Page 1

Prakiraan Cuaca Rabu (28/10) Medan 24-32 C

Berastagi 18-28 C

R. Prapat 24-32 C

Parapat 19-280C

P. Siantar 20-300C

Sibolga 22-330C




Hujan guntur


BMKG Polonia

WASPADA Demi Kebenaran Dan Keadilan

RABU, Wage, 28 Oktober 2009/9 Zulqaidah 1430 H

Rekaman Rekayasa Kriminalisasi KPK

Presiden Bantah Terkait JAKARTA (Antara): Presiden Susilo Bambang Yudhoyono membantah dirinya terkait dalam dugaan rekayasa kriminalisasi pimpinan KPK seperti yang disebut dalam transkrip rekaman pembicaraan antara Anggodo Widjojo (adik buron KPK, Anggoro Widjojo) dengan Wisnu Subroto (mantan Jaksa Agung Muda Bidang Intelijen). “Presiden menegaskan tidak pernah ada pembicaraan presiden dengan siapapun tentang masalah itu. Berita itu adalah aksi pencatutan nama oleh orang yang menyatakan itu dan sama sekali tidak benar,” kata Juru Bicara Presiden Dino Patti Djalal di kompleks Istana Presiden Jakarta, Selasa(27/10). Lanjut ke hal 2 kol. 3

Wakil Jaksa Agung Juga Bantah JAKARTA (Antara): Wakil Jaksa Agung (Waja) Abdul Hakim Ritonga membantah keterkaitan dirinya dalam dugaan rekayasa penetapan tersangka pimpinan Komisi Pemberantasan Korupsi (KPK), Bibit S Rianto dan Chandra M Hamzah. “Saya tidak melakukan rekayasa, saya hanya melaksanakan prosedur penyelesaian perkara,” katanya di Jakarta, Selasa(27/10). Hal itu, kata dia, disampaikan pula kepada Jaksa Agung, Hendarman Supandji, saat dirinya dipanggil untuk mengklarifikasi mengenai pemberitaan tersebut. Dikatakannya, saat dirinya dipanggil, jaksa agung menjelaskan pula adanya perkara KPK yang sedang disidik. Lanjut ke hal 2 kol. 4

No: 22952 Tahun Ke-63

PADANG (Waspada): Majelis Ulama Indonesia (MUI) Cabang Sumatera Barat menekankan pihaknya sejak jauhjauh hari telah mengkhawatirkan masuknya bantuan dari Israel bagi korban gempa Sumatera Barat. Ketua MUI Sumbar Gusrizal Gazahar mengaku sebetulnya ia telah mendengar kabar bakal masuknya bantuan Israel sejak satu minggu ini. Untuk itu MUI telah menyiapkan sejumlah rencana untuk membatasi jangan sampai bencana alam ini berubah menjadi ‘bencana keimanan’. “Kita sudah kirim 20 tim ulama untuk memantau bantuan Israel yang masuk ke Sumbar,” ujar Gusrizal Gazahar, Selasa (27/10). Menurutnya, tim tersebut diterjunkan langsung ke titik-titik penerimaan bantuan dari pihak Israel. Ulama yang diterjunkan MUI ke lapangan berasal dari berbagai daerah di Sumbar yang tidak terkena

Lanjut ke hal 2 kol. 6

BACA DI HALAMAN DALAM Liputan Haji 1430 H: Nama Calhaj Embarkasi Medan Kloter 6 Asal T. Tinggi Dan Medan Baca halaman 24

Dubes Indonesia Untuk Thailand Jadi Tersangka Duta Besar RI untuk Thailand Muhammad Hatta ditetapkan sebagai tersangka oleh Kejagung terkait dugaan korupsi penyimpangan penggunaan dana DIPA tahun anggaran 2008/2009 pada KBRI di Bangkok. 5

Dua Lagi Terdakwa Demo Anarki Dihukum Enam Tahun Majelis PN Medan menjatuhkan vonis dua tahun penjara kepada Erwin Josua Tarigan dan empat tahun penjara kepada Ungkap Parasian Sihombing dalam kasus demo anarki massa pendukung pembentukan Provinsi Tapanuli (Protap) di gedung DPRD Sumut. 11

Dua Mayat Ditemukan Di Sungai Belawan Masyarakat di bantaran sungai Belawan, Dusun 4,, Desa Hamparan Perak, Kec. Hamparan Perak, Deli Serdang dihebohkan dengan penemuan dua sosok mayat pada waktu yang bersamaan. 10

Selat Malaka Rawan Penyelundupan Pasca tenggelamnya KM Harapan Makmur yang mengangkut monza dari Malaysia ke Aceh di perairan Kuala Peureulak, Kab. Aceh Timur, Provinsi Aceh, seolah makin terkuak informasi terkait aksi penyelundupan yang marak di perairan Selat Malaka. 23

