalahan dan tidak transparan. Tapi, ketika dimintai bukti konkrit tentang kesalahan dimaksud, orang itu mengelak,” beber Amir. Bahkan, lanjut Amiruddin, orang itu juga sempat mengirim SMS ancaman ke Pak Munzir dengan bunyi; Jika memang (Amiruddin) tidak bisa dipindahkan, keselamatan yang bersangkutan berikut gedung sekolahnya berada dalam tanggungjawab bapak. Bulan 9 ini, Pak Amir harus sudah dipindahkan ke sekolah lain. “Walau demikian, saya tidak yakin apakah SMS ini ada kaitannya dengan pembakaran itu atau tidak,” tandasnya. Kapolres Aceh Utara, AKBP Farid BE melalui Kapolsek Tanah Jambo Aye, Iptu Mardan P, yang dikonfirmasi terpisah, membenarkan pihaknya sedang menangani kasus tersebut. “Masih proses penyelidikan. Yang pasti, sekolah itu memang dibakar secara berencana dan kita sudah turun langsung ke Tempat Kejadian Perkara (TKP) untuk mengumpulkan keterangan dan barang bukti,” kata Kapolsek, singkat.(cmus)

Gubernur Berjanji Perjuangkan Aspirasi Mahasiswa BIREUEN (Waspada): Tuntutan mahasiswa Perguruan Tinggi Swasta (PTS) seluruh Aceh dalam demonya di Banda Aceh beberapa waktu lalu, agar Gubernur Aceh, Irwandi Yusuf segera membentuk Kopertis Wilayah Aceh, langsung disikapinya serta berjanji akan segera memperjuangkannya dengan cara menyampaikankepadaKopertiswilayahISumut-Aceh. Demikian disampaikan Asisten III Sekda Provinsi Aceh, Ridwan Hasan SH MM, dalam acara rapat senat terbuka dan wisuda di Kampus Unimus, Peusangan Bireuen, Kamis (11/11) mewakili Gubernur Aceh, Irwandi Yusuf yang berhalangan hadir karena mengikuti rapat dengan pihak DPRA di Banda Aceh. “Bapak gubernur akan menyampaikan aspirasi mahasiswa PTS Aceh yang disampaikan kepadanya agar di Aceh sudah layak ada Kopertis tersendiri,” katanya saat itu yang disambut aplaus para hadirin.(amh)

MEUREUDU (Waspada): Sudah setahun lebih ruang Inap Puskesmas Jangka Buya, Kabupaten Pidie Jaya terbengkalai. Belum difungsikan gedung itu ditengarai berselemak masalah. Salah satunya, diduga pihak rekanan belum melunasi utang pada salah satu toko bangunan. Beberapa warga Jangka Buya kepada Waspada, Jumat (12/11) mengungkapkan sudah setahun lebih gedung rawat inap Puskesmas Jangka Buya telah lama dibiarkan terbengkalai. Padahal, masyarakat Jangka Buya berharap gedung ruang inap itu segera difungsikan karena selama ini hampir seluruh warga yang terserang penyakit dirujuk ke Puskesmas Ulee Gle Bandar Dua atau ke Puskesmas kecamatan tetangga lainnya. “Bahkan ada pasien pemegang Jamkesmas atau JKA dirujuk ke Bireuen atau Sigli yang jaraknya jauh. Kami mengharapkan kepada bupati Pidie Jaya bapak Gade Salam melalui dinas terkait supaya, ruang inap Puskesmas Pidie Jaya segera difungsikan,” kata Rahmad. Lambannya pengoperasian ruang inap itu, kini gedung perawatan pasien pada Puskesmas Jangka Buya menjadi ‘kandang’ hewan ternak seperti sapi dan kambing yang banyak berkeliaran di kawasan pasar Jangka Buya. Pemandangan itu amat memprihatinkan karena bangunan yang sejatinya menjadi tempat perawatan manusia malah menjadi tempat parkir hewan-hewan ternak warga yang tidak jelas itu. Tgk. Safwan warga Jangka Buya lainnya menuturkan Pemkab Pidie Jaya dibawah pemerintahan Gade Salam dan M. Yusuf Ibrahim yang telah bersikap baik dalam upaya meningkatkan kesehatan masyarakatnya, dengan membangun ruang inap Puskesmas Jangka Buya. Kepala Dinas Kesehatan Pidie Jaya Munawar Ibrahim kepada Waspada, kemarin mengatakan, akhir tahun ini ruang inap Puskesmas Jangka Buya akan difungsikan. “Kita harap warga bersabar karena semua ada prosedur dan membutuhkan proses,” kata Munawar Ibrahim singkat.(b20)

Kasus RSBI SMPN-1 Lhokseumawe Siap Dilimpahkan Ke Pengadilan LHOKSEUMAWE (Waspada): Setela pemeriksaan seluruh saksi dan dokumen, baik di daerah maupun di Jakarta, kasus RSBI SMPN1 Lhokseumawe siap dilimpahkan ke Pengadilan Negeri setempat. Namun karena beberapa kasus korupsi lain juga sedang dalam proses pengadilan, sehingga dugaan penyelewengan dana pendidikan ini masih menunggu antrian. Kajari Lhokseumawe melalui Kasi Pidsus, Syahrir, SH kepada Waspada, Kamis (11/11) mengatakan, pemeriksaan kasus Rintisan Sekolah Bertaraf Internasional (RSBI) SMPN-1 Lhokseumawe sudah selesai. Akan tetapi untuk diajukan ke Pengadilan Negeri (PN) Lhokseumawe masih menunggu antrian. “Diselesaikan dulu kasus yang lebih dulu selesai,” jelas Syahrir. Diantaranya, kasus pengadaan mobil dinas Bupati Aceh Utara dan Kasus dugaan penyelewengan proyek pembangunan pagar pilot projek PSDA Sebelumnya dia kepada para wartawan juga telah menjelaskan, tim Kejari Lhokseumawe telah memeriksa dua saksi di Direktorat Jenderal Manajeman Pendidikan Dasar dan Menengah Kementerian Pendidikan Nasional di Jakarta. Selain itu, tim ini juga menyita sejumlah dokumen yang dibutuhkan terkait pencairan dana bersumber APBN Rp 600 juta tahun 2008/2009 ke SMPN 1 Lhokseumawe. Sebelumnya Kepala SMPN-1 Lhokseumawe, ditetapkan sebagai tersangka korupsi penggunaan dana RSBI tahun 2008 dan 2009. Dari total anggaran Rp1,60 miliar, kerugian negara dalam kasus itu mencapai Rp700 juta.(b17)

Puskesmas Langkahan Nyaris Diamuk Massa LANGKAHAN, Aceh Utara (Waspada): Puskesmas Langkahan, di Desa Langkahan, Kec. Langkahan Kabupaten Aceh Utara, Rabu (10/11) sekitar pukul 19:30 WIB, nyaris diamuk massa. Ratusan warga sekitar puskesmas itu marah karena tiga pasien kecelakaan lalulintas (Lakalantas) sempat terlantar akibat tidak ada ambulan dan dokter. Beruntung, Kapolsek Langkahan Ipda M Jafaruddin SE, bersama anggota cepat tiba di puskesmas itu dan berhasil meredam emosi massa. Tak lama berselang, massa segera bubar dan salah seorang pasien yang luka kritis langsung dirujuk ke RS PMI Lhokseumawe dengan mengunakan mobil pribadi. Sedangkan dua korban lagi, yang mengalami fraktur atau patah tulang, dibawa ke dukun patah di Lhoknibong. Sayuti, 35 salah seorang saksi mata warga Desa Rumoeh Rayeuk, Kec Langkahan, menjelaskan, ketiga pasien itu warga desanya. Mereka kakak beradik, masing-masing Fadli Syukra, 18, Ratu Umri, 13 dan Maulina, 11. “ Para korban mengendarai sepeda motor. Malam itu sepeda motor mareka terlibat tubrukan dengan pengendara sepeda motor lainnya, bernama Nurdin, asal Kec Pantee Bidari, di jalan lintas Langkahan Kilometer 26,” katanya. Sesaat setelah tubrukan, sambung Sayuti, polisi bersama warga segera membawa korban ke Puskesmas. Namun setiba di sana, tak seorang pun dokter yang siaga untuk keperluan darurat. Sementara ambulan sedang rusak sehingga pasien tidak bisa segera dirujuk. “Satu unit ambulan usang memang ada di puskesmas, tapi bannya gembos. Kabarnya, mobil itu sudah mogok 8 hari. Sedangkan ambulan yang baru, dibawa pulang kepala Puskesmas,” imbuh Sayuti. Kapolres Aceh Utara AKBP Farid BE, melalui Kapolsek Langkahan Ipda M Jafaruddin, SE, saat dikonfirmasi Waspada via telefon, kemarin petang, membenarkan Puskesmas Langkahan, Rabu (10/11) malam nyaris diamuk massa karena pasien lakalantas sempat terlantar. “Massa kecewa dengan pelayanan pihak puskesmas, terutama menyangkut tidak adanya dokter dan ambulan. Tapi Alhamdulillah emosi mereka bisa kita redam. Mareka tidak sampai berbuat anarkis,”kata Kapolsek seraya menambahkan, kedua sepeda motor yang terlibat lakalantas juga sudah diamankan di Mapolsek. Di lain pihak, Kepala Puskesmas Langkahan, dr Jafaruddin, yang dikonfirmasi via telefon juga membenarkan, satu unit mobil ambulan yang disiagakan di Puskesmas, malam itu, sedang mogok.(cmus)

Air Mata Warnai Wisuda Nurhadijah Sang Penyandang Cacat CUACA di kawasan Universitas Almuslim (Unimus), Peusangan, Bireuen, Kamis (11/11) pagi hari cerah, namun tiba-tiba diselimuti mendung. Kala itu, satu persatu mahasiswa yang telah mengenakan baju toga melangkahkan kakinya ke lokasi acara wisuda depan gedung perpustakaan yang juga diikuti para anggota keluarganya, masing-masing termasuk perwakilan dari PT Angkasa Pura Banda Aceh. Setelah itu, mereka duduk di kursi masing-masing yang telah disediakan panitia civitas akademika perguruan tinggi kebanggaan masyarakat Kota Sate itu. Setelah acara serimonial dilaksanakan yaitu pengarahan dari Bupati Bireuen Nurdin Abdul Rahman, Rektor Unimus Drs H Amiruddin Idris SE MSI, Asisten III Aceh Ridwan Hasan SH MM, dan laporan panitia, para wisudawan dan wisudawati menerima ijazah masing-masing dari dekan dan untuk dikukuhkan rektor. Begitu protokol memulai membaca atau menyebut nama Nurhadijah, 23, seorang gadis yatim dengan kondisi kedua tangannya cacat asal Desa Ie Rhoeb, Kecamatan Gandapura, kabupaten setempat, mata ribuan hadirin, termasuk para pejabat perwakilan Kopertis Wilayah I Sumut-Aceh tertuju padanya. Lalu dengan pelan Nurhadijah melangkah ke depan panggung utama diiringi penjelasan dari protokol, Nurhadijah anak yatim cacat kedua tangannya, dia menyelesaikan kuliahnya di Fakultas

Pertanian, Jurusan Sosial Ekonomi Pertanian (SEP), empat tahun dan semua biaya ditanggung PT Angkasa Pura II, Bandara Iskandar Muda Banda Aceh. Suasana seketika hening. Nuhadijah dengan mata berkaca kaca menerima ijazah dari dekan dan saat bersalaman dengan rector, Nurhadijah tak kuasa menahan tangisnya dan langsung cucuran air matanya membasahi pipinya. Bupati Bireuen, Nurdin Abdul Rahman saat itu yang duduk di kursi deretan pertama, langsung bangkit dan berjalan mendekatinya diikuti Surya mantan pegawai Angkasa Pura. Surya yang ikut ditemani Junior Manager Financial Bageting/ Koordinator PKBL Program Kemitraan dan Bina Lingkungan Kantor Cabang Bandara Iskandar Muda, Ramar Wandi, langsung mengulur tangannya satu persatu kepada Nurhadijah sembari mengucapkan selamat sambil terlihat mata bupati, rektor serta sejumlah hadirin berkaca-kaca haru. Tangisan Nurhadijah kian tak terbendung saat saat didekati orang nomor satu di Bireuen tersebut. Dengan suara gemetar dia mengucapkan terimakasih. Setelah itu, bupati dan dua utusan dari PT Angkasa Pura foto bersama dengan Nurhadijah langsung di depan panggung dan para undangan yang hadir. Nurhadijah juga dengan langkah gontai meninggalkan panggung utama. Beberapa saat kemudian, Nurhadijah bersama ibunya Hendon, 39, dipanggil ke satu ruang oleh Surya dan Ramar Wandi untuk pamit dan kembali mengucapkan

terimakasih. “Mungkin anda tahu bagaimana kami bisa membantu Nurhadijah, karena andalah yang menulis rintihan Si Nurhadijah, sehingga kami terketuk hati untuk membantu anak yatim ini, kami juga berterima kasih kepada anda dan kepada semua wartawan di Bireuen,” ucap Surya sambil mengulur tangannya kepada ke arah Waspada. Untuk diketahui,Nurhadijah seorang gadis cacat kedua tangannya asal Desa Ie Rhob, Kecamatan Gandapura, Kabupaten Bireuen, yang telah ditinggal pergi orang tua laki-laki ketika baru duduk di kelas I SD. Semenjak itu gadis berkulit hitam manis itu harus mengarungi hidupnya bersama ibunya dan dua abangnya dalam serba keterbatasan dan kekurangan.“Saya tiap hari bantu ibu jualan, “ kata Nurhadijah empat tahun lalu. Singkat cerita, setelah setahun menamatkan SMA Gandapura sangat berkeinginan untuk kuliah namun dia dan ibunya tak mampu, akhirnya kisah hidupnya disampaikan kepada seorang wartawan. Goresan sang tangan wartawan dibaca pihak Angkasa Pura Banda Aceh. Lalu seorang karyawannyam Surya yang kini telah pensiun menghubunginya dengan bantuan wartawan saat itu bersama rekannya Indar Muda Nasution. Mereka langsung datang ke Unimus meminta kerjasama dalam membantu Nurhadijah. Saat itu Rektor Unimus bersama pembantu Rektor III Marwan

langsung menyambut baik. Setelah itu, Nurhadijah telah terdaftar sebagai mahasiswa baru tahun ajaran 2006/2007 di Fakultas Pertanian jurusan SEP. “Kami bersyukur, Nurhadijah mampu membuktikan kesungguhannya, malahan dia lebih cepat setahun meyelesaikan kuliahnya

dari yang kami targetkan, inilah membuktikan dia anak yang baik,” kata Surya yang tak lagi didampingi Endar Muda Nasution yang juga telah masuk masa pensiun beberapa waktu lalu seperti datang mereka datang untuk buat kontrak dengan Unimus dalam membantu Nurhadijah. Abdul Mukthi Hasan

Waspada/Abdul Mukthi Hasan

Nurhadijah (pakai baju wisuda) foto bersama Asisten III Provinsi Aceh Ridwan Hasan SH (paling kanan) dua karyawan PT Angkasa Pura II Iskandar Muda Banda Aceh, dan Bupati Bitreuen Nurdin Abdul Rahman (dua dari kiri), setelah setelah menerima ijazah dari dekan dan rector Unimus. Peusangan, Bireuen, dalam acara wisuda di kampus setempat, Bireuen, Kamis (11/11).


WASPADA Sabtu 13 November 2010

B7 Walhi Serukan Tutup Aktivitas Pertambangan

STIKes Bina Nusantara Salurkan Beasiswa IDI RAYEUK, Aceh Timur (Waspada): 10 Mahasiswa berprestasi Sekolah Tinggi Ilmu Kesehatan (STIKes) Bina Nusantara, Idi Rayeuk, Kabupaten Aceh Timur, menerima beasiswa prestasi, Rabu (10/11). Prosesi penyerahan dilakukan di aula Gedung STIKes setempat di Idi. Ketua STIKes Bina Nusantara Idi, dr. Zulfikry mengatakan, penyerahkan beasiswa berprestasi tahun akademik 2009/ 2010 diberikan untuk mahasiswa yang memiliki kemampuan prestasi tinggi. “Beasiswa ini adalah beasiswa rutin tahun ke II sejak berdirinya STIKes Bina Nusantara Idi Rayeuk tahun 2008 dengan Izin DIKTI Nomor 119.D.O.2008 tanggal 8 Juli 2008,” ujar dr. Zulfikry seraya menambahkan, penyerahan beasiswa terhadap 10 mahasiswa itu diserahkan Ketua Yayasan Pendidikan Getsempena melalui Ilham Satria, SE dan Ketua STIKes Bina Nusantara Idi Rayeuk, dr. H. Zulfikry. Penerima beasiswa terdiri dari mahasiswa program studi D-III Kebidanan 7 0rang dan S-1 Ilmu Keperawatan tiga orang. Mahasiswa yang menerima bantuan yakni, Devi Maulina, Dwi Suryasafarina, Putri Dewi, Rahmanita, Ermaya Agustina, Nurkaliah, Muliana, Putri Drissianti, Nuraida dan Basri. (cmad)

Gajah Liar Rusak Fasilitas SMPN2 Langkahan LHOKSUKON, Aceh Utara (Waspada): Konflik gajah liar versus manusia, terus berlangsung di pedalaman Aceh Utara. Selasa (9/11) malam, hewan berbadan bongsor itu mengamuk ke pekarangan SMPN 2 Langkahan, di Desa Sereukey, Kec. Langkahan. Akibatnya, sarana air bersih dan MCK sekolah itu rusak berat. Kepala SMPN2 Langkahan, Fakri Lianur, kepada Waspada kemarin menjelaskan, gangguan gajah tersebut merupakan yang pertama kalinya sejak sekolah itu dibuka. Sebelumnya, kawanan Poe Meurah tidak pernah menyambangi sekolah itu meski secara geografis Desa Seurekey masih dikelilingi hutan. “Saya tidak melihat secara langsung. Berdasarkan keterangan saksi mata, kawanan gajah itu dibawah sepuluh ekor. Mereka sempat beristirahat dekat tiang bendera, depan sekolah. Tak lama kemudian, eareka mengamuk merusak sarana air bersih dan MCK. Puluhan batang kelapa sawit yang kami tanam untuk penghijauan lingkungan sekolah juga dirusak,” katanya via telefon. Menurut Fakri, peristiwa itu membuat para guru dan siswa trauma. Namun pihak sekolah belum berniat meliburkan sekolah. “Insya Allah aktivitas belajar-mengajar tetap akan kita jalankan seperti biasa. Harapan kami masalah ini jadi perhatian serius pemerintah. Jangan sampai, gajah liar itu melakukan serangan susulan pada siang hari, saat anak-anak dan siswa masih di sekolah,” pintanya. (cmus)

