Page 1

Harga Eceran Rp2.500,-

AirAsia Sponsor Utama ‘Bali Beach Run’ JAKARTA (Waspada): AirAsia Indonesia menjadi sponsor utama ‘Bali Beach Run’ yang diadakan di sepanjang Pantai Kuta, Bali, Minggu, 24 November 2013. Bernard Francis, Direktur Komersial AirAsia Indonesia, mengatakan perusahaan bangga dapat menjadi pendukung utama dari acara lari di pantai terbesar di Indonesia itu. Bernard menuturkan partisipasi AirAsia Indonesia

Lanjut ke hal A2 kol. 6

Demi Kebenaran Dan Keadilan

Jaga Persatuan Umat


JAKARTA (Antara): Imam Besar Masjid Istiqlal Ali Mustafa Yaqub mengharapkan persatuan umat Islam yang lebih erat lagi terlebih memasuki hari-hari Tahun Baru Islam 1435 Hijriah. “Mudah-mudahan umat Islam bertambah lebih baik lagi,” kata Ali saat dihubungi dari Jakarta, Selasa (5/11). Umat Islam rentan terhadap upaya beberapa pihak yang ingin memecah belah persatuan. Berbagai unsur pemecah belah sangat bervariasi dan semakin menantang. Beberapa tahun terakhir, umat Islam Lanjut ke hal A2 kol. 5

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

RABU, Wage, 6 November 2013/2 Muharram 1435 H

No: 24392 Tahun Ke-67

Terbit 24 Halaman

Sinabung Muntah Awan Panas NAMANTERAN (Waspada): Letusan Gunung Sinabung, Selasa(5/11) sekira pukul 14:23, memuntahkan awan panas (wedhus gembel) berdurasi selama 20 menit. Tinggi abu vulkanik mencapai 3.000 meter dari kawah, dan terbawa angin ke barat daya. Suara gemuruh terdengar sampai Simpang Empat dari Naman Teran Kab. Karo berjarak 8,5 kilometer dan status Siaga (level III). Armen Putra dari Pusat Vulkanologi dan Mitigasi Bencana Geologi (PVMBG) Badan Geologi yang memantau dari Posko BNPB Kec. Simpang Empat melihat awan panas meluncur dari lereng sejauh 1 kilometer ke arah tenggara. Peristiwa itu, perta-

ma kali awan panas keluar dari kawah,sejak Sinabung meletus September 2013. “Tidak ada korban jiwa terkait ke luarnya wedhus gembel dari kepundan Sinabung, karena masyarakat telah mengungsi,” kata Armen Putra kepada Waspada. Dikatakan Armen, meski aktivitas Sinabung masih sangat tinggi, status tetap Siaga (level III). Warga diminta menjauh atau mengungsi dari radius 3 kilometer terutama

BESITANG ( Waspada): Sukarwan, pengusaha dari “kota dodol” Tanjungpura, Kab. Langkat kehilangan uang kontan Rp 50 juta akibat dirampok kawanan bersenjata api di Jalinsum Medan-Aceh kawasan S eusirah, Desa Bukitselamat, Kec. Besitang, Senin (4/11) malam. Informasi diperoleh dari korban Selasa (5/11), malam itu ia dalam perjalanan dari Aceh menuju Medan. Setiba di Jalinsum Seusirah, truk yang ditumpanginya diselip satu

Lanjut ke hal A2 kol. 2

Gubsu: Umat Islam Harus Menjadi Garda Terdepan MEDAN (Waspada): Momentum Tahun Baru Islam 1 Muharram 1435 Hijriah yang jatuh Selasa (5/11), diharapkan menjadi momen, bertekad membuat sebuah deklarasi bersama umat Islam untuk menjadi yang terdepan menyerukan serta melakukan kebaikan di negara Indonesia. Hal itu disampaikan Gubsu H Gatot Pujo Nugroho, saat mengikuti muzakarah khusus menyambut 1 Muharram 1435 Hijriyah yang digelar Majelis Ulama Indonesia (MUI) Provinsi Sumatera Utara di Gedung MUI Provinsi Sumut, Selasa (5/11). “ Saya harapkan , kami tidak berhenti sekedar sebuah

Pengusaha Tanjungpura Dirampok OTK Bersenpi

muzakarah, tetapi hendaklah ada sebuah tekad atau deklarasi bersama. Jika saat pertemuan APEC , kita punya deklarasi untuk Sumut, juga saat Hari Ketahanan Pangan di Bukittinggi, kita punya komitmen deklarasi Bukittinggi untuk ketahan pangan, alangkah indahnya jika hari ini kita membuat deklarasi bersama umat Islam harus tampil di garda terdepan mewujudkan semua kebaikan di negeri yang kita cintai ini,” kata Gubsu. Menurut Gubsu, sampai saat ini kondisi umat masih memperihatinkan. Terlihat masih banyaknya fenomena

Lanjut ke hal A2 kol. 1

Al Bayan

Politik Dinasti Oleh Tgk. H. Ameer Hamzah Demi kekuasaan manusia akan berbuat apa saja, menghalalkan segala cara, kecuali mereka yang mengetahui hakikat kehidupan. Saya tidak terlalu ambisi sebab kekuasaan itu wajib dipertanggungjawabkan kelak. (Muawiyah Tsani bin Yaziz). ISTILAH dinasti menjadi popular di Indonesia ketika terungkap bahwa di Provinsi Banten sangat banyak famili Gubernur Ratu Atut Khamsiah menggenggam berbagai jabatan penting, sejak dari suami, mertua tiri, adik-adik dan sejumlah sepupunya juga menjadi pejabat daerah.

Lanjut ke hal A2 kol. 2

mobil minibus, kemudian diperintahkan berhenti. Setelah berhenti, dua pria turun dari mobil, menghampiri korban.Salah seorang menodongkan senjata mirip pistol dan mengaku aparat.Pria berpistol itu menuduh korban membawa ganja. Saat bersamaan, salah seorang dari kawanan tersebut merampas tas milik korban yang berisi uang tunai Rp50 juta termasuk kunci kontak truk. Lanjut ke hal A2 kol. 5

Ketua DPD-I KNPI Aceh Jamaluddin, ST GUNUNG Sinabung kembali erupsi Selasa (5/11) siang, mengeluarkan awan panas (wedhus gembel).

Waspada/Micki Maliki

Polisi Buron Seorang Ribuan WNI Overstays Penyiram Air Keras Mogok Duduk Di Saudi MEDAN (Waspada): Reskrim Unit Jahtanras Polresta Medan memburu seorang lagi pelaku penyiraman air keras yang mengakibatkan Amelia Sembiring, bocah berusia 7 tahun tewas. “ Kita sudah melakukan pencarian ke tempat yang diduga menjadi persembunyian pelaku namun belum ditemukan,” kata Kasat Reskrim Kompol Jean Calvijn Simanjuntak, Selasa (5/11).

Dijelaskan, pelaku yang buron berperan membantu EG saat penyiraman air keras. Identitasnya sudah kita ketahui,” katanya dan menjelaskan, kondisi tersangka EG yang terkena percikan air keras yang disiramkannya ke arah Harmoko Sembiring, ayah Amelia Sembiring, masih menjalani perawatan di RS Bhayangkara.

Lanjut ke hal A2 kol. 2

JEDDAH, Arab Saudi ( Waspada): Ribuan Warga Negara Indonesia, yang gagal mendapatkan statusnya di Arab Saudi pada masa periode amnesti, mogok duduk di salah satu jalanan paling sibuk di Jeddah untuk menuntut repatriasi. Kerumunan WNI itu, kebanyakan terdiri dari kaum perempuan, mulai berkumpul di persimpangan antara Pangeran Majed Street dan Palestine

Street yang berseberangan dengan Al-Baik pada pukul 11:00 Minggu malam. Menjelang Senin (5/11) pagi, jumlah mereka makin membengkak sampai mencapai ribuan orang ketika sejumlah WNI lainnya mulai berdatangan dari seluruh bagian kerajaan padang pasir itu. “Kami telah berusaha selama beberapa minggu

Lanjut ke hal A2 kol. 6

KNPI Siap Cegah Disintegrasi Bangsa Di Aceh BANDA ACEH (Waspada): KNPI Aceh siap di garda depan untuk mencegah terjadinya disintegrasi bangsa di daerah ini, tegas ketua Umum DPDI KNPI Aceh, Jamaluddin, ST (foto). Jamaluddin menyampaikan itu terkait dilaksanakannya program “Merajut Indonesia” dihadiri wakil pemuda seluruh Indonesia dibawah naungan KNPI dan dibuka oleh Menteri Olah Raga, Roy Suryo, di Pulau Weh, Sabang Selasa,(5/11). Besarnya peran pemuda dalam mencegah perpecahan bangsa, menurut Jamal, hen-

daknya menjadi perhatian pemerintah pusat. “Kita mohon pemuda Aceh harus lebih diberdayakan,”pintanya. Pemerintah pusat harus lebih serius memberikan dorongan lewat berbagai program dan memberikan kesempatan seluasnya untuk mengembangkan diri sehingga para pemuda di Aceh bisa lebih mandiri untuk menghidupi kehidupan dirinya dan keluarga. Pasca konflik dan tsunami, banyak sekali pemuda di daerah ini yang membutuhkan

Lanjut ke hal A2 kol. 6

Ada-ada Saja

Masalah Messi, Komitmen Kaka

Kontes Kecantikan Ayam JIKA umumnya kontes kecantikan diikuti oleh para

Lanjut ke hal A2 kol. 5

BANYAK sekali sisi menarik pertemuan kembali Barcelona dengan AC Milan di Grup H Liga Champions, yang turut ditayangkan langsung SCTV dinihari nanti mulai pkl 02:45 WIB. El Barca tetap pada habitatnya sebagai penguasa La Liga, sebaliknya Milan galau karena terus terpuruk di Seri A. Tapi dari sisi itu pula, memancar fenomena menarik dari figur bintang masing-masing kubu, yang mengerucut pada Lionel Messi dan Ricardo Kaka. Kedua sosok dimaksud, kebetulan menjadi penentu pada jumpa pertama Milan-Barca yang berakhir 1-1 di Stadion San Siro, 22 Oktober lalu. Kaka yang memberikan assist bagi gol Robinho menit 9, Messi mencetak gol penyeimbang menit 23. Tetapi tidak seperti biasanya, Messi malah kurang punya andil membawa El Blaugrana tetap memuncaki klasemen La Liga. La Pulga alias Si Kutu, tidak menyumbang gol dalam empat laga terakhir El Catalan melawan Osasuna (0-0), Real Madrid (2-1), Celta Vigo (3-0), dan Espanyol (1-0). Lanjut ke hal A2 kol. 6

Serampang - Sabar kam kerina...! - He...he...he... Design/Marwan

Berita Utama


WASPADA Rabu 6 November 2013

Sering Dimarahi, Adik Bunuh Abang

Waspada/Amir Syarifuddin

GUBSU H Gatot Pujo Nugroho saat memberi sambutan pada muzakarrah menyambut 1 Muharram 1435 Hijriyah di Gedung MUI Sumut, Selasa (5/11).

Gubsu: Umat Islam .... asusila di kalangan pelajar, maraknya penggunaan narkoba serta pelanggaran-pelanggaran norma agama dan norma susila lainnya. “Fenomena ini harus menjadi catatan dan segera kita carikan solusinya,” ujar Gubsu dan menambahkan, m o m e n t u m Ta h u n Ba r u Hijriyah harus diiringi resolusi bersama untuk memperbaiki kondisi umat. ‘’ Problema dakwah terkini bukan sekadar problem ekonomi dan politik tapi semua problem di tengah-tengah umat. Menjadi tantangan

Kloter 13 Tiba

untuk kita memperbaiki bersama kondisi umat agar kembali mengikuti nilai-nilai yang diajarkan Nabi Muhammad SAW dan perintah Allah SWT .Mari kita gencarkan dakwah,’’ kata Gubsu. Sedangkan, Ketua Dewan Pimpinan Majelis Ulama Indonesia (MUI) Sumatera Utara Prof Dr H Abdullah Syah, MA mengimbau umat Islam untuk memperkuat ukhwah Islamiyah membangun bangsa. 1 Muharam, lanjutnya, adalah momen penting karena Nabi Muhammad meraih keberhasilan dalam dakwahnya pada bulan Muharram.

Dirut PLN Tak Pantas Terima Penghargaan Anti Korupsi

MEDAN (Waspada): Sebanyak 439 jamaah haji Kloter 13 Debarkasi Medan, tiba di Kualanamu International Airport (KNIA), pukul 17: 25, Selasa (5/11) sore. Namun, saat jamaah akan menuju Asrama Haji Madinatul Hajj, bus 07 mengalami kerusakan. Hal ini dibenarkan Kabid pemberangkatan dan pemulangan H Bahrum Saleh MA. “ Ya, ada bus yang rusak saat akan pemulangan jamaah. Tetapi dalam waktu 40 menit, langsung digantikan bus cadangan. Sehingga tidak ada masalah dan jamaah tiba di Asrama Haji Madinatul Hajj usai magrib,” kata Bahrum Saleh. Ia menyebutkan akan dilakukan evaluasi terhadap bus pembawa jamaah haji. Kloter 13 yang semuanya asal Medan menyampaikan terimakasi kepada Pemko Medan yang memberikan fasilitas pada jamaah. (m37/m40/h02/m50)

M E D A N ( Wa s p a d a ) : Peng-hargaan anti korupsi yang diterima Dirut PT PLN Nur Pamudji, terus ditanggapi miring oleh warga Sumut. Karena salah satu kriteria pemberian penghargaan adalah tokoh yang telah mampu secara tegas melawan korupsi dan membawa jajarannya dalam institusi untuk tidak terlibat korupsi. ‘’Kalau kriterianya itu, jelas tidak pantas. Karena faktanya, saat ini saja di Sumut, masih ada aparat PLN yang diproses hukum karena diduga korupsi,’’ kata Wakil Ketua DPRD Sumut Sigit Pramono Asri, Selasa (5/11). Waspada meminta tanggapan Sigit Pramono Asri, dalam

kapasitasnya sebagai perwakilan masyarakat Sumut yang duduk di lembaga legislatif. ‘’Penghargaan yang diterima itu sangat tidak sesuai dengan kondisi yang dialami masyarakat Sumut saat ini. Pelayanan PLN masih sangat buruk, yang salah satu penyebabnya diduga karena prilaku korupsi oknum-oknum PLN,’’ kata Sigit Pramono. Tapi, katanya, terserah kepada Dirut PT PLN Nur Pamudji, bila bersedia menerima penghargaan anti korupsi tersebut. Karena itu diberikan oleh suatu lembaga. Terlebih, bila lembaga pemberi penghargaan itu menilai pribadi Nur Pamudji, sebelum dia menjadi Dirut PT PLN.

Namun, kalau penghargaan itu diberikan dalam kapasitasnya sebagai Dirut PT PLN, menurut Sigit Pramono, sangat tidak relevan. Apalagi salah satu kriterianya, tokoh tersebut telah mampu membawa jajaran dan institusinya untuk tidak terlibat korupsi. ‘’Ini jelas tidak relevan,’’ katanya. ‘’Kalau acuannya hanya karena progam Dirut ‘PLN No Suap’, itu sangat sederhana sekali. Karena seluruh instansi dan lembaga juga programnya seperti itu,’’ katanya. Atau, kata Sigit, lembaga pemberi penghargaan tidak melihat masalah listrik secara keseluruhan (seluruh Indonesia). Lembaga itu hanya melihat kondisi listrik di Pulau Jawa dan

Sinabung Muntah ....

388 jiwa berasal dari Desa Bekerah 152 jiwa dan Desa Simacem 236 jiwa,” ungkapnya. Warga Resah Pantauan Waspada, hingga saat ini ribuan pengungsi resah karena Sinabung yang mempunyai temperatur tepat di Lau Kawar Kec. Naman Teran terus aktif. “Bagaimanalah nasib kami ini, terus dihantui letusan Gunung Sinabung hampir setiap hari selalu kambuh. Sementara kami meninggalkan kerja berladang, serta hewan ternak kami tinggal tanpa ada yang mengurus,” kata Josef Ketaren,56, warga Mardinding di posko pengungsian Jambur Pekan Tiga Nderket. Josep Ketaren, didampinggi Geges, 42, warga yang sama. Bahkan, kata Ketaren, makanan dari dapur umum menunya siap saji dari makanan kaleng, tanpa ada sayur mayur. Erupsi Sinabung tidak membuat surut wisatawan lokal berkunjung ke daerah wisata Berastagi yang berjarak sekitar 15 kilometer dari Sinabung. Bahkan, pada liburan I Muharam 1435 H Selasa (5/ 11), wisatawan tidak terpenga-

ruh dengan erupsi Sinabung. Para wisatawan asyik menikmati alam yang diapit dua gunung aktif, Sinabung dan Sibayak. “Kami sekeluarga sudah tahu stuasi Sinabung dari informasi media. Namun, tidak berbahaya dan tidak mengganggu kawasan gundaling Berastagi,’’ kata Putri dan Tina asal Binjai kepada Waspada. Dikatakan Tina, kedatangan mereka ke Berastagi ingin melihat erupsi Sinabung bila terjadi dan disaksikan langsung. Tidak hanya melihat melalui media massa. ‘’Seperti hari ini, kami melihat langsung,’’ kata Tina. Informasi diperoleh Waspada, sebelum Sinabung erupsi mengeluarkan wedhus gembel,Selasa(4/ 11), Erupsi juga terjadi pada Senin (4/11) pukul19.17, dengan letusan berdurasi 34 menit. Sedangkan kondisi Sinabung pada Selasa sore, terlihat tertutup kabut, abu vulkanik mengarah ke barat serta baratdaya. Seismisitas 18 kali gempa vulkanik dalam, 15 kali gempa low frequency, 27 kali gempa hembusan, 3 kali gempa hybrid dan tremor vulkanik menerus. (c19/c10)

ke Medan, kemudian dirawat di RS Bhayangkara. Kapolresta Medan Kombes Pol Nico Afinta Karokaro, SIK, SH, MH didamping Kasat Reskrim Kompol Jean Calvijn Simanjuntak dan Kapolsek Patumbak AKP Andiko saat ekspos di Polresta Medan Minggu (3/11) mengatakan, EG ditangkap di tempat persembunyiannya di kawasan Pekanbaru pada Jumat pekan lalu. Motif dendam Menurut Kapolresta, motif penyiraman air keras yang dilakukan EG terhadap Harmoko Sembiring, berlatar bela-

kang dendam karena pada September 2013, Harmoko Sembiring ayah korban menganiaya suami tersangka yang bernama Harianto. Namun, tidak dijelaskan, bagaimana kondisi Harianto saat itu. Namun, dalam menjalankan aksi, tersangka dibantu seorang pria yang menunggu di mobil. Amelia Sembiring tewas setelah sempat menjalani perawatan di RSU H Adam Malik Medan karena terkena cairan air keras yang disiramkan tersangka EG ke arah ayahnya Harmoko Sembiring, Rabu (30/10) malam di di rumah korban. (m39)

(sukuisme), tetapi mana bedanya dengan wajah demokrasi yang berbalut ketidakjujuran, suap menyuap, tindakan anarkis bila kelompoknya kalah, dan mengkultus darah biru meski tidak berkualitas. Demokrasi semacam itu adalah wajah baru diktatorisme. Demokrasi sejati adalah bermusyawarah untuk menghasilkan pemimpin yang berkualitas. Prof Dr Muhammad Yusuf Qardhawi dalam bukunya “Fiqh Siasah” melihat demokrat sejati adalah Rasulullah SAW. Baginda Nabi tidak pernah menunjuk salah seorang sahabatnya untuk menjadi kepala negara Madinah. Kalaupun kemudian Abubakar Shiddiq yang terpilih, itu

bukan diwariskan oleh Rasulullah melainkan hasil musyawarah para shahabat di Balai Shaqifah Bani Saidah. Abubakar terpilih karena kualitasnya bukan karena uang dan ashabiyahnya. Muawiyah Tsani bin Yaziz bin Muawiyah bin Abi Sufyan menolak jabatan Khalifah setelah mangkat ayahnya Khalifah Yaziz bin Muawiyah karena dia melihat; politik dinasti yang dirancang kakeknya tidak sesuai prinsipprinsip Islam. Jabatan dia diambil alih oleh sepupunya Marwan bin Hakam yang juga sangat kejam dalam menumpas kaum ahlul bait dan Bani Abbas. Dia memimpin bersama dinastinya dengan tangan besi.

3. Mc5+ atau

dari empat desa yakni Desa Sukameriah, Simacem, Bekerah dan Mardinding. Menurut Armen, erupsi masih berpotensi terjadi, dan abu letusannya dapat mengganggu kesehatan, serta merusak tanaman di area terdampak. Bahkan, pada masa musim hujan beberapa hari terakhir, masyarakat yang bermukim dekat sungai sungai yang berhulu di puncak Sinabung seperti di Desa Sukameriah sampai dengan Desa Bekerah, Desa Kutagugung dan Desa Sigarang garang agar tetap waspada terhadap ancaman bahaya lahar dingin. Sementara itu, Camat Pa y u n g To n i S e m b i r i n g kepada Waspada mengatakan, sampai saat ini, kebutuhan logistik masih mencukupi. Masa tanggap darurat selama 7 hari berakhir sampai Sabtu. “Jumlah pengungsi saat ini 1.681 jiwa, tersebar di empat titik seperti di Jambur (Los)Pekan Tiga Nderket dari Desa Mardinding 891 jiwa. GBKP Payung 292 jiwa berasal dari Desa Suka Meriah, Kec. Payung, dan Masjid Payung 110 jiwa. Jambur Naman Teran

2. ...., Rg5.

Polisi Buron ....

3. Mg6+ akan

“Masih dirawat di rumah sakit dan kondisinya mulai membaik,” katanya. Seperti diberitakan, Reskrim Polresta Medan menangkap tersangka penyiraman air keras yang mengakibatkan tewasnya Amelia Sembiring bocah berusia 7, warga Dusun VI Desa Patumbak Kampung, Perumahan Graha Pesona Amplas, Patumbak ,Deliserdang di Pekanbaru Provinsi Riau, Jumat (1/11). Tersangka EG, 31, warga Patumbak ditangkap gabungan Polresta Medan dan Polsek Patumbak dan dibawa

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Gd7+, Rf4 (terpaksa). 2. Md6+, Re4 (amankan Mg1). 3. Mg6+, MxM (terpaksa). 4. h5xM. Putih menang karena laju promosi pion Putih tak tertahan lagi, sedangkan laju c3 dapat ditahan dengan G-b5. (Jika 2. ....., Re3.

membantai Mg1) Jawaban TTS: TTS


Al Bayan ....

Jawaban Sudoku:

4 9 1 7 3 6 5 2 8

8 7 5 2 1 9 3 4 6

2 3 6 4 5 8 9 7 1

5 8 7 6 4 3 1 9 2

3 1 9 5 2 7 6 8 4

6 4 2 8 9 1 7 3 5

7 6 4 3 8 5 2 1 9

Menurut Abdullah, memasuki tahun baru harus dijadikan awal menghindari segala bentuk perpecahan, permusuhan, saling fitnah dan merendahkan atau menjatuhkan saudaranya. Muzakarah menghadirkan nara sumber DR Ir Masri Sitanggang, MP, Prof Dr Ramli Abdul Wahid. Hadir Ketua Tim Penggerak PKK Sumut Hj Sutias Handayani Gatot Pujo Nugroho, Plt Asisten III Pemprovsu Arsyad Lubis, Ketua dan pengurus MUI dari kabupaten dan kota se-Provinsi Sumut, alim ulama dan para tokoh agama se-Sumut. (m28)

TAPAKTUAN (Waspada): Seorang warga Gampong Lawe Cimanok, Kec. Kluet Timur, Aceh Selatan, ES, 25, tega membunuh abang kandungnya, Hasyimi, 40, hanya karena merasa jengkel akibat sering dimarahi. Insiden itu terjadi Minggu (3/11) malam di kawasan kebun kakao milik mereka di daerah pedalaman Kluet Timur. Jasad korban ditemukan Senin (4/11) sekira pukul 13:00 , setelah ada laporan warga ke polisi. Kapolres Aceh Selatan AKBP Sigit Jatmiko yang dihubungi, Selasa (5/11) melalui Kasat Reskrim AKP Agung Gima Sunarya mengatakan, pihaknya telah menangkap pelaku dan menyita barang bukti sebilah parang dan topi berlumuran darah. Informasi Waspada peroleh, kasus adik bunuh abang yang tinggal serumah itu terungkap, setelah keluarga yang kehilangan melapor ke Polsek Kluet Timur di Payadapur. Saat bersamaan , warga setempat, Zainal, 30, juga melaporkan penemuan sesosok mayat pria yang belum diketahui identitasnya di areal persawahan. Selanjutnya, aparat Reskrim Polres Aceh Selatan turun ke TKP, setelah menerima laporan Polsek Kluet Timur. Di TKP, selain menemukan jasad korban dan menangkap pelaku, polisi menemukan karung berisi topi berlumuran darah. Kasat Reskrim menyebutkan dari pengakuan pelaku kepada polisi, ia merasa jengkel akibat sering dimarahi korban. Kasus itu berawal saat korban membuat pondok di kebunnya dan mencoba meminjam gergaji milik pelaku. Tetapi tidak diberi oleh pelaku.Korban marah dan membentaknya. Sesat kemudian, pelaku membacok abangnya hingga korban tewas di tempat dengan luka di bagian tangan dan leher. Setelah tewas, pelaku menyeret jasad abangnya ke pinggir sawah, 20 meter dari TKP. “Dalam proses pemeriksaan, pelaku agak susah berbicara karena masih trauma,” ujar Agung. (b30)

9 5 8 1 7 2 4 6 3

1 2 3 9 6 4 8 5 7

Lalu bagaimana pandangan Islam? Islam tidak menentukan bentuk apa negara itu ditetapkan? Apakah bentuk kekhalifahan seperti sejak awal Islam, bentuk kerajaan, republik, atau bentuk lainnya. Terserah kepada bangsa-bangsa tersebut. Tetapi Islam sangat mementingkan musyawarah, menekankan keadilan, kesejahteraan rakyatnya. Islam juga sangat mengharapkan agar sebuah Negara wajib memberi ruang yang seluas-luasnya kepada syariat Islam. Ada orang berpendapat dinasti itu tidak sesuai dengan Islam karena di sana terjadi koneksi, nepotisme, korupsi, kultus individu, ashabiyah

Bali saja. ‘’Kalau seperti itu, saya tidak tau. Mungkin, kalau kondisi listrik di (Pulau) Jawa dan Bali sudah sangat baik. Tapi tidak di Sumut,’’ katanya. Kata Sigit, sejak dia menjadi anggota DPRD Sumut tahun 1999, masalah listrik ini terus menjadi pembahasan tapi belum juga dapat dituntaskan.(m12)

Pengusaha .... “Pelaku ketika itu menuduh saya membawa ganja. Salah seorang diantaranya menodongkan benda mirip pistol. Saya tidak tahu, apakah itu senjata api benaran atau tidak.Tapi tidak ada tembakan,’’ kata Sukarwan via selularnya. Setelah berhasil, para pelaku masuk ke mobil dan kabur. Korban bersama sopir melaporkan peristiwa tersebut ke Mapolsek Besitang. Kapolsek Besitang AKP Biston Situmorang, yang dikonfirmasi Waspada melalui selularnya mengatakan, pihaknya belum berhasil mengidentifikasi para pelaku. ’’ Saat ini saya bersama Kanit Reskrim Aiptu M. Ginting dan anggota sedang berada di Kualasimpang melacak para pelaku,” ujarnya. (a02)

Pererat Persatuan .... memiliki berbagai pandangan yang berbeda dalam menyikapi berbagai persoalan umat salah satunya tentang Jamaah Ahmadiyah. Selain itu, Ali berharap umat Islam yang mampu secara harta tidak hanya mementingkan dirinya sendiri. Seperti mereka yang sering kali beribadah haji tetapi lingkungan di sekitarnya masih berada dalam kemiskinan yang parah. Perlu adanya refleksi diri bagi setiap individu. “Jika selama ini banyak ibadah yang berorientasi kepada hal-hal individu maka ubahlah ke arah ibadah sosial sebagaimana Nabi Muhammad SAW telah mencontohkan,” katanya. Pa d a b a g i a n l a i n , A l i mengatakan dalam rangka memperingati hari Tahun Baru Islam 1435 Hijriah Masjid Istiqlal melaksanakan kegiatan refleksi diri bersama Menteri Agama Suryadhama Ali,digelar Selasa pagi.

Ada-ada Saja .... peserta wanita, namun lain halnya bagi para petani di Arab Saudi dan sejumlah negaranegara Teluk.Belum lama ini, mereka mengadakan kontes kecantikan ayam. Kontes ini bertujuan untuk memilih ayam tercantik keturunan Arab. Kontes yang berlangsung pada Jumat lalu itu merupakan kontes kedua yang diadakan dalam waktu kurang dari sebulan. Selain itu, para penonton kontes berjumlah lebih dari 500 orang, juga menghadiri acara lelang yang diadakan penyelenggara di ibukota Riyadh, dihadiri lebih dari 500 orang. Koran Sabq tidak menuliskan berapa harga ayam yang dilelang di acara itu. Namun mereka mencatat bahwa ada seekor ayam yang mampu terjual dengan harga 7.500 riyal pada lelang pertama di bulan Oktober. Selain ayam, Arab Saudi pernah menyelenggarakan kontes kecantikan untuk hewan lain jenis kuda, unta dan, domba. (rzl/emr)


MEDALI DARI MALAKA: Wagubsu HT Erry Nuradi menerima medali dari Ketua Menteri Malaka Datuk Seri Idris Bin Haron dalam acara Konvensi Dunia Melayu Dunia Islam (DMDI) ke-14 di Malaka, Senin (28/10), disaksikan Presiden DMDI Datuk Seri H Mohd Ali Bin Mohd Rustam (3 dari kiri). Medali juga diterima Gubernur Aceh Zaini Abdullah (2 dari kiri), Wagub Riau dan Wakil Menteri Kamboja.

Wagubsu Terima Anugerah Tun Perak MEDAN (Waspada): Wagubsu HT Erry Nuradi menerima anugerah berupa medali dari Ketua Menteri Malaka Datuk Seri Idris Bin Haron dalam acara Konvensi Dunia Melayu Dunia Islam (DMDI) ke-14 di Malaka, Senin (28/10). Kepada Waspada Selasa (5/11), Wagubsu HT Erry Nura-

Masalah Messi .... Pa c e k l i k g o l b o m b e r Argentina berumur 26 tahun itu, dianggap sebagai masalah serius bagi kalangan eksternal El Catalan. La Messiah masih mengoleksi 8 gol dari 12 laga liga, minus lima gol di bawah Cr istiano Ronaldo (Real Madrid) dan Diego Costa (Atletico Madrid). Hanya saja entrenador Barca Gerardo ‘Tata’ Martino tetap yakin, sang mesin gol bakal berkibar lagi dengan mengambil momentum kunjungan balasan Milan di Camp Nou. Alasannya, permainan Rossoneri lebih terbuka, beda dengan rivalrival domestik El Blaugrana.

Ribuan WNI .... paspor dan dokumen lainnya yang asli, yang tidak kami miliki,” kata salah seorang pekerja yang tak ingin disebutkan namanya kepada Arab News. Ribuan pria, wanita dan anak-anak menghabiskan harinya tanpa tidur di bawah jembatan jalan layang. Para pejabat Indonesia, pasukan keamanan, polisi lalulintas dan tim Departemen Paspor tiba di tempat itu dan polisi segera menutup Palestine Road dari lampu rambu lalulintas sampai ke stasiun bahan bakar di pojokan Sahafa Street. (an/m10)

di mengatakan medali yang diterimanya tersebut yakni Anugerah Tun Perak yang merupakan bentuk atau simbol perhatian terhadap perkembangan Dunia Melayu Dunia Islam. Presiden DMDI Datuk Seri H Mohd Ali Bin Mohd Rustam didampingi Ketua Tim Penilai

Anugerah Tun Perak Datuk H Mohd Jamil Mukmin yang juga Wakil Presiden DMDI Malaka mengatakan, penganugerahan Tun Perak juga diberikan Gubernur Aceh Zaini Abdullah, Wakil Perdana Menteri Kamboja Datuk Okhna Othman Hassan dan Wakil Gubernur Riau Drs HR Bambang Mit. (m46)

“Sangat sulit melawan tim yang menempatkan lima pemain di depan empat bek. Dia (Messi) senang mencetak dua, tiga atau empat gol di setiap partai. Dia telah membuat standar tinggi, sehingga saat dia tidak mencetak gol, itu seperti masalah serius,” tutur Tata melalui Marca, Selasa (5/11). “Tidak ada yang salah dengan Messi. Dia berlatih dengan bagus dan sangat kuat. Messi selalu menjadi pemain ambisius yang ingin mencetak banyak gol. Dia baik-baik saja dan gol akan datang dari pemain terbaik dunia,” timpal winger Pedro Rodriguez kepada Soccerway. Messi memang memudar saat Neymar da Silva dan Alexis Sanchez menggeliat untuk mempertahankan status Los Cules sebagai penguasa sepakbola Spanyol, plus pemimpin klasemen Grup H. Kontras sekali dengan Kaka, yang justru bersinar lagi ketika Milan sedang terpuruk. Gelandang veteran Brazil berusia 31 tahun itu seperti hidup lagi pasca mudik ke San Siro, setelah menghabiskan empat musim menyedihkan di Madrid. Kemilau serta komitmen Kaka seolah mendinginkan berbagai serangan yang mesti-

nya dialamatkan kepada allenatore Massimiliano Allegri, yang belum mampu mengembalikan habitat Il Diavolo sebagai raksasa Italia dan Eropa. “Kami akan ke luar dari masa-masa gelap ini. Jika kami percaya diri, maka itu bisa dilakukan. Saya tidak ingin membuat komitmen lainnya,” klaim Kaka kepada SportMediaset. Bintang yang telah menikmati banyak sukses pada periode pertamanya bersama Rossoneri itu malah mencanangkan kebangkitan itu dimulai dari Camp Nou. Dia akan mewujudkan itu dengan cara memanjakan lini depan Milan, yang diisi Robinho dan Mario Balotelli. “Gol dan assist akan menjadi faktor penting, namun keinginan untuk menang dari grup ini jauh lebih penting. Kebangkitan kami akan dimulai saat melawan Barcelona. Pada pertemuan pertama, kami sudah menunjukkan bisa bersaing dengan salah satu tim terbaik dunia,” pungkas Kaka. Klasemen Grup H Barcelona 3 2 1 0 6-1 7 AC Milan 3 1 2 0 4-2 5 Celtic 3 1 0 2 2-4 3 Ajax 3 0 1 2 2-7 1

KNPI Siap Cegah .... kesempatan untuk diberdayakan. “Tanpa dukungan pemerintah, pemuda Aceh akan kalah bersaing dalam menapaki masa depan lebih baik.” Pu n d e m i k i a n , Ja m a l mengingatkan agar pemuda di Aceh tidak lagi membudayakan berlama-lama duduk di warung kopi. “Pada usia muda mari kita kembangkan kreatifitas apa saja, jangan cuma berpangku tangan dan membuang waktu tanpa ada manfaatnya.” Menurut dia, jika pemuda sudah memiliki kegiatan sesuai dengan profesi masing masing, Insyah Allah hal yang tidak diinginkan tidak terjadi. Seperti, terjerat narkoba, pencurian dan berbagai kegiatan negatif lainnya. Potensi dan peran pemuda di Aceh, lanjut Jamal, sangat sentral karena selalu berada di depan. Ambil contoh, untuk kegiatan khanduri di kampung-kampung di Aceh, selalu diberi peran sesuai kapasitasnya. Artinya, keberadaan pemuda, tidak kecuali di tingkat akar rumput tetap dicari dan

AirAsia Sponsor .... dalam ‘Bali Beach Run’ merefleksikan komitmen perusahaan dalam mendukung dunia olah raga. “Lari telah menjadi olah raga yang cukup digemari oleh sebagian besar masyarakat dewasa ini. Diperkirakan sebanyak 1.500 pelari akan berpartisasi di acara ‘Bali Beach Run’ sehingga acara ini akan menjadi acara lari di pantai terbesar di Indonesia. AirAsia sangat dekat dengan dunia olah raga karena adanya kesamaan nilai-nilai yang menyerupai brand value AirAsia seperti fun, sportivitas, dan kebersamaan,” ujar Bernard. ‘Bali Beach Run’ menjadi acara berskala internasional dimana pesertanya selain berasal dari Indonesia juga datang dari beberapa negara sahabat seperti Singapura, Malaysia, Thailand, dan Australia. Bagi masyarakat yang berminat untuk mengikuti ajang ini bisa mendaftar secara

*Jonny Ramadhan Silalahi

sangat dibutuhkan. “Karena itu, pemerintah harus bisa memaksimalkan peran pemuda jauh lebih baik lagi,” katanya. Dalam konteks Aceh, sebut Jamal, peran pemuda sangat penting dalam mempertahankan perdamaian yang abadi sebagaimana yang menjadi dambaan semua pihak. Minim Sarana Kantor Lebih jauh Ketua KNPI Aceh ini minta kepada Menpora, agar kegiatan kepemudaan, wawasan nusantara, termasuk fasilitas dan sarana penunjang kegiatan kepemudaan seperti gedung kantor

di Kab/kota hingga kini masih minim, agar tidak luput dari perhatikan pemerintah. Hal ini, katanya, sangat ironis, dimana pemuda khususnya dibawah naungan KNPI sudah sangat aktif. Namun, untuk tempat mereka berhimpun (gedung kantor) dan berdiskusi masih belum memadai. “Harapan kita, hal ini bisa menjadi perhatian pemerintah dan bisa dibantu dari Kemenpora,” pintanya. Usai dua hari melaksanakan rapat Kerja KNPI se Aceh, sesuai agenda, Rabu (6/ 11) hari ini), pengurus DPDI KNPI Aceh periode 2013 s/ d 2016 akan dilantik oleh Ketua Umum DPP KNPI, Topan Eko Nugroho dan dihadiri Menpora, Roy Suryo di Anjong Mon Mata, Banda Aceh. Dari sekitar 120 personalia DPD-I KNPI Aceh yang dilantik, sebut Jamal, sebagian diantaranya direkrut dari mantan kombatan GAM. “Semua unsur pemuda terwakili dalam struktur baru kepengurusan DPD-I KNPI Periode 2013-2016 ini,” demikian Jamaluddin ST. (b01)

online di atau langsung mendatangi boothpendaftaran yang tersedia di Kuta Beachwalk lantai 1, Bali, sampai dengan 10 November 2013. Biaya pendaftaran untuk acara ini sebesar Rp 200.000 untuk jarak 5 km dan Rp 250.000 untuk jarak 10 km. Setiap peserta yang mendaftar dan mengikuti acara ini akan mendapatkan racepack eksklusif. Guna mengakomodir peserta dari Jakarta, Bandung, Yogyakarta, Surabaya dan Makassar, AirAsia memberikan penawaran harga spesial mulai Rp. 199.000,-*sekali jalan ke Bali untuk periode pemesanan mulai hari ini sampai dengan 3 November 2013, dan periode perjalanan mulai hari ini sampai dengan 31 Januari 2014. “Kami berharap seluruh pelanggan yang telah berencana terbang menuju Bali untuk mengikuti ‘Bali Beach Run’ tidak melewatkan kesempatan istimewa ini karena

ketersediaan penawaran harga spesial ini terbatas,” tambah Bernard. Penawaran kursi promo menyambut ‘Bali Beach Run’ ini dapat diperoleh di seluruh saluran penjualan AirAsia seperti http://www.airasia. com/, call centernasional kami di 021-29270999, kantor penjualan AirAsia maupun biro perjalanan terdekat. Guna mendapatkan kenyamanan dan keamanan ekstra saat melakukan perjalanan AirAsia Indonesia juga menawarkan layanan asuransi inovatif yaitu AirAsia INSURE. Hanya dengan membayar mulai dari Rp 19.000,-, para penumpang akan terlindungi dan mendapatkan berbagai manfaat seperti kompensasi atas keterlambatan penerbangan. AirAsia INSURE menawarkan two hours ontime guarantee, dimana penumpang yang mengalami keterlambatan lebih dari 2 jam akan menerima kompensasi sebesar Rp 600.000. (rel/m11)

Jamaluddin ST

Medan Metropolitan

WASPADA Rabu 6 November 2013


Umat Islam Wajib Konsumsi Produk Berlabel Halal Anggota Komisi VIII DPR RI Kunjungi Toko Roti Aroma MEDAN (Waspada): Umat Islam wajib mengkonsumsi produk makanan dan minuman yang berlabel halal. Bagi umat Islam di Indonesia, kehalalan adalah mutlak dan itu berlaku dalam hukum Islam. “80 Persen penduduk Indonesia beragama Islam. Jika umat Islam menemukan produk makanan yang tidak memiliki label halal dan menimbulkan keraguan, maka harus ditinggalkan,” tegas anggota Komisi VIII DPR RI Drs. H. Hasrul Azwar, MM kepada Waspada saat mengunjungi toko roti Aroma di Jln. AH Nasution Medan, Selasa (5/11) siang. Turut serta dalam kunjungan itu Ketua Fraksi PPP DPRD Medan Ir. H. Ahmad Parlindungan, M.Si yang juga Ketua Dewan Masjid Kota Medan. Mereka disambut pengusaha toko roti Aroma H. Jhon Suhardi, SE beserta istrinya Hj. Triana Daulay; Manager Operasional Arus Aswad, SE;

PENGUSAHA roti Aroma H. Jhon Suhardi, SE didampingi itrinya Hj. Triana Daulay memberi penjelasan kepada anggota Komisi VIII DPR RI Drs. H. Hasrul Azwar, MM didampingi Ketua Fraksi PPP DPRD Medan yang juga Ketua Dewan Masjid Kota Medan Ir. H. Ahmad Parlindungan, M.Si.

Manager Produksi Jumadi, ST; Manager Keuangan Suhartono, SE; Konsultan Pelatihan M. Hirsan Hanafi, S.Sos, M.Si; Konsultan Ke-uangan Drs. H. Ngatemin, M.Si; Manager F & B Cucu Sukria Wijaya, A.Md, Par; Manager Perso-nalia Indra Jaya Asril, A.Md, Par; Pimpinan Proyek Sulaiman; Koordinator Keamanan Isran Pohan. Menurut Hasrul, Komisi VIII DPR RI sedang memproses rancangan undang-undang tentang produk halal dan diharapkan selesai tepat waktu. Undang-undang ini mengatur tentang bahan makanan, kosmetik, obat, sepatu, pakaian dan lainnya. “Komisi VIII DPR RI sudah melakukan studi banding ke Amerika Setikat tentang produk halal. Ternyata masyarakat di sana menyambut baik tentang label halal pada produk makanan. Apalagi di Indonesia yang penduduknya 80 persen beragama Islam. Tentu label halal wajib diterakan pada setiap produk makanan,” tegas Hasrul. Terkait produk roti Aroma, Hasrul melihat proses produksi roti dan kue tersebut telah lulus sertifikasi halal dari MUI dan lulus pengujian Balai POM. “Diharapkan industri makanan di Kota Medan dapat mencontoh toko roti Aroma yang memiliki label halal dari MUI dan lulus pengujian dari Balai POM,” ujarnya. Sementara itu, pengusaha toko roti Aroma H. Jhon Suhardi, SE mengatakan, pihaknya tetap menjaga kualitas bahan baku dan hasil produksi. “Kita menggunakan label halal agar umat Islam tidak ragu mengkonsumsi roti Aroma,” ujarnya. (m36)

Turis Asal Jerman Dirampok MEDAN (Waspada): Dua pengendara sepedamotor merampok tas milik turis asal Jerman di Jln. Palang Merah Medan, Selasa (5/11) siang. Akibat peristiwa itu, korban kakak beradik Seidenschuner, 23, dan HaldenWeeg SimonVincent, 21, asal Haldenweig, Jerman, kehilangan tas yang berisi handphone, kartu kredit, paspor, dan dokumen penting lainnya.

Informasi di Polresta Medan, peristiwa terjadi sekira pukul 12:00. Saat kedua korban baru keluar dari Hotel Kesawan di Jln. Ahmad Yani. Mereka menuju ke arah Jln. Palang Merah dengan berjalan kaki. Ketika tengah menikmata suasana Kota Medan, dua pelaku mengendarai sepedamotor merampas tas yang dipegang Halden Weeg Simon Vincent. Korban yang tidak menyangka menjadi sasaran rampok ini berusaha memperta-

hankan tas yang berisi handphone, kartu kredit, paspor, dan dokumen penting lainnya namun tidak berhasil. Kedua pelaku berhasil membawa tas dan langsung melarikan diri. Sedangkan korban dibantu penarik betor membuat pengaduan ke Polresta Medan. Tukang betor Rickson Sinaga, 32, yang mengantarkan kakak beradik itu membuat laporan ke Mapolresta Medan sempat melihat aksi kriminal itu.

“Aku sempat lihat kejadian itu bang. Habis dijambret ada seorang polisi datang di lokasi kejadian. Jadi aku disuruh sama polisi itu untuk mengantarkan turis ini ke kantor polisi buat laporan pengaduan,” katanya. Menurut dia, pelaku jambret datang dari belakang naik sepedamotor. “Cepat mereka itumainnya(jambret)bang.Siapa yang mau ngejar ngebut kali jambret itu larinya,” tuturnya. Berdasarkan catatan Waspada, aksi perampokan terha-

dap turis asing terus saja terjadi di Kota Medan. Seperti dialami Helen, 50,wisatawan asal Belanda. Dia dirampok dua pria mengendarai sepedamotor saat berjalan kaki di Jln. Ahmad Yani, Kel. Kesawan, Kec. Medan Barat, Minggu (12/5) malam. Akibat kejadian ini, korban mengalami kerugian uang dan handphone. Kemudian, dua pengendara sepedamotor merampok turis Australia yang menumpang betor di Jln. Sisingamangaraja dekat Masjid Raya Al-Mashun

Pertemuan Pemko Dan Pedagang Buku Tanpa Keputusan MEDAN (Waspada): Tuntutan pedagang buku bekas di Sisi Timur Lapangan Merdeka Medan agar dilakukan revitalisasi, hingga saat ini belum bisa dipenuhi Pemko Medan. Relokasi pedagang menjadi keputusan bulat yang akan ditempuh Pemko Medan. Akibatnya, pertemuan yang digelar Pemko Medan dengan pedagang di Balai Kota Medan, Rabu (30/10), berakhir tanpa keputusan. Relokasi ke kawasan Jln. Pegadaian Kelurahan Aur, Kecamatan Medan Maimun merupakan permintaan dari pedagang sendiri sejak awal. Dimana, Pemko berencana menempatkan pedagang di kawasan Mandala. “Pedagang menolak direlokasi ke kawasan Mandala dan mereka sendiri yang meminta di Jln. Pegadaian, makanya kita sepakati saat itu. Setelah itu, mereka menuntut untuk legalitas lahan dan sudah diupayakan,” kata Camat Medan Barat Sutan T. Lubis usai pertemuan tersebut. Dalam rapat itu disam-

paikan Kepala Satuan Polisi Pamong Praja M. Sofyan tentang pertemuan pedagang dengan Pemko Medan di ruang Kasat Lantas Medan di Lapangan Merdeka saat dilakukan pengosongan lahan tersebut. “Saat itu pengosongan dibatalkan dan dilanjutkan dengan dialog. Dalam pertemuan itu, tidak ada tuntutan tentang revitalisasi, melainkan tentang legalitas dan perbaikan kios yang ada di Jln. Pegadaian,” ujarnya. Kemudian dijelaskan Kepala Dinas TRTB Medan Sampurno Pohan yang hadir dalam rapat bahwa dalam peraturan tentang pemindahan pedagang buku ke sisi Timur Lapangan Merdeka adalah untuk menjaga dan melestarikan cagar budaya. “Perlu diingat dan diketahui, cagar budaya itu bukan pedagang buku, melainkan Titi Gantung yang perlu dilestarikan dan dijaga,” ujarnya. Koordinasi Kontras Medan Herdensi selaku kuasa hukum pedagang buku mengatakan, pihaknya tetap meminta agar kawasan pasar buku tersebut

direvitalisasi. “Kita jadikan kawasan itu sebagai pusat peradaban Kota Medan sebagai titik nol,” ujarnya. Herdensi mengatakan, pihaknya telah menjelaskan gambaran tentang rencana revitalisasi yang mereka harapkan ke Pemko Medan. Hanya saja, belum juga ada respon positif dari pihak pemeirntah. Sehingga dalam hal ini, Komnas HAM juga telah menyatakan akan turun melakukan investigasi tentang permasalahan itu. Kemudian, lanjut Herdensi, pihaknya telah membaca perencanaan pembangunan City Check In. Masih ada sisa tanah di antara Lapangan Merdeka dengan City Check In. “Kami hanya meminta lahan yang sisa ini, tidak akan ada yang diganggu,” ujarnya. Meski demikian, kata Herdensi, pembangunan City Check In tidak seharusnya berada di kawasan Lapangan Merdeka. Melainkan di kawasan Jln. Jawa yang kenyataannya saat ini telah dikuasai para pengusaha dengan mendirikan

bangunan besar di kawasan itu. “Kami juga curiga, apakah ini murni untuk pembangunan City Check In atau malah ada rencana Pemko Medan untuk memperjualbelikan lahan itu kepada pihak pengembang,” ujarnya. Usai pertemuan itu, Herdensi mengatakan, pertemuan yang dilakukan Pemko Medan hanya untuk menunjukkan arogansi mereka terhadap peragang buku. Seharusnya, Pemko Medan terlebih dahulu membagikansalinanizinyangditerima Pemko dari PT KAI.“Ini tidak ada dibagikan, kita juga curiga apakah itu ada atau tidak,” ujarnya. Jadi, katanya, ketimpangan yang dilakukan Pemko Medan semakin jelas. Dimana, Pemko juga dinilai telah menentang peraturan yang dibuat tentang jalur hijau. Tidak diperbolehkan mendirikan bangunan di jalur hijau, bahkan kawasan Jln. Pegadaian hanya berjarak dua meter dari lintasan kereta api. Padahal, UU Perkerataapian menegaskan tidak bisa mendirikan bangunan radius 18 meter

dari rel. Herdensi menanggapi pernyataan Sampurno Pohan sebelumnya yang menyatakan bahwa jalur hijau memang tidak bisa dibangun, namun jika bangunan untuk sosial diperbolehkan. Pertemuan yang berlangsung hingga satu jam tersebut tidak kunjung menghasilkan kesepakatan. Akhirnya, pimpinan rapat Ikhwan Habibi menyimpulkan rapat tidak ada kesepakatan atau deadlock. “Dimana Anda sebagai pedagang masih berkeras untuk tetap di kawasan itu, dan itu tidak perlu kami tanggapi. Kami sudah membahas ini di dalam rapat internal. Kami akan sampaikan kepada pimpinan kami, hasil rapat ini,” ujarnya. Sementara itu, menurut Ikhwan, jika pedagang diberikan lahan antara City Check In dengan Lapangan Merdeka, akan memakan sebagian lapangan Merdeka. Itu tidak dibenarkan. Karena itu, Pemko Medan masih bersikukuh melakukan rencana awal merelokasi pedagang ke Jln. Pegadaian, karena izin untuk lahan tersebut telah dikantongi Pemko. (m50)

Medan, Minggu (30/5) sore. Akibat peristiwa itu, Jessica Clare Cumberland, 20, menderita kerugian tas berisi paspor,1 unit iPhone 4, uang tunai Rp400 ribu, 1 unit kamera Sony, dan dua kartu kredit dengan total kerugian sekitar Rp10 juta. Sebelumnya, pasangan suami isteri asal Belgia yakni Cristop dan Cindy menjadi korban perampokan di Jln. Ahmad Yani, Rabu (27/2) siang. Satu kalung emas yang meling-kar di leher Cristop dirampas dua pelaku yang mengendarai sepedamotor. Sedangkan WN Inggris Debbie Hoare, 43, juga menjadi korban perampokan di Jln. Hj Ani Idrus Medan, Minggu (28/ 7). Akibat peristiwa itu, korban menderita kerugian tas berisi handphone. Peristiwa perampokan juga

dialami peserta Konferensi APEC asal Selandia Baru yakni Charlotte Louise Kempthorne, 23, dan Fiona Lin Duncan, 40. Mereka dirampok pengendara sepedamotor di Jln. Raden Saleh, Kamis (27/6). Saat itu, keduanya berjalan kaki dari Lapangan Merdeka menuju Arya Duta Hotel di Jln. Kapten Maulana Lubis. Akibatnya korban kehilangan tas berisi Diplomatic Passport, dua handphone, dompet, kartu kredit, uang tunai Rp 600 ribu, dan satu kamera. Korban membuat laporan ke Polresta Medan. Polisi yang mendapat laporan, langsung melakukan penyelidikan. Pada Minggu (30/ 6), dua tersangka perampok peserta Konferensi APEC tersebut berhasil ditangkap petugas Reskrim Unit Jahtanras Polresta Me-

dandalampenyergapanterpisah. Peserta APEC lainnya menjadi korban perampokan yakni Galina Sagieva, 57, asal Miyanitskaya Moskow, Rusia. Dia dijambret dua pelaku di Jln. Kejaksaan, Kec. Medan Baru, Minggu (30/6). Satu dari dua pelaku berhasil ditangkap petugas Sat Reskrim Unit Jahtanras Polresta Medan. Tersangka ISH, 23, ditangkap di rumahnya kawasan Tembung, Kamis (4/7). Aksi jambret ini berawal ketika Galina melintas di Jln. Kejaksaan. Tiba-tiba dua pria me ngendarai sepedamotor mendekati korban. Selanjutnya tersangka ISH yang berada di boncengan merampas tas sandang berisi handphone warna putih merek Sony Erikson XPeria dan satu unit kamera pocket milik Galina. (m39)

Pemerintah Jangan Terburu-buru Dalam Pengalihan PT Inalum MEDAN (Waspada): Pemerintah termasuk Pemprovsu jangan terburu-buru dalam pengalihan PT Inalum ke Indonesia, melainkan harus menuntaskan sejumlah persoalan yang ada, sehingga kelak tidak sekadar menjadi pengolah sampah. Demikian dikatakan praktisi hukum Ibeng S Rani SH, selaku Direktur LBH Alwashliyah Kota Medan, menjawab pertanyaan Waspada, Kamis (31/10), terkait pengalihan PT Inalum ke Pemerintah RI. Artinya, kata dia, bukanlah Inalum itu dilepaskan kembali ke pihak asing. “Akan tetapi menurut hemat kami masih ada beberapa permasalahan yang mesti dituntaskan dan disiapkan,” ujarnya. Menurut Ibeng, permasalahan itu antara lain soal penanganan limbahnya, persiapan manajemen yang kredibel dan profesional, sumber daya manusia (SDM) nya, bahan bakunya. “Apa gunanya jikalau perusahaan dan industri raksasa itu mendatangkan kerugian saja kelak, atau malah menjadi beban pemerintah, dalam hal ini Pemprovsu,” sebutnya. Dia mengemukakan, apakah pemerintah kita sudah secara benar menghitung untungruginya, apalagi nanti kita menerimanya hanya sebagai sampah yang merugikan pemerintah. Kemudian, yang paling penting adalah

dilakukan audit keuangannya, asetnya sehingga tidak meninggalkan adanya penyimpangan yang menjadi beban. “Misalnya, jangan sampai PT Inalum menjadi ajang korupsi, serta jika seandainya ada kesalahan masa lalu jangan dibebankan kepada pengelola yang baru,” katanya. Pemerintah nantinya harus sangat selektif dalam menempatkan orang-orang yang benarbenar profesional, handal, berkualitas, serius, sebab Inalum itu adalah aset. Jangan sampai menjadi sekedar pengolah sampah, kemudian terbengkalai dan menjadi bangkai. “Justru itu pemerintah termasuk Pemprovsu diingatkan harus berhati-hati serta tidak terburu nafsu,” tuturnya. Secara terpisah, Advokat H Hamdani Harahap SH, MH, menuturkan, PT Inalum masih menuai masalah sebelum kasus limbah B3 dan masalah recoverynya diselesaikan secara tuntas. Apabila hal itu ditabrak, kata dia, maka akan berpotensi pidana korupsi bagi yang menabraknya. Apalagi saat ini kita sedang melakukan gugatan di Pengadilan Negeri (PN) Medan. “Persidangan pertama sudah berjalan di PN Medan, 30 Oktober 2013,” ujarnya. Hamdani meminta mari hormati proses hukum yang sedang berjalan saat ini di pengadilan. Jika tidak maka siapa lagi yang menghormatinya.(m34)


Medan Metropolitan

WASPADA Rabu 6 November 2013

Waspada/Rizky Rayanda

WISATA PANTAI: Sejumlah pengunjung memanfaatkan hari libur Tahun Baru Islam 1 Muharram 1345 H dengan mengunjungi objek wisata Pantai Pondok Permai, Selasa (5/11).