Anggota DPR Harus Wakili Suara Rakyat

Kabinet Akomodatif

SURABAYA (Antara): Wakil Ketua Komisi Pemberantasan Korupsi (KPK), M. Jasin, menyatakan kerabat penyelenggara negara dan pejabat BUMN/ BUMD boleh mengikuti tender atau lelang proyek yang pendanaannya berasal dari keuangan negara. “Boleh-boleh saja keluarga atau kerabat penyelenggara negara ikut lelang, tapi harus sesuai prosedur dan diumumkan kepada publik, bahwa Si A saudara atau keponakan saya ikut dalam lelang,” katanya di Surabaya, Selasa (27/10). Demikian juga, kata dia, kalau ternyata saudara atau kerabat pejabat publik itu menang dalam lelang, harus


PERKEMAHAN MINA: Perkemahan yang disediakan selama di Mina, Senin (26/10). Perkemahan di Mina ditentukan oleh Pemerintah Arab Saudi dan disediakan bagi jamaah haji untuk melaksanakan mabit , tenda besar tersebut dilengkapi pendingin udara dan tahan api. setiap tendanya dilengkapi alas tidur berupa karpet tanpa bantal.

Gaji Menteri Sudah Lama Tak Naik BPK Takut Dikriminalisasi Jika

JAKARTA (Antara): Presiden Susilo Bambang Yudhoyono mengatakan gaji pejabat negara seperti presiden, wapres dan menteri tidak pernah naik dalam lima tahun terakhir dan itu merupakan hal langka dalam pemerintahan. “Ini atas instruksi presiden bahwa dalam lima tahun terakhir gaji presiden, wapres dan menteri tidak pernah naik, ini

hal langka dalam tata kelola pemerintahan kalau diukur secara internasional, yang biasanya ada penyesuaian,” kata Juru Bicara Presiden Dino Patty Djalal di kompleks Istana Presiden Jakarta, Selasa(27/10). Menurut Dino, instruksi presiden untuk mengkaji soal gaji pejabat negara itu sudah disampaikan kepada Menteri PAN dan Menkeu untuk dikaji

kemungkinannya. “Presiden menyebutkan bahwa dalam lima tahun belakangan ini, yang diutamakan untuk naik adalah gaji pegawai negeri, pejabat negara menengah ke bawah. Ini adalah instruksi presiden yang sangat jelas dan sistematis,” kata Dino.

Lanjut ke hal 2 kol. 1

Kitab Kuning Indonesia Dibajak Di Libanon Penerbit Minta Maaf JAKARTA (Antara): Kasus pembajakan kitab kuning karya ulama besar Indonesia Syekh KH Ihsan bin Dahlan oleh penerbit Darul Kutub al Ilmiyah berakhir dengan permintaan maaf penerbit dari Beirut, Lebanon tersebut. “Alhamdulillah sudah selesai Ramadhan lalu. Pihak Darul Kutub bahkan menawarkan kerja sama untuk menerbitkan kitab-kitab karya

ulama kita lainnya,” kata Ketua Pengurus Cabang Istimewa Nahdlatul Ulama Lebanon Muhammad Zainal Aziz di Jakarta, Selasa(27/10). Kasus pembajakan kitab kuning karya ulama dari Jampes, Kediri, Jawa Timur, itu terkuak berdasar informasi dari salah seorang alumni Pondok Pesantren Lirboyo Kediri pada 2008. Pembajakan itu terjadi sejak 2006.

Oleh pihak penerbit, nama pengarang kitab berjudul “Sirajut Thalibin” itu diganti Syekh Ahmad Zaini Dahlan Al-Hasani Al-Hasyimi. Beberapa bagian dari kitab asli juga dihilangkan. Kitab Sirajut Thalibin adalah kitab tasawuf yang merupakan penjabaran dari kitab “Minhajul Abidin” karya Imam Ghazali. Kitab ini aslinya

Lanjut ke hal 2 kol. 1

Buka Aliran Dana Bank Century

JAKARTA (Antara): Pengamat ekonomi Drajad Wibowo mengatakan, Badan Pemeriksa Keuangan (BPK) tidak berani mengungkap aliran dana pada Bank Century (BC) yang merugikan negara sampai Rp6,7 triliun karena takut dikriminalisasi. “Pada laporan awal BPK secara tertulis kepada pimpinan DPR disebutkan hasil audit BPK terhadap Bank Century ada indikasi tindakan pidana,” kata Drajad Wibowo di Jakarta, Selasa(27/10). Dikatakan Drajad, BPK juga memiliki data awal aliran dana BC dan sejumlah nama yang diduga terlibat pada aliran dana tersebut, tapi BPK tidak berani menelusuri lebih lanjut karena takut dikiriminalisasi seperti pimpinan Komisi Pemberantasan Korupsi (KPK). Namun, katanya, Jaksa

Agung Muda Tindak Pidana Khusus (Jampidsus) Kejaksan Agung menyatakan, aliran dana talangan dari pemerintah sampai Rp6,7 triliun tidak ada indikasi tindak pidana. Guna mendukung BPK menelusuri lebih lanjut aliran

tahun silam. Waktu itu, Iman dan Dody terlibat baku hantam dengan menggunakan senjata tajam di pasar sayur mayur Pasar Borong, Klang, Malaysia, mengakibatkan Iman meninggal dunia sedangkan Dody kritis dilarikan Wahyudi dan Erik ke rumah sakit. Haliman mengaku di rumah kos, pasca kejadian didatangi kelompok teman Iman dan dianiaya hingga koma tujuh hari.