Jalan Lintas Keude Geurubak Bagai Kubangan Kerbau KEUDE PLIEK, Aceh Timur (Waspada): Sepanjang enam kilo meter jalan lintas penghubung Keude Geurubak, Kec. Banda Alam, dengan Kota Idi Rayeuk, ibu kota Kabupaten Aceh Timur, kini rusak berat. Bahkan ruas jalan nyaris bagai kubangan kerbau. Pantauan Waspada, Rabu (10/11) badan jalan yang masih berada dalam wilayah Keude Pliek—Kec Idi Tunong, itu kini dipenuhi lubang menganga yang mengganggu arus lalulintas. Jika musim hujan seperti saat ini, hampir seluruh badan jalan penuh air lumpur. Sementara ketika musim kemarau, penuh debu. “Kerusakan terparah terlihat mulai dari Desa Bantayan, hingga dekat pasar Keude Pliek. Kondisi ini sudah berlangsung lama. Wartawan pun sudah sering memberitakan masalah ini di berbagai media. Tapi, hingga kini belum ada tanda-tanda, jalan ini akan segera dibangun. Padahal, ini jalur strategis yang dimanfaatkan puluhan ribu warga dari tiga kecamatan, yakni Idi Tunong, Banda Alam dan Indra Makmu,” kata Hasbi, 38, warga Keude Pliek. Mewakili masayarakat lainnya, Hasbi minta Pemerintah Aceh Timur, melalui dinas terkait segera memperbaiki jalan itu. Kalau tidak mungkin di aspal atau di hotmix karena alasan keterbatasan dana, setidaknya ditimbun dulu dengan basecost supaya kubangannya tertutup,” tandas Hasbi.(cmus)

Polisi Bekuk Enam Tersangka Judi Togel LHOKSUKON, Aceh Utara (Waspada): Aparat Kepolisian Resort Aceh Utara, membekuk enam tersangka bandar dan pemain judi toto gelap (togel) di sejumlah tempat terpisah, Kamis (11/11) petang. Bersama para tersangka turut disita sejumlah barang bukti, termasuk uang Rp830 ribu, 3 handphone, 19 repas togel dan 1 buku tafsir mimpi. Keenam tersangka masing-masing, RZL, 37, MYS, 58, ABD, 35, dan ARB, 39, keempatnya warga Kota Pantonlabu, Ibukota Kecamatan Tanah Jambo Aye, kemudian SDM, 30, penduduk Desa Biara Timu, Kec. Tanah Jambo Aye dan ZKF, 51, asal Desa Tanjong Minje, Kec Madat, Aceh Timur. “Keenam tersangka kita tangkap dalam waktu hampir bersamaan, di seputaran kota Pantonlabu dan kawasan perbatasan Aceh Timur – Aceh Utara. Seusai menjalani pemeriksaan di Polres, mereka kita izinkan pulang dengan syarat wajib lapor dan proses hukumnya tetap berjalan seperti biasa,” kata Kapolres Aceh Utara AKBP Farid BE melalui Kasat Reskrim AKP Erlin Tangjaya, Jumat (12/11). Kasat Reskrim menambahkan, operasi penangkapan para tersangka judi togel itu sengaja digelar dalam rangka operasi penyakit masyarakat (pekat). “Dari enam tersangka tersebut, dua diantaranya yakni SDM dan RZL berstatus bandar. Sedangkan empat tersangka lainnya berstatus pemain,” tandas AKP Erlintang Jaya.(cmus)


Warga Dusun Alue Dawah Kecamatan Babahrot, Abdya melakukan aksi pemblokiran ke lokasi pertambangan biji besi PT Juya Aceh Mining.

Di Pertambangan Biji Besi PT JAM

Warga Temukan Kandungan Emas BLANGPIDIE (Waspada): Areal pertambangan biji besi di kawasan Alue Dawah Kecamatan Babahrot, Aceh Barat Daya (Abdya) disebut-sebut warga setempat juga memiliki kandungan emas besar, bahkan beberapa warga yang mengaku telah mengambil beberapa material di sekitar lokasi pertambangan dan dibawa ke salah satu tempat penggilingan emas mengaku telah mendapatkan bukti di lokasi pertambangan biji besi milik PT Juya Aceh Mining memiliki kandungan emas. “Kita sudah pernah mengambil material di sana (lokasi pertambangan biji besi–Alue Dawah), dalam satu karung material yang kita giling di tempat

penggilingan emas di daerah Sawang beberapa waktu lalu telah kita dapatkan bukti berupa kandungan emas saat itu sebesar 4 milimeter,” ungkap Safrial, 19, salah satu warga Dusun Alue Dawah kepada Waspada, Jumat (12/11). Pengakuan warga Alue Dawah itu dibantah manajemen PT Juya Aceh Mining (PT JAM) selaku operator pertambangan biji besi di sana. Waspada yang mengonfirmasi hal itu melalui Project Leader Pertambangan, Budi Eko Yuono menyebutkan, temuan warga tidak memungkinkan baik dalam kapasitas ilmiah maupun bisnis. Menurut Budi Eko Yuono, jika di lokasi itu mengandung

emas maka pihak perusahaan tentu akan berpikir ulang menambang biji besi dan akan beralih menambang emas karena dinilai lebih memiliki nilai bisnis tinggi, namun dipastikannya pihak perusahaan melakukan penambangan dan eksplorasi sesuai data teknis serta uji geologis melalui survei yang akurat. “Kita melakukan penambangan dan eksplorasi sesuai data dan uji teknis, dan dari hasil data yang kita terima di lokasi itu tidak ada kandungan lain selain biji besi. Jadi sangat tidak mungkin jika di sana disebutkan mengandung emas, kalau Mas Eko atau Mas Darman mungkin iya,” timpal Budi Eko Yuono. Sementara Wakil Ketua Ko-

misi C DPRK Abdya, Zaman Akli, yang juga membidangi masalah pertambangan meminta pihak pemerintah daerah melakukan uji ulang terhadap kandungan mineral yang ada di kawasan itu. “Kita meminta agar pemerintah meneliti ulang dan mengumumkan secara terbuka ke publik, sehingga tidak memunculkan berbagai opini di masyarakat dan jika tidak ada kandungan lain selain biji besi tentu daerah tidak akan dirugikan. Jadi kita berharap harus ada uji teknis secara independen dan diumumkan hasilnya ke publik jika perlu,” desak Zaman Akli, Wakil Ketua Komisi C DPRK Abdya.(sdp)

SMS Jerat Pelanggan Selular Masih Meresahkan Warga BIREUEN (Waspada): Sejumlah pelanggan telephon selular mengaku masih resah dengan ulah oknum tertentu yang memasang aksinya untuk meraup keuntungan pribadi, dengan cara mengirim SMS mengaku anggota keluarganya sedang berurusan dengan pihak kepolisian dan minta dikirimi pulsa. Sementara, kupun berhadiah masih ditemukan warga. Menurut keterangan yang dihimpun Waspada Kamis (11/ 11), SMS untuk menjerat korban dengan cara meminta pulsa telah lama terjadi di Bireuen, bahkan informasinya ada warga yang telah menjadi korban dan telah melaporkan kepada pihak penegak hukum. “Kasihan juga kalau ada warga yang telah menjadi korban, memang SMS itu kesannya seperti benar sekali, mungkin kalau rakyat biasa sudah pasti terkecoh atau menjadi korban,” kata seorang pelanggan kartu Telkkomsel di Bireuen kemarin. Dikatakan, isi SMS cara mengaet mangsa dengan cara minta dikirim pulsa ada beberapa jenis, diantaranya menga-

ku suami lalu minta dikirim pulsa, ada juga yang mengaku sedang berurusan dengan polisi dan minta dikirim pulsa untuk dapatdiselesaikanperkaranyaitu. Sementara itu, seorang warga Kecamatan Kutablang, Kabupaten Bireuen, kembali menemukan kupon berhadiah mobil dalam satu produk cat. Sehingga membingungkannya. Pasalnya, kupon memberi kesan bahwa dia benar-benar mendapat hadiah mobil. “Saya temukan dalam kotak cat merek Avian Paints kupon ini, jenisnya pemberitahuan dan diatasnya ada lambang burung Garuda lagi, ada nomor Depsos ada juga nomor Polri serta ditandatangan Departemen Keuangan RI Armin Nasutioan, Diman Asnawi SH Notaris dan bagian Iklan dan Promosi Ir Bambang Hadiyono. Lalu, di bawahnya ada lambang SCTV, Telkomsel, RCTI dan Indosat, namun saya banyak membaca di koran-koran ini unsur penipuan, makanya saya tanya pada anda, apakah ini benar atau tidak,” kata seorang warga Kecamatan Kutablang kepada Was-

pada Selasa (9/11) yang minta tidak menulis namanya sambil menyerahkan kupon berhadiah yang ditemukannya. Menurutnya, kupon yang ditemukan itu sempat meragukannya karena semua tertera disitu, selain itu juga ada gambar serta tanda tangan orang besar serta juga ada lambang beberapa stasion tv nasional diserta

juga ada kupon kecil yang telah di tata rapi. “Saya sempat berharap saya benar-benar mendapatkan satu unit mobil Honda Jazz Type RS seperti yang tertulis di kupon ini, bukan kupon berhadiah yang berkedok penipuan seperti yang banyak diberitakan di Koran selama ini,” katanya sambil menyerah kupon. (amh)


BB: Petugas Polres Aceh Utara, memperlihatkan sejumlah barang bukti (BB) yang berhasil disita dari enam tersangka kasus togel, Jumat (12/11).

Bupati H. Hasanuddin B dalam sambutannya usai meletakkan batu bata pertama pembangunan Masjid Syuhada Pulonas mengatakan, Masjid Syuhada Pulonas masjid bersejarah dan berperan dalam melahirkan pimpinan daerah di Aceh Tenggara, terutama di bidang pendidikan Agama Islam. Dari masjid yang berdiri di bekas kerajaan tanah Alas ini, telah lahir empat bupati yang memimpin Aceh Tenggara, mulai dari T. Johan Syahbuddin Selian, Drs. H. Syahbuddin BP, Drs. H. Armen Desky dan H. Hasanuddin B. Selain itu, dari Masjid Syuhada juga telah lahir dua orang Sekdakab Agara, anggota DPRK, DPRA dan pimpinan SKPK yang mempunyai peran strategis, karena itu, kata Sanu,

Maling Sepeda Motor Beraksi Saat Shalat SIGLI (Waspada): Masyarakat Kabupaten Pidie diingatkan berhati-hati memarkirkan sepeda motornya di masjid atau meunasah. Sebab pada saat jam shalat biasanya maling sudah mengintai mencuri kendaraan. Seperti terjadi Kamis (11/11) sekira pukul 20.00 Wib di Masjid Abu Beureueh, Beureunuen, Kecamatan Mutiara, Kabupaten Pidie. Maimun, 30, warga Baro Barat Yaman, Mutiara, sepeda motor miliknya yang diparkir di perkarangan Masjid Abu itu hampir raib saat ia sedang shalat Isya. Tersangka Tau, 28, warga Desa Tanjong, Kec. Peusangan. Tersangka sempat diramaikan massa, pada saat mencoba menggondol sepeda motor jenis bebek milik Maimun yang kala itu sedang sahalat di dalam masjid. Kapolres Pidie AKBP Dumadi, SStmk melalui Kasat Reskrim AKP Supriadi, SH kepada Waspada, Jumat (12/11) membenarkan peristiwa itu. Kejadian itu terjadi pada saat korban sedang shalat di dalam mesjid, lalu pelaku yang berada di luar sempat terlihat oleh tukang parkir keluar masuk toilet di masjid setempat. Lalu dengan menggunakan kunci T tersangka mencoba mengutakatik sepeda motor milik korban. Namun pada saat tersangka beraksi, tukang parkir di masjid itu melihatnya. Tak lama warga datang dan meramaikannya. Polisi yang mendapat laporan langsung ke lokasi dan mengamankan tersangka.“Barang bukti dan tersangka telah kita amankan” tandas Supriadi. (b20)

APA Desak Disdik Cairkan Sisa Tunjangan Guru Seorang warga memperlihatkan kupon berhadiah mobil yang ditemukan warga Kutablang Bireuen belum lalu ini dalam sebuah kotak cat. Waspada/Abdul Mukthi Hasan

Bantu Pembangunan Masjid Bersejarah Di Agara KUTACANE (Waspada): Sebagai wujud kepedulian terhadap tempat kelahiran dan tempat menimba ilmu Agama bagi empat pimpinan teras di bumi sepakat segenep, Bupati H. Hasanuddin B membantu pembangunan Masjid Syuhada Pulonas senilai Rp100 juta. Selain bupati, sumbangan pembangunan masjid bersejarah karena tempat menimba ilmu dan pendidikan agama bagi empat bupati Aceh Tenggara (Agara) itu, datang dari Ketua DPRK HM. Salim Fakhri SE.MM, Wakil Ketua DPRK Drs. H. Syahbuddin BP, anggota dewan Hj. Samsiar, Ir. Budimansyah, Kadis Dikpora H. Ali Basrah SPd.MM dan pimpinan SKPK lainnya dari Desa Pulonas serta bantuan keramik dari Hj. Rabiah Ame Sumi.

BLANGPIDIE (Waspada): Besarnya dampak lingkungan serta kerugian yang akan dialami masyarakat akibat pembukaan dan pemberian izin pertambangan, dinilai menjadi alasan utama untuk segera dilakukan evaluasi serta penutupan terhadap izin pertambangan yang ada saat ini. Sehingga dampak-dampak yang telah muncul beberapa waktu terakhir baik secara langsung maupun tidak langsung kepada masyarakat sesegera mungkin masih mungkin diminimalisir. Pernyataan tersebut dikemukakan Direktur Eksekutif Wahana Lingkungan Hidup (Walhi) Aceh, TM Zulfikar kepada Waspada Rabu (10/11) terkait munculnya masalah pencemaran lingkungan akibat aktifitas pertambangan biji besi oleh salah satu perusahaan tambang di Kecamatan Babahrot, Aceh Barat Daya (Abdya) dan berbuntut munculnya pemblokiran dari para warga yang menuntut agar pihak perusahaan menyediakan fasilitas air bersih karena sumber air yang mereka gunakan saat ini sudah tercemar. “Apa yang terjadi di Abdya serta beberapa daerah lainnya menunjukkan bahwa aktifitas pertambangan memang sudah semestinya segera dilakukan evaluasi dan ditutup untuk sementara waktu sampai ada penjaminan pelaksanaan regulasi secara tepat. Karena, yang paling dirugikan dari dampak pertambangan tersebut adalah masyarakat,” sebutnya. Lebih lanjut dituturkannya, pemerintah di daerah juga dinilai terlalu mudah dan lemah dalam memberikan izin serta rekomendasi terhadap usaha pertambangan, belum lagi munculnya persoalan koordinasi antara kabupaten dengan provinsi yang saat ini masih terlalu lemah. Sehingga, seorang Gubernur saja seperti dikemukakan oleh TM Zulfikar masih sering tidak mendapatkan informasi yang akurat terhadap izin-izin pertambangan yang ada di daerah. “Aktifitas pertambangan jelas memiliki resiko yang sangat besar dan bahkan bisa mematikan, jadi pemerintah harus mengevaluasi secara menyeluruh sebelum izin tersebut diberikan, jadi harus ada komitmen dan kesiapan sebelum izin tersebut dikeluarkan,” tutur TM Zulfikar. ‘Kebal’ Seperti diberitakan sebelumnya, aktifitas pertambangan biji besi yang dilakukan oleh salahsatu perusahaan di kawasan kecamatan Babahrot, Abdya, mulai menimbulkan dampak pencemaran terhadap lingkungan. Akibatnya, beberapa warga sempat melaporkan mulai terserang penyakit kulit akibat menggunakan sumber air yang sudah tercemar limbah dari aktifitas pertambangan perusahaan tersebut. Beberapa warga, sejak Minggu (7/11) hingga Selasa (9/11) sempat diblokir oleh para warga yang menuntut agar pihak perusahaan menyediakan sarana air bersih karena sumber air bersih yang mereka gunakan selama ini sudah tercemar. “Hingga jam tiga dini hari (Rabu 10/11) masih belum ada titik temu antara warga dengan PT Juya (Perusahaan tambang biji besi). Masyarakat juga masih terus bertahan dan akan menutup lokasi itu hingga permintaan mereka supaya perusahaan mau menyediakan sarana air bersih dapat terealisasi,” tukas Tgk.Abu Bakar Albayani, salah seorang tokoh ulama setempat yang juga pimpinan salahsatu pondok pesantren di Babahrot. Sementara Kepala Susun Alue Dawah M.Fredi Sitinjak, 41, yang ditemui saat aksi pemblokiran di lokasi pertambangan di dusun tersebut menyebutkan bahwa perusahaan tambang dinilainya memiliki ‘kekebalan’ terhadap hukum dan bisa berbuat apa saja dan sesuka hatinya.(sdp)

pembangunan Masjid Syuhada merupakan kewajiban bagi semua warga Pulonas, baik yang tinggal di desa dan di luar daerah. “Saya ingat, ketika masih berumur 3 tahun, di masjid ini pertama kali saya belajar mengaji dan ilmu agama lainnya, bahkan orangtua serta abang saya juga pernah membantu beberapa karung padi untuk menyelesaikan pembangunan masjid yang sudah berusia tua ini,” urai bupati. Kepada panitia dan warga Desa Pulonas dan Pulonas Baru yang berjumlah sekitar 2.700 jiwa itu, bupati menyarankan agar jangan pernah menyerah menyelesaikan pembangunan masjid bersejarah itu, karena dari masjid ini lahir puluhan pemimpin dan orang-orang penting di Aceh Tenggara

maupun yang berdomisili di luar daerah. Sebelumnya Ketua Panitia Pembangunan Masjid Syuhada Pulonas, Alpansyah didampingi Kades Darmawan Selian, Kadus Gaduh Pinim dan tokoh masyarakat Pulonas Sahedun dan Halidin Desky mengatakan, untuk pembangunan masjid berukuran besar itu, minimal dibutuhkan biaya senilai Rp700 juta. Sedangkan biaya yang sudah tersedia dan sudah mempunyai titik terang yakni, dari HT. Syarifuudin Selian, angota DPRA senilai Rp180 juta, lelang bahan masjid yang dibongkar, uang kas masjid dan dari masyarakat senilai Rp13 juta, sumbangan keramik dari Hj. Rabiah Ame Sumi, timbunan masjid dari H. Syahbuddin BP serta donatur lainnya. (b27)