Pengendara Moge Ugal-ugalan Wartawan Waspada Jadi Korban Tabrak Lari MEDAN (Waspada): Aksi ugal-ugalan di jalan raya dipertontonkan seorang pengendara motor gede (Moge) di Jln. AH Nasution, Selasa (5/11). Pengendara Moge yang terkesan arogan itu menabrak wartawan Harian Waspada, lalu melarikan diri. Peristiwa itu bermula ketika korban MF Sembiring mengendarai sepedamotor menuju ke kantor Harian Waspada. Saat melintas di Jln. AH Nasution, tiba-tiba pelaku yang melaju kencang dari arah Jln. Jamin Ginting Simpang Pos, menyeng-

gol sepedamotor korban dari belakang. Akibatnya, korban terjatuh di badan jalan dan menderita luka-luka. Saat itu, pelaku sempat menghentikan Moge yang dikendarainya. Meski telah melihat korban terjatuh, pelaku bukannya meminta maaf dan memberikan pertolongan. Dia langsung kabur meninggalkan korban.Warga sekitar yang menyaksikan peristiwa itu sempat meneriaki pelaku. Dalam keadaan luka-luka, korban yang mengendarai sepedamotorYamaha Mio berusaha mengejar pelaku. Menjelang

persimpangan Jln. AH Nasution – Jln. Karya Jaya, korban berhasil menyusul pelaku. Korban meminta pelaku berhenti dan mempertanggungjawabkan perbuatannya. Namun pelaku dengan sikap arogannya, tidak menghiraukan korban yang mengalami lukaluka. Pelaku langsung tancap gas melarikan diri. Sementara itu, sejumlah saksi mata di lapangan menilai tindakan pengendara Moge tersebut sangat tidak manusiawi. “Kita tahu bahwa pengendara Moge ini adalah orang berduit. Karena harga sepedamotornya sangat mahal. Tapi dia tidak

punya rasa kemanusiaan terhadap korban yang ditabraknya,” ujar salah seorang warga. Warga mengharapkan agar polisi segera mengusut kasus tersebut dan menertibkan pengendara Moge yang ugal-ugalan di jalan raya. “Fenomena di lapangan, ada sejumlah pengendara Moge yang terkesan arogan di jalan raya. Mereka selalu menggebergeber kendaraannya sehingga menimbulkan kebisingan dan mengganggu kenyamanan pengguna jalan lainnya,” ujar warga. Sejumlah warga juga mengaku resah dengan kebera-

daan Moge yang sering mondar mandir di tengah kota. “Moge ini selalu menimbulkan kebisingan di jalan raya. Tapi pengendaranya seperti ingin ‘pamer kekayaan’ kepada masyarakat dan selalu mondar mandir di tengah kota. Seharusnya polisi mengambil tindakan tegas karena Moge tersebut menggunakan knalpot yang menimbulkan kebisingan,” ujar Manto, warga Medan Maimun. Sementara itu, informasi yang diperolehWaspada, pelaku tabrak lari dapat dipidana dan diberi hukuman denda sebagaimana tertera dalam Undangundang Nomor 22 Tahun 2009

STIE-STMIK IBBI Gelar Wisuda MEDAN (Waspada): Sekolah Tinggi Ilmu Ekonomi IBBI dan Sekolah Tinggi Manajemen Dan Informatika Komputer IBBI menggelar acara wisuda mahasiswa di Hotel Grand Aston Internasional, Jln. Balai Kota Medan, Rabu (30/10) dan Kamis (31/10). Ketua STIE IBBI Prof. Dr. Amrin Fauzi mengatakan, kemajuan suatu bangsa sangat ditentukan kualitas sumber daya manusia. Menurutnya, suatu negara

yang memiliki sumber daya alam melimpah, namun sumber daya manusianya tidak bisa diandalkan, maka negara tersebut tidak akan mencapai kemajuan yang berarti. Sementara Ketua STMIK IBBI Ir. B. Ricson Simarmata, MSEE, IPM mengatakan, lulusan Sekolah Tinggi Ilmu Ekonomi dan Sekolah Tinggi Manajemen Dan Informatika Komputer IBBI diutamakan memiliki moral. “Sebaik-baiknya pendidikan jika mengabaikan

aspek moral, akan menjadi siasia, bahkan sangat mungkin akan berakibat fatal,” kata Ir. B. Ricson Simarmata, MSEE, IPM pada acara wisuda 832 lulusan perguruan tinggi tersebut. Ketua Pembina Yayasan Pendidikan IBBI Juswan mengatakan, yayasan yang didirikan sejak tahun 1996 ini telah menghasilkan lulusan sebanyak 13.160 orang dari berbagai program studi. Dalam kurun waktu 17 tahun ini, banyak suka dan dukanya. Namun berkat kerja-


ALUMNI berprestasi foto bersama Ketua STIE IBBI dan Ketua Pembina Yayasan IBBI

sama dan saling pengertian serta dukungan penuh dari seluruh pengelola dan anggota yayasan, seluruh civitas akademika, para pegawai dan kepercayaan masyarakat, maka lembaga ini tetap eksis dan cenderung berkembang dari tahun ke tahun. Juswan menambahkan, mahasiswa sebagai salah satu komponen utama yang menjadi pilar bagi berjalannya perguruan tinggi, harus memiliki beberapa kualifikasi atau prasyarat. Prasyarat dimaksud setidaknya berkenaan dengan empat tanggungjawab utama yang harus dimiliki setiap mahasiswa di lembaga pendidikan tinggi IBBI ini. Pertama, sebagai individu sudah tentu mahasiswa memiliki tanggungjawab secara pribadi terhadap dirinya sendiri. Kedua, sebagai anggota keluarga tentunya mahasiswa memiliki tanggungjawab terhadap orang tua. Ketiga, sebagai bagian dari civitas akademika, mahasiswa memiliki tanggungjawab secara akademik. Keempat, sebagai bagian dari masyarakat, mahasiswa juga memiliki tanggungjawab secara kolektif terhadap masyarakat. Ketua Pengurus Yayasan

Pendidikan IBBI Amrin Susilo Halim mengatakan, ada beberapa hal yang perlu dipahami dalam hidup bermasyarakat. Pertama, Destination (tujuan), dimana kita hidup itu harus mempunyai tujuan yaitu mencapai keberhasilan. Dengan keberhasilan itu, kita dapat membantu banyak orang. Jadi, mulai hari ini tentukanlah tujuan baik dari hidup kalian masing-masing. Kedua, Dignity (harga diri), dimana kita harus memiliki harga diri yang harus kita jaga dalam hidup bermasyarakat. Ketiga, Do it (lakukan), intinya adalah lakukanlah apa saja yang menurut kalian itu benar selama tidak melanggar normanorma yang berlaku. Dengan demikian, kalian pasti mendapatkan apa yang kalian inginkan nantinya, termasuk menjadi orang yang sukses. Semoga pemahaman dari saya ini dapat bermanfaat bagi kita semua. Acara diakhiri dengan pemberiaan penghargaan kepada mahasiswa berprestasi dan dosen berprestasi yang diberikan langsung Ketua Pembina Yayasan Pendidikan IBBI Juswan didampingi Ketua STIE IBBI Prof. Dr. Amrin Fauzi dan Ketua STMIK IBBI Ir. B. Ricson Simarmata, MSEE, IPM.(m25)

tentang Lalu Lintas dan Angkutan Jalan. Pidana 3 tahun dan denda hingga jutaan rupiah (Pasal 312) itu berlaku apabila korban tidak mengalami luka ringan, berat atau meninggal dunia. Apabila korban mengalami luka ringan, berat atau meninggal dunia,

maka hukuman terhadap pelaku tabrak lari ini akan ditambah. Bila korban hanya luka ringan, maka pelaku diancam pidana penjara 4 tahun atau denda paling banyak Rp8 juta (Pasal 311 Ayat 4). Jika korban menderita luka berat, maka pelaku bisa diancam pidana

penjara 10 tahun atau denda paling banyak Rp20 juta (Pasal 311 Ayat 5). Ancaman hukuman lebih berat apabila korban kecelakaan meninggal dunia. Pelaku dikenakan ancaman penjara 12 tahun atau denda maksimal Rp24 juta (Pasal 311 Ayat 6).(m49)

Antisipasi Kejahatan, Pasar Petisah Dipasang CCTV MEDAN (Waspada): Mengantisipasi aksi kejahatan di Pasar Petisah, PT Gunung Karya Kencana Sentosa (GKKS) Medan meningkatkan pelayanan, pengamanan, dan memasang CCTV di 16 titik. “Delapan petugas satpam dari PT. GKKS dibantu personel berpakaian dinas dan sipil dari Polsek Medan Baru terus melakukan patroli di lokasi pasar Petisah agar tetap kondusif,” kata Direktur PT GKKS Medan Effendi Ginting SH, kepada Waspada, Selasa (5/11) siang. Effendi mengatakan, pengamanan dan pelayanan sudah jauh-jauh hari dilakukan, tapi kini lebih ditingkatkan agar masyarakat dari berbagai daerah seperti Medan, Deliserdang, Binjai, Langkat, Rantauprapat, dan Aceh yang datang berbelanja di Pasar Petisah merasa aman dan nyaman. Menurut dia, satpam dan petugas kepolisian

selain melakukan patroli, juga standby di setiap pintu masuk Pasar Petisah. Begitu juga meningkatkan pengamanan di areal parkir kendaraan. “Kendaraan yang parkir di areal parkir Pasar Petisah tidak dikutip biaya retribusinya. Parkir ini sudah dikuasai PT GKKS selama hampir sebulan dan sebelumnya dikuasai Dishub Medan,” tuturnya. Sementara itu, Humas PT GKKS Medan HM Jamil mengatakan, pengamanan tetap terus ditingkatkan demi kenyamanan Pasar Petisah. “Gebrakan ini kita lakukan karena PT GGKS mendukung program dan sesuai instruksi Plt Wali Kota Medan,” ujarnya. Sebelumnya, satpam PT GKKS Medan menangkap dua orang wanita diduga mencopet dompet milik warga yang berbelanja di Pasar Petisah. Kemudian kedua wanita itu diserahkan ke Polsek Medan Baru. (m36)

Wali Kota Diminta Klarifikasi Pergantian Nama Jln Ngumban Surbakti MEDAN (Waspada): Masyarakat Karo meminta Plt Wali Kota Medan Dzulmi Eldin segera melakukan klarifikasi atau penjelasan terhadap keberadaan Jln. Ngumban Surbakti Medan. Pasalnya, masyarakat Karo merasa heran dengan keputusan Wali Kota Medan yang membuat Jln. Ngumban Surbakti semakin dipersempit atau dihapus menjadi Jln. Soekarno Hatta. “Kami meminta PltWali Kota Medan melakukan klarifikasi keberadaan Jln. Ngumban Surbakti. Apakah masih ada jalannya (dihapus) dan ukuran serta luasnya sejauhmana dengan keluarnya Keputusan Wali Kota Medan No: 620/650.K/ X/2013 tentang perubahan dan penabalan nama-nama jalan di Kota Medan supaya jelas,” kata Roy Fachraby Ginting yang juga Sekretaris Jenderal Majelis Permusyawaratan Rakyat Karo, yang datang ke redaksi Harian Waspada usai rapat akbar masyarakat Karo di Medan, Kamis (31/

10). Dalam rapat akbar Masyarakat Karo di Medan itu, hadir tokoh-tokoh dari Tanahkaro seperti Ngasup Karo-karo Sitepu yang merupakan mantan Ketua Panitia Peresmian Jln. Ngumban Surbakti Medan, Syarikat Ginting selaku DPC PPM Kota Medan, Edy Sebayang, Bahtera Sinulingga, Daniel Pinem anggota DPRD Medan. dan Paulus Sinulingga. Dijelaskan Roy, Ngumban Surbakti selaku pahlawan yang melawan penjajah Jepang di zaman dulu tanpa pamrih, sudah sepantasnya kita sebagai ahli waris kemerdekaan menghargai dan memberikan nama jalan yang jelas. Roy juga menyayangkan pembahasan terkait Keputusan Wali Kota Medan No:620/650.K/X/ 2013 tentang perubahan dan penabalan namanama jalan di Kota Medan tidak melibatkan masyarakat Karo di Medan. (h04)

Medan Metropolitan

WASPADA Rabu 6 November 2013

Jadwal Penerbangan Di Bandara KNIA No. Penerbangan Ke Flight


Tiba Dari


GARUDA INDONESIA 1 Jakarta GA-181 2 Jakarta GA-183 3 Jakarta GA-185 4 Jakarta GA-187 5 Jakarta GA-143 6 Jakarta GA-189 7 Jakarta GA-191 8 Jakarta GA-193 9 Jakarta GA-195 10 Banda Aceh GA-278 11 Banda Aceh GA-142 12 Banda Aceh GA-280 14 Palembang GA-266 GA-268 15. Palembang GA-270 16. Batam GA-272 17. Batam 18. Padang GA-260 19. Penang GA-804 20. Pekanbaru GA-276 CITILINK 1. Jakarta 2. Jakarta 3. Jakarta 4. Jakarta 5. Batam

QG-831 QG-837 QG-833 QG-835 QG-882

AIR ASIA 1 Kuala Lumpur 2 Kuala Lumpur 3 Kuala Lumpur 4 Kuala Lumpur 5 Penang 6 Penang 7 Kuala Lumpur 8 Baangkook 9 Bandung 10 Surabaya 11 Bandung 12 Banda Aceh 13 Pekanbaru 14 Singapura 15 Singapura

05.15 08.55 11.00 12.10 13.20 13.55 16.45 18.30 20.30 07.15 09.40 17.10 06.00 17.40 09.30 14.20 10.35 10.55 06.00

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Banda Aceh Banda Aceh Banda Aceh Palembang Palembang Batam Batam Padang Penang Pekanbaru

GA-180 GA-142 GA-182 GA-184 GA-186 GA-188 GA-190 GA-192 GA-196 GA-279 GA-143 GA-281 GA-267 GA-269 GA-271 GA-273 GA-261 GA-805 GA-277

08.10 08.55 10.15 11.25 13.10 16.00 17.30 19.30 22.10 09.50 12.35 19.45 09.55 21.35 12.50 20.45 16.25 13.20 08.45

08:40 09:30 18:50 20:10 14:55

Jakarta Jakarta Jakarta Jakarta Batam

QG-830 QG-832 QG-836 QG-834 QG-883

05:55 06:55 12:15 17:25 16:40

QZ-8050 06.05 QZ- 8054 11.20 AK- 1351 08.00 AK-1355 17.25 QZ-8072 10.40 AK-5837 18.30 AK-1357 21.25 QZ-8084 17.00 QZ-7987 08.25 QZ-7611 11.35 QZ-7981 17.10 QZ-8022 11.00 QZ-8028 07.00 QZ-664 09.20 QZ-668 18.00

Kuala Lumpur Kuala Lumpur Kuala Lumpur Kuala Lumpur Penang Penang Kuala Lumpur Bangkok (2,4,6) Bandung Surabaya Bandung Banda Aceh Pekanbaru Singapura Singapura

QZ-8051 QZ-8055 AK-1350 AK-1354 QZ-8073 AK-5836 AK-1356 QZ-8085 QZ-7986 QZ-7610 QZ-7980 QZ-8023 QZ-8029 QZ-665 QZ-669

08.30 10.55 07.35 17.00 16.30 18.15 21.05 29.55 05.35 11.10 19.55 13.20 10.30 12.35 21.15

LION AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Jakarta 5 Jakarta 6 Jakarta 7 Jakarta 8. Jakarta 9 Jakarta 10 Jakarta 11 Jakarta 12 Jakarta 13 Jakarta 14 Penang 15 Penang 16 Jakarta 17 Jakarta 18 Jakarta 19 Jakarta 20 Jakarta 21 Surabaya 22 Surabaya 23 Banda Aceh 24 Jakarta

JT- 211 JT- 381 JT- 397 JT- 207 JT- 301 JT- 395 JT- 303 JT- 215 JT-201 JT- 387 JT-399 JT-383 JT-385 JT-1282 JT-1288 JT-205 JT-203 JT-219 JT-309 JT-209 JT-0970 JT-972 JT-396 JT-305

0545 06.45 07.50 08.40 10.00 11.00 11.50 12.25 12.50 13.50 15.20 15.50 17.00 08.05 13.35 2010 18.00 20.40 19.10 21.00 07.00 12.55 12.15 18.30

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Penang Penang Jakarta Jakarta Jakarta Jakarta Jakarta Surabaya Surabaya Banda Aceh Jakarta

JT-380 JT-300 JT-394 JT-302 JT-214 JT-200 JT-204 JT-398 JT-382 JT-384 JT-202 JT-212 JT-396 JT-1283 JT-1289 JT-206 JT-208 JT-386 JT-308 JT-218 JT-971 JT-973 JT-397 JT-210

08.20 09.20 10.20 11.10 11.40 12.10 13.10 14.40 15.10 16.20 17.20 17.50 19.45 10.25 15.55 9.20 18.25. 21.05 22.20 23.20 12.15 16.00 07.05 07.20

MALAYSIA 1 Kuala Lumpur 2 Kuala Lumpur

MH-861 MH-865

09.40 15.45

Kuala Lumpur Kuala Lumpur

MH-860 MH-864

08.50 15.00

SILK AIR 1 Singapura 2 Singapura

MI-233 MI-237

08.40 20.35

Singapura Singapura

MI-232 MI-238

07.50 19.50

VALUAIR 1 Singapura (2.4,7) VF-282 2 Singapura (1,3,6) VF-284 3 Singapura (Jumat)VF-282

10.35 18.30 09.45

Singapura (2.4.7) VF-281 Singapura (1,3,6) VF-283 Singapura (Jumat)VF-281

09.55 17.40 09.05

SRIWIJAYA AIR 1 Jakarta 2 Jakarta 3 Batam 4 Pekanbaru 5 Pekanbaru 6 Banda Aceh 7 Penang 8 Padang

SJ-015 SJ-011 SJ-035 SJ-043 SJ-041 SJ-010 SJ-102 SJ-021

13.25 15.55 16.50 10.20 17.20 12.50 07.20 16.00

Jakarta Jakarta Batam Pekanbaru Pekanbaru Banda Aceh Penang Padang

SJ-010 SJ-016 SJ-034 SJ-042 SJ-040 SJ-011 SJ-103 SJ-020

11.00 16.20 14.55 11.50 15.45 14.20 09.50 14.10

FIRE FLY 1 Subang 2 Penang 3. Penang

FY -3413 FY- 3403 FY- 3407

14.35 10.55 18.20

Subang Penang Penang

FY-3412 FY-3402 FY-3406

14.05 10.35 17.55

07.30 11.45 18.50

Singapura Jakarta Jakarta

RI-862 RI-093 RI-097

08.00 12.00 19.30

MANDALA AIRLINE 1 Jakarta RI-092 2 Singapura RI-861 RI-096 3. Jakarta


Jadwal Perjalanan Kereta Api No KA

Nama KA





U.28 Sri Bilah Eks/Bisnis Medan RantauPrapat U30 Sri Bilah Eks/Bisnis Medan Rantau Prapat U.32 Sri Bilah Eks/Bisnis Medan Rantau Prapat U.34 Sri Bilah Eks/Bisnis Medan Rantau Prapat U.27 Sri Bilah Eks/Bisnis Rantau Prapat Medan U.29 Sri Bilah Eks/Bisnis Rantau Prapat Medan U.31 Sri Bilah Eks/Bisnis Rantau Prapat Medan U.33 Sri Bilah Eks/Bisnis Rantau Prapat Medan U35 Sri Lelawangsa Ekonomi Tebing Tinggi Medan U36 Sri Lelawangsa Ekonomi Medan Tebing Tinggi U37 Sireks Ekonomi Siantar Medan U38 Sireks Ekonomi Medan Siantar U.39 Putri Deli Ekonomi Tanjung Balai Medan U.40 Putri Deli Ekonomi Medan Tanjung Balai U.41 Putri Deli Ekonomi Tanjung Balai Medan U.42 Putri Deli Ekonomi Medan Tanjung Balai U.43 Putri Deli Ekonomi Tanjung Balai Medan U.44 Putri Deli Ekonomi Medan Tanjung Balai U45 Sri Lelawangsa Ekonomi Binjai Medan U46 Sri Lelawangsa Ekonomi Medan Binjai U47 Sri Lelawangsa Ekonomi Binjai Medan U48 Sri Lelawangsa Ekonomi Medan Binjai U49 Sri Lelawangsa Ekonomi Binjai Medan U50 Sri Lelawangsa Ekonomi Medan Binjai U51 Sri Lelawangsa Ekonomi Binjai Medan U52 Sri Lelawangsa Ekonomi Medan Binjai U53 Sri Lelawangsa Ekonomi Binjai Medan U54 Sri Lelawangsa Ekonomi Medan Binjai U55 Sri Lelawangsa Ekonomi Binjai Medan U56 Sri Lelawangsa Ekonom Binjai Medan U57 Sri Lelawangsa Ekonomi Medan Binjai U58 SriLelawangsa Ekonomi Binjai Medan U59 Sri Lelawangsa Ekonomi Medan Binjai Reservasi Tiket KA Medan (061-4248666)

08.17 10.47 15.46 22.50 08.45 15.20 17.10 23.55 05.36 18.17 06.25 14.27 07.55 06.57 13.20 13.12 19.00 16.57 05.45 05.00. 07.15 06.30 09.15 08.30 11.35 10.00 14.30 12.30 16.15 17.45 17.00 21.30 20.10


13.57 16.00 21.16 03.52 14.04 20.43 22.11 05.09 07.53 20.38 10.22 18.15 12.52 11.28 17.55 17.36 23.20 21.35 06.14 05.29 07.44 06.59 09.44 08.59 12.04 10.29 14.59 12.59 16.44 18.14 17.29 21.59 20.39

Kasus Penganiayaan Anggota Brimob

Polisi Buron Putra Oknum Anggota DPRD Deliserdang MEDAN (Waspada): Tim Khusus (Timsus) Reskrim Polsek Medan Baru bekerjasama dengan Brimob Poldasu hingga kini masih mengejar sekitar 10 pelaku diduga terlibat kasus penganiayaan terhadap anggota Patra Brimobdasu Brigadir M. Suwardi, 31. “Identitas para pelaku sudah diketahui dan satu diantaranya putra oknum anggota DPRD Deliserdang,” kata sumber Waspada, Selasa (5/11) sore. Menurut sumber di kepolisian,Timsus Reskrim Polsek Medan Baru dipimpin Panit Reskrim Iptu Alexander SH, bekerjasama dengan Brimob Poldasu sedang bekerja di lapangan dan kini sedang mengumpulkan berbagai informasi dari tersangka yang sudah ditangkap terlebih dulu dan warga yang me-

nyaksikan kasus penganiayaan terhadap anggota Patra Brimob Poldasu itu. “Kita masih mencari putra oknum anggota dewan, karena saat itu dia mengadakan acara ulang tahunnya di The Traders (Cafe–Restorant–Bar) di Jln. Patimura Medan, dia diduga mengundang teman-temannya,” ujar sumber. Dalam kasus itu, pihaknya sudah menangkap dua tersangka yakni EJS, 18, putra oknum Polri dan ditangkap dari kediamannya Jln. Budi Plamboyan II C Medan, dia kenakan pasal 170 Subs 351 Yunto 55-56 KUHP dengan ancaman lima tahun penjara. Begitu juga tersangka MARB, 20, mahasiswa di salah satu perguruan swasta di Medan, yang ditangkap di Jln. Patimura dikenakan pasal 170 Subs 351 KUHP ancaman lima

Kuala Namu- Medan

No. KA

No. KA




MEDAN (Waspada): Enam orang warga Patumbak, terdiri suami istri, anak dan mertua mengalami luka bakar serius akibat terkena ledakan tabung gas, Selasa (5/11) pagi. Ledakan tabung gas itu sempat membuat warga Jln. Pertahanan, Dusun VI, Kampung Lama, Kec. Patumbak heboh, dan berduyunduyun mendatangi kediaman korban. Dari keterangan warga disana, ledakan berasal dari gudang penyimpanan tabung gas yang berada di dalam rumah korban.Warga mengatakan, pemilik rumah Anshari Saroha selama ini merupakan agen penyalur gas ukuran 3 Kg dan 14 Kg.“Kami menduga ledakan terjadi disaat mereka mengisi gas ke dalam tabung,” sebut warga. Enan korban mengalami luka bakar di tangan, kaki, dan kepala. Mereka, Anshari Saroha, 38, dan istrinya Nurhayati, 38, tiga anak mereka Rahman

Saputra, 10, Rahmadani, 7, Anggi Sahputri, 1, dan mertua Domia br Nasution, 73. Mereka kemudian dibawa ke RSU Sembiring Jln. Besar, Delitua. Sedangkan petugas Polsek Patumbak yang datang ke lokasi melakukan olah tempat kejadian perkara (TKP) dan memasang garis polisi (police line) untuk proses penyelidikan. Polisi juga mengamankan sejumlah barang bukti tabung gas untuk proses penyelidikan. Informasi lain mengatakan, ledakan terjadi ketika Nurhayati hendak memasak air membuat susu anaknya yang masih balita sekira pukul 06:00. Diduga tabung gas digunakan keluarga itu mengalami kebocoran sehingga saat kompor gas dinyalakan langsung terbakar dan meledak. Erwin, 40, saksi mata mengaku saat terjadi ledakan, tabung gas sampai terbang ke atas menembus atap rumah korban.

Saat itu dia sedang membersihkan pekarangan rumahnya yang berada di samping rumah korban. “Sebelum kejadian saya mendengar suara tangis anakanak meminta susu, beberapa menit kemudian terdengar suara ledakan keras,” kata dia menduga ibu anak itu hendak memasak air saat terjadi ledakan. Korban Anshari Saroha ditemui di RSU Sembiring mengaku tidak menyadari aroma gas di rumahnya. “Saat itu sebenarnya kami masih tertidur, dan tidak menyadari adanya kebocoran tabung gas,” ujarnya. Sedangkan Kanit Reskrim Polsek Patumbak AKP Hatopan Silitonga dihubungi mengatakan, masih melakukan pemeriksaan penyebab terjadinya ledakan. “Penyebabnya masih dalam pemeriksaan, saksi-saksi sudah dimintai keterangan, tetapi pihak korban belum diperiksa karena masih dalam perawatan,” tuturnya.(m27)

PT AKE Diadukan Ke BLH Sumut MEDAN (Waspada): Diawali pengaduan masyarakat dan hasl investigasi oleh BPD Asosiasi Pengelolaan Limbah B3 (Bahan Berbahaya dan Beracun) Indonesia (APLI) Sumut, terindikasi kuat telah terjadi penyimpangan dalam pengelolaan limbah bahan berbahaya dan beracun yang dihasilkan dari pengoperasian pembangkit dan trafo distribusi dilingkup PT Asta Keramasan Energi (AKE) Sicanang Belawan. “APLI telah mengadukan PT Asta Keramasan Energi ke Badan Lingkungan Hidup (BLH) Sumut pada hari Rabu (30/10),” kata Ketua BPD APLI Sumut Oscar Siagian didampingiWakil Ketua Ir M Saleh Pane, Hasler Sila M, Senin (4/11). Menurut Oscar, dari pengoperasian pembangkit dan pemakaian trafo distribusi tersebut, telah menghasilkan volume limbah tergolong sebagai limbah B3 antara lain oli (pelumas) bekas, baterai, kain majun terkontaminasi, filter bekas, dan sebagainya. Adapun volume limbah B3 khususnya dalam bentuk cair yang dihasilkan PT AKE diduga kuat mencapai antara 100-200an drum per bulannya. Bisa dibayangkan, dalam setahun

berapa banyak volume limbah yang dihasilkannya. “Mengacu pada UU No. 32 Tahun 2009 tentang Perlindungan dan Pengelolaan Lingkungan Hidup serta Peraturan Pemerintah No.85 Tahun 1999 tentang perubahan atas Peraturan Pemerintah No. 18Tahun 1999 tentang pengelolaan Limbah Bahan Berbahaya dan Beracun, maka PT AKE termasuk sebagai perusahaan penghasil limbah B3 yang memiliki tanggungjawab penuh atas limbah yang dihasilkannya” sebutnya. Karena termasuk sebagai penghasil limbah B3, maka PT AKE diwajibkan untuk tunduk pada segala aturan berkaitan dengan pengelolaan limbah B3, termasuk untuk memiliki sistem pengelolaan bahkan penampungan limbah B3. Atau bila bekerjasama dengan pihak pengelola limbah B3 mestinya mempunyai manifest (dokumen pengelolaan limbah B3) sebagaimana diatur dalam UU RI No. 32 Tahun 2009 tentang Perlindungan dan Pengelolaan Linkungan Hidup. Peraturan Pemerintah RI No.85 Tahun 1999 tentang perubahan atas Peraturan Pemerintah No.18 Tahun 1999 tentang pengelolaan Limbah Bahan Ber-

bahaya dan Beracun, Keputusan Kepala Bapedal No. 01/ BAPEDAL/09/1995 tentang tata cara dan persyaratan teknis penyimpanan dan pengumpulan limbah B3, Keputusan Kepala Bapedal No.255/BAPEDAL/08/ 1996 tentang tata cara dan persyaratan penyimpanan dan pengumpulan minyak pelumas bekas, Surat Edaran Kepala Bapedal No. 08/SE/02/1997 tentang penyerahan minyak pelumas bekas, dan p Peraturan Daerah Provsu No.2 Tahun 1985 tentang pengelolaan dan pemeliharaan lingkungan hidup. Limbah B3 berupa pelumas bekas yang dihasilkan PT AKE tidak disimpan sementara dengan baik dan benar, melainkan dibiarkan menumpuk diatas tanah dalam drum. Oleh karena itu, sangat dimungkinkan tumpah dan mencemari lingkungan. “Hasil investigasi kami (APLI Sumut), manajemen PT. AKE menyerahkan limbahnya kepada pihak ketiga tanpa dokumen atau dengan dokumen seadanya. Kami menduga PT AKE dengan sengaja melakukan tindakan pelanggaran hukum. Oleh karena itu kami menyampaikan permasalahan tersebut kepada BLH Provsu agar dilakukan tindakan tegas,” tutur Oscar.(m24)

CICIT mendiang Tjong Jong Hian Budihardjo Chandra (empat kanan) menyerahkan bantuan uang tunai kepada Ketua BKM Masjid Raya Al Mashun Drs. H. Ulumuddin Siraj disaksikan Anggota DPRD Medan Dra. Lily MBA, MH (tengah), Rabu (30/10), di pelataran masjid setempat. Bantuan serupa juga diserahkan kepada BKM Masjid Lama Gang Bengkok.

Keluarga Besar Tjong Jong Hian Bantu Masjid Lama Dan Masjid Raya Al Mashun MEDAN (Waspada): Keluarga besar mendiang Tjong Jong Hian menyerahkan bantuan uang tunai untuk Masjid Raya Al Mashun dan Masjid Lama Gang Bengkok Kesawan, Rabu (30/10) sore. Masing-masing masjid menerima bantuan Rp50 juta. Sumbangan itu diserahkan cicit mendiang Tjong Jong Hian, yakni Budiharjo Chandra dan istri Linda Setiawan bersama keluarga. Mereka didampingi Anggota DPRD Kota Medan yang juga Ketua Perhimpunan INTI Kota Medan Dra Lily MBA, MH. Menurut Linda Setiawan, bantuan tersebut merupakan wujud rasa syukur kepada Tuhan Yang Maha Kuasa atas digantinya nama Jln. Bogor menjadi Jln. Tjong Jong Hian. Selain itu, bantuan yang diberikan kepada kedua masjid tersebut, juga untuk meneruskan kegiatan-kegiatan sosial yang pernah dilakukan leluhur mendiang Tjong Jong Hian. “Mendiang Tjong Jong Hian

sering melakukan aksi sosial di termasuk memberi bantuan untuk pembangunan Masjid Lama Gang Bengkok dan Masjid Raya Al Mashun. Kegiatan yang mulia ini, patut kami teruskan,” ungkap Budiharjo Chandra melalui istrinya Linda Setiawan. Sementara itu, anggota DPRD Medan Dra. Lily MBA, MH mengapresiasi kegiatan so-sial yang dilakukan Keluarga Be-sar Budiharjo Chandra karena ingin meneruskan aksi sosial leluhurnya, mendiang Tjong Jong Hian. Lily mengatakan, menurut rencana pada 10 November mendatang, nama Jln. Bogor akan ditabalkan kembali menjadi Jln. Tjong Jong Hian. Perubahan itu merupakan pengembalian nama Jln. Tjong Tong Hian yang ditahun 60-an diganti menjadi Jln. Bogor. “Wujud rasa syukur dan menyambung silaturahmi tersebut, pihak keluarga Tjong Jong Hian menyerahkan bantuan untuk pembangunan dan perawatan Masjidi Lama Gang Bengkok

dan Masjid Raya Al Mahsun,”ungkap Lily. Penyerahan bantuan di Masjid Lama Gang Bengkok Kesawan diterima Ketua Badan Kenajiran Masjid (BKM) HM Sazli Nasution didampingi sekretaris HM. Ihsan Tanjung, Bendahara Silmi Tanjung, S.PdI dan Imam Masjid Fauzi Effendi Nasution dan Kepala Lingkungan II yang juga pengurus masjid H. Muhlis Tanjung. Di Masjid Raya Al Mashun, bantuan diterima Ketua BKM Drs. H. Ulumuddin Siraj didampingi Sekretaris H. Ridwan AS dan Penasehat BKM Raya Al Mahsun HM Pasaribu. “Kami mengucapkan terima kasih karena bantuan ini meneruskan tradisi mendiang Tjong Jong Hian. Bantuan ini akan digunakanuntuk merenovasi masjid,” ungkap HM Sazli Nasution yang pada kesempatan itu menyerahkan piagam penghargaan kepada Budiharjo Chandra cicit mendiang Jong Hian. (m22)

Pemerintah Harus Jujur Soal CPNS K1, K2 MEDAN (Waspada): Asosiasi Guru Pendidikan Islam (AGPAI) Sumatera Utara, meminta pemerintah memberikan penjelasan yang jujur kepada masyarakat terkait kesempatan bagi tenaga honorer yang mengikuti ujian CPNS tenaga honorer (K1) dan (K2) yang sudah berlangsung Minggu (3/11). “Saya menilai pelaksanaan ujian itu belum sejalan dengan azas keadilan bagi mereka yang sudah bekerja puluhan tahun tapi tidak punya kesempatan lagi menjadi PNS. Apakah ada perbedaan pengabdian antara yang disertakan ujian (K1) dan (K2) dengan tenaga honorer yang sudah puluhan tahun tapi tidak ada kesempatan. Karena itu penilaian untuk kelulusan menjadi PNS harus jujur dan transparan,” ujar Ketua AGPAI Su-

mut Ali Nurdin MA, Senin (4/11). Dia mengingatkan Menteri Agama RI Suryadharma Ali memenuhi janjinya terkait penambahan kuota guru agama di Sumatera Utara. “Tahun 2011 lalu saat Menteri Agama Suryadharma Ali ke Medan, dia sudah berjanji akan menambah kuota guru agama di Sumut. Tapi sampai sekarang belum ada tandatanda realisasinya, padahal sudah tahun 2013 dan sudah ada penambahan lowongan bagi CPNS di lingkungan kementerian agama,” katanya. Terkait pelaksanaan ujian honorer PNS, Kepala KantorWilayah Kementerian Agama Provinsi Sumatera Utara Drs H Abd. Rahim MHum, belum lama ini menyebutkan, jumlah peserta ujian sebanyak 1.931 orang, de-

ngan persyaratan, usia maksimal 46 tahun pada Januari 2006. Selain itu, mempunyai masa kerja sebagai tenaga honorer paling sedikit satu tahun pada 31 Desember 2005 dan sampai sekarang masih bekerja secara terus menerus, bekerja pada instansi pemerintah, penghasilannya tidak dibiayai dari APBN untuk Kategori II, dan penghasilannya dibiayai dari APBN bagi Kategori I serta diangkat oleh pejabat yang berwenang. Penerimaan CPNS tenaga Honorer (K1) dan (K2) Kanwil Kemenag Provinsi Sumut mengirim data ke Jakarta berdasarkan usulan Kemenag Kab/ Kota se Sumut (K1) berjumlah 445 orang, dan (K2) berjumlah 1.931 orang, dan selanjutnya data ini disampaikan oleh Biropeg Kemenag RI ke Menpan. (m37)

Abdullah Rasyid: Caleg PAN Jangan Selingkuh

Berangkat KNIA Tiba Medan

U62 04:00 04:37 U63 05:55 06:42 U4A 06:15 06:52 U71 08:35 09:19 U8A 08:20 08:57 U5A 09:25 10:02 U14A 11:10 11:47 U11A 12:25 13:02 U18A 13:45 14:22 U15A 14:55 15:42 U22A 15:15 15:52 U19A 16:25 17:02 U26A 17:15 17:52 U23A 18:30 19:07 U26 19:10 19:47 U73 20:15 20:59 U70 20:00 20:37 U75 22:15 22:59 U72 22:00 22:37 U69 00:15 00:52 NB: Tiket dapat dibeli di stasiun KA Bandara Medan dan Kuala Namu. Pembayaran dapat menggunakan Kartu Prabayar, Debit dan Kredit Card. Tiket dapat dipesan 7 hari sebelum berangkat. (m32)

tahun. Saksi yang sudah diperiksa lima orang dan kemungkinan saksi akan bertambah. Kapolsek Medan Baru Kompol Nasrun Pasaribu SH, SIK, MH, melalui Panit Reskrim Iptu Alexander SH mengatakan, pihaknya masih mengejar pelaku lainnya. Sedangkan, dua tersangka yang ditangkap EJS dan MARBa diamankan di Mapolsek Medan Baru. Peristiwa penganiayaan terhadap anggota Brimob terjadi pada Minggu (3/11) dinihari. Selain menangkap MARB, polisi menyita barang bukti tas sandang, borgol, dua kunci borgol, lima handphone, tiga kartu ATM, tiga memory card handphone. Salah satu memory card itu berisi foto-foto mesum tersangka MARB dengan pacarnya berinisial IP, 19, mahasiswi salah satu perguruan tinggi negeri. (m36)

Tabung Gas Meledak, Enam Luka Bakar

Jadwal Keberangkatan KA Bandara Medan –Kuala Namu



CALEG DPR RI dari Partai Amanat Nasional (PAN) Abdullah Rasyid memberikan materi Pembekalan Caleg DPRD Kota Medan di Hotel Garuda Plaza, Selasa (5/11).

MEDAN (Waspada): Calon anggota legislatif (Caleg) DPR RI dari Partai Amanat Nasional (PAN) di daerah pemilihan (Dapil) Sumut I Abdullah Rasyid mengingatkan agar caleg DPRD Kota Medan memilih tandem yang satu partai dalam berkampanye. Jangan selingkuh ke caleg partai lain, karena hal itu merupakan pelanggaran kode etik. “Bertandem antara DPRD kota dengan DPRD provinsi dan DPR RI, itu harus in line (segaris/satu partai). Jangan beda parpol, karena dalam kode etik itu tidak diperbolehkan selingkuh,” kata caleg nomor 4 untuk Dapil Medan, Deliserdang, Serdangbedagai dan Tebingtinggi ini saat memberikan materi Pembekalan Caleg DPRD Kota Medan di Hotel Garuda Plaza, Selasa (5/11). Staf Khusus Menko Perekonomian Hatta Rajasa ini membuka diri kepada caleg DPRD Kota Medan untuk bertandem dengannya. Selama caleg tersebut punya prinsip dasar pemenangan yang terukur, rasional, terstruktur dan berbasiskan data. Menurut Rasyid, caleg tidak bisa hanya mereka-reka dukungan yang diperolehnya tanpa didasari data yang valid. Harus jelas dan tegas berapa angkanya. Jangan berdasarkan asumsi apalagi perasaan. “Kalau disebut punya dukungan 1.000 orang, maka harus ada datanya dan siapa saja orangnya,” ujar mantan Ketua Barisan Muda (BM) PAN itu. Untuk mendapatkan data yang realistis, maka khusus untuk caleg tingkat kabupaten/kota harus punya tim pemenangan minimal 100 orang. Tim pemenangan ini bertugas menyebar kartu nama, poster, bertegur sapa dengan masyarakat dan bersosialisasi. Jika tidak punya tim pemenangan, maka jangan harap bisa terpilih.

Sebab, dalam kompetisi politik tidak ada juara harapan, yang ada hanya menang dan kalah. Rasyid mengingatkan target PAN di setiap tingkatan adalah memperoleh dua digit persentase perolehan suara. Dia melihat semangat dan antusiasme untuk memperoleh target tersebut terpancar di mata para caleg yang ikut pembekalan. Jika perjuangan dua digit tercapai, maka PAN siap mencalonkan Hatta Rajasa sebagai calon presiden (capres). “Untuk mewujudkan hal itu, caleg harus mengikuti strategi umum PAN. Yakni, aksi nyata dengan tekad merebut hati serta menjalankan amanah rakyat,” ujar mantan aktivis Himpunan Mahasiswa Islam (HMI) ini . Sebagai mantan anggota KPU Provinsi Jambi, Rasyid mengingatkan, angka partisipasi politik saat ini semakin rendah. Itu menjadi tugas bersama terutama caleg DPRD Medan untuk melakukan pendidikan politik kepada warga. Terutama mengingatkan untuk tidak terbuai dengan politik uang. “Sadarkan warga bahwa caleg yang dipilih berdasarkan politik uang dipastikan akan melupakan rakyat yang memilihnya ketika telah mendapatkan kursi,” kata alumni SMAN 1 Medan angkatan 1988 ini. Sementara itu, Ketua DPD PAN Kota Medan Ahmad Arif mengatakan, pembekalan caleg DPRD Kota Medan ini bertujuan agar semua memahami peraturan Pemilu serta kode etik internal partai selama berkampanye. Diharapkan PAN dapat meraih target nasional yaitu dua digit angka atau 8 sampai 10 kursi di DPRD Medan. (h03)

Medan Metropolitan


WASPADA Rabu 6 November 2013

Hentikan Penyidikan Kasus P2TL

Letras Prapidkan Kapoldasu MEDAN (Waspada): Lembaga Transparansi (Letras) Sumatera Utara mengajukan permohonan Praperadilan terhadap Kaporli cq Kapoldasu cq Direktur Reserse Kriminal Khusus (Direkrimsus) Poldasu, sehubungan dengan diterbitkannya Surat Penghentian Penyidikan Perkara (SP3) No. K/63/I/2013/Ditreskrimsus pada tanggal 15 Januari 2013 atas Laporan Perkara No. LP/233/II/2012 SPKT II tanggal 27 Pebruari 2012 dengan terlapor Ir Rutman Silaen sebagai Ketua P2TL PT PLN Wil I Sumut. Kuasa hukum Letras Sumut Leden Simangunsong SH, kepada wartawan, Selasa (4/11) mengatakan, permohonan Praperadilan diajukan berdasarkan Ketentuan Pasal 77 huruf (a) dan Pasal 80 Undang-Undang No. 8 Tahun 1981 Tentang Kitab Undang-Undang Hukum Acara Pidana (KUHAP) pasal 77 huruf (a) mengenai sah atau tidaknya

penghentian penyidikan, dan Pasal 80 menyatakan bahwa pemeriksaan untuk memeriksa sah atau tidaknya suatu penghentian penyidikan dapat diajukan oleh pihak ketiga yang berkepentingan, kepada Ketua Pengadilan Negeri (PN) dengan menyebutkan alasannya. Leden yang merupakan Advokat dari Kantor Hukum Sudiarto Tampubolon SH, MH dan Rekan menyebutkan, kasus ini bermula dari laporan Lukman Wijaya, Direktur PT Sari Tani Jaya Sumatera (STS) beralamat di Jln. Prof HMYamin, Lk III, Kel. Kisaran Naga, Kota Kisaran Timur, Kab. Asahan, membuat surat permohonan perlindungan hukum kepada Poldasu 14 September 2011, terkait pemutusan listrik di perusahaannya oleh tim P2TL PLN Wilayah Sumut. Masalah ini kemudian ditindaklanjuti dengan dilakukan penyelidikan oleh Ditreskrimum melalui surat No. LI/108/ IX/ 2011/ Ditreskrimum tanggal 1 4 Se p t e m b e r 2 0 1 1 d a n

Tingkatkan Kualitas Air, Tirtanadi Cuci Pipa Transmisi MEDAN (Waspada): Dalam rangka menjaga kualitas air yang didistribusikan kepada pelanggan, PDAM Tirtanadi Cabang Deliserdang akan melaksanakan pekerjaan pencucian pipa transmisi diameter 300 mm. “Untuk meminimalisir gangguan air yang terjadi akibat pelaksaan pekerjaan tersebut, maka kita melaksanakan pekerjaan pencucian pipa transmisi tersebut secara bertahap yaitu tahap pertama pada Kamis (7/11) malam pukul 22:00 dan selesai Jumat (8/11) pukul 04:00 WIB,” kata Kepala Divisi Public Relations PDAM Tirtanadi Ir Amrun dalam siaran persnya, Senin (4/11). Menurut Amrun, pada tahap pertama pelaksanaan pekerjaan pencucian pipa transmisi beberapa wilayah mengalami gangguan air yaitu Jln. Siantar, Jln. Galang, Kompleks Kantor Bupati Deliserdang, Jln. Imam Bonjol, Jln. Diponegoro, Jln. A Yani, dan Jln. Medan sekitarnya. Tahap kedua, kata dia, pencucian pipa transmisi dilaksnakan pada Kamis (14/11) malam pukul 22:00, sehingga beberapa kawasan mengalami gangguan air seperti Jln. Siantar, Jln. Pembangunan, Jln. Sekip, Jln. Sutomo, Jln. Fachrudin, Jln. Setia Budi, Jln. Bakaran Batu. Selain itu, PDAM cabang Belawan juga akan melakukan pencucian sumur bor Pompa III di Jlb. Hanafiah. Pekerjaan akan dilaksanakan selama beberapa hari yaitu mulai Sabtu (9/11) dan diperkirakan akan selesai Jumat (15/11). Akibat pelaksanaan pencucian sumur bor tersebut, supply air di Cabang Belawan akan mengalami gangguan. “Kami mohon maaf atas ketidaknyamanan ini, informasi dan keluhan dapat disampaikan ke cabang terkait atau melalui Call Center 500444,” tutur Amrun. (cwan)

dikeluarkanlah Surat Perintah Penyelidikan No. Pol. SP – Lidik/ 35/ II/ 2012/ Ditreskrimsus tertanggal 3 Pebruari 2012. Kemudian, untuk melanjutkan penyelidikan, pada tanggal 27 Pebruari 2012, Lukman Wijaya membuat Laporan Polisi di Pos Pengaduan Masyarakat, dan diberi No. Laporan Polisi No. Pol. LP/ 233/ II/ 2012/ SPKT II tertanggal 27 Pebruari 2012, mengenai dugaan tindak pidana kejahatan yang dilakukan melampaui batas kewenangan dalam jabatan dan/atau pemalsuan surat” sebagaimana dimaksud dalam Pasal 421 dan/ atau 263 KUHPidana. Pada tanggal 6 Maret 2012, dikeluarkanlah Surat Perintah Tugas Ditreskrimsus Poldasu No. Pol. SP – Tugas/123/III/ 2012/Ditreskrimsus tertanggal 6 Maret 2012, dan kemudian pada tanggal 5 September 2012 Ditreskrimsus Polda Sumut mengeluarkan Surat Perintah Penyidikan No. SP–Sidik/69/IX/ 2012/Ditreskrimsus. Dalam perkembangan

penyidikan, penyidik Poldasu telah menerima hasil pemeriksaan secara laboratoris dari Fakultas Tehnik Elektro USU atas barang bukti yang disita dengan hasil tidak ditemukannya tandatanda kerusakan yang disebabkan oleh faktor lain seperti pemotongan menggunakan alat pemotong maupun dengan bahan kimia. Kawat segel mengalami kondisi korosi (karat) yang merata di permukaannya (uniform corosion) dan mengalami penurunan kekuatan hingga menyebabkan terjadinya patah. Setelah penyidik melakukan koordinasi dengan ahli pidana Fakultas Hukum Universitas Sumatera Utara (USU), selanjutnya pada 27 September 2012 dan 8 Oktober 2012 telah dilakukan gelar perkara di Poldasu oleh para penyidik Ditreskrimsus sesuai dengan Perkap No. 14 Tahun 2012 terhadap Laporan Polisi No. Pol. LP/ 233/ II/ 2012/ SPKT II tertanggal 27 Pebruari 2012, mengenai dugaan tindak pidana “Kejahatan yang dilakukan melampaui batas ke-

wenangan dalam jabatan dan/ atau Pemalsuan Surat” sebagaimana dimaksud dalam Pasal 421 dan/atau 263 KUHPidana, dengan hasil yang diberitahukan ke masyarakat bahwa hasil gelar perkara atas perkara yang dilaporkan LukmanWijaya telah diperoleh fakta bukti permulaan yang cukup untuk ditingkatkan ke penyidikan dengan persangkaan. Akan tetapi tanggal 15 Januari 2013, perkara tersebut dihentikan penyidikannya yakni melalui surat No. K/63/I/2013/ Ditreskrimsus Poldasu perihal Pemberitahuan Penghentian Penyidikan yang ditujukan kepada Kepala Kejaksaan Tinggi Sumatera Utara. Leden mengatakan, penghentian penyidikan atas laporan perkara itu bertentangan dengan hukum materiil dan hukum acara pidana. “Tidak ada sedikitpun alasan hukum untuk penyidik melakukan tindakan penghentian penyidikan perkara tindak pidana dengan alasan “demi hukum” terhadap kasus

DPRD Dukung Polisi Gelar Razia MEDAN (Waspada): Peristiwa tragis yang menimpa dua personel polisi yang ditabrak pengendara sepedamotor hingga cidera dan kritis saat sedang melaksanakan razia mengundang simpatik dari kalangan legislatif. “Peristiwa ini sangat sadis dan menyedihkan. DPRD Medan meminta pelaku yang telah menabrak kedua personel polisi yakni Aiptu Sutrisna, anggota Sat Lantas Polresta Medan, dan Aiptu Edy Hermanto, anggota Sabhara Polsek Medan Timur agar ditangkap dan diproses secepatnya,” kata Anggota DPRD Medan Parlindungan Sipahutar, di gedung dewan, Senin (4/11). Menurut politisi Partai Demokrat ini, anggota legislatif pastinya mendukung polisi untuk bertindak tegas terhadap pengendara sepedamotor yang dengan sengaja menabrakkan sepedamotornya kepada personel polisi yang sedang melaksanakan tugas razia.

“Jadi perbuatan itu tidak bisa ditoleransi, karena sudah ada unsur kesengajaan dan perbuatan itu harus segera diproses hukum dan diberi tindakan tegas yang setimpal dengan perbuatannya, karena kita menginginkan hukum ditegakkan dan pelaku tindak kriminal tidak semena-mena terhadap polisi,” sebutnya. Untuk menjaga stabilitas keamanan, kata dia, DPRD Medan sangat mendukung polisi menggelar razia rutin tersebut. Karena akhir-akhir ini diakuinya masyarakat sangat resah dan terancam jiwanya dengan aksi kejahatan seperti perampokan, penjambretan dengan senjata tajam, senjata api, maupun narkoba. Parlindungan mengatakan, secara umum seluruh lapisan masyarakat termasuk anggota dewan sangat mendukung sepenuhnya razia rutin tersebut termasuk razia senjata api,

senjata tajam, dan narkoba. Ap a l a g i , s a a t i n i a k s i penganiayaan terhadap polisi yang terkait dengan razia semakin marak, bahkan belakangan aparat kepolisian sering menjadi korbannya. “Bila perlu razia tersebut tidak hanya sebatas ditujukan kepada masyarakat, tetapi juga harus diselidiki siapa pemasok atau pengedar narkoba itu di masyarakat,” tutur anggota Komisi A DPRD Kota Medan ini. Hal ini mengindikasikan semakin maraknya peredaran senjata api, senjata tajam, dan narkobat yang berdampak kepada kondisi keamanan dan kenyamanan masyarakat. Sebelumnya Aiptu Sutrisna, anggota Sat Lantas Polresta Medan dan Aiptu Edy Hermanto, anggota Sabhara Medan Timur menjadi korban penabrakan pengendara sepedamotor saat sedang melakukan razia rutin di10titikrawankemacatan.(m30)

Mobil Hilang, Oknum Pengacara Pukul Security Hotel MEDAN (Waspada): Petugas security Swiss Bell Hotel dipukul oknum pengacara berinisial ST di hotel tersebut Jln. S Parman Medan, Selasa (5/11) siang. Pemukulan terhadap korban M Ali Sipahutar, 35, berawal ketika mobil Fortuner milik ST hilang ketika sedang parkir di depan Swiss Bell Hotel Jln. S Parman. Tak terima dengan pemukulan itu, korban yang mengalami luka memar dibagian mata sebelah kanan didampingi Komandan Regu (Danru) Mansyur Alamsyah, 36, membuat laporan pengaduan ke Mapolresta Medan. Menurut Mansyur Alamsyah, pemukulan terjadi karena mobil milik ST hilang ketika sedang parkir di depan hotel. Padahal, anggotanya itu M Ali Sipahutar melarang agar mobil itu tidak parkir di depan hotel persisnya di pintu masuk karena menghalangi kendaraan tamu hotel yang mau parkir di basement. “Karena agak menghalangi, sopir mobil itu parkir menjauh. Ya memang sopirnya itu parkir agak jauh lah,” tuturnya. Dijelaskannya, oknum pengacara ST diketahui memang tamu di Swiss Bell Hotel dan sudah menginap beberapa malam. Ketika sopir itu naik ke kamar hotel untuk menjemput barang milik majikannya, mobil ditinggal parkir di depan hotel. Beberapa menit kemudian ketika mereka menuju ke depan hotel, mobil yang diparkir sudah enggak ada lagi. “Anggota saya tidak tahu menahu kemana mobilnya. Itu kan diluar tanggung jawab kami. Tapi kalau parkir di basement dan mobilnya hilang itu baru tanggungjawab kami. Ya kami akan menempuh jalur hukum soal aksi pemukulan ini,” ujar Mansyur. Sedangkan Ali Sipahutar mengaku, begitu mobilnya hilang, dirinya disalahkan dan dipukul hingga mengalami luka memar di mata sebelah kanan. “Setahu saya, si pelaku itu berprofesi sebagai pengacara,” katanya sembari memperlihatkan luka memar di matanya. (m39)

Tewas Ditabrak Truk MEDAN (Waspada): Akibat ditabrak truk yang akan berbelok, seorang pengendara sepedamotor tewas dengan kondisi mengenaskan di Jln. SM Raja Km 8,8 Medan, Senin (4/11) sekira pukul 22:30 WIB. Informasi yang diperoleh di Unit Laka Sat Lalulintas Polresta Medan, Selasa (5/11) siang, peristiwa itu berawal saat korban Syamsuddin Simangunsong, 20, warga Jln. Suruk Pandan Lumban Toruan, Kec. Lae Parera, Kab. Dairi, berboncengan dengan Rianto Manurung, 15, warga Dusun I Bangun Sari, Deliserdang, mengendarai sepedamotor Honda Supra X BK 6938 UP melaju dari arah Tanjungmorawa menuju Medan tepat dibelakang truk Mitsubishi Colt Diesel BK 9841 MN yang dikemudikan Joko ,35, warga Desa Bandar Kuala, Kec. Galang, Deliserdang. Ketika berada di Km 8,8 Jln. SM Raja Medan, truk yang dikemudikan Joko akan berbelok ke kiri untuk masuk ke dalam satu gudang di kawasan tersebut. Karena badan truk yang besar, Joko sempat memutar badan truknya ke arah kanan sedikit dan kemudian berbelok ke arah kiri. Saat bersamaan, Syamsudin yang berada di belakang mengira truk akan berbelok ke arah kanan, mencoba mendahului dari kiri, namun tiba-tiba truk berbelok ke kiri menabrak sepedamotor yang dikendarai korban. Akibatnya, Syamsudin tewas ditempat kejadian dengan kondisi paha kanan patah, hidung, mulut, dan telinga mengeluarkan darah. Sedangkan Rianto yang berada di boncengan hanya mengalami luka ringan. Sementara sopir truk Joko melarikan diri usai kejadian tersebut. Petuga Unit Laka Sat Lantas Polresta Medan yang turun ke lokasi mengamankan truk dan sepedamotor milik korban ke Sat Lantas Polresta Medan. “Truk dan sepedamotornya sudah kita bawa ke Mako, sementara ini sopir truk melarikan diri,” kata Aiptu Marwandi personel Sat Lantas Polresta Medan yang turun ke lokasi.(h04)

perkara ini,” sebutnya. Sementara itu, Direktur Letras Sumut Muhammad Hendrico Harahap menuturkan, sidang Prapid ini sudah digelar

dua kali dimana pihaknya telah menghadirkan saksi ahli yakni Prof Dr Safruddin Kalo SH, MH, dariUSU.Selanjutnyasidangakan digelar pada 7 November 2013.

Kata dia, Letras sudah terdaftar di Kesbang Pol dan Linmas ProvinsiSumutdenganNoInventaris : 632.F/BKB-PM/XII/2008 Tanggal18Desember2008. (m39)


SISWA/I HighScope Indonesia membawakan tarian Poco-poco dari Ambon dalam Pekan Budaya Indonesia yang diselenggarakan sekolah tersebut.

HighScope Indonesia Gelar Pekan Budaya MEDAN (Waspada): Sejak didirikan pada tahun 2003, HighScope Indonesia, sekolah yang berbasis multiple inteligent telah banyak menarik minat para orangtua untuk menyekolahkan anaknya di sekolah yang berada di Kompleks Citra Garden Jln. Letjen Djamin Ginting, Padang Bulan dan Jln. Kartini No. 31A Medan ini. “Selama sepakan ini, para siswa/i SD HighScope Medan, menyelenggarakan Pekan Budaya Indonesia. Anak-anak diperkenalkan dengan budaya suku-suku di Indonesia, mulai dari bahasa, adat istiadat, rumah adat, baju daerah, lagu dan tarian daerah, makanan khas serta monumen yang menjadi ciri khas dari daerah tersebut,” kata Managing Director HighScope Indonesia Sylvia Joyce didampingi Kepala Sekolah Fourgelina, Senin (4/11). Selain itu, ujar dia, yang paling menyenangkan, anak-anak diperkenalkan dengan permainan anak tradisional yang mungkin sudah hampir tidak pernah dimainkan oleh anakanak di era digital ini. Tidak hanya itu, anak didik juga diperkaya dengan pengetahuan tentang nama-nama provinsi dan ibukotanya serta sumber daya alam dari masing-masing daerah. Menurut Sylvia, dilaksanakannya kegiatan Pekan Budaya

Indonesia, supaya anak-anak HighScope dapat mengenal budaya sendiri sejak dini dan belajar untuk mencintai budaya Indonesia. Hal ini dikarenakan Sekolah HighScope juga mengajarkan anak-anak untuk menghargai perbedaan, meskipun mereka berasal dari beragam suku, bahasa, dan agama. “Dalam proses pemilihan daerah yang akan ditampilkan, siswa diajak berdiskusi oleh guru sehingga tercapai kesepakatan untuk memilih daerah yang ingin mereka tampilkan. Ada Manado, Maluku, Batak, Nias, Papua, dan sebagainya. Anak-anak juga belajar budaya, bahasa, adat istiadat, alat musik, tarian hingga mencoba masakan sesuai dengan daerah yang mereka pilih,” sebutnya. Kata dia, para orangtua memilih HighScope karena mereka percaya bahwa pendidikan bukan hanya merupakan akademis saja, tetapi juga termasuk di dalamnya segi sosial emosional, karakter, dan kekuatan lainnya yang sangat dibutuhkan anak-anak dalam menghadapi tantangan di era globalisasi. “Sehingga di masa depan anakanak ini tidak hanya menjadi seorang pekerja tetapi diharapkan dapat menjadi pemimpin dan entrepreneurship yang memiliki karakter yang baik,” ujarnya. Sementara itu, Kepala Seko-

lah HighScope Indonesia Fourgelina mengatakan, kegiatan Pekan Budaya Indonesia telah dilaksanakan selama sepekan sekaligus memperingati Hari Sumpah Pemuda. Siswa/i selama seminggu terus belajar dan menggali informasi tentang kebudayaan yang mereka pilih. “Mereka juga melakukan wawancara ke masing-masing kelas untuk mendapatkan informasi tentang kebudayaan dari kelas lain. Pada intinya, mereka belajar tentang kebudayaan Indonesia dan makna Sumpah Pemuda dengan cara yang menyenangkan sehingga diharapkan akan tumbuh rasa nasionalisme dalam diri mereka,” tuturnya. Fourgelina menyebutkan, sekolah sudah selayaknya tidak hanya mengajarkan anak baca, tulis, hitung semata, tetapi mampu memfasilitasi anak dengan pengetahuan sosial budaya, serta nilai-nilai etika yang diterapkan langsung dalam kehidupan nyata sehari-hari anak. “Anak sebagai generasi penerus bangsa diharapkan mampu melestarikan budaya nasional, dengan kreatifitasnya mampu mengembangkan serta mengolah budaya lokal menjadi peluang usaha yang dapat memberikan kesejahteraan bagi masyarakat sekitarnya dan menambah devisa negara. (cwan)

Masyarakat Mulai Cerdas Tentukan Pilihan

Waspada/Feirizal Purba

KETUA PAC Pemuda Pancasila Kecamatan Medan Maimon Ir. M. Fahrial Parinduri mewakili Ketua MPO PP Kota Medan Kodrat Shah menyerahkan bantuan beras kepada korban banjir.

Ketua MPO PP Kota Medan Bantu Korban Banjir MEDAN (Waspada): Ketua Majelis Pimpinan Organisasi (MPO) Pemuda Pancasila (PP) Kota Medan Kodrat Shah menyerahkan bantuan beras kepada korban banjir akibat luapan Sungai Deli, di Kecamatan Medan Maimun, Selasa (5/11). Bantuan 200 karung beras tersebut diserahkan melalui Ketua Pimpinan Anak Cabang (PAC) PP Kecamatan Medan Maimun Ir. M. Fahrial Parinduri didampingi Sekretaris Sulaiman S, di Sekretariat PAC PP Medan Maimun Jln. Brigjen Katamso,

Kampung Baru. M. Fahrial Parinduri mengatakan, bantuan dari Ketua MPO PP Kota Medan tersebut merupakan wujud kepedulian terhadap warga, terutama yang mengalami musibah banjir. “Selaku organisasi kemasyarakatan pemuda, kita harus peduli terhadap nasib saudarasaudara kita yang ditimpa musibah, termasuk jajaran anggota PP yang juga mengalami hal serupa,” ujar Fahrial. Kodrat Shah melalui Fahrial berharap, bantuan masing-

masing 10 kg beras untuk tiap KK itu jangan dinilai dari jumlahnya, tetapi wujud keprihatinan maupun rasa peduli terhadap sesama anak bangsa. Fahrial menjelaskan, warga yangmenerimabantuantersebut berasal dari wilayah Kecamatan MedanMaimun,yakniKelurahan Aur, Hamdan, Jati dan Sei Mati. Salah seorang penerima bantuan di Kelurahan Aur mengucapkan terimakasih kepada PP yang peduli terhadap para korban banjir akibat luapan Sungai Deli.(m34)

Rumah Terbakar Di Perumnas Mandala MEDAN (Waspada): Rumah milik Khairun Napitupulu, 53, di Jln. Garuda Raya/Jln. Seriti Perumnas Mandala, Kec. Percut Seituan, ludes terbakar, Senin (4/11) sekira pukul 21:00. Informasi yang diperoleh di kepolisian, saat kejadian rumah yang berada di dekat jalan tol itu dalam keadaan kosong, sedangkan penghuni rumah berjualan buah-buahan di kawasan Jln. Denai, Kec. Medan Denai. Penyebab kebakaran diduga akibat hubungan arus pendek/ korsleting, rumah tersebut langsung terbakar, dan menyambar seluruh isinya. Warga sekitar yang melihat

kebakaran tersebut, berusaha memadamkan api dengan air parit. Akhirnya api berhasil dipadamkan, sedangkan rumah ludes terbakar. Tak lama kemudian, baru mobil milik Dinas Pencegahan Pemadam Kebakaran tiba di lokasi. Petugas pemadam langsung menyemprotkan sisa-sisa api dan asap. Fahmi, 25, warga sekitar mengatakan, dirinya melihat api mulai membesar bersama warga lainnya berusaha memadamkan api. “Saat kebakaran terjadi, rumah dalam keadaan kosong, sedangkan pemilik sedang berjualan. Warga yang lain langsung ke Jln. Denai un-

tuk memberitahukan kepada pemilik rumah,” ujarnya. Pemilik rumah Napitupulu dan istrinya sangat terkejut melihat rumahnya terbakar yang setiap harinya mereka tinggalkan sejak pagi dan pulang menjelang larut malam karena mencari nafkah berjualan buahbuahan di Jln Denai. Kapolsek Percut Seituan AKP Ronald Sipayung ketika dikonfirmasi menyebutkan, penyebab kebakaran masih dalam penyelidikan. “Hingga saat ini kita masih menyelidiki penyebab kebakaran tersebut. Tidak ada korban jiwa dalam kebakaran tersebut,” sebutnya. (h04)

MEDAN (Waspada) : Masyarakat sudah mulai cerdas menentukan pilihan yang akan di usung menjadi calon perwakilan di legislatif daerah maupun pusat. Penilaian tersebut disampaikan Calon DPR RI Dapil 1 Sumut Purnama D Napitupulu Sitompul (foto), di Medan, Selasa (5/11). Kata dia, kecerdasan masyarakat berdasarkan data yang dia himpun saat bertatap muka langsung dengan warga di Sergei, Deliserdang, dan Tebingtinggi. Umumnya, menurut Purnama, masyarakat menyadari bahwa wakil rakyat yang sebenarnya adalah mereka yang pada awal pencalonan sudah melakukan sosialisasi diri kepada masyarakat yang akan memberikan suara. Selain itu tidak memberikan janji yang mulukmuluk, tetapi langsung berbuat

di tengah masyarakat. “Dari data yang saya himpun bersama tim kecil di daerah Sergai, Tebingtinggi, dan sebagian Deliserdang masyarakat sudah mengharapkan wakilwakilnya nanti adalah orang yang datang kepada mereka sebelum pemilihan berlangsung. Bahkan ada yang mengharapkan calon mereka untuk duduk di legislatif adalah orang yang memiliki kepekaan sosial dan memberikan pokok pikiran yang bisa membangun dan memberdayakan masyarakat dengan potensi yang ada, sehingga ada perubahan dalam kehidupan mereka, terutama pada aspek perubahan ekonomi,” kata Sitompul alumni SMAN 5 Medan dan pernah menjadi Paskibra Nasional tahun 1977. Masyarakat mengharapkan agar calon yang mereka pilih

adalah sosok yang akan kembali lagi kedaerah pemilihan setelah terpilih. Bukan seperti yang terjadi selama ini, sebelum terpilih selalu berkunjung dan setelah terpilih tidak lagi memperhatikan masyarakat yang memberikan suara saat pemilihan berlangsung. “Dari tiga kabupaten/kota yang ada, saya melihat aspek yang sangat didambakan oleh masyarakat adalah perbaikan jalan, sebagai sarana utama untuk berhubungan dengan daerah lain, terutama di Sergei, yang belum lama ini terkena imbas banjir. Hal ini sangat penting diperhatikan agar mereka bisa berkembang perekonomiannya,” tutur Sitompul yang mengaku mulai menggalakkan berbagai kegiatan kepemudaan bidang olahraga, keterampilan, dan pertanian/perikanan di Sergei. (m37)

Mahasiswa Penganiaya Anggota Brimob Akan Diberi Sanksi Akademik MEDAN (Waspada): Wakil Rektor III Universitas Muhammadiyah Sumatera Utara Muhammad Arifin Gultom mengaku sangat prihatin atas terjadinya peristiwa penganiayaan anggota Patra Brimob Poldasu Brigadir M Suwandi, kemarin. “Jika benar pelaku penganiayaa itu mahasiswa kita, tentu ada sanksi akademik yang diberikan sesuai ketentuan yang berlaku di universitas. Begitu pun kami tetap menjunjung tinggi azas praduga tak bersalah, “ kata Gultom menjawab Waspada, Senin (4/11). Menurut dia, pihaknya terus memantau kasus tersebut. Artinya, proses hukum yang sedang berjalan tetap akan menjadi pedoman dan dihormati. “Kita hormati proses hukum yang sedang berjalan karena itu kewenangan aparat penegak hukum.

Jika kasus ini sudah memiliki kekuatan hukum tetap, maka sanksi akademik pasti bergulir,” sebutnya. Namun yang jelas pada prinsipnya, kata Gultom, pihaknya menyayangkan peristiwa itu. Dia berharap kedepan tidak pernah terjadi lagi. Mahasiswa sebagai kaum intelektual dan agen perubahan, harus menjadi contoh bagi adik-adiknya. “Sebagai kalangan akademik kita imbau kepada seluruh mahasiswa baik dari perguruan tinggi negeri dan swasta di Sumut, agar tetap menjaga citranya sebagai kaum intelektual penerus tongkat estafet kepemimpinan bangsa ini kedepan,” ujarnya. Dia berharap, para mahasiswa harus menghindari segala bentuk perbuatan pidana atau tindakan yang merusak citranya

sebagai kalangan intlektual. Mahasiswa adalah harapan keluarga, agama, dan bangsa jadi jangan nodai itu dengan karakter buruk. Untuk itu, kata dia, sebagai kaum intelektual, mahasiswa selalu berkata dan berprilaku baik mencerminkan sosok pemimpin dan bukan malah merusak citranya selaku generasi penerus bangsa. Seperti diberitakan, anggota Patra Brimob Poldasu Brigadir M Suwandi, 31, menjadi korban penganiayaan yang diduga dilakukansekitar20priadiJln.PatimuraMedan, Minggu (3/11) dinihari. Salah seorang pelaku diduga ketua dari kelompok yang melakukan penganiayaan itu berinisial MARB, 20, mahasiswa salah satu perguruan tinggi swasta, berhasil dibekuk korban Brigadir Suwandi. (m49)


WASPADA Rabu 6 November 2013

Waspada/Hendrik Prayitno

PARA pengungsi yang berasal dari desa Suka Meriah, berkumpul di Masjid Nurul Awaliah, Desa Payung, Kecamatan Payung Tanah Karo, Selasa 5/ 11. Masjid tersebut menampung 120 jiwa pengungsi.


Waspada/Hendrik Prayitno

DAPUR UMUM: Para pengungsi yang berasal dari desa Suka Meriah, membuat dapur umum di Masjid Nurul Awaliah Desa Payung Kecamatan Payung Tanah Waspada/Dede Basri Hasibuan Karo, Selasa 5/11. Masjid tersebut menampung 120 jiwa pengungsi. WISATAWAN berpose pasca erupsi Sinabung. Tepatnya di Puncak Gundaling.