Lanjut ke hal 2 kol. 1

Lanjut ke hal 2 kol. 1

Pria Asal Sidimpuan Tewas Ditembak Di Jakarta JAKARTA (Waspada): Tato Purba, pria asal Padangsidimpuan, selama dua tahun menjadi buronan kepolisian Polda Metro Jaya atas kasus perampokan rumah mewah di Jakarta. Dia akhirnya ditembak mati polisi, Senin (26/10) malam. Kasat Satuan Kejahatan

dan Kekerasan (Jahtanras) Dit Reskrimum Polda Metro Jaya, AKBP Nico Afinta membe-narkan penembakan itu. “Anggota kita semalam bermaksud menangkapnya, tapi akhirnya ditembak,” kata Nico di Polda Metro Jaya, Selasa (27/10).

Lanjut ke hal 2 kol. 4

Calhaj Sumut Kesulitan Capai Raudah

Airmata Kebahagiaan Tumpah Di KBRI KL AIRMATA bercucuran di lobby KBRI Kuala Lumpur Selasa (27/10) ketika tiga perempuan tua warga Afdeling I, Desa Aek Loba, Kec. Aek Kuasan bertemu ketiga putra masing masing, Haliman bin Herlan Sihombing, Wahyudi bin Boini dan Erik Kartem. Haliman, Wahyudi dan Erik sebelumnya didakwa hukuman gantung dalam perkara pembunuhan yang menewaskan TKI asal Air Joman, Kabupaten Asahan diidentifikasi bernama Iman, tiga

dana BC dan menyelesaikan laporan final hasil investigasinya, Drajad menyarankan agar DPR menggunakan hak angketnya yang akan menjadi dukungan moral terhadap BPK.

Merampok Di Rumah Dokter Pribadi Ani Yudhoyono

Tiga Warga Asahan Luput Dari Tiang Gantung

Waspada/Nurkarim Nehe

BERPELUKAN: Erik, satu dari tiga TKI yang dibebaskan Mahkamah Tinggi Shah Alam Malaysia dari tiang gantungan, memeluk Bupati Asahan Drs H Risuddin MSi di lobby gedung KBRI Kuala Lumpur, Malaysia, Selasa (27/10). Ketiga TKI ini dipulangkan ke tanah air Rabu (28/10) setelah proses imigrasinya selesai.

Cerita Hantu Jadi Pembicaraan Di Padang Mengaku Salah Seorang Korban Kirim SMS, Minta Dicarikan Kepalanya

WASPADA Peduli Sumbar

Lihat daftar nama penyumbang di halaman 5.

Harga Eceran: Rp 2.500,-

KPK: Sulit Hindari Konflik Kepentingan

Opini - 13

Bantuan untuk para korban gempa Sumatera Barat bisa disampaikan melalui transfer Bank An. Peduli Ummat Waspada Bank Muamalat Cabang Medan No. Rek. 211.00002.15 Bank Mandiri Cabang USU No. Rek. 106-0002203803 Bank Syariah Mandiri Cab. Medan No. Rek. 006.000832.1 BNI Cab. Medan No. Rek. 005.7504808 Bank Sumut No. Rek. Untuk keperluan publikasi, harap bukti setoran Bank dikirim melalui fax. 061-4511936 atau email:

ISSN: 0215-3017

Terbit 24 Halaman

Oleh Oleh H Irham Taufik Umri, SH, MAP DR. Drs. H. Ramli, MM

Opini - 13

Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999)

Keluarga Pejabat Boleh Ikut Tender

Lanjut ke hal 2 kol. 1

MUI Turunkan 20 Ulama Pantau Bantuan Israel

Harian Umum Nasional Terbit Sejak 11 Januari 1947

Waspada/Muhammad Faisal

MENYERAMKAN: Puing-puing di Hotel Ambacang, Kota Padang belum sepenuhnya dibersihkan. Sebagian warga percaya tempat tersebut banyak dihuni roh-roh halus korban gempa. Jika malam tiba suasana di lingkungan tersebut terasa menyeramkan. Foto diambil Senin (26/10).

PERCAYA atau tidak, tetapi ini menjadi perbincangan hangat masyarakat Kota Padang dan sekitarnya tentang banyaknya makhluk halus atau roh gentayangan pasca gempa terutama di Hotel Ambacang, Jl. Bundo Kanduang, Kota Padang, Sumbar. Entah siapa yang memulai mengisukan hal tersebut. Yang jelas, sejumlah masyarakat ada yang memercayainya dan ada juga yang tidak. Wartawan Waspada semula menanyakan alamat Hotel Ambacang, Minggu (25/10) siang kepada Amat, penjaga warung lotek (gado-gado) di Jl. Pasar Baru, Kota Padang. Di warung itu, kebetulan ada seorang laki-laki lagi yang kebetulan makan di warung loteknya Amat. Dia adalah seorang tukang ojek yang bernama Indra. Saat Waspada menanyakan alamat Hotel Ambacang kepada Amat, Indra langsung menyambutnya, “Ayo Bang saya antar, dekatnya dari sini,” terang Indra dengan logat Padangnya. Di situlah perbincangan kami mengenai arwah gentayangan itu dimulai. “Kalau malam-malam sekarang ke daerah itu seram bang, banyak hantu gentayangan,” terang Indra. Tapi, Indra mengaku belum pernah jumpa langsung sama arwah-arwah korban gempa di lokasi Hotel Ambacang tersebut. Dia mengetahui banyaknya hantu di lokasi tersebut dari seorang temannya. Indra menceritakan, saat itu temannya bercerita seorang supir angkot lagi narik angkot melewati hotel tersebut. Ketika itu, di reruntuhan hotel itu banyak orang yang menyetop angkotnya. Kebetulan saja angkot tersebut kosong, supir angkot itupun berhenti dan menyuruh calon penumpangnya itu masuk. Lanjut ke hal 2 kol. 6