IDI RAYEUK, Aceh Timur (Waspada): Aliansi Peduli Aceh (APA), sebuah lembaga pemerhati nasib guru, mendesak Dinas Pendidikan (Disdik) Aceh, segera mencairkan sisa tunjangan guru dari dana pembagian migas, untuk ribuan guru di seluruh Aceh, termasuk di Aceh Timur. “Biasanya tunjangan tersebut lunas dalam sekali bayar, namun pada tahun 2010 ini para guru baru menerima setengahnya. Padahal dana itu sangat berarti bagi guru, apalagi ini mendekati hari raya Idul Adha,” kata Ketua LSM APA, Yusnil Amri, S.Pd, Selasa (9/11). Berdasarkan hasil peelusuran APA, lanjut Yusnil, total dana tunjangan itu Rp2,2 juta per guru. Dinas Pendidikan Aceh Timur beberapa bulan yang lalu hanya menyalurkan 50 persen dengan dalih dana itu memang diatur oleh provinsi untuk dibagi dalam dua tahap. Kondisi demikian juga berlaku di kabupaten lainnya di Aceh. “Meski sudah menunggu lama, para guru hingga kini belum menerima sisa tunjangan itu dan tidak jelas kapan dana itu akan cair. Itu sebabnya, kami mendesak dinas terkait bertindak lebih cepat demi memenuhi hak para pahlawan tanpa tanda jasa itu. Jangan sampai tunjangan migas para guru dipolitisir dengan berbagai alasan yang tidak logis,“ tandas Yusnil. Sementara Kepala Dinas Pendidikan Aceh Timur, H. Agussalim, SH, MH, yang dihubungi via telefon selular, kemarin, mengatakan, pihaknya sudah mengusulkan sisa tunjangan itu segera dicairkan ke Dinas Provinsi dan jika tidak ada halangan, dana tersebut akan cair dalam waktu dekat. “Laporan pertanggungjawaban pencairan dana tunjangan sebesar 50 persen yang telah dicairkan sebelumnya, sudah kita kirim ke Banda Aceh. Pada saat bersamaan kita juga mengusulkan sisanya yang 50 persen lagi. Menurut informasi, dalam waktu dekat ini, tunjangan tersebut akan cair,” kata Agussalim.(cmus)

Waspada/Abdul Mukthi Hasan

Belajar Baca Al Qur’an: Sejumlah santri belajar membaca Al Qur’an yang dituntun seorang guru pngajian di Meunasah Kulah Batee Lingkungan II Kota Bireuen. Mereka belajar seperti itu rutin tiap pagi.




Sabtu 13 November 2010

Sejumlah siswa SD memperhatikan patung Pahlawan saat berkunjung ke Museum Daerah, Jl HM Jhoni Medan. Selain memperingati Hari Pahlawan, kunjungan ini juga bertujuan untuk menumbuhkan rasa nasionalisme siswa. -Waspada/M Hamdani Wibowo -

Novita Wulandari,

Nurul Ramadani, STMIK Kaputama Binjai “Menurut aku sih, pahlawan adalah tokoh yang berusaha keras mempertahankan negara dari tangan para penjajah. Terus terang aku kagum dengan Bung Karno karena Presiden pertama kita itu memiliki kharisma, wibawa dan kemampuan menjadi pemimpin dalam memperjuangkan kemerdekaan Indonesia.”

Waspada/Khairil Umri Batubara

Apa Itu Pahlawan? PAHLAWAN dalam konteks pemerintah adalah mereka yang menyerahkan seluruh jiwa raga untuk kepentingan bangsa dalam rangka merebut dan mempertahankan kemerdekaan. Saat ini, makna pahlawan udah mengalami perluasan arti. Semua orang yang mengorbankan dirinya dengan sepenuh hatidemikebaikanoranglainpun bisa disebut pahlawan. Melihat sedikit ke belakang, peristiwa berdarah di Surabaya saat menggerakkan perlawanan rakyat mengusir penjajah dan mempertahankan kemerdekaan menjadi cikal bakal dikenang sebagai Hari Pahlawan.

Dua hari lalu atau tepat 10 November, kita memperingati Hari Pahlawan. Berbagai acara mengenang para pahlawan pun digelar, mulai dari upacara kenegaraan sampai mengheningkanciptasejenakdemimengingat jasa-jasapejuang-pejuangbangsa yang telah mengorbankan diri. Kalau masa penjajahan, ciriciri pahlawan begitu jelas dan nyata yakni orang yang berada digardadepanberjuangmelawan penindasan dan kekejaman penjajah baik secara konfrontatif ataupun dialogis. Setelah merdeka, arti pahlawan lebih luas sehinggasetiaporangbisadisebut pahlawan. Seorang pelajar yang giat belajar aja udah dapat disebut sebagai pahlawan karena berkorban waktu sembari berusaha mengubahkeadaanmenjadilebih baik karena suatu saat ilmunya kelak dapat mengubah takdir

dirinya, keluarga bahkan bangsanya sendiri. Dewasa ini, ketika kita mengenang arti Hari Pahlawan mungkin sangat besar manfaatnyadimanakitaakaningatkembali bahwa bangsa Indonesia yang kita huni ini adalah hasil perjuangan orang-orang dari berbagai suku, agama, ras, keyakinan politik dan jangka lama pula. Denganmerenungkansecara mendalam akan berbagai tahap perjuangan bangsa itu, maka akan makin jelaslah kiranya bagi kita semua bahwa Republik Indonesia adalah benar-benar milik kita bersama. “Pahlawan itu adalah orangorang yang berjasa, karena di masa lalu mereka telah mengorbankan nyawanya demi kemerdekaan negara yang kita cintai ini,” ungkap Ridwan Siregar (21), mahasiswa semester V Teknik Elektro UMSU.

STMIK Kaputama Binjai “Seorang pahlawan bagi aku merupakan orang yang banyak berjasa dalam memperjuangkan kemerdekaan Indonesia. Cut Nyak Dien merupakan sosok pahlawan yang aku kagumi, karena termasuk pejuang wanita yang mampu menjadi simbol. Jika tidak, semua wanita bangsa pasti lemah tapi kehadirannya menjadi simbol pejuang emansipasi wanita demi melepaskan kaum hawa dari ketertindasan pria.”

Ridwan juga menambahkan pahlawan itu bukan sebatas ikut berperang dan mengorbankan nyawa aja, tapi ikut memajukan negara baik dalam bidang apapun. Hal sama juga diungkapkan Lulu F Tobing (18). Mahasiswi semester I STIKPMedannanimutinimengatakan pahlawan itu keikhlasan berkorban yang identik dengan pengorbanan harta nyawa untuk mewujudkan kehidupan bangsa yang lebih baik. Terlepas wacana di atas, semoga kita semua mengamini saatinipahlawanbukanlahorang yang mengangkat senjata lagi. Pahlawan bukanlah orang yang relamenumpahkanjiwaraganya, tapi orang yang tanpa pamrih membantu orang lain untuk dapat bekerja agar kesejahteraan hidupnya menjadi lebih baik. Setuju? *Syahrial Siregar

Pahlawanku, Orangtuaku… TEPAT 10 November lalu, kita mengibarkan bendera satu tiang guna mengenang jasa para pahlawan yang telah mengorbankan diri demi memperjuangkan dan mempertahankan kemerdekaan. 10 November dipilih sebagai Hari Pahlawan karena 65 tahun silam para pejuang bertempur mati-matian melawan tentara Inggris di Surabaya. Saat itu, pejuang kita hanya memiliki beberapa pucuk senjata api dan selebihnya menggunakan bambu runcing. Namun mereka tak pernah gentar melawan penjajah. Kita masih ingat Bung Tomo yang mampu menyalakan semangat perjuangan rakyat. Begitu besar jasa-jasa para pahlawan bangsa yang dengan ikhlas mengorbankan segenap jiwa raga sampai tetes darah penghabisan. Semua itu demi satu tujuan, yaitu Merdeka! Namun, kepahlawanan tidak hanya berhenti di sana. Dalam mengisi kemerdekaan pun kita dituntut menjadi pahlawan. Bukankah arti pahlawan itu adalah orang yang menonjol karena keberanian dan pengorbanannya membela kebenaran? Bukankah makna pahlawan itu adalah pejuang gagah berani? Bagaimana dengan orangtua kita? Toh mereka juga berani dan rela berkorban demi anak-anaknya agar kelak menjadi orang yang bermanfaat dan dapat membanggakan keluarga maupun negara. “Orangtua adalah pahlawan yang tiada tanding. Mereka membesarkansayadenganpenuhkasihsayangdanberharapnantinya sayamenjadikaumintelektualdanmampumemberigagasan-gagasan tentang perubahan,” ujar Ayu Prasandi, mahasiswa Sekolah Tinggi Ilmu Komunikasi “Pembangunan” (STIK-P) Medan. Hal serupa disampaikan Heri Chaniago. Dikatakan, orangtua memang luar biasa dan tiada tandingannya.“Walaupun dari kalangan kurang mampu, tapi orangtua tak pernah menyerah untuk membiayai saya hingga duduk di bangku perguruan tinggi. Sulit rasanya membalas jasa mereka,” terang Heri yang berkeinginan menjadi jurnalis itu. Negara tanpa pahlawan sama artinya negara tanpa kebanggaan. Jika sebuah negara tak memiliki tokoh yang bisa dibanggakan, negeri itu miskin harga diri. Karena Bung Karno pernah berkata bahwa bangsa yang besar adalah bangsa yang tidak pernah lupa akan jasa para pahlawan. * Hajrul Azhari Ritonga

Wulandari, SMA Eria Medan “Makna dari seorang pahlawan adalah orang yang berani mengorbankan dirinya demi mempertahankan negara yang dicintainya. Pahlawan yang menjadi panutan sekarang ini tentunya RA Kartini, karena tergolong sebagai pahlawan yang berani membela kaum wanita dari penindasan semasa penjajahan.”

Waspada/M Hamdani Wibowo

Khaidah Muawarah, SMAN 5 Binjai “Pahlawan? Kalo aku, pahlawan memiliki arti sebagai tokoh yang paling berjasa dalam memperjuangkan tanah air dari tangan penjajah. Pahlawan yang aku idolakan adalah Cut Nyak Dien. Kenapa? Karena beliau adalah salah satu pahlawan wanita yang berani mengusir penjajah dari bangsa kita tanpa pernah berpikir resiko yang akan dihadapinya sebagai seorang wanita.”

PIKR SMAN 5 Binjai Peduli Remaja Gelar Seminar HIV/AIDS dan Narkoba

Gilbert Jhontari, STIK-P Medan “Kalo aku berpendapat seorang pahlawan itu selain tokoh panutan bagi generasi muda juga sosok yang berani, tegas dan gigih dalam membela bangsa di era penjajahan dulu. Sosok itu aku nilai terdapat dalam diri Bung Karno karena beliau itu pemberani, gigih dan kharismatik sebagai pemimpin sehingga mampu memperjuangkan bangsa Indonesia dari ketertindasan bangsa lain.” Teks: Arianda Tanjung Foto: Khairil Umri Batubara

SAAT ini penyalahgunaan narkoba dan merebaknya penyakit HIV/AIDS di Indonesia sudah merajalela. Hal ini terlihat dengan makin banyaknya pengguna narkoba dari semua kalangan dan peredaran narkoba yang terus meningkat plus perkawinan dini di kalangan remaja. Padahal mereka merupakan generasi penerus bangsa yang nantinyaakanmenjadipemimpinpeminpin di negeri tercinta ini. Didorong rasa kekhawatiran tersebut, Pusat Informasi Konsultasi Remaja (PIKR) SMAN 5 Binjai bekerjasama dengan BKKBN Binjai, Polresta Binjai dan Dinas Pendidikan Binjai mengadakan seminar bertema “MeningkatkanKeterampilandan Ilmu Pengetahuan Untuk Remaja” di aula sekolah itu, Senin (8/11) lalu. Pesertanya sendiri terdiri dari pengurus PIKR SMAN 4, SMAN 7, SMAN 3 dan SMAN 5 Binjai sebagai tuan rumah. Seminar

dibuka Kepala SMAN 5 Drs Agus IsmadiKuncorodanturutdihadiri Kepala BKKBN Binjai Dr Andi Rinaldy,WakapolsekBinjaiSelatan AKP T Matanari (mewakili Kapolres Binjai), Drs Janu Asmadi Lubis sebagai wakil dari Kadis Pendidikan Binjai. Seminar itu juga menampilkan narasumber dari Badan KBdanPKSBinjaiMeilaniFebiola Harahap dan Permadi dari PIKR Binjai Selatan. Para peserta pun terlihatantusiasinginmengetahui bahaya dari penyakit HIV/AIDS dan penyalahgunaan narkoba. Menurut Wakepsek Bidang Kehumasan, Habibbullah SPd, kegiatan ini bertujuan membimbing siswa agar menjauhi penyakit HIV/AIDS dan kecanduan narkoba sejak dini serta menginformasikan akan bahaya dan upaya penanggulangan HIV/ AIDS dan narkoba. Kepada Kreasi, Reza Armaya PutraselakuWakepsekKesiswaan didampingi Ketua PIKR SMAN 5 Binjai Dhannis Khairunnisa

mengatakan sangat penting bagi remaja mengetahui bahaya HIV/ AIDS dan narkoba agar nantinya dapat menghindari penyalahgunaannya dan penyimpangan seks di luar nikah. PIKR sendiri memiliki beberapa tugas pokok di antaranya membantu para siswa yang memilki masalah termasuk dalah halpendidikan,keluargamaupun masalah pribadi remaja itu sen-

diri. “Terkadang banyak dari teman-teman malu menceritakan masalahnya kepada guru maupun orangtua. Karena itu, PIKR dapat menampung segala keluh kesah dari teman-teman di sekolah karena memang PIKR menganut sistem tutor sebaya,” tambah Dhannis. *Arianda Tanjung

Syauqi Lufti Lubis, SMAN 5 Binjai “Pendapat aku tentang makna seorang pahlawan adalah tokoh panutan yang pantas untuk dicontoh, khususnya bagi pemudapemudi indonesia saat ini karena jasa-jasanya yang begitu besar untuk ibu pertiwi. Pahlawan yang menjadi panutanku adalah Sisingamangaraja sebab beliau merupakan tokoh yang berjuang keras membela bangsa terutama Sumatera Utara dari tangan para penjajah.”


Peserta Seminar HIV/AIDS dan Narkoba di SMAN 5 Binjai antusias mendengar narasumber di aula sekolah tersebut, Senin (8/11) lalu.

Teks: Arianda Tanjung Foto: Khairil Umri Batubara


WASPADA Sabtu 13 November 2010

07.30 Disney Clubhouse 08.30 Weekend Dahsyat 11.00 Silet 12.00 Seputar Indonesia 12.30 PR : Agama Kristen 13.00 Film Keluarga 15.00 Cek & Ricek 16.00 Bedah Rumah 17.00 Seputar Indonesia 17.30 Who Wants To Be Millionaire 18.00 Putri Yang Ditukar 20.30 Kemilau Cinta Kamila 22.30 BOM 01.30 Liga Champions 02.00 Seputar Indonesia Malam


07.30 Inbox 09.30 Hot Shot 10.00 SCTV FTV Pagi 12.00 Liputan 6 Siang 12.30 SCTV FTV 14.00 SCTV FTV 14.30 Status Selebritis 15.00 Get Married The Series 16.00 SCTV FTV 17.00 Liputan 6 Petang 17.30 Uya Emang Kuya 18.00 Islam KTP 19.00 Taxi 20.30 Cinta Fitri 22.00 20 Wajah Indonesia 01.00 Liputan 6 Malam

07.00 Layar Pagi 08.00 Gwrobak Rejeki 08.30 Santapan Nusantara 09.30 Layar Spesial 11.00 Jendela 11.30 Sidik Kasus 12.00 Layar Kemilau 13.30 Layar Special 15.00 Disney Club 16.30 Lintas 5 17.00 Zona Juara 18.00 Animasi Spesial 19.30 Upin & Ipin 20.30 Sinema Utama 22.00 Cerita Pilihan 23.00 Sinema Malam 01.00 Layar Tengah Malam

07.00 Curious George 08.00 Peroro The Little Pinguin 09.00 Hidup Sehat Dengan Ekstrak Herbal 10.30 Forum Kita 11.00 Cantik 12.00 Klik! 15.00 Topik Petang 15.30 Mantap 17.00 Wayang On Stage 18.30 Super Family 21.00 Penghuni Terakhir 22.00 The Partners 00.00 Topik Malam 00.30 Makmur

07.00 The Price Is Right 08.00 The Chef Indonesia 09.00 Bango Cita Rasa Nusantara 09.30 KiSS Plus 10.00 Arti Sahabat 12.00 Indonesia Got Talent 13.00 Happy Song 14.00 Beningnya Cinta 15.00 Fokus 16.30 He Is Beautiful 17.00 Arti Sahabat 18.00The Price Is Right Celebrity 19.00 Indonesia Got Talent 20.00 Gila Gilaan 21.00 Gebyar BCA 22.00 Miss USA 2010 00.00 Sinema Malam

07:05 Editorial Media Indonesia 08:05 Agung Sedayu 09:05 Indonesia Now 09:30 Fashion Galery 10:30 Metro Xin Wen 11:05 OprahWinfrey Show 13:05 Spirit Football 13:30 Expedition 15:05 Provocative Proactive 16:05 Supernanny 16.30 Distroyed In Seconds 17:05 Metro Hari Ini 18.30 Metro Highlights 19.05 Metro Files 20.05 Exposed 21.05 Top Nine News 21.30 The Best Five Film Eagle Award 20052009 22.05 World Cinema 23.30 Metro Sports