Lembaga Survei Harus Umumkan Pemberi Dana JAK ARTA ( Waspada): Lembaga survei politik harus berani mengumumkan siapa penyandang dana dari hasil penelitiannya. Sikap itu merupakan sebagai bagian dari kode etik lembaga. Dengan mengumumkan sumber dananya, masyarakat mengetahui secara transparan. “Memang sebuah lembaga survei itu mestinya memenuhi kriteria, pertama, bisa dipertanggunjawabkan hasil penelitiannya, kedua, tidak asalasalan dan ketiga mengu-

mumkan ke publik penyandang dananya,” kata peneliti Lembaga Ilmu Pengetahuan Indonesia (LIPI) Firman Noor dalam diskusi “Etika Lembaga Survei” di Jakarta, Senin (4/11). Menurut Firman, memasyarakatkan poling-polling atau hasil survei bukanlah sesuatu yang menakutkan, apalagi harus dicurigai. Aksi ini merupakan kegiatan akademis yang logis. “Karena banyak manfaat dari survei, bahkan bisa mendewasakan masyarakat,” tegasnya. Terkait adanya upaya pe-

ngaturan terhadap survei, lanjut Firman, tidak perlu pemerintah mengatur-atur soal survei itu. “Meski saat ini ada kecenderungan dan trend untuk memanfaatkan hasil survei, namun di sisi lain lembaga survei juga sebenarnya tidak bisa mempengaruhimasyarakat,”tambahnya. Sebagai contoh, lanjut Firman, pada pemilu 1999 dalam beberapa survei PAN masuk dalam tiga besar partai pemenang pemilu. Justru malah PKB tidak masuk. “Hasilnya, ternyata PKB malah yang tercantum

Per September 2013 Wholesales Daihatsu 133.711 Unit JAKARTA (Waspada): Wholesales September 2013 mencapai 133.711 unit yang merupakan tertinggi dibandingkan dengan delapan bulan sebelumnya 2013. Ini menjadikan September 2013 sebagai bulan istimewa. Selain karena PT Astra Daihatsu Motor (ADM) meluncurkan Astra Daihatsu AYLA juga karena adanya penyelenggaraan Pameran Otomotif terbesar di Asia Tenggara, Indonesia International Motor Show (IIMS) tanggal 19-29/9/2013. Selama 11 hari IIMS 2013, total perolehan SPK Daihatsu mencapai 923 unit. Kontribusi terbesar SPK selama IIMS 2013 datang dari Ayla, Sahabat Baru Keluarga, yang mencapai 511 unit (55 persen). Kemudian disusul Xenia 158 unit (17 persen), dan Terios 154 unit (17 persen). Sedangkan yang lain seperti Gran Max Pick Up terjual 34 unit (4 persen) dan Gran Max Minibus 21 unit (2 persen). Sementara Sirion mencapai 25 unit (3 persen) dan Luxio meraih 20 unit (2 persen). Nampak pada IIMS 2013 Astra Daihatsu AYLA telah menjadi idola baru Sahabat Daihatsu. Melewati bulan September 2013 penjualan wholesales Daihatsu selama periode 9 bulan 2013 berhasil mencapai 133.711 unit atau naik 10,8 persen dibandingkan 9 bulan 2012 sebanyak 120.664 unit. Sehingga market share wholesales Daihatsu mencapai 14,7 persen dari total pasar domestik sebesar 908.271 unit. Sementara retailsales Daihatsu mencapai 129.644 unit, naik 7,8 persen dibandingkan periode yang sama 2012 sebanyak 120.213 unit. Sehingga pangsa pasar retailsales Daihatsu mencapai 14,7 persen. Dengan demikian, Daihatsu menduduki posisi kedua volume penjualan dan pangsa pasar nasional per September 2013. Jika kita bandingkan rincian penjualan Daihatsu bulan Agustus dan September 2013, maka Astra Daihatsu AYLA telah berhasil menjadi andalan baru Daihatsu melengkapi lini produk yang sudah ada. Selama September 2013, Ayla telah terjual 4,377 unit (24 persen) menggeser Xenia yang bulan Agustus sebelumnya 4.961 unit (42 persen) menjadi 5.000 unit (28 persen) di bulan September, meskipun

secara volume bukannya berkurang malah justru bertambah. Sementara Type yang lain hanya menunjukkan sedikit pengurangan dari sisi prosentase kontribusi, namun tetap bertumbuh secara volume. Ini menunjukkan bahwa pasar Daihatsu masih terus bertumbuh sesuai pertumbuhan pasar otomotif nasional. Untuk periode 9 bulan, Januari – September 2013 rincian akumulasi wholesales Daihatsu adalah sebagai berikut. Xenia masih menjadi yang terbesar dengan 53.509 unit (40 persen), disusul Gran Max sebanyak 46.105 unit (34 persen) dimana Gran Max (GM) bisa dibagi dua menjadi GM Pick up 34.852 unit (26 persen) dan GM Minibus 11.253 unit (8 persen). Menyusul posisi ketiga adalah Terios sebanyak 19.484 unit (15 persen). Disusul Sirion 5.640 unit (4 persen), Luxio 4.596 unit (3 persen) dan pendatang baru Ayla 4.377 unit (3 persen). Sementara retailsales Daihatsu Januari September 2013 mencapai 129.644 unit terdiri dari Xenia 52.442 unit (40 persen). Disusul Gran Max (GM) terjual 45.487 unit (35 persen) yang terdiri dari GM Pick Up sebanyak 34.164 unit (26 persen) dan GM Minibus 11.323 unit (9 persen). Kemudian Terios mencapai 19.186 unit (15 persen), Sirion terjual 5.588 unit (4 persen), Luxio terjual 4.609 unit (4 persen) dan anggota baru Daihatsu Ayla 2.332 unit (2 persen). “September 2013 menjadi bulan yang istimewa bagi kami. Kemunculan AYLA sebagai Sahabat Baru Keluarga telah memberikan alternative pilihan bagi sahabat Daihatsu. Kami bersyukur animo masyarakat terhadap AYLA sangat positif yang tercermin pada capaian angka penjualan. Jika kita lihat trend selama sembilan bulan 2013, pasar otomotif domestik tumbuh sekitar 10 persen-11 persen dari 816.317 unit (Jan-Sep 2012) menjadi 908.279 unit (JanSep 2013). Kami optimis dalam 3 bulan mendatang penjualan Daihatsu akan terus tumbuh sebagaimana pertumbuhan pasar. Untuk itu kami terus meningkatkan kualitas pelayanan di seluruh kantor cabang Daihatsu,” ungkap Amelia Tjandra, Direktur Marketing PT Astra Daihatsu Motor.(m07/rel)

dalam tiga besar. Inilah kendala dari lembaga survei dalam hal metodologi,” tuturnya. Polling atau survei itu merupakan wilayah civil society, katanya, jadi biarkan saja lembaga survei berkembang secara alamiah saja. “Intinya, biarkan saja pasar yang menilai lembaga survei tersebut. Yang penting lembaga itu terus memperbaharuai metodologinya dan bertanggungjawab,” ucapnya. Di AS saja ada sekitar 2000an lembaga survei, paparnya, sementara di Indonesia baru mencapai ratusan saja. Dengan banyaknya hasil survei di AS, masyarakat menjadi terbiasa. “Sayang di Indonesia ini belum terbiasa, masyarakat masih

asing. Elit politik juga asing. Begitu juga lembaga survei belum bertanggungjawab,”kataFirman. Idealnya, kata Firman lagi, status lembaga survei itu independen, sehingga hasilnya bisa obyektif. “Toh manfaat dari survei itu banyak dan bisa mendewasakan masyarakat. Juga bisa mengubah kualitas kebijakan pemerintah untuk mendekatkan diri pada masyarakat,”tukasnya. Bukan Pesanan Anggota DPD RI Wahidin Ismail dalam diskusi itu mengingatkan dampak hasil lembaga survei bagi masyarakat itu sangat besar, meski hasil survei itu belum tentu benar dan belum tentu bisa diper-

Pemerintah Tetapkan Nilai Ambang Batas Tes CPNS JAKARTA (Waspada): Pemerintah menetapkan nilai ambang batas (passing grade) kelulusan tes kompetensi dasar (TKD) CPNS 2013 untuk pelamar umum. Ketetapan itu tertuang dalam Peraturan Menteri Pendayagunaan Aparatur Negara dan Reformasi Birokrasi (PANRB) No. 35/2013 tentang Nilai Ambang Batas TKD Seleksi CPNS dari Pelamar Umum tahun 2013. Menteri PANRB Azwar Abubakar mengungkapkan, nilai ambang batas TKD adalah nilai minimal yang harus dipenuhi oleh setiap peserta ujian seleksi CPNS. “Peserta yang memenuhi nilai ambang batas TKD dapat mengikuti tahapan seleksi selanjutnya,” ujar Azwar kepada wartawan, di Jakarta, Senin (4/11). Dalam peraturan itu dibedakan passing grade antara peserta tes dengan sistem computer assisted test (CAT) dengan lembar jawab komputer (LJK). Pasalnya, jumlah soal antara keduanya juga berbeda. Untuk CAT, jumlah soalnya 100, terdiri dari 35 soal karakteristik pribadi, 30 soal intelegensia umum, dan 35 soal wawasan kebangsaan. Sedangkan tes dengan sistem LJK, jumlah soalnya ada 120, yakni karakteristik pribadi 45 soal, intelegensia umum 35 soal, dan wawasan kebangsaan 40 soal. Dijelaskan, seperti halnya passing grade tahun lalu, nilai untuk setiap kelompok soal harus terpenuhi, tidak berdasarkan akumulasi nilai. Untuk peserta TKD dengan sistem CAT nilai karakteristik pribadi minimal harus mencapai 60% dari nilai maksimal yakni 175, yakni 105. Sedangkan intelegensia umum, nilai minimalnya 75 (50%) dari nilai maksimal, dan wawasan kebangsaan nilai minimalnya 70. Adapun passing grade untuk peserta TKD dengan sistem LJK, nilai karakteristik pribadi minimal 108, intelegensia umum minimal 70, dan wawasan kebangsaan 64. Dijelaskan juga bahwa penilaian untuk tes karakteristik pribadi (TKP) tidak ada nilai 0 (nol), tetapi kisaran skornya 1 – 5. Sedangkan nilai untuk intelegensia umum dan wawasan kebangsaan, kalau salah 0 (nol) kalau benar nilainya 5 (lima). Azwar Abubakar menekankan kepada para pejabat pembina kepegawaian instansi pemerintah penyelenggara seleksi CPNS dapat menentukan kelulusan TKD CPNS di instansi masing-masing daerah sesuai dengan ketentuan Permen PANRB No. 35/2013 ini. Menurut rencana, Panselnas CPNS 2013 akan mengumumkan hasil TKD bagi yang menggunakan LJK pada tanggal 4 Desember 2013. Sementara yang menggunakan CAT peserta dapat mengetahui hasilnya saat ujian berlangsung, sehingga bisa memperhitungkan sendiri, apakah dia lulus atau tidak. (dianw)

tanggungjawabkan secara akademis. Selain itu makin banyaknya lembaga survei yang muncul menjelang pemilu 2014 ini, maka Komisi Pemilihan Umum (KPU) perlu mengatur lembaga survei itu agar tidak membingungkan masyarakat. “Kita bersukur karena masyarakat tidak menerima secara mentah-mentah dari sebuah hasil survei. Mestinya lembaga survei itu independen dan tetap berpijak pada nilai-nilai aka-

demis dalam menjalankan surveinya. Bukan sesuai pesanan,” tegasnya. Menurut dia, bagaimana pun, kataWahidin, ada masalah dengan hasil lembaga survei akhir-akhir ini, sehingga perlu diatur oleh KPU. “Motivasi, metodologi, pendanaan, latarbelakang survei dan sebagainya itu perlu diatur dengan transparan. Sementara politisi Fraksi PKS MPR RI Agus Purnomo

berpendapat KPU harus mengatur agar lembaga survei itu menjaga netralitasnya. Pengaturan lembaga survei oleh KPU itu menurut Agus, karena pihaknya khawatir opini yang dibangun bisa mengalihkan pilihanpilihan politik masyarakat, sebelum pemilu itu sendiri dilaksanakan. “Apalagi survei yang dilakukan sering tidak melibatkan masyarakat di bawah, partai atau capres itu sendiri,” ujarnya.(J07)

Zaidan BS Peroleh Anugrah Penggerak Budaya Dari Malaysia MEDAN (Waspada): Budayawan Melayu dan jurnalis senior Sumatera Utara, H Zaidan BS, mendapat anugrah sebagai ‘Tokoh Penggerak Budaya’ dari Dunia Melayu Dunia Islam (DMDI) yang diserahkan langsung oleh Ketua Menteri Melaka, Y.A.B. Datuk Seri Ir Hj. Idrus bin Hj Haron, di Hotel Hatten, Bandar Hilir Malaka, 28 Oktober 2013 lalu. Penyerahan anugrah yang merupakan rangkaian kegiatan Konvensyen Dunia Melayu Dunia Islam ke-14 tahun 2013 tersebut, diberikan kepada Zaidan BS sebagai pribadi dalam kiprahnya pada pemikiran pembangunan kebudayaan khususnya Melayu, baik di Sumatera Utara maupun di Malaysia. Aktivitas itu telah lama diamati terutama oleh Ketua GAPENA (Gabungan Penulis Nasional) Malaysia) dan Pengurus ISMA (Institut Seni Melaka). Prof. Datuk Wira DR Abd. Latif Abu Bakar. Zaidan mendapatkan anugrah bersama dua tokoh Indonesia lainnya yakni Dekan Fak. Sastra Universitas Raja Ali Haji Provinsi Kepulauan Riau, Drs H Abdul Malik M.Si., dan Ketua Yayasan Tun Sri Lanang di Acheh, Datuk Pocut Haslinda Syahrul yang juga pewaris keturunan Tun Sri Lanang. Dua tokoh Malaysia juga mendapat anugrah sama yakni Sutradara Film Datin Paduka Shuhaimi Baba dan Pelukis Negara Ismail Embong. Pokok pikiran Zaidan yang selalu menjadi pembicaraan menarik adalah keyakinannya bahwa Melayu adalah bangsa


ZAIDAN BS saat menerima anugerah tokoh penggerak budaya dari dunia melayu dunia Islam yang diserahkan Ketua Menteri Melaka YAB Datuk Seri Ir Hj Idrus bin Hj Haron. pada tataran kultural dan bukan etnik. Melayu adalah kumpulan dari berbagai etnik dan menyatakan dirinya Melayu, berbudaya Melayu dan beragama Islam. “Itu sebabnya Melayu ada di Indonesia, Malaysia, Thailand, Burma, Bosnia, Afrika dan belahan Negara lainnya,” ujar Zaidan. Zaidan juga menyuarakan agar Melaka menjadi jendela tamadun Melayu. Sebab, “Sejak dahulu selain menjadi pusat perdagangan dunia, Melaka merupakan centrum kebudayaan Melayu Global.” Dalam kegiatan yang rutin diselenggarakan DMDI tersebut, kali ini Zaidan BS didampingi Grup Seni “Cempaka Deli” asuhan Dato’ Seri H Syamsul Arifin, SE, yang sudah enam tahun menjadi pengisi acara tetap pada kegiatan DMDI. Grup Pembina dan pemain grup ini diantaranya DR HM Takari, Dra Hj Emmy Erwina,

(Can. DR), Dra Tarwiyah, Eva Gusmayanti, Yusti, Mulkan Azhar, Ahmad Husin, Zulkarnain Lbs, Irham Tambuse dan beberapa lainnya. Presiden DMDI, Datuk Seri Mohd. Ali Rustam, menyebutkan anugrah itu diberikan atas usaha dan pengorbanan mereka dalam memartabatkan warisan peradaban Melayu serumpun. Pengiktirafan itu diyakini dapat merapatkan lagi hubungan antara kedua negara sekaligus mewujudkan kesatuan serta perpaduan dalam kalangan umat Melayu dan Islam. “Tokoh-tokoh yang dipilih terdiri daripada penggerak seni budaya dan adat Melayu yang telah memainkan peranan penting di rumpun ini termasuk di Malaysia, Indonesia, Brunei dan Singapura,” ujar Datuk Seri Mohd. Ali Rustam, dalam sidang paripurna Konvensyen DMDI Ke-14.(rel)

Catatan Peristiwa Nasional Oktober 2013 2 Okt: Ketua MK Ditangkap KPK KPK menangkap Ketua MK Akil Mochtar di rumah dinasnya bersama anggota DPR RI Chairun Nisa serta Bupati Gunung Mas Hambit Binti Rabu (2/10). Dua orang lainnya yakni seorang pengusaha berinisial DH dan teman Bupati Hambit Binti. Uang suap yang diterima Akil berupa dolar Singapura bernilai Rp 23 miliar. Dua hari sebelumnya KPK mendapatkan informasi akan terjadi penyerahan uang suap terkait sengketa Pilkada Kabupaten Gunung Mas. Penyidik KPK menyegel mobil dinas Akil Mochtar Berplat Nomor RI 9. Akil juga ditetapkan sebagai tersangka untuk suap terkait Pilkada Lebak, Banten. 7 Okt: Presiden Buka KTT APEC Presiden Susilo Bambang Yudhoyono (SBY) mengemukakan, Forum Kerjasama Ekonomi Asia Pasifik (APEC) akan menghadapi tantangan yang besar karena sejumlah negara anggotanya hingga sekarang belum keluar dari krisis yang sedang berlangsung. Untuk itulah, kerja sama APEC sangat penting dalam menghadapi krisis sekarang ini sesuai dengan tema yang diambil dalam Konferensi Tingkat Tinggi (KTT) kali ini. “Oleh karena itu, pertemuan para pemimpin APEC ini, akan menjadi sangat berguna,” kata Presiden SBY saat membuka secara resmi pertemuan APEC Business Advisory Council (ABAC) di Sofitel, Nusa Dua, Bali, Senin (7/10). 7 Okt: Ruhut Sitompul Mundur Ruhut Sitompul didampingi istrinya, Diana Lovita akhirnya menyatakan mengundurkan diri sebagai calon ketua Komisi III DPR.Sementara penolakan yang dilancarkan sejumlah anggota Komisi III DPR terus berlangsung hingga rapat pleno penetapan ketua Komisi III DPR, yang dipimpin Wakil Ketua DPR Priyo Budi Santoso, Senin (7/10). Keputusan mundur yang disampaikan Ruhut di rapat pleno, merupakan keputusannya sendiri. Tarik menarik soal ketua Komisi III tsb sempat menghebohkan media cetak dan elektronik. 10 Okt: Bunda Putri Buat Pusing SBY Presiden Susilo BambangYudhoyono menyatakan keterangan bekas Presiden PKS Luthfi Hasan Ishaaq di Pengadilan Tindak

Pidana Korupsi Jakarta, Kamis (10/10), mengenai adanya orang yang dekat dengan Presiden dan dipanggil Bunda Putri adalah tidak benar. Presiden dalam keterangan pers di Pangkalan Udara Halim Perdanakusuma Jakarta, Kamis malam, setelah tiba dari kunjungan di Brunei Darussalam, mengatakan dalam persidangan yang berlangsung di Pengadilan Tindak Pidana Korupsi Jakarta pada Kamis, Luthfi Hasan menyampaikan keterangan bahwa Bunda Putri dekat dengan Presiden dan mengetahui informasi mengenai reshuffle kabinet. “Saat bersaksi untuk terdakwa Fathanah di Pengadilan Tipikor di Jakarta, Kamis, Luthfi mengatakan tujuannya menemui Bunda Putri terkait informasi reshuffle kabinet. Apa hubungannya dengan reshuffle kabinet? Bunda Putri orang yang sangat dekat dengan Presiden SBY 1.000 persen Luthfi bohong. Dia sangat tahu kebijakan reshuffle 2.000 persen bohong, kalau ada reshuffle kabinet istri saya pun tidak tahu. Tidak semua menteri tahu, yang saya ajak bicara Wakil Presiden, sekretarisnya Mensesneg. Kalau menteri kebetulan di bawah menko, menko yang saya panggil,” kata Presiden. Nama Bunda Putri mencuat setelah pemutaran rekaman pembicaraan antara anak Ketua Dewan Syuro PKS, Ridwan Hakim, dengan seorang perempuan bernama Bunda Putri yang mengesankan Bunda Putri dapat mengatur sejumlah pejabat pemerintahan. 16 Okt: Auditor Utama BPK Dalangi Pembunuhan Gatot Supiartono, auditor utama yang juga pejabat eselon I Badan Pemerika Keuangan (BPK), Rabu (16/10) ditetapkan sebagai tersangka pembunuh istri sirinya sendiri, Holly Angela Ayu, 37. Dari hasil pemeriksaan selama lebih 10 jam oleh penyidik Jatanras Polda Metro Jaya, Gatot mengakui otak pembunuhan yang terjadi di apartemen Kalibata City, Jaksel, pekan lalu itu adalah dirinya. Kasus itu sendiri sempat menggegerkan warga ibu kota, terutama masyarakat penghuni dan sekitar apartemen Kalibata City. Bersamaan dengan terbunuhnya Holly, warga juga dikejutkan tewasnya seorang lelaki yang terjatuh dari lantai 8 apartemen itu, yang ternyata salah seorang eksekutor pembunuh Holy. Gatot dijerat pasal 340 KUHP tentang pembunuhan berencana dengan ancaman maksimal hukuman mati atau 20 tahun penjara. Pihak

kepolisian menyatakan, Gatot nekad membunuh isterinya itu Karen tak tahanterus dirongrong. Selain meminta materi berupa apartemen, mobil dan materi lainnya, Holly juga mendesak agar Gatot menceraikan istri pertamanya. Yang terakhir inilah yang menjadi puncak kekesalan Gatot. 17 Okt: Andi Malaranggeng Ditahan KPK Mantan Menteri Pemuda dan Olahraga (Menpora) Andi Alfian Mallarangeng, ditahan KPK, Kamis (17/10) sebagai tersangka kasus proyek Sport Center Hambalang. Usai diperiksa selama 6 jam , Andi yang keluar dari gedung KPK sekitar pukul 16:00 WIB, terlihat mengenakan baju tahanan KPK berwarna oranye. Kemudian Andi dinaikan kedalam mobil tahanan KPK . Mantan Juru Bicara Presiden Susilo BambangYudhoyono (SBY) itu ditahan di Rutan KPK. Andi yang menjadi tersangka hampir 1 tahun dalam kasus proyek Sport Center Hambalang , Andi diduga melanggar Pasal 2 ayat 1 dan Pasal 3 Undang-Undang Pemberantasan Tindak Pidana Korupsi. 21 Okt: Fathanah Dituntut 17,5 Tahun Penjara Jaksa Penuntut Umum (JPU) Komisi Pemberantasan Korupsi (KPK) menuntut Terdakwa Ahmad Fathanah 17, 5 tahun penjara atas tindak pidana suap dan pencucian uang terkait pengurusan kuota impor daging sapi di Kementerian Pertanian (Kementan), Senin (21/10). Untuk tindak pidana korupsi Fathanah dituntut tujuh tahun enam bulan penjara dan denda Rp 500 juta subsider enam bulan kurungan. Sedangkan untuk tindak pidana pencucian uang, Ahmad Fathanah dituntut hukuman 10 tahun penjara dan denda Rp 1 miliar subsider satu tahun kurungan. 22 Okt: Gempa Guncang Aceh Gempa bumi berkekuatan 5,6 SR, yang mengguncang Provinsi Aceh, Selasa(22/10) pukul 12:40, mengakibatkan puluhan rumah rusak. Informasi Waspada peroleh, di Sigli sebanyak 83 rumah, satu masjid dan satu gedung Sekolah Dasar di Desa Neubok Badeuk rusak. Sementara dua warga dilaporkan menderita luka berat akibat tertimpa bangunan. Sedangkan, delapan Ruko di Pusat Pasar Kec. Tangse, bagian atapnya yang terbuat dari beton amblas.

23 Okt: Presiden SBY Mengaku Korban Pers Presiden Susilo Bambang Yudhoyono mengatakan dirinya merupakan salah seorang korban pers, namun ia juga berterimakasih karena kritikan dan kecaman yang dilakukan media telah menjadi cambuk untuk melaksanakan tugasnya lebih baik dan menjadikan dirinya bertahan. “Saya salah satu korban pers, tetapi sekaligus saya berterimakasih kepada pers,” kata presiden saat memberikan sambutan dalam silaturahim dengan Pengurus Pusat Persatuan Wartawan Indonesia (PWI) periode 2013-2015 di Banjarbaru, Kalimantan Selatan, Rabu (23/10). Presiden melanjutkan; “kalau saya tidak dikritik, dikecam sejak hari pertama saya jadi presiden, mungkin saya sudah jatuh, mungkin saya semau-maunya, mungkin gegabah dalam mengambil keputusan, mungkin kebijakan saya malah aneh-aneh, mungkin saya merasa wah saya bisa memimpin bisa berbuat apa saja, saya berterimakasih terhadap semua itu.” 24 Okt: Sinabung Meletus Lagi Gunung Sinabung kembali erupsi dengan menyemburkan abu vulanik setinggi 3 kilometer. Letusan Sinabung disertai dentuman keras yang terdengar hingga radius 10 kilometer, Kamis (24/ 10) sekira pukul 05.50,. Tiga kecamatan terkena abu vulkanik dan beberapa sekolah terpaksa diliburkan karena tebalnya debu mengganggu pernafasan dan pandangan mata. Ratusan jiwa terdiri dari 130 kepala keluarga (KK) mengungsi di jambur Kec. Payung. 25 Okt: Kapolri Sutarman Berjanji Presiden Susilo Bambang Yudhoyono (SBY) di Istana Negara, Jumat (25/10) melantik Komisaris Jenderal (Pol) Sutarman sebagai Kepala Kepolisian RI (Kapolri). Presiden mengangkat sumpah Komjen Sutarman dan menyaksikan penandatanganan berita acara pengangkatan sumpah jabatan. Presiden berharap masyarakat mendukung Komjen Sutarman melaksanakan tugastugasnya sebagai Kapolri menggantikan Jenderal Timur Pradopo. Sementara Komjen Sutarman berjanji akan memberantas premanisme dan perjudian. “Premanisme, perjudian dan lainnya harus kita bersihkan dan kita berikan target-target ke wilayah untuk penegakan hukum,” ujar Sutarman.

Luar Negeri


WASPADA Rabu 6 November 2013

Pembajakan Bus Disertai Penikaman Di Norwegia STAVANGER, Norwegia (AP): Seorang pria bersenjata pisau membajak satu bus di daerah pedesaan Norwegia dan membunuh sopirdanduapenumpangsebelumdiaditahanolehpihakberwenang, kata para pejabat. Polisi di daerah Sogn dan Fjordane di barat Norwegia memberikan beberapa rincian tentang tersangka, tetapi menggambarkan dia sebagai warga setempat berasal dari Sudan Selatan. Pengacara Polisi Trine Erdal mengatakan tersangka berada di awal 30an, bukan dalam usia 50-an seperti dikatakan polisi sebelumnya. Aksi pembajakan itu terjadi di sebuah jalan terpencil di dekat kotamadya Ardal, sekitar 220 km dari baratdaya Oslo, Norwegia. Seorang pria penduduk lokal di daerah itu menusuk tiga orang di dalam bus hingga tewas. MenurutABCNews,Senin(4/11),pelakuadalahwargalokal,namun dia berasal dari Sudan Selatan. Menurut keterangan salah seorang petugaspolisi,TrineErdal,pelakumasihberusiaawal30-an.Sementara tiga korban tewas terdiri dari dua pria berusia sekitar 50-an. Keduanya merupakansupirbusNorwegia.Sedangkansatukorbanlainnyayakni penumpang wanita asal Swedia berusia 19 tahun. Erdal memastikan ketiganya ditusuk hingga tewas. Dia menambahkan tidak ada lagi penumpang lain di bus itu, selain ketiga korban. Hal serupa juga ditegaskan oleh petugas polisi lainnya, Joern Lasse Foerde Refsnes. “Untuk sementara ini, saya tidak memiliki informasi yang mengindikasikan ada penumpang lain di dalam bus selain ketiga korban tadi,” ujar Refsnes kepada stasiun televisi Norwegia, TV2. Pelaku lantas ditangkap oleh petugas pemadam kebakaran yang mengira adanya laporan soal kecelakaan lalu lintas. Petugas damkar lalu menyerahkan pelaku kepada polisi untuk ditahan dan dibawa ke RS supaya dia menerima perawatan medis. Kantor berita Norwegia, NTB, melaporkan pelaku juga terluka dalam aksi tersebut namun tidak serius. Hingga kini polisi belum merilis identitas pelaku dan masih terus menyelidiki untuk mencari motif aksi penusukan. Usai terjadi aksi pembajakan itu, kepolisian Oslo langsung menurunkan unit anti teror. Menurut laporan NTB, bus dengan rute serupa juga pernah diserang di tahun 2003 silam, ketika seorang warga asal Ethiopia menusuk hingga tewas supir bus itu.(m10)

PM Thai Pertahankan RUU Amnesti, Senator Menolak BANGKOK,Thailand (AP): PM Thailand mempertahankan satu RUU Amnesti yang berbau politik yang telah memicu beberapa aksi protes di ibukota Bangkok. Para penentang mengatakan RUU itu direkayasa untuk memulangkan mantan PM Thaksin Shinawatra kembali dari pengasingannya di luar negeri. Adik perempuanThaksin, yang sekarang menjabat PM,Yingluck Shinawatra, mengatakan dalam satu pidato televisi Selasa (5/11) bahwa amnesti itu dapat menyelesaikan perpecahan politik yang terjadi sejak lama di Thailand. RUU itu akan memberikan amnesti kepada para pemimpin dan yang lainnya yang terlibat dalam berbagai konflik, yang kadangkadang keras. RUU itu telah disahkan oleh majelis rendah parlemen Jumat. Satu kelompok senator mengatakan Selasa mereka akan menolak RUU tersebut bila diperdebatkan pekan depan. Yingluck mengatakan dia yakin majelis rendah akan menerima keputusan Senat itu, yang menegaskan bahwa pemerintahnya tidak akan menekan parlemen lebih jauh jika Senat menolak. Banyak senator Thailand secara terbuka menentang Rancangan Undang Undang (RUU) Amnesti yang dijadwalkan akan dibahas di majelis tinggi Senin (11/11) depan. Dalam pertemuan Senat Minggu, Senator Uttaradit, Naruemol Siriwat, meminta ketua DPR bahwa RUU yang akan diperdebatkan dalam tiga pembacaan pendapat fraksi itu dan berlangsung dalam satu hari tersebut dilaporkan secara luas. Dia mendesak para senator untuk bertindak dengan bermartabat, netralitas dan kemandirian mengenai nasib tujuh pasal RUU Amnesti itu. Undang-undang kontroversial itu disahkan dalam pembacaan pendapat ketiga atau pendapat akhir oleh DPR pekan lalu, yang kemudian memicu reaksi marah meluas di kalangan beberapa orang Thailand di seluruh negeri, khususnya di Bangkok, di mana beberapa kelompok masyarakat sipil telah berunjuk rasa terhadap RUU itu. Beberapa senator mengambil tempat kemarin untuk berbicara menentang RUU pemberian amnesti kepada pelaku yan berselimut dalam kasus pidana dan korupsi. Banyak yang mengatakan mereka lebih suka RUU asli, yang diusulkan oleh anggota parlemen Pheu Thai, Vorachai Hema. Versi asli itu kemudian diubah dalam berbagai bagian pada pembacaan pendapat kedua. Senator Petchaburi, Sumon Sutaviriyawat, mengatakan sangat percaya RUU itu akan merangsang lebih banyak protes, dan bahwa orang mengharapkan Senat melakukan pembalikan resolusi Majelis Rendah itu. Para senator Charin Harnsuebsai dari Tak dan Singchai Thungthong dari Uthai Thani mengatakan mereka bermaksud untuk memilih RUU asli, yang diusulkan oleh Vorachai, tetapi berubah pikiran mereka. Menunjuk senatorVicharn Sirichai-ekawat bergabung dengan pendapat-pendapat pasangannya dan mengatakan pekan depan debat akan menentukan apakah senator bertindak independen. Ketua Senat mengatakan Majelis Tinggi akan membahas RUU itu besok, tetapi ia percaya majelis tidak akan melewati tiga bacaan pendapat dalam sekali persidangan.(bbc/m10)

Pertempuran Sengit Berkobar Di Ibukota Libya, Tripoli TRIPOLI, Libya (Antara/Reuters): Pertempuran seru menggunakan meriam dan senjata anti-pesawat meletus Selasa (5/11) di ibukota Libya, Tripoli, kata para saksimata. Pertempuran itu terjadi antara milisi-milisi di daerah Suq alMuma, Tripoli Timur, kata seorang sumber milisi yang punya hubungan dekat dengan pemerintah dan menambahkan dia tidak memiliki informasi lebih jauh. Banyak wartawan di Tripoli mendengar suara baku tembak selama tiga jam. Satu laman Facebook menayangkana apa yang dikatakannya dua mobil yang terbakar dari lokasi pertempuran itu, kendatipun tidak dapat memverifikasi kebenarannya. Seorang pejabat kementerian pertahanan menolak memberi komentar, sementara tidak ada para pejabat lainnya dapat segera dihubungi. Libya penghasil minyak yang anggota OPEC (Organisasi Negara Pengekspor Minyak) menghadapi kekacauan dan anarki sementara pemerintah berusaha untuk mengekang milisi-milisi, geng-geng dan kelompok-kelompok garis keras Islam di negara yang beredar senjata tanpa izin dua tahun setelah mantan orang kuat Muammer Gaddafi disingkirkan.

Thai Airways Temukan Ban Pecah Di Pesawat Airbus BANGKOK,Thailand (AP):Thai Airways mengatakan pihaknya telah menemukan satu ban pecah pada pesawat Airbus A300600 setelah pesawat tersebut mendarat dengan selamat Selasa (5/11) di satu bandara di Thailand Utara. Ban belakang yang meledak itu ditemukan dalam satu pemeriksaan setelah Flight TG130 dari Bangkok mendarat di Chiang Rai, kata perusahaan itu dalam satu pernyataan. Dalam pernyataan itu disebutkan bahwa tak seorang pun dari 197 penumpang atau 10 anggota awak yang berada di dalam pesawat itu cedera. Para mekanik segera mengganti ban yang meletus itu dan setelah tertunda selama 55 menit penerbangan itu kembali ke Bangkok. Perusahaan penerbangan tersebut mengatakan pihaknya sedang menyelidiki sebab terjadinya gangguan itu. September lalu, satu pesawat Airbus 330-300 Thai Airways tergelincir di landasan pacu bandara utama Bangkok setelah roda pendaratnya tidak berfungsi, 14 penumpang cedera. (m10)

Hongkong Peringatkan Manila Sanksi Dalam Tragedi Sandera The Associated Press

PENYELIDIK polisi berdiri di luar satu bus setelah pembajakan di Aardal, barat Norwegia, Selasa (5/11) dinihari. Seorang pria bersenjata pisau membajak satu bus dan membunuh pengemudi dan dua penumpang sebelum dia ditahan oleh pihak berwenang, kata para pejabat.

Bangladesh Vonis Mati 152 Orang Karena Kasus Pemberontakan Tahun 2009 DHAKA, Bangladesh (AP): Satu pengadilan Bangladesh menjatuhkan vonis mati atas 152 terdakwa Selasa (5/11) terkait satu pemberontakan tahun 2009 yang dilakukan oleh para penjaga perbatasan yang tidak puas. Puluhan komandan militer tewas pada pemberontakan dua hari itu yang dicap brutal. Hukuman itu dijatuhkan dalam sidang massal yang melibatkan 846 terdakwa — suatu proses yang dikritik oleh kelompok hak asasi manusia yang mengatakan tindakan itu tidak kredibel dan bahwa setidaknya 47 tersangka meninggal dalam tahanan. Para penjaga perbatasan, yang dikenal pada saat pemberontakan sebagai Bangladesh Rifles, mengatakan mereka memberontak menuntut gaji sesuaidengankomandanmereka di tentara, tugas pada misi penjaga perdamaian PBB, yang datang dengan fasilitas yang lebih baik. Pemberontakan itu pecah di kompleks penjaga perbatasan Dhaka’, sebuah oasis di dalam kota yang lengkap dengan kebun

mawar dan kebun binatang kecil. Pada saat berakhirnya pemberontakan itu, diketahui 74 orang tewas, termasuk 57 komandan militer. Banyak mayat yang ditemukanbertumpukdisatulobang kecil dan mereka kemudian dimakamkan di beberapa kuburan massal. Kasus itu mengungkapkan adanya ketegangan yang dalam di antara pemerintah dan militer. Pihak militer sangat marah dengan PM Sheikh Hasina untuk bernegosiasi dengan pemberontak, bukannya membiarkan tentara menyerang. Di Bangladesh, sebuah negara di Asia Selatan sangat miskin dengan sejarah bencana,parapemimpinmilitertelah berusaha 21 kali untuk menggu-

lingkan pemerintah, dua kali berhasil. Pengadilan khusus tersebut menjatuhkanhukumanmatiatas 152tentaradalamperistiwaitu,yang antara lain dipicu oleh rendahnya gajidanburuknyakondisipasukan paramiliterbersenjataBangladesh Rifles (BDR) yang berpatroli menjaga perbatasan negara. “Sekurang-kurangnya 152 tentara BDR dihukum mati atas pembantaian perwira angkatan darat,” kata jaksa penuntut Baharul Islam di luar ruang sidang di Dhaka. Sebanyak 400 tentara lain dijatuhi hukuman penjara antara seumur hidup hingga beberapa tahun atas keterlibatan mereka dalam peristiwa tersebut, sementara sebanyak 270 tentara dibebaskan. “Kejahatan itu begitu mengerikan hingga mayat korban pun tidakmendapatkanhak-haknya,” kata hakim Mohammad Akhtaruzzaman dalam sidang yang penuh sesak di ibukota Dhaka saat membacakan keputusan. Ke-823 tentara tersebut didakwa dengan tuduhan pembu-

nuhan, penyiksaan, konspirasi, dan dakwaan lain dalam pemberontakan yang berlangsung selama 30 jam diawali dari markas BDRdiDhakadankemudianmenyebar ke markas-markas lain di seluruh negeri. Sekitar 6.000 tentara sudah diadili dalam puluhan sidang pengadilan khusus terkait peristiwa pemberontakanyangmenyebabkan 74 orang tewas, termasuk 57 perwira tinggi angkatan darat. Sebuah penyelidikan resmi yang dilakukan menyebutkan peristiwa tersebut dipicu oleh kemarahan terpendam selama bertahun-tahunakibatdiabaikannyapermintaankenaikangajidan perbaikan kesejahteraan tentara biasa,yangtidakmenyukaiatasan mereka yang bergaji lebih layak. Hakim mengatakan bahwa para tentara itu selayaknya diberi gaji yang lebih baik serta kemudahanuntukmeredakankemarahan mereka, dan menambahkan bahwa para tentara itu bahkan tidak mampu menyekolahkan anak-anak mereka di sekolah milik militer.(m10)

Penembakan Terdengar Di Mal New Jersey PARAMUS, New Jersey (AP): Seorang pejabat lokal mengatakan, rangkaian tembakan terdengar menggema di dalam satu mal di utara New Jersey, AS, dan belum ada laporan tentang korban. Menurut laporang lainnya, sampai saat ini pelaku penembakan masih jadi buronan pihak berwajib. Wanita jurubicarta Daerah Bergen Jeanne Baratta mengatakankepadaTheAssociatedPress bahwa beberapa saat setelah pukul09:00malam,satupanggilan telefon mengatakan bahwa serangkaian penembakan terjadi di Garden State Plaza Mall di Paramus, New Jersey. Baratta mengatakan salah satu sarang peluru penembak ditemukan. Dia mengatakan beberapa tim SWAT dan polisi dengan satuan anjing pelacak melakukan operasi mereka di mal tersebut. Dia mengatakan

pihak berwenang bekerja keras untuk mengevakuasi siapa saja yang berada di dalam mal itu. Barratta mengatakan bahwa sampaipukul11:30Seninmalam, pihakberwenangyakinmasihada orang di dalam mal. Memurut laporan sebelumnya, seorang dengan senjata api melakukan penembakan di sebuah mal di kota Paramus, New Jersey, Amerika Serikat, Senin malam atau Selasa (5/11 WIB) pagi. Penembakan terjadi jelang pusat perbelanjaan itu ditutup. Gara-gara aksi penembakan ini, penutupan mal dipercepat dan semua pengunjung dievakuasi. Saksimata mendengar sejumlah tembakan dalam beberapa detik di dalam mal bernama Garden State Plaza Mall. CNN melaporkan bahwa si penembak itu melepaskan peluru ke kamera keamanan. Kru televisi mengambil gambar dari luar mal dan me-

ngabadikankehadiranpolisiyang mengelilingi mal itu. “Sejumlah tembakan terdengar. Kami percaya itu dilakukan seorang pelaku. Saya tahunya pelaku aktif itu di area Nordstrom. Pengunjungmaldievakuasi,”kata Baratta. Jonathan Astacio, seorang saksimata di dalam mal mengatakan dia mendengar sejumlah tembakan. “Kami mendengar dualedakankeras.Lalukamimendengar dua tembakan dan orangorang lalu berlarian. Setelah itu tak ada lagi tembakan,” katanya. Pemilik mal Paul Erlandson mengatakan dia berada di lokasi itusejakpukul21:00.“Sayasedang berjalan ke pintu depan, tiba-tiba kerumunan orang berlari ke arah saya. Saya tidak pernah sampai ke dalam,” katanya. Ratusan personil polisi dikerahkan di sekitar mal di New Jersey itu. Hingga saat ini, pelaku

Taiwan Terima Kelompok Pertama Helikopter AS

Para Pejuang M23 Di Kongo Seru Hentikan Pemberontakan

TAIPEH, Taiwan (Antara/AFP): Taiwan telah menerima enam pertama dari 30 helikopter tempur canggih Apache yang dibeli dari Amerika Serikat saat pihaknya melakukan modernisasi militernya meskipun hubungan dengan China membaik, kata para pejabat Selasa (5/11). Keenam helikopter AH-64E —versi terbaru dari salah satu helikopter serbu yang paling kuat dunia itu — dikirim ke pelabuhan selatan Kaohsiung Senin, kata pejabat di kementerian pertahanan. Tentara Taiwan akan menjadi kekuatan pertama di luar AS untuk memperkenalkan model baru ini, kata mereka. Pengiriman awalnya ditetapkan pada Oktober, tetapi ditunda oleh penutupan pemerintah AS, kata laporan media. Kelompok kedua dari enam helikopter lainnya dijadwalkan tiba pada Desember, sementara sisanya akan dikirimkan pada akhir 2014, kata laporan itu. Sebanyak 30 Apache Longbow canggih adalah bagian dari kesepakatan senjata senilai 6,5 miliar dolar AS yang diumumkan pada tahun 2008, dan menyebabkan kemarahan di China. Taiwan dan China berpisah pada 1949 setelah perang sipil. Namun, Beijing masih menganggap pulau itu sebagai bagian dari wilayahnyamenunggureunifikasi,dengankekerasanjikadiperlukan, yang mendorongTaipeh untuk mencari lebih banyak persenjataan - terutama dari Amerika Serikat.

KINSHASA, Kongo (AP): Seorang pemimpin kelompok pemberontak M23 di timur Kongo mengatakan gerakannya mengakhiri pemberontakannya setelah lebih dari setahun setengah berjuang melawan pemerintah Republik Demokrasi Kongo (DRC). Dalam pernyataannya yang disiarkan Selasa (5/11) dinihari, Presiden M23 Bertrand Bisimwa mengatakan kelompoknya berusaha menyelesaikan keluhannya melalui “cara-cara politik saja.” Pengumuman itu muncul ketika militer Kongo mengumumkan kemenangan atas pemberontak tersebut, setelah menguasai dua bukit terakhir yang telah dikuasai oleh M23. Perundingan damai antara kedua belah pihak telah berulang

kali terhenti sejak Desember, dan militer Kongo meningkatkan ofensif bulan lalu terhadap pemberontak. Pengamat memperingatkan, meskipun,M23hanyareinkarnasi terbaru dari ketidakpuasan di wilayah itu dan bahwa kelompok lain bisa muncul dari kehancurannya. Pemerintah DRC, Selasa mengumumkanbahwapihaknya mencapai “kemenangan total” atas pemberontak M23, tetapi militer menolak memberikan konfirmasi. “Unsur-unsur terakhir dari M23telahmeninggalkanpangkalan-pangkalan mereka di Runyonyi dan Chanzu akibat tekanan FARDC (pasukan pemerintah) yang baru saja memasuki daerah itu,”katamenterikomunikasidan

juru bicara pemerintah dalam pesannya di Kiwanja, satu kota dekat lokasi pertempuran itu. Dia mengacu pada dua posisi di kaki bukit sekitar 80km utara ibu kota daerah Goma, di belasan pemberontak bertahan. Jend. Lucien Bahuma, komandan militer di Provinsi Kivu Utara, dengan hati-hati mengatakan “Saya tidak dapat mengonfirmasikan itu saat ini.” Seorang perwira militer lain Kongo mengatakan dia mendengar bahwa “pemberontak M23 telah lari”. “Mereka membakar 42 kendaraan dan depot-depot amunisi mereka, mereka semuanya lari,” katanya dan menambahkan bahwa pertempuran telah berlangsung sepanjang malam”. (m10)

penembakan masih belum ditemukan. Pihak kepolisian menduga, pelaku penembakan keluar dari areal gedung mal Garden State PlazadiParamusbersamadengan pengunjung. Insiden penembakan ini tidak menimbulkan korban jiwa ataupun terluka dan berlangsung di saat mal menjelang tutup. Media televisi setempat memperlihatkan kehadiran polisi dalam jumlah besar. Mereka tampak menyisir area mal guna mendapatkan pelaku penembakan. “Beberapa toko di dalam Garden State Plaza masih terkunci. Polisi bergerak dari toko ketokountukmengevakuasipara pekerja,” ujar Detektif Polisi wilayah Paramus Rachel Morgan Selasa. (m10)

HONGKONG (AP): Hongkong mengancam Filipina dengan sanksi Selasa (5/11) jika tidak ada kemajuan dalam perundingan tentang satu permohonan maaf bagi para keluarga wisatawan yang tewas saat melakukan liburan di Manila tiga tahun lalu. Pemimpin kota di China Selatan, Leung Chun-ying, mengatakan jika tidak ada ‘kemajuan yang substansial’ dicapai Filipina dalam sebulan ini, maka pemerintah Hongkong akan mengambil langkah ‘dengan sanksi penting.’ Para anggota parlemen akan memperdebatkan satu mosi Rabu (6/11) yang menyerukan sanksi ekonomi terhadap Filipina. Delapan wisatawan Hongkong dan pemandu mereka tewas dalam satu usaha penyelamatan polisi yang ceroboh setelah mereka disandera naik bus wisata dan diberhentikan oleh Manila polisi. “Saya mendesak pemerintah Filipina dan/atau pemerintah kota Manila agar cepat membuat propo-sal untuk menanggapi keluarga almarhum dan permintaan biaya bagi yang terluka,” tambah Leung. Ketidakmampuan polisi jelas membuat penduduk Hongkong marah, kota yang terbiasa dengan tingkat kejahatan rendah, dan memperkirakan hubungan dengan negara Asia Tenggara itu menukik. Lebih dari 160.000 warga Filipina berada di Hongkong, dengan sebagian besar bekerja sebagai pembantu rumah tangga. Perdagangan bilateral antara keduanya berjumlah sekitar 8,2 miliar dolar AS pada tahun 2012.(m10)

Raja Dan Ratu Thailand Dalam Keadaan Sehat BANGKOK, Thailand (Antara/TNA-OANA): Kesehatan Raja dan Ratu Thailand semakin membaik, kata sebuah pengumuman resmi Rumah Sakit Siriraj Selasa (5/11). Prof Udom Kachinthorn, dekan Fakultas Ilmu Kedokteran Siriraj, mengatakan raja secara pribadisudahbisamengendalikankursirodalistrikdanmemberikan makan ikan di paviliun oktagon dekat pantai setiap malam. Dia bersemangat dan tersenyum kepada para petugas yang merawatnya, kata Dr Udom. Ratu telah berada dalam kondisi normal dan bisa berjalan 700-800 meter - jarak yang ditentukan oleh dokter sebagai memuaskan. Dr Udom mengatakan orang tidak perlu khawatir tentang kesehatanYang Mulia Raja dan Ratu serta mengatakan belum ada jadwal untuk keberangkatan mereka dari Istana Klai Kangwon ke tempat kediamannya di Rumah Sakit Siriraj.

Anwar Ibrahim: Amerika Serikat Harus Minta Maaf! JAKARTA (Waspada): Mantan Deputi PM Malaysia Anwar IbrahimmenuntutAmerikaSerikat(AS)untukmemintamaafkepada Malaysiadannegara-negarayangtelahdisadapnya.“Malaysiaharus tegas.ASharusmemohonmaaf,sertakeluarkanmerekayangterlibat dalam kasus penyadapan dari Malaysia. Padahal Jerman dianggap informan penting,” tutur Anwar, saat konferensi pers, di Jakarta, Selasa(5/11).Menurutdia,menanggapimasalahini,negara-negara ASEANharusbersatudanmempunyaipendiriantegasdalammenyikapi masalahtersebut.“Kita,danjuganegara-negaraASEAN,harusbersatu menghadapiini,sertamempunyaipendiriantegas,”tegasnya.Indonesia pertama kali dilaporkan suratkabar Australia, Sydney Mornning Herald.Keduanegaradisebutmemilikifasilitaspenyadapandikantor kedutaannya.Indonesiaturutmenjadikorbandugaanpenyadapan ini.MenurutSydneyMorningHerald,selainIndonesiaASdanAustralia jugamenyadapnegaraAsialainnyasepertiChina.PemerintahIndonesia sebelumnyasudahmenuntutpihakAustraliadanASuntukmemberikan keterangan mengenai penyadapan tersebut.

Terjun Bebas Di Ultah Ke-100 PERRIS, California (AP): Ketika para teman Vernon Maynard meminta dia agar melaksanakan keinginannya untuk melakukan terjun bebas pada hari ulangtahun kep-100, pria California Selatan itu mengatakan dia selalu ingin melakukan terjun dari satu pesawat dengan parasut. Pensiunan pedagang mobil memperoleh kesempatan untuk menandai ulangtahunnya yang ke-100 Senin (4/11) dengan melakukan apa yang sejak lama diidamkannya. Jean Walcher dari U.S. Parachute Association mengatakan Maynard dan dua cicitnya melakukan terjun pertama kalinya bersama beberapa instruktur dari ketinggian 13.000 kaki (3.900 meter) di tenggara Los Angeles. Menejer Skydive Perris Dan Brodsky-Chenfeld mengatakan Maynardtelahmendapatpersetujuandoktersebelumdiamelakukan terjun. Putri Maynard, Linda Hironimus mengatakan teman-teman ayahnya membuat satu pengaturan bagi dia untuk terjun bebas setelah dia mengatakan dia selalu ingin mencoba itu. Maynard, yang berasal dari Nebraska, tinggal di Palm Desert. (m10)

The Associated Press

DALAM foto yang disiarkan oleh Skydive Perris/U.S. Parachute Association,Vernon Maynard (bawah) terjun bebas bersama instruktur James Perez untuk merayakan ulangtahunnya yang ke-100 di Perrris, California, Senin (4/11).


WASPADA Rabu 6 November 2013


Sandi Terima Bonus Let Bugeh BANDA ACEH (Waspada): Gelandang Timnas U-19 asal Aceh, Hendra Sandi Gunawan, mendapat buah tangan dari tokoh sepakbola Aceh, H Zainuddin Hamid. Bantuan itu diberikan untuk menambah motivasi pemain muda tersebut. Pria akrab disapa Let Bugeh ini memberi bonus senilai Rp10 juta kepada pemain muda Persiraja Banda Aceh di Kantor KONI Aceh, Selasa (5/11). Bantuan yang diberikan tersebut berbentuk cek. Sebelumnya, Let Bugeh yang juga Ketua PSSI Aceh itu memberikan bonus yang sama kepada pemain Timnas U-19 lainnya, yakni Zulfiandi dari Bireuen. Pada kesempatan itu, Let PEMAIN Timnas U-19, Hendra Sandi Gunawan (kiri), menerima bantuan cek senilai Rp10 juta dari H Zainuddin Hamid, Selasa (5/11). -Waspada/Munawardi Ismail-

Bugeh berharap Sandi cs bisa meningkatkan performanya agar mampu menembus tim inti Garuda Jaya. “Jangan sampai tidak lolos dan jangan patah semangat bila belum masuk tim inti,, kamu harus terus berusaha, “ harap Let Bugeh berharap trio pemain Aceh yang sudah dipanggil seleksi jangka panjang terus berjuang. Sandi mengutarakan keharuannya atas perhatian Let Bugeh. Sandi mengaku terharu dan bangga, karena tidak menyangka ada perhatian begitu besar dari Let Bugeh. Pemain yang memakai nomor 11 di Timnas U-19 ini juga mengaku salut atas kepeduliannya kepada pemain Aceh yang membela timnas. “Alhamdulillah, saya dan keluarga mengucapkan terima kasih banyak kepada Pak Let,” ujar Sandi. Selain Sandi, dua pemain muda Aceh lainnya, yakni Zulfiandi dan Miftahul Hamdi kembali dipanggil Badan Tim Nasional (BTN) mengikuti seleksi persiapan Piala AFC U-19 di Myanmar, Oktober 2014. Training camp jangka penjang ini akan dipusatkan di Batu, Malang, mulai 9 November nanti. (b07)

Vetyeka Tantang Chris JAKARTA (Waspada): Keinginan Simpiwe Vetyeka (Afsel) menantang petinju terbaik Indonesia, Chris John, seperti yang pernah diungkapkan saat akan menghadapi Daud ‘Cino’ Yordan beberapa waktu lalu, tampaknya segera terlaksana. Hal tersebut menyusul adanya rencana pertemuan antara Chris John dan Vetyeka dalam pertarungan penyatuan gelar kelas bulu (57,1 kg) WBA dan IBO yang direncanakan bakal digelar di Metro City Club, Perth, Australia, 6 Desember mendatang.

“Dengan segala daya upaya, jerih payah, dan latihan keras, saya tak akan membiarkan gelar juara direbutVetyeka. Meskipun kali ini kembali bertanding di luar negeri, saya tetap membawa nama Indonesia,” kata Chris John, Selasa (5/11). “Saya mohon doa restu selu-

ruh rakyat Indonesia demi menghadapi pertandingan nanti, semoga Tuhan menyertai perjuangan saya mempertahankan gelar juara,” sambung Chris yang berusia 34 tahun itu. Chris adalah pemegang gelar juara super kelas buluWBA, sedangkan Vetyeka menggenggam gelar juara kelas bulu versi IBO. Keduanya pernah tampil satu ring di Stadion Tenis Indoor Senayan, Jakarta, pada 14 April silam. Saat itu, The Dragon mempertahankan gelar setelah ber-

tarung seri dalam tiga ronde melawan Satoshi Hosono (Jepang). Ketika itu, Vetyeka mempecundangi Cino lewat kemenangan KO di ronde 12 dan merebut sabuk IBO. “Saya sudah pernah menang di Amerika, Mexico, dan mengalahkan DaudYordan di kandangnya. Sekarang saya akan bertanding melawan bintang Indonesia lain, Chris John, di Australia. Pesan saya hanya satu, bersiaplah melihat kejutan lain di Australia,” koar Vetyeka. (yuslan)

Awal Bagus PIMNAD Di PBL JAKARTA (Waspada): PIMNAD Aceh memetik kemenangan perdana atas klub pendatang baru, Gelora Bahari Tegal, 82-71 dalam Seri I Premier Basketball League (PBL) 2013 di GOR Soemantri Brojonegoro, Jakarta, Selasa (5/11). PIMNAD, menurunkan pemain-pemain mudanya seperti Reangga, Akbar, Encep Farlan, Yudha, dan Kevin, mengawali laga dengan permainan cepat

dan keras. Mengandalkan fast break, PIMNAD merebut kuarter pertama 19-13. Kuarter kedua, PIMNAD diinstruksikan lebih ngotot mengandalkan Akbar sebagai big man. PIMNAD pun unggul dengan mengemas 18 poin berbanding 16 milik Gelora. Babak pertama ditutup dengan keunggulan 37-29 untuk PIMNAD. Pada dua kuarter terakhir, PIMNAD terus mampu meredam

perlawanan lawan, hingga tak terbendung merebut kemenangan. Encep Farlan tampil sebagai top skor PIMNAD dengan torehan 31 poin disusul Akbar 17 poin dan Yudha 11 angka. Hasil lainnya, Scorpio Jakarta mengandaskan Cenderawasih Papua 62-54. ManajerPIMNAD,drLukman Hasibuan, mengatakan sukses timnya diharapkan dapat menjadi motivasi bagi para pemain

untuk meraih kemenangan pada pertandingan berikutnya. “Alhamdulillah, anak-anak tampil semangat dan tidak terpengaruh kondisi keuangan yang saat ini membelit tim,” lapor Lukman. Jadwal berikutnya, PIMNAD vs Scorpio Jakarta (6/11), vs Cenderawasih Papua (7/11), vs Champ GSBC Bandung (9/11), dan terakhir menghadapi BBC Sumsel (10/11). (b04)

Surya Boyong Tiga Sepeda Motor Waspada/ist

SENTUL (Waspada): Sukses membukukan total poin tertinggi di tiga kelas membuat pebalap asal Purwakara, Surya Uya Kuya (foto), berhak memboyong hadiah utama tiga unit sepeda motor dalam seri akhir Kejuaraan “The Master Of Pertamina Enduro-Comet KYT-R9-BRT Matic Race Championship 2013” di Sirkuit Karting Sentul Bogor, akhir pekan lalu. Surya, tergabung dalam tim Hardolin Paula Poker Woy Imola CLD GOZ, hingga seri kelima tidak terbendung dalam pengumpulan poin kelas Matic 130cc Standar Pemula (umum) dan se Jabotabek, Banten, dan Jawa Barat serta kelas Matic 150cc Tune Up Pemula. Hadiah motor tersebut diperoleh tidak lepas dari keputusan Trendypromo Mandira selaku pihak penyelenggara event

yang menetapkan hadiah utam untuk kelas yang diikuti peserta terbanyak. Pada Matic 130cc Standar Pemula dari lima seri, Surya mengumpulkan 125 poin, selisih 65 angka dari rival terdekatnya, Aldi M Taufik (Subang/60) dan M Arif (Bandung/48). Hal sama pada kelas Matic 150cc Tune Up Pemula, Surya mengoleksi total 90 poin, mengungguli Agung Ikhkal (Karawang/68) dan Anggara Ardani (Bandung/65). Dari total enam unit sepeda motor yang disediakan panitia, dua unit lainnya masing-masing direbut Danny Keder (Subang) yang tampil sebagai juara umum kelas Matic Free For All (FFA) s/d 130cc dan Ferry Ocktane (Bandung) selaku jawara kelas Matic 150ccTune Up Open. Helmy Sungkar, pimpinan sekaligus pemilik Trendypromo

Agara Siap Ladeni Tuan Rumah Sepakbola Pra Pora 2013 KUTACANE (Waspada): Tim sepakbola Aceh Tenggara (Agara) siap meladeni tuan rumah Aceh Jaya dalam laga Prakualifikasi Pekan Olahraga Aceh (Pra Pora) 2013, guna meraih tiket tersisa Pora 2014 di Aceh Timur. Kesiapan itu disampaikan Manajer Tim Iskandar Muda dan pelatih Hidayat Wan Tanzil kepada Waspada, Selasa (5/11). Berdasarkan jadwal, Agara yang tergabung di Grup E bersama Aceh Jaya dan Aceh Tengah,

akan mengawali laga melawan tuan rumah di Stadion Jaya Sakti Lamno, Rabu (6/11) ini. “Aceh Jaya lebih diuntungkan karena tampil sebagai tuan rumah. Namun hal itu tidak membuat kami gentar karena seluruh pemain siap tempur memenangkan laga dengan cara sportivitas tinggi,” ujar Iskandar Muda. Meski belum pernah bertemu dan buta kekuatan lawan, Iskandar optimis timnya mampu melewati hadangan tuan ru-

Problem Catur

mah. Pelatih Hidayat menambahkan hal terpenting adalah pemain tampil penuh semangat dan tetap disiplin. Skuad tim Agara terdiri atas Sarmaidi, Heri Kurniawan, Doli Clasovic, Muzi Ibrahim, Dedi Pradewo, Khairil, Firman Anugrah, Fajar Ramadhan, Baihaqi, Riki Sahputra, Oman Anggriawan, Jauhari, M Reza Al Fatah, Tomo Putra, Kusnadi, Wahyudi, Weldi Syahputra, Abdul Razak, dan Adi Sunanjar. (b26)


Mandira, mengatakan persaingan perebutan sepeda motor ini sangat sengit, karena masingmasing kandidat juara tampil maksimal. “Makanya, hingga putaran empat lalu di Serang, Banten, baru Surya Uya Kuya dan Pieka yang dipastikan berhak masingmasing mendapat satu motor, karena keduanya sudah tidak terkejar dalam perolehan poin,” kata Helmy. (yuslan)


ATLET DKI, Ririn Agustina (tengah), menyumbang medali emas bagi Indonesia di ajang 4th Asian Taekwondo University Championship 2013 di Changyong, Korsel.

Taekwondo Indonesia Membanggakan Atlet Sumut Sumbang Emas CHANGYONG, Korsel (Waspada): Atlet taekwondo nasional yang tergabung di Universal Taekwondo Indonesia Profesional (UTI Pro) meraih prestasi membanggakan di ajang 4th Asian Taekwondo University Championship 2013. Di Changyong, Korea Selatan., Indonesia berhasil menggondol 6 medali emas, 7 perak, dan 6 perunggu. “Ini pencapaian yang sangat membanggakan tampil di Korea dengan materi lawan yang rata-rata memiliki kemampuan bertaraf Internasional,” puji Manajer Tim Indonesia, Alfian Bangun, Selasa (5/11). Alfian melanjutkan, UTI

Pro merasa sangat terhormat bisa berpartisipasi dalam kejuaraan yang berakhir 4 November tersebut. PembinaYayasan Universal Taekwondo Indonesia (YUTI) dan UTI Pro, Grand Master Lioe Nam Khiong, juga mengaku cukup puas dengan hasil yang dicapai. “Ini merupakan program pembinaan prestasi dan hasilnya benar-benar membanggakan,” sebut Nam Khiong. Selain memberangkatkan Timnas UTI Pro, YUTI juga menyertakan seorang wasit, yakni Rahadewineta, plus sejumlah Pelatih Pelatnas UTI Pro seperti Martina Navratilova, Lessitra Draningrari Satrio Rahadani,

BANYUWANGI, Jatim (Waspada): Pebalap tim Tabriz Petrochemichal Iran, Mirsamad Pourseyedigolakhair, menjuarai balap sepeda internasional “Banyuwangi Tour de Ijen 2013” yang berakhir Selasa (5/11), setelah memimpin klasemen akhir kategori individu. Mirsamad berhak menyabet yellow jersey dengan membukukan catatan waktu tercepat 16 jam 11 menit 43 detik dalam lomba menempuh total jarak 606,5 kilometer yang terbagi sebanyak empat etape. Pemenang etape kedua itu unggul 1 menit 20 detik dari John Kronborg Ebsen (Danish District Denmark) yang berada di perangkat kedua dan Rahim Emami (RTS Santic Taiwan) di posisi ketiga terpaut 1 menit 25 detik. Kemenangan Mirsamad tidak lepas dari keberhasilannya menaklukkan jalur tanjakan menuju Paltuding di kawasan wisata objek wisata Kawah Ijen yang memiliki ketinggian 1.876 meter di atas permukaan laut pada etape keempat atau terakhir sejauh 166,3 kilometer. Dia menyentuh garis finis di urutan keempat dengan hanya terpaut selisih waktu 1 menit 32 detik dari pemenang etape Rahim Emami (RTS Santic) yang mencatat waktu tercepat 5 jam 08 menit 06 detik. Namun itu sudah cukup mengantarkan

Mirsamad menjadi yang terbaik pada Tour de Ijen tahun ini, sekaligus menggusur pimpinan lomba selama tiga etape sebelumnya Jason Christie (OCBC Continental Singapura) yang finis di urutan belakang dengan kehilangan banyak waktu. Bahkan, kemenangan Mirsamad cukup dramatis karena dia sempat salah arah saat 10 meter menuju titik finis dan terjatuh hingga kemudian dibopong anggota Satpol PP mendekati garis finis. Petugas medis langsung memberikan pertolongan kepada Mirsamad melalui bantuan oksigen dan memeriksa kondisi fisiknya yang drop. “Kemenangan ini hasil kerja sama seluruh anggota tim. Rute tanjakan ini memang sangat berat, tapi stamina saya cukup prima untuk menghadapi etape ini,” kata Mirsamad usai perlombaan. Tidak hanya menempatkan pebalapnya menjuarai kategori individu, Tabriz Petrochemical juga tampil sebagai yang terbaik untuk kategori tim dengan total waktu 48 jam 47 menit 22 detik. Posisi kedua direbut tim RTS Santic Taiwan yang tertinggal 2 menit 10 detik dan tim tuan rumah Banyuwangi Racing Cycling Community (BRCC) di peringkat ketiga dengan selisih waktu 9 menit 55 detik.(m15/ant)
















JUARA Banyuwangi Tour de Ijen (BTdI) 2013, Mirsamad Pourseyedigolakhair, dibopong petugas memasuki finish pada etape empat BTdI di Paltuding Kawah Ijen, Kecamatan Licin, Banyuwangi, Jawa Timur, Selasa (5/11).