MEDAN (Waspada): Jamaah calon haji asal Sumatera Utara dikabarkan kesulitan mencapai Raudah dan ziarah ke Makam Rasulullah, kecuali dengan perjuangan panjang dan sangat berat. Demikian disampaikan calhaj asal Medan, HM Hatta, Selasa (27/10), terkait kondisi para jamaah di Madinah saat ini. Hatta mengatakan, saat ini Madinah mulai dipadati oleh jamaah dari berbagai penjuru dunia, bahkan para jamaah asal berbagai negara itu mengenakan busana dengan warna yang serba mencolok. Sehingga pemandangan di area Madinah mirip kawasan fashion dengan berbagai motif, sayangnya busana Indonesia kurang memberikan warna mencolok. Kebiasaan jamaah untuk berbelanja sudah terasa, terutama membeli kurma dengan berbagai ukuran dan rasa. Dia menambahkan, suhu udara yang diperkirakan dingin, perlahan mulai menyengat tubuh terutama saat keluar dari Masjid Nabawi. Kegiatan lain, sambung Hatta, calhaj asal Medan semuanya berinisiatif untuk melaksanakan

Lanjut ke hal 2 kol. 1

erampang Seramp ang - Nampaknya banyak yang nggak kebagian lagi - He...he...he...

WASPADA Demi Kebenaran Dan Keadilan

Banda Aceh: Cuaca : Berawan dan hujan Angin : Tenggara - Barat Laut Kec. antara 10 s/d 30 Km/jam

Provinsi NAD: Lereng Timur Pegunungan, Dataran Tinggi, Pesisir Timur, Pantai Barat: Berawan dan hujan ringan

Temperatur Maks/Min: 330C - 240C BMKG Polonia


RABU, Wage, 28 Oktober 2009 /9 Dzulqa’dah 1430 H � No: 22952/A Tahun Ke-63

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

Terbit 24 Halaman � Harga Eceran: Rp 2.500,- (belum termasuk ongkos kirim)

Kloter IV Resiko Tinggi Rp7 M Dana Porprov Diduga Diendapkan BIREUEN (Waspada): Sedikitnya Rp7 miliar dari Rp12 miliar dana untuk pembangunan sarana dan prasarana Pekan Olahraga Provinsi (Porprov) Aceh XI di Bireuen 2010 yang telah disalurkan pihak provinsi sekitar sebulan lalu, diduga diendapkan di rekening oknum anggota panitia. Bahkan dikabarkan, sisanya Rp5 miliar lagi terancam belum bisa ditarik bila dana tahap pertama belum dipertanggungjawabkan. Sementara itu, Ketua Bidang Sarana dan Prasarana Porprov XI, Bukhari, mengatakan, pihaknya sedang mempersiapkan administrasi pra pembangunan sarana dan prasaran tersebut. Informasi yang diperoleh Waspada, kemarin dari berbagai sumber yang layak dipercaya, dana Rp7 miliar untuk pembangunan sarana dan prasarana pelaksanaan Porprov telah disalurkan sebulan lalu ke rekening panitia. Namun sampai sekarang masih diendapkan, sehingga sarana dan prasarananya belum dikerjakan. Padahal pelaksanaan pesta Lanjut ke hal 2 kol.1

Rampok Berlian Rp3 M Milik Dr Ibu Ani SBY, Warga Tapsel Ditembak Mati JAKARTA (Waspada): Aparat Satuan Kejahatan dan Kekerasan (Jatanras) Polda Metro Jaya menembak mati gembong perampok bernama Tato Purba. Tato diketahui pernah melakukan perampokan terhadap dokter pribadi Ny Ani Yudhoyono beberapa waktu lalu. Harta yang dirampoknya berupa berlian Rp3 miliar. Kepala Satuan Jatanras Ditreskrimum Polda Metro AKBP Nico Afinta saat dikonfirmasi membenarkan penangkapan tersebut. “Anggota Jatanras semalam menangkap tersangka,” kata Nico saat dihubungi wartawan, Selasa (27/10). Tato adalah buronan polisi sejak 2 tahun yang lalu. Dia dipergoki aparat di Jl Daan Mogot KM 13, Jakarta Barat, saat turun dari taksi menuju ke sebuah hotel di kawasan Jakbar pada Senin (26/10) malam. Saat polisi hendak menangkap, Tato melakukan perlawanan dengan menembaki petugas. Polisi kemudian memberikan tembakan peringatan dan berhasil melumpuhkan Tato. Namun Tato kemudian tewas saat dilarikan ke Rumah Sakit Polri, Jakarta Timur. Dari tangan Tato, polisi menyita 1 pucuk senjata api Lanjut ke hal 2 kol.1