B9 07.30 Kuliner Pilihan 08.00 Gula Gula 08.30 Koper dan Ransel 09.00 Ceriwis 10.00 Ala Chef 10.30 Benu Buloe 12.30 Ngulik 13.00 Peppy The Xplorer 13.30 Belajar Indonesia 14.00 The Camp 14.30 Kenari 15.00 Hidup Kedua 15.30 Sahabat JP 16.00 Gaul Bareng Bule 17.00 Reportase Investigasi 18.15 Termehek-Mehek 19.00 IMB bersama Supermi 22.00 Bioskop TRANS TV 24.00 Bioskop TRANS TV

06.30 Kabar Pagi 08.30Nuansa1000Pulau 09.00 Property 09.30 Keliling Indonesia 10.00 Backpacker 10.30 World Boxing 12.00 Kabar Siang 13.00 Indonesia Grand Prix Gold Championship 2010 17.00 Tepi Jaman 17.30 Kabar PEtang 19.00 Catatan Seorang Jurnalis 20.00 Apa Kabar Indonesia Malam 21.00 Local Documentary 22.00 Documentary One 22.50 Liga Spanyol

07.00 Spongebob 08.00 Back At Banyard 09.00 Big Movies 11.00 Kitchen Beib 11.30 Ngidam 12.00 Kesempatan Kedua 13.00 Global Siang 13.30 Genie 14.00 Movie Special 15.30 Berita Global 17.00 Naruto 20..00 Big Movies 21.00 My Name Is Eko 22.00 Made In Indonesia 23.00 Big Movies 01.00 Global Malam 01.30 MTV Insomnia

07.30 Selamat Pagi 08.00 CAWAN 09.00 Cooking In Paradise 11.00 Wildlife On One 12.00 I Gosip Siang 13.00 Buku Harian Si Unyil 14.00 One Stop Football 15.30 Paradiso 16.00 Mancing Mania 16.30 Redaksi Sore 17.30 Guruku Selebritis 18.00WaraWiriWeekend 19.00 Misterl Tukul 20.45 Pas Mantab 21.45 Beauty And Azis 23.00 Clas Community 23.30 Kualifikasi MotoGP


Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

Ingat Anak, Phil Collins Urung Bunuh Diri

Sule Tak Cuma Lucu, Tapi Pinter Nyanyi AJI mumpung atau sekedar memanfaatkan moment, mungkinituyangterbesitdibenak kita saat pertama kali melihat album Prikitiew milik Sule ini. Takbisadipungkirikomedian berpenampilan eksentrik ini memang sedang naik daun lewat penampilannya dalam serial komedi OperaVan Java dan Awas ada Sule. Namun, anggapan itu tidak sepenuhnya benar. Sebab Sule bukan sekadar memanfaatkan popularitas yang sedang melambung untuk merambah ke dunia tarik suara. Dia memiliki nilai lebih untuk menjadi seorang penyanyi. “Saya senang sekali dengan album ‘Prikitiew’. Secara pribadi saya suka lagu-lagu di dalamnya. Syairnya komunikatif, musiknya keren,pokoknyamantaplah!Saya optimistis album ini akan banyak disukai,” ungkap Sule mengenai album pop perdana ini. Rasa optimis itu kuat melihat kuatnya materi dalam single pertama dari album Prikitiew berjudul Susis. Lagu dibuka dengan kalimat berbahasa Inggris:What am I going to do/But I can’t Do Anything bernuansa reggae itu langsungdapat melekatdikuping siapapun yang mendengarnya. Musikyangriang,denganlirik berisi sindiran terhadap tingkah para suami yang sieun istri alias suami takut istri dengan mudah melekat di telinga. Ditambah dengan pembawaan Sule yang khas dan mengundang senyum. “Saya enjoy sekali menyanyikan lagu Susis. Syairnya menggambarkan hubungan pria dan wanita yang memang terjadi dalam kehidupan sehari-hari,”

PHIL COLLINS mengaku pernah akan melakukan bunuh diri seiring merosotnya karir serta kehidupan pribadi. Penyanyi sekaligus pemain drum berusia 59 tahun itu mengaku terpikir untuk mengakhiri hidupnya setelah pernikahan ketiga kandas dan cedera yang membuatnya tak dapat menabuh drum lagi. Satu-satunya yang membuatnya batal mengakhiri hidup adalah karena ingat anak. Collins berjaya selama 40 tahun baik sebagai drummer maupun penyanyi bersama band Genesis dan kemudian menjadi penyanyi solo dengan pendapatan terbesar sepanjang masa. Ia mengatakan, bertahun-tahun kritikan pedas atas karya solonya telah membuat dia gusar dan tak ingin rekaman lagi. Phil Collins menyebutkan, catatan bunuh diri dari seorang selebritis lain yaitu terlalu banyak dan terlalu sering hal yang tak benar selalu terngiang di pikirannya, katanya dalam wawancara seperti dimuat majalah Rolling Stones edisi terbaru. Ia juga membuat pengakuan “nyeleneh” dalam wawancara dengan majalah Rolling Stone itu. Collins mengatakan dalam kehidupan sebelumnya, ia kemungkinan besar adalah seseorang yang terlibat peperangan di Alamo. Ia memiliki koleksi terbesar artefak perang yang terjadi di tahun 1836 itu. Perang tersebut terjadi di wilayah yang kini bernama Texas. Sejak bubarnya pernikahan bersama penterjemah asal Swiss Orianne Cevey di Januari 2007, ia tinggal sendirian. Tujuh tahun lamanya mereka menikah. Pasangan itu dikaruniai anak bernama Nicholas dan Matthew. Collins lebih banyak tinggal di dekat rumah anak-anak mereka di Jenewa. Ia juga memiliki seorang putri, bernama Lily dari pernikahannya dengan Jill Tavelman, yang berakhir di tahun 1996. Saat masih anak-anak, Collins sudah sukses sebagai aktor, yang tampil sebagai Aerful Dodger di panggung teater London dalam produksi “Oliver!” Di tahun 1970 ia bergabung dengan band

ucap Sule. Itu yang menjadi nilai plus pertama dari album Prikitiew. Sebagai pelawak Sule mampu menghidupkan lagu dengan pesan kuat dengan cara penyampaian yang lucu. Hal semacam ini pernah dilakukan mendiang Benyamin S ataupun kelompok Pancaran Sinar Petromaks. Tak sekadar lucu, Sule juga memiliki kemampuan olah vocal yang lebih dari cukup. Terbukti, jauh sebelum menduduki posisi sebagai pelawak papan atas, pria berambut gondrong berwarna pirang ini sudah menjajaki dunia tariksuaralewatacararealityshow SuperStar Show beberapa tahun lalu. Karena itu jika dibanding dengan album komedi, di album Prikitiew ini Sule tak sekadar menawarkan lagu lucu saja. Dia benar-benar ingin membuktikan kemampuannya bernyanyi. Simak single andalan kedua Memendam Rasa. Lagu berirama pop melayu ini berkisah tentang cinta terpendam dibawakandenganpenuhekspresi.Simak juga lagu -lagu lain di album ini seperti Senyumlah Ibu, Sinyal Cinta, Bola Salju, termasuk Oh KekasihkudiciptakanSulesendiri. Ini membuktikan bahwa Sule serius dalam menggarap album ini. Dari semua itu, karakter Sule yang unik, multy talented dan humoris tetap kuat. Simak saja pada lagu Prikitiew Bye Bye dan Be Happy yang begitu khas. Apalagi pada video klipnya ditambah dengan kehadiran kawan-kawan Sule yang biasa meramaikan OVJ (Opera Van Java).(m09)

Phil Collins/ Genesis sebagai drummer band itu dan lima tahun kemudian menggantikan Peter Gabriel sebagai penyanyi. Ia meraih kesuksesan di tahun 1980-an dengan sejumlah hits seperti InThe AirToninght , Against All Odds dan Two Hearts, dan tetap sebagai pentolan Genesis formasi baru. Ia memenangi tujuh Grammy dan sebuah Oscar untuk lagu You‘ll be in my heart dari film animasi produksi Disney, Tarzan (1999). Collins sudah satu dasawarsa tak mengeluarkan album dengan lagu baru. “Saya terkadang berpikir sedang menulis karakter Phil Collins dalam suatu cerita,” ujarnya dalam wawancara tersebut.` Laludiamengatakan,tokohbernamaCollins akan menghilang atau dibunuh di kamar hotel. “Orang-orang akan berkata, apa yang terjadi dengan Phil? dan jawabannya akan seperti ‘dia dibunuh,tetapiyeah,hidupterusberlanjut’kurang lebih hal seperti itu,” katanya.` Cedera leher yang didianosa dua tahun lalu membuatnya tak bisa main drum, kecuali jika stik drum diikat ke tangan. Tulang punggungya telah rusak. Bagaimanapun, Collins mengatakan dirinya tak rindu main drum.”Saya memang akan berhenti main. Saya sudah berhenti dan tak kangen ingin main.”(ant)


Taylor Swift Sabet Penghargaan TAYLOR Swift (20) telah menjadi orang termuda yang pernah meraih penghargaan buat kategori “country songwriter of the year”, BMI, hanya satu pekan setelah debut album barunya Speak Now. Taylor juga membawa pulang hadiah buat country song of the year buat lagu You Belong With Me di dalam upacara penyerahan hadiah Broadcast Music (BMI) di Nashville, Selasa malam (9/ 11), sebagaimana dikutip dari Reuters Life! Itu adalah tahun ketiga berturut-turut artis lintas warna country/pop itu telah meraih hadiah country song of the year, BMI. Hadiah

kategori penulis lagu menempatkan dia di liga mendiang legenda musik country Johnny Cash, yang meraih hadiah sama pada 1956, ketika ia baru berusia 24 tahun. Taylor, yang lagu-lagu pribadinya berkisah tentang cinta dan resiko sosial di sekolah menengah telah membuat dia memiliki pemirsan remaja yang setia, meraih empat Grammy awal tahun ini buat albumnya Fearless dan album yang baru diluncurkan Speak Now berada di jalur keberhasilan yang sama. Album laris tersebut menjual lebih dari satu juta copy di Amerika Serikat

dalam pekan debutnya, sehingga membuatnya jadi penjualan pekan pertama terbesar dalam lima tahun. Taylor juga mengukir sejarah di chart singel Billboard Hot 100 pekan lalu, dengan pemecahan rekor 11 lagu dari Speak Now masuk chart dalam satu pekan. Taylor kembali jadi pusat perhatian pada Rabu (10/11) waktu setempat, saat ia tampil di acara penyerahan hadiah Country Music Association di Nashville, dan bersaing dengan Carrie Underwood, Reba McEntire, Martina McBride dan Miranda Lambert buat kategori “CMA female vocalist of the year”.(ant)

6nam 9embilan Band Menyentuh Hati PUAS mencari jati diri dan kepuasan bathin dengan berpindah-pindah band, Krishna Balagita memutuskan mengakhiri petualangannya dengan mengibarkan panji 6nam 9embilan Band. Lewat album band barunya bertajuk “Rebirth”, mantan Keyboardis Ada band ini, lagilagi menuangkan eksplorasi daya ciptatotalmusikalitasnya–dengan menciptakanmelodi-melodiyang menyentuh hati. Berniat menyaingi Ada Band dengan membidik penikmat musik wanita ? “Ya, mau bagaimanalagi.Menciptakanlagu melodius yang menyentuh hati sepertinya sudah menjadi spesialis saya. Jadi, wajar walau tanpa berniat menyaingi Ada band pada

akhirnya banyak pula penikmat musik wanita yang tersentuh lagu-lagu terbaru usungan 69 band,” papar Krishna Balagita kepadaWaspada di Jakarta, barubaru ini. Menurutkomposerpendiam kelahiran 26 Maret 1967 yang lewat lagu-lagu hitsnya berperan besar melambungkan panji band lamanya, 69 band tak sedikit pun berniat manjadi pesaing Ada band. “Sebab, lewat band baru kami hasil upaya keras lagu-lagu andalankamiterutamaMengapa Kau Lari, banyak disukai pria.Toh, panji6nam9embilanmerupakan simbol keseimbangan penikmat musik yang dibidik yakni wanita dan pria,” tandasnya. Menurutpemusikyangsebe-

lumnya pernah mengibarkan panji New Spectrum band, lagulagu karya ciptanya terkini lebih mencuatkan kesan feminim namunsangatcocokdinyanyikan kaum Adam yang bermakna maskulin. “Formula keseimbangan penikmatmusikpria–wanitayang dibidik itulah yang coba saya analogikan dalam simbol 69. Jika, pada kenyataannya banyak kaum Hawa menyukai karya saya, semua itu merupakan bonus,” jelas Krishna seraya menyelaskan formula keseimbangan yang dilakukannya dalam proses menciptakan lagu. “ Dimulai dari refrain terlebih dahulu, baru kemudian bagian yang lainnya,” tambahnya.

6nam 9embilan Band Dibantu Charlie ST 12 Tekad mengkristal Krishna menjadikan 69 band merupakan pelabuhan terakhir geliat musikalitasnya, berjalan cukup mulus. Proses penciptaan lagu dan mixing album perdana bertitel Rebirth dari band yang dibentuk September 2009 ini hanya membutuhkan waktu enam bulan. Sebuah kerja cepat namun

tak mengabaikan kualitas karya, sama halnya kala doa mencari vokalisyangpasuntukmembingkai angan-angannya tersebut. Pasalnya, pertemuan Krishna dengan Rizal Rakhmandika Ramadhan (vokalis), banyak dibantu Charlie ST 12. Musisi asal Bandung tersebutlah, yang memberikan nama Rizal pada Krishna. * (AgusT)

Jane Aprilia ditengah grup pengiringnya

Jane Aprilia Menggeliat Lebih Total TAK mudah memang bagi pendatang baru untuk bersaing di blantika musik nasional tanpa kejelian melirik selera pasar. Itulah yang tengah diupayakan penyanyi belia Jane Aprilia. Untuk terus memelihara semangat menggebu-gebunya menjadi penyanyi profesional, dara cantik kelahiran Jakarta, 8 April 1994 yang cukup sukses magang menjadi penyanyi rekaman lewat singel daur ulang “Lagu Rindu” milik Krispatih band dilansir setahun silam, kini mencoba menggeliat lebih total. Caranya, membentuk band pengiring baru didukung empat pemusik belia – Dani (lead gitar), Fahri (gitar), Andri (keyboard) dan drummer wanita Ajeng yang memiliki kemampuan musikalitas mumpuni, Jane pun tengah bersiap rekaman singel kedua mengandalkan lagu baru bertajuk “Kamu” karya komposer Tony Tomang. “Ditopang strategi dan formula baru yakni mengusung lagu baru bernuansa nge-beat membentuk band pengiring baru yang lebih fresh, keatif plus berkemampuan musikalitas mumpuni, saya berharap karir nyanyi saya bisa menggeliat lebih total dimasa datang,” tekad Jane Aprilia kepada Waspada di Lapangan Gazibu Bandung, baru-baru ini. Ditemui selepas tampil memukau dan menyegarkan ribuan remaja kota Kembang lewat konser dan festival musik Coca-Cola

Soundburst dengan mengusung tiga tembang – Love, Lagu Rindu dan Kamu – siswi kelas dua SMA Regina Pacis Bogor ini menambahkan, belakangan ada kecendrungan para kaula muda lebih menggandrungi lagu-lagu nge-beat, ketibang yang mellow. “Sebagai penyanyi yang tengah berjuang menjunjung tinggi profesionalitas, dirinya harus jeli melirik selera pasar. Dan gayung pun bersambut, seiring niatan saya mengusung lagu baru bertempo nge-beat, saya mendapat suplai lagu bagus dari komposer Tony Tomang. Keberuntungan pun berlanjut, dipertemukan dengan empat pemusik muda Bogor yang cukup berpengalaman sebagai band pengiring pengganti Tolentino – termasuk penggebuk drum wanita Ajeng yang kerap menjadi additional player band SHE (Sond and Harmony Electic),” terang Jane sambil menyunggingkan senyum renyahnya. “Mudah-mudahan singel kedua saya bertajuk Kamu - bisa rampung dan diedarkan awal Desember nanti. Hingga saya bisa memanfaatkan puncak rangkaian tur konser dan festival musik Soundburst di sembilan kota digelar di Surabaya, 11 Desember 2010 mendatang, sebagai ajang promosi sekaligus pembuktian eksistensi di industri musik,” harap penyanyi yang lebih dulu berprestasi di dunia model – antara lain menyabet predikat None Remaja Kencur Jakarta tahun 2007 ini. * (AgusT)

B10 1 CM 2 CM

Rp. 12.000 Rp. 24.000

WASPADA 3 CM Rp. 36.000 4 CM Rp. 48.000


AUTOMOTIVE Informasi Pembaca


Bursa Automotive

: Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower


: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window


Mau Xenia Baru Angsuran Per bln 2,7Jt/3Th?? Hub. Astra : 77033511 / 0812 6423 792. Terios, Luxio, Pick Up Ready.