Jawaban di halaman A2.


kg, Stefhani Elizabet (Lampung) juga mendulang emas. Kelas 62 kg putri, emas dipersembahkan Ririn Agustina (DKI) dan satu emas lainnya hasil kemenangan Oppie Danena Ginting (Sumut) di kelas +73 kg putri. Sisa perak masing-masing dihasilkan CaturYuni Riyaningsih (Jatim/-73 kg), Nuri Revani Siregar (Sumut/-53 kg) serta Kyurugi beregu putra-putri. Perunggu lainnya direbut Jason Filomeno (NTT/-58 kg), Supriyanto (Papua Barat/-63 kg), Putra Herlambang (Lampung/ -80 kg), Aprilia Uno Sanjaya (Jateng/-46 kg), Dinda Meirisa (Aceh), dan Widya Kristianti (Jateng). (m33/ant)

Mirsamad Juara Kendati Salah Masuki Finish

Putih melangkah, memaksa adu menteri di g6 untuk promosikan h5. Caranya?


Satriyono, dan KwakYoung Min. Di kategori Poomsae pasangan, Christina Agung Intan (Bali)/JhonJuniorMandagi(Sulut) merebut emas. Prestasi serupa ditoreh tim beregu putra yang diperkuat Danny Harsono, Jhon Junior Mandagi, dan Alfristo K Pranata (Yogyakarta). Emas ketiga didapat dari nomor beregu putri kala Christina Agung Intan, Domas Ayu Kirana Santoso (Jateng), dan Elizabeth Sherly Kurniawan (DIY) tampil dominan. Dua medali perak dihasilkan di nomor perseorangan oleh Alfristo K Pranata (putra) dan Domas Ayu Kirana Santoso (putri). Di kategori Kyurugi kelas 49



1. 5. 8. 9.

1. Punya sifat atau tertarik pada dua jenis kelamin. 2. Singkatan tablet. 3. Singkatan panggilan dokter. 4. Enzim pemecah protein yang diperoleh dari cairan usus. 5. Tumbuhan dari Asia Timur jadi obat kuat. 6. Alat suntik atau jahit. 7. Kaca bulat (untuk mata, kamera). 10. Ada jinak (benigna) dan ada ganas (maligna). 11. Mikroorganisme penyebab dan penular penyakit. 17. ——Mulyasari, mantan pasien yang pernah digugat RS Omni. 19. Warangan; Racun pembunuh tikus, dipakai untuk meracun aktivis Munir. 21. Penyakit menular disebabkan oleh jamur. 22. Faktor keturunan. 24. Obat demam produksi Bayer. 25. Penyakit akibat infeksi dengan gejala kejang-kejang. 26. Binatang yang disebut dalam penyakit sifilis. 27. Jarum gantung. 28. Parut bekas digaruk dsb; Gores.

Obat antiseptik untuk luka. Buah pinggang. Singkatan Rumah Sakit Islam. Spesialis Bedah Toraks Kardio Vaskular. 12. Unit fungsional ginjal. 13. Penyakit menular disebar kutu-kutu tikus. 14. Kejang otot. 15. Revised Trauma Score. 16. Microscopic PolyAngiitis. 18. Teknik diagnostik untuk menguji struktur badan bagian dalam; Kepanjangan USG. 20. Tablet untuk dikulum. 23. Penyakit pria tua urusan Urolog. 26. Cabik yang dalam pada bibir. 29. Infeksi Saluran Pernapasan Akut. 30. Bagian hulu kerongkongan yang berhubungan dengan hidung; Epifaring. 31. Debu. 32. Radang jaringan tubuh yang menimbulkan rongga tempat kumpul nanah. 33. Spesialis Anestesi. 34. Magister Administrasi Rumah Sakit.

Isi dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di kotak 3x3 bergaris tebal. Tingkat kesulitan: sedang (***), bisa diselesaikan kurang dari sepuluh menit. Jawabannya di halaman A2 kolom 1.

8 2 9 1

7 9 8 1 4

2 3


1 6 5 8 2 5 8 9 3 7 1 2 5 2

8 5

9 8 3 6 1

9 3 ***419

Sport Ozil Penasaran Dortmund


LONDON (Waspada): Playmaker anyar Arsenal Mesut Ozil menegaskan, tidak membutuhkan motivasi tambahan untuk menjajal kembali Borussia Dortmund pada matchday 4 Grup F Liga Champions. Tetapi dia mengakui, sangat penasaran dengan kekalahan 1-2 Arsenal atas Dortmund pada 22 Oktober lalu di Emirates Stadium. “Tidak ada dendam, namun setiap kekalahan mengganggu saya,” ucap Ozil. “Penasaran, karena kalah di kandang dan terlebih lagi di Liga Champions. Kami hampir membalikkan keadaan, namun Dortmund mampu mencetak gol kedua,” kenangnya lagi, seperti dikutip dari Bild, Selasa (5/11). Melalui hasil di Emirates itu pula, Ozil menilai, pasukan Juergen Klopp lebih kuat dibanding sebelumnya. Padahal, Dortmund berstatus runnerup setelah kalah 1-2 dari Bayern Munich pada final musim lalu di Stadion Wembley. “Tim yang mampu menang di London tentu saja menjadi salah satu favorit. Dortmund sudah menjadi tim kuat musim lalu, kesan saya mereka kini lebih baik dibandingkan sebelumnya,” beber bintang Jerman berusia 25 tahun tersebut. Ozil sangat mengenal pasukan Klopp, sebab dibesarkan bersama FC Schalke dan Werder Bremen, yang notabane saingan Die Borus-sen di Bundesliga. “Saya telah berada di luar Schalke selama lebih dari enam tahun, jadi bukan masalah lagi,” jelasnya.

“Laga Liga Champions sudah cukup memotivasi. Sejujurnya, Arsenal membuat segalanya menjadi menyenangkan. Pelatih, pemain dan kehidupan di London, saya merasa sangat nyaman,” pungkas Ozil. Peran Ozil semakin strategis dinihariWIB nanti di Signal Iduna Park, sebab manajer ArseneWenger tidak bisa menurunkan jenderal lapangan tengah Jack Wilshere,yangmenderitacederaengkel ketika menjalani sesi latihan. “Wilshere mengalami masalah di bagian engkel. Apakah dia akan siap untuk pertandingan Rabu, saya tidak tahu. Kami mesti menunggu kepastiannya,” beberWenger kepada Daily Star. Musim lalu, Wilshere absen pada leg kedua babak 16 besar melawan Bayern Munich di Allianz Arena, karena cedera yang sama. The Gunners juga tidak akan diperkuat bek kiri Kieran Gibbs, yang mengalami cedera betis. Namun Ozil dan para punggawa Meriam London lainnya sangat percaya diri untuk membalas kekalahan atas Dortmund, setelah akhir pekan lalu menggunduli Liverpool 2-0 dalam bigmatch Liga Premier di Emirates Stadium. “Melawan Dortmund akan sangat berbeda, jadi kami harus lebih siap. Bermain di Liga Champions, Anda harus bisa

WASPADA Rabu 6 November 2013

Matchday 4 UCL Malam Ini (GMT) Grup E Chelsea v FC Schalke 19:45 Basel v Steaua Bucuresti 19:45 Grup F B Dortmund v Arsenal 19:45 Napoli v Marseille 19:45 Grup G Zenit SP v FC Porto 17:00 Atletico v Austria Wien 19:45 Grup H Ajax Amsterdam v Celtic 19:45 Barcelona v AC Milan 19:45 *SCTV live mulai pkl 02:45 WIB memanfaatkan peluang sekecil apapun,” klaim gelandang Mikel Arteta. Gunners kini memimpin klasemen Liga Utama Inggris, tetapi November ini bisa saja menghadirkan awan kelabu bagi Per Mertesacker cs. Sebabnya sepanjang bulan ini, Arsenal mesti melakoni beberapa laga keras dan ketat. Setelah Liverpool dan dinihari nanti Dortmund, The Young Guns mesti tandang ke markas Manchester United. “Saya harus lari, karena agenda bisa membunuh kami. Itu menunjukkan kepada Anda bahwa segala hal dapat berubah dengan cepat, tapi itu juga menjadi peringatan bagus bagi kami,” tutur Wenger. “Kami tetap harus fokus untuk meningkatkan mutu tim kami, karena selalu ada ruang untuk berkembang. Sampai akhir November, Anda baru dapat melihat ide yang lebih jelas,” pungkas pria Prancis berusia 64 tahun tersebut. (m15/goal/bild/ds/espn) BINTANG baru Arsenal Mesut Ozil (kiri) penasaran untuk membalas kekalahan atas Neven Subotic dan kawan-kawan. -AP-

Torres Gagal Teror Lagi Schalke


Klopp Sindir Orkestra Wenger BERLIN (Waspada): Juergen Klopp (foto tengah) menyindir gaya kepelatiihan ArseneWenger, yang menjadikan permainan Arsenal ibaratkan orkestra dengan terus mendominasi penguasaan bola. “Wenger memang spesial, saya menyukainya. Dia Sir Arsene Wenger, dia selalu seperti ‘halo’. Saya seperti ini,” papar pelatih Borussia Dortmund itu, seperti dikutip dari Bild, Selasa (5/11). “Dia gemar menguasai, memainkan, mengoper bola... seperti orkestra. Tetapi itu musik tenang, saya lebih menggemari heavy metal. Saya selalu ingin terdengar keras,” sindir Klopp. Untuk itu Klopp menegaskan, lebih memilih gaya sepakbola heavy metal BVB ketimbang aksi orkestra The Gunners. Gaya itu sepertinya bakal kembali diterapkan Die Borussen ketika menjamu Meriam

London dinihariWIB nanti pada matchday 4 Grup F Liga Champions. Sentuhan permainan keras dan taktis ala heavy metal versi Klopp pun telah terbukti efektif mempecundangi orkestra Wenger dengan skor 2-1 pada jumpa pertama di Emirates Stadium, 22 Oktober lalu. “Saya menyukai filosofi Arsenal, tetapi tidak bisa menerapkannya karena saya berbeda. Jika Anda melihat saya di sisi lapangan, saya bahkan merayakan ketika tim bisa menekan lawan dan bola keluar lapangan,” ungkap Klopp. “Tetapi yang paling menarik, kami masih diperhitungkan bisa mengalahkan tim terbaik di dunia sekalipun. Anda selalu ingin menghajar tim kaya. Apa yang kami lakukan dalam lima tahun terakhir adalah mencatat sejarah yang akan dibicarakan semua orang hingga 100 tahun ke depan,” ujarnya lagi.

Pelatih berusia 46 ini memang menyadari, BVB bukanlah tim terbaik dunia, namun selalu percaya bahwa kerja keras bisa membuat berlari lebih jauh dari lawan-lawan yang mapan secara finansial. Prinsipnya itu terbukti jitu menyulitkan raksasa Bayern Munich di Bundesliga Jerman. “Saya bekerja untuk mendapat keadilan, ini poin penting. Memang tidak ada garansi Anda bisa mewujudkan semua mimpi, tetapi dengan mengerahkan segenap tenaga Anda bisa meraih sesuatu,” tegas Klopp. “Orang-orang hanya tertarik jika kita bisa tampil bagus dan bermain seperti kami menghadapi Bayern dan Arsenal dan tim-tim hebat lainnya, selalu seperti itu. Untuk mewujudkannya, Anda harus bekerja lebih keras dari yang lain,” papar pria Jerman kelahiran 16 Juni 1967 tersebut. (m15/goal/bild)

LONDON ( Waspada): Striker Fernando Torres rawan absen ketika Chelsea menghadapi FC Schalke 04 dinihari WIB nanti pada matchday 4 Grup E Liga Champions. Mantan mesin gol Atletico Madrid dan Liverpool itu mengalami masalah pada ototnya saat menjalani sesi latihan untuk persiapan menjamu The Royal Blues di Stamford Bridge, London. Menurut Mirror, Selasa (5/ 11), Torres bahkan diragukan bisa tampil membela The Blues saat melawan West Bromwich Albion akhir pekan nanti di Liga Premier. Ini tentu pukulan telak bagi manajer Jose Mourinho, mengingat performa bomber berumur 29 tahun itu sedang bagus-bagusnya. Torres bahkan menjadi aktor utama teror Si Biru ke benteng pertahanan Schalke pada jumpa pertama di Gelsenkirchen, 22 Oktober lalu. Striker Spanyol kelahiran Madrid pada 20 Maret 1984 itu pula yang menjadi bintang kemenangan tandang 3-0 pasukan Mourinho, setelah dua kali membobol gawang kiper Timo Hildebrand. Absennya Torres berarti memberi Samuel Eto’o peluang untuk mengisi posisi striker di garis serang London Blues, yang akan didukung gelandang serang Oscar, Eden Hazard dan Juan Mata. Chelsea dan Schalke kini memimpin klasemen Grup E,

Bologna Belum Beranjak ROMA (Waspada): Bologna gagal meraih kemenangan atas Chievo Verona di Renato Dell’Ara, Selasa (5/11) dinihari WIB, padahal lebih mendominasi permainan sekaligus memperoleh beberapa peluang bagus. Kedua tim akhirnya bermain 0-0 pada partai pamungkas giornata 11 tersebut, sehingga posisi masing-masing belum beranjak naik di klasemen sementara Liga Seri A. Mentas di Renato Dall’Ara Stadium, Bologna yang ingin mengoleksi tiga kemenangan beruntun, langsung menekan tamunya yang telah menderita enam kekalahan berturut-turut. Gennaro Sardo melepaskan tembakan keras di menit ketiga, yang sayangnya masih melenceng. Klasemen Liga Seri A Chievo asuhan allenatore AS Roma 11 10 1 0 25- 2 31 Giuseppe Sannino perlahan mulai Napoli 11 9 1 1 24- 8 28 mendapatkan ritme permainan. Juventus 11 9 1 1 23-10 28 Beberapa peluang mereka melalui Inter Milan 11 6 4 1 27-12 22 umpan-umpan silang Macelo EstiHellas 11 7 1 3 22-17 22 garribia cukup membuat pertahaFiorentina 11 6 3 2 22-13 21 nan Bologna kerepotan. Rossoblu juga membahayakan Lazio 11 4 3 4 15-15 15 Genoa 11 4 2 5 11-14 14 melalui umpan silang yang dilepasAtalanta 11 4 1 6 12-14 13 kan Alessandro Diamanti, yang Udinese 11 4 1 6 11-14 13 bahkan hampir membuahkan gol AC Milan 11 3 3 5 17-19 12 ketika Jonathan Cristaldo mampu Torino 11 2 6 3 17-19 12 menyambutnya dengan tandukan. Parma 11 3 3 5 16-19 12 Di babak kedua, Bologna makin Livorno 11 3 3 5 13-16 12 meningkatkan serangannya dan teCagliari 11 2 4 5 11-19 10 rus memaksa kiper Christian PugBologna 11 2 4 5 13-22 10 gioni melakukan beberapa penyelaSampdoria 11 2 3 6 12-20 9 matan gemilang. Namun skuad 11 2 3 6 12-27 9 asuhan Stefano Pioli tetap gagal menAP Sassuolo 11 1 3 7 7-19 6 dulang gol, sehingga belum be-ranjak BOMBER Bologna Jonatan Cristaldo (kiri) bertarung seimbang Catania 11 1 2 8 7-18 5 dari peringkat 16. (m15/goal/uefa) dengan pemain Chievo Nicolas Frey di Renato Dall’Ara Stadium. Chievo

Klasemen Grup E Chelsea Schalke Basel Steaua

3 3 3 3

2 2 1 0

0 0 1 1

1 1 1 2

8-2 4-3 3-3 1-8

6 6 4 1

Klasemen Grup F Dortmund Arsenal Napoli Marseille

3 3 3 3

2 2 2 0

0 0 0 0

1 1 1 3

6-3 5-3 4-4 2-7

6 6 6 0

Klasemen Grup G Atl Madrid Zenit SP FC Porto Austria Wien

3 3 3 3

3 1 1 0

0 1 0 1

0 1 2 2

8-2 2-3 2-3 0-4

9 4 3 1

Klasemen Grup H Barcelona AC Milan Celtic Ajax


STRIKER Chelsea Fernando Torres dua kali membobol gawang kiper Schalke Timo Hildebrand di Gelsenkirchen, 22 Oktober lalu. sama-sama mengoleksi nilai enam. Karenanya, Mourinho sangat fokus menyiapkan sukses

menyambut kedatangan Julian Draxler cs, sehingga kurang maksimal ketika mentas di mar-

kas Newcastle United akhir pekan lalu. John Terry dan kawan-ka-

Uche Penuhi Keperluan Villarreal Klasemen La Liga Barcelona 12 Atl Madrid 12 Real Madrid 12 Villarreal 12 Bilbao 12 Getafe 12 Sociedad 12 Levante 12 Valencia 12 Espanyol 12 Granada 12 Malaga 12 Elche 12 Sevilla 12 Celta Vigo 12 Valladolid 12 Osasuna 12 Real Betis 12 Almeria 12 Vallecano 12

11 11 9 7 6 6 5 4 5 4 4 3 3 3 3 2 3 2 2 3

1 0 1 2 2 1 4 5 1 3 2 4 4 4 3 5 1 3 3 0

0 1 2 3 4 5 3 3 6 5 6 5 5 5 6 5 7 7 7 9

34- 7 34 30- 8 33 30-16 28 20-12 23 18-17 20 16-13 19 18-12 17 12-15 17 15-19 16 12-15 15 8-12 14 14-16 13 12-16 13 20-25 13 14-16 12 14-18 11 10-21 10 11-20 9 14-24 9 10-30 9

MADRID (Waspada): Villarreal memperkokoh cengkeramannya di posisi keempat klasemen La Liga, Senin (SelasaWIB), saat tembakan striker Ikechukwu Uche berhasil menaklukkan Elche 1-0 pada partai pamungkas jornada 12. Pertandingan penuh perjuangan keras di MartinezValero Stadium itu tampaknya bakal berakhir tanpa gol, sampai akhirnya Uche (foto) menyarangkan bola ke gawang tuan rumah dari jarak dekat menit 90. “Kami tahu bagaimana cara bertahan di sana. Menjelang akhir laga, kami mendapat sedikit keberuntungan yang kami perlukan,” ucap Uche, seperti

dikutip dari Cuatro, Selasa (5/11). Striker Nigeria berusia 29 tahun itu seperti menjawab keperluan Villarreal, yang ingin terus bertahan di posisi empat besar sebagai batas zona Liga Champions. “Saat ini kami berada di posisi kualifikasi Liga Champions, tetapi kami harus melakukannya secara bertahap,” papar Uche. Villarreal melewatkan setahun bermain di divisi dua musim lalu. Kini di bawah asuhan entrenador Marcelino, pasukan Kapal Selam Kuning tampil mengesankan dengan gaya sepakbola menyerang yang atraktif. Skuad Marcelino malah mampu menahan Real Madrid 2-2 di Stadion El Madrigal, September silam. Juga mencatat

3 3 3 3

2 1 1 0

1 2 0 1

0 0 2 2

6-1 4-2 2-4 2-7

7 5 3 1

wan akibatnya dipecundangi Newcastle 2-0 dengan menjadikan bek David Luiz sebagai kambing hitam. Daily Mail melansir, Mourinho dan beberapa pemain Chelsea kecewa dengan penampilan bek Brazil berambut keriwil tersebut. (m15/okz/mrr/dm) Reuters

kemenangan 4-1 saat melawan tim kuat Valencia, Oktober lalu. “Tim ini menjalani musim yang bagus dan kami harus terus mengikuti jalur yang sama. Pertahanan kami juga solid, saya pikir Anda harus menunggu kesempatan Anda dan itu akan datang,” optimisme Uche. (m15/ant/rtr)

Kwarta Boyong 18 Pemain

Waspada/Arianda Tanjung

PEMAIN PS Kwarta Orion (tengah) berusaha menghalau bola dari penyerang PS Pertamina dalam laga ujicoba di Lapangan SSB Klambir V, Selasa (5/11).

MEDAN (Waspada): PS Kwarta memboyong 18 pemain untuk mengikuti Babak 8 Besar Divisi I LI yang digelar di Stadion Galuh, Ciamis, mulai Sabtu (9/11) nanti. Skuad Burung Sumatera tergabung di Grup I bersama tuan rumah PSGC Ciamis, Villa 2000, dan Bintang Jaya Asahan. Pelatih Kwarta FC, Lilik, mengatakan dengan berbagai ujicoba yang telah dilakukan, M Affan Lubis cs siap bersaing dengan tiga tim lainnya di fase grup dan berusaha untuk meraih hasil maksimal. “Tim akan membawa 18 pemain yang benar-benar siap untuk bertanding, yakni Vidi, Jefry, M Iqbal, Roni, Dikky, Anda Aulia, Imam, Novi, Surya, Affan Lubis, Ichan, Affandi, Ryan, Orion, Malik, Kiki, Ismail, dan Suandi,” kata Lilik, Selasa (5/11). Dikatakan, hingga ujicoba terakhir beberapa masalah kecil masih terus dibenahi seperti finishing dan kontrol bola yang terkadang sering lepas. Selain itu, kondisi fisik juga menjadi kendala mengingat jarak perjalangan yang cukup jauh. “Kita berangkat ke Ciamis 7 November dan diharapkan pemain menjaga kondisi sebaik mungkin karena rencananya langsung jumpa tuan rumah di pertandingan pertama. Sudah pasti mereka akan menyerang sejak menit pertama,” tutup Lilik seraya memotivasi pemain untuk menjaga mental juara. (cat)


WASPADA Rabu 6 November 2013


Clippers Menang Tanpa Cela LOS ANGELES, AS (Waspada): Kemenangan LA Clippers atas Houston Rockets, Selasa (5/11), membuat peringkat klasemen NBAWilayah Barat berubah. Kini, Clippers menggeser Rockets yang sebelumnya berada di puncak. Tampil di Staples Center, Clippers langsung tancap gas. Sejak tip off, Chris Paul cs mampu membongkar defense Rockets yang digalang center anyar dari Lakers, Dwight Howard. Alhasil, Clippers unggul 42-25. Forward Clippers, Blake Griffin, tampil menonjol di

kuarter kedua dengan mencetak sejumlah poin. Tidak hanya Griffin, JJ Redick juga menambah pundi-pundi poin tuan rumah lewat shooting akurat. Sebaliknya, Rockets yang mengandalkan James Harden, Jeremy Lin, dan Howard kesulitan. Clippers menang telak 78-66. Setelah menyisip beberapa pemain cadangan di kuarter ketiga, Clippers kembali tampil ngotot di 12 menit penutup. Di sini, Griffin menunjukkan kualitasnya sebagai salah satu forward terbaik NBA. Rockets otomatis keteteran menandingi rebound dan penetrasi Griffin

yang mengakhiri laga dengan sumbangan 18 poin dan tujuh rebound. Clippers pun menang 137118 berkat tambahan 26 angka dari Reddick dan 23 poin 17 assist hasil kontribusi Chris Paul. Dari Rockets, top skor disandang Omar Casspi dengan 19 angka plus 15 dari Harden. Howard sendiri tertahan dan hanya mampu mendulang 13 poin. “Ini merupakan salah satu pertandingan di mana pemain tidak pernah meleset dalam setiap tembakannya. Kendati tiga pemain inti mengalami foul trouble, kami tetap menjaga

fokus dan memberi hadiah kekalahan pertama bagi Rockets,” ujar coach Clippers, Doc Rivers. Dengan demikian, tren kemenangan Rockets terhenti di tangan Clippers. Begitu pula dengan Philadelphia 76ers yang harus menuai kekalahan perdana musim ini. Melawan Golden State Warriors, Sixers takluk 90-110. Bintang Warriors tak lain adalah mantan pemain Sixers sendiri, yakni Andre Iguodala. Kembali tampil di mantan markasnya selama delapan musim, Iguodala menjadi kunci kemenangan Warriors dengan 32

angka. Di laga lain, kemenangan tipis ditoreh Cleveland Cavaliers saat menyudahi perlawanan Minnesota Timberwolves 93-92. Sementara itu, Memphis Grizzlies juga merebut sukses kala menang atas Boston Celtics 95-88. (m33/ap) GUARD LA Clippers Chris Paul (kiri) dan guard Houston Rockets Jeremy Lin berebut bola liar dalam lanjutan kompetisi NBA di Staples Center, Los Angeles, Selasa (5/11). -AP-

Peboling Sumut Tambah Perak Berharap Pemprovsu Segera Bangun Lintasan Waspada/Dedi Riono

TIM SSB Flamengo diabadikan bersama usai menjuarai Festival Sepakbola U-11 se Sumut Piala DR H Amarullah Nasution SE MBA dan Drs Hendra DS di Lapangan Air Bersih, Selasa (5/11).

Flamengo Kampiun U-11 SSB Patriot Boyong Piala Amarullah-Hendra DS MEDAN (Waspada): SSB Flamengo Medan memboyong trofi DR H Amarullah Nasution SE MBA dan Drs Hendra DS, setelah menjuarai Festival Sepakbola U-11 se Sumut digelar SSB Patriot Medan, Selasa (5/11). Bertanding di Lapangan Air Bersih Medan, Flamengo merebut juara setelah meraih kemenangan adu penalti atas SSB Patriot Pantonlabu, Aceh Utara, 3-1. Tendangan penalti dilakukan setelah kedua kubu bermain tanpa gol pada waktu normal 2x10 menit. Drama penalti sendiri berlangsung menegangkan. Tiga eksekutor Flamengo, yakni Ilham, Andre, dan Bagas, sukses

menaklukkan kiper Patriot Pantonlabu, Arif Maulianda. Dari kubu Patriot, hanya Asrul Rizka mencetak gol, sedangkan tendangan M Khalet ditepis kiper Flamengo, Herlambang. Sebelumnya, posisi ketiga direbut SSB K3 Asahan setelah mengungguli tuan rumah SSB Patriot Medan juga melalui drama penalti 2-1. Sukses tim Patriot Medan tampil di semifinal menjadi kejutan, mengingat tim ini diperkuat pemain-pemain berusia di bawah 10 tahun. “Hampir semuanya pemain kami kelahiran tahun 2003. Tim senior mereka (2002) sudah tersingkir di babak delapan besar. Sukses tim 2003 cukup mengejutkan dan mereka akan kita

persiapkan untuk Piala Danone dua tahun mendatang,” ujar Kepala SSB Patriot, Fityan Hamdy. Festival yang digelar sejak 1 November itu ditutup resmi oleh DR H Amarullah Nasution SE MBA yang juga Caleg DPR RI dari Partai Hanura. Dia memberikan apresiasi kepada SSB Patriot yang terus komit menggelar kompetisi kelompok usia. “Bangga sekali melihat semangat dan antusiasme pemain dalam festival sepakbola kali ini. Meski masih usia dini, mereka punya kemampuan bermain yang bagus, sportif, dan penuh semangat juang. Semoga ke depan akan lahir banyak bibit pemain andal dari Kota Medan

yang bisa memperkuat timnas,” ujar Amarullah. Ketua Umum SSB Patriot, Drs Hendra DS, mengucapkan terima kasih kepada seluruh tim peserta, termasuk dari Pantonlabu. Hendra pun mengaku bangga melihat antusiasme peserta dalam setiap turnamen yang digelar SSB Patriot Medan. “Antusiasme peserta dalam setiap kompetisi yang kami gelar, membuktikan Medan dan Sumut memiliki segudang bibit sepakbola masa depan. Hal ini harus didukung dengan pembinaan yang serius, salah satunya rutin menggelar kompetisi,” ujar Hendra, juga Caleg DPRD Kota Medan dari Partai Hanura. (m42)

MEDAN (Waspada): Prestasi gemilang kembali diukir peboling junior Sumut. Kali ini, Imam Wiguna dan Aldiya Indryati sukses mempersembahkan medali perak dalam Kejuaraan Nasional Piala Soetopo Jananto di Denpasar, Bali, 2-9 November 2013. Imam dan Indri menyabet medali perak dari nomor mixed double, setelah mengemas total 2.187 poin dalam enam game partai final. Medali emas disabet peboling nasional Yeri Ramadhona dan Ivana Hie dengan membukukan poin total 2.290, sedangkan perunggu jatuh kepada pasangan Nadia Pramanik dan Ocar (Jawa Barat) dengan mengemas 2.160 poin. “Senang sekali bisa mempersembahkan medali buat Sumut. Ini hasil yang sangat membanggakan buat kami dan kami masih akan berjuang untuk menambah perolehan medali,” ujar Indri, dihubungi Waspada via handphone, Selasa (5/11). Hal senada diungkapkan ImamWiguna, dia bahkan tidak menyangka kembali menyabet medali, setelah sehari sebelumnya menyumbangkan perunggu nomor single putra. “Ya, dari awal saya memang

Lindswell Sabet Emas Wushu Dunia MEDAN (Waspada): Pewushu kebanggaan nasional asal Sumut, Lindswell (foto), mempersembahkan medali emas Taiji Jian dalam Kejuaraan Dunia XII/2013 di Stadium Badminton Kuala Lumpur, Malaysia, Senin (4/11). Prestasi itu membuat cabang wushu pimpinan Master Supandi Kusuma kembali membanggakan Indonesia. Bendera Merah Putih berada di tiang paling atas dan lagu Indonesia Raya berkumandang. Lindswell merebut emas ketiga di Kejuaraan Dunia (sebe-

lumnya di Bali 2008 kelompok junior dan Kanada 2009 kelompok senior), lewat aksi-aksi taiji pedang yang cukup memikat. Dewan juri sepakat memberinya nilai tertinggi, 9.70. Medali perak diraih Ai Uchida (Jepang/ 9.67) dan perunggu untuk Chen Yi Ying (China Taipei/9.60). Raihan medali ini membuat Lindswell yang Oktober lalu mendapat penghargaan Satyalencana Dharma Olahraga dari Presiden RI, terhitung sejak Agustus hingga November 2013, sudah menyumbangkan lima medali emas secara ber-

turut-turut untuk Indonesia. Sebelumnya, dara cantik ini mendulang emas di Cali, Kolombia, ISG Palembang (2), Sportaccord Combat Games Rusia (1). Selain emas, Lindswell juga menyumbang perak nomor Taiji Quan (taiji tangan kosong) di Kejuaraan Dunia 2013. “Saya bersyukur dan senang sekali bisa memberi yang terbaik buat bangsa dan negara,” ujar Lindswell. “Syukur kepada Yang Maha Kuasa. Medali emas Lindswell merupakan jawaban pembinaan yang dilakukan PBWushu In-

donesia. Kita bangga, wushu kembali mengharumkan nama bangsa dan negara,” ujar Ketua Umum PB WI, Master Supandi Kusuma. Kejuaraan Dunia Wushu 2013 berakhir Selasa (5/11). Dominasi China belum terbendung dan kembali tampil menjadi juara umum dengan raihan 17 emas 1 perak. Iran menyusul (7-0-3) diikuti Malaysia (4-5-5), Vietnam (3-6-3), dan Rusia (33-2). Indonesia berada di posisi 11 dengan 1 emas, 1 perak, dan 2 perunggu. (m42)


8 Klub Jalani Fase Knock Out Divisi III PSSI MEDAN (Waspada): Delapan klub yang telah lolos penyisihan grup, langsung menjalani fase knock out Divisi III Liga Amatir Indonesia (LAI) PSSI zona Sumatera Utara tahun 2013, Rabu (6/11) ini. “Babak delapan besar Divisi III PSSI zona Sumut ini menggunakan dua lapangan, yakni Stadion TD Pardede dan Lapangan Dispora Sumut,” ujar Ketua Panitia M Joni Rakasiwi dan Sekretaris Hery Riyanto, seusai acara technical meeting di Kantor KONI Medan, Selasa (5/11).

Dijelaskankan, laga delapan besar akan mempertemukan juara Grup A Medan Soccer menghadapi runner-up Grup D Kwarta Medan dan juara Grup B PS Batubara vs runner-up Grup C Mencirim Putra (Lapangan Disporasu mulai pukul 13.30 WIB). Selanjutnya, juara Grup C PS Tasbi Medan melawan runner-up Grup B Kurnia Medan City FC dan juara Grup D Taruna Satria melawan runnerup Grup A PS Rapel (Stadion TD Pardede Medan mulai pukul 08.30 WIB).

Ditambahkan Joni, pemenang dari laga babak delapan besar ini, otomatis melaju ke semifinal yang akan berlangsung di Stadion Teladan Medan. Selain itu, klub semifinalis otomatis melaju putaran Wilayah Sumbagut. “Jadi nantinya ada empat klub mewakili Sumut memperebutkan tiket tampil di tingkat nasional, guna memperebutkan tiket promosi ke Divisi II musim depan. Sumut sendiri kemungkinan menjadi tuan rumah tingkat wilayah sangat terbuka,” pungkas Joni.


SKUAD PS PTPN III diabadikan bersama setelah menjuarai Dandim Simalungun Cup 2013.

PS PTPN III Kampiun Dandim Simalungun Cup 2013 KISARAN (Waspada): PS PTPN III menjadi juara pertama dalam turnamen U-16 Dandim Simalungun Cup 2013, setelah menaklukkan PTPN IV Bahjambi 4-0 di Lapangan Kodim Simlungun, Minggu (3/11). Hebatnya, selama turnamen berlangsung, anak-anak kebun ini belum pernah kalah. Mengandalkan kiper Bambang Rahmad Hidayat yang merupakan putra Bambang Sugianto (SPBUN PTPN III Sistrik Asahan), gawang PTPN III juga jarang kebobolan.

“Kita bangga dengan permainan anak-anak, karen mereka bisa menunjukkan jati diri dan bermain dengan lepas,” ujar Manajer Tim PS PTPN III, Sugito didampingi pelatih Saiful Ambri, kepada Waspada di Kisaran, Selasa (5/11). Menurutnya, prestasi ini belum cukup, sehingga kemampuan anak-anaknya akan terus ditingkatkan dengan latihan dan pertandingan ujicoba. “Terima kasih atas dukungan semua pihak, khususnya para orangtua pemain,” pungkas Sugito. (a15)

PS Rapel Optimis PS Rapel Perbaungan asal Sergai pun optimis melewati hadangan Taruna Satria Tebingtinggi, sekaligus melaju ke semifinal. Tekad tersebut dalam upaya PS Rapel tampil di putaran Wilayah Sumbagut. “Taruna Satria sebagai juara Grup D, merupakan tim bagus. Namun kami sudah siap tampil maksimal dan memenangkan laga,” ujar ManajerTim PS Rapel, Syafruddin Syaf didampingi

Sektim M Arifin Sinaga, dan pelatih Chairul Sofyan. Dijelaskan, tim asuhannya sudah siap tempur baik fisik maupun mental. Terlebih dengan hadirnya salah satu pemain Timnas U-19, yakni Reza Pahlevi Maldini Sitorus. “Selain Reza, kami juga punya pemain berbakat lainnya seperti Baginda Syahnur, Dedek Kurniawan, Syahrizal Sipayung, dan penjaga gawang Supianto,” pungkas Syafruddin. (m42)

Timnas Butuh Banyak Kalori JAKARTA (Waspada): Dokter Syarief Alwi terus mengontrol asupan nutrisi para pemain Timnas Indonesia, sebelum menjalani pertandingan resmi Pra Piala Asia 2015 Grup C melawan tuan rumah China, 15 November. Pengontrolan terhadap asupan nutrisi, menurutnya, sangat diperlukan karena timnas akan dihadapkan pada cuaca dingin sehingga membutuhkan kalori yang lebih banyak dibandingkan bermain di Indonesia. “Bermain dengan cuaca dingin, kalori pemain harus cukup. Makanya harus dipersiapkan dengan baik, termasuk menaikkan kadar lemak, tapi tidak sampai berlebihan,” jelas Syarief Alwi di Jakarta, Selasa (5/11). Dikatakan, salah satu upaya menaikkan kalori dan kadar lemak dilakukan dengan pengaturan pola makan. Para pemain timnas juga didorong untuk mengonsumsi gandum maupun beras merah. Hal ini juga pernah dilakukan saat timnas bertanding di Yordania. Selain mengontrol asupan nutrisi, pihaknya juga telah mempersiapkan peralatan untuk menopang pemain saat bertanding di wilayah dengan cuaca dingin atau kurang dari 10 derajat Celsius. “Seperti kaos, kaos tangan maupun yang lain. Yang paling penting adalah pemain dalam kondisi sehat. Kalau sehat mereka pasti tahan bermain dalam cuaca dingin,” beber dokter, akrab dipanggil papi itu. Sebelum bertanding di China yang diperkirakan suhunya di bawah lima derajat celsius, tim asuhan Jacksen F Tiago dijadwalkan menjalani ujicoba melawan salah satu klub di Korea Utara, 9 November. Eksibisi itu salah satu tujuannya untuk beradaptasi dengan cuaca dingin. Sesuai rencana, Ahmad Bustomi cs bertolak menuju Korea Utara, Kamis (7/11). (m15/ant)

tidak ada target medali. Saya hanya ingin menambah jam tanding, mengingat kompetisi boling di Medan sudah tidak ada lagi, setelah ditutupnya Lintasan Super Bowl Perisai Plaza Medan,” ujar Imam. Imam pun berharap Pemerintah Provinsi Sumut mendukung perkembangan olahraga boling dengan membangun fasilitas lintasan. “Sangat disayangkan di Medan tidak ada lagi lintasan boling. Kami pun terpaksa harus berlatih ke luar daerah atau bahkan luar negeri,” ujar atlet penghuni Pelatnas junior ini. Ketua Umum Pengda PBI Sumut, Singgih Goenawan, mengaku terharu dengan prestasi yang dipersembahkan para atletnya. Terlebih Imam dan Indri harus bersaing dengan atletatlet senior berlabel nasional. “Prestasi Imam dan Indri menjadi bukti jika boling Sumut

Waspada/Dedi Riono

PEBOLING junior Sumut, Imam Wiguna dan Aldila Indryati, menyabet medali perak nomor mixed double Kejurnas 2013 di Bali. punya masa depan cerah. Hal ini harus menjadi perhatian KONI dan Pemprovsu untuk mendukung sarana prasarana olahraga boling di Sumut, khususnya pembangunan lintasan,” ujar Singgih. “Kasihan atlet-atlet boling Sumut, tidak ada lagi lintasan representatif yang bisa digunakan untuk berlatih. Hanya ada

di Yuki, tapi kondisinya sudah tidak memungkinkan. Hal ini akan menghambat perkembangan olahraga boling di Sumut,” pungkas Singgih. Peluang peboling Sumut menambah perolehan medali masih terbuka lebar, di mana pada Rabu (6/11) ini, lima peboling Sumut akan tampil di nomor trio putra dan putri. (m42)



WASPADA Rabu 6 November 2013

Marquez Tanpa Persiapan Khusus VALENCIA, Spanyol (Waspada): MotoGP Valencia bakal menjadi penentu bagi Marc Marquez (foto) dan Jorge Lorenzo dalam usahanya merebut gelar juara dunia musim ini. Meski unggul 13 poin, Marquez mengaku tidak memiliki persiapan khusus.

Marquez memang berpeluang menjadi juara MotoGP di musim debutnya, setelah menjadi kampuin Moto2 2012. Sebaliknya, Lorenzo masih memiliki asa mempertahankan gelar musim lalu saat beradu dengan sang rookie di Sirkuit Ricardo Tormo, Minggu (10/11) nanti. Dengan posisi sekarang, Marquez cuma butuh finish keempat untuk mempersembahkan gelar kepada Repsol Honda. Bagi pria berusia 20 tahun asal Spanyol itu, keharusan itu bukan hal sulit karena selalu naik podium musim ini, kecuali mengalami kecelakaan atau terkena diskualifikasi seperti di seri Australia. Di Valencia, Marquez mengaku tak punya persiapan khusus. Jelang seri penutup tersebut, dirinya menegaskan akan mempersiapkan diri sebagaimana seri-seri sebelumnya. Beberapa waktu lalu, Lorenzo yang juga andalan Yamaha Factory itu menilai tekanan besar berada di pihak Marquez. “Balapan akhir pekan ini penting, tapi saya menghadapinya seperti balapan lain dan kami akan fokus sama seperti sejak seri pertama,” sahut Marquez, Selasa (5/11).

Bilamana terdapat sedikit perbedaan adalah Marquez memanfaatkan jeda dua pekan antara Jepang dan Valencia dengan fisioterapi. Ini dilakukan demi memulihkan kondisi pasca-mengalami kecelakaan di MotoGP Jepang. “Saya menjalani beberapa sesi fisioterapi untuk memulihkan kondisi leher, setelah terjatuh di Motegi. Untungnya, saya baikbaik saja dan menuju Cheste (MotoGP Valencia) dalam kondisi 100 persen,” tegasnya. Marquez boleh optimis saat tampil di Valencia, karena tercatat memiliki rekor yang baik di lintasan tersebut. Belum lagi, dirinya tak menyangka berada di posisi berpeluang masuk buku sejarah sebagai juara dunia MotoGP termuda. Bila berhasil, Marquez akan menjadi rookie pertama yang mencapai prestasi tersebut setelah Kenny Roberts pada musim 1978. “Saya selalu memberikan yang terbaik di Valencia. Saya masih ingat kenangan tahun lalu saat masih di Moto2 (juara), tapi cuaca yang selalu berubah menjadi salah satu faktor yang harus diperhatikan. Yang penting, saya siap naik motor dan kembali ke lintasan lagi!” tutup Marquez. (m33/mgp)

Ricciardo Ingin Tiru Marquez


Balas Dendam Sang Raja LONDON (Waspada): Raja tenis dunia asak Spanyol, Rafael Nadal (foto), mengawali perjuangannya di ATP World Tour dengan baik. Dalam laga pembukanya di O2 Arena, London, Selasa (5/11), Nadal juga revan kekalahan atas David Ferrer. Melawan rekan senega-

ranya itu, Nadal menang 6-3, 6-2. Hasil ini memuaskan Nadal karena membalas kekalahannya di semifinal Paris Masters pekan lalu. Di laga Grup A sebelumnya, Stanislas Wawrinka (Swiss) mengalahkan Tomas Berdych (Rep Ceko) 6-3, 6-7 (0), 6-3. Di Grup B, Juan Martin del Potro (Argentina) juga meng-

ikuti jejak Nadal. Kemenangan penting diraih Del Potro ketika menaklukkan Richard Gasquet (Prancis) 67 (4), 6-3, 7-5. Saat berita ini diturunkan, duel Grup B antara Novak Djokovic (Serbia) melawan Roger Federer (Swiss) masih berlangsung. (m33/bbc)

Vettel Bisa Lebihi Schumi MILTON KEYNES, Inggris (Waspada): Sebastian Vettel (foto kiri) mungkin belum memiliki gelar juara dunia Formula One (F1) sebanyak Michael Schumacher (foto kanan). Tapi, Stirling Moss menilaiVettel sudah lebih hebat dibanding Schumi. Mantan pebalap F1 asal Inggris itu memuji driver Red Bull Racing itu setelah finish terdepan di GP Abu Dhabi, akhir pekan lalu. Sukses di Sirkuit Yas Marina tersebut sekaligus memenangkan balapan tujuh kali beruntun bagi Vettel. Kemenangan di Abu Dhabi sendiri hanya berselang sepekan setelah Vettel memastikan titel juara dunia keempat secara beruntun. “Schumacher adalah pebalap hebat. Kontribusi terbesar Michael adalah ketika performa Ferrari menurun. Dia membawa beberapa desainer mobil

Pasang Iklan


untuk bekerja di Ferrari” jelas Moss, Selasa (5/11). “Tapi jika berbicara tentang pebalap besar, saya tidak berpikir Schumi. Saya tidak mengatakan dia buruk. Dia hebat, memberi tanda tangan untuk para penggemar, tapi Vettel adalah pebalap yang istimewa,” ungkapnya. Moss juga membandingkan

Telp. 4528431 HP. 081370328259

Schumi dan Vettel pada eranya masing-masing. Lagi-lagi, Moss yang sudah berusia 84 tahun berpendapat bahwaVettel lebih unggul daripada Schumi, sebab kualitas driver Red Bull itu jelas berbeda. “Vettel pria yang luar biasa, seorang driver yang luar biasa. Dia masih muda dan masih mungkin menang 10 gelar lagi,” sanjung Moss juga mengaku sebagai fans berat Vettel. (m33/auto)

VALENCIA, Spanyol (Waspada): Debut gemilang Marc Marquez (foto) bersama Repsol Honda di ajang MotoGP ternyata menginsipirasi pebalap Formula One (F1), Daniel Ricciardo. Diakui, Marquez dijadikan Ricciardo sebagai panutan ketika musim depan bergabung dengan Red Bull Racing untuk menjadi rekan Sebastian Vettel. Loncat dari kelas Moto2 ke MotoGP, Marquez menjalani transisi dengan mulus ketika memuncaki klasemen sementara kejuaraan dunia MotoGP. Bahkan, rider berusia 20 tahun asal Spanyol itu berpeluang menjadi juara dunia MotoGP bila finish empat besar di Valencia akhir pekan nanti. “Marc Marquez adalah role model saat ini. Saya hanya pindah tim dan masih membalap di F1, sedangkan Marquez beralih kategori. Dia benar-benar membuat kagum banyak orang karena membuat segalanya jadi mungkin,” ungkap Ricciardo berharap bisa menuai sukses serupa musim depan, Selasa (5/11). “Saya tidak akan membebani diri dan berkata akan melakukan ini, tapi saya memiliki keyakinan. Saya akan memberikan kemampuan maksimal musim depan karena memang memperkuat tim terbaik di dunia, itu pasti,” ujar driver berkebangsaan Australia itu. Meski Ricciardo tetap sepenuhnya memahami tantangan di depannya, pria berusia 24 tahun menambahkan bahwa ambisi utamanya adalah membangun tim solid di sekelilingnya. Ricciardo juga ingin memastikan belajar banyak dari Vettel. “Ini bukan masalah pribadi, tapi Anda perlu membangun tim di sekitar Anda . Memiliki kesempatan tampil di tim top, saya pasti harus mendapatkan apa yang saya inginkan. Saya datang dengan rasa hormat, tapi juga datang dengan visi dan tujuan,” tutup pebalap Toro Rosso tersebut. (m33/auto)

Sumatera Utara

WASPADA Rabu 6 November 2013


Zhuhur ‘Ashar

Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

12:11 12:24 12:11 12:18 12:18 12:15 12:11 12:07 12:14 12:13

15:32 15:45 15:33 15:40 15:40 15:36 15:33 15:28 15:35 15:35

Magrib 18:11 18:22 18:11 18:17 18:17 18:17 18:12 18:08 18:14 18:12



Shubuh Syuruq


19:21 19:32 19:22 19:27 19:27 19:28 19:22 19:18 19:25 19:23

04:41 04:57 04:42 04:51 04:50 04:43 04:42 04:37 04:44 04:45

04:51 05:07 04:52 05:01 05:00 04:53 04:52 04:47 04:54 04:55

L.Seumawe 12:17 L. Pakam 12:10 Sei Rampah12:09 Meulaboh 12:21 P.Sidimpuan12:08 P. Siantar 12:09 Balige 12:09 R. Prapat 12:06 Sabang 12:24 Pandan 12:10

06:09 06:24 06:09 06:18 06:17 06:10 06:09 06:04 06:12 06:12

Zhuhur ‘Ashar 15:38 15:31 15:31 15:42 15:30 15:31 15:30 15:27 15:45 15:32





Shubuh Syuruq


Zhuhur ‘Ashar




Shubuh Syuruq







Shubuh Syuruq

18:15 18:10 18:09 18:20 18:11 18:10 18:10 18:07 18:21 18:12

19:26 19:20 19:19 19:31 19:21 19:20 19:21 19:18 19:32 19:23

04:49 04:41 04:40 04:52 04:36 04:39 04:38 04:35 04:57 04:39

04:59 04:51 04:50 05:02 04:46 04:49 04:48 04:45 05:07 04:49

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:10 12:11 12:21 12:14 12:11 12:18 12:06 12:16 12:09 12:09

18:12 18:12 18:19 18:16 18:11 18:17 18:07 18:17 18:11 18:09

19:23 19:23 19:30 19:26 19:22 19:27 19:18 19:27 19:22 19:20

04:39 04:41 04:54 04:43 04:42 04:50 04:36 04:47 04:38 04:39

04:49 04:51 05:04 04:53 04:52 05:00 04:46 04:57 04:48 04:49

Panyabungan Teluk Dalam Salak Limapuluh Parapat GunungTua Sibuhuan Lhoksukon D.Sanggul Kotapinang AekKanopan

12:07 12:14 12:12 12:07 12:09 12:07 12:06 12:16 12:10 12:05 12:06

15:28 15:35 15:33 15:29 15:31 15:28 15:28 15:38 15:32 15:26 15:28

18:10 18:17 18:13 18:08 18:10 18:09 18:09 18:14 18:12 18:07 18:08

19:21 19:28 19:24 19:19 19:21 19:20 19:20 19:25 19:22 19:17 19:18

04:35 04:41 04:41 04:38 04:39 04:35 04:34 04:49 04:39 04:34 04:36

04:45 04:51 04:51 04:48 04:49 04:45 04:44 04:59 04:49 04:44 04:46

06:16 06:08 06:07 06:19 06:04 06:06 06:05 06:02 06:24 06:06

15:31 15:33 15:43 15:36 15:33 15:39 15:28 15:38 15:31 15:30

06:06 06:09 06:21 06:11 06:09 06:17 06:03 06:14 06:06 06:06

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

06:02 06:08 06:09 06:05 06:06 06:02 06:01 06:16 06:07 06:01 06:03

Merasa Ditipu, Warga Miskin Penerima BSPS Ngadu Ke Polisi PANGKALANSUSU (Waspada): Belasan warga miskin dari Desa Alurcempedak penerima Bantuan Stimulan Perumahan Swadaya (BSPS) dari Kemenpera, melaporkan sejumlah oknum yang diduga melakukan pungli dengan dalih untuk membuka buku rekening bank ke Polsek Pangkalansusu, Selasa (5/11). Para korban yang merasa dirugikan atas pemungutan itu datang ke Mapolsek didampingi salah seorang tokoh pemuda, Deswanta. Laporan pengaduan masyarakat diterima petugas SentraPelayananKepolisian(SPK) MapolsekPangkalansusu,Brigadir P. Sihombing.

Mariana,salahseorangwarga mengatakan,merekamenempuh upaya hukum karena merasa tertipu atas permintaan uang masing-masingRp100.000dengan alasan untuk membuka buku rekening. Padahal mereka tahu, pemerintah atau pihak Bank BRI tidak mengutip uang kepada

H. Haris Fadillah Plh. Bupati Sergai SEIRAMPAH (Waspada): Sekretaris Daerah (Sekda) Kab. Serdang Bedagai, Drs. H. Haris Fadillah, M.Si (foto) ditunjuk sebagai Pelaksana Harian (Plh) Bupati Sergai berdasarkan surat tugas No:18.36/800/4312/2013 tertanggal 1 November ditandatangani Bupati Sergai, Ir. H. Soekirman, terhitung 3-15 November mendatang. Plh. Bupati Sergai, H. Haris Fadillah kepada Waspada, Senin (4/11) di ruang kerjanya menyatakan dia ditunjuk sebagai Plh menjalankan tugas rutin bupati berhubung Bupati Sergai H. Soekirman menjalani tugas pendidikan kepemimpinan yang diselenggarakan Kemendagri ke Australia. “Mudah-mudahan pelaksanaan pemerintahan di Kab. Sergai tidak akan terkendala,” harap H. Haris Fadillah. Pengamatan Waspada, ditunjuknya Sekdakab Sergai sebagai Plh. Bupati Sergai, berhubung calon Wakil Bupati Sergai yang telah diusulkan Bupati H. Soekirman ke DPRD, yakni Syahrianto, SH (mantan Ketua KPUD Sergai) dan Ridwan Sitorus, SE (Sekretaris DPD PAN Sergai) masih dalam prosesTim Pansus Tata Tertib Khusus PemilihanWakil Bupati Sergai Sisa Masa Jabatan tahun 2010-2015, di DPRD Sergai.(c03)

PNPM MP Brandan Timur Baru Rampung 80 Persen P. BRANDAN (Waspada): Pembangunan parit beton dan rabat beton Program Nasional Pemberdayaan Masyarakat Mandiri Perdesaan(PNPM MP) tahun 2013 di Kelurahan Brandan Timur Baru, Kec. Babalan, Kab Langkat yang tahap pengerjaannya dimulai pertengahan Juli lalu, sudah rampung 80%. Ketua Tim Pengelola Kerja (TPK) PNPM MP Kel Brandan Timur Baru, Harmyn didampingi Bendahara M. Azhar mengatakan dari lima titik pembangunan hanya dua titik lagi tahap pengerjaan, di antaranya pembangunan rabat beton di Lingkungan Krida. “Pembangunan parit beton di tiga lokasi sudah rampung dan tinggal dua lokasi tahap pengerjaan. Sudah 80% rampung berarti tinggal 20% lagi,” terang Harmyn kepada Waspada, kemarin. Secara terpisah, Lurah Brandan Timur Baru Ashari Siregar berterimakasih kepada TPK PNPM MP Brandan Timur Baru, yang bekerja maksimal dengan hasil berkualitas. (c01)

Pemko T. Tinggi Aktifkan Safari Subuh Ke Masjid TEBINGTINGGI (Waspada): Pemko Tebingtinggi bekerjasama dengan Mapolres, mengaktifkan kegiatan safari subuh atau sholat subuh berjamaah ke berbagai masjid. Jumat lalu, rombongan Wali Kota Ir. H. Umar Zunaidi Hasibuan, MM dan AKBP Enggar Pareanom, S.Ik mengunjungi masjid Al Huda di Kel. Brohol, Kec. Bajenis. Turut hadir Ketua MUI, Drs. Ahmad Dalil Harahao, Ketua FUI, H.Agusul Khair, S.Ag, Ketua Nahdahtul Ulama, Ketua Dewan Masjid, tokoh masyarakat serta Kabag Adm Humas PP Pemko Tebingtinggi Ahdi Sucipto, SH, Kabag Kesra dan jamah subuh warga setempat. Usai sholat subuh, kegiatan dilanjutkan dengan dzikir bersama dibawakan Kapolres Enggar Pareanom, dilanjutkan tausiyah oleh Wali Kota dan Kapolres.(a09)

Warga Ke DPRD Tolak Pembangunan Tower TEBINGTINGGI (Waspada): Puluhan warga Lk.02, Kel. Teluk Karang, Kec. Bajenis, mendatangi DPRD kota Tebingtinggi, Senin (4/11), mempersoalkan pendirian bangunan tower telekomunikasi yang prosesnya dinilai menyalahi aturan. Delegasi warga diterima Wakil Ketua DPRD H. Amril Harahap, didampingi Kakan P2T Syahnan Hasibuan, SH, mewakili Dinas PU, Kaban Kebangpol dan Linmas Amas Muda, SH dan Kasat Intel Polres Tebingtinggi. Salah seorang warga Lelawati, kepada anggota dewan mengatakan wargakeberatanterhadappembangunantower.“Selamainikehidupan kami aman dan tidak waswas. Tapi setelah pembangunan tower, kami cemas,” terang ibu rumah tangga itu. Diungkapkan, Kepling 02 sebelumnye pernah menjanjikan akan ada sosialisasi dan musyawarah antar warga dengan perusahaan yangmendirikantower.Namunsetelahdinanti-nantihinggabangunan mulai dikerjakan, janji musyawarah itu tak pernah terlaksana. “Jelas kami dibohongi,” ketus Lelawati.Warga minta pembangunan tower dihentikan. Kakan P2T Syahnan Hasibuan, SH menerangkan pihaknya belum mengeluarkan izin pembangunan tower itu. Meski permohonan memperoleh IMB sudah diajukan perusahaan. Diakui, dari pemeriksaan berkas permohonan, ada tandatangan sejumlah warga di sekitar lokasi pembangunan. “Saya lihat secara prosedur, semua memenuhi ketentuan,” ujar Syahnan. Namun dikatakannya, kalau soal teknis bukanlah wewenang Kantor P2T, melainkan wewenang Dinas PU. Menyikapi hal itu, Wakil Ketua DPRD H. Amril Harahap minta Kantor P2T tidak mengeluarkan izin IMB sebelum ada kesepakatan dari masyarakat. “Sebelum ada kesepakatan DPRD minta jangan keluarkan izin,” tegas Amril. DPRD akan menyurati Sekda agar memerintahkan Camat, Lurah dan Kepling memfasilitasi pertemuan antara warga dengan pihak pengembang, dan kepada Satpol PP agar menghentikan pembagunan tower tersebut menunggu IMB selesai, tegas Amril Harahap.(a09)

masyarakat. Dia mengaku menyerahkan uang kepada SF, dicatat perangkat desaWu. Penyerahan uang sebagianberlangsungdiruanganSDN 056034 dan sebagian di luar ruangan. Proses penyerahan disaksikan langsung oleh Kades, Surya Dharma, termasuk, Indra Cahyadi, yakni Caleg DPRD Langkat. Sementara karena ruangan terbatassebagianwargadiantaranya, Hamdani, Zuriah, Nurhayati dan Sistiana mengaku menyetorkan uang kepada seorang oknum perangkat desa berinsial Gu. “Ketika itu ratusan warga sengaja dikumpulkan Kades di gedung SDN,” aku Zuriah. Tidakhanyaitu,wargamiskin penerima bantuan BSPS juga dikenakan uang untuk pengurusan surat tanah yang besarannya bervariasi, antara Rp150.000 s/ d Rp200.000. “Untuk mengurus surat tanah Kades minta Rp200.000,” kata Irnawati, Zuriah dan Nurhayati. Kepala Unit Bank BRI Pangkalansusu, Jefri yang dikonfirmasi sebelumnya menyatakan, pembukaan rekening dilakukan secara massal di BRI Pusat.“Tugas BRI Unit Pangkalansusu hanya mencetakbukurekening,”ujarnya

sembari menambahkan, warga tidak dikenakan biaya untuk membuka rekening. Ketua DPC MPI Kec. Pangkalansusu, Deswanta, disela mendampingi warga mengadu, saat ditemui Waspada menyatakan, warga tidak perlu takut memperjuangkankebenaran.Iamenegaskan,masyarakatharusberaniberjihadmelawankebatilanyangdibangun Kades bersama kroninya. “Saya siap mem-back up masyarakat yang dirugikan,” ujar tokoh pemuda ‘kota minyak’ itu seraya mengingatkan pihak kepolisian serius memproses kasus ini agar ke depan tidak ada lagi oknum yang melakukan pembodohan kepada masyarakat miskin yang awam. KapolsekPangkalansusu,AKP Abdul Somad, melalui Kanit Reskrim Ipda D. Situmorang ketika dikonfirmasi menegaskan pihaknya siap menindaklanjuti pengaduan masyarakat. Namun karena jumlah korban cukup banyak, maka proses pemeriksaan dilakukan bertahap. Terkait adanya dugaan keterlibatan oknum Kades, ia mengatakan itu tergantung hasil proses penyelidikan dan penyidikan. “Kita belum dapat menyimpul-

kan, tunggu hasil pengembangan,” ujarnya seraya menambahkan, terlapor dijerat Pasal 372 dan Pasal 378 KUHP. Membantah Sementara itu Indra Cahyadi (Caleg DPRD Langkat) dan Surya Darma (Kades Alur Cempedak, Kec. P. Susu, Langkat), melalui surat tertanggal 12 November 2013 yang dikirim via faximile ke Waspada, membantah pemberitaan Waspada menyangkut kutipan Rp100.000 kepada warga penerimaBSPS,untukmembuka buku rekening di BRI. Dalam faxnya disebutkan, pihaknya membantah/menyanggah pemberitaanWaspada tanggal 30 Oktober 2013 ‘Penerima BSPS Resah, Oknum Minta Bagian’. Kemudian tanggal 31 Oktober 2013, ‘Masyarakat Penerima Bantuan BSPS Jangan Dibodoh-bodohi’, dan berita 1 November 2013, ‘Kutipan Penerima BSPS Turun Dari Rp1,5 Juta Jadi Rp100.000’. Indra Cahyadi dan Surya Darma menyebut pihaknya tidak pernah melakukan pemotongan satu sen pun, tapi uang sebesar Rp100.000untukmembukabuku rekening, bukan merupakan kutipan illegal.(a02)

Haram Hukumnya Memotong Dana BSPS BINJAI (Waspada): Adanya oknum atau lembaga tertentu memotong dana bantuan perumahan BSPS, berarti dosa besar. “Haram hukumnya memotong atau meminta dana bantuan perumahan bagi masyarakat takmampu,”tegasDeputyBidang Perumahan Swadaya, Kemenpera RI, Ir. Jamil Ansyari, SH, MM, di Pendopo Umar Baki Binjai, kemarin, saat menyerahkan bantuan pembangunan rumah bagi 805 warga Binjai. Masih adanya pemotongan dana bantuan perumahan di Kab. Langkat dan Binjai, berarti masih ada oknum tertentu yang mencari keuntungan dari orangorang miskin. Apalagi Ansyari secara tegas, menyatakan bantuan kepada masyarakat miskin untuk membangun rumah agar layak huni, sebesar Rp7.500.000

disalurkan ke rekening warga melalui BRI. “Tidak boleh satu sen pun dipotong,” tegasnya. Bantuan BSPS di kota Binjai disalurkan untuk 805 penerima, Kab. Langkat sekitar 800, Simalungun 1.700, dan ditotal pada 2013 di Prov. Sumut bantuan untuk perumahan disalurkan kepada 9.000 penerima. Deputi Bidang Perumahan Swadaya Kemenpera RI juga menegaskan,bantuandiberikanmurni daripemerintah.“Janganadapihak tertentuyangmemanfaatkanbantuan dari APBN untuk politis.” Ir. Ansyari juga berdialog dengan penerima di Pendopo Umar Baki, serta memberikan berbagai saran, agar dana bisa dimanfaatkan secara baik. Seperti pembelian bahan bangunan, harus langsung ke panglong, jangan melalui calo. Pekerjaan

bisa digotongroyongkan sesama warga,gunamencukupidanayang ada,” sarannya. Ditegaskan Deputi, Ir. Jamil Ansyari, “harusnya disadari, jangan lagi menyusahkan orang miskin. Intel KPK akan masuk ke rumah anda”, ujarnya sambil menambahkan, hal itu berkaitan tentang pengawasan bantuan dana APBN untuk perumahan. Sedangkan LSM Peduli Rakyat Miskin di Kab. Langkat, juga menegaskan pengusutan tuntas terhadap adanya pemotongan dan permintaan uang dari warga penerimaBSPSdiBesitang,P.Susu dan daerah lainnya. Begitu juga di Binjai, LSM Peduli Binjai minta janganadapolitisasipihaktertentu tentang bantuan perumahan rakyatmiskin,sebabbantuanyang diterima merupakan perjuangan Pemko Binjai.(a04)


BELASAN warga miskin penerima BSPS melaporkan sejumlah oknum yang melakukan pemungutan uang ke Mapolsek Pangkalansusu.