Dilaporkan Ke Polisi, Muhyan Ingatkan Walhi Soal Data BANDA ACEH (Waspada) : Kepala Dinas Bina Marga dan Cipta Karya Provinsi Aceh, Ir MuhyanYunan mengingatkan LSM Walhi (Wahana Lingkungan Hidup Indonesia) untuk tidak salah memberikan data pada polisi. “Walhi salah minum obat. Jangan nanti balik diserang,” ungkap Muhyan yang dihubungi Waspada terkait laporan Walhi kepada polisi, Selasa (27/10) siang. Walhi melaporkan kepala Dinas Bina Marga dan Cipta Karya (BMCK) Provinsi Aceh, Muhyan Yunan, ke polisi, terkait pembangunan ruas Jalan Jantho-Lamno (kabupaten Aceh Besar) di kawasan hutan lindung. Direktur eksekutif Walhi Aceh, Bambang Antariksa, di Banda Aceh menyatakan, laporan dugaan perusakan hutan di kawasan hutan lindung itu sudah disampaikan ke Kapolda Aceh pada, Kamis (22/10). “Laporan Walhi Aceh telah diterima Kapolda Aceh melalui Ditreskrim berdasarkan Laporan Polisi No. Pol. : LP/B168/X/2009/ROOPS tanggal 22 Oktober 2009 tentang perambahan hutan lindung,” katanya. Muhyan menyebut, pembangunan jalan itu dilakukan karena jalan dimaksud sudah ada sejak 35 tahun silam, memang ada ruas jalan lain yang berada ditengah hutan yang sama di bangun oleh HPH namun kata Muhyan yang

BANDA ACEH (Waspada): Sedikitnya 216 jamaah calon haji kelompok terbang (Kloter) IV asal Kabupaten Pidie dan Pidie Jaya berisiko tinggi (Risti) dengan kesehatannya. Kloter IV berangkat penuh tanpa ada yang open seat atau gagal berangkat. Koordinator Humas Panitia Pembantu Penyelenggara Ibadah Haji (PPPIH), Juniazi, kepada Waspada, Selasa (27/10) merinci, Calhaj kloter IV berjumlah 325 orang jamaah dengan rincian jamaah haji lakilaki sebanyak 124 orang dan jamaah perempuan sebanyak 201 orang. “Tidak ada open seat, baik itu karena sakit atau meninggal dunia. Namun, dari jumlah tersebut, 216 jamaah berisiko tinggi terhadap kesehatannya,” kata Juniazi di sela-sele pelepasan Calhaj yang dilakukan langsung oleh Bupati Pidie, Mirza Ismail. Dia menyebutkan, nantinya calhaj Kloter IV ini akan menempati pemondokan di maktab yang berada di wilayah Nuzhah dan Zahir nomor 67. Kloter IV itu diisi penih oleh calon haji asal Pidie dan Pidie Jaya. Menurut dia, bagi jamaah yang berisiko itu harus menjaga kesehatannya ketika sudah tiba di tanah suci. Kata Juniazi, saat ini, suhu udara di Mekkah mencapai 25,0 derajat Celsius, dan Madinah suhunya mencapai 36,8 derajat Celsius. Lanjut ke hal 2 kol.6

Waspada/H. Rusli Ismail

PEMBALAKAN HUTAN: Hutan di kawasan Gunung Seulawah, wilayah Kabupaten Pidie dan Aceh Besar, semakin gundul akibat ulah tangan-tangan manusia yang tidak mengindahkan dampak dan bahaya kerusakan lingkungan. Pembalakan hutan itu masih saja terus dilakukan seperti terlihat, hutan atau kayu-kayu besar dan kecil terus ditebang untuk dijadikan kebun. Foto direkam beberapa waktu lalu.

Banyak Fakultas Di Unigha Tak Terakreditasi, Kampus Disegel SIGLI (Waspada): Sekira 2000-an mahasiswa Universitas Jabal Ghafur menggelar unjuk rasa ke Gedung Dewan Perwakilan Rakyat Kabupaten (DPRK) dan Kantor Buputi Pidie, Selasa (27/10) pagi. Mereka menuntut kedua lembaga negara itu mendesak pemilik yayasan memperjelas status universitas kebanggaan masyarakat Pidie tersebut. Pasalnya, kebayakan fakultas dan jurusan di universitas itu belum terakreditasi, sehingga banyak mahasiswa jebolan fakultas nomor satu di Pidie itu, mengantongi ijazah bodong (tidak jelas-red). Demo yang dikoordinir Pemerintah Mahasiswa (Pema) dan Dewan Legislatif Mahasiswa (DLM) Unigha, Sigli tersebut berlangsung tertib dan terkoordinir. “Berapa banyak sudah kor-