DAIHATSU Rocky Thn. 94. Asli Medan, AC, Tape, VR, BR, PW, PS, Mulus, siap pakai. Harga 65Jt damai. Hub. 0812 650 8814 DIJUAL

- Espass Th. 96 Pintu Sorong Merah met 1600cc. Harga 35,5Jt Nego. - Kijang Commando Th. 92 Long 5 Speed. Biru met. Harga 47Jt. Nego. Tdk. Melayani Agen/sms. Hub. 0812 6389 4717

DAIHATSU Espass Th. ‘95 (1.3). W. Silver metalic, Pintu Sorong, Siap pakai. Dijual Segera BU. Harga damai. Hub. Telp. 0813 7086 5875 TP. DAIHATSU Xenia Xi VVTi Sporty Thn. 2009. W. hitam met, AC, Tape, VR, BR, Mirror, BK Medan, Original, sgt mulus, Jarang pakai, Harga: 132Jt/damai. Hub. (061) 77731399

DAIHATSU Feroza Th. 93. Warna hitam, BK Medan Asli, Velg Racing, AC, Tape, Hub. 77702406 Nego. DAIHATSU BARU UNTUK NATAL & THN. BARU Paket Kredit Spesial Untuk Xenia, Terios, Luxio & Gran Max. Dapatkan Juga Diskon, Kontrak Servis & Hadiahnya. Info: TRISNA - ASTRA 0813 6177 3589 / 77943677 “BAWA PULANG DAIHATSU BARU ANDA SEKARANG !!! Xenia Hanya DP 11 Jt-an Angsuran 2 Jt-an Terios DP 15 Jt-an ansuran 4 Jt-an Grand Max Pick Up, DP 7 Jt-an angsuran 2 Jt-an, dll. Proses Mudah dan dijemput 24 jam stand by. Pemesanan Hub. MANDA ASTRA- DAIHATSU. SM. Raja Medan. HP. 0812 6316 330 / (061) 6647 0080


- Pick Up DP 7 Jt-an / Angs. 2 Jt-an - Xenia DP 11 Jt-an / Angs. 3 Jt-an - Terios DP 15 Jt-an / Angs. 4 Jt-an Ready Stock. Proses Cepat & Muda, Data Dijemput. Pesan sekarang ke: Ahmad Arif SE Astra Daihatsu 061-76277692 / 0812 6005 2465

PROMO DAIHATSU NATAL Xenia DP 15 Jt-an/Angs. 3Jt-an New Terios DP 16 Jt-an/Angs. 4 Jt-an Granmax PU & MB DP 10 Jt-an Hub. GERY 0813 7694 1988 / 061.77722561

DAIHATSU Xenia 1.0 Thn.2005. Dijual Over Kredit. Type Li, BK Medan asli, warna biru. AC, Tape, VR, BR, CLRC, PS, Kembali DP. Rp. 53.000.000. Kredit 21 Bulan lagi. Hub. 0812 6038 561

# DAIHATSU ASTRA PROMO # Ready: Xenia, Terios, Luxio & Granmax MB. Bunga ringan/DP kecil. Trm Tkr Tambah !!! Hub. EDY 061-7772 3699 / 081 985 1688

# DAIHATSU 100% BARU # * Xenia DP: 12 Jt Terios DP: 14Jt * Pick-Up DP: 8 Jt Luxio DP: 11 Jt Proses Cepat, Data dijemput + Hadiah Hub. Kalpin 0852 7041 9000


Gran Max Pick ‘UP DP 8 Jt-an Angs. 2Jt-an Luxio D DP 14 Jt-an Angs. 4 Jt-an Xenia 1.0 Deluxe DP 11 Jt-an Angs 3 Jt-an Terios TS Xtra DP 14 Jt-an Angs. 4 Jt-an Hub. ERWIN HP. 0812 6315 4132 061-77402067

DAEWO Nexia Thn. 97 Asli Mdn. AC, Tape, VR, BR, PS, PW, Harga 22Jt. damai. Hub. 0812 650 8819

FORD Everest 4x4 M/T Thn. 2005. Biru met. Ban 5 Bh Baru, BK Mdn, pajak STNK Baru. Hub. 0815 3182 818

5 CM 6 CM

Rp. 65.000 Rp. 78.000

7 CM 8 CM

Rp. 91.000 Rp. 104.000

9 CM Rp. 126.000 10 CM Rp. 140.000

11 CM Rp. 165.000 12 CM Rp. 180.000

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

Sabtu, 13 November 2010



Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput

- HONDA CRV, 04, Hitam manual a/n. Sendiri dari baru. -Mercy 230-E, Boxer Thn. 90/Hitam. - Daihatsu Taruna 01, Tipe FGX. 0813 - 9663 8992/770 63610/DOGEN

SUZUKI Katana Th. 89 W. Biru metalic. AC, Tape, VR, BR, BK Medan, Body kaleng. Mulus seperti baru. H. Nego. Hub. 0813 7582 3555

SOHC, Warna Champion metalic. Harga 33Juta Nego. Hub. 0812 63 69 880

- ACCORD VTIL M/T Gg. Coklat Met. - Odyssey Matic 97 Hitam. Hub: 0812 6594 2789

SUZUKI Aerio Th. 2003. W. Biru metalic. AC, Tape, VR, BR, PS, PW, BK Medan, Body kaleng. Mulus. seperti baru. H. Nego. Hub. 0813 6233 0595

# TOYOTA 100% BARU # TRUCK DYNA Rp. 12 Jt-an...Innova, Avanza, Rush, Yaris, Vios, Bunga Ringan. Hub. 061-77875227 atau 0815 304 2382

BUTUH SGR Sbg: 1. SPG, 2. Consultan, Utk pemasaran organic Food + Soya, ditempatkan atau mandiri dgt lgs bw Materai + FC, KTP pd hr Minggu jam 14.00 ke Hotel Grand Angkasa Lt. 2, Info Hub. P. Gandi 0813.6174.1964

TOYOTA Corolla Altis G M/T Thn. 2002. Hitam, BK Mdn Rp. 125Jt. Hub. 91144382

TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.6802 - 661.8116 - 7653 2188

SUZUKI Baleno 97 W. Hijau met TV, System Spt. Baru. H. 69Jt Nego. Orisinal. Toyota Avanza E. W. Silver Spt. Baru Orizinal. TV. Sound System. H. 112Jt. Nego. Yang Serius Hub. 061-30313617




ISUZU Panther LS 2,5 Turbo Matic Thn. 2001. Coklat Met, BK Mdn, Ban Baru Rp. 99 Jt. Hub. 913 27433 ISUZU Panther Grand Deluxe 95 Merah metalic. P. Window, P. Steering, Velg Racing, BK Panjang, jok Baru, Tape, CD Sony, Cat mulus, mesin sehat, Siap jalan jauh. Siap pakai. Harga 62/Nego. Hub. 0812 6568 818 / 7730 5875

# ISUZU 100% BARU (ASTRA) # Panther Pick Up Turbo........DP 8 Jt Panther LM, LV, LS, Touring...DP 35Jt Hub. Suprapto 0813 7507 0088 / 061-77860168

ISUZU Panther Hi Grade Dijual. Thn. 93. Warna hijau tua. Hub. HP. 061.913 97917 - 0852 7630 2646 ISUZU Panther Hi-Sporty 2,5 Thn. 97. Wrn. Abu2 met, AC DB, CL, Alrm. Ban Besar Baru (Savero), STNK Baru Bayar. Siap pakai. Hrg. 72Jt. Nego. Hub. 085210908484 ISUZU Panther Clencer. Th. 94. W. Abu2 metalic. AC DB, Tape, VR, BR, PS, Pw, BK Medan. Body kaleng, jamin mulus. H. Nego. Hub. 061-6991 1187

5th CUMA 13,5Jt HP. 0813.7589.6778 GARANSI NEW PICANTO COSMO



5 Th.

DP 13,5 Jt Jadi Milik Anda Syarat Ringan & Gampang

Hotline Service: 0813.6111.1310

M-ETERNA -91 Satu tangan dari baru. Kondisi luar biasa mulus. Hub. 061-91145520 - 0815 3374 8820 MITSUBISHI Kuda Super Exeed Th. 99 W. Biru metalic. AC, DB, Tape, VR, BR, CL, PS, PW, BK Medan asli. Body kaleng mulus, seperti Baru H. Nego. Hub. 061.7793.5466

DOUBLE CABIN/MITSUBISHI STRADA Dijual. Tahun 2006. BK Medan. Warna Hitam. HP. 0813 754 11186 / 699 70499 MITSUBISHI BUNGA 0%

Pajero Sport A/T. M/T, Fuso, Colt Diesel, L.300. Grandis, Lancer, T120, Ready Stock !!! Proses Cepat. Hub. Antonius Sinaga (061) 7628 3331 - 0812 6020 3974

MERCY Mini 200 73/74 HP. 0821 6031 3063 MAZDA Vantrend 93 W. Abuabu. H. 21,500.000/Nego. HP. 0812 603 7977 OPEL Blazer Montera Thn. 2001, Silver, BK Medan Rp. 59Jt. Hub. 0816 3113 953 SUZUKI Esteem 1.6 ‘96. Mrh Maron Met, AC, RT, VR, BR, PW, PS DP 13,5Jt. Angs: 1,3Jt. Mercy E-230 ‘96. New Eyes HTM, BK 2 Angka, DP 45Jt. Angs. 3.xx. Hub. 76.700.976 /0878.6912.9124

SUZUKI Baleno Next G. Thn. 2003. Hitam, BK Binjai Rp. 92Jt. Hub. 7786 3981 DEALER RESMI SUZUKI MOBIL

PU 1.5 DP 6 Jt-an. Angs. 3.170.700 APV Dp. 12 Jt-an Angs. 4.830.000 NB: Proses Mudah & Cepat Data dijemput Hub. 0812 6540 809 / (061) 7772 2121

TOYOTA All New Corolla ‘97. Pemakaian 98. Wrn. Abu2 met. Complit, terawat, interior original. Khusus Pemakai Hrg. 73Jt Nego. Hub. 77323858

TOYOTA Kijang Commando 1.8 Dijual. Thn. 96 BR, VR, AC (DB), Mulus. 65Jt. Nego. Hub. 0812 6502 730 TOYOTA Kijang Kencana Thn. 96. AC, Tape, VR, PS, PW, BK Mdn. Hub. 0857 6236 5160 TOYOTA Kijang Commando Thn. 88/ 89. W. Abu2 met. Tape/AC, BR, VR, BK Asli Medan 6 Speed. Mobil cantik. 41Jt/ Nego. Hub. 0813 9610 8610

TOYOTA Corolla Twin Cam. 1.3 Thn. 88. W. Hitam, mobil cantik. 32Jt/Nego. 0813 6150 8497 TOYOTA BARU 100%

Fortuner Ready Stock Warna Putih Kijang Innova, Rush, Avanza, Yaris Bisa Cash Dan Kredit / Data dijemput Hub. 0813 6120 1719 / 6878 3325

JUAL CEPAT . TOYOTA Fortuner 2.7 GLUX A/T 2006. Silver metalic. Kondisi baik, mulus. Hub. 0811 625455 TOYOTA TWINCAM LIFT BACK Thn. 87, Abu Rokok metalic, lengkap, Hub. 0811 616414 (Via SMS) Harga 33 Juta TOYOTA Kijang Kapsul Th. 2002. Dan Suzuki Carry Th. 1995. Hub. 0852 6116 3754 / 0852 6195 1906 TOYOTA Soluna XLi ‘02, BK Mdn, Silver, AC, RT, Jok kulit, VS, BR, DP 21Jt. Angs: 2,3Jt ISUZU Panther 2,5 Hi-Sporty ‘97 Akhir, BK Mut, Hijau, DP 23 Jt. Angs: 2,1Jt. Hub. 76700.976/0878.6912.9124 TOYOTA Kijang Capsul Model LGX New Bensin 1.8 Thn. 2003. Hitam Met, sgt terawat, VR16, BR, PS, PW, CL, E. Miror. AC DB, Sound, DVD, MP4. Ada TV, Acesories Full. Hrg. 140Jt. Nego. Hub. 0813 7550 1012

TOYOTA AVANZA VVTI TH ‘06. Wrn. Silver. Mbl Ctk Sekali, Bln 9. Pakai sensor. 1 tangan dari baru, Rp. 129Jt. Jl. SM. Raja No. 200 (depan UISU). 0812 6038 5555 / 785 1402 OVER KREDIT Mobil Kijang Kapsul Solar Warna Hijau, 2000, Velg Krista, Sound Kembali DP 37,5Jt. 26 Bln, 2,6Jt/Bln. Hub. 0813 9666 3766, 0852 6212 0411

TOYOTA Kijang tahun 1996 Warna putih Super Standard, BK Asli Medan. Hub. 0813 6112 9222

HYUNDAI ACCENT THN. 2000 Silver, BK Medan Asli, Satu nama. Hub. 0812 6400 747 - 777 47147

SUZUKI Aerio 03 M/T. Hitam, Kondisi mulus, Ass. All Risk. Hrg. Rp. 90Jt/Nego. Hub. 0813 7515 3332

TOYOTA Innova V Diesel Th. ‘09. Balik DP Rp. 92 Jt. Wrn Abu2 metalik, sdh byr 19 kali, Bisa 29 bln x Rp. 6.483.100. Pelunasan Rp. 157 Jt. Assuransi All Risk. Kembar Ponsel Jl. SM. Raja No. 200 (depan UISU) 0815 337 33688 / 7851 402

HONDA Accord Thn. 85. Warna hitam mulus sekali. AC Dingin, VR, BR, Jok kulit. Pwr. Steering, P. Window. dalam2 orisinil. Mesin sehat siap pakai. Terima BBN. Rp. 20 Juta/ nego. 0812 6578 790 - 77788647

SUZUKI Carry Real Van 1,3 Thn. 97 AC, Tape, Ban Baru, M. Mulus/ Cantik, T. Pakai. Hub. 7348522/ 0813 7624 4166 H. 47Jt. TP.

TOYOTA Kijang Grand Extra Th. 94 W. Merah metalic. AC DB, Tape, VR, BR, PS, PW, CL, BK Medan. Body Kaleng, mulus H. Nego. Hub. 0813 9754 5210



Sebagai Profesional muda

Jl. Rachmadsyah No. 176 (d/h Jl. Japaris) simp Jl. Laksana 80m dari BCA (Kode: Marketing)


AVANZA, RUSH, INNOVA, FORTUNER, YARIS, VIOS, ALTIS, CAMRY, HILUX. DP 21 Jt-an. Hub. 0813 7512 7297 - (061) 7795 1428

Operator Warnet/ Rental OFFICE BOY Lamaran antar: ACC. NET Jl. Sakti Lubis No. 27

SEPEDA MOTOR HONDA Revo 2007 Dijual. Warna silver Ex cewek. Hrg. Rp. 7 Jt. Hub. 061-7660332

DIBUTUHKAN PERAWAT Laki-laki Muslim di Klinik “Spesialis Jiwa Syifak” Jl. Beringin IV No. 161 Medan Helvetia, Syarat: Fc. Ijazah Akper, Transkip Nilai, KTP

SUPRA X 125D =7,8 Jt. Kebon Coklat/ Kelapa=18x80=75Jt. (Di Marelan) 50x80=70Jt. Rumah Jl. Belawan Sp. KIM : 5 x 10=30Jt. 7x17=15Jt. 6x10: 40 Jt. 20x20: 90Jt. Tanah 6x11=11Jt. 40x60: 85 Jt. Nego: 061-9155 9824


Sofa, Jepara, K. kantor, Ganti kulit/ kain + Busa cat ulang perabotan, Murah dan garansi. NB. Tempahan sofa minimalis Hub. 7740.5997 (Anto)

Spring Bed 6 kaki 2 lapis Rp. 1.100.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun Hub Telp. (061) 661.6802 - 661.8116 - 7653 2188



BSA ( Birmingham Small Army) 350cc. Roda dua, Thn. 1952, Plat Medan, Harga Rp. 28,5 Juta Nego. Hub. 0813 7567 0005


Informasi Hub. 0812.6311.1123 (dr. Nisa)





TV, LCD, PS 1, 2, 3, Kulkas, M. Cuci, AC, Laptop, LCD Projector, Handycam, Camera. Tape Compo, Power Dll. Hub. UD. SENANG HATI: 4517509 - 77073637. Jl. Sekip 67 A





Tanpa biaya bulanan, lacak posisi mobil, matikan mesin dari HP, area blok, dengar suara dalam mobil, cocok untuk rental, Rp. 2,5Jt. Juga tersedia System Server (rekam jalur perjalanan s/d 3 bln). Garansi 1 thn. Rusak? Ganti Baru !! Hub. ELCO ELECTRONIC. 4567336 Gemilang 77399577


CPU P1V, 80 GB, 1 GB, DDR II, DVD, CASING NEW Rp. Murah. 061-7654 7788, 0812 6547 788







Jaminan Apa Saja, Sertifikat Tanah. Spd. Motor, Take Over Mobil. Hub. 061-8222774, HP. 0816 314 1807



KULKAS - M. CUCI- DISPENSER 0813 7565 6534 (061) 76355562

AC061 77972065 - 0813 6149 7921

Jaminan BPKB, Mobil, Sp. Motor, Betor dan Taksi semua tahun, Surat Tanah. syarat ringan, Proses Cepat. Hub. 061-7633 6525 -0812 6081 3010




BUTUH DANA CEPAT Cabang Baru YOGA FINANCE Jaminan BPKB: - Sepeda Motor (Kereta) - Betor (beca bermotor) - Angkot (KPUM) - Mobil Pribadi SEMUA - TAHUN Alamat: Jl. Tritura No. 10 L Titi Kuning Medan. Telp. (061) 785 3281



Pelanggan Yang Terhormat

HA TI-HA TI terhadap penipuan yang ATI-HA TI-HATI mengatas namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk membeli produk anda, TI-HA TI apabila anda ingin dan HA HATI-HA TI-HATI melakukan transaksi jual beli melalui transfer. Segala akibat yang terjadi diluar tanggujawab PT. Harian WASPADA. Apabila anda mencurigai sesuatu, silahkan hubungi kami di 061-4576602. Terimakasih

Mau Menjual Rumah, Tanah, Kendaraan, Barang Kerajinan Tangan atau Barang Dagangan Lain? Ya Tentu...Pasang Iklan di... Surat Kabar Tercinta:


WASPADA Untuk informasi lebih lengkap hub

TEL. (061) 4576602 FAX. (061) 4561347 BUNGA 0% Berhadiah BLACKBERRY TORCH atau CASH BACK 15,6 JUTA


Telp. 77677220 HP. 0813 7536 4412

REPARASI AC, KULKAS, MESIN CUCI Kompor Gas, Dispenser H & C TV, M. Pompa Air Sanyo

Hub. SURYA TEKNIK SERVICE Telp. 66482216 - 0813 7589 8757 Siap Ketempat






AC, KULKAS, MESIN CUCI B. Pasang, Instalasi, Cuci, Spare Part 061.76764660 “ 0812 6557 521


RIDWAN AHLI TV Prof. 0812 6303 4400


HILANG/TERCECER TERCECER BPKB a/n. Sofian Efendi Hasibuan. BK 6805 HV. Jl. Persatuan No. 35. No. Mesin: E402-ID-7897 43.


Surat Tanah SHM a/n. MANIPAR NAPITUPULU yang terletak Kec. Medan. Petisah Kel. Sei Putih Timur. HILANG/TERCECER

Surat Tanah Sertifikat Hak Guna Bangunan No. 1866. Tertanggal W. Maret 1988, Yang beralamat Jl. Melati. W. No. 76. Blok 10 Perumnas Helvetia Medan, An. Alm. Muhammad Saleh.