Program Presiden SBY Di Kecamatan Beringin DS BERINGIN, Deliserdang (Waspada): Salah satu program Presiden Susilo Bambang Yudhoyono diimplementasikan para ibu di Desa Karanganyar, Kec. Beringin, Deliserdang. Pantauan dan informasi Waspada himpun akhir pekan lalu, para ibu yang tergabung dalam Kelompok Tani Sanggar Pertiwi dan Sanggar Rezeki dengan pimpinan PPL Rohedi menerima bantuan dari BPPT Kementerian Pertanian via Provinsi Sumut. “Untuk meningkatkan gizi pangan pada keluarga, Presiden Susilo BambangYudhoyono memberi instruksi kepada setiap provinsi agar melaksanakan program Model Kawasan Rumah Pangan Lestari (MKRPL). Ini sebagai upaya kita meningkatkan gizi dengan memanfaatkan halaman yang sempit,” demikian Bagian Penelitian BPPT Pertanian Tingkat I Sumut, Ir. Helmi, M.Si di hadapan para ibu di Desa Karanganyar. Menurut Helmi, upaya menanam sayuran di halaman rumah melalui program MKRPL ini penting untuk semua keluarga, khususnya di Sumut. “Dengan menanam sayuran 10% gizi panganbisakitaserap.Meskidarisisibisnisbelum

dapat terpenuhi, setidaknya kebutuhan keluarga bisa terpenuhi,” imbuhnya. Helmi menambahkan, Program MKRPL dilakukan berkesinambuangan. “Selain menanam melalui kelompok kita juga membuat pembibitan desa dengan sebutan Kebun Bibit Desa (KBD) agar penanaman ini lestari,” ujarnya sembari berharap kesungguhan para ibu dengan bekerja keras serta menggalang warga lainnya, agar program itu maju dan dapat memasarkannya melalui kelompok bila gizi keluarga telah terpenuhi. Sementara Camat Beringin, Batara R Harahap pada kesempatan pemberian bantuan berupa bibit sayuran, pupuk kompos, polibet serta bambu sebagai media pembuatan pagar, berterimakasih kepada BPPT Pertanian Tingkat I yang telah menyerahkan bantuan pertanian ke Desa Karanganyar. “Mari kita bersatu agar program ini berhasil, selain desa kita hijau kebutuhan gizinya juga cukup. Acara itu dihadiri Kepala Desa Karang Anyar, Sugeng beserta ibu Herlina, PPL Pertanian UPT Beringin,RohedidanSupadi,S.Pd,sertamasyarakat tani Kec. Beringin.(m16)

Waspada/Rizaldi Anwar

Kelompok tani Desa Karanganyar bersama BPPT Tingkat I Sumut.

Ribuan Umat Islam Tebingtinggi Semarakkan Tahun Baru 1435 H UDARAmendungdiiringi hujan rinai, Selasa (5/11), tak mengendurkan semangat ribuan umat Islam kota Tebingtinggi menyemarakkan penyambutan Tahun Baru Islam1435H.Berbagaielemen umat Islam, tumplek di lapangan Merdeka, melakukan apel, pernyataan sikap serta pawai ta’aruf sejauh sekira 3 km. Pada podium kehormatanWali Kota Ir. H. Umar Zu-

naidi Hasibuan, MM bersama WakilWali Kota H. Irham Taufik, SH, MAP, Ketua DPRD H. Sjahrial MaliksertaKapolresAKBPEnggar Pareanom, S.Ik memimpin acara pembukaan. Wali Kota Ir. H. Umar Z Hasibuan, MM, menyatakan Tahun Baru Islam 1435H harus jadi momentum tepat mendorong semangat setiap muslim untuk mengembangkan kesadaran dan kesungguhan mengamalkan ajaranIslam.“Pengamalanajaran

Islam yang benar dan kaffah sepanjang sejarah mampu memberi peran penting dalam peradaban dunia,” ujar Wali Kota. Dalam Alquran, lanjut Wali Kota,adapenegasanbetapaumat Islam adalah umat terbaik yang pernah diorbitkan di muka bumi, jika melaksanakan Islam secara benar dan kaffah. “Ajaran Islam yang benar dan kaffah merupakan Rahmatan lil alamin,” tegas Umar Z Hasibuan. Ada sejumlah masalah yang

saat ini menyerang umat Islam dan harus segera diselesaikan. Terjadinya kerusakan moral dan akhlak yang menggoyahkan sendi-sendikehidupanberbangsa dan bernegara, berujung pada lemahnya ukhuwah islamiyah, tingginya tingkat kenakalan remaja rendahnya minat orangtua menanamkannilaiagamakepada anak, pergaulan bebas, narkoba, perjudian serta sikap masa bodoh terhadap lingkungan. “Sayamenyerukanagarumat

Waspada/Abdul Khalik

BARISAN pawai ta’aruf Ormas Islam dalam kegiatan penyambutan Tahun Baru Islam 1435H di hadapan unsur Muspiko Tebingtinggi.

Islam bersatu tenaga untuk menangani permasalahan yang jadi beban umat Islam ini,” pinta Wali Kota. Pemko Tebingtinggi akan mendukung penuh berbagai upaya ke arah itu, dengan menyiapkan berbagai hal yang diperlukan,semisalregulasiuntuk penanganan dan pencegahan masalah-masalah yang dihadapi umat Islam. Perangi Judi Umat Islam kotaTebingtinggi dalam apel itu membuat lima pernyataansikap,ditandatangani MUI, Dewan Masjid Indonesia, Ikatan Persaudaraan Haji Indonesia, AlWashliyah, NU, Muhammadiyah, Al Ittihadiyah, Dewan DakwahIslamiyahIndonesiadan Forum Uhuwah Islamiyah kota Tebingtinggi. Pernyataan sikap yang dibacakan di hadapan unsur Muspiko dan Kapolres, di antaranya berbunyi; Siap membantu dan berpartisipasi aktif memberantas segalabentukkemaksiatan,seperti perjudian, Narkoba, prostitusi dan lainnya, karena perbuatan itu merusak moral anak bangsa. Juga mendukung PemkoTebingtinggi menerbitkan Perwa/Perda Syari’ahtentangJamWajibBelajar Bagi Pelajar. Siap menjadi garda terdepan dalam rangka memakmurkan masjid, mengaktifkan majelis taklim di setiap masjid dan perwiridan serta mengajarkan Alquran dan mendorong umat Islam untuk melakukan amar makruf nahi munkar. Siap memberi contoh dalam

berbusana Islami dan mengimbau umat Islam untuk berbusana muslim, terlebih pada Jumat,khususnyakepadaPNS muslimdiinstansipemerintah dan swasta. Siap menyukseskan Pemilu 2014 dengan mengimbau seluruh umat Islam menggunakan hak pilihnya dan memilih calon legislatif yang menjalankan syariat agamanya serta mengecam kerasGolputdanmoneypolitic. Mendukung gerakan Islam peduli dengan mengimbau umat Islam punya kepedulian terhadap penderitaan sesamadilingkunganmasingmasing. Sebelumnya, Ketua Panitia Drs. H. Agussalim melaporkan berbagai kegiatan dalam menyemarakkan penyambutan Tahun Baru Islam 1435H. Sedekah Abadi Di sela acara Kabag Kesra PemkoTebingtinggi Sahbana Hasibuan, SPd, MM menyampaikan adanya gagasan yang harus dipikirkan umat Islam ke depan, dalam bentuk gerakan ‘sedekah abadi.’ Di mana setiap umat Islam yang mampu punya tekad mengeluarkan sedekahnya untuk dijadikan sebagai dana membantu sesama. “Tekad ituakanbesarmanfaatnyabagi kemaslahatan umat Islam,” saransosokyangberadadibalik sukseskegiatan‘Penyambutan Tahun Baru Islam 1435H.’ * Abdul Khalik

Sumatera Utara

B2 Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir

KOTAPINANG (Waspada): Ratusan santri Pondok Pesantren Ahmadul Jariyah Kotapinang, Kab. Labusel, Selasa (5/11) pagi melakukan pawai untuk memeriahkan Tahun Baru Islam 1 Muharam 1435 Hijriyah. Pawai yang diikuti 700-an santri tingkat Tsanawiyah dan Aliyah ini dilepas oleh Pimpinan Yayasan Pondok Pesantren Ahmadul Jariyah, H Syaiful Mashuri Rambe didampingi sejumlah wali santri. Pawai dimulai dari halaman pesantren, di Jl. Bedagai, Kel. Kotapinang. Peserta kemudian berjalan menempuh jarak lebih kurang tiga kilo meter dan berakhir di Jl. Labuhan, lalu kembali lagi ke pesantren. Peserta pawai hanya memakai separuh badan jalan,sehinggapenggunajalanlaintidakterganggu.

Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu Lusia Damayanti (Jakarta).

Wartawan Kota Medan: Umum: H. Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkili Darwis, H. Abdullah Dadeh, H. Suyono, Hj. Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa, Avli Yarman. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Arianda Tanjung, Dio Utama. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebingtinggi: Muhammad Idris, Abdul Khalik. Pematangsiantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Tarutung: Parlindungan Hutasoit. Sibolga/Tapanuli Tengah: Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanaiah, Hasanul Hidayat. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar, Dedek Juliadi. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Jasvira Sautisa. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

 Semua wartawan WASPADA dilengkapi dengan kartu pers. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada yang mengaku wartawan WASPADA tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi 

Hubungi kami

Waspada/Rasudin Sihotang

PUTRA Ayong, William memperlihatkan ventilasi di Toko M 2000 yang dirusak dan menjadi pintu keluar masuk para tersangka.

Polisi Ringkus Penjarah Toko M 2000 TANJUNGBALAI (Waspada): Satu dari enam penjarah toko telepon seluler M 2000 di Jl. Sudirman Kota Tanjungbalai diringkus petugas Kepolisian Resort Kota Tanjungbalai. Tersangka berinisial HL alias Katam, 16, warga Jl. DTM Abdullah, Kel. TB Kota IV, Kec. Datukbandar, Kota Tanjungbalai ditangkap di kawasan Kualuh Ledong, Kab. Labuhanbatu, Senin (4/11) malam. Tersangka dalam pemeriksaan mengungkapkan pelaku pemboboltokoponselitusemuanyaberjumlahenamorang.“Lima tersangka lainnya sudah kita

masukkandalamdaftarpencarian orang,”kataKapolresTanjungbalai AKBP ML Hutagaol melalu KasubbagHumasAKPYSinulingga. Saat ini, kata Sinulingga, tersangka masih dilakukan pengembangan intensif dan sudah dijebloskan di sel tahanan PolresTanjungbalai. Katam dikenakan Pasal 363 Ayat 4 dari Kitab Undang-undang Hukum Pidana tentang Pencurian dan Pembe-

ratan dengan ancaman di atas 6 tahun kurungan. “Kami mengimbau agar masyarakat berhatihatimenjagahartabendanya.Bila inginmeninggalkanrumah,harap membuat pengamanan ekstra guna pencegahan karena tindak kriminal bisa terjadi kapan saja,” imbau Sinulingga. Sebulan sebelumnya, Toko M2000 di Jl. Sudirman No 68 dibobol kawanan maling. Dari konter HP milik Ayong alias Sunardi, 42, warga KS Tubun, pencuri berhasil membawa kabur ratusan telepon seluler berbagai merek dengan kerugian di atas Rp150 juta. (a32)

Pembangunan Jeti Terapung Di P. Salahnama TG TIRAM (Waspada): Kalangan masyarakat menyambut baik paket pembangunan jeti terapung (dermaga terapung) bersumber dari APBN Tahun 2013 di Batubara, dan menilai pembangunan tersebut tak terlepas gebrakan dilakukan Bupati H OK Arya Zulkarnain, SH, MM dalam rangka memajukan daerah khususnya di sektor wisata. “Lihatini,tumpukanmaterial pembangunan jeti terapung menggunakan bahan pabrikasi dan tinggal dipasang,” tukas sejumlah nelayan dan tokoh pemu-

dadiTanjungtirambegitumelihat tumpukan material paket proyek tersebut di pelataran pelabuhan untukdidropkePulauSalahnama, salah lokasi wisata yang berada di perairan Kec. Tanjungtiram, Selasa (5/11). Material pembangunan tersebuttibasejakkemarin,diangkut menggunakantrukdandibongkar di pelataran pelabuhan untuk dipasang.“Kitaharapkanininanti lebih mempermudah akses pelayanan bagi jasa wisata yang akhirnya dapat meningkatkan ekonomi masyarakat,” ujar tokoh pemuda Sultan Aminuddin,

sembari mengatakan pembangunan jeti tersebut lebih memudahkanbagikalanganwisatayang berkunjung khususnya yang hobby memancing. Sedangkan pembangunan, katanya, langsung di bawah pengawasan Dinas Kelautan dan Perikanan (DKP) Kab. Batubara. Bupati Batubara H OK Arya Zulkarnain, SH, MM sejak awal menyatakan, pembangunan jeti terapung sebagai upaya pengembangan di sektor wisata, sejalan memberikan pelayanan kepada wisatawanmaupunnelayanyang menggunakan jasa wisata. (a13)

Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN DAN BIRO  Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874.

 Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109.

Waspada/Iwan Has

TUMPUKAN material yang umumnya bahan pabrikasi untuk pembangunan jeti terapung sebagai mendukung pengembangan sektor wisata P. Salahnama di pelataran pelabuhan Tanjungtiram, sebelum di bawa ke pulau.

 Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412.

Kabel Listrik Mengundang Bahaya

Harga iklan per mm kolom: Hitam-putih Rp. 13.000,-, berwarna Rp. 36.000,Halaman depan: hitam-putih Rp. 39.000,-, berwarna Rp. 108.000,Ukuran kolom: 40,5 mm. E-mail Iklan:

TANJUNGBALAI (Waspada): Sejumlah kabel lampu jalan di Jl Di Jl AMD Kel. Bungatanjung, Kec. Datukbandar Timur, Kota Tanjungbalai mengancam pengguna jalan. Pasalnya, kabel tersebut tidak lagi di posisi sebenarnya yakni menjuntai ke bawah dan sudah bisa disentuh anak SD. Parahnya lagi, kabel diselipkan di antara pepohonan di pinggir jalan.

Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Seleksi CPNS Batubara Bebas KKN LIMAPULUH (Waspada): Bupati Batubara H OK Arya Zulkarnain, SH, MM menjamin seleksi CPNS Tahun 2013 bebas dari praktik korupsi, kolusi dan nepotisme (KKN). “Kami menjamin pelaksanaan test CPNS Batubara bebas KKN,” tukasnyadidampingiSekdakabErwinSEdanKepalaBKDSautSiahaan SE, MM usai memantau pelaksanaan ujian CPNS di Limapuluh, Minggu (3/11). Sistem penerimaan CPNS, katanya, dikoordinir oleh tim nasional dan tidak dapat dicampuri siapapun. Apa lagi mengintervensi. Bupati yang terpilih melalui jalur independen ini mengaku, jumlah pegawai di lingkungan Pemkab Batubara masih memerlukan penambahan dan berharap dari tes tersebut akan diperoleh CPNS yang terbaik dan berkualitas. Dalam pelaksanaannya juga Pemkab berkoordinasi dengan kantor regional VI Badan Kepegawaian Negara (BKN), BPKP, pihak kepolisian serta instansi terkait demi kelancaran pelaksanaan. CPNS Batubara diikuti 2976 peserta umum dan 588 melalui jalur honorer atau kategori 2 dilaksanakan di SMAN 1, MAN, SMPN 1 Limapuluh, SMAN, SMKN, SMK Budi Darma, SMK Amir Hamzah Air Putih- Indra Pura, SMPN 2 Sei Balai dan Sei Bejangkar. Dari jumlah peserta umum Pemkab Batubara akan menerima sebanyak 95 CPNS. (a13)

“Ini kegiatan rutin pesantren untuk memeriahkan hari-hari besar Islam. Kita melakukannya agar santri lebih menanamkan sikap-sikap ke-Islaman dan memahami Islam sejak dini. Ini juga untuk merangsang santri di sekolah ini agar siap untuk berkompetisi,” kata Syaiful Mashuri Rambe. Pengamatan Waspada, selama pawai berlangsung seluruh tenaga pendidik pesantren dan beberapa petugas Kepolisian Polsekta Kotapinang memandu jalannya kegiatan menggunakan mobil patroli, sehingga perjalanan tertib. Selain pawai, peringatan 1 Muharram 1435 H ini juga diisi oleh pihak Pondok Pesantren Ahmadul Jariyah dengan berbagai perlombaan seperti lomba cerdas cermat Islami, pidato Bahasa Inggris, Bahasa Arab, dan Bahasa Indonesia, serta perlombaan lainnya. (c18)

Kontes Kicau Mania Bupati Cup III 2013

Penerbit: PT Penerbitan Harian Waspada

 Perwakilan dan Biro Banda Aceh: Jalan Ratu Syaiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385.

Rabu 6 November 2013

Santri Ahmadul Pawai Peringati 1 Muharram


Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: H. Halim Hasan. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Zulkili Harahap. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Promosi: Edward Thahir (Koordinator). Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Sinur Manik (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi); Hang Tuah Jasa Said (Potret).


“Kita khawatir jika kulit kabel terkelupas, pasti berbahaya bagi pengguna jalan yang lewat dari sini,”kataRidwan,40,pengendara sepedamotor kepada Waspada, Senin (4/11). Menurut Ridwan, jalan tersebut merupakan daerah perlintasan yang banyak dilalui masyarakat terutama anak-anak. Meski belum pernah merenggut korban, namun kiranya hal tersebut

menjadi perhatian pihak terkait. “Tahulah anak-anak, mainmainkanpulanantidekatkabelini, teruskesetrum,siapayangbertanggungjawab,”pungkaspengendara lainnya, Khairul Amri, 35. Menghindari hal-hal yang tidak diinginkan, warga meminta instansi yang bertanggungjawab agar mengembalikan kabel ke posisisemula,supayamasyarakat merasa aman dan nyaman. (a32)

RANTAUPRAPAT ( Waspada): Bupati Kajari Cup III 2013 kelas Burung Kenari, Kapolres LabuhanbatuTigor Panusunan Siregar, membuka Cup III 2013 kelas Kacer dan untuk Bupati Cup kontes mania kicau burung Bupati Cup III 2013, III 2013 kelas A Murai Batu. Adapun yang berhasil menjadi juara untuk Minggu (3/11) bertempat di lapangan Polres Murai Batu Best of the Best Arbain dari Dumai, Labuhanbatu. Bupati, dalam sambutannya mengatakan, sedangkan Kacer Best of the Best Jopi dari Kisaran. Acara ini turut dihadiri oleh Kapolres bahwa hari ini kita menyaksikan kontes kicau burung yang sangat merdu kita dengarkan, Labuhanbatu AKBP Ahcmad Fauji Dalimunthe daripada kita mendengarkan kicauan-kicauan SIK, Ketua DPRD Labuhanbatu Hj Ellya Rosa politik yang membuat pikiran kita jadi pusing. Siregar SPd dan unsureMuspida lainnya. (c07) Diharapkan, Kicau Mania inidapatmenjadiagendatetap dan terbaik dari kontes mania yang pernah dilakukan sebelumnya oleh panitia. Tigor mengucapkan terima kasih kepada panitia yang telah melaksanakan kontes ini dengan baik serta terima kasih kepada BapakTong Seng yang menjadi sponsor acara ini sehingga sukses. Panitia pelaksana Indramono dalam laporannya mengatakan, Kicau Mania BupatiCupIII 2013 memperebutkanhadiahtotalRp150juta dan diikuti oleh 600 peserta yang berasal dari lima Provinsi yakni Aceh, Sumut, Sumsel, Sumbar dan Riau. Rangkaian Waspada/Budi Surya Hasibuan kegiatan kicau mania ini juga BUPATI Labuhanbatu Tigor Panusunan Siregar foto bersama memperebutkan Dandim Cup III 2013 kelas Love Bird, pemenang lucky draw Kicau Mania.

DPT Pileg L.Batu Berkurang 3.113 Jiwa RANTAUPRAPAT (Waspada): Daftar Pemilih Tetap (DPT) Pemilu Legislatif Kabupaten Labuhanbatu berkurang 3.113 Jiwa. Sebelumnya, KPUD setempat menetapkan jumlah pemilih sebanyak 293.790 jiwa. Ketua KPUD Hj Ira Wirtati didampingi Sekretaris Gargaran Siregar, Senin (4/11) menerangkan, pada rapat pleno terakhir 1 November 2013, pihaknya menetapkan jumlah DPT menjadi 290.677 jiwa terdiri dari laki-laki 146.934 jiwa dan perempuan 143.743 jiwa.

Jumlah pemilih itu, tambah Ira, terbagi di 9 kecamatan, yaitu Kecamatan Bilah Barat 23.231, Bilah Hilir 33.617, Bilah Hulu 38.997, Panai Hilir 23.986, Panai Hulu 22.600, Panai Tengah 23.412, Pangkatan 21.722, Rantau Selatan 41.245 dan Kecamatan Rantau Utara sebanyak 61.867 jiwa. Selain itu, katanya, untuk Kab. L.Batu terdapat sebanyak 1.215 Tempat Pemungutan Suara (TPS) dengan 98 Desa/Kelurahan. “Perbaikan jumlah DPT kemarin dihadiri perwakilan dari partai politik dan diketahui oleh Panwaslu. (a18)

Pembunuh Siswi SMK Divonis Hukuman Seumur Hidup KISARAN (Waspada): Tersangka pemerkosa dengan kondisi bagian wajah dan badan terbakar dan pembunuh siswi SMK Fernando Malau, dikebunkaret 4AncakBDivisiIISerbanganPT.BSP divonis hukuman seumur hidup oleh Majelis Kisaran, Minggu (21/4). Jasad tersebut diketahui melalui sandal dan cincin emas yang melingkar Hakim Pengadilan Negeri Kisaran. Sidang pembacaan vonis yang dipimpin di jari manis tangan sebelah kiri, karena korban Majelis Hakim Oloan Silalahi SH dengan hakim telah menghilang sejak tiga hari sebelum anggota Nur Effrianti SH dan Safwan Siregar SH, ditemukan tewas. Berkat kerja keras Polres Asahan tersangka Senin (4/11). Terpidana merasa tidak senang dan sempat meronta dengan mengambinghitamkan dapat dibekuk di Medan, kurang dari 24 jam penemuan mayat siswi SMK itu. Tersangka juga media. “Karena pemberitaan media saya divonis menjual sepeda motor milik korban, seharga seumur hidup,” ungkap terpindana sambil teriak Rp700 ribu. (a15) dandiamankanpetugaskemudian dibawa ke mobil tahanan dan langsung membawanya ke LP Labuhanruku. Sebelumnya juga sempat terjadi kerusuhan karena pihakkeluargamemaksamasuk ke ruang sidang, namun petugasberhasilmengamankannya. Terpidana seumur hidup Fernando Malau, 20, warga DusunV, Desa Rawang, Pasar VII, terpaksa berhadapan dengan hukum karena pada 20 April lalu, nekat memperkosa dan membunuh korban siswi kelasXII,SMKN1Kisaran,warga Kec. Rawangpancaarga, Waspada/Sapriadi Asahan. TERPIDANA seumur hidup Fernando Malau mendengar pembaKorban ditemukan tewas caan hukuman oleh Majelis Hakim Pengandilan Negeri Kisaran.

Pesantren Al Mukhlisin Meriahkan Tahun Baru Hijriah TG TIRAM (Waspada): Pesantren Tahfizul Quran Al Mukhlisin Tanjungtiram Batubara sambut meriah Tahun Baru 1 Muharram 1435 Hijriah dengan berbagai kegiatan lomba selama empat hari, Senin sampai Kamis (4-7/11). Pesantren Al Mukhlisin dengan pembina yayasan HM Nasir, Lc.MA dan Rizki Eka Putra sebagai KetuaYayasan, memeriahkanTahun Baru Hijriah 1435 dengan lomba bidang tahfizul quran

tingkat Aliyah dan Tsanawiyah (pidato, hias lokal) olahraga (sepakbola, gerak jalan). Sementara tingkat ibtidaiyah lomba membaca. Surah pendek dan RA/TK lomba menggambar di mana kepada pemenang akan diberi hadiah. Kegiatan gerak jalan yang diikuti dengan kelas berlangsung ramai mendapat sambutan warga melintasi dengan rute Jl. Pendidiikan- Solo- Rakyat dan Jl. Merdeka, Senin (4/11). (a12)

Diskanla Batubara Dapat Bantuan Keramba Apung

Waspada/Rasudin Sihotang

KABEL listrik di AMD Kota Tanjungbalai, menjuntai di antara pepohonan sehingga mengancam pengguna jalan.

BATUBARA (Waspada): Dinas Kelautan dan Perikanan Kab. Batubara mendapat bantuan berupa ‘keramba apung’, ditandai dengan menumpuknya bahan-bahan bantuan menumpuk di Pelabuhan Tanjungtiram, Senin (4/11). Warga Tanjungtiram terlihat ramai menyaksikan tiga truk membongkar bahan yang disebutsebut sebagai keramba apung. “Barang yang ditumpuk di pelabuhan itu seperti pelampung terbuat dari fiber,” kata Durahman, salah seorang

warga yang tumpukan barang berwarna biru dan kuning dipelabuhan. Kerambaapungitu,menurutsumber,bantuan dariKementerianKelautandanPerikanansatupaket. Disayangkan Kadiskanla Batubara yang dihubungi via ponselnya untuk mendapat kejelasan tentang proyek bantuan keramba apung tersebut itu, Selasa (5/11) tidak berhasil. Didapat jawaban suara perempuan dan anak-anak yang mengatakan salah sambung. (a12)

Sumatera Utara

WASPADA Rabu 6 November 2013


DPRD Se-Tabagsel Gandeng ICW Ke KPK

Cegah Kecurangan Penerimaan CPNS PANYABUNGAN (Waspada): DPRD Mandailing Natal (Madina) dan DPRD Padanglawas (Palas), memutuskan menggandeng Indonesia Corruption Watch (ICW) untuk memfasilitasi anggota dewan ke Komisi Pemberantasan Korupsi (KPK) dalam konteks pencegahan terjadinya kecurangan bernuansa korupsi, kolusi dan nepotisme dalam seleksi penerimaan Calon Pegawai Negeri Sipil (CPNS) 2013, khususnya di wilayah Tapanuli Bagian Selatan.

Langkah ini dilakukan lembaga legislatif, karena panitia seleksi nasional CPNS di Jakarta dituding telah mengebiri hak anggota dewan di daerah dalam melaksanakan fungsi pengawasanyangjelasdiaturdalamSusduk DPR nomor 27 tahun 2009. Demikian disampaikan pimpinan DPRD Madina Fahrizal Efendi Nasution selaku juru bica-

Waspada/Sarmin Harahap

DPRD di wilayah Tapanuli Bagian Selatan (Tabagsel) mengadakan rapat di Jakarta menggandeng ICW ke KPK dalam kontek mengawasi seleksi penerimaan CPNS sehingga bersih dari kecurangan bernuansa KKN.

ra perwakilan DPRD se-Tabagsel kepada Waspada, Selasa (5/11). Hadir dalam pertemuan itu Ketua DPRD Palas, Ridho Harahap, dan Wakil Ketua, Ammar Lubis. Kemudian Ketua Komisi I DPRD Madina Abdul Kholil, Wakil Ketua Iskandar Hasibuan, dananggotaKomisiIDodiMartua, Aminah Ismail Lubis, Sobirin, Irwansyah Nasution dan Jafar Siddiq. Rizal menyampaikan, Panselnas CPNS di Jakarta, tidak memperbolehkan DPRD menyaksikanprosespengolahandata LJK sesuai SOP dari Panselnas. Hal ini tentunya tidak sesuai dengan Permenpan-RB Nomor 23Tahun 2011 yang dengan tegas menyebutkan,prinsippengadaan CPNS dilakukan berdasarkan prinsiptransparansi.Transparansi yang di maksud adalah proses lamaran pendaftaran, pelaksanaan ujian, pengolahan hasil ujian, serta pengumuman hasil dilaksanakan terbuka. “Kondisi ini menjadi tanda tanya besar bagi kita, ada apa dan mengapa keberadaan anggota dewan dikebiri,’’ ucap Rizal. Diamenambahkan,MenpanRB maupun Panselnas CPNS jangan membuat bingung rakyat, yang telah mempercayakan sepenuhnyapengawasankepada

anggota dewan supaya rekrutmenCPNSinibenar-benarbersih dari KKN. Menurutnya, saat ini sekira 1,5 juta orang di Indonesia menaruhharapankelulusanyangmurni pada tahun ini. Namun harapan murni itu mulai sirna akibat ulah Panselnas yang mengebiri hak anggota DPRD secara terangterangan. “Panselnas CPNS jangan main-main, karena yang di pertaruhkan di sini bukan saja aspirasi rakyat yang menuntut murni kelulusan, tapi juga berimplikasipadakredibilitasdan marwahMenpandanRepormasi Birokrasi,” ucap Rizal. Katanya, rekrutmen CPNS khususnya di Madina terkesan dipaksakan karena saat ini, belanja pegawai saat ini lebih besardaribelanjapembangunan, sehingga sangat tidak memungkinkan untuk dilakukan penerimaan CPNS. Kemudian, Pemkab Madina dalam hal ini Plt Bupati Madina, Dahlan Hasan Nasution tidak pernah koordinasi terkait akan dilakukannya rekrutmen CPNS. Padahal, rerutmen CPNS berkonsekuensi dengan penggunaanAPBDMadina,yangkenyataannyabelanjapegawailebihbesar dari belanja pembangunan. (c14)

Diragukan, Kemurnian Penerimaan CPNS GUNUNGTUA (Waspada): Sejumlah peserta ujian tertulis calon pengawai negeri sipil

(CPNS) pesimis lolos seleksi karena meragukan kemurnian penerimaan CPNS.

KNPI Tobasa Bantu Korban Kebakaran TOBASA (Waspada): Dewan Pengurus Daerah Komite Nasional Pemuda Indonesia Kabupaten Toba Samosir (DPD KNPI Tobasa) memberikan bantuan kepada korban kebakaran di Desa Tangga Batu I, Kec.Parmaksian, Kab.Tobasa, Selasa (5/11). Ketua DPD KNPI Tobasa David O Hutabarat didampingi Ketua PK KNPI Parmaksian Riduan Situmorang, Sekretaris Helderia Purba dan para pengurus kabupaten/kecamatan memberikan bantuan lima paket sembako untuk dipergunakan dalam keperluan seharihari para korban kebakaran. Paket sembako diberikan kepada SanggapanTambunan termasuk pengurus PK KNPI Parmaksian yang tinggal sementara di rumah orangtuanya, juga ke lokasi kebakaran yang diterima James Sitorus dan Jekson Sitorus mewakili korban kebakaran. (a22)

Waspada/Jimmi Sitinjak

KETUA DPD KNPI Tobasa David O Hutabarat didampingi Ketua PK KNPI Parmaksian Riduan Situmorang memberikan bantuan paket sembako kepada korban kebakaran di Parmaksian.

Kepada Waspada, kemarin, Indah Lestari Harahap, 26, pelamar dari formasi kesehatan yang telah mengikuti tes CPNS di Paluta, Minggu (3/11), mengaku pesimis bisa lulus seleksi menjadi pegawai negeri. Meski telah mengerjakan LJK denganbaikdanbenar,iamengakusiapbersaingsecaraintelektual, namuntidaksiapbersaingjikaada persaingantidaksehat(suap-red). “Kalau masih membayar, saya pesimis bisa lulus. Saya hanya bisa berdoa dan menyerahkan segalanya kepada Allah

SWT,” tutur Indah. Dia juga berharap dalam penerimaan tes CPNS tahun ini bisa lebih baik dan berlangsung sportif. “Selakupelamar,tentunya kami menginginkan hasil yang adil. Mudah-mudahan saja tidak ada tarif yang harus dibayar agar bisa lulus,” ungkapnya. Oleh sebab itu, kepada semua pihak diharapkan untuk tetap mengawasi proses pelaksanaanCPNSini,sehinggatidakada kesan negatif. Sedangkan Wakil Bupati Padanglawas Utara (Paluta) H

Riskon Hasibuan melakukan peninjauan langsungpelaksanaan ujian tes CPNS 2013 di sejumlah sekolah di wilayah Gunungtua dan sekitarnya, Minggu (3/11), di antaranya di SMAN 1 Padangbolak, SMPN 3 Padangbolak dan SMAN 2 Padangbolak. Dalam kunjungan orang nomor dua di lingkungan pemkab Paluta tersebut turut didampingi Ketua Komisi I DPRD Paluta Amas Muda Siregar SE, Kadis PU MakmurHarahap,KabagHumas Amrin Junirman Siregar dan sejumlah pejabat lainnya. (a35)

R-APBD Simalungun 2014 Diminta Berpihak Kepada Rakyat SIMALUNGUN (Waspada): Sejumlah elemen masyarakat dan anggota DPRD Kab. Simalungun menegaskan, R-APBD Simalungun Tahun Anggaran (TA) 2014 yang saat ini sedang disusun tim panitia anggaran daerah (TPAD) harus benarbenar berpihak kepada rakyat kecil dan berdasarkan skala prioritas. Penegasan itu dikemukakan anggota DPRD Simalungun Bernhard Damanik dan Sekretaris Eksekutif Simalungun Coruption Watch (SCW) M Adil Saragih, kepada Waspada, Selasa (5/11), menyikapi dimulainya pembahasan KUA-PPAS RAPBD Simalungun TA 2014.

Keduanya menekankan pemanfaatan anggaran agar terhindar dari pemborosan, agar tidak seperti alokasi anggaran tahuntahun sebelumnya. “Saat ini sedang dilakukan pembahasan KUA-PPAS dengan tim anggaran Pemkab. Kita tekankan alokasi anggaran harus berpihak kepada rakyat, dan tidak boros,” tandas Bernhar Damanik. Dikatakan, RAPBD Simalungun 2014 yang disusun oleh TPAD Pemkab Simalungun agar lebihmemperhatikanskalaprioritas yang saat ini sangat-sangat dibutuhkan masyarakat, agar pembangunantersebutdapatdikategorikan tepat sasaran.

“Saat ini masyarakat sangat membutuhkan sarana dan prasarana jalan serta perbaikan irigasi sehingga anggaran untuk pembangunan dapat lebih diarahkan ke program tersebut. Kita berharap tidak ada lagi pembangunan gedung baru, kecuali rehab gedung sekolah,” tandas Bernhard. M Adil Saragih, Sekretaris Eksekutif SCW, mengingatkan, pembahasan KUA-PPAS harus berdasarkan hasil Musrenbang, sehingga program-program kerakyatan dapat terwujud dengan baik. Pihak yang akan menyusun KUA - PPAS diwantiwanti berpedoman kepada RPJM dan RPJP. (a29)

Waspada/Sukri Falah Harahap

TIM terpadu diketuaiWakil Bupati Tapsel, Aldinz Rapolo Siregar, membuka dan mengumumkan hasil uji laboratorium PT Intertek terhadap air Sungai Batangtoru sebelum dan sesudah bercampur limbah tambang PT AR.

Tim Terpadu Pantau Air Sungai Batangtoru BATANGTORU (Waspada): Ketua Tim Terpadu Pemantau Air Limbah PT Agincourt Resources (AR) yang juga Wakil Bupati Tapsel AldinzRapoloSiregar mengungkapkan,pihaknya akan terus memantau kondisi air Sungai Batangtoru di Kab. Tapanuli Selatan. Namun, Tim Terpadu menyatakan, hingga kini air Sungai Batangtoru di tidak ada masalah walau telah bercampur dengan air sisa proses Tambang Emas Martabe. “Meski demikian,kitaakanterusmemantaunya,” kata Aldinz Rapolo Siregar usai membuka danmengumumkanhasilujilaboratoriumPTIntertek terhadapsampelairlimbahtambangyangdibuang ke Sungai Batangtoru, Senin (4/11). Acara di aula Rechall Pelangi CampTambang Emas Martabe, Kel. Aek Pining, Kec. Batangtoru itu,dihadiridandisaksikanunsurMuspidaTapsel, mewakiliKepalaBadanLingkunganHidup(BLH) Pemprov. Sumatera Utara, Kepala BLH dan Kadis Pertambangan Tapsel, masyarakat, pers, LSM, manajemen PT AR, dan lainnya. Aldinz mengatakan, lokasi pengambilan air berada di pangkal/hulu pipa pembuangan

limbah. Di Sungai Batangtoru dengan posisi 500 meter sebelum ujung pipa pembuangan limbah. Di 30 meter, 500, 1.000, 2.000, dan 3.000 meter setelah ujung pembuangan limbah cair. “Setiap titik dilakukan tiga kali pengambilan air dan dimasukkan ke tiga wadah berbeda kemasan. Kemudian diantar langsung ke laboratorium PT Intertek oleh PT AR dan Divisi Pengambilan Air Limbah Tim Terpadu,” jelasnya. Dari 12 jenis zat yang diuji lab, 11 diantaranya, pH, Cyianida, Arsenic, Cadmium, Crhomium, Copper, Iron, Lead, Mercury, Nickel, dan Zinc, samasekalitidakadamasalahkarenajumahzatnya sangat jauh di bawah ambang batas standar. Tetapi khusus untuk Total Suspended Solids (TSS) atau tingkat kekeruhan air yang diambil pada 11 Oktober 2013 di titik sebelum dan sesudah pipa pembuangan limbah cair , kondisinya sudah sangat jauh di atas ambang batas standar. “Tingkatkekeruhanairataulotokniaek (bahasa Batak Angkola) Sungai Batangtoru pada 500 meter sebelumujungpipalimbahadalah 218Mg/L.Sementara setelah 30 meter setelah ujung pipa berkurang menjadi 154 Mg/L,” kata Aldinz Rapolo. (a27)

Hutan Madina Diukur Ulang PANYABUNGAN (Waspada): Pemkab Mandailing Natal (Madina) mulai menyiapkan pemancangan batas sementara hutan di seluruh kawasan daerah itu. Upaya ini dilakukan guna menjawab sekaligus merevisi SK Menhut Nomor 44 tahun 2005 yang kontroversial. Hal ini terungkap dalam rapat pembahasan persiapan pemancangan batas sementara kawasan hutan di Madina dilakukan Pemkab Madina melalui Dinas Kehutanan dan Perkebunan, di aula kantor bupati, baru-baru ini. Rapat dipimpin Plt Bupati Dahlan Hasan Nasution dan dihadiri Kepala Balai Pemantapan Kawasan Hutan (BPKH)Wilayah I Medan Lontas Jonner Sirait , Dinas Kehutanan, BPN, para camat dan kepala desa yang wilayahnya masuk dalam kawasan hutan versi SK Menhut Nomor 44 tahun 2005 serta stakeholder terkait lainnya Akibat terbitnya Surat Keputusan Menhut Nomor 44 Tahun 2005 tersebut, telah menghunjuk kawasan hutan di wilayah Provinsi Sumatera Utara seluas 3.742.120 hektar lebih, dimana wilayahdiKab.MandailingNatalterhunjukseluas 120.675 hektar. Dalam kesempatan itu, Dahlan Hasan Nasution menyatakan bahwa keluarnya SK .44 /Menhut–II/2005tentangpenunjukankawasan hutan di Sumut, yang di antaranya menetapkan

ratusan desa yang menjadi pemukiman penduduk di Kab. Mandailing Natal berubah menjadi Hutan Lindung (HL), Hutan Produksi (HP) dan Hutan Produksi Terbatas (HPT), telah menyebabkan munculnya ketidakpastian hukum. “Akibat SK 44 tahun 2005 ini, areal perkebunan telah diusahai masyarakat secara turun temurun telah masuk menjadi areal hutan, sehingga sangat membigungkan masyarakat,” ujarnya. Sesuai SK Menhut itu katanya, wilayah Madina mempunyai kawasan hutan seluas 441.451 hektar atau 62,28 persen. Luas hutan lindung di dalamnya ada 120.675 hektar, hutan produksi 18.204 hektar, hutan produksi terbatas 164.572 hektar danTaman Nasional Batang Gadis seluas 108.00 hektar. “Namun sangat menyedihkan bagi kita, sekitar 115 desa yang sudah ada sebelum merdeka, masuk dalam kawasan hutan. Ini mengakibatkan ketidakpastian hukum dalam berusaha bagi masyarakat danpadaakhirnyamelemahkankemampuanmasyarakat untuk mencapai kebutuhan hidupnya,” terangnya. Untuk itu jelasnya, adanya kegiatan pemancanganbatasitukiranyadapatmengakomodirhakhakmasyarakatyangsaatiniberadadalamkawasan hutan.Dengandemikianmasyarakatmendapatkan legalitas terhadap pemukiman dan lahan perkebunannnya sebagai sumber mata pencaharian. (a28)

Panen Raya Padi Unggul Di Kotanopan WA J A H s u m r i n g a h sejumlah petani amat kentara terlihat saat Pelaksana Tugas (Plt) Bupati Mandailing Natal Dahlan Hasan Nasution bersama rombongan ikut melakukanpanenrayapadiunggul di lahan persawahan Desa Padang Bulan Muarasoro, Kec. Kotanopan, Senin (4/11). Petani bersyukur, panen kali ini dapat menghasilkan padi dalam jumlah lebih banyak. Maklum saja, Plt Bupati Madina memang melakukan panen padi unggul model pemanfaatanlitbangyasaiptek nuklir bidang pertanian dan peternakan Sumut 2013. Ikut dalam panen raya itu Kepala Badan Tenaga Nuklir Nasional (Batan) diwakili KepalaPusatDiseminasiIptek Nuklir Ir. Ruslan, Ketua DPRD Madina diwakili M. Jafar Rangkuti, mewakili Kapolres dan Ketua PN,Sekdakab Marwan Bakti Siregar, Kadis Pertanian Taufik Zulhendra Ritonga, Kakan Ketahanan Pangan Bahrein Lubis, Sekcam Kotanopan Umar M Nasution, Kepala Desa Padang Bulan Fahruddin, tokoh masyarakat H Riza Fahlewi Lubis, stakeholder dan petani. Melalui binaan dilakukan petugas pertanian, PPL dan kelompok tani, pengembangan tanaman padi jenis varietas inpari sineduk di daerah itu cukup menggembirakan, karena hasilnya mencapai 7, 52 ton per hektar, sehingga

dinilai dapat memberikan kesejahtraan bagi para petani di Mandailing Julu dan Madina. Kadis Pertanian Madina Taufik Zulhendra melaporkan, perhatian Batan dalam tiga tahun terakhir terhadap petani di Madina sangat besar baik dalam bidangpertaniandanpeternakan. “Sudah tiga tahun Batan memberikan partisipasinyadan hanya Madina di Sumut yang mendapatkan program pengembangan padivarietassinedukini,”ucapnya. Pemkab Madina melalui Dinas Pertanian, tentunya menyambut baik program ini, karena varietas yang dikembangkan memiliki kualitas tinggi. “Sebelumnya, petani Madina juga menanam varietas berstari, Mira 1 danPandan1yanghasilnyacukup menggembirakan. Untuk tahun 2013ini,varietasinparisinedukakan dikembangkan di lahan 60 hektar di daerah ini dan yang baru terealisasi baru 40 hektar,” terangnya. KepalaPusatDiseminasiIptek Nuklir Badan Tenaga Nuklir Nasional Ir. Ruslan dalam kesempatan itu menyatakan rasa bangganya karena masyarakat di daerah itu dapat menerima varietas padi produk mereka. Keunggulan varietas ini, sebutnya, disamping tahan lama, juga berumur pendek dibanding jenispadilainnyadanrasanyajuga lebih enak. Kemudian varietas inpari sineduk memiliki indeks prestasi tiga kali musim panen setahun, karena hanya berumur 102 hari sudah bisa dipanen, sementara jenis padi unggul

lainnya 120 hari. Bupati Dahlan Hasan Nasution dalam kesempatan itu mengatakan, sektor pertanian merupakan salahsatu prioritas utama pembanguna daerah itu, karena sektor ini merupakan mata pencaharian utama masyarakat. Menurutnya, kegiatan panen raya sebagai bentuk keberhasilan di bidang pertanian dimana penggunaanbenihvarietasunggul berlabel ungu yang hasilnya akan menjadibenihsebar(berlabelbiru). “Pada tahun 2012, produksi padi di Madina meningkat 5,99

persen dibanding tahun 2011 dan ditahun 2013 ini produksi padi ini diharapkan terus meningkat agar swasembada dapat dipertahankan,” ujarnya. Dahlan juga mengucapkan terimakasihkepadaBadanTenaga NuklirNasional(Batan)yangtelah melakukankerjasamaselamatiga tahun dengan Pemkab Madina, khususnya dalam meningkatkan produksi benih sebar, sehingga pada akhirnya daerah ini mampu memenuhikebutuhanbenihnya. Usai panen raya, Dahlan Hasan juga menyerahkan alat-alat

pertanian berupa thereser, pompa solo, tajak, jerat babi dan rondap kepada sejumlah kelompoktaniditerimaKepala Desa Pagar Gunung, Padang Bulan,GunungtuaMuarasoro, Sibiobio dan Botung. Kemudian, bupati juga menerima buah kentang hasil produksi petani di Mandailing Julu yang serahkan Kadis Pertanian Taufik Zulhendra Ritonga didampingi unsur pemerintahkecamatan,kepala desa dan tokoh masyarakat daerah itu. (a28/c15)

Waspada/ Rap.Negara Siregar

SALAHSATU kelompok Festival Anak Sholeh (FAS) berfoto bersama guru pembimbingnya di atas panggung terbuka di Pematangsiantar.

Peringati Tahun Baru Hijriyah Gelar Festival Anak Sholeh PEMATANGSIANTAR (Waspada): Dalam mengisi dan merayakan Tahun Baru Hijriyah 1435 H (1 Muharram 1435 H), Dewan Pimpinan Daerah DPD Lembaga Dakwah Islam Indonesia (LDII) Cabang Pematangsiantar menggelar Festival Anak Sholeh (FAS), Selasa (5/11). Ketua DPD LDII Pematangsiantar, Pranoto didampingi Sekretarisnya Sulaizar, Bendahara Darianto dan pembina DPD LDII, Muhiman, kepada Waspada mengatakan, digelarnya FAS sebagai realisasi perwujutan dari konsep

pembinaan di organisasi, yaitu tri sukses generasi penerus untuk anak usia dini yang meliputi pembinaanfaqih,ahklakdansikapmentalmandiri. Ketua panitia FAS, Aiptu Mianto, didampingi sekretarisnya, menyebutkan, kegiatan FAS yang dilaksakan di halaman Masjid Al Ikhlas di Jalan Karangsari, Kelurahan Tambun Nabolon, Kec. Siantar Martoba Pematangsiantar itu, diikuti 106 anak usia di bawah 6 tahun berasal dari daerah kerja cabang LDDI di Kec. Siantar Martoba dan Kec. Siantar Barat. (crap/c16)

5 Honorer K2 Tapsel Absen Ujian CPNS

Waspada/Munir Lubis

PLT Bupati Madina Dahlan Hasan bersama Kepala Badan Tenaga Nuklir Nasional (Batan) diwakili Kepala Pusat Diseminasi Iptek Nuklir Ir. Ruslan, Ketua DPRD Madina diwakili M. Jafar Rangkuti ,Kadis Pertanian Taufik Zulhendra Ritonga serta pihak terkait lainnya ketika melakukan panen raya di lahan persawahan petani Desa Padang Bulan Muarasoro Kec. Kotanopan.

BATANG ANGKOLA (Waspada): Dari 306 orang tenaga honorer Kategori Dua (K2) yang terdaftar sebagai peserta ujian Calon Pegawai Negeri Sipil (CPNS), hanya 301 yang hadir dan lima lagi absen, Minggu (3/11). Meski demikian, ujian yang dipusatkan di SMP Negeri 1 Batang Angkola itu berjalan lancar. “Alhamdulillah semua berjalan lancar dan kondusif, meskipun lima peserta tidak hadir,” kata Kepala Badan Kepegawaian Daerah (BKD) Pemkab Tapsel, Drs. Syahtohat, di dampingi Kabid Pengadaan Pegawai dan Pengolahan Data,

Raden Yusuf S.Sos, di sela-sela peninjauan pelaksanaan ujian CPNS Honorer K2. Dijelaskan, ujian ini diselenggarakan BKD bersama Dinas Pendidikan, Dinas Kesehatan, Satpol PP, dan Inspektorat Tapsel. Dipantau oleh Badan Pemeriksa Keuangan dan Pembangunan (BPKP), BKD Pemprov. Sumatera Utara, dan personil Polres Tapsel. “Pengawas ujian 35 orang dan semuanya merupakan guru di SMPN 1 Batang Angkola. Seluruh peserta mengikuti ujian di 19 lokal yang disiapkan pihak sekolah,” ujar Syahtoat. (a27)


Sumatera Utara

WASPADA Rabu 6 November 2013

147 Jamaah Haji Tiba Di T. Tinggi Satu Jamaah Meninggal Di Tanah Suci TEBINGTINGGI (Waspada): 147 Jamaah haji yang baru menunaikan ibadah di tanah suci Mekkah, tiba di Kota Tebingtinggi, Sabtu (2/11) dinihari pukul 13:30. Kepulangan jamaah ahji asal Kota Tebingtinggi itu disambut unsur Muspida di Masjid Raya Jalan Suprapto Tebingtinggi. Turut menyambut Wali Kota Tebingtinggi, Umar Zunaidi Hasibuan, MM, Kapolres Tebingtinggi AKBP H. Enggar Pareanom, Ketua MUI Drs H. Ahmad Dalil Harahap, Kakan Kemenag, Ketua FKUB, Ketua FUI, serta para keluarga jamaah.

Wali Kota mengucapkan selamat atas kepulangan para jamaah haji dan hajjah yang telah menunaikan rukun Islam ke lima ke tanah suci Mekkah. Diharap menjadi haji dan hajjah mabrur. “Sebelum berangkat ke tanah suci, kita merindukan dapat pergi ke sana untuk melaksanakan rukun Islam ke lima dan semua itu dapat terwujudkanuntukmenjadihajimabrur,”katanya. Sementara Kabag Adm Humasy PP Pemko Tebingtinggi, Ahdi Sucipto, SH mengatakan dari 148orangjamaahKotaTebingtingiyangberangkat, satu orang meninggal dunia di Madinah.(a11)

Setiap Hari 20 Pelajar Ditilang Di Binjai BINJAI(Waspada):Setiapharipihakkepolisian Sat Lantas Polres Binjai menindak lebih kurang 20 pelajar yang mengendarai sepedamotor tanpa memiliki kelengkapan seperti helm, SIM dan lainnya. Kasat Lantas Polres Binjai AKP Afdhal Junaidi, kemarin mengatakan, untuk itu pihaknya mengundang para orangtua dan pelajar yang ditilang di aula Satlantas Polres Binjai, untuk diberi pengarahan agar hal ini tak terulang lagi sebagai upaya menekan angka kecelakaan lalulintas. Waspada/Helmy Has

BADAN jalan Kp Lalang persis depan jalan masuk ke Pesantren Al Mukhlisin banjir tergenang air.

Drainase Tak Berfungsi Jalan Kp Lalang Banjir TG.TIRAM (Waspada): Akibat drainase tak berfungsi, badan jalan Kp. Lalang/Sukamaju, Tanjungtiram banjir. “Ini baru air hujan, apa lagi sering diguyur air pasang. Kami minta Pemkab Batubara c/qPUBatubaradapatmengurangideritawargadenganmerehabilitasi bangunan drainase yang tak berfungsi,” tukas warga Desa Lalang dan Sukamaju, Selasa (5/11). Masalah banjir di pemukiman warga di Kp.Lalang/Sukamaju sudahpuluhantahunbelumberhasildiatasi.PadahalPemkabBatubara mungkin sudah miliaran ludes untuk membangun drainase/parit, memotong badan jalan besar (Jl.Merdeka) guna memperlancar saluran air ke sungai Mesjidlama. Namun kurang tahu sebabnya saluran air tak berfungsi, banjir terus terjadi saat ini seperti di bagian jalan persis masuk ke Pesantren Al Mukhlisin. Di sini air menggenang hingga 10 -15 Cm, dan terpaksa anak sekolah menjinjing sepatunya. (a12)

Ketua Panwascam Arse Lantik 26 PPL ARSE (Waspada): Ketua Panitia Pengawas Kecamatan (Panwascam) Arse, Kab.Tapanuli Selatan, Ali Imran Pane, melantik 26 Pengawas Pemilu Lapangan (PPL) yang akan bertugas mengawal semua tahapan pesta demokrasi tahun 2014 di seluruh desa dan kelurahan se Kec. Arse, Minggu (3/11). Pelantikan dihadiri dan disaksikan dua anggota Panwascam Arse, Fahri Siregar dan Hadiansyah Panjaitan. Usai dilantik, 26 PPL itu mengikuti pembekalan yang juga dilaksanakan di kantor sekretariat Panwascam di Desa Gunung Manon. Ali Imran Pane dalam arahannnya menyebutkan, pembentukan dan pelantikan PPL merupakan amanah UU No. 15 Tahun 2011 tentang Penyelenggaraan Pemilu. Dikatakan, pemilihan anggota DPR, DPD, dan DPRD kabupaten/kota sangat rawan konflik dan gesekan. Karena itu PPL sebagai garda terdepan pengawas seluruh tahapan Pemilu tahun 2014, harus netral. Tidak boleh berpihak kepada calon legislatif maupun parpol peserta Pemilu. Jika kedapatan dan terbukti, akansegeradikenakansanksietikyangbisaberujung pemecatan.(a27)

Agus Sopian Kritis Ditikam BINJAI (Waspada): Agus Sopian alias Ian, 30, kritis ditikam di Jalan Gugus Depan, Kelurahan Berngam, Kecamatan Binjai Selatan. Tangan, perut dan kaki pria yang menetap di Simpang Selesai, Kelurahan Pekan Selesai, Kecamatan Selesai, Kabupaten Langkat itu robek ditikam tiga pria yang salah satunya disebut-sebut berinisial JD, warga Kelurahan Berngam. Warga yang melihat kejadian itu melarikan korban ke Rumah Sakit Arta Medica. Warga menceritakan, saat itu melihat pelaku maupun korban bertengkar, namun setahu bagaimana korban yang mengendarai sepedamotor Suzuki Spin BK 5303 LK dipepet ketiga pelaku yang mengendaraiYamahaVixion dan Honda. Mereka terlibat pertengkaran dan pelaku menikam korban. Setelah itu korban ditinggal begitu saja. Kasat Reskrim Polres Binjai, AKP Revi Nurvelani didampingi Kanit Jatanras Ipda Rudi Lapian menyebutkan, kemarin, kasusnya masih dalam penyelidikan.(a05)

Pemkab L. Batu Akan Gelar Sosialisasi HAM RANTAUPRAPAT (Waspada): Pemkab Labuhanbatu mulai tanggal Rabu(6/11) akanmenggelarpelaksanaanSosialisasiHakAsasiManusia (HAM) di sembilan kecamatan sesuai dengan surat Bupati Labuhanbatu Nomor: 180/3843/Huk/2013 tertanggal 29 Oktober 2013 Perihal, Jadwal Sosialisasi HAM di Kabupaten Labuhanbatu TA 2013. Hal itu dijelaskan Anggota Tim Penyelenggara Sosialisasi HAM Kabupaten Labuhanbatu, Drs Sugeng, Senin (4/11) di ruang kerjanya. Kata Sugeng, Tim Penyelenggara Sosialisasi HAM yang dihunjuk Bupati Labuhanbatu terdiri dari 18 orang yang diketuai oleh Plt Sekdakab H Ali Usman Harahap SH dibantu dengan Wakil Ketua, Sekretaris serta 15 orang anggota. Selain itu, turut bersama Tim Sosialisasi HAM di sembilan kecamatandalamwilayahKab.Labuhanbatu,enamorangnarasumber yakni Siti Hafsah Silalahi SH (Kabag Hukum Setdakab Labuhanbatu), Ramli Siregar (Penyidik Polres Labuhanbatu), Surung Pasaribu Bc IP SH MHum (Kalapas Klas II-A Rantauprapat), Khairul Fahmi SH (Kabid Koperasi Disperindagkop/UKM), Abdi Jaya Pohan SH (Kabid Hubungan Antar Lembaga Kesbangpol Linmas) dan Indrawaty Sinaga S Psi (Ketua LPPA). Kabag Humas Infokom itu menambahkan, sosialisasi HAM yang digagasPemkabLabuhanbatuinimerupakan bertujuanuntukmemberikan pencerahan kepada masyarakat di sembilan kecamatan. (c07)

Pembobol Kios Nyaris Tewas Diamuk Massa DOLOKMASIHUL (Waspada): PL pria 28 tahun mengaku warga Dusun IV, Gunung Monako, Kec. Sipispis, Kab. Serdang Bedagai nyaris tewas diamuk massa setelah tertangkap tangan membongkar kios milik Basuki, 38, warga Dusun I, Desa Bukit Cermin, Kec. Dolok Masihul, Selasa (5/11) dinihari. Tersangkapelakumengalami luka-luka di kepala, namun beruntungaksiwargayangtelahtersulut emosi dapat diredam setelah

petugasPolsekDolokMasihulyang sebelumnyamendapatinformasi kejadian itu, tiba di lokasi. Dengan kondisi tubuh berlumuran darah petugas memboyong pelaku ke salah satu Klinik di Pekan Dolok Masihul guna mendapat perawatan. Setelah itu, pelaku yang dalam kondisi lemah diboyongkeMapolsekDolokMasihul untuk penyidikan lebih lanjut. Tapi ketika ditemui di Mapolsek Dolok Masihul, PL membantah dituduh mencuri.

Dia berkilah hanya bermaksud mengunjungi rumah temanya. KapolsekDolokMasihul,AKP DarwinKatarenkepadaWaspada mengatakan, menurut korban di Polsek Dolok Masihul, saat itu pelaku sedang berusaha membongkar pintu kios dengan tojok, tapi diketahui tetangga korban dan warga sekitar. “Pelaku telah diamankan di Mapolsek Dolok Masihul bersama barang bukti sebilah tojok yang digunakan pelaku,” kata Kapolsek.(c03)

Diganggu Oknum, Dokter Spesialis Hengkang Dari Seirampah MEDAN (Waspada): Karena merasa terus ‘diganggu’ oknum, dokter spesialis berniat memindahkanfasilitaskesehatanberupa Klinik Spesialis Penyakit Dalam dari Jalan Sudirman, Desa Seirampah, Kec. Seirampah, Kab. Serdang Bedagai. ‘’Sudahlah, saya pindahkan sajaklinikinidariSeirampah,’’ujar dr Rudi Mahruzar Lubis, SpPD, FINASIM, pemilik klinik tersebut kepada Waspada di Medan, kemarin. Dijelaskannya,klinikinisudah beroperasi sekira dua tahun dengan layanan 24 jam, dan sudah dimanfaatkan masyarakat untuk mendapatkan pelayanan kesehatan. Kendati begitu, dr Rudi Mahruzar Lubis mengungkapkan, keberadaan klinik ini seolah tidak didukungoknum,‘’Merekaseperti menghambat pelayanan kesehatan di Sergai yang sebenarnya terus dimaksimalkan sesuai visimisi Pemkab,” ujarnya. Persoalan ini bermula, saat pihak klinik membangun garasi disekitarklinik,yangdimaksudkan

untuk tempat parkir ambulance dan parkir kendaraan keluarga pasien. Sedangkan klinik didirikan setelah segala perizinan diurus, termasuk Surat Izin Mendirikan Bangunan (SIMB) No. 040/02/ III/KPT/2009. ‘’Makanya saya heran, apa yang salah. Tak benar bangunan ini tanpa IMB,’’ tegas dr Rudi yang sehari-hari bertugas sebagai pejabat fungsional penyakit dalam di RSUD Sultan Sulaiman. Karena itu, saat datang sejumlah oknum Satpol PP termasuk oknum berinisial H di lokasi bangunan klinik baru-baru ini, dr Rudi mengaku sangat heran, apalagi dengan cara sangatsangat tidak bersahabat dan cenderung kasar. dr Rudi mengungkapkan, dia sudahmenerimasuratdariSatpol PP Sergai ditandatangani Kasatpol PP Drs Purba Siregar 24 Oktober 2013, berisi semacam ultimatum untuk menghentikan pembangunan klinik 1x24 jam karena disebutkan “patut diduga tidak memiliki SIMB”.

Padahal,lanjutdia,bangunan garasi ini didirikan sejajar dengan bangunan yang sudah ada sebelumnya di lokasi itu seperti bangunansalahsatuBUMN, serta tidak melewati batas tanah sesuai sertifikat hak milik. Karena itu, dr Rudi yang sudah malang-melintang bertugas di sejumlah kawasan tanah air, termasuk di Aceh saat konflik, mengakutidakhabispikir,kenapa ada oknum aparat memperlakukan warga seperti itu, apalagi berkaitan dengan pengadaan fasilitas pelayanan kesehatan. ‘’Saya tak tahu, ini, kok, seperti dendam pribadi,’’ ujarnya. dr Rudi mengungkapkan, pemerintah menyarankan agar dokter spesialis menyebar ke daerah untuk memberi pelayanan kesehatanlebihmaksimalkepada masyarakat, sehingga dokter spesialis tidak hanya menumpuk di kota. ‘’Ini kan aneh, saat kita mau berbuat lebih maksimal untuk masyarakat, yang tujuannya untuk kemaslahatan orang banyak, kok, diperlakukan seperti ini,’’ ujarnya. (ihn)

Bank Sumut P. Sidimpuan Serahkan Klaim Asuransi P. SIDIMPUAN (Waspada): PT Bank Sumut Cabang Padangsidimpuan menyerahkan klain Asuransi Jiwa Sipanda kepada sembilan ahli waris nasabah Tabugan Martabe yang meninggal dunia. Total klaim keseluruhan Rp73.500.0000. Penyerahan klaim dilakukan usai rangkaian peringatan HUT ke-52 PT Bank Sumut di halaman kantor Cabang Padangsidimpuan, Jalan Sudirman/eks Merdeka, Wek II, Kec. Sidimpuan Utara, Senin (4/11). Klaim asuransi jiwa itu diserahkansecaralangsungPimpinan

PT Bank Sumut Cabang Padangsidimpuan, Hifzan Lubis, kepada sembilan ahli waris. Jumlah dana yang diterima bervariasi, karena tergantung pada jumlah tabungan terakhir nasabah. Ahliwarisalmarhumah(Alm) Rosimah menerima klaim Rp5 juta, Nurlela Rambe Rp500 ribu, Abdul Munir Harahap Rp10 juta, DrsNasaruddinRp25juta,Rasma Siregar Rp500 ribu, Saut Pardomuan Rambe Rp juta, dan Lenggang Hasibuan Rp 2,5 juta. Almh. Nurhabibah Lubis Rp10 juta, Henmar Simanjuttak Rp5 juta, dan Sukarmin Rp10 juta.