ban anak-anak Aceh, khususnya Pidie yang merasa dibohongi oleh pihak Unigha. Setelah lulus dan menerima selembar ijazah dari unifersitas ini hanya dapat digunakan sebagai pembungkus kacang, karena tidak diakui oleh Badan Akreditasi Nasional Perguruan Tinggi (BAN-PT)” teriak kordinator Pema Unigha T. Syawal dalam orasinya di Gedung DPRK Pidie. Hadirnya mahasiswa Unigha di Gedung dewan tersebut, diterima Ketua DPRK Pidie Muhammad AR dan sejumlah anggota dewan terhormat lainnya. Tak lama mereka berorasi, pimpinan DPRK Pidie meminta 15 orang perwakilan mahasiswa masuk ke dalam ruang rapat komisi, untuk berdelegasi. Ketua DPRK Pidie Muhammad AR berjanji akan menyelesaikan

carut marutnya persolan Unigha bersama dengan Pemkab Pidie hingga tuntas. “Sebenarnya persoalan ini sudah kita pikirkan sejak dulu, jauh sebelum kami duduk sebagai wakil rakyat di Pidie. Karena itu, persoalan mahasiswa akan kami bahas bersama Pemkab Pidie dan pemilik yayasan Unigha,” tegas Muhammad yang disambut gemuruh tepuk tangan mahasiswa. Usai berdelegasi di kantor dewan, lalu perwakilan mahasiswa menyerahkan kunci pintu kampus kepada pimpinan dewan untuk disimpan, dan mereka meminta wakil rakyat tidak menyerahkan kunci kampus kepada pemilik yayasan sebelum menyelesaikan semua Lanjut ke hal 2 kol.6

Baca Halaman Dalam Selat Malaka Rawan Penyelundupan

ACEH UTARA (Waspada): Ketua Majelis Permusyawaratan Ulama (MPU) Aceh Utara, Tgk H Mustafa Ahmad alias Abu Paloh Gadeng minta Gubernur Aceh, IrwandiYusuf jangan ragu tanda tangani Qanun hukuman rajam bagi penzina (Jinayat).

Pasca tenggelamnya KM Harapan Makmur yang mengangkut monza dari Malaysia ke Aceh di perairan Kuala Peureulak, Kab. Aceh Timur, Provinsi Aceh, Selasa (20/10) dini hari, seolah makin terkuak informasi terkait aksi penyelundupan yang marak di perairan Selat Malaka.

satwa dilindungi seperti gajah dan harimau dalam beberapa tahun terakhir. “Harimau dan gajah kini telah masuk ke kampung sebagai bukti terganggunya habitat hewan dilindungi itu. Kondisi ini tentunya tidak bisa dibiarkan dan perambahan hutan harus dihentikan segera,” katanya menjelaskan. Di pihak lain, Hasbi juga mempertanyakan program jeda tebang kayu yang digagas Gubernur Provinsi Aceh Irwandi Yusuf, beberapa tahun lalu. “Saya juga heran, kenapa penebangan hutan itu masih terjadi saat moratorium itu diberlakukan di seluruh Aceh. Itu mungkin tidak efektif atau perlu adanya ketegasan dan peraturan

Hal itu sebagai tanggapan ulama terhadap kesan keraguan para pejabat di Aceh, terkait Qanun Jinayat. “Kemungkinan akibat adanya keraguan dan bisikan, sehingga Irwandi Yusuf ragu-ragu dalam meneken Qanun Jinayat,” kata Abu Paloh

1 November Sumbar Direhab


Lanjut ke hal 2 kol. 1

BANDA ACEH (Antara): Ketua sementara Dewan Perwakilan Rakyat Aceh (DPRA) Hasbi Abdullah mengatakan, segala aksi pembalakan hutan harus segera dihentikan, menyusul semakin kritisnya kondisi hutan di provinsi itu. “Tidak ada alasan melakukan perusakan lingkungan. Kondisi hutan Aceh meski lebih baik dibandingkan daerah lain, namun harus segera diselamatkan,” kata Hasbi Abdullah, di Banda Aceh, Selasa (27/10). Di sela-sela pembukaan rapat forum koordinasi implementasi rencana strategis (renstra) pendidikan Aceh, ia menyatakan sebagai salah satu akibat dari pembalakan liar itu yakni terganggunya habitat

yang lebih tegas lagi,” katanya menambahkan. Oleh karenanya, legislatif Aceh mewacanakan memanggil Gubernur Irwandi Yusuf guna menanyakan masalah program “moratorium” yang sudah berjalan itu. Pada pihak lain, Hasbi Abdullahmengatakan,DPRAperiode 2009-2014 memiliki komitmen menyelamatkan hutan Aceh. Salah satu upaya itu dengan membentuk komisi khusus menangani masalah lingkungan. Data Greenomics menyebutkan, selama empat tahun proses rekonstruksi pascatsunami di Aceh, terjadi kerusakan tutupan hutan seluas 200.329 hektare akibat penebangan liar dan perambahan.