1 (Satu) Surat Perjanjian Pelepasan Hak dan Ganti Rugi An. DRS. H. BURHANUDDIN HARAHAP dengan No: 593/83/ 28/1987/3/SPPH-GR/DS/1987 dan No: 593/83/27/1927/3/SPPH DGR/DS/1987. Hilang/tercecer di Jln. Bambu Desa Helvetia Kec. Labuhan Deli. HILANG/TERCECER 1 (Satu) Lembar Surat Izin Pemakaian Tempat Berjualan Nomor: 511.3/6083/PDPKM/2001. Pasar Penampungan Jl. Bulan Medan. Stand No. 093 An. MILIYANA BR. TOBING

HILANG/TERCECER 1 (Satu) Surat Keterangan Ganti Rugi atas Tanah Kaplingan No. Surat 500.9/681/11/PJ/SKT/ 1994, Tgl. 9 Februari 1994. An. SUHARDI BSC. Terletak di Desa Pem. Johar. Labuhan Deli KEHILANGAN 1 (Satu) Berkas Surat Izin Nomor: 702, Dengan Kode: D-702, Atas nama: MASRUM KAMIN, terletak di Jalan perbatasan/Jalan Suka Murni, Kampung Suka Maju (Sekarang Kelurahan Suka Maju), Kecamatan Delitua (Sekarang Kecamatan Medan Johor), Kotamadya Medan (Sekarang Kota Medan), Propinsi Sumatera Utara, Dengan Luas Tanah +/- 795 M2, Sesuai dengan Petikan Dari Surat Keputusan Gubernur Kepala Daerah Propinsi Sumatera. Utara di Medan. Tertanggal 08 Nopember 1973, Nomor SK: 197/DA/HML/DS/1973



Hubungi Dealer



JL. JEND. G. SUBROTO 18-20 Depan Air Mancur Petisah Tel. 4522619 - 4146757 MEDAN



Pemasangan Depot Air Minum Isi Ulang paling murah Sesuai kemampuan anda 1. Depot RO 40 s/d 400 Galon/ hari 2. Depot Air Mineral/ Pegunungan 3. Jual alat-alat depot isi ulang Terima siap untuk jualan


Jl. Veteran Psr. 10 (dpn Mesjid Al-Hidayah) Helvetia Telp. (061) 685.7558 HP. 0813.7580.8866



Seorang Sopir Umur 20 - 25, Muslim, Rajin Jujur/ Bertanggung jawab Hub. BUFET HALIM Jl. AR. Hakim No. 156 Depan Gg. Pendidikan Medan Hubungi langsung dengan membawa KTP/ SIM diutamakan luar kota Telp. (061) 734.9218 Pak Salim


Tukang Jahit Syarat: Berpengalaman menjahit dengan menggunakan mesin besar (mesin Brother, Mitsubishi) Hubungi: 0852.7035.8079


Sekolah baru membthkan guru Tk min lls SMA, kreatif & suka dunia anak Hub Jl. Karya Wisata No. 23A Johor Ph. 786.1690 Medan

Pemasangan Depot Air Minum Isi Ulang Standart DEPKES

15 Jt - 35 Jt (Nego)

Air Mineral dan Sistem RO Jual alat-alat Depot Isi Ulang


Jl. Yos Sudarso Km. 15,5 No. 121 Medan RINALDI, S.Pd.I (061) 685.0456 HP. 0813.6214.3160





JL. JEND. GATOT SUBROTO NO. 325 MEDAN TELP. (061) 456.9548 - 457.3158 BURSA


Butuh tenaga kerja P/W (17 - 35 thn) untuk posisi dlm kantor, ada shift kerja Syarat: - Pendidikan min SMU/ sederajat - Bawa surat lamaran lengkap + guntingan iklan ini untuk proses interview Penghasilan: Rp. 1.800.000/ bln Hub. IBU ZULFAH/ BPK. ANDRE HP. 0812.6388.5458 / 0812.6476.6711 Alamat Kantor: Jl. Brigjen. Zein Hamid No. 221C (±10 dari Pamplet Perumahan Seroja Indah) arah Delitua Medan NB. 5 Pelamar pertama langsung di terima kerja


Seorang Staf IT yg berpengalaman, dgn keahlian: - Menguasai Hardware & Jaringan Komputer - Menguasai Perbaikan Database Visual Basic - Menguasai Pembuatan Website - Dapat bekerja dalam team Berminat: Lamaran diantar langsung ke: OFFICE GELORA PLAZA (Jam kerja) Jl. SM. Raja No. 4-A/ 18 Medan (Bu Ida)







Perempuan, MUSLIM, MENGINAP, untuk jaga anak dan kerja rumah tangga, sabar, jujur, umur max. 35 thn 2. PEGAWAI WARUNG MAKAN: Perempuan, MUSLIM, MENGINAP, bisa memasak, jujur, umur max. 35 thn Hubungi: (061) 9101.1455






Jl. Sutomo No. 436 Medan 20231 (samping Bank Maspion) Telp. (061) 452.2588 - 415.7504 - 455.7204 - 455.71494 Fax. (061) 415.7504 SUMUT - INDONESIA




Yang beralamat Jl. Prof. H.M. Yamin Gg. Belimbing No. 2D Medan Membutuhkan karyawan tetap dengan gaji perbulan 1 juta 1. Pimpinan Cabang : 2 Orang 2. Sekretaris : 2 Orang 3. Komputer (Program) : 1 Orang 4. Lapangan : 50 Orang 5. Koki : 1 Orang 6. CS : 1 Orang NB. Buka Tgl. 13 November 2010 Tutup Tanggal 19 November 2010 Pak Joko 0812.6099.2580




PERSYARATAN: 1. Umur maksimum 25 tahun 2. Laki-laki 3. Yang sudah berpengalaman menjadi operator dibidang listrik diutamakan

Lamaran, pasphoto, CV dialamatkan ke:

EMBARA PSIKO KONSULTAN Jl. Setiabudi No. 275-D Mdn Selambat-lambatnya 10 hari setelah iklan ini diterbitkan

DIBUTUHKAN Kami Perusahaan Distributor Consumer Goods yang sedang berkembang, saat ini membutuhkan tenaga profesional muda untuk mengisi posisi:


Persyaratan: Pria/ wanita, max 35 thn, pnddkn min. D3 semua jurusan pengalaman min. 2 thn, bersedai ditempatkan di sluruh area kerja perusahaan, dapat berkomunikasi dengan baik, pekerja keras dan mampu bekerja dengan target. (SS) Kirimkan langsung lamaran lengkap beserta daftar riwayat hidup ke: (Tulis kode posisi di sudut kanan atas, paling lama 14 hari sejak iklan ini terbit) HRD PT. PANCA PILAR TANGGUH Jl. Helvetia By Pass No. 16 Medan







Anda Butuh Perabot Jepara Asli?

MALIOBORO PERABOT Hubungi: Jl. Bilal No. 90 P. Brayan Medan Telephone Toko : 661.6285 Rumah : 661.1540 Fax : 661.6285 (061) Jl. K.L. Yos Sudarso depan SMA Negeri 1 Tebing Tinggi Telp. (0621) 24243



WC 0812 642 71725




WC WC 0812 60444275 PAK ADI



Jl. Gatot Subroto Medan Ada Garansi



WC TUMP TUMPAAT, Sal. AIR, K. Mandi Tel. 081361718158, 0813 6230 2458 NARO SERVICE Jl. Sisingamangaraja

Ekonomi & Bisnis

WASPADA Sabtu, 13 November 2010


BUMN Tak Paksa Bukopin Diakuisisi BRI JAKARTA (Waspada): Kementerian Badan Usaha Milik Negara (BUMN) tidak bakal memaksa jika manajemen PT Bank Bukopin Tbk enggan diakuisisi PT Bank Rakyat Indonesia Tbk. Kementerian akan menyerahkan keputusan akuisisi kepada direksi Bukopin. “Terserah Bank Bukopin saja,” kata Menteri BUMN Mustafa Abubakar di kantornya, Jalan Medan Merdeka Selatan, Jakarta, Jumat (12/11). Menurut Mustafa, masalah akuisisi Bukopin oleh BRI sepenuhnya diserahkan kepada kedua pihak karena itu merupakan bagian dari aksi korporasi perusahaan terbuka.


SONGKET PALEMBANG: Mai Suharni, 38, menyelesaikan pembuatan kain songket Palembang di Medan, Sumut, Jumat (12/11). Songket Palembang yang merupakan warisan budaya itu dijual dengan harga berkisar Rp1 juta- Rp5 juta, tergantung kehalusan dan jenis benang.

Rupiah Melemah 26 Poin JAKARTA (Antara): Nilai tukar rupiah terhadap dolar AS di pasar spot antarbank Jakarta, Jumat sore kemarin, melemah 26 poin menjadi 8.923/8.933 per dolar AS ketika aksi jual rupiah lebih gencar dibanding hari sebelumnya. Masuknya Bank Indonesia (BI) ke pasar melepas rupiah dan membeli dolar juga menekan rupiah terus terpuruk, kata Direktur Retail Banking PT Bank Mega Tbk Kostaman Thayib di Jakarta, Jumat (12/11).

Kostaman mengatakan, nilai tukar rupiah merosot 26 poin merupakan penurunan cukup tajam untuk pertama kalinya terjadi dalam bulan ini. “Kami memperkirakan rupiah akan terus terpuruk, karena faktor negatif makin kuat,” ujarnya. Menurut dia, rupiah melemah akibat penguatan dolar euro dan yen di pasar global. Menguatnya dolar karena pelaku pasar masih khawatir dengan ekonomi kawasan

Ingin Promosikan Produk Anda Harian

WASPADA Media yang Tepat untuk Iklan Anda BURSA


Informasi Pembaca Bursa Property

GR : Garasi LB : Luas Bangunan KM : Kamar Mandi LT : Luas Tanah KP : Kamar Pembantu RM : Ruang Makan KT : Kamar Tidur RT : Ruang Tamu SHM: Sertifikat Hak Milik

RUMAH Dijual, LT. 15x42,5:± 634m², SHM di Jl. Garu III No. 54 Medan, Harga Rp. 850 Jt/nego Hub. Ibu Evi HP. 0852.7601.2770

RUMAH DIJUAL Tasbi Blok VV 57, Luas Tanah 12x20m, Type 100, Kamar Utama 2 Tiap Kamar ada kmr mandi + 1 Kmr Pembantu, SHM Hub. 0813.6147.7528


Uk. 8,75x17m, SHM, Listrik, PAM Hub. (061) 736.1123/ 0813.6203.3847


Blok B/ No. 2 L. Pakam Jl. Antara - L. Pakam Type 65, Luas 8x15m, Harga Rp .150.000.000 Hub. 0812.658.5351 - 0852.9799.2108 RUMAH DIJUAL

Jl. Eka Warni Seroja No. 6 Gedung Johor Mdn, Dua lantai model Villa, Uk. 8x27m² SHM, KT 3, KM 2, Harga nego Hub. 0813.7694.9191


Rumah siap huni Jl. Danau Marsabut, Uk. 525m², SHM Hub. 0813.7039.8988


Dekat Pajak Melati Jl. Seroja/ depan Kantor Arkeologi, Siap huni, SHM, Luas 104m², Full keramik, Security 24 Jam


Harga 175/ nego Hub. 0852.9700.1251


Jl. Kapten Sumarsono Gg. Residence No. 177/ A (depan Pengadilan Agama), SHM, Tingkat 3, LT. 135m², P: 15,L: 9, Ada kolam renang, Harga 500/ nego HP. 0813.6116.3873

Ruko 3 Lt di Setia Budi Center, Full keramik, Sekat, PDAM, Genset Serius HP. 0815.306.2358 (No SMS) Jl. Perjuangan 45 No. 9 dekat Ringroad Petronas, H. 250 Jt/nego HP. 0812.603.7977


Uk. Tanah 14x23m, Harga 675 Jt/ nego, Surat Sertifikat Jl. Karya Darma T. Kuning M. Johor Hub. 0813.6153.9219 / 7700.5821


Type 50, LT. 6x18, 2 KT, 1 KM, Taman, Pagar klg Jl. Denai Ujung/ Jl. Datuk Kabu Gg. Bukori (Aspal), Utk Muslim Hub. 0812.6307.2300


Luas Tanah 8x22,5 (±170m²), Bangunan 2 Lantai, 5 KT, 4 KM, Jl. Senam/ Jawa No. 7 Medan Pasar Merah Barat Hub. 0813.9710.7557, TP RUKO HALAT 123 PERMAI

3 TKT COCOK UNTUK USAHA INTI KOTA, DP 100 JT Dijual 4 pintu ruko Jl. Senam No. 1 Simp Jl. Halat (samping Sekolah Negeri), LB. 4x16m, LT. 4x29m, Row depan 10m, Row belakang 3m, Fas. SHM, PLN, PDAM, Pintu plat besi, Cocok utk usaha, Perhotelan, Fotocopy, Praktek dokter, Kost²an, hospital, warnet, kantor NB:300meter dari Jl. Juanda dan Bandara Polonia, bisa bantu KPR, KPR per bulan 5 Jt, Harga 525 Jt, Sisa 2 unit, Full keramik, Siap huni ± 80 Jt Hub: 7772.2123 / 7759.8123 HP. 081.165.1123


Ukuran Tanah 7,5x15m², Bangunan Permanen Kramik: 7,5x15m Fasilitas: 3 Kmr Tidur, 1 Kmr Mandi Air PAM/ Listrik 900 Watt, Teras Harga Rp. 130 Jt/nego Lokasi: Jl. Puri/ Japaris Gg. Maksum Hub: 7781.7402/ 0813.6244.7000



Di Komp. Villa Jasari Manunggal, Jl. Manunggal, Tipe 50, 2 Kamar Tidur, Lantai keramik, Ada carport dan Kanopi model minimalis, Cocok untuk pasangan muda, Harga 200 Jt Hubungi 0813.9758.6670

TANAH TANAH Dijual Uk. 10x18m, Komplek Griya Aspa Khusus Muslim, Cocok untuk tempat tinggal, Hrg 65 Jt/nego (TP) Hub. 0813.9714.4473


Tanah Kaplingan, 1. Ukuran 15x20m, Status (SHM), Harga Rp. 45 Jt/nego, 2. Ukuran 7x20m, Status SK Camat, Harga Rp. 21 Jt/nego, Di Desa Aras Kabu ±3 Km dari Airport Internasional Hub. 0819.866.311


Eropa yang masih tak menentu, katanya. Pelaku pasar aktif melepas, juga karena mereka khawatir saham-saham di Wall Street akan terus melemah, karena isu bahwa China akan menaikkan suku bunga. Upaya China itu antara lain untuk menekan laju inflasi yang t e r u s m e n i n g k a t . Me s k i demikian, rupiah masih tetap memiliki peluang menguat karena pasar domestik masih menjanjikan ‘gain‘ lebih baik.

Sedangkan, BRI mengaku hanya ingin menjadi mitra Bukopin melalui mekanisme akuisisi. Usulan tersebut, ujar

JAKARTA (Antara): Direktorat Jenderal (Ditjen) Pajak Kementerian Keuangan mencatat jumlah wajib pajak (WP) yang mengajukan keberatan atas kasus pajak mencapai 6.500 kasus hingga September 2010. Kasubdit Banding dan Gugatan II Ditjen Pajak Jon Suryayuda Soedarso dalam jumpa pers di Jakarta, Jumat (12/11), mengklaim angka tersebut turun apabila dibanding tahuntahun sebelumnya. “Tren-nya turun. Pada 2008 jumlah keberatan mencapai 20.000, tahun 2009 keberatan mencapai 13.000,” ujarnya. Namun, ia tidak memaparkan berapa besar keberatan yang diajukan oleh wajib pajak orang pribadi (WPOP) ataupun keberatan yang diajukan oleh

WP badan. Ia hanya memastikan dari jumlah tersebut, kasus terbanyak berasal dari keberatan untuk Pajak Bumi dan Bangunan (PBB) “Berapa dari per kasus kita belum lihat dari situ, tapi utama-nya dari hasil pemeriksaan jenis pajaknya dari semua entah itu badan atau orang pribadi. Tapi kalau dari jenisnya ada PBB 60 persen dan sisanya yang lain-lain,” ujarnya. Dia mengatakan berdasarkan ketentuan, WP dapat mengajukan keberatan hanya kepada Ditjen Pajak atas suatu surat berdasar Pasal 25 UU KUP yaitu berdasar ketetapan pajak kurang bayar, surat ketetapan pajak kurang bayar tambahan, surat ketetapan lebih bayar dan surat ketetapan pajak nihil.

JAKARTA (Waspada): Indonesia mengusulkan kepada anggota G-20 agar sepenuhnya mengintegrasikan pembangunan ke dalam reformasi struktural guna mencapai pertumbuhan yang kuat, berkelanjutan, dan berimbang. “Kami mengusulkan isu-isu pembangunan menjadi agenda utama G-20. Ini harus menjadi prioritas penting jika ingin memiliki pertumbuhan berkelanjutan dan berimbang,” kata Presiden Susilo Bambang Yudhoyono (SBY) saat menjadi pembicara utama (leader speaker) pada Plenary Session 3 KTT G20 di Convention and Exhibition Center (COEX) Seoul, Jumat (12/11) seperti dikutip dari laman Presidensby.

Selain itu, keberatan juga dapat diajukan atas suatu pemotongan atau pemungutan oleh pihak ketiga berdasarkan ketentuan peraturan perundang-undangan perpajakan. “Dan, apabila wajib pajak berpendapat bahwa jumlah rugi, jumlah pajak, pemotongan atau pemungutan pajak tidak sebagaimana mestinya, maka WP dapat mengajukan keberatan hanya kepada Ditjen Pajak,” ujarnya. Dia menambahkan untuk kasus banding, pada periode yang sama tercatat sebanyak 2.700 kasus dan jumlahnya terus menurun. “Banding kalau pada 2008 sebanyak 3.000 banding, pada 2009 sebanyak 2.900 banding,” demikian Jon Suryayuda Soedarso.