Mewakili ahli waris penerima klaim, Lenggang Hasibuan, mengungkapkan rasa haru dan tidak menyangka adanya klaim asuransi ini. “Terimaksih Bank Sumut, semoga terus sukses dan jaya,” katanya. Sebelumnya pada upacara peringatan HUT ke-52 PT Bank Sumut, Hifzan Lubis bertindak sebagai inspektur upacara (Irup) dan membacakan pidato tertulis Direksi Bank Sumut, yang memaparkan sejumlah keberhasilan dicapai Bank Sumut pada tahun-tahun sebelumnya. (a27)

Caleg Diingatkan Jangan Tabur Uang Agar Dipilih PEMATANGSIANTAR (Waspada): Calon anggota legislatif (Caleg) diingatkan jangan membagi-bagi uang agar bisa terpilih menjadi anggota legislatif. “Karena, kalau Caleg bekerja dengan uang agar terpilih, berarti akan menghalalkan segala cara agar uangnya bisa kembali,” kata Ketua Parsadaan Pomparan Toga Sinaga dan Boru (PPTSB)Cab.KotaPematangsiantarOppuDebora J. Sinaga didampingi para pengurus lainnya saat memberangkatkan Caleg DPR RI, DPD RI daerah Sumut, DPRD Sumut dan Pematangsiantar dari keturunan marga Sinaga dan Boru di rumahnya di Lorong 26, Jalan Kesatria, Kelurahan Merdeka, Kecamatan Siantar Timur, Selasa (5/11). Caleg yang diberangkatkan untuk DPR RI Ir. AliWongso H Sinaga dan saat ini masih duduk sebagai anggota DPR RI, DPD RI Dr. Ir. Benny Pasaribu, M.Ec, DPRD Sumut Ir. Untung Sinaga, MM, DPRD Pematangsiantar St. Drs. TPR Sinaga, SKM, Henry Dunand Sinaga, SP, St. Drs. Tanjung Sijabat, Alan Bean Nadeak dan Masison Naibaho. Satu calon anggota DPD RI daerah Sumut Dr. EB. Sinaga turut diberangkatkan meski tidak hadir. “Harus selalu berdoa dengan terus menerus serta jangan meminta untuk diri sendiri, tapi harus meminta sesuai kehendak Tuhan. Seandainya nanti duduk menjadi anggota legislatif, jangan menghalalkan segala cara,” ujar Oppu Debora kepada para Caleg. Kepada seluruh marga Sinaga dan Boru, Oppu Debora meminta agar bersatu dan jangan berdua rupa serta menyatakan awal tahun 2014 akanmengadakanpestabonataonPPSTBCabang Pematangsiantar, tapi tidak akan membebani para Caleg, karena PPTSB Cabang Pematang-

siantar ikhlas memberangkatkan para Caleg agar berhasil. Penasehat Oppu Rio M. Sinaga mengingatkan para Caleg harus menyusun kekuatan di tengahtengah masyarakat. “Bila tidak mengetahui kekuatan dan kelemahan diri sendiri, pasti akan gagal. Harus mengetahui ke mana arah kita dan bagaimana cara kita, karena masyarakat sudah pintar.” Senada, Penasehat SRP. Sinaga memberi contoh Ali Wongso H Sinaga yang berhasil pada periode sebelumnya, karena rendah hati, pintar melihat sistuasi, rajin beribadah, terjun ke organisasi marga dan lainnya. Ali Wongso H Sinaga menyatakan sangat berterimakasih. Kata dia, diberangkatkan sebagai Caleg merupakan suatu karunia, bisa mengabdi kepada bangsa dan memuliakan nama Tuhan. Menurut Ali Wongso, kursi yang tersedia terbatas dan perlu strategi serta suara yang cukup. “Kalau ada tekad, tidak cukup PPTSB saja mendukung, tapi harus memberikan pengorbanan sebagai konsekuensi dengan kampanye kepada keluarga, tetangga dan teman-teman. Semoga Tuhan memberkati segala perbuatan baik kita dan sesuai dengan doa PPTSB, saya juga berdoa agar ada dari keturunan marga Sinaga bertambah menjadi anggota legislatif.” Benny Pasaribu sebagai bere marga Sinaga dan sudah pernah duduk sebagai Deputi Menneg BUMN dan anggota DPR RI menyatakan anganangannya sebenarnya ingin memimpin Sumut, namun belum bisa terwujud. “Duduk di parlemen sebenarnya gampang-gampang susah, termasuk di DPRD. Kalau tidak kuat imannya, keluarga bisa susah. Saya marasa nasehat yang diberikan PPTSB sangat cocok.” (a30)

Waspada/Edoard Sinaga

MEMBERANGKATKAN para Caleg DPR dan DPD RI serta DPRD Sumut dan Pematangsiantar dari keturunan marga Sinaga dilaksanakan di rumah Ketua PPTSB Cabang Kota Pematangsiantar.

Rekanan Diminta Jaga Kualitas Proyek Di Musim Penghujan GUNUNGTUA (Waspada): Di musim penghujan saat ini, sejumlah proyek pemerintah sedang berjalan dan dikerjakan. Apalagi, saat ini memasuki akhir tahun, sejumlah proyek diharuskanselesaisecepatnya,bahkantidakjarang dikerjakan malam hari di saat hujan turun. Namun tidak jarang akibat mengejar tenggat waktu dan keuntungan yang besar, pemborong tega mengurangi kualitas pekerjaan tersebut, sehingga membuat kualitasnya menjadi rendah dan mudah rusak. Bahkan tidak jarang pekerjaan itu baru satu atau dua minggu sudah mengalami kerusakan. Dan dengan dalih itu kemudian biaya pemeliharaan 5 persen dicairkan untuk memperbaiki kerusakan pekerjaan tersebut. Padahal biaya pemeliharaan itu seharusnya dikeluarkan sebulan atau dua bulan setelah pekerjaan selesai. Untuk itu dalam menghindari perbuatan

nakal rekanan ini, pemerintah melalui Dinas Pekerjaan Umum (PU) selaku yang mengawasi pekerjaan untuk melakukan pengawasan ketat dan melakukan uji ketahanan terhadap proyek fisik yang suda selesai dibangun agar terjamin kualitasnya. “Hal ini untuk peningkatan kualitas proyek terutama proyek fisik, makanya perlu peningkatan sistem pengawasan kegiatan fisik. Dan diharapkan Dinas PU untuk jeli menilai kualitas proyek tersebut,” kata pengamat kebijakan Kabupaten Paluta Asmar Ismail Siregar, Selasa (5/11). Dikatakannya,padatahun-tahunsebelumnya pelaksanaan beberapa proyek fisik yang sudah dilaksanakankurangmemuaskanhasilnya,bahkan ada yang harus sampai diperbaiki lagi, baik jalan, irigasi dan lainnya. Maka pada tahun 2014 nanti, diharapkan dapat lebih ditingkatkan dan hasilnya bermanfaat bagi masyarakat banyak. (a35)

PP Sibolga Kantor Baru

Meida R Hutagalung Jadi Anggota DPRD Sibolga SIBOLGA (Waspada): Meida R Hutagalung dilantik sebagai Pengganti AntarWaktu (PAW) DPRD Sibolga menggantikan Megawati Hutagalung. Pelantikan dilakukan di ruang Paripurna DPRD Sibolga, Senin (4/11). Pelantikan anggota DPRD Sibolga melalui PAW dilakukan Ketua DPRD Sahlul Umur Situmeang dihadiri Wali Kota Drs H M Syarfi Hutauruk, Dandim Tapteng Letkol Indra para unsur Muspida, sejumlah anggota DPRD Sibolga, Wakil Bupati Tapteng H Sukran J Tanjung SE dan undangan lainnya. Meida yang pernah menjabat Wakil Ketua DPRD Sibolga, mengungkapkan, meskipun dia dilantik di penghujung masa jabatan periode 209-2014 atau hanya bertugas dalam hitungan beberapa bulan, namun dia mengaku akan melaksanakan tupoksi DPRD sebagaimana mestinya. (cpol)

Dalam pengarahannya dia mengharapkan agar para orangtua tidak sembarangan memberi kendaraankepadaanak-anakyangmasihdibawah umur, karena selama ini tingkat kecelakaan lalulintas lebih banyak terjadi kepada kalangan remaja. “Anak-anak ini merupakan generasi penerus bangsa. Kita tidak ingin masa depan mereka terenggut akibat kecelakaan,” terang AKP Afdal Junaidi, didampingi Kaur Reg Inden Ipda Ali Umar dan Ipda Ali Kamil.(a05)

Waspada/Sukri Falah Harahap

PIMCAB Bank Sumut P.Sidimpuan, Hifzan Lubis (kiri) dan wakilnya, meniup lilin HUTke52 bank milik rakyat Sumut. Di ujung acara, ada penyerahan klaim asuransi kepada sembilan ahli waris nasabah Tabungan Martabe, Senin (4/11).

SIBOLGA (Waspada): Untuk lebih proaktif menjalankan tugas organisasi dan juga untuk lebih mengintensifkan konsolidasi sesuai dengan arahan Ketua MPW (Majelis PimpinanWilayah) PemudaPancasila(PP)SumutAnuarShah(Aweng), maka MPC (Majelis Pimpinan Cabang) Pemuda Pancasila (PP) kota Sibolga menggunakan kantor barunya di Jalan Buchari Koto nomor 26 Kel. Kotaberingin, Sibolga. Peresmian kantor baru yang digelar Minggu (3/11) malam itu dibuka oleh Ketua Majelis Pertimbangan Organisasi (MPO) PP Kota Sibolga Drs H M Syarfi Hutauruk (Wali Kota Sibolga) yang juga dihadiri oleh Wakil Ketua MPO PP Sibolga Sahlul Umur Situmeang(Ketua DPRD Sibolga). Menurut Ketua MPC PP kota Sibolga Asri

Sikumbang, pembukaan kantor baru itu, selain untukmenjalankanrodaorganisasisecaraproaktif, juga dapat meningkatkan silaturahmi di antara Keluarga besar PP Sibolga beserta jajarannya. “Tentunya, sesuai arahan Ketua MPW PP Sumut Anuar Shah (Aweng), agar seluluh jajaran PP di Sumut melakukan konsolidasi, maka kita juga di Kota Sibolga bersama para kader telah melakukankonsolidasidanterusproaktif,sehingga dengan keberadaan kantor ini akan lebih menggiatkan sejumlah kegiatan yang dapat menambah motivasi masyarakat Sibolga dalam peningkatan pembangunan yang dilakukan Pemko Sibolga,” kata Ketua MPC PP Asri Sikumbang didampingi paraWakil Ketua Dadang R Ginting, Agus STobing, SekretarisFHalomoanSimatupangsertasejumlah kader lainnya. (cpol)

Disdukcapil Masih Terbitkan KTP SIAK RANTAUPRAPAT (Waspada):Walau tahun 2013 akan berakhir sekitar 54 hari lagi, namun Dinas Catatan Sipil Kab. LabuhanbatumasihmenerbitkanKTP Sistem Informasi Administrasi Kependudukan (SIAK). Bupati Labuhanbatu dalam seruannya yang dipajang di salah satu balihonya menyebutkan bahwa KTP Siak tidak berlaku lagi di tahun 2014 yang selanjutnya hanya elektronik atau e-KTP yang berlaku. Mengingat, masa waktu dari

proses pendataan sampai penerbitane-KTPmembutuhkan waktu yang cukup panjang, sedangkan masa berlaku yang KTP SIAK tinggal sekitar lebih kuramg 54 hari lagi, dikuatirkan kebijakan Bupati itu tidak akan dapat dilaksanakan sampai pada batas yang ditentukan. Dari pantauan wartawan di Disdukcapil Pemkab Labuhanbatu, diakhir tahun 2013 ini masih terlihat ratusan warga yang mengurus kepemilikan KTP SIAK.

Kadis Disdukcapil Pemkab Labuhanbatu, Edi Gani Ginting yang dikonfirmasi melalui telepon Selasa (5/11), membenarkan sampai saat ini pihaknya masih menerbitkan KTP SIAK. “Benar, tapi masa berlakunya akhir tahun 2013. Kalau jumlah persisnya, saya kurang tahu, namun persepsi media tentang penerbitan dan masa berlaku dengan kami berbeda,� katanya sembari menutup pembicaraan dengan wartawan via telepon selulernya. (c07)

Waspada/Budi Surya Hasibuan

BALIHO Bupati Pemkab Labuhnabatu Tigor Panusunan Siregar yang terpajang di pintu masuk kota Rantauprapat, tertulis masa berlakunya KTP SIAK sampai 31 Desembar 2013



Selesaikan Masalah DPT Agar Pemilu 2014 Sukses


i tengah hujan kritikan dari parpol peserta pemilu 2014 Komisi Pemilihan Umum (KPU) Pusat menetapkan Daftar Pemilih Tetap (DPT) kemarin. Banyak kritik bermunculan terkait banyaknya data dalam DPS (Daftar Pemilih Sementara) yang bermasalah akibat tidak sinkronnya data KPUBawaslu-Parpol dengan data Kemendagri. Dalam penetapan DPT tercatat jumlah DPT 186,6 juta, termasuk 10,4 juta masih bermasalah. Namun menetapan itu langsung disikapi dengan kritis oleh Partai Nasional Demokrat (Nasdem), PDI Perjuangan, dan Partai Gerinda. Terjadi beda pandangan antara KPU dengan beberapa parpol yang semula keras menolak DPT. Untuk memuluskan jalannya pleno, KPU menjelaskan jumlah DPT sebesar 186,6 juta, termasuk 10,4 juta yang bermasalah akan dicarikan solusinya. Sebelumnya, PDI Perjuangan dan Partai Gerindra keras menolak penetapan DPT itu, namun kedua partai itu akhirnya menerima dengan catatan KPU harus memperbaiki 10,4 juta DPT bemasalah sampai tuntas segera mungkin. Di antaranya, adanya nama ganda dan tidak memiliki Nomor Induk Kependudukan (NIK). Hemat kita, memang tidak mudah mendata jumlah penduduk yang terus bertambah banyak dan selalu berpindah-pindah. Apalagi mendata jumlah penduduk di kawasan terpencil, terlebih lagi di Papua yang arealnya sangat luas. Namun begitu, kalau KPU bekerja profesional dan Kemendagri juga serius melakukan pendataan masalah DPT tidak sampai serumit sekarang ini, apalagi jumlah data yang bermasalah sampai 10,4 juta orang. Wajar saja kalau KPU menjadi sasaran kritik, apalagi mengingat banyaknya kasus pemilih siluman pada pemilu-pemilu lalu. Untuk pemilu 2014 pemerintah sudah mengupayakan perbaikan-perbaikan, termasuk mengadakan proyek Kartu Tanda Penduduk elektronik (e-KTP) yang telah digagas oleh pihak Kemendagri sejak lama, dan menelan biaya sangat besar. Jadi, kalau proyek e-KTP berjalan dengan baik seharusnya kekacauan data pada DPT untuk pemilu 2014 Intisari tidak akan terjadi. Justru itu, masih terdapatnya 10,4 juta pemilih bermasalah –abu-abu dan fiktif— meKPU wajib menyelesainunjukkan kinerja KPU amburadul sekaligus kan masalah DPT khumenun jukkan pemuktahiran data menuju DPT tidak berjalan sejak awal, dan terbawa susnya pemilih siluman terus hingga saat ini. Di sinilah KPU - Kemendagri patut digugat. Keduanya tidak mam(fiktif) agar jalannya pepu saling bekerjasama sehingga datanya milu 2014 sukses! berbeda jauh dan data itu terus menjadi masalah hingga saat ini. Akankah masalah 10,4 juta pemilih ‘’siluman’’ itu dapat diselesaikan? Semua terpulang pada niat baik KPU dan khususnya Kemendagri. Sebab, masalah data kependudukan ada di tangan mereka. Data pemilih yang bermasalah tersebut disebabkan banyak pemilih yang belum memiliki NIK atau bisa dikatakan tidak jelas identitasnya, sesuai dengan temuan Badan Pengawas Pemilu (Bawaslu) RI. Ya, kalau di hulunya bermasalah maka seterusnya tetap bermasalah sampai ke hilirnya. Tidak dicapai titik temu antara KPU dan data Kemendagri maupun temuan yang dimiliki parpol peserta pemilu 2014 beserta Bawaslu. Yang kita khawatirkan jika masalah DPT ini tidak tuntas bisa menimbulkan gugatan ke Mahkamah Konstitusi dll sehingga berdampak pada rendahnya kualitas pemilu. Padahal, legalitas pemilu sangat diperlukan untuk menciptakan pemerintahan yang kuat. Namun begitu, kita maklumi KPU ngotot menetapkan DPT dengan jadwal pemilu yang semakin dekat. Kalau ditunda-tunda terus bisa-bisa jadwal pemilu 9 April 2014 bakalan tertunda pula nantinya dan dampaknya bisa membahayakan bagi kelangsungan demokrasi dan masa depan bangsa jika pemilu sampai menimbulkan kekacauan dan anarkisme (chaos). Kalau masalah krusial tak terselesaikan bisa-bisa malah melanggar undang-undang. Oleh karena itu, kita setuju dengan penetapan DPT, walau di sana-sini disahuti dengan protes dan kecaman. Prores boleh saja, namun KPU harus menjalankan tugasnya sesuai jadwal atau tenggat waktu agar pemilu tahun depan bisa berjalan sesuai jadwal dan jurdil alias sukses. Kalau titik masalahnya terkait pemilih siluman, pemilih tidak punya NIK, kita harapkan sejalan dengan tahapan pemilu selanjutnya hal itu bisa diperbaiki, khusus untuk 10,4 juta pemilih ‘’abu-abu’’ dan ‘’fiktif’’ yang kerap kali disalahgunakan oleh pihak-pihak tertentu dan oknum penguasa pada pemilu sebelumnya. Yang pasti, DPT sudah diketuk. Munculnya angka 10,4 juta pemilih ‘’siluman’’ menunjukkan administrasi kependudukan kita masih kacau sekaligus pertanda awal proyek triliun rupiah untuk pendataan e-KTP diduga sarat korupsi. Seharusnya semua penduduk di negeri ini punya NIK. Kalau belum punya wajib diberi supaya punya NIK dan ini wewenangnya Kemendagri. Sedangkan KPU wajib mengingatkan dan mendesak Kemendagri untuk memberikan data NIK bagi 10,4 juta pemilih bermasalah. Jika tidak mampu, sebaiknya Mendagri Gemawan Fauzi mundur. Sebab, amburadulnya data kependudukan menunjukkan kinerja jajaran Kemendagri di bawah harapan alias tidak profesional sehingga top manajerialnya (Kemendagri) harus bertanggung jawab.+

Hijrah; Momen Persaudaraan Oleh Dr Drs H.RamliLubis, SH, MM Persaudaraan berlandaskan akidah menggantikan persaudaraan nasab (darah), dan ikatan iman menggantikan ikatan materi, kepentingan individu maupun ambisi pribadi.


ahun Baru Islam 1435 Hijriyah tepatnya 5 November 2013, umat Islam dunia masih dilanda isu perbedaan bahkan perpecahan. Di banyak negara Islam di jazirah Arab dilanda Arab Spring, yang merupakan fenomena demonstrasi dan perlawanan rakyat yang mengakhiri jatuhnya kekuatan kekuasaan. Arab Spring dimulai di Tunisia pada Desember 2010 lalu. Kemudian dengan cepat merembet ke negara tetangganya di Mesir, Libya, Bahrain, Suriah, Yaman, Aljazair, Irak, Yordania, Maroko, dan Oman, dan sekarang Suriah. Kemunculan gerakan bersifat masif tersebut mengakibatkan kekuatan lama yang berkuasa tumbang. Kejadian Arab spring yang awalnya mengarah kapada perubahan peta politik kawasan Timur Tengah malah terkesan menguntungkan Israel—dengan rontoknya kekuatan militer negara- negara Arab—yang menjadi ganjalan kuat terhadap perkembangan Israel yang masih menguasai Palestina melalui penjajahan. Secara kasat mata perpecahan di tubuh umat Islam itu terjadi di manamana dan merugikan umat Islam yang memiliki sejarah kejayaan, dan memiliki pondasi kuat untuk tampil kembali ke pentas dunia—seakan belum beranjak dari persoalan internal—malah terkesan semakin meruncing. Sama halnya dengan di dalam negeri. Ketidakbersatuan umat Islam itu terlihat dari banyaknya organisasi, kelompok, faham, dan aliran yang seringkali bertentangan satu sama lain. Konflik dan polemik di antara umat Islam juga tidak jarang muncul ataupun dimunculkan ke permukaan. Gerakan Islam yang satu seolah mencibir gerakan Islam lain, partai Islam yang satu seolah menuding partai Islam lain. Padahal, di antara gerakan, dan partai Islam tersebut memiliki kesamaan mendasar, yakni akidah dan tujuan “menuju” Allah SWT. Karena itu tidak tertutup kemungkinan perbedaan itu justru saling mengisi, dengan beragam perbedaan penafsiran yang terjadi— bukan sebaliknya. Kewajiban Persaudaraan Islam Di antara nilai-nilai sosial kemanusiaan dalam Islam adalah persaudaraan (ukhuwah). Manusia hidup mestinya saling mencintai dan saling menolong diikat perasaan layaknya anak-anak dalam satu keluarga. Mereka saling mencintai, saling memperkuat, sehingga benar-benar terasa bahwa kekuatan saudara adalah kekuatannya, dan kelemahan saudaranya adalah ke-

Faks 061 4510025

lemahannya. Ia akan kecil tidak berarti jika sendirian dan akan memiliki makna manakala bersama saudaranya. Persaudaraan umat Muslim ini ditegaskan Rasulullah SAW melalui hadis Beliau; Orang Mukmin bagi Mukmin lainnya seperti bangunan, sebagiannya menguatkan sebagian yang lain. (HR Abu Ya‘la, Ahmad, Bukhari, Ibnu Abi Syaibah, Ibnu Hibban, Muslim, Nasa’i, Thabrani, Tirmidzi dan Qudha‘i) Perumpamaan orang-orang beriman di dalam cinta dan kasih sayang mereka adalah seperti tubuh. Jika salah satu anggotanya mengeluh sakit, maka anggota tubuh lainnya akan memberikan kesetiaan kepadanya d e n g a n berdagang (susah tidur) dan demam.” (H.R. AlBukhari, 6011 dan Muslim, 2587) Dalam hadis lain Rasulullah SAW bersabda: Rahim (tali persaudaraan) itu digantungkan pada arsy, ia berkata: Barang siapa yang menyambungku (berbuat baik kepada kerabat), maka Allah akan menyambungnya dan barang siapa yang memutuskan aku, maka Allah pun akan memutuskannya.(Shahih Muslim No.4635) Alquran juga menyatakan bahwa hidup bersaudara itu suatu kenikmatan yang terbesar. Allah SWT berfirman: “Dan ingatlah akan kenikmatan Allah kepadamu ketika kamu dahulu (masa jahiliyah) bermusuhmusuhan, maka Allah mempersatukan hatimu, lalu menjadikan kamu karena nikmat Allah orang-orang yang bersaudara.” (Ali Imran: 103) Karena sesungguhnya persaudaraan dalam bermasyarakat di antara orang-orang Mukmin adalah merupakan suatu konsekuensi keimanan yang tidak dapat terpisah satu sama lain di antara keduanya. Allah SWT berfirman: Sesungguhnya orang-orang Mukmin itu bersaudara...” (Al Hujurat: 10) Ulama kontemporer Syaikh DrYusuf al-Qardhawi mengatakan yang disebut ukhuwah diniyah (Islamiyah) di antara umat Islam tidak saling menafikan antara yang khusus dan yang umum. Ukhuwah diniyah ini memiliki hak-hak yang lebih banyak, sesuai dengan ikatan akidah dan syariah serta pemikiran dan tingkah laku.

Oleh Arfanda Siregar Facebook Smswaspada

+6281273400119 Kepada Plt Walikota Medan Tolong di Tertipkan Pak Pesantren Modren Nurul Hakim Tembung yang,tidak Memiliki Ijin Domisili &Ijin Operasional,Terus beroperasional,dan. Perlu Bapak ketahui Yayasan tersebut Belum terdaftar di Pengadilan Negri,Sedang kanwil Kementrian Agama,Sumut terkesan Membiarkannya, untuk Waspada Semoga Selalu Menjadi Media terdepan dalam Setiap pemberitaan +6281263772357 Kepada pihak yg berwenang.. Pupuk subsidi di Desa Hadundung. Kec Kota Pinang Raib. Kalaupun ada harganya 117000. Mohon perhatian. +6285261599475 Alhamdulillah,Telah ditanda tangani 29/9/2013 MoU,dengan Tulusnya hamba Allah Dr H. Tigor Panusunan Siregar.SpPd.memberikan areal plasma kepada Masyarakat di L.Bilik.. Kec.Panai Tengah, Kab.L.Batu.Yang tergabung dalam KOPERASI PANE-SAPOKAT BERMITRA DGN PT HIJAU PRYAN PERDANA SEBAGAI BAPAK ANGKATNYA( DALAM BENTUK PLASMA SAWIT).Yg sudah 30thn terukir kembali masa Pak Dr Tigor. Yang peduli, prihatin atas kehidupan masyarakat pesisir pantai L.Baru .inilah baru BUPATI YG PEDULI,KEPADAPENDIDIKAN,SOSIAL,KEBERSIHAN.PANTAS DIDUDUKKAN UNTUK KEDUA KALI,NYATA DIMASYARAKAT.tks UCOK.MASPAR.S. KETUA.PANE SAPOKAT.LAB.BILIK. +6282369821953 mohon kpd bpk atau pejabat yg mau komentar tlg dipikirkan krn dampak ny ke pd kmi rakyat kecil. krn klu komentar atau mengkoreksi aja tpi tidak membuat satu perubahan tentang apa yg di komentari itu hnya membuat kmi rakyat kecil mkin di bantai. atau bpk yg berkomentar punya misi lain yg untk keuntungan pribadi. salah stu ny tentang MK yg ditangkap bukan malah semua hakim2 dinegri ini jadi taubat malah semakin marah kemana lampiasan nya kalau tdk ke rakyat kecil .tau bapak setan mereka ini dikasanakan ny setan lg itu lah mereka. +6281360885678 Hebat dan salut ama PRO DUTA,,padahal mereka masih muda,, dan anak kemarin sore, kalau di bandingkan sama TETANGGA nya sekarang ???? Tapi dgn keadaan yg terus menerus seperti ini ?? Saya yakin,,suatu saat nanti,bukan tidak mungkin PRO DUTA FC,,jd legenda baru di SUMUT dan sekitar nya !!! +6281362155246 Sekilas Infomasi Tentang Diantara Peristiwa Yang Insya Allah Menambah Kebaikan Kita: 1)Hari Minggu tanggal 03 Nopember 2013 akan terjadi gerhana matahari cincin atau total yang dimulai jam 17.04 wib,tengah atau puncak gerhana jam 19.46 wib dan akhir gerhana jam 21.28 wib.Gerhana tidak dapat dilihat dari Indonesia (Sumber: Kalender Muhammadiyah tahun 2013). 2)Selasa, tanggal 05 Nopember 2013 adalah Tahun Baru Islam 1 Muharram 1435 Hijriah. Wallaahu a’laam. +6285262134619 Ass wr wb. Kpd Ust Tgk H. Ameer Hamzah yg terhormat. Saya terkejut dgn tulisan ust di kolom Albayan pd 29 okt 13, ttg “Tsa’labah Bin Hathib”. Pertanyaan saya, 1.Tolong berikan Refernsi dari kisah yg sudah ustad tulis. 2. Asbabun nuzul QS attaubah:103, benarkah terkait dgn tsa’labh? Tlg kitab tafsir yg ust pakai apa?..Yg saya tahu, bahwa seluruh sahabt rosul yg pernah ikut PERANG BADAR dijamin Masuk SYURGA. Mungkinkah seorg kaya yg sombong, & ingkar kepada ayat Allah (tsa’labah) masuk syurga? Nau’ udzu billahi min zalik.

Tahun Baru Islam Salah satu momentum yang baik sebagai sarana melakukan introspeksi diri, muhasabah atau evaluasi diri adalah Tahun Baru Islam. Tahun baru yang juga dikenal dengan Tahun Baru Hijrah ini secara bahasa artinya meninggalkan dan pindah, baik fisik maupun mental-spiritual. Berpindah menunjukkan adanya dinamika dan transformasi. Manusia perlu hijrah karena perbaikan kualitas hidup menuntut adanya transformasi fisik dan mental spiritual. Karena itu, di antara ayat yang turun kepada Nabi Muhammad SAW pada awal kenabiannya adalah perintah hijrahh, Dan, hendaklah engkau hijrah (tinggalkan) dosa besar. (QS. Al-Mudatstsir 74: 5). Ulama penulis tafsir Al-Misbah Prof Quraish Shihab mengatakan, hijrahnya Nabi SAW adalah bentuk optimisme dan hijrah mengandung nilai dan peradaban. Ketika Nabi SAW hijrah menuju kota yang disebutYastrib, jelasnya, beliau lantas mengubah nama kotanya menjadi Madinah, di situlah Nabi memulai sebuah peradaban baru dan nilai-nilai baru yang ditanamkan, yang kini populer kita kenal sebagai masyarakat madani. Oleh karenanya Tahun Baru Hijrah setiap 1 Muharram hendaknya menjadi momentum pembebasan diri dari semua perilaku jahiliah, kebobrokan, kezaliman, dan kedidakadilan,termasuk keterpecahbelahan. Muharam juga hendaknya menginspirasi kita semua untuk mengubah diri, keluarga, dan masyarakatkearahhidupyanglebihpositif dan konstruktif. Bagi negara dan pemerintah, momentum ini hendaknya digunakan untuk perbaikan dan peningkatan kualitas moral pengelola birokrasi pemerintahan. Bagi persaudaraan Islamiyah, hendaknya ini menjadi sebagai momentum untuk merekatkan persatuandakkesatuanumatdalamikatan ukhuwah Islamiyah yang kuat. Khusus bagi negeri ini, makna hijrah hendaknya menjadi momentum pendewasaandalamkehidupansesamaumat Islam untuk semakin matang dalam kebersamaan hidup berbangsa dan bernegara—terutama di tengah berbagai kontroversi isu yang meliputi masyarakat secara lokal maupun global. Bahaya Melupakan Ukhuwah Sesungguhnya, ukhuwah Islamiyah adalah ruh dari iman yang kuat dan inti dari perasaan yang meluap-luap yang dirasakan oleh seorang Muslim terhadap saudara-saudaranya yang seakidah.

Bahkan, ia merasa bahwa ia bisa hidup karena mereka, bersama mereka dan di tengah mereka. Dengan perasaan itu, maka hilanglah perbedaan kesukuan dan warna kulit, lenyaplah perbedaan ras, dan matilah fanatisme kebangsaan dan kesukuan. Yang ada hanyalah pondasi besar yang menjadi landasan berdirinya masyarakat Islam internasional yang dihimpun oleh satu tali dan dinaungi satu bendera, yakni bendera iman dan tali ukhuwwah Islamiyah. Persaudaraan yang berlandaskan akidah akan menggantikan persaudaraan nasab (darah), dan ikatan iman menggantikan ikatan-ikatan materi, kepentingan individu maupun ambisi pribadi. Dalam persaudaraan akidah, seorang mencintai saudaranya seperti mencintai dirinya sendiri. Ia merasa sedih bila mereka sedih dan ia merasa senang bila mereka senang. Ia selalu berbagi suka dan duka bersama mereka. Karena itu, Islam memberantas gejala egoisme dan mental suka mementingkan diri sendiri yang kejam. Karena, ia merupakan kecenderungan tercela dan bencana yang buruk, diganti dengan rasa persaudaraan dan persahabatan. Namun bila umat Islam telah melupakan ukhuwah kepada sesamanya, maka hatinya akan dikuasai oleh materi, peradaban yang palsu merajalela di mana-mana, dan dunia melompat dari tangan ke dalam hati. Ia akan selalu bertemu dengan iman yang lemah dan pendidikan yang salah, dan melaju bersama kesenangan dan materi. Kemudian ia akan tunduk di hadapan tantangan yang menghadang? Maka yang terjadi selanjutnya adalah ketegangan hubungan sosial di antara sesama, karena sebab yang sangat sepele. Bahkan, ketegangan itu pun terjadi di antara orang-orang yang memiliki hubungan dekat, baik hubungan nasab (keturunan), perkawinan, persahabatan, maupun tetangga. Sehingga pertikaian merajalela, pertengkaran terjadi di mana-mana, perpecahan meluas, dan pemutusan hubungan menjadi-jadi. Kondisi itu menyebabkan hilangnya kasih sayang dan kejernihan, menimbulkan perpecahan dan gugat-menggugat, lalu memicu timbulnya sikap egois dan mementingkan diri sendiri. Pada kenyataannya gejala seperti itu diteruma dalam komunitas umat Islam, baik dalam skala nasional maupun internasional. Itu semua dipicu oleh lemahnya ukhuwwah Islamiyah di antara umat Islam. Maka momentum Tahun Baru Hijriyah ini mari bersama kita bertobatlah, memohon ampun kepada Allah SWT dan berdoa agar dijauhkan dari penyakit saling menjauhi, saling membantai, saling membenci, dan saling membelakangi. Mari bersama-sama bergerak menuju naungan cinta, perdamaian, tolongmenolong, persaudaraan dan keharmonisan. Penulis adalahMantanWakilWaliKotaMedan.

Pesan Hijrah Nabi Untuk Pemimpin


WASPADA Rabu 6 Nopember 2013

Bagaimana mungkin negeri ini hijrah dari negeri yang terkenal negara paling korup di dunia? Seharusnya,hijrah dijadikan teladan dalam memimpin bangsa dan negara. ijrah Nabi Muhammad SAW bukan sekadar berpindah tempat dari Makkah ke Madinah. Peristiwa hijrah merupakan titik awal perubahan umat Islam dari masyarakat tertindas di Makkah menjadi umat berperadaban di Madinah. Jika sebelum hijrah, umat Islam diintimidasi oleh orang Quraisy yang tak mau menerima keberadaan umat Islam, namun setelah hijrah Islam muncul sebagai peradaban baru di dunia.


Napak Tilas Hijrah Peristiwa hijrah berawal dari kegundahan hati Nabi Muhammad SAW atas intimidasi yang tidak kenal henti kepada sahabat beliau oleh kaum Quraisy yang domotori oleh Abu Jahal. Tidak hanya siksaan fisik, aktivitas ekonomi yang merupakan hak asasi manusia pun diamputasi sehingga membuat umat Muslim di Makkah tidak mempunyai akses perdagangan, baik sebagai penjual maupun pembeli. Pada masa itu, kehidupan Nabi dan sahabat sangat susah. Tak ada transaksi jual beli, seluruh pedagang di Makkah dilarang menjual produk apapun kepada umat Islam. Apapun yang dikerjakan kaum Muslimin selalu diancam dengan perang dan penyiksaan yang mengerikan. Menurut Al-Mubarakfury dalam bukunya berjudul Siroh Nabawiyah, siksaan kejam yang dialamai oleh Nabi dan sahabat disebabkan dua hal. Pertama, seruan bertauhid atau menyembah kepada satu Tuhan membuat para pembesar Quraisy merasa singgasana dan kekuasaan yang diwariskan turun-menurun terancam. Kebiasaan dan tradisi kuno yang telah berusia ratusan tahun, seperti kepemimpinan di Semenanjung Arab, kebiasaan menyembah berhala, dan perilaku jahiliyah terpaksa berubah pasca pengakuan Allah SWT sebagai Tuhan. Kedua, struktur sosial masyarakat Arab yang dikembangkan suku Quraisy akan runtuh setelah pengakuan Muhammad ibn Abdillah sebagai utusan Allah SWT. Pascakeislaman, tak ada lagi manusia yang patut dipatuhi dan diikuti

selain Muhammad SAW. Dengan kondisi umat Islam yang menyedihkan, Nabi sebenarnya sudah berniat ke luar dari Makkah. Namun karena belum ada perintah dari Allah SWT membuat beliau mengurungkan niatnya. Barulah pada tahun 622 M, perintah Allah SWT turun agar umat Islam pindah ke Yatsrib, sebuah kota 280 mil dari Makkah. Hijrah dari Makkah ke Yatsrib dijadikan Nabi sebagai awal episode kehidupan yang baru sebagai umat yang berperadaban. Sebagai bukti keseriusan Nabi mengubah kehidupan umat Islam yang dulunya tertindas serta terpinggirkan di Makkah, lalu diubahlah nama Yatsrib dengan Madinah yang berarti berperadaban. Perpindahan dari Makkah menuju Madinah kemudian terkenal dengan istilah Hijrah. Dan pada masa kepemimpinan Umar bin Khatab, waktu hijrah tersebut ditetapkan sebagai awal perhitungan tahun Hijriyah. Dari Madinah, monumen sejarah kebangkitan peradaban slam lahir dan berkembang ke seluruh tapak bumi. Dalam waktu cukup singkat Muhammad SAW mengubah wajah Madinah yang dulunya berpola diskriminatif, primordialis-fanatis dan eksklusif menjadi masyarakat yang terbuka, egaliter dan penuh dengan nilai-nilai persaudaraan. Madinah yang awalnya selalu diselimuti oleh perang antarsuku menjadi komunitas yang dipenuhi semangat kolektif reformasi. Selama di Madinah, Nabi Muhammad tidak hanya tampil sebagai seorang agamawan yang selalu mendermakan pesan spiritualnya, tetapi juga tampil sebagai negarawan yang adil dan bijaksana. Islam dipraktikkan tidak hanya sekadar panduan ritual tetapi juga etikmoral yang selalu hidup di tengah masyarakat. Tidak salah jika kemudian Michael Hart dalam The 100: A Rangking of The Most Influental Person in History menempatkan beliau pada urutan yang pertama. Pesan Hijrah Sejarah membuktikan bahwa hijrah bukan sekadar domain umat Islam mencapai masa keemasan. Umat

terdahulu mencapai keemasan peradaban setelah melakukan hijrah. Hijrahnya Musa dari negeri Fir’aun menjadi tonggak sejarah baru umat Yahudi yang tertindas di negeri Mesir, yang sekarang diperingati dengan perayaan Paskah. Ibrahim juga meninggalkan rumahnya di Ur untuk hijrah ke Kan’an sebagai tonggak keberhasilannya menjadikan Kabah sebagai pusat peribadatan. Zaman kebesaran Yusuf dimulai ketika beliau secara tidak sengaja hijrah ke negeri Mesir. Bangsa Indonesia saat ini telah disiksa masa transisi berkepanjangan. Pergantian rezim, mulai dari kejatuhan Soeharto sampai masa SBY sekarang belum menghasilkan peradaban emas bangsa Indonesia. Peradaban negeri ini dari orde ke orde berikutnya hanya menghasilkan ketidakpuasan di benak rakyat. Kebuntuan dan kemandulan orientasi dalam segala aspek kehidupan membuat rakyat frustasi. Penyakit sosial tidak kunjung sembuh, bahkan menjalar ke mana-mana memangsa visi kebangsaan yang kian kropos. Korupsi yang merupakan perilaku jahiliyah tidak lagi menjadi kejahatan memalukan. Koruptor merasa bangga kalau bisa korupsi. Lihat saja gaya mereka kalau diwawancarai televisi bagai anak muda film action, merasa menjadi korban, mencari simpati. Tak satupun koruptor yang mau mengaku bersalah, semua merasa dikambinghitamkan. Bahkan, presiden kita yang dipilih rakyat secara langsung masih berkutat pada perubahan yang simbolik dan penuh retorika. Berjanji akan memberantas korupsi sampai ke akar-akarnya. Kenyataannya “rumah sendiri” pun tak mampu bebas dari cengkeraman koruptor. Sekarang, satu per satu“orang dekat” dan pembantu presiden terindikasi melakukan praktik jahilyah: korupsi ! Namanama mereka beredar di tengah masyarakat dengan profesi sangat memalukan: koruptor. Presiden kita yang pintar berpidato dan selalu berapi-api menyatakan bahwa dirinya antikoruptor pun tak sanggup membersihkan koruptor di partai yang didirikannya. Bagaimana mungkin negeri ini hijrah dari negeri yang terkenal negara paling korup di dunia? Seharusnya, hijrah dijadikan teladan dalam memimpin bangsa dan negara. Mungkin apa yang dinasehatkan oleh Malik bin Nabi’ seorang sosiolog dari Al-Jazair bahwa yang kurang dalam diri

setiap Muslim pada saat ini, bukanlah logika berpikir dan retorika, tetapi logika kerja dan gerakan (semangat hijrah, semangat mengubah diri). Kebanyakan Muslim saat ini tidak berpikir apa yang dilaksanakan, tetapi sekadar beretorika tanpa hasil kerja memuaskan. Jika ingin nasib negara ini berubah seharusnya presiden harus lebih banyak bertindak mengganyang koruptor, bukan beretorika ke sana kemari mencari simpati. Ini sesungguhnya pesan hijrah Nabi kepada pemimpin bangsa. Penulis adalah Dosen Politeknik Negeri Medan, Kepala SMP IT Ali Bin Abu Tholib Tanjungmorawa.

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengandisertaiCDataumelaluiemail: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkandiMediamanapun.Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Presiden SBY: Upah buruh murah sudah selesai - Sekarang masuk masa kesejahteraan * Gubsu pelajari tawaran investasi Inggeris - Hitungannya harus jelas mas! * MUI: Kita harus hijrah dari kesalahan - Tambah umur kelakuan harus makin baik


D Wak


WASPADA Rabu 6 Nopember 2013


Kembalikan UU 1945 Menghayati Berbangsa Dan Bernegara Tahun ini era reformasi telah memasuki usia 14 tahun. Harapan yang telah dicetuskan mahasiswa dan masyarakat saat menggebrak gedung MPR/ DPR RI, dapat dikatakan belum kesampaian. Masyarakat luas dan mahasiswa menghendaki perubahan demi kesejahteraan dan kemakmuran, faktanya kita berada pada kehidupan yang bebas tapi nyaris kehilangan tanggung jawab. Kita belum berhasil secara keluar dari krisis multidimensional, malah lebih dari itu, idealisme semakin tergerus oleh materialisme dan pragmatisme. Individualisme menjalar terus merasuki kehidupan masyarakat kita di perkotaan malah di pedesaaan Padahal kita semua tahu, bahwa jiwa Indonesia adalah jiwa gotong royong, jiwa persaudaraan dan kekeluargaan. Jiwa/jati diri bangsa Indonesia mengalami degradasi seiring dengan sistim politik dan sistim ketatanegaraan mengalami perubahan yang fundamental melalui amandemen ke-1 s/d 4 UUD 1945 tahun 2009/2014. Dalam perubahan dan Amandemen UUD 1945 Pasal 26 Ayat 1 yang berbunyi: yang menjadi warga negara indonesia adalah Bangsa Indonesia asli dan orang-orang bangsa lain yang disahkan dengan undang-undang sebagai warga negara. UUD 1945 yang telah diamandemen Harus diamandemen kembali sebagaimana mestinya dalam Ketetapan MPRNo IV /MPR/1978 yang berbunyi: Orang-orang bangsa lain, misalnya orang peranakan Belanda, peranakan China, dan peranakan Arab yang bertempat kedudukan di Indonesia, mengakui Indonesia sebagai tanah airnya dan bersikap setia kepada Negara Kesatuan Republik Indonesia dapat menjadi warga negara. UUD Dasar 1945 Pasal 27 Ayat 1 Segala warga negara bersamaan kedudukannya di dalam hukum dan pemerintahan dan wajib menjunjung hukum dan pemerintahan itu dengan tidak ada kecualinya. UUD Dasar 1945 Pasal 27 Ayat 1 harus diubah sehingga: Segala warga negara bersamaan kedudukannya didalam hukum dan pemerintahan dan wajib menjunjung hukum dan pemerintahan itu dengan tidak ada kecualinya dan setiap warga negara Indonesia tidak diperkenankan menguasai dan membeli tanah Indonesia kecuali bangsa Indonesia. Kebablasannya sekarang banyak masjid diruntuhkan oleh pengembang untuk kepentingan pengusaha yang dibacking pejabat/pengusasa, menguasai lapangan Merdeka dengan nama Merdeka Walk , Kesawan Square tempat Karoke Warga Negara Indonesia. Hampir semua lini dikuasai, sampai perguruan tinggi, rumah sakit maupun kuliner, malah sampai penjual bumbu dikuasai tanpa adanya penyaringan/pengawasan walaupun dapat mematikan produk bangsa Indonesia. Tekad dan semangat reformasi untuk menegakkan civil society, ataupun masyarakat madani, pada kenyataannya dimaknai sebagai era kehidupan yang paradoks dengan keperibadian dan jati diri bangsa Indonesia. Sebagai ilustrasi, kita bangun pagi, ke luar rumah, kita akan rasakan dan menemukan fenomena di jalan raya, sepertinya kita berada dalam sebuah ruang kehidupan yang tanpa aturan, tanpa kepribadian. Semua merasa dirinya paling berhak, sehingga dengan sikap seperti itu pula kemudian merampas hak orang lain. Kebebasan mengemukakan pendapat dan kebebasan berserikat yang dijamin konstitusi, pada prakteknya malah melahirkan tindakan kekerasan, anarkis dan merusak. Juga kebebasan berserikat dikhawatirkan tidak lagi dimaksud untuk semakin menegakkan jiwa Pancasila. Karena pada prakteknya lebih didominasi syahwat kekuasaan dan materi yang semakin menjauhkan kita dari nilai-nilai Pancasila sebagai idiologi bangsa. Bagaimanapun komitmen dan tekad kita, harus ada upaya terorganisir dan sistemik serta berkesinambungan, yang dimulai dari sekarang. Jangan tunggu sampai besok, apa yang diperbuat saat ini, kita lakukan. Pertama, saat negara dan bangsa Indonesia terpuruk pada zaman orde lama, Mabes TNI AD melaksanakan seminar yang pada gilirannya berhasil mengangkat martabat bangsa ini dan membubarkan PKI. Menurut hemat kami sudah saatnya pula TNI-AD melaksanakan seminar menemukan langkah-langkah demi NKRI, UUD 1945 dan Pancasila. Kembalikan Dwifungsi ABRI untuk melindungi NKRI. Kedua, kepada pemuda, pelajar dan mahasiswa, supaya melakukan kerja keras bersatu padu, bekerjasama dengan berbagai upaya legal membangun dan memantapkan komitmen NKRI, Pancasila dan UUD 1945, serta memberi teladan, berbuat tanpa pamrih. Ketiga, kepada seluruh organisasi pemuda, pelajar dan mahasiswa supaya melalukan upaya maksimal untuk bersatu padu lahir dan batin, menjadi benteng NKRI, Pancasilais dan UUD 1945. Kita bangun pula komitmen kepada generasi muda dan jangan terjadi pertikaian pelajar maupun pemuda seperti tawuran. Keempat, kepada pemerintah pusat cq Departemen Pendidikan Nasional, mohon agar panitia penyusun sejarah bangsa Indonesia diaktifkan, untuk melahirkan buku sejarah bangsa yang benar. Radjoki Nainggolan, SE, MA Dosen Fisipol UMSU

Si Baik Budi Dia anak yang wajahnya lumayan tampan, kurus tinggi kulit kuning air. Dia anak bungsu dari tiga bersaudara. Kakak dan abangnya sudah pada berumahtangga. Ayahnya tukang perbaiki jam tangan, sedangkan ibunya jualan sarapan di depan rumah. Mereka memiliki rumah sederhana dan sebuah sepedamotor. Mereka dikelompokkan keluarga mampu karena tak mendapat BLSM. Orang tua di kampung kami memberinya gelar si baik budi. Kami menggelarnya karena perangai sikap dan tingkah lakunya berbudi pekerti sangat baik. Anaknya ramah patuh lembut dan sopan santun. Sehingga dia selalu disayangi teman dan handai tolan. Dia tak mau bikin repot, tak buat susah, tak nimbulin masalah, bahkan mau menolong orang. Cara dia berjalan, bertutur kata dan bersikap tak buat orang tersinggung. Kalau berjalan dia tertunduk lihat jalan, suka mengalah kalau berselisih, dan memberikan kesempatan kepada orang tua terlebih dahulu. Jika bicara satu-satu teratur tertata rapi dan tak mengeluarkan kalimat yang membuat orang sakit hati. Dia tak mau menyela atau memotong pembicaran orang lain, kecuali orang tersebut menghinanya. Nyaris kita tak pernah dengar dia bertengkar, disakiti, dilecehkan atau dikhianati. Karena tak satupun orang tersinggung dibuatnya. Bayangkan, jika parkir, meludah, buang sampah, makan-minum, buang air kecil, tertawa, bersedih, selalu di tempatnya. Sampai-sampai berdiri di halte-pun dia mengalah. Si Baik budi ini sepertinya kurang cerdas, karena tak mau memberikan ide atau pendapat jika tak diminta. Karena dia sangat menjaga perasaan orang lain. Dikatakan dia rajin, sepertinya biasa saja, karena dia bekerja sesuai tupoksi saja, tak mau mencampuri pekerjaan orang lain, takut menyalahkan atau disalahkan. Mungkin Si Baik Budi ini senantiasa berhubungan dengan Allah, karena apa yang dibuatnya sesuai dengan apa yang disuruh Allah. Entah-entah, sebelum bertindak dia nanya dulu ke Allah, benar apa enggak? Pokoknya apa yang dikerjakannya yang disuruh Allah dan sebaliknya. Atau, dia keturunan Rasul, karena sikap tingkah lakunya sesuai sunnah Rasul. Pokoknya nyaris tak ada dosanya. Sepertinya Si Baik Budi senantiasa dalam perhatian dan kasih sayang Allah, karena ketika dia mengalami kesulitan ekonomi, Allah selalu berikan jalan kemudahan. Karena Allah lihat dia setiap hari baik budi, maka Allah enggak rela lihat dia menderita. Dengan kuasaNya Allah berikan dia kemudahan. Duh…entahentah Allah “naksir” ke dia. Lalu, dari mana dia dapat sikap baik budi tersebut. ”Ouuuu…mamaknya itu pendiam sangat, ayahnya tukang senyum, pokoknya kedua orang tuanya baik budi. Kakak dan abangnya pun dulu, ketika masih di kampung kami, mereka baik budi juga,” demikian pengakuan orang kampung . Berarti, ada gen baik budi diwariskan kedua orang tua kepadanya. Singkat cerita, Si Baik Budi tumbuh kembang lajang bekerja kawin dan beranak, tetapi dia tetap baik budi seperti dulu. Kabarnya dia sekarang kerja sebagai guru SD di daerah terpencil sambil perbaiki jam tangan juga. Berita terahir kami dengar dia meninggal dunia sepulang mengerjakan haji. Kira-kira hikmah yang dapat kita petik dari kehidupannya adalah, Allah “naksir” padanya. Jika kita sebagai kekasih Allah, tentu Allah akan melindungi, memerhatikan, menyayangi, bahkan memberikan apa yang kita mau. Dus… tentu Allah akan tempatklan kita kelak di Surga Firdaus. Dan satu lagi. Karena semasa hidupnya dia baik budi, maka dia teteskan gen baik budi tersebut buat ketiga orang anaknya. Maka semakin banyaklah orang baik budi di negara kita ini. Amin. Nada Sukri Pane Guru SMA Negeri 16 Medan

(Bukan) DPT Kecengan Oleh Choking Susilo Sakeh Jika berangkat dari keyakinan bahwa kita bukan bangsa kecengan— dan karenanya masalah DPT tersebut sudah semestinya selesai tanpa masalah. ercayalah, sesungguhnya Indonesia bukan negara kecengan. Bahkan saya akan marah andai ada yang menyebut Indonesia adalah negara kecengan. Sebab, simaklah pernyataan Presiden Susilo Bambang Yudhoyono saat menanggapi pengakuan mantan Presiden Partai Keadilan Sejahtera (PKS) Lufti Hasan Ishak di PN Tipikor Jakarta, beberapa pekan lalu. “Saya bukan pejabat kecengan!”, kata SBY. Itu artinya—menurut pemahaman awam saya—Indonesia pastilah bukan negara kecengan, sebab pemimpinnya bukan pejabat kecengan! Karena Indonesia adalah bangsa yang besar dan maju (baca: bukan bangsa kecengan), maka masalah data kependudukan tentu bukan lagi sebuah masalah. Data kependudukan yang semrawut, boleh jadi, hanyalah milik negara-negara terbelakang. Kesungguhan Indonesia sebagai bangsa yang besar dan maju dalam membereskan masalah data kependudukan ini, dapat dilihat dari adanya badan pusat statistik yang hadir dari tingkat pusat sampai ke kab/kota. Lembaga yang mempunyai anggaran relatif cukup ini, setiap saat melakukan tugasnya


dengan baik, sehingga masalah data kependudukan berikut perilaku dan indikasi lainnya sesungguhnya bukanlah soal berat bagi Indonesia. Tidakcumaitu,Kemendagripunterus merampungkan program e-KTP, sebuah program pendataan penduduk melalui teknologi komputer. Program berbiaya triliunan rupiah ini, masih terus menerus melakukan pembaruan pendataan penduduk. Dengan demikian, sekali lagi, sesungguhnyamasalahdatakependudukan bukan sebuah soal bagi bangsa yang dinakhodai oleh bukan pemimpin kecengan. Lantas kenapa KPU masih kesulitan menyusunDaftarPemilihTetap(DPT)untuk Pemilu Legislatif dan Pemilu Presiden tahun 2014? ?Sesuai jadwal yang disusun KPU, semestinya pada 23 Oktober 2013 telah ditetapkan DPT setelah sebelumnya molor dari jadwal semula pada 7-13 September 2013. Bulan lalu KPU tak berhasil menetapkan DPT, karena masih ada kesemrawutandataKPUdengandatayang diajukan para stakeholder Pemilu. Berdasarkan Pasal 33 ayat (2) UndangUndangNomor8Tahun2012,bahwaDPT paling sedikit memuat NIK, nama, tanggal lahir, jenis kelamin, dan alamatWNI yang mempunyaihakpilih.Namun,dalamdata

pemilih KPU, ditemukan data masih terdapat pemilih bermasalah secara administasi kependudukan. Data pemilih tetap yang disusun KPU tersebut berasal dari DP4 (data penduduk potensial pemilih Pemilu) dari Kemendagri. Sedangkan DP4 Kemendagri, tentu sajaberdasarkandatakependudukanyang mereka susun melalui program e-KTP. Pada September lalu, data Kemendagri yang mengacu ke DP4 dengan nomor induk kependudukan (NIK) mencatat 190.463.184 pemilih, sedangkan data KPU menunjukkan 181.140.282 pemilih.? Selebihnya, KPU sebagai lembaga penyelenggara Pemilu telah berulangkali menyelenggarakan Pemilu dan Pemilukada provinsi dan kab/kota sejak era reformasi. Dengan demikian, KPU sesungguhnya telah mempunyai kemahiran dalam menyusun DPT pada setiap Pemilu maupunPemilukada.Lantas,kenapaDPTtetap saja menjadi biang kegaduhan? Aroma Kepentingan Banyakfaktamenyebutkan,salahsatu penyebab kegaduhan pada Pemilu dan Pemilukadaadalahdikarenakanbrengseknya DPT. Konflik pada Pemilukada Dairi misalnya, salah satu pemicunya adalah ketidakbecusan DPT yang disusun KPUD. Dalam konteks nasional, Pemilu 2009 yang menghantarkan Partai Demokrat sebagai pemenang dan SBY terpilih menjadi presiden kedua kalinya, adalah Pemilu palingtidakbermutudalamsejarahPemilu era reformasi. Salah satu penyebabnya, apalagi kalau bukan soal DPT yang sembarangan. Artinya, salah satu aspek yang

menentukan bermutu atau tidaknya sebuah pemilu adalah faktor ketertiban DPT. Tentu saja hal semacam ini sungguhsungguh mengherankan. Sebab, pada era reformasi ini kita sudah beberapa kali menyelenggarakan Pemilu dan entah sudahberaparatuskalimenyelenggarakan Pemilukadaprovinsiataukabupaten/kota. Namun, menetapkan DPT yang benar tetap saja bagaikan mimpi. Jika berangkat dari keyakinan bahwa kita bukan bangsa kecengan— dan karenanya masalah DPT tersebut sudah semestinya selesai tanpa masalah—tentunya patutlah dicurigai ketidakbecusan penyusunan DPT secara baik dan benar tersebut. Jangan-jangan, DPT memang sengajadibuatkacaukarenaadakelompok kepentingan tertentu yang mengendalikannya. Jika memang demikian, maka semua elemenharusmenolakDPT,sampaibenarbenarKPUmampumenyusunDPTsecara baik dan benar. DPT yang tertib adalah juga cermin moralitas kita sebagai bangsa yang besar dan maju, bukan bangsa kecengan. DPT kecengan hanya dihasilkan oleh KPU kecengan di negara kecengan, dan itupastilahbukanIndonesia.Selainsebagai kejahatankarenamelanggarhakkonstitusi warga,sebagaimanadiaturdalamundangundang, DPT kecengan adalah juga bukan perbuatan orang-orang terhormat. Maka KPU, jangan sok bermoral jika tak mampu menyusun DPT secara benar. Semoga… Penulis adalah Jurnalis, Ketua Panwas Pemilu Sumatera Utara 2004.

Kasus Sutoyoso; Tinjauan Komunikasi Oleh Suwardi Lubis Hukum yang tegak merupakan pesan yang bisa menimbulkan efek komunikasi berupa perubahan attitude, opinion, behavior khalayak pada umumnya. Ini merupakan faktor pendorong Pemilu yang lebih berkualitas.


esta demokrasi Pemilihan Umum (Pemilu) 2014 telah dimulai dengan kasus hukum yang melibatkan Ketua Umum Dewan Pimpinan Nasional Partai Keadilan dan Persatuan Indonesia (DPN PKPI) Sutiyoso. Bang Yos, sapaan akrab Sutiyoso menjadi Ketum Parpol pertama yang divonis hakim dalam pelanggaran Undang-undang Pemilu. Dalam dakwaan pada sidang 21 Oktober lalu, Jaksa Penuntut Umum (JPU) Kejati Jateng Bambang Rukun membacakan sejumlah pelanggaran yang dilakukan Sutiyoso. Antara lain melanggar pasal 276 UU Pemilu Nomor 8 tahun 2012 dan peraturan KPU Nomor 6 tahun 2013. Pada sebuah acara halal bi halal di lapangan, Sutiyoso berorasi politik meminta dukungan termasuk dalam pemenangan Pemilu 2014. Kegiatan Sutiyoso itu terekam yang menjadi barang bukti di pengadilan. Selain orasi, Sutiyoso sebagai terdakwa juga memberikan doorprize. Hakim menjatuhi vonis hukuman dua bulan masa percobaan dengan ancaman pidana satu bulan penjara dan denda Rp 1 juta subsider 15 hari. Vonis ini lebih ringan dari tuntutan jaksa Kejaksaan Tinggi Jawa Tengah yang menuntut pidana penjara 1 bulan dengan masa percobaan 2 bulan dan denda Rp 5 juta subsider 1 bulan kurungan. Sutiyoso didakwa dengan Pasal 276 Undang-Undang Nomor 8 Tahun 2012 tentang Pemilihan Umum Anggota DPR, DPD, DPRD. Sutiyoso menyatakan tidak terima dengan vonis hakim, alasannya karena banyak Capres dan Parpol lain yang terus melakukan kampanye. Ia mengaku masih akan mempertimbangkan apakah akan menerima vonis atau me-

lakukan banding. Shock Therapy Kasus di awal perhelatan Pemilu ini tentunya merupakan kejutan dan penghantar menuju Pemilu 2014 yang sebenarnya. Sesuai pasal 276 Undang-Undang Nomor 8 Tahun 2012 tentang Pemilihan Umum Anggota DPR, DPD, DPRD, semetinya JPU menuntut lebih tinggi. Karena bunyi pasal tersebut menyebutkan ancaman pidana kurungan paling lama satu tahun dan denda paling banyak Rp12 juta. Kiranya baik dakwaan JPU maupun putusan hakim merujuk pada level terendah pasal Pemilu tersebut. Jika pasal ini bisa benar-benar diterapkan, maka akan menimbulkan dampak shock therapy kepada peserta Pemilu lainnya, sekaligus berupa sinyal bahwa ada hukum yang tegak dalam pelanggaran Pemilu. Ada efek komunikasi dari pesan dalam kasus Sutioyoso bagi setiap stakeholder Pemilu maupun masyarakat secara umum menyangkut pemahamannya tentang Pemilu itu sendiri. Bahwa aturan Pemilu itu sebenarnya tidak boleh dilanggar, karena akan berarti hukuman bagi pelanggarnya, tak peduli dia seorang ketua umum partai ataupun seorang jenderal. Hukum yang tegak ini memungkinkan menimbulkan efek perubahan sikap (attitude), perubahan pendapat (opinion), perubahan perilaku (behavior), dan perubahan sosial (social) peserta, penyelenggara Pemilu maupun khalayak pada umumnya. Ini merupakan faktor pendorong Pemilu yang lebih berkualitas. Meski begitu, apa yang dialami Sutiyososetidaknyabisamenjadipembuka bagi penindakan hukum yang lebih tegas

dalam Pemilu. Bahwa aturan perundangundangan yang dibuat memang sudah semestinya dijalankan sebagaimana mestinya, dan bukan sekedar persyaratan sebuah Pemilu tanpa penerapan yang objektif. Selama ini aturan perundang-undangan seperti dijadikan sebagai pemanis tanpagregetyangmendorongterwujudnya Pemiluyanglebihberkualitasdanmemiliki kredibilitas di mata publik. Dari mulai persyaratan pencalonan, ataupun menegakkanaturanpelanggarankampanye,seakan tidak menjadi acuan dalam penindakan. Akibatnya, defenisi kampanye diartikan dengan sangat longgar, baik oleh peserta Pemilu, maupun oleh penyelenggara Pemilu sendiri. Akibatnya lagi pelanggaran kampanye kerap terjadi dan kerap pula tak memiliki dampak hukum bagi pelakunya. Oleh karenanya tidak mengherankan tanggapan Sutiyoso mengomentari putusan pelanggaran kampanye atas dirinya itu. Penegakkan Hukum Untuk mewujudkan negara yang demokrasi, maka Pemilu adalah prasyarat utamanya. Dengan segala kompleksitas nasional, Pemilu tetap dituntut untuk diselenggarakan secara profesional dan memilikikredibilitasyangdapatdipertanggungjawabkan. Di setiap negara yang menganut paham negara hukum, kita Pemilu harusnya bekerja secara massif dan berdaulat. Para pakar merumuskan setidaknya ada tiga hal mendasar dalam negara hukum yakni, yaitu supremasi hukum (supremacy of law), kesetaraan di hadapan hukum (equality before the law), dan penegakan hukum dengan tidak bertentangandenganhukum(dueprocessoflaw). Dengan ditegakkannya prinsip-prinsip tersebut maka di dalam masyarakat akan tercipta beberapa hal yang merupakan konsekuensi logis penerapan prinsip tersebut. Misalnya akan muncul hak azasi manusia yang terjamin, independensi kehakiman, hukum menjadi acuan dalam tindakannegaradansebagainya.Iniadalah keniscayaan, karena penegakan hukum harus melihat apa yang menjadi tujuan Pemilu. Indonesia Pemilu merupakan saranaperwujudankedaulatanrakyatguna

menghasilkan pemerintahan negara yang demokratis berdasarkan Pancasila dan Undang-Undang Dasar Negara Republik Indonesia Tahun 1945. Pada gilirannya partai politik dalam menjalankan perannya itu akan bertemu denganproseskomunikasipolitik.Perkembangan ilmu komunikasi selanjutnya akan menyandarkan komunikasi politik khususnya dalam Pemilu ini pada political marketing. Ini adalah strategi kampanye politik untuk membentuk serangkaian maknapolitisyangdiinginkandiendapkan berada dalam pikiran para pemilih. Dan dalam rangka menjalankan political marketing inilah Sutiyoso terjerat hukum karena dia memang terbukti melakukan pelanggaran terhadap ketentuan yang berlaku. Maka di sinilah kita melihat pentingnya tinjauan komunikasi dalam Pemilu, khususnya penegakkan hukum pelanggaran Pemilu. Bahwa ada rangkaian dariperanstrategispartaipolitikmembingkai demokrasi yang mesti patuh kepada aturan hukum yang disepakati bersama. Alur ini harusnya terangkai secara utuh untuk menciptakan pesan komunikasi yangutuhpulakepadakhalayak,yangpada gilirannyamenjadipendorongbagikualitas Pemilu. Penutup KitaberharapBadanPengawasPemilu (Bawaslu) yang dibentuk untuk menerima laporan pelanggaran Pemilu pada setiap tahapannya itu terus menjalankan tugasnya. Kasus Sutiyoso kiranya hanyalah salah satu contoh awal saja dari penindakan kasus-kasus pelanggaran Pemilu lainnya. Sudah saatnya tidak lagi terjadi kesenjangan antara persepsi publik tentang penegakkan hukum Pemilu dengan anggapan penyelenggara Pemilu maupun pemerintah daeran partai politik tentang pelanggaran Pemilu yang terjadi. Karena semakin kecil terjadi kesenjangan dengan persepsi publik tersebut, merupakan indikator semakin tinggi pula kualitas Pemilu. Oleh karenanya publik berharap akan adatindakantegasterhadapparapelanggar aturan Pemilu di masa mendatang. Tujuannya hanya satu yakni meningkatkan kredibilitas dan kualitas Pemilu itu sendiri. Penulis adalah Guru Besar USU Dan STIK “Pembangunan” Medan.