Gubernur Jangan Ragu Teken Qanun Jinayat

Lanjut ke hal 2 kol.6

Oleh H Ameer Hamzah Dialah yang telah menurunkan ketenangan dalam hati orang-orang mukmin supaya keimanan mereka bertambah di samping keimananan mereka (yang telah ada)... (QS. al-Fath:4) Sahabat Nabi Abubakar Siddiq pernah gelisah ketika berada dalam Gua Tsur bersama Rasulullah (Waktu Hujrah). Abubakar kembali gelisah menjelang pecah perang Badar. Rasulullah memberi resep ketetangan kepadanya. Allah bersama kita, sabarlah dan ingat Allah. Hanya dengan mengigat Allah hati menjadi tenteram. Abubakar langsung tenang. Pada dasarnya manusia diciptakan Allah dalam keadaan

Ketua DPRA: Hentikan Pembakan Hutan

Waspada/Muhammad Riza

SEGEL KAMPUS: Seorang kakek dengan mendayung sepeda melintas di depan mahasiswa Jabal Ghafur yang sedang menyegel kampus mereka di Jalan Lingkar, Keunire, Kota Sigli. Selasa (27/10).

WASPADA Peduli Sumbar Gempa bumi tektonik berkekuatan 7,6 SR meluluhlantakkan berbagai daerah di Sumatera Barat, Rabu (30/9). Jumlah korban tewas mencapai ratusan jiwa, mereka tertimpa dan tertimbun rerutuhan bangunan. Ribuan rumah penduduk, sekolah, rumah ibadah, gedung-gedung hancur—rata dengan tanah. Sarana infrastruktur rusak berat. Kini, mereka membutuhkan bantuan kita semua. Kepedulian Andasangatdibutuhkanuntukmeringankanpenderitaandanduka saudara kita yang terpaksa hidup di tenda-tenda darurat dengan kondisi serba kekurangan, sementara para korban yang cedera berat/ringanmemerlukan pertolongan medis segera. Kirimkan bantuan Anda melalui‘’WASPADA Peduli Sumbar’’. Berapapun bantuan Anda dapat meringankan mereka yang kini membutuhkanpertolongankita.Bantuandapatdisalurkanmelalui Peduli Ummat Waspada, Jalan Letjen Suprapto 1 Medan atau Bank Muamalat Cabang Medan No. Rek. 211.00002.15 dan Bank Mandiri Cabang USU Medan No. Rek. 106.0002203803. (Red)

J A K A RTA ( Wa s p a d a ) : Pemerintah segera melakukan tahap rehabilitasi dan rekonstruksi dalam penanganan bencana gempa di Sumatera Barat pada 1 November 2009 mendatang. Menurut Menteri Koordinator Kesejahteraan Rakyat Agung Laksono, telah disiapkan dana senilai Rp8,6 triliun untuk tahap rekonstruksi dan rehabilitasi ini.

“Rekonstruksi gempa dananya Rp8,6 triliun. Itu diambil dari APBN dan APBD, sumbangan masyarakat baik internasional maupun nasional,” kata Agung, seusai rapat koordinasi dengan menteri bidang kesejahteraan rakyat, di kantornya, Selasa (27/10). Agung menyebut, delapan Lanjut ke hal 2 kol. 3

Rekaman Bukti Rekayasa Kasus KPK

Cerita Wakil Jaksa Agung Ritonga Soal Rekaman WAKIL Jaksa Agung, Abdul Hakim Ritonga, akhirnya bicara. Setelah sebelumnya Ritonga terkesan menghindari wartawan. Pagi tadi Ritonga berbicara kepada wartawan, terkait rekaman yang menyebut namanya. Ritonga datang di Kejaksaan Agung pukul 08.35 dia menaiki mobil Toyota Altis hitam B 1517 WQ, wartawan yang menunggu Ritonga sedari pagi meminta sedikit keterangan dari Ritonga, tapi dia buru-buru memasuki kantornya. “Bapak ganti baju dulu,” kata Ajudan Ritonga. Sekitar pukul 09.50, Ritonga turun dari ruangannya dan didampingi Jaksa Agung Muda Intelejen, Iskamto. Dia menyapa wartawan yang Lanjut ke hal 2 kol. 1

Gadeng di ruang kerjanya, Senin (26/10). Menurut ketua MPU Aceh Utara ini, pihaknya optimis kalau Qanun Jinayat diberlakukan akan mengangkat wibawa, martabat dan moral orang Aceh. Karena dalam pelaksanaan hukum rajam terhadap penzina tentu sesuai dengan aturan yang lebih awal disosialisasikan Pemda sampai ke pelosok. Ia (Abu Paloh Gadeng) menyebutkan, ada pejabat daerah yang terkesan alergi terhadap penerapan Qanun Jinayat. Tak perlu alergi, kata dia, karena hukum jinayat akan dijalankan secara adil, sesuai dengan syarat yang ditetapkan dalam kitap Fiqih. Bahkan, jika Qanun satu ini ditetapkan akan jadi pagar (penghambat) maksiat di Aceh, sebab si pelanggar (Pelaku) akan takut dengan ancaman qanun ini. “Kenapa kita harus alergi ketika warga di Aceh kini nyaris tak mampu membendung Lanjut ke hal 2 kol. 3

erampang Seramp ang - Mengendap-endap - He... he... he... Vivanews

Wakil Jaksa Agung, Abdul Hakim Ritonga.