53 Ha, Bangun Purba Desa Tarean Hub. 0811.644.380


4x24m, Jl. STM Hrg 210 Jt 6,5x20m, Jl. Bajak II Gg. Langsat Hrg 70 Jt/ SHM KPR Hub. 0812.6307.2300


1. Uk: 8x21 Harga Rp. 35 Jt (Psr. 4) 2. Uk: 11x16,5 Harga Rp. 30 Jt (Psr. 4) 3. Uk: 8x18 Harga Rp. 30 Jt (Psr. 1) 4. Uk: 8x12 Harga Rp. 25 Jt (Psr. 2) 5. Uk: 7x11,5 Harga Rp. 25 Jt (Psr. 1) 6. Uk: 6x12 Harga Rp. 18 Jt (Psr. 2) Semua Milik Pribadi (SK. Camat) MARELAN Hub: 7781.7402 - 0813.6244.7000

KAPLING MUSLIM 10x10 Rp. 12.500.000 10x12 Rp. 14.000.000 10x13 Rp. 15.000.000

Lokasi Dsn. I Aman Damai Desa Sei Semayang Kec. Sunggal (700m dari Jl. Medan Binjai - Km. 16,5) masuk dari Samping Galon Minyak, Mesjid Belok Ke kanan Tanah tinggi, Rata bebas banjir dekat Rumah penduduk cocok untuk yang kerja di Medan Hubungi: H. SALIMIK HP. 081.2601.8160 Jl. Binjai Km. 15,4 No. 7 AB Diski



Telp: 061 - 4576602 BURSA



Pada awal pandangannya, Presiden SBY mengatakan pertumbuhan yang kuat, berkelanjutan, dan seimbang kunci bagi upaya bersama dalam memerangi kemiskinan. Indonesia sendiri telah menempatkan upaya pemberantasan kemiskinan ini sebagai prioritas utama. “Tetapi kami tahu upaya nasional ini dapat lebih efektif jika bersinergi dengan upaya di tingkat global. Itulah sebabnya pengembangan kemitraan global sangat penting,” kata dia. Presiden SBY menambahkan, baik negara maju maupun negara berkembang memiliki kewajiban dan tanggung jawab masing-masing. Pertama, negara-negara maju harus menjaga pasar mereka terbuka untuk produk negara-negara berkembang, khususnya pertanian, sesuai dengan kesepakatan Putaran Doha. Kedua, negara-negara maju

harus memberikan bantuan keuangan. Ketiga, negara-negara maju harus memastikan arus keuangan yang cukup, baik melalui bantuan pengembangan luar negeri atau melalui bantuan perbankan multilateral. Keempat, negara-negara maju dapat memainkan peran dalam menjamin arus investasi asing langsung melalui kemitraan publik-privat untuk membangun infrastruktur, dan meningkatkan teknologi. Di sisi lain, negara berkembang harus terlebih dahulu menerapkan praktik tata kelola pemerintahan yang baik atau good governance. Selanjutnya, meningkatkan sumber daya manusia, menyediakan iklim kondusif bagi investasi langsung asing, serta memastikan pembangunan lingkungan berkelanjutan. “Saya percaya, jika negara maju dan berkembang memenuhi komitmen,” ujar Presiden SBY. (vvn)

2011, Bappenas Patok Kemiskinan Turun 1 Persen BANDUNG ( Waspada): Kementerian Perencanaan Pembangunan Nasional (PPN)/ Bappenas mengklaim angka kemiskinan di Indonesia 13,33 persen dari populasi penduduk 2010. Angka itu harus lebih baik pada tahun berikutnya. Lantas berapa persen target pengentasan kemiskinan diusung Kementerian PPN/ Bappenas pada 2011? Angka pengentaskan kemiskinan yang menjadi target pemerintah di kisaran 11,5-12,5 persen. Deputi Kementerian PPN/ Kepala Bappenas Bidang Kemiskinan, Ketenagakerjaan, dan Usaha Kecil Menengah, Ceppie Kurniadi Sumadilaga menjelaskan target tersebut sangat ideal untuk mengentarkan kemiskinan. “Target pengentasan kemiskinan di angka 11,5-12,5 persen. Syukur-syukur kalau bisa mencapai satu persen,” kata Ceppie

dalam acara “Temu Media 2010” di Bandung, Jumat (12/11). Ceppie membeberkan bila target tersebut tercapai maka menjadi sesuatu yang luar biasa dalam program pngentasan kemiskinan. “Pencapain pengentasan kemiskinan satu persen akan berdampak di 2014. Pada akhir kerja lima tahun, angka kemiskinan pada level 8-9 persen,” paparnya. Faktanya, pemerintah mengalami berbagai kendala dalam mengatasi kemiskinan. Kondisi ini disebabkan oleh tidak meratanya angka kemiskinan. Mengacu data Kementerian PPN/Bappenas, sebagian besar penduduk miskin tersebar di pulau Jawa yakni mencapai 57,8 persen. Pulau yang paling sedikit jumlah penduduk miskinnya yakni Kalimantan yaitu hanya 3,4 persen.(okz)







Cucu Asli Mak Erot Bersama


BILA anda ingin perkasa ingat jangan sampai salah masuk carilah yang benarbenar pewaris ilmu Mak Erot Sejati, karena keahlian H. Teja Saeful sudah tidak diragukan lagi dalam menangani keluhan seputar alat vital bahkan pengobatan H. Teja Saeful, sudah terkenal Indonesia dan kota-kota besar di Indonesia, sudah ribuan pasien tertolong dipengobatan Mak Erot ini yang aman tanpa efek samping, bahkan dimanca negara sekalipun pengobatan Mak ERot sudah tidak diragukan lagi keberhasilannya. INGAT untuk Kaum Pria janga nsampai Anda terhina Kaum wanita karena kondisi alat vital yang kurang sempurna Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041 KONSULTASI UMUM: KHUSUS PRIA: - Buka Aura - Ejakulasi dini - Cari Jodoh - Impotensi - Sesama jenis - Memperbesar “Alvit” - Pelaris - Memperpanjang “Alvit” - Memikat lawan jenis - Keras dan tahan lama dll - Besar PYDR KHUSUS WANITA: - Ingin punya keturunan - Memperkencang & memperbesar payudara - Mengobati keputihan dll

DIJAMIN 100% Hanya Tempat Kami Klinik Mak Erot

FORUM KOMUNIKASI & PENYEMBUHAN ALTERNATIF INDONESIA SPECIAL MENANGANI PROBLEM ASMARA & RUMAH TANGGA - Gendam Asmaradhana (Solusi Kilat) izin depkes: 448/15830 Problem Asmara & Rumah tangga Izin Kejati: 13270/DSP5.08 - Gendam Pedothish (pemutusan hubuBuka setiap hari kerja ngan asmara & Perselingkuhan PIL & WIL) - Puter Giling (Menarik/ memanggil orang yg minggat/ kabur), Suami, Istri atau pacar dalam waktu singkat, Insya Allah akan kembali dengan cepat - Penyembuhan segala macam penyakit medis - non medis “BERGARANSI” (kutukan, keturunan, bawaan & guna²) BISA JARAK - Pelaris jual tanah, rumah, toko, restoran, dll JAUH Alamat: Jl. Puri (± 300m dari RM. Famili, Jl. SM. Raja) No. 57F Medan Telp. (061) 7678.1087/ 0813.7040.5888





NO. POM. TR. 873635522


Terapi keperkasaan seksualitas Pria hasil permanen tanpa efek samping, alami, bebas pantangan, untuk semua usia Hasil langsung reaksi ditempat, cukup satu kali berobat



Panjang: 13, 14, 15, 16, 17, 18, 19, 20 cm Besar: 3,5. 4,5. 5. 5,5. 6 diameter Memperkeras, Tahan lama Ejakulasi dini, Mani encer Impotensi, Lemah syahwat Diabetes, kencing manis/ batu

Juga melayani problem asmara, mempercepat jodoh, pengasihan, penglaris, buka aura, pasang susuk, dll ALAMAT KELINIK TETAP: Jl. SM. Raja Masuk ke Jl. Utama No. 18 Medan Dari Toko Roti Majestik ±100meter Izin Kejaksaan: B/DSP.5/12/2008 Izin Dinkes: No. 448/0649/I/2008 HP. 0812.6388.7999 Buka setiap hari

Dpt Diperoleh di Sumatera - Aceh Hub: (061) 7365429 - 7362887





secara langsung menambah posisi CAR perseroan yang saat ini berada pada kisaran 12 persen. (vvn)


Jl. Laksana No. 55J masuk dari Jl. Amaliun Yuki Simpang Raya Medan (Praktek Tetap) HP. 0812.4038.333

Pasang Iklan “WASPADA”

Glen, dianggap manajemen Bukopin tidak sesuai dengan keinginan perusahaan. Menurut dia, akuisisi tidak

Pertumbuhan Berkelanjutan Jadi Prioritas

Ditjen Pajak Catat 6.500 Keberatan

Uk. 10x30m, Terletak di Jl. Tempuling Simp. Tombak Huk Hub. 0852.7545.9343 Tanah Sertifikat Hak Milik di Jl. Perjuangan Gg. Darso dekat RingRoad Setiabudi Uk. 15x23m Hub. 0812.656.8058

Namun, bila tidak jadi masuk ke Bukopin, Mustafa mengatakan BUMN masih memiliki kesempatan untuk menjadi mitra bank yang fokus di bisnis kredit mikro tersebut. Sebab, saat ini, PT Jamsostek sudah menjadi mitra dari anak perusahaan Bukopin yaitu di PT Bank Bukopin Syariah. Selain itu, Bukopin berencana menggelar penawaran terbatas saham atau rights issue, sehingga aksi korporasi itu bisa diserap oleh Jamsostek. Seperti diketahui, Direktur Utama Bukopin, Glen Glenardi, memberikan persyaratan untuk perusahaan yang ingin menjadi mitranya, yakni mempunyai kesamaan visi dan keinginan. Selain itu, Bukopin menginginkan agar rasio kecukupan modal (capital adequacy ratio/ CAR) perusahaan ke depan bisa ditingkatkan di antaranya dengan menambah modal melalui rights issue maupun penerbitan obligasi subordinasi (subdebt).

Jangan Lewatkan Interaktif langsung dengan PASAK BUMI di DELI TV Setiap Sabtu Malam Pkl. 22.30 Wib (Live)

Call Center: 0818 090 73481

Kami memberi bukti bukan janji, alat vital besar dan panjang ditempat, no suntik, no silikon dan bukan bahan kimia, murni tradisional, ramuan alami dan Do’a, dijamin paten dan permanen tanpa ada efek samping bebas pantangan. Untuk semua usia, ras dan agama



Untuk Pria: Besar dan panjang disesuaikan dengan ukuran yang di inginkan, dijamin joss, menjadikan alat vital keras, kuat, tahan lama, menyembuhkan impotensi, ejakulasi dini, lemah syahwat, lemah karena diabetes dan mengatasi ereksi, loyo dan kurang gairah, kembali perkasa menangani bekas suntik/ silikon, mani encer, plek cur, mati total, spilis, mandul, ingin punya keturunan, dan menangani yang gagal ditempat lain. Untuk Wanita: (Bisa berdarah lagi) menghilangkan keputihan becek, bau tidak sedap, ingin mencengkram, wangi. Buktikan disini (Bergaransi)

HP. 0812.8481.8889


REKOR BISNIS: Irwan Hidayat (tengah) saat menerima rekor bisnis.

Sido Muncul Raih Penghargaan Rekor Bisnis JAKARTA (Waspada): Bertempat di Hotel Mulia, Jakarta, Rabu (3/11) Sido Muncul mendapat penghargaan Rekor Bisnis untuk dua rekor sekaligus dari Tera Foundation bekerjasama dengan Harian Seputar Indonesia. Dua rekor yang diterima Sido Muncul yaitu sebagai “Perusahaan Penyedia Layanan Mudik Lebaran Terbanyak dan Terlama untuk para Stakeholdernya” dan “Perusahaan Jamu Tradisional Pertama yang mendapatkan sertifikat CPOTB (Cara Pembuatan Obat Tradisional yang Baik) dan CPOB (Cara Pembuatan Obat yang Baik) setara dengan Perusahaan Farmasi”. Penghargaan diserahkan oleh Indra Kurnia Direktur TERA Foundation dan Marigold Maitimoe Deputy Director of Sales and Marketing SINDO dan diterima oleh Irwan Hidayat, Direktur Utama PT Sido Muncul. Rekor Bisnis (ReBi) merupakan pengakuan terhadap perusahaan-perusahaan terkemuka di Indonesia atas prestasi yang berhasil diraih di kategori bisnis masing-masing. Prestasi yang mendapat pengakuan dari ReBi adalah suatu prestasi yang mencerminkan keunggulan nyata diatas rata-rata industri, atau istilahnya yang “Ter” dan segala sesuatu yang bersifat superior.

Selain itu juga perusahaanperusahaan yang mempelopori terciptanya suatu jenis produk maupun layanan. Penghargaan yang diterima Sido Muncul pada kategori “Perusahaan Penyedia Layanan Mudik Lebaran Terbanyak dan Terlama untuk para Stakeholdernya” merupakan bentuk apresiasi apa yang telah dilakukan oleh Sido Muncul selama ini dalam menyelenggarakan kegiatan Mudik Gratis bersama Pedagang Jamu se-Jabotabek. Sementara penghargaan yang diterima sebagai “Perusahaan Jamu Tradisional Pertama yang mendapatkan sertifikat CPOTB (Cara Pembuatan Obat Tradisional yang Baik) dan CPOB (Cara Pembuatan Obat yang Baik) setara dengan Perusahaan Farmasi”, sertifikat tersebut telah diterima PT Sido Muncul pada tahun 2000 saat peresmian pabrik PT Sido Muncul di Jl Soekarno Hatta KM 28, Klepu – Semarang oleh Menkes RI, Sujudi saat itu. “Penghargaan ini memberikan motivasi tersendiri bagi Sido Muncul untuk melakukan hal yang lebih baik lagi kedepannya dalam segala hal baik dari segi produknya maupun kinerjanya” ujar Irwan Hidayat, direktur utama Sido Muncul pada kesempatan tersebut.(rel)

Ekonomi & Bisnis


WASPADA Sabtu 13 November 2010

Armin Nasution


Redaktur Ekonomi

Kedatangan Obama SAYA sebenarnya tidak memilih topik ini untuk dijadikan analisis pekan ini. Sebab ada yang lebih menarik dari itu. Seperti hasil survei pelayanan publik di Medan yang diungkap Fakultas Ekonomi USU, kemudian ada hasil survei indeks persepsi korupsi daerah-daerah di Indonesia. Namun karena topik Obama pasti akan terlewatkan pekan depan ada baiknya melihat dampak kunjungan kepala negara adikuasa tersebut ke Indonesia. Pekan ini presiden yang paling mempengaruhi dunia itu berkunjung ke Indonesia. Paket kunjungannya kali ini tidak saja Indonesia tapi juga Korsel, Jepang dan India. Tiga negara yang saat ini sedang mengalami pertumbuhan ekonomi cukup baik. Di tengah kedatangan itu tentu saja euforia mengemuka. Ada yang bilang Presiden AS sekarang sudah lebih dekat dengan komunitas muslim. Lalu ada pula respon kedatangan Barack Obama akan mempengaruhi perekonomian Indonesia. Di tengah itu tentu saja ada pula aksi-aksi teatrikal yang menolak kedatangannya. Sampai kemudian kehadirannya ke Indonesia seolah menegaskan kalau dia tak lupa dengan negara yang ikut membesarkannya. Saya fikir ini terlalu sentimentil dan cengeng. Tidak sampai seperti itu dampak kedatangan Obama. Presiden AS, tetaplah presiden Amerika. Tak berganti jadi orang yang melankolis atau berkunjung tanpa kepentingan. Pasti saja kunjungan Obama ketiga negara lain punya kepentingan baik secara ekonomi dan politis. Apalagi di negara-negara yang dikunjunginya punya hubungan dagang dengan AS. Sementara Indonesia sebenarnya hanya karena jumlah penduduk yang besar namun secara ekonomi masih jauh dibanding negara yang dikunjunginya sekarang. Memang saat berpidato di Istana Negara Obama sempat bilang tidak ingin menjadi partner ketiga dalam bisnis. Dia ingin Indonesia menjadi partner dagang nomor satu. Tapi itu kan berproses. Bukan serta merta begitu dia datang ekonomi Indonesia langsung membaik. Dari kunjungan Obama sebenarnya kita bisa menyimpulkan untuk ekonomi tidak ada formula yang bisa mendorong pertumbuhan di dalam negeri. Itu sifatnya kunjungan kenegaraan biasa. Apalagi dia tidak membawa tim teknis yang membidangi ekonomi. Jadi kalau kedatangan Obama akan mendorong ekspor atau menggerakkan ekonomi lebih kencang saya tidak

yakin. Apalagi yang menjadi kekhawatiran AS selama ini adalah China yang turut menguasai perdagangan dunia. Bukan Indonesia yang iklim bisnisnya pun masih berbiaya tinggi. Saat berada di Sun Plaza mengikuti pameran komputer Kamis (11/11), saya bersama praktisi ekonomi Vincent Wijaya. Kecenderungannya pun menunjukkan kalau dia tidak setuju kedatangan Obama akan membawa perubahan banyak hal. Ditinjau dari perekonomian AS saja sejak kepemimpinan Obama negara itu menghadapi berbagai ancaman. Terutama jumlah pengangguran yang sudah semakin tinggi. Ancaman kredit macet di sektor perumahan pun cukup berat. Bahkan inflasi yang sangat ditakuti ikut mendorong ekonomi Amerika ke pola yang lebih buruk. Untuk mengatasi kondisi ekonomi di negaranya yang semakin buruk Obama pun sudah mengisyaratkan tambahan dana stimulus tahap kedua. Padahal nantinya pertambahan dana ini hanya akan membebani ekonomi AS. Tapi beginilah ya, harusnya kita tidak perlu berharap terlalu banyak dengan kedatangan Obama akan membawa perubahan terhadap ekonomi Indonesia. Sebab dia saja pun sudah pusing memikirkan masalah ekonomi negaranya. Sebagai presiden negara super power dia hanya menyelesaikan banyak masalah yang sekarang melilit negara tersebut. Jadi bagaimana mungkin dia harus memikirkan ekonomi negara ini. Namun begitupun seperti dituturkan banyak kalangan bukan tidak ada untungnya dia ke Indonesia. Yang pertama tentu saja para penjual bakso, kerupuk dan nasi goreng yang disantapnya akan terkenal ke berbagai belahan dunia. Ini promosi gratis buat para tukang bakso dan penjual nasi goreng ke dunia. Kedua tentu saja ada sedikit imej yang melekat kalau selama ini Indonesia kurang aman akan terbantahkan. Buktinya Obama sebagai orang yang paling banyak dapat ancaman di dunia berani datang ke Indonesia. Paling tidak Indonesia sudah memiliki sitem pengamanan yang baik dan menjadi citra positif di mata internasional. Berharap kedatangan Obama akan membawa ekonomi Indonesia tidak ada salahnya. Namanya harapan dan siapa pun boleh berharap agar setidaknya ekonomi Indonesia bisa setara dengan China dan India yang sekarang sedang bagus-bagusnya.