Ekonomi & Bisnis


WASPADA Rabu, 6 November 2013

Armin Nasution


Teori Upah Besi SEPERTINYA kita para buruh sekarang harus banyak-banyak berterimakasih kepada Robert Owen yang ikut mendorong revolusi industri tahun 1817. Di abad ke-18 semua badan usaha yang berupaya untuk memaksimalkan produksi dengan menetapkan aturan jam kerja sebanyak mungkin setiap harinya. Buruh harus datang bekerja sejak matahari terbit hingga matahari terbenam dengan bayaran yang sangat minim. Masa itu para pekerja yang sebagian besar dari kalangan orang tak mampu malah harus mengajak anak dan saudaranya untuk ikut bekerja walau kondisinya sangat tidak memungkinkan. Mereka harus bekerja antara 10 jam hingga 18 jam setiap hari selama enam hari seminggu. Jam kerja yang menekan buruh inilah yang kemudian menjadikan pemberontakan buruh pada abad ke 19 diawali Rovert Owen seorang warga berkebangsaan Inggeris berfaha sosialis. Dialah yang mendorong agar pengusaha/ badan usaha membagi waktu buruh menjadi tiga perbandingan antara bekerja, beristirahat serta waktu untuk mereka sendiri secara berimbang. Kampanye yang muncul pun kemudian adalah delapan jam kerja, delapan jam rekreasi dan delapan jam istirahat. Demonstrasi pecah dimana-mana. Kerja rodi yang dialami buruh kemudian menjadi pemberontakan dan demonstrasi. Sehingga jam kerja per hari pun menjadi 10 jam saja terutama untuk wanita dan anak-anak. Tapi buruh tidak puas. Usul delapan jam kerja per hari muncul lagi di Inggeris tahun 1884. Dicetuskan Tom Mann, anggota Federasi Sosial Demokrat. Dia mendirikan organisasi Eight Hour League yang bertujuan membela kaum buruh bekerja delapan jam sehari. Dalam Trades Union Congress yang mewakili sebagian besar serikat buruh di Inggeris masa itu akhirnya diputuskan jam kerja menjadi delapan jam per hari. Organisasi Eight Hour League itu kemudian menjalar ke Amerika, Australia dan negaranegara industri lain. Maka sekarang kita pun bekerja delapan jam sehari. Intinya dari zaman dulu buruh selalu dalam posisi tertekan. Sama dengan kondisi sekarang. Hampir di setiap penentuan upah minimum provinsi yang dilakukan setiap tahun buruh selalu dalam pihak yang merasa ‘ditindas’. Selalu ada saja friksi saat penentuan upah tiap tahun. Termasuk dalam penentuan upah tahun ini. Data yang masuk di Kementerian Tenaga Kerja hingga hari ini sudah ada 20 daerah provinsi yang menentukan upah.

Agar buruh bisa punya tabungan, pengusaha dan pemerintah harus sama-sama memikirkan agar buruh mendapat fasilitas transport, uang makan, beras murah, pendidikan anak buruh dan jaminan kesehatan. Itulah yang dilakukan di China. Termasuk Sumut tentunya dengan kalkulasi Rp1.505.850 per bulan. Setiap tahun, perwakilan buruh, pengusaha dan dewan pengupahan daerah harus beradu argumentasi untuk menentukan nilai yang pas. Inti dari pertemuan itu tetap saja pengusaha selalu ingin menetapkan upah serendahrendahnya. Sedangkan buruh ingin lebih tinggi dan sesuai standar kebutuhan hidup layak. Apakah bisa layak? Jawabannya tidak. Dalam menentukan kalkulasi setiap tahun ini saya cenderung melihat satu teori upah yang pas dari kaum sosialis. Ferdinand Lassale dari mashab sosialis menyatakan tentang teori upah besi. Dia berpendapat upah buruh tidak mengandung harapan apa-apa dan tidak akan naik di atas biaya hidup minimum. Oleh karena itu dia menyebutnya upah besi. Yang berarti bahwa upah rata-rata buruh atau pekerja terbatas sama dengan biaya hidup minimum dengan keluarganya. Teori ini memang menjadi acuan. Sebab kalau untuk mendapatkan kebutuhan hidup layak masih jauh dari angan-angan buruh. Saya tidak ingin menghitung-hitung upah buruh Rp1,5 juta itu cukupnya untuk apa saja setiap bulan. Sebab ternyata buruh lajang itu menghabiskan 45 persen dari upah untuk kontrak rumah, 30 persen untuk makan sehari-hari dan 15 persen untuk ongkos angkutan (Kompas, 4/11). Kalau sudah seperti itu kalkulasi penggunaan upah buruh otomatis hanya cukup buat bertahan hidup? Berapa take home pay-nya? Bisa jadi di akhir bulan utang yang menumpuk tanpa menyisakan tabungan. Agar buruh bisa punya tabungan, pengusaha dan pemerintah harus sama-sama memikirkan agar buruh mendapat fasilitas transport, uang makan, beras murah, pendidikan anak buruh dan jaminan kesehatan. Itulah yang dilakukan di China. Walau upah di luar perkotaan negara itu Rp1,3 juta per bulan, namun mereka masih punya tabungan. Karena kebutuhan formal buruh seperti pendidikan, kesehatan dan pangan tidak membebani.

Pertamina Gelar Pelatihan Pengolahan Sampah Rumah Tangga MEDAN (Waspada): PT Pertamina (Persero) Marketing Operation Region I Sumbagut bekerjasama dengan Fakultas Kesehatan Masyarakat (FKM) Universitas Sumatera Utara (USU) memberikan pelatihan pengolahan sampah rumah tangga kepada kelompok binaan PKK Kelurahan Bagan Deli Kecamatan Medan Belawan, Senin (4/11). Asisten Customer Relation PT Pertamina (Persero) Regional I Sumbagut Sudarman mengatakan, Kegiatan ini merupakan salah satu program CSR Bidang Pemberdayaan Masyarakat Pertamina kepada masyarakat guna meningkatkan taraf hidup dengan melatih kreativitas warga memanfaatkan sampah rumah tangga menjadi barang bernilai ekonomis seperti pupuk kompos maupun aksesoris kerajinan tangan. “Dengan bekerjasama dengan FKM USU, kita memberikan pelatihan kepada warga masyarakat Kelurahan Bagan Deli, Kecamatan Medan Belawan ini membuat kerajinan tangan berbahan dasar sampah plastik an-organik seperti aksesoris, kalung, gantungan kunci, tirai, bros dan hiasan bunga lainnya yang nantinya bisa dijual sehingga mendapatkan uang untuk menambah pendapatan keluarga,” ujarnya. Menurutnya, dengan pelatihan tersebut akan dapat memberikan kemandirian ekonomi bagi kelompok PKK. Sebagai BUMN yang fokus me-

ngelola bisnis inti di bidang energi, pihaknya tetap berupaya menunjukkan kepedulian terhadap masyarakat terutama meningkatkan taraf ekonomi dengan program pemberdayaan. Sementara itu, Ketua kegiatan pelatihan Syarifah dari FKM USU mengatakan, kegiatan diikuti 25 peserta ibu rumah tangga tersebut dilatih oleh timnya dan mahasiswa untuk membuat kerajinan tangan. “Hasil kerajinan tangan ini nantinya bisa kita pasarkan ke pasar tradisional maupun modern, sehingga bisa memberikan pendapatan,” ujarnya. Menurutnya, yang terpenting adalah kemauan dari masyarakat untuk mengembangkannya nanti setelah diberikan pelatihan. “Karena jangan jadikan sampah musuh masyarakat, tapi sudah seharusnya untuk diolah menjadi nilai ekonomi masyarakat,” tuturnya. Lurah Bagan Deli Irwan Syah Lubis sangat menyambut baik program yang dilakukan Pertamina bersama FKM USU, karena kegiatan tersebut menambah wawasan masyarakatnya, serta mendapat ilmu, pengalaman dan pendapatan. “Apalagi di Kelurahan Bagan Deli merupakan gudangnya sampah yang berkumpul dari kiriman berbagai daerah melalui Sungai Deli. Sampahsampah tersebut bisa dimanfaatkan baik untuk pupuk kompos maupun kerajinan tangan seperti pembuatan aksesoris,” ujarnya. (m41)

Indeks Keyakinan Konsumen Mulai Meningkat JAKARTA (Waspada): Setelah mengalami tren pelambatan tiga bulan terakhir usai kenaikan harga BBM, optimisme konsumen mulai meningkat pada Oktober 2013. Peningkatan secara bulanan itu tercermin dari kenaikan Indeks Keyakinan Konsumen (IKK) dari 107,1 pada September 2013 menjadi 109,5 pada Oktober. Namun, menurut survei konsumen yang dilakukan Bank Indonesia (BI) yang dirilis awal November 2013, IKK tersebut lebih rendah dibandingkan periode sama tahun sebelumnya yang mencapai 119,5. “Kondisi ini menunjukkan pertumbuhan IKK secara tahunan masih cenderung melambat,” tulis survei BI itu. Kenaikan tipis IKK secara bulanan itu didorong peningkatan Indeks Ekspektasi Konsumen (IEK) dari 108,6 menjadi 113,7, seiring membaiknya optimisme konsumen terhadap kondisi ekonomi pada enam bulan mendatang. Walaupun, Indeks Kondisi Ekonomi (IKE) saat ini menurun. Secara regional, dari 18 kota yang disurvei, 11 kota mengalami kenaikan IKK. Peningkatan indeks tertinggi terjadi di Manado sebesar 13 poin dan Samarinda 11 poin. Sementara itu, berdasarkan kelompok responden, kenaikan IKK tertinggi terjadi pada responden dengan pengeluaran Rp4-5 juta per bulan. Selanjutnya, untuk IEK, kenaikan terjadi pada

semua indikator pembentuknya. Setelah mengalami tren penurunan pada tiga bulan terakhir, IEK pada Oktober meningkat 5,1 poin menjadi 113,7. Peningkatan terbesar terjadi pada indeks ekspektasi kegiatan usaha sebesar 6 poin menjadi 107,6. Diikuti indeks ketersediaan lapangan kerja sebesar 5 poin menjadi 96, dan indeks ekspektasi penghasilan enam bulan ke depan yang naik 4,6 poin menjadi 137,6. Ekspektasi terhadap membaiknya iklim usaha dan kondisi ekonomi menjadi pendorong utama meningkatnya optimisme responden atas kegiatan usaha enam bulan ke depan. Tekanan kenaikan harga Untuk Indeks Ekspektasi Harga (IEH), tekanan kenaikan pada tiga bulan mendatang, atau Januari 2014 diperkirakan dalam tren menurun. Meskipun, IEH diprediksi meningkat pada Desember 2013 seiring liburan Natal dan Tahun Baru. “Pada tiga bulan mendatang, IEH akan turun dari 171,5 menjadi 170,6,” tulis survei BI. Turunnya tekanan kenaikan harga diperkirakan terjadi pada semua kelompok komoditas. Penurunan indeks terbesar pada kelompok transportasi, komunikasi, dan jasa keuangan, serta makanan jadi, minuman, rokok, serta tembakau. (j03/vvn)

Garuda Indonesia Akan Kembali Terbang Ke London LONDON (Waspada): Dutabesar Indonesia untuk Kerajaan Inggris Raya dan Republik Irlandia, Hamzah Thayeb, mengaku bangga. Karena maskapai penerbangan Garuda Indonesia kembali terbang ke London, yang merupakan satu pasar yang terus bertumbuh bagi pariwisata nasional. “Saya bangga Garuda kembali melayani rute London-Jakarta. Pelayanan Garuda Indonesia juga unggul dibandingkan maskapai penerbangan internasional lain,” ujar Thayeb, di sela Pameran Pariwisata Internasional London, Selasa (5/11).

Dia juga datang ke gerai Indonesia dan menjajal model kursi kelas bisnis skala penuh di sudut Garuda Indonesia pada pameran pariwisata akbar itu. Garuda Indonesia membeli 10 Boeing B-777300ER baru untuk menerbangi rute internasionalnya, mulai 24 Mei 2014 nanti. Untuk London-Jakarta pulang-pergi, Boeing B-777-300ER itu akan menjadi andalan, menjadikan penerbangan di atas 12.000 kilometer itu nonstop. Rute London-Jakarta itu bagian dari rute London-Sydney lewat Jakarta, di mana transit hanya memerlukan waktu dua jam saja. (ant)


NELAYAN menata ratusan keranjang ikan Tongkol saat proses lelang di Terminal Pendaratan Ikan (TPI), Lampulo, Banda Aceh, Selasa (5/11). Hasil tangkapan ikan melimpah, terutama jenis ikan tongkol dengan harga penjualan turun drastis dari Rp300.000/keranjang menjadi Rp150.000/keranjang.

SBY Akui Masih Banyak Pungli JAKARTA (Waspada): Presiden Susilo Bambang Yudhoyono (SBY) mengakui masih banyak pungutan liar (Pungli) dan pemerasan yang dilakukan oknum yang tidak bertanggung jawab. Akibatnya pelaku usaha kesulitan berinvestasi di Indonesia. Presiden SBY meminta para pengusaha yang diperas dapat melapor ke Unit Kerja Presiden bidang Pengawasan dan Pengendalian Pembangunan (UKP4) dan menjamin akan merespon dengan cepat laporan yang diterima. Namun, Ketua Dewan Pimpinan Nasional Asosiasi Pengusaha Indonesia (Apindo) bidang Pengupahan dan Jaminan Sosial Hariyadi Sukamdani, mengatakan para pengusaha takut melaporkan karena kebanyakan pungli datang dari proses birokrasi. “Banyak pengusaha yang takut kalau mereka yang harus

melapor karena ini susah. Itu (pungutan liar) memang sudah di semua lini terjadi seperti itu. Ini hubungan dengan proses birokrasi,” kata Haryadi, Selasa (5/11). Dia mengatakan, pungli sudah terjadi dari pengusaha akan melakukan investasi. Seperti dari proses pengajuan pemanfaat lahan yang harus menyetor uang ke birokrasi-birokrasi terkait. “Mulai pengurusan izin lahan itu sudah mulai kena. Pungutan-pungutan liar ini sistematis dan semua saling mendukung,” ujarnya. Haryadi menilai, pembe-

rantasan pungli seharusnya dilakukan oleh pemerintah dengan memanfaatkan lembagalembaga negara seperti KPK, bukan dengan meminta pengusaha itu melaporkan sendiri. “Pengusaha itu malas melapor karena akan menganggu jadwal kerjanya. Kan dunia usaha ini terus berjalan, tidak pernah berhenti. Dia lebih baik memilih diam, agar tidak menambah masalah,” tutur Haryadi. Dia menambahkan kasus pungli paling banyak terjadi pada perusahaan yang banyak bersinggungan dengan birokrasi seperti kontraktor yang mengerjakan proyek pemerintah. Lebih lanjut, dia berharap pemerintah tidak hanya menunggu laporan dari pengusaha, tetapi harus lebih proaktif menyelidiki kasus pungli agar investasi di Indonesia berjalan dengan baik.

Kapoldasu Dukung Pengamanan Program Strategis Pelindo I MEDAN (Waspada): Kapoldasu Irjen Pol Syarief Gunawan, mendukung pengamanan program strategis Pelindo I. Yakni memperluas Terminal Peti Kemas Belawan serta pengembangan Pelabuhan Kuala Tanjung. Karena itu merupakan infrastruktur vital yang mendukung pertumbuhan ekonomi Sumut. Kapoldasu Irjen Syarief Gunawan mengegaskan hal itu saat menyambut kunjungan Direksi PT Pelabuhan Indonesia I (Persero) ke markas Kepolisian Daerah Sumatera Utara, Senin siang (04/11). Kapoldasu Syarief Gunawan, mengatakan, saat ini polisi dituntut untuk lebih membuka diri dengan dunia luar. Pihaknya akan selalu siap untuk mengamankan program-program strategis negara, termasuk programprogram strategis Pelindo I. Direktur Utama Pelindo I Bambang Eka Cahyana, dalam pertemuan itu mengharapkan

dukungan Kapoldasu terhadap program-program strategis Pelindo I. “Kami sebagai BUMN yang mengelola jasa kepelabuhanan di Sumut, saat ini ditugaskan pemerintah untuk mengembangkan Pelabuhan Belawan. Dalam waktu dekat, kami akan segera memulai pembangunan perluasan terminal petikemas di Belawan yang akan diresmikan Menteri Perhubungan dan Menteri BUMN 18 November 2013. Kami sangat mengharap dukungan Poldasu untuk kelancaran program tersebut,” kata Bambang. Dia juga berharap Kapoldasu mengamankan aset-aset Pelindo I di Belawan, terutama aset tanah dan bangunan. “Saat ini kami sedang mendata aset dan di lapangan mengalami beberapa kendala. Seperti klaim hak tanah oleh sekelompok masyarakat atas aset Pelindo I. Kami mohon bantuan Poldasu untuk pengamanan aset-aset

kami,” kata Bambang lagi. Kapolda Sumut Irjen Pol Syarief Gunawan, menyebutkan pihaknya bersedia mendukung pengamanan program strategis Pelindo I, seperti pengembangan Pelabuhan Kuala Tanjung dan Pelabuhan Belawan. “Kerjasama harus direncanakan dari sekarang untuk mencegah permasalahan-permasalahan keamanan dan kejahatan, dengan meningkatkan komunikasi dan koordinasi antara Pelindo I dan Poldasu supaya lebih bersinergi,” kata Syarief. Bambang mengharapkan bahwa kerjasama Pelindo I dan Polda bisa ditindaklanjuti dalam bentuk pendatanganan bersama nota kesepahaman. Syarief, menyambut baik usulan Bambang dan meminta agar segera disusun bentuk kerjasama tersebut. “Kami siap mendukung Pelindo I,” tegas Syarief. (m35)

Lapor ke UKP4 Sebelumnya, saat bertemu dengan para pengusaha yang tergabung dalam Kamar Dagang dan Industri (Kadin) Indonesia, di Istana Bogor, Senin (4/11), Presiden SBY meminta pengusaha yang merasa dipungli untuk melapor ke UKP4. Presiden juga mengaku terus meningkatkan fungsi UKP4 untuk dapat menyelesaikan permasalah tersebut. Presiden mengatakan, UKP4, dirasa sudah cukup mengakomodir kepentingan para pengusaha yang menghadapi permasalahan tersebut. “Dulu, saya pernah bentuk Satgas Pemberantasan Mafia. Akhirnya dikeroyok untuk dibubarkan,” tambahnya. Presiden menegaskan, selain UKP4, dirinya pun secara

langsung membuka pintu selebar-lebarnya bagi para pengusaha yang ingin melaporkan kesulitannya dalam berbisnis di Indonesia. Dia menjamin akan merespons cepat keluhan tersebut. Sebagai contoh, ada beberapa keluhan dari pengusaha yang sedang diproses di kantornya. “Dua hari ini saya terima laporan sedang diproses. Pak Sudi dan Pak Dipo, sedang cek ke instansi terkait. Apa betul atau tidak laporan tersebut. Kalau betul, tegakkan keadilan,” tegasnya. Presiden berharap, dengan upaya tersebut, iklim investasi yang baik dapat tercipta di Indonesia. Sehingga pada akhirnya pertumbuhan ekonomi dapat terjaga. (okz/vvn)

Buruh Tolak UMP Rp1,505 Juta MEDAN (Waspada): Aliansi Buruh Sumatera Utara menolak penetapan Upah Minimum Provinsi (UMP) Sumut Rp1,505 juta. Walaupun terjadi kenaikan, namun hanya sebesar 8,5 persen, dari Rp1,375 juta. Karenanya, mereka mengaku akan tetap menuntut kenaikan upah 50 persen. Presidium Aliansi Buruh Sumut, Minggu Saragih, mengatakan itu, Senin (4/11), menanggapi keputusan Pemprovsu yang menetapkan UMP 2014 Rp1,505 juta. Minggu Saragih, menyebutkan, Gubsu selaku pemegang tampuk kekuasaan tertinggi di daerah ini telah gagal dalam memberikan peningkatan kesejahteraan bagi kaum buruh. Hal ini terlihat dari kenaikan UMP Sumut yang hanya 8,5 persen, dari Rp1,375 juta menjadi Rp1,505 juta. Saragih, menyebutkan, yang lebih memprihatinkan lagi seolaholah Gubsu tutup mata terhadap pelanggaran sistem kerja kontrak. Belum lagi gagalnya Gubsu dalam memberikan jaminan ketersediaan energi di Sumut. Seperti listrik dan kelangkaan gas, serta buruknya infrastruktur. Dalam kesempatan itu, Minggu Saragih juga menyebutkan, lemahnya daya saing ekonomi Indonesia saat ini adalah kegagalan dari pemerintahan SBY-Budiono. Dimana hal itu akibat dari maraknya pungutan resmi dan pungli yang mencapai 25-40 persen dari biaya produksi, sistem birokrasi, infrastruktur yang buruk, regulasi kebijakan yang tidak melindungi dunia usaha dalam negeri. Menurutnya, kegagalan tersebut yang menyebabkan hight cost ekonomi. Di tambah lagi kegagalan pemerintah dalam menjamin ketersediaan energi seperti listrik, gas dan yang lainnya, dimana menjadi faktor utama dari lemahnya daya saing yaitu kebijakan impor yang membuat industri dalam negeri kalah bersaing. Dia mengatakan, saat ini Indonesia masih menggunakan sistem upah murah, dimana dari 189 negara di dunia, Indonesia menduduki peringkat ke 69 dengan upah murah. Sedangkan dari sisi sistem kerja saat ini, sekitar 70 persen pekerja formal di Indonesia menggunakan sistem kerja kontrak. “Khususnya di Sumut, dari 1,6 juta lebih buruh formal, 70 persen berstatus kontrak dan sebahagian besar tidak mendapatkan hak-ak normatifnya, seperti tidak menerima upah sesuai upah minimum, tidak mendapat cuti, tidak mendapat jaminan sosial, THR dan lainnya,” ujar Minggu. (m41)

Bahan Baku Berkurang, Produksi Industri Manufaktur Mikro-Kecil Menurun DPR Minta Tinjau Ulang MEDAN (Waspada): Pertumbuhan produksi industri manufaktur mikro dan kecil di Sumatera Utara triwulan III 2013 mengalami penurunan sebesar 2,73 persen bila dibandingkan dengan triwulan III tahun 2012 (yoy). Penurunan tersebut disebabkan ketersediaan bahan baku berkurang serta daya beli masyarakat yang melemah. “Ketersediaan bahan baku yang cenderung berkurang karena kurang tersedia secara memadai pada musim tertentu. Di samping itu juga daya beli sebagian masyarakat cenderung sedikit melemah yang pada gilirannya menurunkan permintaan pasar,” kata Kepala Bidang Statistik Produksi BPS Sumut Dwi Prawoto, kemarin. Beberapa industri yang mengalami penurunan produksi yaitu industri farmasi, produk obat kimia dan obat tradisional turun 16,34 persen, industri per-

cetakan dan reproduksi media rekaman sebesar 12,97 persen, industri barang galian bukan logam sebesar 6,27 persen, industri karet, barang dari karet dan plastik turun 4,37 persen, industri makanan 3,76 persen, industri kimia 3,47 persen, industri pakaian jadi turun 2,35 persen, serta industri pengolahan lainnya turun 1,01 persen. Meskipun secara umum pertumbuhan produksi industri manufaktur mikro dan kecil triwulan III 2013 mengalami penurunan, tetapi ada juga beberapa industri mengalami peningkatan yaitu jasa reparasi, pemasangan mesin dan peralatan sebesar 35,79 persen, industri pengolahan tembakau 18,50 persen, industri alat angkutan lainnya, industri furnitur, industri kulit, barang dari kulit dan alas kaki, industri kendaraan bermotor, dan beberapa lainnya. Dwi Prawoto menyebutkan,

bila dibandingkan dengan triwulan II 2013, pertumbuhan produksi industri manufaktur mikro dan kecil pada triwulan III 2013 mengalami penurunan sebesar 9,16 persen. “Penurunan tersebut disebabkan berkurangnya permintaan konsumen setelah bulan suci Ramadhan dan Hari Raya Idul Fitri serta ketersediaan bahan baku yang cenderung berkurang terutama untuk industri yang bahan bakunya bersifat musiman,” ujarnya. Jika dibandingkan dengan pertumbuhan produksi industri manufaktor mikro dan kecil nasional, di Sumut mengalami penurunan sebesar 9,16 persen, dimana nasional juga turun sebesar 4,45 persen. “Hal ini mencerminkan kinerja industri manufaktur mikro dan kecil Sumut pada triwulan III 2013 lebih rendah dibandingkan nasional,” ujarnya. (m41)

Penjualan TelkomVision JAKARTA (Waspada): Kementerian BUMN diminta untuk meninjau ulang penjualan TelkomVision kepada TP Transcorp. TelkomVision merupakan anak usaha PT Telekomunikasi Indonesia Tbk (Telkom) yang berbisnis TV berlangganan. Wakil Ketua Komisi VI DPR Erik S. Wardhana, mengatakan itu di Jakarta, Selasa (5/11). Kaanya, Menteri BUMN Dahlan Iskan, seharusnya tidak gegabah dalam memutuskan penjualan TelkomVision kepada Transcorp. Karena Komisi VI DPR sudah merekomendasikan kepada pemerintah membatalkan rencana penjualan TelkomVision tersebut. Menurut Erik, rekomendasi DPR membatalkan rencana penjualan TelkomVision karena tidak bisa menerima alasan transaksi tersebut lantaran TelkomVision terus merugi. “Dalam laporan yang kami terima, TelkomVision memang merugi. Namun kerugiannya selama 5 tahun terakhir sudah menurun. Artinya, prospeknya cerah dan masih terbuka peluang bisa meraup keuntungan, asalkan dikelola lebih baik,” katanya. Merujuk riset Media Partners Asia (2012), Indonesia diproyeksikan memiliki pertumbuhan pelanggan TV berlangganan tertinggi di Asia Pasifik sebesar 26,7 persen hingga 2016. Bandingkan dengan Thailand yang hanya separuhnya sebesar 13,6 persen, China 9,1 persen, India 7 persen, Malaysia 4,6 persen, dan Singapura 4,6 persen. Bahkan sekelas Korea dan Hongkong masing-masing diprediksi hanya tumbuh 3,4 persen dan 1,8 persen. (ant)


WASPADA Rabu 6 November 2013



08:45 Halo Selebriti 10:00 SCTV FTV Pagi 11:00 SL Liputan 6 terkini 11:03 Lanjutan FTV Pagi 12:00 SL Liputan 6 Siang 12:30 SCTV FTV Siang 14:30 SL Eat Bulaga Indonesia 16:00 Liputan 6 Terkini 16:03 Lanjutan Eat Bulaga indonesia 16:30 SL Liputan 6 Petang 17:00 Bidadari-Bidadari Surga 18:15 Si Cemong 19:45 Cinta yang Sama 21:00 Emak Ijah Pengen Ke Mekah 22:30 SCTV FTV Utama

07:00 Kisah Unggulan 08:30 Pose 09:00 Layar Unggulan 11:00 Di Antara Kita 11:30 Lintas Siang 12:00 Layar Kemilau 14:00 Top Pop 15:00 Lintas Petang 15:30 Animasi Spesial 16:30 Tuntas 17:00 Biru 18:10 Juna Cinta Juni 19:10 Cinta Itu Anugerah 20:20 Gajah Mada 21:20 Raden Kian Santang 23:00 Suka-suka Uya 00:30 Lintas Malam 01:00 Sidik

07:30 Hati Ke Hati Bersama Mamah Dedeh 08:00 Seleb @ Seleb 08:30 Scooby DooWhere AreYou 09:00 Curious George 09:30 Marsha & The Bear 10:00 Fenomania Hits 11:00 Ngobrol Asik 11:30 New Friends 12:00 Topik Siang 13:00 Seputar Obrolan Selebriti 14:00 Tom & Jerry 14:30 Bima Sakti 15:00 Curious George 15:30 Mr. Bean 16:00 Angry Birds Toon 16:30 Topik Petang 19:30 Pesbukers 20:30 Campur-Campur 21:30 RT Sukowi 23:55 Sinema Spesial

07:00 Sinema Spesial 08:30 Sinema Pagi 10:30 Live Kiss Pagi 11:30 Live Patroli 12:00 Sinema Pintu Tobat Siang 14:00 Hot Kiss 15:00 Live Fokus 15:30 Drama Korea Sore Cheongdamdong Alice 16:30 Konser Pilih Aku AFI 18:00 Drama Seri Indonesia 19:00 Sinema Indonesia : Damarwulan 21:00 Sinema Indonesia 23:00 Fokus Kasus

07:05 Bedah Editorial Media Indonesia 08:05 8 Eleven Show 11:05 Sisi Berita 11:30 Metro Siang 12:05 Road To Eagle Awards 2013 13:05 Wideshot 17:05 Metro Hari Ini 18:05 Prime Time News 20:05 Suara Anda 20:30 Healthy Living 21:05 Top 9 News 21:30 Mata Najwa 22:30 Stand Up Comedy Show 23:05 Realitas

B9 07:30 YKS Best Moment 08:30 Sinema Spesial Liburan 11:00 Insert 12:00 Bioskop Indonesia Premiere 14:00 Sketsa 14:45 Insert Investigasi 15:30 Show Imah 16:30 Reportase Sore 17:00 Sinema Indonesia Sore 19:00 Oh Ternyata 20:00 YKS 22:30 Bioskop TransTV 00:30 Harta Tahta Wanita 01:00 Reportase Malam

07:00 Apa Kabar Indonesia Pagi 09:00 Tempo Hari 09:30 Kabar Pasar 10:00 Coffee Break 11:30 Kabar Siang 13:00 Kabar Haji 2013 13:30 Ruang Kita 14:30 Kabar Pasar 15:00 Coffee Break Sore 15:30 Kabar Pemilu 16:00 Menyingkap Tabir 16:30 Sorotan Kasus 17:00 Kabar Petang 19:30 Indonesia Lawyers Club 22:30 Kabar Malam 23:30 Kabar Hari Ini

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

07:00 Spongebob Squarepants 07:30 The Penguins Of Madagascar 08:00 Thomas and Friends 08:30 Sketsa Tawa 09:30 Hot Spot 10:00 Obsesi 11:00 Buletin Indonesia Siang 12:00 Seleb On Cam 13:00 Super Hero Kocak 14:00 Unix14:30 Fokus Selebriti 15:00 Awas Ada Sule 16:00 Canda Lucu Bikin Ketawa 17:30 Spongebob Squarepants 19:00 Big Movies 21:00 Big Movies 23:30 Big Movies

07:30 Selebrita Pagi 08:00 Makan Besar 08:30 Ga Nyangka 09:00 Ups Salah 09:30 Spotlite 10:30 Warna 11:30 Redaksi Siang 12:00 Selebrita Siang 12:30 Laptop Si Unyil 13:00 Si Bolang 13:30 Dunia Binatang 14:00 Tau Gak Sih 14:30 Brownies 15:00 Jejak Petualang 15:30 Redaksi Sore 16:30 Indonesiaku 17:00 Orang Pinggiran 18:00 On The Spot 19:00 Opera Van Java 21:00 Hitam Putih 22:00 Bukan Empat Mata 23:30 Dua Dunia **m31/G

Eminem Dinobatkan Jadi Artis Tahun IniYouTube Penghargaan musik pertama YouTube menobatkan Eminem sebagai Artis Tahun Ini (Artist of the Year) meski sebagian besar penghargaan diberikan kepada para seniman belum terlalu terkenal. Dalam acara penghargaan musik ditayangkan langsung di YouTube itu Eminem tampil membawakan Rap God di New York. Namun penyanyi rap dikenal dengan kemampuan tampil mengejutkan itu tidak menjadi yang paling kontroversial dalam pertunjukan dipandu Jason Schwartzman dan komedian-musisi Reggie Watts. Peraih penghargaan yang

la-in adalah Macklemore & Ryan Lewis. Mereka mendapatkan The Breakthrough Act Award atas kesuksesan video yang mereka unggah di YouTube. Grup Korea Selatan Girls’ Generation membawa pulang penghargaan Best Video Award untuk lagu mereka I Got a Boy, mengalahkan nama-nama besar seperti Miley Cyrus, Psy, Lady Gaga, dan Justin Bieber. Video klip I Got a Boy telah ditonton lebih dari 1,9 miliar menurut blog tren YouTube. YouTube juga memberi penghargaan Best Response Award pada pemain biola Lindsey Stirling yang karirnya meni-

ngkat drastis lewat YouTube. The Phenomenon Award jatuh pada I KnewYouWere Trouble dari Taylor Swift dan Innovation of the Year jatuh pada DeStorm Power, menempati posisi ke-160 sebagai pengguna YouTube paling banyak memiliki pelanggan. Video resmi dari 10 artis yang masuk nominasi Artist of the Year ditonton nyaris 10 miliar kali dari Oktober 2012 hingga awal bulan ini. YouTube telah memposisikan diri sebagai salah satu sumber penting bagi para penggemar yang mencari video musik. Tidak seperti acara pengharga-

an lain, penyelenggaraYouTube Music Awards memisahkan nominasi dan pemenang dalam kategori usia pengguna Internet, berdasarkan banyaknya penonton, pelanggan, dan atau tingkat keterlibatan.

Rajai puncak lagu Eminem dan Rihanna meraih posisi teratas dalam tangga lagu single Inggris, menurut Official Charts Company, Minggu, membatalkan ambisi One Direction untuk mencatat single nomor satu keempatnya. Lagu duet dua penyanyi itu, The Monsters, diambil dari album baru Eminem The Mars-

hall Mathers LP 2 diluncurkan, Senin. Lagu itu langsung bertengger di posisi teratas sekalipun baru mulai dijual Selasa lalu. Lagu baru itu juga menggeser lagu nomor satu pekan lalu, Royals, milik remaja kelahiran Selandia Baru, Lorde ke tempat kedua. One Direction dan single terbaru mereka Story of my Life berada di posisi keempat. Di tangga album, Reflektor milik band indie Kanada Arcade Fire, langsung bertengger di posisi nomor satu, menggeser album Prism milik Katy Perry ke posisi kedua hanya dalam satu pekan.(ant)


Ikuti Miss Universe:

Whulandary Diminta Jaga Nama Baik Indonesia Menteri Pemberdayaan Perempuan dan Perlindungan Anak Linda Amalia Sari Gumelar berpesan kepada Puteri Indonesia 2013Whulandary Herman yang sedang mengikuti ajang Miss Universe 2013 di Moskow, Rusia menjaga nama baik Indonesia. “Dia diharapkan bisa menjaga nama baik Indonesia, norma-norma dan budaya Indonesia,” kata Linda Gumelar di Kota Bandung, Senin.

Ia mengatakan jika Puteri Indonesia 2013 telah menjaga nama baik bangsa, norma dan budaya di kontes ratu sejagad tersebut, maka keikutsertaannya dalam acara tersebut tidak perlu dipermasalahkan. “Kalau itu semua sudah dilakukan saya kira tidak perlu dipermasalahkan ya. Saya kira pemerintah sudah mewakili sikapnya, kalau saya bicara tentu sudah mewakili pemerintah ya,” kata dia.

Ajang Miss Universe 2013 digelar di Moskow akan berlangsung hingga 9 November 2013. Indonesia mengirimkan wakilnya, Puteri Indonesia 2013 Whulandary Herman dalam pemilihan tersebut. Sebelum melangkah menuju panggung final, para peserta akan mengikuti rangkaian kegiatan di Moskow antara lain di Gorky Park,Vegas Mall dan sejumlah kegiatan lain menuju final di Crocus Hall.(ant)


Putri Indonesia 2013 Whulandary mengenakan busana nasional dengan tema Reog Ponorogo karya Solo Batik Fashion saat konferensi pers jelang ajang Miss Universe 2013 di Jakarta/ant

Stewart-Pattinson Rujuk?

Deepika Padukone

Deepika Padukone Ingin Jadi Aktris Kawakan Bollywood Di Bollywood selalu disebutkan bahwa dua aktris jarang bisa bersahabat akrab, namun beda dengan Deepika Padukone dan sahabatnya aktris Esha Gupta. Keakraban keduanya diibaratkan seperti kacang dengan kulitnya. Mereka sering tampak bersama dan Esha sering memuji sahabatnya sebagai aktris dan penari yang hebat. Khususnya ketika tampil dalam film Ram Leela, Deepika menari sangat baik dan mengagumkan. Ia mengeluarkan energi besar untuk melakukan gerakan tarian itu. Kendati mendapat pujian dari temannya, aktris cantik dengan rambut tergerai indah ini tidak merasa besar kepala. Deepika Padukone lahir pada 5 Januari tahun 1986 adalah seorang aktris dan model. Kiprahnya di dunia Bollywood dimulai dalam film-film berbahasa Hindi. Deepika membuat debut akting dalam film Kannada bersama aktris Aishwarya Rai pada tahun 2006. Tahun berikutnya ia memainkan peran utama wanita dalam film drama reinkarnasi Om Shanti Om. Film ini terbukti meraup sukses besar dan memenangkan Filmfare Award untuk kategori debut wanita. Selanjutnya Deepika berperan sebagai potret wanita modern dan independen dalam beberapa film yang sukses secara komersial termasuk dalam film roman Love Aaj Kal tahun 2009, produksi komedi Housefull tahun 2010, film komedi romantis Cokctail tahun 2012 dan film komedi romantis Yeh Jawaani Hai Deewani tahun 2013 yang meraup keuntungan ketiga terbesar dalam sejarah perilisan film Bollywood. Penampilan Deepika dalam film Cocktail membuatnya meraih apresiasi dan nominasi aktris terbaik pada beberapa even penghargaan termasuk Filmfare. Aktris yang kini berusia 27 tahun ini ingin menjadi aktris kawakan Bollywood. Sekarang ini Deepika menjadi pembicaraan hangat media India karena popularitasnya di dunia akting. Nur/

Kristen Stewart balik lagi dengan Robert Pattinson yang biasa dipanggil Rob setelah pasangan ini pisah selama lima bulan. Berita gonjang-ganjing perpisahan bintang filmTwilight ini memang memenuhi media massa sejak Mei lalu. Rob dan Stewart mengakhiri hubungan percintaan mereka selama tiga tahun pada Mei lalu, secara rahasia bertemu lagi di Los Angeles pada 30 Oktober lalu dengan mobil terpisah. Rob mengenderai mobil Jeep dan Kristen membawa truk pick upnya. Mereka bertemu selama tiga jam. Kendati keduanya sudah merahasiakan pertemuan mereka, namun ada saja paparazi yang mengetahui pertemuan itu sehingga foto keduanya dan mobil yang mereka kenderai dapat dijepret sang paparazi. Pertemuan keduanya terhenti karena mereka mengetahui ada paparazi yang mengamati dan menjepret mereka. Menurut paparazi, Kristen pada kesempatan itu tidak tampak bahagia dan tidak pula memancarkan mimik wajah terkejut. Na-


mun kelihatan ia ingin bertemu lagi dengan Rob pada kesempatan yang lain. Karena mereka merasa sangat kehilangan satu dengan lainnya selama berpisah. Sebenarnya Rob masih sangat mencintai Kristen. Terbukti ketika baru-baru ini aktor ganteng itu melihat foto Kristen, Rob tersenyum dan mengatakan bahwa cewek cantik itu senang mengenakan topi baseball-nya. Seorang teman Rob mengatakan kepada bahwa aktor itu selalu bertanya tentang Kristen secara sembunyi-sembunyi karena ia tidak ingin orang-orang tahu bahwa ia masih mencintainya. “Kami mengetahui rencananya untuk bertemu dan menggunakan cara-cara pendekatan dengan apa-apa yang disenangi Kristen selama mereka pacaran,” kata sumber terdekat dengan Rob. Sumber menambahkan, Rob ingin bersama Kristen lagi dan menggunakan boneka kesayangan Bear dan Bernie untuk mendekati Kristen.

Rob ingin bertemu lagi dengan mantan pacarnya. Reuni kedua bintang ini terjadi ketika Rob sudah menyelesaikan syuting film Queen of the Desert di Maroko. Kedua bintang ini membutuhkan waktu untuk bisa saling memahami. Memang Rob pernah marah dengan Kristen karena isu mantan kekasihnya mulai melirik Rupert Sanders sutradara film Snow White & The Huntsman. Selama lima bulan belakangan ini Rob berusaha mencoba melupakan Kristen dengan berbagai cara seperti akrab dengan Katy Perry, Dylan Penn dan Riley Keough. Rob juga menandatangani kontrak beberapa film macam The Rover dan Mission: Blaclist. Ia juga menggelar pesta-pesta di Chateau Marmont, Soho House dan The Viper Room. Sementara Kristen masih setia, ia belum pernah mencoba menggantikan Rob dengan lakilaki lain selama berpisah. Aktris cantik ini dinilai setia dengan Rob meskipun ia kecewa disakiti Rob. Nur

Robert Pattinson dan Kristen Stewart/

Penyelenggaraan Festival Film Indonesia (FFI) 2013 yang malam puncak penganugerahan Piala Citra digelar di Semarang – JawaTengah, 6 – 7 Desember mendatang, harus lebih sukses dan semarak dibandingkan tahun-tahun sebelumnya. Harapan itu disampaikan Menparekraf Mari Elka Pangestu saat meninjau proses penjurian film peserta FFI tahun ini di Gedung Film Jl MT. Haryono – Jakarta Selatan, baru-baru ini. “Dengan telah terdaftarnya 43 film bioskop terbaik dari seratus lebih diputar di bioskop, plus 55 film pendek, 65 film televisi, 68 judul dan peserta film animasi yang mengejutkan hingga 81 judul serta kesiapan 31 dewan juri kapabel di bidangnya untuk bekerjas keras, FFI tahun ini harus lebih sukses dan semarak dari penyelenggaraan sebelumnya,” harap Mari Elka Pangestu kepada wartawan di Jakarta. Menparekraf didampingi Sekjennya Ukus Kuswara serta

Ketua Panpel FFI 2013 Firman Bintang dan Armain Firmansyah menambahkan, sejalan denganTagline“Bersama Kita Bisa, Majukan Film Indonesia”, katgori film animasi yang baru pertama kali digelar, untuk melengkapi kategori lainnya – ternyata banyak diminati para kreatornya hingga 81 peserta. “Berkat adanya kategori animasi, kedepan film karya anak Bangsa dengan karaker asli Indonesia, berpotensi dijual ke manca negara bersama film layar lebar nasional. Kemenparekraf kini tengah giat melobi agar film karya sineas dan kreator animasi nasional bisa mulai go international,” terang Mari Pangestu. Ketua Panpel HM. Firman Bintang optimis FFI di Semarang bakal berjalan sukses dan semarak dengan hadirnya artisartis tua dan muda. “Berkat pendekatan khusus dengan para produser agar mereka berperan lebih aktif termasuk meliburkan syuting film/si-

netron pada puncak FFI 6 – 7 Desember nanti, ratusan artis ternama baik muda dan tua sudah konfirmasi akan membanjiri kota Semarang. Dengan begitu, FFI tahun ini dipastikan jauh lebih semarak,” jamin Firman yang juga Ketua Umum Persatuan Produser Film Indonesia (PPFI). Persaingan Piala Citra Berdasarkan hari terakhir penutupan peserta FFI 2013, terdaftar 43 film bioskop akan bersaing ketat. Diantara yang berpotensi merebut penghargaan paling bergengsi – Piala Citra yakni film nasional terlaris tahun 2012 Habibie & Ainun produksi MD Pictures dan 5 CM produksi Soraya Intercine Film. Kedua film ini bakal bersaing ketat dengan beberapa film terlaris 2013 seperti Cinta Brontosaurus (Kharisma Starvision), Coboy Junior (Falcon Pictures) dan Sang Kiai (Rapi Film). * (AgusT)

Menparekraf Mari E Pangestu (tengah) didampingi Sekjen Ukus Kuswara dan Ketua Panpel FFI 2013, HM Firman Bintang Memberi Keterangan Pers

Jackie Chan Dukung Penghentian Perdagangan Hewan Langka Superstar aksi Hong Kong Jackie Chan bergabung dengan Gambling on Extinction rumah produksi Kanada-Jerman guna berjuang melawan pembantaian gajah yang diburu untuk diambil gadingnya. Pembuatan film dokumentasi Real to Reel sekaligus bertujuan menginvestigasi sekaligus menghentikan perdagangan ilegal hewan-hewan langka dan dilindungi termasuk gading gajah, tanduk badak dan bagian tubuh harimau. “Setiap orang harus menghentikan mitos bahwa gading gajah, tanduk badak atau bagian tubuh harimau memiliki kekuatan supranatural dan keunikan lainnya. Ini sungguh tidak benar jika gajah diburu dan dibunuh untuk mendapatkan gadingnya. Satusatunya cara untuk menghentikan pembantaian adalah usahausaha menghentikan peminat bagian tubuh hewan langka itu ,” ujar Jackie Chan. Sementara produser film dokumenter Anne Pick menyatakan kegembiraannya atas kepeduliaan Jackie dalam usaha melindungi hewan langka dari perburuan orang-orang yang tidak bertanggung jawab dan hanya mengutamakan kepentingan sendiri. Keterlibatan aktor top Hong Kong itu diharapkan dapat menarik perhatian masyarakat dunia akan pentingnya melindungi hewanhewan langka. Gambling on Extinction juga mensponsori sutradara film dokumenter Jakob Kneser mengadakan perjalanan ke hutanhutan Afrika dan Asia tenggara untuk mendokumentasikan secara langsung perburuan terhadap hewan-hewan langka yang dilindungi. Nur/thr

Jackie Chan/

Aceh B10 BC Langsa Sita Ribuan Slop Rokok LANGSA (Waspada): Kantor pengawasan dan Pelayanan Bea dan Cukai tipe Pratama Kuala Langsa menyita 25 bal rokok ilegal (sekira 1.000 slop) merk Sakura Indonesia asal Jawa yang tidak terdaftar di bea cukai (tanpa cukai) melalui paket bus yang dikirim melalui truk colt BL 8512 Y jasa armada Medan untuk dikirim ke Takengen di Titi Kembar, Langsa Timur, Selasa (5/11) sekira pukul 03:00. Informasi yang diperoleh wartawan di lapangan, rokok

berasal dari Pulau Jawa ini dikirim melalui paket bus tujuan Medan, selanjutnya dikirim kembali ke Takengen dengan tujuan atas nama Safwan Umar yang dibawa melalui jasa pengiriman armada di Medan. Rokok sitaan tanpa terdaftar di bea cukai itu berjumlah 25 bal, di mana masing-masing bal terdapat 2 tim rokok, kemudian masing-masing tim terdapat 20 slop rokok bermerk Sakura Indonesia, yang tidak terdaftar di Bea Cukai. Dalam 1 slop rokok setiap bungkusnya label harganya berbeda-beda. Sementara ketika dikonfirmasi wartawan ke kantor Pengawasan dan Pelayanan Bea dan Cukai tipe Pratama Kuala Langsa,

Warga Medan Terombangambing Di Laut LANGSA (Waspada): Warga Jalan Pancing, Kota Medan, Asnawi alias Pak Roy, 50, sempat dinyatakan hilang saat memancing karena mesin perahunya kehabisan bensin, Minggu (3/ 11), akhirnya ditemukan warga selamat di perairan laut Kuala Bayeun, Aceh Timur, Senin (4/11). Koordinator Basarnas Pos Langsa, Chairul Nova melalui Dantim,Rizki Hidayat, kepada wartawan mengatakan, korban ditemukan tim terdiri dari Basarnas, Pol Air Polres dan Polsek Rantau Seulamat Polres Langsa, serta nelayan Desa Bayeun, yang melakukan pencarian sejak Senin (4/11) subuh. Dikatakan Chairul, korban Asnawi, ditemukan dalam kondisi lemas karena kehabisan stok makanan. “Saat itu Pak Roy, pergi memancing berangkat melalui Cafe Apung, Dusun Kongseng, Desa Bayeun menyewa perahu mesin. Namun tiba-tiba perahu itu kehabisan bensin, dan ia tak dapat kembali lagi ke darat. Sejak itulah perahu yang ditumpanginya terombang-ambing terbawa arus air pasang surut laut. Kini korban telah diserahkan kepada keluarganya. (m43)

Lamban Proses PAW, Perburuk Kinerja DPRK Aceh Tengah TAKENGEN (Waspada): Lambannya proses usulan Pergantian Antar Waktu (PAW) yang digodok DPRK Aceh Tengah menambah buruknya kinerja legislatif ini di mata masyarakat. Hal tersebut seperti yang dikatakan Irvan Rasyid,Wakil Ketua Partai Persatuan Pembangunan (PPP), Senin (4/11), di ruang sidang DPRK Aceh Tengah saat menghadiri paripurna istimewa DPRK Aceh Tengah, pelantikan Dasaluddin dari Partai Persatuan Pembangunan sebagai PAW DPRK Aceh Tengah menggantikan Umar, periode 2009-2014. “Usulan PAW yang kami usulkan kepada DPRK Aceh Tengah sudah sejak satu setengah tahun lalu, artinya kinerja dewan yang kami pertanyakan. Apakah mereka sungguh-sungguh dalam melakukan proses PAW atau lainnya. Tapi Alhamdulillah dengan pengawalan ketat proses PAW juga terlaksana,” tutur Irvan.’ Dia menambahkan, proses PAW ini cukup lama kami kawal dan melelahkan. “Kami berharapa masyarakat tidak curiga dengan pengurus PPP, karena kita tidak main-main jika menindak anggota dewan dari PPP yang melanggar, kemudian berujung kepada PAW. Lambannya proses ini adalah murni di DPRK, bukan pada pengurus partai,” ujarnya. Sementara sidang paripurna ini dipimpin Ketua DPRK Aceh Tengah Zulkarnain. “Terkait lambannya proses PAW tersebut, Zulkarnaen hanya mengatakan semua proses sudah dijalankan dan butuh waktu,” katanya. Begitu juga dengan sambutan Gubernur Aceh Zaini Abdullah, dibacakanWakil Bupati Aceh Tengah Khairul Asmara. Dalam pidatonya dijelaskan, PAW ini telah sesuai mekanisme dan sesuai kewajaran sehingga semua pihak dapat menerima proses ini. (b33/b32)

Penerimaan CPNS Untungkan Masyarakat BLANGKEJEREN (Waspada) : Terhitung sejak dibukanya penerimaan CPNSD, hingga memasuki tahapan ujian tes tertulis yang digelar kemarin, diperkirakan miliaran rupiah beredar di masyarakat. Demikian dikatakan Bupati Gayo Lues, Ibnu Hasim, Minggu (3/11) ketika mengunjungi beberapa lokasi ujian CPNSD. Dikatakan, Pemkab Gayo Lues telah menganggarkan dana sekira Rp1,8 miliar untuk rekrutmen CPNSD, secara individu Pemkab bisa dikatakan rugi, namun secara makro untuk masyarakatnya sangat menguntungkan, karena perputaran uang langsung dirasakan masyarakat, sejak awal proses penerimaan CPNS di Gayo Lues. Untuk itu, bupati berharap ke depan, untuk kepentingtan kesejahteraan masyarakat tidak saja melalui penerimaan CPNS, tetapi harus memikirkan peluang-peluang baru, seperti eveneven besar kebudayaan misalnya seperti Tari Saman, Bines dan lainnya. Leman, salah satu pengusaha fotocopy mengaku telah meraup keuntungan Rp40 juta sejak dibukanya penerimaan CPNS, ditambah dengan penyediaan jasa penginapan di rumahnya. Karena memang diakui, jasa penginapan seperti hotel, losmen dan lainnya tidak mencukupi untuk menampung para pelamar sehingga para warga yang mengambil kesempatan itu sengaja membuka jasa penginapan, dengan tarif sederhana. Yanto, salah satu pelamar CPNS, memuji Pemerintah Kabupaten Gayo Lues, yang telah berusaha semaksimal mungkin memfasilitasi kebutuhan para pelamar, mulai dari pemasangan tenda-tenda posko info lokasi ujian, hingga tenda-tenda penampungan para pelamar CPNS. Pantauan wartawan, Minggu (3/11) sore, ribuan pelamar dari luar daerah usai melaksanakan ujian test tertulis CPNS, mereka langsung pulang ke daerah masing-masing. (cjs)

Tiba (light, asal, waktu)

seluruh staf enggan memberikan komentarapapunterkaitpenangkapan tersebut. Padahal wartawan sudah dua jam menunggu untuk meminta keterangan. “Sebentar lagi bang, bapak masih menelepon, belum bisa diganggu,” ujar salah seorang petugas satpam ketika wartawan menanyakan Kepala Bea cukai Langsa. Hasil pantauan wartawan di lapangan, truk colt BL 8512 Y terpakir di halaman kantor Bea Cukai, sementara rokok ilegal sudah dipindahkan ke dalam kantor setempat dalam kondisi terbuka. Begitu juga halnya sopir truk sedang duduk-duduk di halaman kantor Bea Cukai setempat. (m43)


TRUK colt BL 8512 Y jasa armada Medan yang digunakan untuk mengangkut rokok ilegal untuk dikirim ke Takengen yang ditangkap di Titi Kembar, Langsa Timur terparkir di halaman kantor Bea Cukai Langsa, Selasa (5/11)

mudah putus asah. “Kegagalan adalah awal dari kesuksesan, jangan mudah menyerah bila gagal atau bangkrut saat menjadi pengusaha, tetapi harus bangkit dan terus beru-aha lagi,” ujar pengusaha sukses ini. Ia juga menceritakan kisah sejarah jatuh bangun saat pertama menjadi pengusaha. “Saya berulang kali mengalami ke-

bangkrutan saat menjadi pengusaha, namun dengan tekad keyakinan dan modal kejujuran saya bisa bangkit dan sukses,” papar orang nomor satu dalam Partai Golkar ini. Aburizal Bakrie juga sempat menyantuni 44 anak yatim dan memberikan hadiah kepada siswaberprestasiusaiceramahmotivasikepadaseribuansiswa.(cb01)

Pegunungan Gayo Lues Diduga Miliki Ladang Ganja IDI (Waspada): Pasca tertangkapnya dua tersangka agen ganja bersama 20 kilogram barang bukti di daerah aliran sungai (DAS) Simpang Jernih menjadi perbincangan hangat. Setelah kedua tersangka mengakui ganja tersebut berasal dari Gayo Lues, sejumlah pihak menduga pegunungan Blangkejeren, Kabupaten Gayo Lues memiliki ladang ganja. “Kita terus mengikuti perjalanan kasus penangkapan dua tersangka ganja di wilayah timur Provinsi Aceh. Sesuai pengakuan kedua tersangka menguat-

kan dugaan bahwa 20 kilogram ganja tersebut berasal dari pegunungan Gayo Lues, apalagi salah satu tersangka beralamat di Gayo Lues,” kata Direktur Yayasan Advokasi Rakyat Aceh (YARA) Safaruddin, Selasa (5/11). Guna mendukung kerja Polres Aceh Timur dalam mengungkap kasus ganja hingga tuntas, Safaruddin mendesak Kapolda Aceh membentuk tim khusus. Tim yang melibatkan Polres Aceh Timur dan Gayo Lues nantinya akan menelusuri pegunungan Gayo Lues, baik melalui Blangkejeren (Gayo

Lues) atau melalui pegunungan Lokop (Aceh Timur) sehingga dugaan ladang ganja di pegunungan Gayo Lues terjawab,” kata Safaruddin. Sebagaimana diketahui, Polsek Simpang Jernih menyita 20 kilogram ganja, Sabtu (2/11). Bersama barang bukti, petugas juga menangkap dua tersangka yakni berinisial, BH Bin Is, 25, asal Desa Pinding, Gayo Lues. Sementara temannya berinisial ME Bin SB, 28, asal Desa Ranto Bintang, Kecamatan Bandar Pusaka, Aceh Tamiang mengaku ganja tersebut berasal dari Gayo Lues. (b24)

KUALASIMPANG ( Waspada) : Oknum Komisioner (anggota) Panitia Pengawas Pemilihan Umum (Panwaslu) Aceh Tamiang yang menangani Divisi Pelanggaran Pemilu berinitial, AB diduga memiliki Kartu Tanda Penduduk (KTP) ganda yang diterbitkan Pemko Medan dan Pemkab Aceh Tamiang. Pasalnya berdasarkan informasi, Senin (4/11), Komisioner Panwaslu Aceh Tamiang itu juga terdaftar sebagai pemilih tetap pada Pemilu Legislatif 2014 di TPS-17 Kelurahan Tanjung Rejo, Medan, Sumatera Utara.