HEWAN QURBAN : Anwar (50) memberi makan hewan qurban di Jalan Karya Jaya Medan, Jumat (12/11). Menjelang Lebaran Haji penjualan hewan qurban meningkat hingga 75 persen. harga Sapi mulai dari Rp.7 juta hingga Rp 14 juta per ekor, berbeda dengan harga Kambing mulai dari Rp.1 juta hingga Rp.3 juta per ekor

Vietnam Kirim 11.315 Ton Beras Ke Sumut MEDAN (Waspada): Vietnam mengirim 11.315 ton beras hasil pertanian rakyatnya ke Sumatera Utara dalam rangka memenuhi pesanan pemerintah pusat untuk memenuhi stok beras dalam negeri.

Waspada/Armin Nasution

HADIAH: M. Adil (dua kanan) saat menyerahkan hadiah kepada pemenang undian BNI Taplus.

Dana Murah BNI Medan Capai 69 persen MEDAN (Waspada): Bank Negara Indonesia (BNI) Kantor Wilayah Medan terus meningkatkan porsi dana murah dalam perolehan dana pihak ketiga (DPK). Perluasan layanan mesin anjungan tunai mandiri (ATM) menjadi salah satu cara untuk meningkatkan porsi dana murah dalam dari total DPK bank tersebut. Pemimpin BNI KantorWilayah Medan M Adil mengatakan dari sekitar Rp9 triliun DPK BNI Wilayah Medan saat ini, sekitar 69 persen di antaranya (Rp6,21 triliun) berupa dana murah dalam bentuk simpanan tabungan dan giro. “Sisanya sekitar 31 persen merupakan simpanan deposito. Kita sampai saat ini terus meningkatkan porsi dana murah, baik tabungan maupun giro pada total DPK kita,” jelasnya kepada wartawan disela-sela penyerahan hadiah Undian Rezeki BNI Taplus Periode II dan III, di Medan, Senin lalu. Adil mengatakan, secara year on year, hingga Oktober

2010, simpanan tabungan dan giro di BNI Kantor Wilayah Medan tumbuh 18 persen dibandingkan periode yang sama tahun sebelumnya. Sementara perolehan DPK telah tumbuh 16 persen per Oktober 2010 dibandingkan periode yang sama tahun sebelumnya. Hingga akhir tahun ini, total perolehan DPK ditargetkan dapat mencapai Rp9,5 triliun. Selain melalui penyelenggaraan undian rezeki BNI Taplus, peningkatan dana murah juga dilakukan dengan memperbanyak mesin ATM di wilayah kerja BNI yang meliputi Sumut-NAD tersebut. Hingga saat ini, pihaknya telah menambah 70 mesin ATM baru hingga total mesin yang dimiliki mencapai 298 mesin ATM. “Dalam waktu dekat kita juga akan mengaktifkan beberapa mesin setor tunai. Kemudian membuka beberapa BNI week end banking di berbagai tempat . Kita harapkan upaya ini dapat memenuhi pencapaian target DPK,” tegasnya.

Dalam acara tersebut, BNI menyerahkan satu unit mobil mewah Toyota Alphard kepada pemenang undian rezeki BNI Taplus periode II 2010 yakni HM Affan Daud yang merupakan pensiunan pegawai PT Kereta Api Indonesia (KAI). Affan Daud dalam sambutannya, mengaku tidak menyangka jika dirinya berhasil memenangkan hadiah grand prize tersebut. Nasabah yang telah menabung di BNI selama 24 tahun ini sangat bersyukur dapat memperoleh hadiah mobil yang nilainya ratusan juta tersebut. Pada kesempatan itu juga diserahkan tiga unit skutik Honda Scoopy kepada pemenang Undian Rezeki BNI Taplus Periode III tahun 2010. Penyerahan hadiah tersebut juga disaksikan Wakil Pemimpin Kantor Wilayah Medan Imam Ansory dan Hendrik Poluan, Kepala BNI Cabang Utama Medan Munazar dan jajaran BNI Kantor Wilayah Medan.(m13)

Penerbangan Murah Kian Diminati Penumpang JAKARTA (Waspada): Pasar penerbangan berbiaya rendah (low cost carrier/LCC) di Asia Pasifik dan Indonesia tumbuh pesat melebihi angka pertumbuhan dunia. Pertumbuhan itu seiring kondisi makro ekonomi Asia Pasifik yang juga berkembang pesat. Direktur Kelaikan Udara dan Pengoperasian Pesawat Udara Direktorat Perhubungan Udara, Yurlis Hasibuan, menjelaskan pada 2010 jumlah penumpang pesawat terbang di Indonesia mencapai 48 juta

orang per tahun, atau diperkirakan naik 17 persen. “Pertumbuhan penumpang sejalan dengan perkembangan maskapai di Indonesia,” kata Yurlis di Jakarta, Jumat (12/11). Dari pertumbuhan 17 persen tersebut, sekitar 14 persen di antaranya dikuasai maskapai penerbangan berbiaya rendah (LCC). Sementara itu, tiga persen sisanya diambil oleh legacy airlines seperti PT Garuda Indonesia. Pertumbuhan itu disebabkan oleh daya beli masyarakat Indonesia yang masih berkutat

di penerbangan berbiaya rendah. “Masyarakat biasanya lebih memilih LCC, sedangkan pebisnis jarang. Penumpang terbanyak dipegang Lion Air, mencapai 20 juta per tahun,” katanya. Sementara itu, Country Director Frost & Sullivan untuk Indonesia, EugeneVan deWeerd menyatakan, jumlah penumpang pesawat berbiaya rendah diharapkan meningkat dari 116 juta orang pada 2008 menjadi 217 juta penumpang selama 2012. Tingkat rata-rata pertumbuhan per tahun sebesar 16,9 persen. (vvn)

Belasan ribu beras impor dari negara Paman Sam itu diangkut dengan dua kapal berbendera asing KM Van Don mengangkut 5.315 ton dan MV Golden Rice mengangkut 6.000 ton. Kedua kapal ini masuk ke Pelabuhan Belawan secara bergantian sejak Jumat (5/11) dan terakhir, Kamis (11/11). Berdasarkan data kunjungan kapal di Pusat Pelayanan Satu Atap (PPSA) PT Pelabuhan Indonesia I (Persero) Belawan, kapal pengangkut beras kebutuhan masyarakat ini akan melakukan pembongkaran muatan hingga Rabu (17/11). Seluruh bongkaran ini disimpan di gudang Bulog tersebar di beberapa daerah di Medan. Data di Ketahanan Pangan Nasional menjelaskan stok beras di seluruh daerah termasuk di Badan Urusan Logistik (Bu-

log) Divre Sumatera Utara saat ini bergantung dengan kedatangan beras impor, setelah target pengadaan beras nasional tahun ini tidak tercapai akibat terjadinya perubahan musim. Kementrian Pertanian atas nama pemerintah tidak punya pilihan lain kecuali menyetujui pengimporan beras hingga akhir tahun ini untuk menambah cadangan beras nasional. Berdasarkan realisasinya pemerintah akan mengimpor beras sebanyak 300.000 ton seluruhnya dari Vietnam yang saat ini merupakan negara penghasil beras terbesar di dunia. Dari ratusan ribu ton beras impor telah disetujui selanjutnya akan dibagi bagikan kepada seluruh tanah air. Sementara Sumatera Utara mendapat jatah beras impor sebanyak 45.000 ton. Humas Bulog Divre Sumut Rusli membenarkan pemerintah telah membagi bagikan impor beras dari yang disetujui sebanyak 300.000 ton. Dari jumlah itu Sumut mendapatkan 45.000 ton. Dengan jumlah sebanyak ini Sumut untuk sementara tidak lagi mendatangkan beras dari dalam negeri yang selama ini seluruhnya diperoleh dari Jawa, karena jumlah itu sudah mencukupi.(m35)

Masyarakat Kurang Dilibatkan Pacu Ekonomi LHOKSEUMAWE ( Waspada): Dalam bidang ekonomi, hampir tidak ada peran serta masyarakat, melainkan yang lebih menonjol keterlibatan lembaga swadaya masyarakat, baik asing maupun lokal. Hal itu dipandang, apa yang menjadi aspirasi masyarakat tidak dapat terpenuhi, sehingga pergerakan ekonomi rakyat hampir tidak kelihatan. Malahan apa yang dilakukan pemerintah terhadap peningkatan kesejahteraan masyarakat hampir tidak terlihat sama sekali masa damai dan sesudah bencana air raya. Pertumbuhan ekonomi di kalangan rakyat Aceh masih sangat jauh dari harapan, hal ini berkaitan dengan kebijakan pemerintah yang masih gamang dan tidak memahami masalah yang dihadapi masyarakat, demikian ungkap Ihsan, pemerhati ekonomi Aceh dalam Majelis Rabuan yang diselenggarakan Aceh Peace Consultative Management (APCM) di kedai kopi Ulee Kareng Delima, Rabu (10/11). Ihsan yang juga dosen Ekonomi Unimal Lhokseumawe, menjelaskan lebih lanjut apa yang dilakukan pemerintah Aceh terhadap pembangunan ekonomi yang bersentuhan langsung dengan rakyat boleh dikatakan belum berhasil. Hal ini berkaitan dengan data statistik bahwa kemiskinan masih berada di angka 60 persen.

Sementara pemerhati sosial Kamaruddin Hasan menilai, apa yang menjadi aspirasi masyarakat tidak sepenuhnya disuarakan wakil rakyat, malah beberapa kebijakan legeslatif dapat menganggu perdamaian Aceh, semisal pembentukan Qanun Gampong yang tidak dipercepat. Selain itu, dalam proses pembentukan qanun itu tidak melibatkan peranserta dari unsur-unsur masyarakat yang layak dan berhak. “Bisa jadi apa sudah dibentuk itu tidak akan diterima, dan apabila menimbulkan kericuhan di kemudian hari, maka harus segera direvisi dan ditinjau ulang,” katanya. Sebetulnya, banyak kebijakan lahir dari kampung-kampung, seharusnya diterima oleh pemegang otoritas semisal dewan, yang kemudian dijalankan sebagai kebijakan publik. Namun, aspirasi-aspirasi ini juga tidak tersampaikan karena masyarakat sendiri kurang aktif. Perihal itu terjadi bukan saja berkaitan dengan masalah struktural, melainkan juga dipicu oleh soal kultural, di mana masyarakat sendiri seperti enggan melibatkan diri. Untuk itu perlu adanya peran aktif dewan untuk terjun ke dalam masyarakat, bukannya malah melancong ke luar negeri atau pun pergi pesiar dan pelesiran ke kota-kota lain yang tak ada kaitannya dengan peningkatan ekonomi rakyat Aceh.(b12)

Dampak Perang Mata Uang Masih Teratasi PALU (Antara): Penguatan rupiah terhadap dolar AS yang masih dalam batas normal dibanding dengan negera-negera berkembang lainnya membuat Indonesia belum terlalu merasakan dampak dari perang mata uang terjadi saat ini. Gubernur Bank Indonesia Darmin Nasution di Palu, Jumat (12/11), mengatakan ada dua hal dilakukan dalam menghadapi situasi perang mata uang, yakni menjaga penguatan rupiah tidak terlalu cepat dan mempersiapkan langkah antisipasi jika terjadi arus balik modal asing. Menurut Darmin, masa pemulihan ekonom negaranegara berkembang lebih cepat dibanding negara-negara maju, pemicu terjadinya perang mata uanng. Tingkat suku bunga di negara-negara berkembang lebih tinggi mengakibat terjadinya pelarian modal dari negaranegara maju. Aliran modal ini kemudian membuat nilai tukar mata uang negera-negara berkembang menguat namun dipihak lain menimbulkan kekhawatiran negara-negara maju sebab melemahkan daya saing mereka dalam perdagangan terutama ekspor. “Akibatnya mereka (negara maju) mulai menjaga diri dengan melakukan intervensi dan kebijakan-kebijakan aneh yang justru memperburuk situasi perekonomian global,”katanya katanya. Lebih lanjut Darmin mengatakan nilai tukar rupiah terhadap dolar AS sejak Januari hanya menguat 5,5 persen, masih lebih rendah dibanding penguatan mata uang Malaysia dan Thailand sebesar 11 persen, serta Jepang 14 persen. “Artinya penguatan rupiah

tersebut masih cukup aman bagi Indonesia,” ujarnya. Selanjutnya, kata dia, bank sentral akan memupuk cadangan devisa lebih banyak yang dapat digunakan setiap saat jika terjadi pelarian modal asingasing secara tiba-tiba. “Kedua strategi ini yang tengah dilakukan saat ini dalam menghadapi situasi perang mata uang,”tambahnya. Darmin menilai solusi terbaik keluar dari situasi perang mata uang ini membangun konsesus inter-nasional, namun ia pesimis hal itu dapat tercapai dalam waktu dekat ini. Pasar tunggal Sementara itu perbankan di wilayah ASEAN menyepakati perlunya harmonisasi berbagai hal menjelang berlakunya pasar tunggal ASEAN 2015. “Secara esensi masing-masing negara mulai mempersiapkan diri berkaitan dengan pasar tunggal 2015,” kata Ketua Umum Perbanas Sigit Pramono dalam jumpa pers usai penutupan Pertemuan Dewan Perbankan ASEAN ke-40 di Nusa Dua Bali, Jumat (12/11). Hadir dalam kesempatan itu Ketua Panitia Pelaksana Pertemuan Dewan Perbankan ASEAN ke-40 Abdul Rachman, Sekjen Perbanas Farid Rahman, dan Sekjen Asosiasi Perbankan ASEAN (ABA), Teh-Kwok Chui Lian. Menurut Sigit, harmonisasi berbagai hal, terutama peraturan, mendesak dilakukan karena hingga saat ini masih terdapat kesenjangan besar di antara negara-negara ASEAN. Mengenai integrasi mata uang, Sigit mengatakan, hal itu merupakan langkah terakhir akan dilakukan terkait dengan integrasi pasar ASEAN.

“Terkait integrasi mata uang memang belum ada kesepakatan karena masih ada gap yang besar, mungkin akan diberlakukan secara bertahap untuk beberapa negara saja dulu,” katanya. Namun terkait dengan harmonisasi peraturan, akan dilakukan upaya harmonisasi sebelum memasuki pasar bersama ASEAN. “Karena itu siap tidak siap, semua harus siap karena 10 kepala negara sudah menandatangani kesepakatan pasar bersama itu,” kata Sigit. Sementara itu Sekjen Perbanas, Farid Rahman mencontohkan, kesenjangan dalam pengaturan perbankan di antara negara-negara ASEAN misalnya dalam penetapan batas minimum modal bank. Farid menyebutkan, modal minimum pendirian bank di Singapura sebesar 100 juta dolar Singapura, di Myanmar 30 juta dolar AS, Kamboja 37 dolar AS, Laos 35 juta dolar AS, dan Malaysia 300 juta RM. Menurut dia, ketentuan pembukaan bank asing di suatu negara juga berbeda dengan negara lain. Misalnya di Indonesia, pihak asing bisa menguasai saham hingga 99 persen, di Laos 100 persen, dan Malaysia sekitar 25 persen. “Dalam kondisi pasar bersama harus ada treatment yang sama atau resiprokal. Kalau bank-bank asing bisa membuka dengan mudah di sini maka bank di Indonesia seharusnya bisa dengan mudah di negara lainnya,” katanya. Menurut dia, hal lain yang mungkin perlu harmonisasi menyangkut SDM perbankan. Saat ini fit and proper test terhadap pengurus bank masih menjadi otoritas masingmasing negara.

Harga Barang Diharapkan Tak Naik Jelang Idhul Adha BIREUEN ( Waspada): Naiknya harga beberapa jenis mata barang di Bireuen, seperti minyak goreng (migor) curah diharapkan hanya naik sementara, dan segera diturunkan kembali sebagaimana harga semula menjelang Idul Adha ini. “Kondisi ekonomi masyarakat sekarang sangat sulit, mudah-mudahan naiknya harga beberapa jenis barang kebutuhan dalam waktu dekat ini tidak berlangsung lama dan barang kebutuhan lainnnya tidak mengikutinya,” harap warga. Menurut keterangan diperoleh Waspada, Rabu (10/11) harga beberapa jenis barang kebutuhan berangsur-angsur sudah naik, sehingga warga

khawatir menjelang Idul Adha naiknya dua kali lipat sehingga warga tidak sanggup membelinya. “Sekarang harga minyak goreng curah sudah melonjak tajam, informasinya karena kurangnya pasokan dari Medan. Mudah-mudahan tidak lama terjadi dan kita harap menjelang lebaran nanti harga barang kebutuan tetap sttabil atau normal,” harap Ismail, warga Kota Bireuen kepada Waspada. Disebutkan minyak goreng curah sebelumnya masih dijual pedagang Rp9.500 per kilogram (kg) kini mencapai Rp10.500 per kg. “Kami pedagang terpaksa menaikkan harga migor sekarang ini karena harga tebusnya Rp9.200 per kg, sedangkan

sebelumnya tidak sampai seperti itu, dan yang perlu diketahui bila pasokannya tersendat dapat dipastikan migor itu stoknya tidak mencukupi untuk kebutuhan hari raya, “ kata seorang pedagang secara terpisah kemarin (11/11). Sementara itu harga barang kebutuhan lain di pasar Bireuen masih tetap dan stabil, kecuali barang kebutuhan sayur-sayuran yang naik harganya.” Harga sayuran sekarang naik karena barangnya kurang dan kami dengar juga sekarang ini sayur dari Aceh di pasok ke Medan makanya harganya mahal dan barangnya juga kurang,” kata Syarifah seorang pedagang sayur di Bireuen. (amh)

Waspada, Sabtu 13 November 2010  

Waspada daily

Waspada, Sabtu 13 November 2010  

Waspada daily