Selain itu, AB juga terdaftar sebagai pemilih pada Pemilu Legislatif di TPS-1 Desa Upah, Kecamatan Bendahara, Aceh Tamiang . Berdasarkan data tersebut patut untuk diduga kuat oknum komisioner PanwasluAceh Tamiang itu memiliki KTP Ganda dan diduga terindikasi melanggar Undang-Undang Kependudukan Tahun 2009. Direktur Eksekutif LembAHtari, Sayed Zainal menyatakan, pihaknya sudah melayangkan surat somasi yang ditujukan kepada oknum AB supaya

segera mengundurkan diri sebagai anggota Panwaslu. AB terkait dengan tudingan desas-desus yang ditujukan kepadanya itu ketika ingin dikonfirmasi, Senin (4/11) sedang tidak masuk kantor dan disebutsebut sedang pergi ke Medan ada urusan penting. Ketua Panwaslu Aceh Tamiang, Saiful Alam menyatakan, persoalan anggota Panwaslu Aceh Tamiang mempunyai KTP ganda sudah dilaporkan kepada Bawaslu Aceh untuk disikapi. (b23)

Terlilit Utang, Pasutri Mencuri Lembu ALUE IE PUTEH ( Waspada): Sepasang suami istri yang baru sekitar dua bulan menikah, terlibat pencurian induk dan seekor anak lembu di Kilometer XI Jalan Bireun-Takengon, Desa Teupin Mane, Kec. Juli, Bireuen, Selasa (5/11) sekitar pukul 01:30. Si istri, Nwt, 29, warga Desa Panggoi, Kec. Muara Dua, Lhokseumawe dan rekannya Msb bin Us alias Bulek, 30, asal Dusun Keramat Jaya, Kec. Bandar, Bener Meriah, ditangkap polisi saat hendak menjual induk lembu yang sudah disembelih, di Pasar Alue Ie Puteh, Kec. Baktiya, Aceh Utara, sekitar 8 jam kemudian. Sementara si suami, Mr bin Jr alias Hr, 41, asal Desa Batang Nangka Ishak,Takengon, Aceh Tengah, berhasil kabur dan dinyatakan buron. “Saat petugas menangkap Nwt dan Msb, Mr sedang ke kamar kecil di komplek pasar sehingga sempat melarikan diri,” kata Kapolres Aceh Utara AKBP Gatot Sujono mela-

lui Kapolsek Baktiya Iptu Zulfitri. Sesuai pengakuan Nwt, lanjut Kapolsek, sebelum melakukan aksinya, pasutri yang masih dalam masa bulan madu itu sedang dalam perjalanan pulang ke Lhokseumawe dari kampung si suami, Desa Batang Nangka Ishak, Takengon. Mereka pulang dengan menggunakan mobil rental jenis Avanza silver, BK 1317 KQ. “Setiba di kawasan Cot Panglima, Bireun, sekitar pukul 01:30, tersangka Msb yang tadinya dalam perjalanan ke arah Takengen turun dari Mopen L 300, lalu naik ke mobil Avanza yang dikendarai Mr. Tak lama kemudian, aksi pencurian terjadi. Eksekutor utamanya Mr. Yang induk disembelih dulu dengan parang, sementara anaknya langsung dimasukkan ke bagian belakang mobil, hiduphidup,” imbuh Kapolsek. Dalam perjalanan pulang, sambung Iptu Zulfitri, anak lembu yang baru sebesar kam-

bing dewasa tersebut, diturunkan di rumah orang tua Nwt, di Desa Panggoi, Kec. Muara Dua, Lhokseumawe. Sedangkan induknya, yang sudah disembelih, langsung dibawa ke pasar Alue Ie Puteh, Baktiya, untuk dijual. “Kebetulan, saat itu kita sedang melakukan pengamanan di jalan Medan-Banda Aceh, karena di Masjid Alue Ie Puteh, ada zikir akbar tahun baru Islam. Petugas curiga melihat ceceran darah di bumper belakang mobil tersangka dan langsung mengikutinya hingga ke pasar,” ujar Kapolsek. Kedua tersangka berikut barang-bukti akan diserahkan ke pihak Polsek Juli Bireun, karena tempat kejadian perkara (TKP) di sana. Tersangka Nwt, sebelumnya mengaku nekat mencuri lembu tersebut karena ia dan suaminya terlilit utang Rp12 juta dengan seorang anggota TNI yang bertugas di wilayah timur Aceh Utara. (b19)

07:05 10:45 14:50

GA 0279 Medan GA 0143 Medan/Jakarta GA 0147 Medan/Jakarta

07:45 11:3 0 15:45

11:35 15:55 21:30

JT 397 Medan/Jakarta JT 307 Jakarta JT 305 Medan/Jakarta

06:00 12:15 16:35


SJ 011 Medan/Jakarta


12:00 11:20

QZ 8022 Medan AK 1306 Kuala Lumpur*

12:25 11:45


FY 3400 Penang*


Sriwijaya Air SJ 010 Jakarta/Medan

Air Asia QZ 8023 Medan AK 1305 Kuala Lumpur *

Fire Fly FY 3401 Penang* * Setiap Senin, Rabu, Jumat dan Minggu.

ber 2013. Dalam kesempatan itu, bupati juga berharap dukungan dari UIN Ar-Raniry dan semua pihak agar Sekolah Tinggi Agama Islam (STAI) Teungku Dirundeng dapat mengikuti jejak UIN Ar-Raniry. “Untuk menuju ke arah itu kami mengharapkan dukungan dan kerjasama lembaga pendidikan lain terutama UIN Ar-Raniry baik terkait dengan tenaga pengajar maupun dengan kegiatan-kegiatan lain,” ujar Haji Tito. Rektor UIN Ar-Raniry Farid Wajdi Ibrahim mengatakan, kegiatan Raker tersebut membahas program kerja UIAN Ar-Raniry selama satu tahun untuk tahun 2015 mendatang, selain itu peserta juga mengevaluasi program kerja yang telah terealisasi selama setahun sebelumnya. (b07)

Banda Aceh Peringkat Pertama Terbaik Keterbukaan Informasi BANDA ACEH (Waspada): Berdasarkan evaluasi Komisi Informasi Aceh (KIA) terkait keterbukaan informasi publik, Kota Banda Aceh berada pada peringkat satu kategori kepatuhan terhadap penyediaan informasi berkala dan kategori penyediaan informasi yang tersedia setiap saat. Sementara di jajaran pemerintah Aceh kategori kepatuhan terhadap penyediaan informasi berkala peringkat satu Dishubkomintel Aceh, dan kategori ketersediaan informasi setiap saat peringkat satu Badan Pemberdayaan Perempuan dan Perlindungan Anak Aceh. “Semua pemerintah kabupaten/kota di Aceh mempunyai website, sedangkan di jajaran Pemprov Aceh masih ada 10 SKPA yang belum mempunyai website dan enam lain masih dalam perbaikan,” ungkap Afrizal Tjoetra, Senin (4/11) di Anjong Monmata, Banda Aceh. Sedangkan 37 SKPA, kata Ketua KIA Aceh ini, sudah mempunyai website yang aktif. “Evaluasi ini bukan bermaksud mencari kesalahan, tapi untuk memastikan kepatuhan badan publik melaksanakan Undang-Undang Keterbukaan Informasi Publik,” tutur Afrizal Tjoetra Gubernur Aceh pada anugerah keterbukaan informasi publik rangkaian peringatan Hari Hak Untuk Tahu 2013 itu, mengatakan, pemberian penghargaan ini sebagai upaya menegur

lembaga yang belum menerapkan semangat transparansi dan keterbukaan informasi publik. “Jajaran pemerintahan selayaknya menjadi motor penerapan undang-undang keterbukaan informasi publik. Jadi seluruh jajaran birokrasi mempunyai kewajiban membuka akses informasi kepada masyarakat, kecuali untuk informasi yang dikategorikan bersifat rahasia,” katanya. Gubernur dalam sambutan yang dibacakan staf ahli Gubernur bidang Pemerintahan, Zulkifli Ahmad menjelaskan, informasi rahasia itu ada kategori-kategori tertentu. “Bagi jajaran pemerintahan, sebenarnya informasi yang sifatnya rahasia sangat sedikit,” tegasnya. Hasil evaluasi KIA kepada pemerintah kabupaten/kota untuk kategori informasi berkala, peringkat satu Kota Banda Aceh, dua Pidie Jaya, dan tiga Aceh Selatan. Kategori informasi yang tersedia setiap saat, peringkat satu Kota Banda Aceh, dua Aceh Singkil dan tiga Pidie Jaya. Untuk SKPA, kategori informasi berkala peringkat satu Dishubkomintel, dua Badan Investasi dan Promosi Aceh, tiga Disperindagkop dan UKM Aceh. Kategori ketersediaan informasi setiap saat peringkat satu Badan Pemberdayaan Perempuan dan Perlindungan Anak Aceh, dua Bapedal Aceh, tiga Badan Investasi dan Promosi Aceh. (b06)

Waspada/Muhammad Zairin

WAKIL WALI Kota Banda Aceh Illiza Sa’aduddin Jamal menerima penghargaan penyediaan informasi pubik terbaik untuk pemerintah kabupaten/kota di Aceh, yang diserahkan staf ahli Gubernur Bidang Pemerintahan, Zulkifli Ahmad, Senin (4/11)di Anjong Monmata, Banda Aceh

Panwaslu Aceh Tamiang Bersihkan Alat Peraga KUALASIMPANG (Waspada): Panwaslu Kabupaten Aceh Tamiang melakukan penertiban terhadap baleho atau alat peraga kampanye Pemilu Legislatif 2014 yang dipasang parpol atau calon anggota legislatif di Kota Kualasimpang yang tidak sesuai Peraturan KPU Nomor 15 Tahun 2013, Senin (4/11). “Nanti semua baleho atau alat peraga kampanye caleg yang yang tidak sesuai Peraturan KPU Nomor 15 tahun 2013 akan kita bersihkan

semuanya di 12 kecamatan dan 213 kampung,” jelas Ketua Panwaslu Kabupaten Aceh Tamiang, Saiful Alam melalui komisioner Panwaslu Lindawati yang bertugas menangani Divisi Pengawasan Pemilu 2014. Lindawati menyatakan, Panwaslu Aceh Tamiang mulai melakukan pengawasan penertiban alat peraga kampanye. Penertiban dilaksanakan melibatkan Satpol PP sesuai dengan Peraturan KPU Nomor 15 Tahun 2013.(b23)

Pawai Ta’aruf Meriahkan Tahun Baru Islam IDI (Waspada): Pawai ta’aruf dengan berkonvoi kendaraan mulai dari Julok hingga ke Birem Bayeun menjadi agenda rutin Majelis Ulama Nanggroe Aceh (MUNA) dalam memeriahkan Tahun Baru Islam 1435 Hijriah, Selasa (5//11). Sementara Pemkab Aceh Timur yang dimotori Bagian Keistimewaan Aceh menggelar pawai taaruf terhadap pelajar di Aceh Timur dengan berjalan kaki mengelilingi Kota Idi. Kedua pawai taaruf tersebut dilepas Bupati Aceh Timur Hasballah M Thaib dihadiri unsur muspida plus. Kegiatan pawai taaruf dipusatkan di halaman Masjid Nurul Izzah, Kecamatan Julok. Seluruh pengurus MUNA di kecamatan membawa peserta pawai menggunakan mobil pickup. “Kegiatan ini rutin kita laksanakan setiap menyambut Tahun Baru Islam,” kata Ketua MUNA Aceh Timur, Ahmad Mustafa didampingi sekretarisnya, Agus Khadafy. Bupati Aceh Timur meminta umat Islam

khususnya di Aceh Timur untuk memanfaatkan momentum Tahun Baru Islam untuk mengintrospeksi diri sebagai wujud perubahan menuju ke arah yang lebih baik, terutama akhlakul karimahnya dan ibadahnya. “Sehingga pada akhirnya momentum 1 Muharam menjadi cikal bakal perubahan dalam sikap dan tingkah laku sehari-hari, baikantaramuriddenganguruataupunantaraanak dengan orangtua,” jelas Hasballah M Thaib. Pawai ta’aruf yang dilaksanakan Pemkab Aceh Timur juga berlangsung meriah. Namun para peserta berasal dari sekolah di Aceh Timur yakni SD/MI, SMP/MTs dan SMA/SMK/MA, berbeda dengan pawai yang diselenggarakan MUNA. Pawai yang melibatkan pelajar tersebut hanya berjalan kaki mengelilingi Kota Idi. Ribuan orangtua siswa dan masyarakat di Aceh Timur tumpah ruah ke lokasi acara pawai yang dilepas Bupati Aceh Timur dan dipusatkan di halaman pendopo Idi. (b24)

DPRK Singkil Terima PAPBK 2013

Berangkat (light, tujuan, waktu)

Lion Air JT 304 Jakarta JT 306 Jakarta/Medan JT 396 Jakarta/Medan

UIN Ar-Raniry Diminta Bangun Pendidikan Barsela

Anggota Panwaslu Diduga Miliki KTP Ganda

Garuda Indonesia GA 0278 Medan GA 0142 Jakarta/Medan GA 0146 Jakarta/Medan

Rabu 6 November 2013

ACEH BARAT (Waspada): PemKAB Aceh Barat berharap Universitas Islam Negeri ArRaniry melaksanakan perannya yang strategis. Peran itu adalah membangun pendidikan masyarakat Aceh, khususnya wilayah Barsela (Barat Selatan Aceh). “Terkait dengan dunia pendidikan, khususnya di Barsela, kampus UTU sebagai kampus Jantong Hate Masyarakat Barat Selatan Aceh akan menjadi kampus negeri, untuk itu kami mohon dukungannya,” ujar Bupati Aceh Barat T Alaidinsyah. Bupati mengatakan itu pada kegiatan Rapat Kerja UIN Ar-Raniry tahun 2013, Senin (4/11) di Hotel Meuligoe Meulaboh Aceh Barat. Raker akan berlangsung 4 sampai 7 Novem-

Aburizal Ceramah Motivasi Di SMK 1 Nagan Raya NAGAN RAYA (Waspada): Ketua Umum DPP Partai Golkar Aburizal Bakrie pada kunjungannya ke Nagan Raya, Selasa (5/11) memberikan ceramah motivasi di hadapan siswa SMK Nagan Raya. Aburizal mengajak para siswa untuk menjadi pengusaha, karena akan menuai kesuksesan bila berusaha secara sungguh-sungguh dan tidak



KAPOLSEK Baktiya Iptu Zulfitri (kiri) diabadikan bersama tersangka kasus pencurian lembu, Msb dan Nwt beserta barang bukti, di halaman Mapolsek Baktiya, Selasa (5/11)

SINGKIL UTARA (Waspada): Tiga fraksi DPRK Aceh Singkil menerima dan menyetujui Rancangan Qanun (Raqan) Perubahan APBK 2013 menjadi Qanun melalui sidang paripurna dewan, Senin (4/11) di ruang utama DPRK Kampung Baru, Singkil Utara. Pendapat akhir dari ketiga fraksi itu masingmasing Fraksi Golkar dan Fraksi Keadilan disampaikan ketua fraksinya Budi Hendrawan dan Mairaya, sedang Fraksi Reformasi disampaikan Taufiq. Sidang yang dipimpin ketua DPRK Putra Ariyanto dihadiri Bupati Safriadi dan unsur muspida, kepala SKPK serta pejabat terkait. Angka PAPBK 2013 Aceh Singkil tercatat Rp474. 569. 883. 293 bertambah sebesar Rp11. 725. 672.449, dari APBK sebelumnya yang hanya Rp462.844.210.794. Pada pendapat akhir fraksi itu, dua fraksi memberikan catatan terkait PAPBK 2013,

masing-masing Fraksi Keadilan melalui Mairaya me-nyoroti sejumlah paket proyek fisik di lapangan tanpa papan nama sehingga publik menilai itu sebagai proyek siluman. Fraksi Keadilan juga meminta pelaksanaan ujian CPNSD agar berjalan transfaran dan bersih serta pencairan dana tambahan sebesar Rp760 juta dengan total Rp1,8 miliar dari alokasi awal Rp1,2 miliar untuk biaya kegiatan pada Pekan Kebudayaan Aceh (PKA) harus dilakukan audit internal terlebih dahulu. Sedangkan pendapat akhir Fraksi Reformasi yang disampaikan Taufiq, menyoroti pembangunan pelabuhan Cruid Palm Oil (CPO) di Pulo Sarok Singkil, fraksi ini menyayangkan sikap eksekutif yang tidak pernah mengekspose kegiatan tersebut di DPRK. “Kita menyayangkan eksekutif yang tidak pernah mengekspose kegiatan tersebut di DPRK,” tegas politisi PDIP itu. (b27)


WASPADA Rabu 6 November 2013

B11 Penahanan Mantan Bupati Bireuen Ditangguhkan

Parlementaria DPR Kota Banda Aceh

BIREUEN (Waspada): Mantan Bupati Bireuen Nurdin Abdul Rahman, 64, yang ditahan Polres Bireuen sejak Jumat (1/11) yang diduga terlibat kasus tindak pidana korupsi Rp1,6 miliar sudah ditangguhkan penahanannya, Senin (4/11). Berikut penangguhan juga bagi dua mantan direktur dan bendaharawan RSUD Dr Fauziah, masing-masing, Yurizal, 46, Kadinkes Bireuen Chandra, 49, staf fungsional medis RSUD Dr Fauziah dan Isfanni, 32, mantan bendaharawan RSUD Pengacara Nurdin Abdul Rahman Cs, M Ali Ahmad menjelaskan, Selasa (5/11), penahanan mantan bupati Nurdin Abdul Rahman dan tiga tersangka lainnya dengan dugaan korupsi Rp1,6 miliar tidak tepat, karena itu kasus perdata. Pasalnya, tersangka Nurdin Abdul Rahman meminjam uang sebanyak Rp1,6 miliar sewaktu masih menjabat Bupati Bireuen 2007-2012 dari BLU RSUD Dr Fauziah, bukan untuk kepentingan pribadi, akan tetapi untuk kepentingan operasional Pemkab Bireuen, biaya Ruislah tukar guling tanah Yonif-113/JS dan pembayaran gaji pemain PSSB Bireuen. Peminjaman uang surplus pendapatan BLU RSU Dr Fauziah sesuai mekanisme PP No.61/ tahun 2007 dibenarkan untuk investasi atau utang piutang. Konon lagi sebagian besar dari pinjaman Nurdin Abdul Rahman senilai Rp1,4 miliar sudah dibayarkan melalui penyerahan tanah warisan untuk dijual Pemkab Bireuen melalui Majelis Pertimbangan Tuntutan Ganti Rugi. Pihak mantan Direktur RSUD Dr Fauziah Yurizal, dr Chandra dan bendaharawan Isfanni memberikan uang surplus BLU RSUD Dr Fauziah atas dasar surat permintaan resmi Bupati Bireuen saat itu dijabat Nurdin Abdul Rahman. Penetapan keempat tersangka terlibat tin-

Dewan Godok RAPBK Banda Aceh TA 2014 Rp1 Triliun Menjelang akhir tahun 2013, DPR Kota Banda Aceh sedang giat-giatnya menggodok dan membahas Rancangan Qanun (Raqan) APBK Banda Aceh Tahun Anggaran (TA) 2014 sebesar Rp1 triliun lebih. RAPBK Banda Aceh TA 2014 sebesar Rp1 triliun itu telah diserahkan secara resmi oleh Wali Kota Banda Aceh diwakili SekdakotT SaifuddinTA kepadaWakil Ketua Edi Aryansyah dalam sidang paripurna DPRK Banda Aceh, Selasa (29/10) lalu. Wali kota dalam pidatonya menyebutkan pendapatan dalam RAPBK Banda Aceh TA 2014 direncanakan sebesar Rp1.088.662.087.533 terjadi kenaikan sebesar Rp139.742. 184.417 atau 14,73 persen dari pagu pendapatan TA 2013. Menurut wali kota, kenaikan pendapatan tersebut terjadi antara lain pada PAD TA 2014 sebesar Rp143.191.956.809 mengalami peningkatan sebesar Rp35.414.189.651 atau 32,86 persen dari PAD yang ditetapkan pada TA 2013 sebesar Rp107.777.767.158. Sementara itu, untuk Belanja Daerah direncanakan sebesar Rp1. meningkat sebesar Rp100.186.402.114,atau 10,16 persen bila dibandingkan dengan Belanja Daerah yang ditetapkan pada APBK TA 2013. Peningkatan belanja tersebut, kata wali kota, terjadi pada Belanja Tidak Langsung yang direncanakan sebesar Rp 574.551.692.844 mengalami peningkatan sebesar Rp6.055. 768.808,- atau 1,07 persen dari belanja tidak langsung TA 2013 sebesar Rp568.495.924.036. Peningkatan ini disebabkan adanya penyesuaian dana tunjangan profesi guru dan tambahan penghasilan guru. Adapun Belanja Langsung yang direncanakan TA 2014 sebesar Rp511.610.394.689- mengalami peningkatan sebesar Rp94.130.633.306 atau 22,55 persen dari Belanja Langsung yang ditetapkan TA 2013 sebesar Rp417.479.761.383. Kenaikan ini disebabkan adanya belanja untuk melaksanakan program dan kegiatan otsus. Wakil Ketua DPRK Banda Aceh Edi Aryansyah mengatakan, pembahasan RAPBK Banda Aceh TA 2014 telah dimulai sejak 29 Oktober hingga berakhir 28 November 2014. Sekarang ini pembahasan terus dilakukan secara marathon melalui rapat kerja komisi dewan dengan SKPK-SKPK serta rapat kerja Badan Anggaran dengan pihak Tim Anggaran Pemerintah Kota (TAPK). “Kita harapkan APBK 2014, ini benarbenar manfaatnya dapat dirasakan langsung oleh masyarakat warga kota Banda Aceh,” tutur politisi dari Partai Aceh ini.

8 Kabupaten/Kota Ikuti Lomba Posyandu Plus MANGGENG RAYA (Waspada) : Sedikitnya delapan kabupaten/kota di Provinsi Aceh mengikuti lomba Pos Pelayanan Terpadu (Posyandu) Plus sebagai bentuk kepedulian terhadap kesehatan anak. Badan Pemberdayaan Masyarakat (BPM) Provinsi Aceh melalui Tim Pokja IV PKK Aceh, melakukan peninjauan secara langsung ke sejumlah Posyandu plus yang memiliki Bina Kesehatan Balita (BKB), PAUD, TK dan TPA pada delapan kabupaten/kota se-Provinsi Aceh, dalam rangka menilai peningkatan pelayanan terhadap kesehatan anak pada masyarakat desa setempat. Wakil Ketua Pokja IV PKK Aceh, Khuzaimah Ibrahim saat melakukan penilaian perdana di Aceh Barat Daya, Jumat (1/ 11) mengatakan, penilaian ini dilakukan sebagai bentuk kepedulian terhadap kesehatan anak sebagai generasi penerus bangsa. “Kami mewakili Ketua PKK Provinsi Aceh Niazah A Hamid ditugaskan untuk meninjau Posyandu plus di sejumlah kabupaten/ kota se-Aceh, untuk tahap ini kita hanya mengambil delapan kabupaten/kota saja yang masuk dalam kategori perlombaan,” paparnya ketika menilai Posyandu Plus di Desa Pusu Ingin Jaya, Kecamatan Manggeng. (cza)

Gotong Royong Bangun Rumah Guru Bakti BAKTIYA (Waspada): Zulaina, 33, seorang guru bakti murni di Desa Matang Bayu Baktiya, Aceh Utara sudah sebulan lebih tidah memiliki tempat tinggal. Untuk membantu beban guru SD tersebut, para relawan IPSM setempat gotong-royong membangun kembali rumah yang rusak dihantam pohon. Ketua Ikatan Pekerja Sosial Masyarakat (IPSM) Aceh Utara, Muktaruddin, Senin (4/11) mengatakan, Zulaina bekerja sebagai guru bakti murnidi SD Matang Bayu sudah sembilan tahun. Selama ini, janda tersebut tinggal bersama tiga anaknya yang masih kecil. “Kita datang ke sana untuk membantu memperbaiki rumah yang rusak parah,” jelas Muktaruddin. Karena tidak memilik penghasilan memadai, Zulaina tak mampu memperbaiki tempat tinggalnya. Sehingga dia bersama anak-anaknya terpaksa mengungsi ke rumah orangtuanya yang lokasinya jauh dari sekolah. Muktaruddin mengaku prihatin dengan kondisi guru yang kehilangan tempat tinggal. “Sebagai pendidik sudah selayaknya dia mendapat bantuan kita,” tambah dia. Para relawan IPSM Aceh Utara mendatangi rumah untuk memperbaiki kerusakan. Sementara untuk membeli peralatan, ikut dibantu Khaidir Abdurahman dari DPRK Aceh Utara dan bantuan pribadi dari sejumlah pejabat Pemkab Aceh Utara. Kegiatan gotong-royong melibatkan seluruh relawan IPSM dan warga sekitarnya. Selain itu tampak ikut hadir Kadis Sosial Aceh Utara Jailani, Kadis DPKKD M Nasir dan Anwar dari Dinas Pendidikan Pemuda dan Olahraga setempat. (b15)

Banjir Mulai Rendam Singkil RIMO (Waspada): Hujan deras yang mengguyur wilayah Aceh Singkil sekitarnya sejak tiga hari terakhir menyebabkan banjir yang merendam areal sawah dan perkebunan di sejumlah tempat. Amatan Waspada, Senin (4/11) sore, sepanjang ruas Singkil Utara-Subulussalam terdapat tiga kawasan yang tergenang air dampak meluapnya Sungai Cinendang dan anak-anak sungai. Ketiga kawasan yang telah terendam banjir di sisi kiri dan kanan jalan negara serta jalan provinsi tersebut masing-masing di kawasan perkebunan Astra Agro Lestari (AAL) Kampung Telaga Bakti, Kecamatan Singkil Utara. Kemudian kawasan Solok Kampung Rimo dan Kampung Anjoa-anjo, Kecamatan Gunung Meriah serta kawasan Silatong, Kecamatan Simpang Kanan. Hingga berita ini dikirim, hujan terus mengguyur wilayah tersebut. Selain berdampak banjir, hujan yang mengguyur wilayah d isana menyebkan struktur tanah menjadi labil dan menyebabkan terjadi longsor di dua tempat yang menutup sebagian jalan, namun arus lalu lintas saat itu masih lancar . Kedua lokasi longsor yang menutup sebagian badan jalan terdapat di kawasan Lae Petal, Kampung Pangkalan Sulampi, Kecamatan Suro, Aceh Singkil. Kemudian di kawasan Lae Motong, Kecamatan Penanggalan, Subulussalam. (b27)

Waspada/Tarmizi Ripan

BANJIR merendam kawasan Anjo-anjo, Kec. Gunung Meriah, Aceh Singkil, Senin (4/11)

Waspada/Aldin Nl

GUBERNUR Aceh Zaini Abdullah didampingi Ketua DPRA Hasbi Abdullah dan Kapolda Aceh Herman Efendi menerima ranup (sirih) usai menari di Pendopo Gubernuran sebagai penyambut kedatangan 1 Muharam yang dimeriahkan iring-iringan karnaval di Banda Aceh, Selasa (5/11)

Perayaan Tahun Baru Islam Kurang Bermakna BAND ACEH (Waspada): Perayaan tahun baru Islam yang diperingati setiap tahun 1 Muharram tidak semeriah perayaan tahun baru masehi yang jatuh setiap 1 Januari. Semua pihak mengakui, peringatan tahun baru Islam diperingati hampir di seluruh kabupaten/kota di Aceh, namun gaung yang terlihat tak lebih dari sekadar pawai ta’aruf dan do’a bersama serta tausiah. Dengan berbagai keterba-

tasan, tahun baru 1435 hijriah tahun ini dinilai tahun yang paling meriah dalam peringatan tahun baru Islam. Namun perayaan sangat sederhana dan peserta yang mengikutinya juga tidak banyak. Sejumlah pihak telah berbuat berbagai kegiatan untuk menampakkan syiar Islam, namun kegiatan-kegiatan tersebut belum terkalahkan gaungnya dengan peringatan Hari Proklamasi Kemerdekaan Republik Indonesia. “Padahal, Aceh yang sedang digalakkan Syariat Islam dinilai memiliki peluang yang lebih untuk menganggarkan sedikit dana dari APBK dan APBA pada Pos Anggaran Dinas Syariat Islam se-

hingga berbagai kegiatan bisa dilaksanakan oleh masingmasing lembaga, sehingga gaung 1 Muharram lebih muncul dan meriah lagi,” kata alumni Dayah Darul Huda Lhoknibong, Alauddin, Selasa (5/11). Tak hanya itu, pusat peringatan 1 Muharam rata-rata di pekarangan masjid yang sempit. Bahkan para peserta pawai hanya dari dayah-dayah serta pondok pesantren di Aceh. Menurut Sekjend Rabithah Silaturrahmi Santri se-Aceh (RASSA), M Iqbal Hanafiah, dia mendesakDinasSyariatIslamdan MPU Aceh mengusulkan anggaran untuk peringatanTahun Baru Islam tahun depan dengan angka yang lebih besar. (b24)

Gubernur Aceh: Pemuda Adalah Sumber Daya Potensial BANDA ACEH (Waspada): Melihat strategisnya peran dan keberadaan pemuda, maka tidak ada yang bisa menyangkal bahwa mereka adalah sumber daya potensial bagi sebuah bangsa. “Pemuda adalah sumber daya unggul bagi pembangunan ketika bisa diberdayakan secara positif. Tapi jika tidak, maka mereka akan menyaksikan kenyataan yang pahit bahwa mereka telah kehilangan sebuah generasi,” kata Gubernur Aceh Zainia Abdullah dalam sambutan tertulis dibacakan Sekda Dermawan ketika membuka Rakerda KNPI Aceh 2013, Senin (4/11). Itu sebabnya, kata gubenur, dalam berbagai kesempatan bertemu dengan wakil organisasi pemuda dan mahasiswa di Aceh, dia kerap mengatakan agar pemuda harus bangkit dan mau bertarung merebut posisi penting dalam pembangunan di wilayah ini. “Tidak zamannya lagi pemuda dudukduduk santai di warung kopi dan membuang waktu hanya untuk facebookan atau bermain poker. Pemuda harus selalu tampil di depan dan siap melanjutkan kepemimpinan di masa mendatang,” tegasnya. Gubernur mengungkapkan, pertemuan The World Programme of Action for Youth 2010 — sebuah even membahas tentang kepemudaan di tingkat internasional — menyebutkan adanya tiga isu utama yang seharusnya menjadi perhatian pemuda saat ini: Ketiga isu itu adalah, peran pemuda dalam menangani hal-hal terkait dengan globalisasi ekonomi, peran pemuda dalam membangun kepribadian serta peran pemuda dalam kehidupan masyarakat sipil Menurut Doto Zaini, begitu beliau akrab disapa, jika menyimak isu kepemudaan yang dirangkum dari pertemuan tersebut, rasanya tidak jauh dengan apa yang terjadi di Provinsi Aceh ini. Terkait pembangunan ekonomi, kata dia, peran pemuda sangat dibutuhkan sebagai fasilitator atau bisa juga sebagai motor penggerak. Sampai tahun ini Pemprov Aceh masih memberikan perhatian tinggi terhadap program pember-dayaan masyarakat, mengingat tingkat kemis-kinan di Aceh relatif masih tinggi, yakni sekitar 20,9 persen. Kemudian dalam peta politik Aceh saat ini,

Kadis DKP Kecewa Pembangunan KM SIGLI (Waspada): Kadis Kelautan dan Perikanan Aceh Raihana, Selasa (5/11) mengaku kecewaterhadapkualitaspembangunan Kapal Motor (KM) 40 GT di Galangan, Desa Kupula, lokasi objek wisata pantai Matak Tari, Kecamatan Simpang Tiga, Pidie. Tiga unit KM, dibangun menggunakan sumber dana Otonomi Khusus (Otsus) Aceh, senilai Rp7.219.200.000 itu, menurut mantan Kadis DKP Pidie, masa bupati AbdullahYahya, dikerjakan kurang bermutu. Lambung kapal dicat asal jadi, dan papandipasangtidakrapisehingga tidak indah dipandang mata. “Saya minta kepada rekanan supaya segera memperbaikinya. Papan pada lambung kapal, dicat asal-asal saja. Bigitupun papan pada lambung kapal, dipasang tidak rapi. Kalau hasilnya tidak bagus, kami dari DKP Provinsi Aceh tidak akan terima KM ini,” tegas Raihana saat melakukan kunjungan kerja bersama rombongan dari Banda Aceh ke objek wisata Matak Tari, Kecamatan Simpang Tiga, Pidie, Selasa ( 5/11). Dalam kesempatan itu, kepada rekanan dia meminta KM yang dibangun hampir ram-

pung itu segera dilakukan perbaikan yang masih terlihat kurang. Raihana menjelaskan, ketiga unit KM yang sedang dibangun itu, akan diserahkan pihaknya kepada kelompok nelayan setempat dengan managemen pengelolaan profesional. Selain di Kecamatan Simpang Tiga, proyek pembangunan KM yang sama juga terdapat di Kecamatan Bate, satu unit, dan Pasie Rawa, Kecamatan Kota Sigli, satu unit. Selanjutnya di Kabupaten Pidie Jaya total sebanyak 21 unit. Meliputi

dak pidana korupsi tidak tepat, sebab itu masalah utang piutang yang belum dilunasi Nurdin Abdul Rahman hanya Rp200 juta lagi. Kapolres Bireuen AKBP Muhammad Ali Kadafi didampingi Kasat Reskrim AKP Jatmiko men-jelaskan, keempat tersangka ditetapkan sebagai tersangka tindak pidana korupsi di BLU Dr Fau-ziah Bireuen, sewaktu Nurdin Abdul Rahman masih menjabat Bupati Bireuen periode 2007-2012. Hasil audit BPKP Perwakilan Provinsi Aceh menyebutkan, akibat perbuatan para tersangka memberikan pinjaman dan meminjam uang di Layanan Umum RSUD Dr Fauziah Rp1,6 miliar di luar prosedur telah terjadinya kerugian negara sebesar Rp1,6 miliar. Tentang pinjaman mantan Bupati Nurdin Abdul Rahman sudah dibayar dengan menyerahkan tanah kepada Pemkab Bireuen dilakukan setelah terungkap audit BPKP tidak bisa menghapus tindak pidana korupsi. Kasat Reskrim AKP Jatmiko mengatakan, berkas perkara keempat tersangka sudah selesai diperiksa dan akan dilimpahkan ke kejaksaan minggu depan. Terhadap tersangka dr Yurizal, dr Candra dan Isfanni sebagai bendaharawan dipersangkakan dijerat melanggar pasal 2 yo 3 UU RI No. 31 Tahun 1999, sebagaimana telah diubah dengan UU RI No.20 Tahun 2011 tentang pemberantasan tindak pidana korupsi. Ancaman pidananya pa-ling lama 20 tahun dan paling singkat empat tahun penjara. Sementara terhadap mantan Bupati Nurdin Abdul Rahman, dijerat pasal 2 yo 3 yo 4 UU RI No.31 Tahun 1999, sebagaimana telah diubah dengan UU RI No.20 Tahun 2011 tentang pemberantasan tindak pidana korupsi. Ancaman pidananya paling singkat empat tahun dan paling lama 20 tahun penjara. (b12)

Kecamatan Jangka Buya, 14 unit, Trienggadeng empat unit, Pante Raja satu unit, dan Lueng Bimba, Meureudu, sebanyak dua unit. Sedangkan di Kabupaten Bireuen dibangun di Kecamatan Jeunieb sebanyak tiga unit. Pimpinan PT Istana Lautsa, Niazi Kamaruddin, rekanan yang membangun tiga unit Kapal Motor, 40-GT, di Galangan Desa Kupula, lokasi objek wisata Mantak Tari, menanggapi keluhan Kadis DKP Aceh itumenyampaikan, pihaknya segera memperbaikinya.(b10)

Peringatan 1 Muharam, Pemko Gelar Zikir LANGSA (Waspada): Mememeriahkan penyambutan Tahun Baru Islam, 1 Muharam 1435 H, Pemko Langsa menggelar zikir dan ceramah di Lapangan Merdeka Langsa, Senin (4/11). Kabag Humas Pemko Langsa Hamdani mengatakan, umat Islam saat ini sudah jauh dari nilai-nilai keIslaman. Sehingga kebanyakan umat Islam sendiri tidak sadar dengan tanggal dan tahun agamanya sendiri. Menurut Hamdani, jangankan untuk merayakan pergantian tahun baru Islam dengan berbahagia, terkadang sudah tahun keberapa saja masih banyak yang tidak tahu. Sementara sore harinya diadakan pawai ta’aruf menyambut datangnya Tahun Baru Islam 1435 H. Pawai diikuti ratusan pelajar di Kota Langsa mulai dari tingkat sekolah dasar hingga sekolah menengahatas.PawaidiikutiribuanpelajaritudilepasWaliKotaLangsa Usman Abdullah yang menempuh rute Jl. Ahmad yani – Jl T. Umar – Telkom dan kembali lagi ke Lapangan Merdeka Langsa. (m43)

gubernur menyatakan dukungannya jika para pemuda Aceh atau kader KNPI sekalipun, mau menunjukkan kepedulian soal alih kepemimpinan di Aceh. Apakah berperan sebagai pemain, figuran atau sebagai pihak yang mendorong agar pelaksanaan pesta demokrasi itu berlangsung jujur dan adil. Pada bagian akhir, gubernur menyampaikan selamat kepada seluruh anggota dan keluarga besar KNPI/Pemuda Aceh yang menyelenggarakan Raker dan mengharapkan kegiatan ini dapat menghasilkan rumusan untuk membangun Aceh yang lebih baik di masa depan. Ketua KNPI Aceh, Jamaluddin menyampaikan bahwa pihaknya mendukung pesan gubernur agar pemuda jangan banyak menghabiskan waktu di warung kopi. Tapi harus benarbenar memikirkan bagaimana agar ke depan Aceh ini siap bersanding dengan daerah lainnya. “Aceh masih memiliki dana Otsus dan ke depan juga ada AFTA yang harus dijalankan. Jika para pemuda tidak ikut memikirkan masalah ini, maka Aceh akan terus tertinggal dalam berbagai hal,” papar Jamaluddihn.(b04)

300 Mobil Hias Keliling Lhokseumawe LHOKSEUMAWE (Waspada): Sebanyak 300 mobil hias melakukan pawai peringatan Tahun Baru Islam 1 Muharram 1435 Hijriah dengan mengelilingi Kota Lhokseumawe. Aktivitas itu diikutisiswa dan pegawai dari instansi pemerintah, Selasa (5/11). Pantauan Waspada, rute pawai dilakukan mulai dari Lapangan Hiraq pusat kota, menuju Keude Punteut Keacamatan Blang Mangat, pusat kecamatan paling ujung sebelah timur, kemudian menuju Batuphat, Kecamatan Muara Satu, pusat kecamatan paling ujung sebelah barat. Kemudian kembali lagi ke lapangan hiraq, dan membubarkan diri pada siang hari. Pawai kendaraan hias dan busana muslim ini, tidak hanya diikuti pelajar, tapi sejumlah pegawai dari Satuan Kerja Perangkat Daerah (SKPD) dan instansi pemerintah lainnya ikut memeriahkan hari besar Islam ini. Pelepasan dilakukan Wali Kota Lhokseumawe Suaidi Yahya dan wakil wali kota Nazaruddin. (cmk)

Fenomena KA Jelang Pengoperasian SEPERTI dikatakan tim dari PT Kereta Api Indonesia (KAI) Divre I Sumut dan Aceh, bahwa Kereta Api (KA) di Aceh akan bergerak di sebagian wilayah Aceh Utara, tepatnya sebelah barat yang berbatas dengan Kabupaten Bireuen. Hasil pantauan, Senin (4/ 11), rel kereta api di wilayah itu dari Stasiun Krueng Mane di Desa Cot Seurani telah siap secara fisik melayani operasinya kereta massal bersejarah di Aceh itu. Kendatipun didapatkan kondisi stasiun paling ujung sebelah barat itu, pagar beberapa sisi telah reot, rubuh dan berantakan. Situasi tak indah juga terpaksa dipandang, seperti ternak masyarakat bebas merumput dan membuang kotoran di dalam stasiun, karena masih banyak pakan sapi tumbuh hijau dan subur. Hal itu mungkin jarang dibersihkan. Hal mendadak lain didapatkan, pasca disurvei tim dari PT KAI Divre I Sumut dan Aceh, Rabu (30/10), seorang pria tua sibuk mengecat dinding stasiun karena dimakan usia lebih kurang empat tahun. “Saya disuruh cat dinding ini, ,” ungkap pria berumur sekitar 65 tahun ini. Kemudian bergerak ke Stasiun Bungkaih, sekitar 7 km ke arah timur, masih di Kecamatan Muara Batu. Stasiun yang menjadi Dipo Lokomotif atau tempat penyimpanan kereta api yang mengkilap itu berjumlah dua gerbong dan terkurung dalam pagar kawat. Tampilannya

mentereng, meski sedikit berkarat di bodi, warnanya biru dipadu putih dan garis orange di bagian samping. Di sini juga didapatkan suatu hal yang mendadak. Seorang kakek berusia sekitar 60 tahun, sedang mengasah mata mesin potong rumput.. Dia mengutarakan bahwa dia sedang bekerja memotong rumput disuruh salah satu kontraktor. Namun kondisi stasiun ini lebih mentereng ketimbang Krueng Mane. Karena tidak ada yang rusak, bahkan terlihat lebih bersih. Kemudian bergerak menempuh jarak sekitar 7 kilometer ke arah timur dan memasuki Desa Keude Krueng Geukueh, Kecamatan Dewantara, tepatnya berdiri Stasiun Krueng Geukueh. Fenomena aneh di sini tidak didapatkan apa-apa, selain sepi. Perjalanan kemudian menuju ke Kota Lhokseumawe menepi melalui sisi kanan rel. Dari stasiun Krueng Geukueh, mulai terlihat amburadul di atas rel, seperti bangunan kayu, sampah. Tapi Alhamdulillah terlepas kapan dimanfaatkan, rel ini sudah diikat besi kokoh di atas bantalannya. Jaraknya sampai ke Kota Lhokseumawe, tepatnya di depan Makam Pahlawan Desa Blang Panyang, Kecamatan Muara Satu. Perkiraan manual, jaraknya dari Stasiun Krueng Geukueh sekitar 9 km. Sepanjang ini, didapatkan pemandangan tak sedap, di Desa Blang Naleung Mameh dan Batuphat

Barat, pagar pembatas sisi rel, sebagian telah dipotong besinya. Selepas itu, sampai ke Cunda, Kecamatan Muara Dua, lebih kurang 4 kilometer di jalur rel itu, bantalannya sekitar 80 persen telah dipasang beraturan di tempatnya. Sisanya, karena jalur itu terletak dalam permukiman penduduk, terpaksa ditumpuk pada tempat tertentu agar tidak mengganggu. Ke ujung rel, atau sebelah timur Cunda, lain lagi, persisnya di Desa Uteun Kot. Jalur rel Kereta Api telah dijadikan jalan beraspal hotmix untuk lintasan kecamatan. Bantalan rel ditumpuk ke suatu tempat dan sebagian di pinggir jalan tersebut. Sejak mati suri pada 1982 yang kala itu masih bernama Atjeh Tram (AT), maka pada masa Presiden BJ Habibie tahun 1998, kereta api di Aceh kembali bergelora. Harapan kelam itu tak pernah menjadi nyata sampai 5 November kemarin. Bila dihitung, ternyata telah mencapai angka 15 tahun. Pada saat itu, rel mulai dibangun di Aceh, permulaannya dilakukan di Aceh Tamiang yang berbatas dengan rel di Besitang (Sumatera Utara). Panjangnya mencapai 32 kilometer, dan dikerjakan hingga 2004. Seiring musibah tsunami tahun itu, proyek ini dihentikan sementara. Pengerjaan ini dilakukan, bagian dari program Trans Sumatera Railway Development setelah bentuk Rencana Umum Pengembangan Kereta Api Su-

Waspada/Mustafa Kamal

WARGA memperhatikan pagar kawat yang copot dari fondasi akibat terbengkalai di Stasiun Krueng Mane, Kecamatan Muara Batu, Aceh Utara, Senin (4/11) matera melalui kesepakatan Gubernur se-Sumatera pada 2002. Targetnya, akan melintasi Aceh, Sumatera Utara, Riau, Sumatera Barat, Jambi, Sumatera Selatan, Bengkulu dan Lampung. Pada 2007 sampai 2008, pembangunan rel kereta api Aceh dilanjutkan kembali, tapi tidak dimulai Aceh Tamiang, melainkan di Aceh Utara bagian barat dan Kota Lhokseumawe bagian barat (Krueng Mane, Aceh Utara sampai Cunda, Lhokseumawe). Untuk menyakinkan masyarakat, kereta api di Aceh benar-benar terwujud, melalui Pe-

labuhan Umum Krueng Geukueh pada 2008, Lokomotif Kereta Api dari PT Industri Kereta Api Indonesia (INKA) Madiun, Jawa Timur tiba di lokasi. Tak hanya itu, untuk menyempurnakan mimpi, pada 2009, ditambah pembangunan tiga stasiun plus kantor di Krueng Mane, Bungkaih dan Krueng Geukueh. Pada 2011, Kereta Api jenis KRDI-3 08210 tersebut dilakukan uji coba di rel yang telah selesai dibangun. Rute diambil, Bungkaih sampai Krueng Mane. Percobaan tersebut kemudian dilakukan lagi pada Rabu (30 10) lalu. Seraya, teknisi PT KAI Zul-

fikar di Dipo Lokomotif Stasiun Bungkaih memberi angin segar kembali kepada masyarakat Aceh. “Kita meninjau untuk mengetahui perkembangan fasilitas serta menyiapkan apa saja yang masih diperlukan. Untuk saat ini, menjelang pengoperasian, tidak didapatkan kendala lagi. Bila dioperasikan, akan melayani tiga stasiun dengan jarak tempuh 12 km. Tiga stasiun ini sudah memadai, baik dari segi infrasturktur bangunan, fasilitas lainnya, dan rel,” ujar Zulfikar. Mustafa Kamal




Rabu 6 November 2013

Bertaruh Maut Di Jembatan Gantung PAGI itu, Senin (4/11), awan putih menggumpal cerah di langit kebiru-biruan. Sang mentari yang baru saja terbit seolah tersenyum riang mengiringi jalan anak-anak berseragam sekolah di Desa Lampoih Lada, Kemukiman Beuracan, Kecamatan Meureudu, Kabupaten Pidie Jaya. Desa Lampoih Lada, terletak bagian selatan, dengan jarak tepuh sekira 8,9 km, dari pusat pemerintahan Kabupaten Pidie Jaya. Mayoritas penduduk di desa tersebut berprofesi sebagai petani, baik kebun maupun sawah. Hasil perkebunan yang dihasilkan, durian, pinang, kakao, rambutan, dan mangga. Sedangkan hasil pertanian sawah yang paling baik dihasil daerah itu, berupa padi. Meski sektor pertanian dan perkebunan, sangat bagus, sangat disayangkan desa tersebut kurang mendapat perhatian dari Pemerintah Pijay, selama kurun waktu lima tahun terakhir ini. Satu unit jembatan dengan panjang sekira 40 meter dan lebar sekira 1,3 meter, sejak setahun terakhir ini dibiarkan putus akibat diterjang banjir dan pengikisan sungai. Jambatan Desa Lampoih Lada, merupakan satu-satunya sarana penghubung bagi warga Kemukiman Beuracan, khususnya warga desa setempat yang sehari-hari mempergunakannya untuk bermacam keperluan. Putusnya jembatan itu sejak awal 2012 itu mengakibatkan masyarakat setempat harus berenang melalui sungai untuk bepergian ke Meureudu. Sedihnya lagi, anak-anak usia sekolah hampir setiap hari melawan maut menaiki jembatan putus itu untuk bersekolah. “Kalau airnya deras anak-anak biasanya terpaksa naik jembatan yang putus ini. Tetapi kalau airnya kering, mereka lebih memilih berjalan melalui sungai, meski pakaian mereka basah. Tapi kalau kalau bocah perempuan mereka lebih memilih berjalan di jembatan ini, meski saat mereka berjalan tiba-tiba kayu badan jembatan itu patah dan mereka terjatuh dalam sungai,” kata Abubakar, 50, warga Desa Lampoih Lada.

Sulaiman, 46, warga Desa Lampoih Lada, mengungkapkan, putusnya jembatan ini juga berdampak buruk terhadap perekonomian masyarakat. Sebab, jembatan itu satu-satunya sarana yang digunakan hampir masyarakat Kemukiman Beuracan untuk pergi ke kebun atau ke sawah-sawah mereka. Sejak putusnya jembatan itu, para petani kesulitan menurunkan hasil panen ke kota Meureudu, guna dijual. Ekses, dari itu harga beli hasil panen pun jadi menurun karena para pembeli tidak bisa datang ke kebun dengan sepeda motor, melainkan hasil panen diturunkan dengan berjalan kaki dan melewati sungai. “Kami berharap dengan terpilihnya pemimpin baru, melalui Pilkada Selasa (29/10) lalu. Jembatan Desa Lapoih Lada, Beuracan, dapat diperhatikan dan segera dibangun,” katanya. Kadis Pekerjaan Umum Pidie Jaya Hanief Ibrahim, Senin (4/ 11) mengatakan, penyebab amblasnya jembatan itu disebabkan faktor galian C. Hampir setiap hari Daerah Aliran Sungai (DAS) di Desa Lampoih Lada sekitarnya pasirnya dikeruk sehingga pada saat musim hujan air dalam DAS itu meluap sehingga menimbulkan erosi, dan dampaknya jembatan itu amblas ke dasar sungai. Ekses dari itu menyebabkan warga kesulitan melakukan aktivitas, begitupun anak-anak sulit pergi ke sekolah. Sebenarnya pihaknya telah mengusulkan pembangunan kembali jembatan gantung di Desa Lampoih Lada, itu. Tetapi, itu direncanakan dibangun pada 2014, itupun apa bila tidak terjadi perubahan. Muhammad Riza

Waspada/Muhammad Riza

ANAK sekolah asal Desa Lampoih Lada, Pidie Jaya berjalan di jembatan gantung yang ambruk, Senin (4/11)

Bayar Utang Dengan Cek Kosong

Mantan Cabup Abdya Dipolisikan BLANGPIDIE (Waspada) : SA yang juga mantan calon Bupati Aceh Barat Daya pada Pilkada 2012 lalu, dilaporkan ke Polda Aceh oleh Zainuddin Daud, pengusaha yang juga Ketua Umum Solidaritas Warga Aceh Barat Daya (SWADAYA) Jakarta. Pelaporan tersebut berkenaan dengan tindak pidana penipuan yang dilakukan SA dengan modus memberikan lembaran cek kosong terkait utang terhadap Zainuddin Daud sebanyak Rp400 juta yang sudah dipinjam sejak 2007 lalu. “Memang benar (laporan ke Polda Aceh), sudah kami lakukan secara resmi pada Senin

(4/11), dan sudah dibuatkan BAP oleh personel Reskrim Polda Aceh, dengan Surat Keterangan Tanda Bukti Laporan No: BL/244/XI/2013/SPKT, Tanggal 4 November 2013, laporan tersebut terkait penipuan yang dilakukan SA kepada kami dengan memberikan cek kosong saat mencoba mengelabui pembayaran utangnya yang sudah bertahun-tahun,” ungkap Zainuddin Daud, Selasa (5/11). Disebutkan Zainuddin Daud, permasalahan ini bermula pada 2007 lalu saat SA melakukan pinjaman sebanyak Rp400 juta, dirinya memberikan pinjaman pada saat itu karena diyakinkan SA akan dibayarkan dalam tempo waktu 3 bulan. Namun setelah melewati batas waktu yang dijanjikan utang tersebut belum juga dibayar, bahkan setelah lewat bebe-

rapa tahun SA mulai ingkar janji dan melakukan upaya-upaya yang dianggap tidak memiliki itikad baik untuk menyelesaikan utangnya, bahkan puncaknya pada 2009 lalu dirinya ditipu

mentah-mentah oleh SA dengan memberikan lembaran cek kosong. “Setelah bertahun-tahun tidak juga ada upaya dan itikad baik dari SA menyelesaikan

utangnya, dan malah kami ditipu dengan lembaran cek kosong, maka masalah ini kami serahkan ke aparat yang berwajib,” ujar Zainuddin Daud. (cb05)

Lomba Seni Kebudayaan Aceh Diminati LHOKSEUMAWE (Waspada) : Perlombaan seni kebudayaan Aceh yang digelar stan Disdikpora Kota Lhokseumawe pada acara pameran pendidikan dan pembangunan di Desa Mon Geudong, Kecamatan Banda Sakti menyedot perhatian publik untuk berkunjung. Berbagai jenis perlombaan yang bernuansa budaya Aceh juga bernafaskan Islami ditampilkan di atas pentas dan pesertanya adalah para pelajar yang berasal dari berbagai jenjang pendidikan, tingkat Taman Ka-

nak - Kanak, SD, SMP / MTsN, SMA/MAN. Di antara jenis lomba seperti pidato dalam tiga bahasa, tabuh Rapai, tari Seudati , justru mengundang minat masyarakat untuk menyaksikan atraksi para pelajar mempraktikkan seni yang biasanya dilakoni oleh orang dewasa. Salah seorang wali murid Nazaruddin, mengatakan, umumnya pengunjung di stan Disdikpora adalah orangtua murid yang ingin melihat kegiatan pelajar yang menampilkan

hasil pendidikan dan budaya Aceh. Nazar mengaku anaknya yang duduk dibang SD juga ikut menjadi peserta lomba seni kebudayaan Aceh dan merasa bangga menyaksikan penampilan anaknya. Kepala Disdikpora Lhokseumawe Rusli Ismail mengatakan, pameran pendidikan dan pembangunan Kota Lhokseumawe diadakan dalam rangka memperingati HUT ke-12 Kota Lhokseumawe dan peringatan Satu Muharram. (b16)

Kekerasan Terhadap Wartawan Melecehkan BANDA ACEH (Waspada) : Ketua Persatuan Wartawan Indonesia (PWI) Wilayah Aceh, Tarmilin Usman menyayangkan arogansi oknum kepolisian terhadap Kaya Alim, wartawan The Globe Journal Biro Subulussalam yang terjadi Jumat (1/11) pekan lalu saat aksi warga terkait Pilkada Sulbulussalam. Menurut Tarmilin, mencekik wartawan merupakan bentuk pelecehan yang sangat besar terhadap profesi jurnalis. “Itu pelecehan terhadap jurnalis,” kata Tarmilin, Minggu (3/11) siang. Dalam peliputan demonstrasi dengan jumlah massa yang besar, para jurnalis tak dipungkiri mengalami tantangan khusus. Tidak saja saat berhadapan dengan polisi, bahkan kadang kala tantangan yang sama juga diperoleh dari massa itu sendiri. Lumrahnya, para jurnalis kerap merasa ditarik atau ditolak oleh oknum tertentu dalam kerumunan tersebut. “Itu biasa terjadi. Bukan kekerasan,” paparnya. Pimpinan Umum sekaligus Pimpinan Redaksi The Globe Journal, Radhi Darmansyah menyebutkan kasus tersebut sudah dilaporkan ke pihak Provost, Polres Singkil-Subulussalam. (b08)

Pemprov Aceh Belum Terbuka Soal RTRW BANDA ACEH (Waspada) : Kelompok-kelompok aktivis lingkungan meminta Pemprov Aceh untuk membuka data dan informasi mengenai Tata Ruang Aceh yang baru, menurut mereka Pemprov Aceh belum terbuka terkait RTRW Aceh. Ketidaktransparan ini di kekhawatiran banyak pihak lantaran rencana pemerintah membuka kawasan hutan untuk konsesi kayu, kebun kelapa sawit dan konsesi tambang yang selama ini menjadi penyebab utama tanah longsor dan banjir di Provinsi Aceh. “Kita sudah menghabiskan waktu berbulan-bulan dalam rangka upaya meminta kepada Pemprov Aceh untuk lebih transparan terhadap rencana pengembangan dalam rencana tata ruang yang baru termasuk pembukaan hutan lindung, tetapi Pemprov Aceh sendiri sampai saat ini masih menjadikan dokumen ini sangat rahasia untuk public,” kata Efendi, Juru Bicara Koalisi Peduli Hutan Aceh (KPHA).(b08)

Polisi Usut Kebakaran KM Abadi TAPAKTUAN (Waspada): Kasus kebakaran yang menghanguskan Kapal Motor (KM) Abadi, di pelabuhan pendaratan ikan (PPI) Lhok Pawoh, Kecamatan Sawang, Aceh Selatan, Minggu (3/11) hingga kini masih misteri. Pihak kepolisian Resort Aceh Selatan dilaporkan mulai mengusut kasus yang menelan kerugian materil sebesar Rp1,5 miliar. Seluruh peralatan dan jaring serta bodi kapal tak dapat diselamatkan dan ludes dilalap si jago merah. Kapolres Aceh Selatan AKBP Sigit Jatmiko melalui Kapolsek Sawang Iptu Mustafa, Senin (4/11) mengakui kasus kebakaran tersebut dalam penyelidikan polisi. Pihaknya sedang meminta keterangan dari pawang dan petugas bagian teknisi mesin. “Kami sedang memeriksa pawang dan bagian teknisi mesin untuk diambil keterangannya, karena keduanya merupakan pihak yang bertanggungjawab dalam insiden itu,” papar Mustafa. Pawang yang diminta keterangan Helmiyadi, 35, dan teknisi mesin Irwansyah, 30, keduanya warga setempat. Penyelidikan dilakukan setelah mendapat pengaduan dari pemilik kapal T Lizam Mahmud melalui putranya TM Nasrizal. Penyebab kebakaran berdasarkan kesaksian keduanya bermula ketika mereka memperbaiki mesin. Setelah dinyalakan dan ternyata ada peralatan yang tidak cocok dan berusaha mengganti. “Namun belum sempat diganti, tiba-tiba muncul percikan api dan melalap dua jerigen bensin serta lima belas jerigen solar dalam kapal,” tutur Mustafa. (b30)

Waspada/Mustafa Kamal

ROMBONGAN anak SD bersama guru duduk di depan melintasi di Jalan Merdeka Barat, Kota Lhokseumawe menggunakan mobil pick-up akibat kurangnya pelayanan bus. Pelayanan bus di pedalaman Aceh Utara, terutama bagian barat masih terbatas. Foto direkam, Senin (4/11)

Lokal Diabaikan, Milik Luar Yang Membara WARGA pesisir barat Aceh berharap keberadaan PLTU Nagan Raya dapat membawa manfaat bagi daerah tersebut. Salah satu manfaat yang belum dirasa adalah masih “diabaikannya” pemakaian batu baru lokal, Nagan Raya dan Aceh Barat diyakni memiliki potensi batu bara yang besar. Dan itu yang menjadi alasan didirikannya PLTU di kawasan tersebut. Namun, sampai saat ini, warga menyayangkan tak digunakannya batu bara lokal sebagai bahan bakar pembangkit PLTU Nagan Raya. “Memang kalorinya rendah, namun harusnya sejak awal direncanakan agar alat yang digunakan dapat menggunakan batu bara lokal. Tidak mesti punya kami. Banyak perusahaan pemegang IUP operasi produksi dan IUP eksplorasi batubara yang beroperasi di Aceh saat ini,” ujar Humas PT Mifa Bersaudara, Rahmad. Seharusnya kata dia, keberadaan PLTU Nagan Raya mengacu pada rencana usaha penyediaan tenaga listrik PLN dan dokumen Kebijakan Energi Nasional. Di mana lanjut dia, pemerintah mendorong pengembangan batu bara peringkat rendah didalam negeri untuk memenuhi kebutuhan energi melalui pengembangan PLTU. “Saya tidak berani mengomentari perusahaan lain, tapi sebagai putra daerah kita sayangkan. Sebenarnya Jika PLN memanfaatkan batubara lokal akan banyak efesiensi biaya karena batu bara lokal murah dibanding bila didatangkan dari luar,” katanya. Selain itu, penggunaan batu bara lokal tentu akan menjadi sumber pendapatan asli daerah yang berasal dari royalti serta multiplayer efek dari aktifitas penambangan batubara. “Secara teknis saya tidak paham tapi dengan kadar kalori 3000 kcal/kg (gar) suplai kita diterima Lafarge Semen Andalas Indonesia dan pembangkit listrik milik media grup,” ujarnya. Kata dia, saat ini perusahaan tersebut memiliki cadangan batu bara hingga 500 juta ton.

Belum maksimalnya operasional perusahaan membuat perusahaan hanya berproduksi 1 juta ton batu bara per tahun. Kualitas Rendah Kebutuhan batu bara untuk PLTU Nagan Raya didatangkan dari Kalimantan. Alasan mereka tak memakai bahan bakar batu bara dari Aceh, karena kualitas rendah. PLTU Nagan Raya didesain berspesifikiasi di atas 4.000 kilo kalori, lalu batu bara Aceh di bawah 4.000 kilokalori. Kepala Bidang Pertambangan Mineral dan Batubara, Dinas Pertambangan dan Energi Aceh Ir. Mahdi Nur menjelaskan, itu yang menjadi alasan pihak PLN menggunakan bahan bakar utama batu bara dari Kalimantan. “Jauh sebelumnya pemerintah daerah sudah berupaya meminta kepada PLN agar menggunakan batu bara yang berada di Aceh terutama dari pertambangan yang berada di Aceh Barat dan Nagan Raya,” paparnya. Tapi ada tanggapan pihak PLN, yang akan merencanakan melakukan pencampuran batu bara asal Kalimantan dan batu bara dari Aceh. “Waktunya belum pasti, karena mereka masih rencana, tapi kita berharap batu bara Aceh bisa digunakan di PLTU Nagan Raya,” tambah Mahdi. Dia merincikan kelas dan jenis batu bara berdasarkan tingkat proses pembentukannya yang dikontrol oleh tekanan, panas dan waktu, batu bara umumnya dibagi dalam lima kelas: antrasit, bituminus, sub-bituminus, lignit dan gambut. Sementara yang digunakan bahan bakar PLTU Nagan Raya saat ini adalah jenis Bituminus mengandung 68 - 86 % unsur karbon (C) dan berkadar air 8-10% dari beratnya. Kelas batu bara yang paling banyak ditambang di Australia. Sedangkan batu bara yang dimiliki Aceh adalah jenis Sub-bituminus mengandung sedikit karbon dan banyak air, dan oleh karenanya menjadi sumber panas yang kurang efisien dibandingkan dengan bituminus. (cbo6/cb01)

Datuk NG Razali : Tempatkan Sesuatu Itu Sesuai Fungsi Pesan baginda Rasulullah SAW yang menyebutkan : “Jika sesuatu urusan diserahkan kepada yang bukan ahlinya, maka tunggulah kehancurannya” memiliki makna yang teramat dalam bagi Datuk NG Razali. Di usianya yang sudah memasuki 76 tahun, pesan Baginda Nabi tersebut begitu menjiwai dirinya baik dalam kehidupan sehari-hari, maupun di aktivitas bisnis yang sudah malang melintang selama bertahun-tahun. Dikisahkannya, pada 1964 merupakan titik awal dirinya melakukan ‘Hijrah’ (pindah) ke ibu kota Jakarta dengan meninggalkan kampung halamannya di Desa Lama Inong, Kecamatan Kuala Batee, Aceh Barat Daya dalam upaya mencari perubahan agar kehidupannya dapat menjadi lebih baik. Namun ternyata kepergian dan perjalanan itu tidak dilalui dengan mulus, pahit getir dan bahkan nyaris tenggelam di lautan Samudera Hindia yang sangat ganas juga sempat dirasakannya, namun dengan bekal keyakinan serta keteguhan doa yang mengiringi langkah perjalanannya, maka semua kesulitan tersebut dapat dihadapi dan dilalui dengan baik. “Keyakinan saya saat itu adalah firman Allah yang menyebutkan bahwa : Di balik kesukaran akan ada kemudahan, membuat saya kuat melalui semua terpaan kesulitan itu, bahkan ketika saya nyaris tenggelam saat berlayar di laut Sinabang, bahkan harus melempar semua bekal dari perahu untuk mengurangi beban agar terhindar dari amukan gelombang, semua itu menambah keyakinan saya,” ungkap Datuk NG Razali dalam pesan tausiah yang bertepatan dengan Tahun Baru Islam 1 Muharram 1435 Hijriah, Selasa (5/11). Kini dengan semua pengalaman hidupnya, dirinya berharap agar generasi muda saat ini harus memiliki mentalitas dan moralitas yang tinggi dalam menyikapi setiap perubahan yang kini dianggap memiliki beban tantangan yang sangat berat. Sehingga diharapkannya generasi saat ini

tidak mudah frustasi serta memiliki jiwa yang optimis dalam usaha mencapai kesuksesan hidup. “Jika boleh saya berbagi kisah, usaha bisnis yang saya rintis pada awalnya juga sempat jatuh bangun, namun kita harus memiliki sikap yang optimis di setiap kondisi yang kita hadapi sehingga tidak mudah frustasi,” tutur Datuk NG Razali yang kini memiliki bisnis perkebunan serta pertambangan batubara, biji besi dan emas di sejumlah daerah di Indonesia. Terhadap kondisi di daerah, khususnya Aceh Barat Daya saat ini yang menurutnya sedikit tertinggal dibandingkan daerah lain di tanah air, dirinya melihat ada sesuatu yang ‘keliru’ dalam pengambilan kebijakan serta pengelolaan pemerintahan yang dilakukan oleh pemimpin di daerah saat ini. Padahal dengan segala potensi yang dimiliki, baik sumber daya alam maupun manusia, maka tidak semestinya daerah memiliki tingkat laju pembangunan yang sangat rendah, malah seharusnya dengan sumber daya yang ada tersebut daerah serta masyarakatnya diyakini memiliki tingkat kesejahteraan yang lebih baik, bilamana memang dikelola secara benar dan niat yang tulus dalam rangka pengabdian kepada masyarakat serta daerah. “Tiada bermaksud saya ingin menciderai perasaan saudara kami yang sedang memimpin di daerah saat ini, namun jika boleh saya menyarankan, sebaiknya berpijak-lah dengan arahan Rasulullah dalam setiap pengambilan kebijakan, niscaya akan membawakan hasil yang baik, seperti penempatan kepala dinas, serta personel lainnya sehingga mampu menerapkan fungsinya dengan benar. Jadi, tempatkan sesuatu itu sesuai fungsinya, InsyaAllah semua akan memberikan kebaikan,” papar H Datuk NG Razali, yang mengaku masih mencintai daerah walaupun sudah berdomisili di Jakarta. Sudarmansyah

Korupsi Lebih Berbahaya Dari Teroris TAPAKTUAN (Waspada): Korupsi lebih berbahaya dari teroris. Teroris mempunyai target dan sasarannyajelas,ditujukanbagisegelintirkelompok tertentu. Tetapi prilaku korupsi, membuat mayoritas rakyat menderita, termasuk kaum duafa. Demikian dikemukakan Rasyidin Abdullah yang lebih popular dengan panggilan Tgk JinJin Jok, dalam tausiahnya menyambut Tahun Baru Hijriyah 1 Muharram 1435 H di komplek Masjid Agung Istiqamah, Tapaktuan, Aceh Selatan, Senin (4/11) malam. Mengingat dampaknya begitu berbahaya, ia sependapat jika pelaku korupsi di tanah air, khususnya di Aceh dihukum dengan hukuman berat. Sehingga menjadi efek jera bagi pelaku serta pembelajaran bagi pihak lain. Dalam acara yang dihadiri Bupati Aceh Selatan T Sama Indra, unsur Muspida, SKPK, para camat serta masyarakat Aceh Selatan yang memadati halaman masjid kabupaten pala itu, Tgk Jin-Jin Jok juga menyatakan prihatin terhadap kondisi Aceh yang dijuluki daerah Serambi Mekkah saat ini. Daerah yang sedang diberlakukan Syariat Islam secara kaffah ini, justru memegang rangking terkorup nomor 2 di tanah air serta ranking 12 bidang pembacaan Alquran (MTQ), di bawah Provinsi Papua Barat. “Ini sangat memalukan kita, di mata dunia,” tambahnya.

Hal ini terjadi, menurut dia, karena minimnya perhatian Pemprov Aceh terhadap sektor keagamaan, seperti pembinaan dayah (pesantren), masjid, balai pengajian agama termasuk pembinaan bacaan bidang Alquran. Kondisi ini diperburuk lagi dengan banyaknya anggaran daerah, terserap sebagai dana aspirasi wakil rakyat dan hal-hal seremoni lain yang kurang menyentuh hajat hidup rakyat yang masih dililit kemiskinan. “Padahal dana aspirasi itu haram hukumnya dinikmati anggota dewan, karena dana tersebut seutuhnya menjadi milik rakyat yang memilihnya,” papar mantan qariah asal Aceh Utara itu. Karena itu, melalui momentum tahun baru Hijriah ini, ia mengajak masyarakat Aceh Selatan berhijrah dari membenarkan kebiasan lama menjadi membiasakan kebenaran dalam kontek kehidupan sehari-hari. Bupati Aceh Selatan T Sama Indra dalam sambutannya mengajak semua elemen masyarakat daerahnya, memanfaatkan momentum 1 Muharram ini, menatap masa depan Aceh Selatan menjadi lebih baik. “Mari kita tingkatkan ukhuwah Islamiyah melalui kebersamaan dan persatuan umat, sebagaimana Nabi Besar Muhammad SAW, menyatukan kaum Anshar dan Muhajirin, setelah berhijrahdariMekkahkeMadinah,”ucapnya.(b30)

IPELMABAR Peringati 105 Tahun Wafatnya Cut Nyak Dhien BANDA ACEH (Waspada): Memperingati Hari Pahlawan sekaligus mengenang 105 tahun meninggalnya pahlawan nasional Cut Nyak Dhien, mahasiswa asal Aceh Barat yang tergabung dalam Ikatan Pelajar Mahasiswa Aceh Barat (IPELMABAR) Banda Aceh akan menggelar peringatan wafatnya Cut Nyak Dhien. Ketua umum IPELMABAR, Zulkifli Andi Govi mengatakan, alasan diperingatinya 105 tahun wafatnya Cut Nyak Dhien sebagai momentum mengenang jasa-jasa Cut Nyak Dhien untuk rakyat Aceh dan Indonesia serta memberikan kesadaran kepadamasyarakatuntuktidakmelupakansejarah. “Kegiatan ini sebagai momentum untuk kita lebih mengenal jasa-jasa yang telah diberikan Cut Nyak Dhien untuk rakyat Aceh dan Indonesia serta menumbuhkan sikap semangat

juang pahlawan nasional kepada para mahasiswa, khususnya mahasiswi untuk memiliki mental dan prinsip hidup yang kuat,”. ujar Andi di Banda Aceh, Senin (4/11) Sekretaris IPELMABAR, Teuku Faizil, mengatakan, kegiatan persembahan IPELMABAR untuk Cut Nyak Dhien yang mengambil tema “We Love Cut Nyak Dhien” ini dilaksanakan mulai 6 hingga 10 November 2013 dengan berbagai rangkaian kegiatan. “Kita melakukan serangkaian kegiatan dimulai dengan talk show, membersihkan rumah peninggalan beliau di Desa Lampisang, Aceh Besar, Konvoi dan membagikan bunga, seminar budaya, nonton bareng film Cut Nyak Dhien, serta doa dan zikir bersama untuk mengenang Cut Nyak Dhien,” ungkap Faizil. (b04)

Waspada, rabu 6 november 2013  
Read more
Read more
Similar to
Popular now
Just for you