2 Cerita Wakil Jaksa Agung ... dari pagi menunggu. “Maaf ya kemarin cuma begini (Ritonga melambaikan tangan),” kata Ritonga kepada wartawan. “Apa kabar semua?” kata Ritonga membuka pembicaraan sebelum konferensi pers dimulai. Lantas Ritonga bercerita kemarin anaknya mendadak masuk rumah sakit. Pagi tadi dia mengantar adiknya masuk rumah sakit. Ritonga mengatakan, kemarin dia diminta klarifikasi oleh jaksa agung. “Apakah dalam penanganan perkara ini ada rekayasa Pak Ritonga?” kata Ritonga menirukan Jaksa Agung. Ditanya demikian Ritonga menjawab, “Saya tidak melakukan rekayasa tetapi penanganan perkara.” Kenapa berita itu beredar di masyarakat? Hal itulah yang membuat mantan Jaksa Agung Muda Tindak Pidana Umum ini berbicara pada wartawan. Menghela nafas sebentar Ritonga kemudian bercerita. Pada suatu malam, AH Ritonga dan jajarannya diperintahkan Jaksa Agung, untuk menerima ekspose perkara, pemerasan, dan penyalahgunaan wewenang aparat KPK. “Kasus tersebut ditangani Mabes polri,” kata dia, Selasa (27/10). Beliau (Jaksa Agung), kata Ritonga, memerintahkan dia bersama Jampidsus, Marwan Effendy untuk mengikuti ekspose. “Kami ekspose di mabes polri,” kata Ritonga. Menurut rencana, gelar perkara itu sebelumnya di Kejaksaan Agung, namun batal. Hadir dalam ekspos itu yakni Kepala Badan Reserse Kriminal Komisaris Jenderal Susno Duaji, Jaksa Agung Muda Tindak Pidana Khusus Marwan Effendy, Jaksa Agung Muda Tindak Pidana Umum Abdul Hakim Ritonga, dan beberapa staf. Dalam ekspos dibicarakan penyalagunaan wewenang. “Perbuatan yang disangkakan,” ujar Ritonga. Awalnya Ritonga berpikir undangan ekspose terkait kasus pembunuhan Direktur Putra Rajawali Bajaran, Nasrudin Zulkarnain. “Saya tolak kasus itu bukan kasus pidum (pidana umum),” kata Ritonga. Kasus itu menurut Ritonga menyangkut Pasal 12 E UndangUndang Pemberantasan Tindak Pidana Korupsi. Memperkuat pasal itu telah didapat keterangan Ari Muladi sebagai saksi utama.“Orang yang langsung melakukan penyerahan,” ujarnya. Selain itu ada pula keterangan Anggodo, Edi Sumarsono, ada pula testimoni Antasari. “Sesuai SPDP (Surat Pemberitahuan Dimulainya Penyidikan) yang kami terima, kami berkesimpulan kasus memenuhi syarat untuk ditingkatkan ke penyidikan,” kata dia. Kasus ini terus berlanjut. Konsultasinya bukan lagi pada jampidum tapi beralih pada jampidsus. “Sekali lagi ini bukan lagi ditangani pidum,” kata Ritonga menegaskan kembali. Dari situ Ritonga membantah adanya rekayasa P21 olehnya. Ritonga tak mau menanggapi panjang soal rekaman itu. “Kalau kita menanggapi itu barangnya kita tidak tahu,” katanya. “Ini beda dengan masalah yang dulu, Pak Uji dan Pak Kemas, itu nyata,” kata dia. Ditanya soal kemungkinan meminta rekaman ke KPK, Ritonga mengatakan tidak perlu. “Konsen kejaksaan bukan pada rekaman,” katanya. Menurut Ritonga, Kejaksaan lebih berkonsentrasi pada ada tidaknya rekayasa yang dilakukan oleh unsur kejaksaan dan kepolisian. Dia juga menyangkal ada pernah bicara dengan seorang perempuan. “Saya tidak tahu,” katanya. Disinggung soal pertemuannya dengan Anggodo, Ritonga mengatakan dirinya tak pernah menangani kasus Anggodo. Namun ketika ditanya apa dia kenal anggodo, Ritonga menjawab, “Anggodo semua orang kenal.” Meski demikian Ritonga tak mengenal siapa Bos Masaro itu. Ritonga pun tak pernah merasa pernah dihubungi orang dekat Anggodo. Wartawan memberondong Ritonga dengan pertanyaan, bagaimana jika KPK berani mengaluarkan bukti? “Belum tahu nanti kita lihat,” katanya. Lebih lanjut Ritonga menjelaskan KPK mengetahu pasti penyadapan yang diperkenankan sesuai undang-undang. “Apa ini soal tindak pindak pidana korupsi tentu dipertanyakan,” ujarnya. Ritonga memungkasi kalimatnya, “Kalau menyangkut kehidupan seseorang ini melawan hukum.”(vivanews)

Rp7 M Dana Porprov Diduga ... tahun 2009 akan berakhir,” ulangnya. Ketua Bidang Sarana dan Prasarana Porprov, Bukhari yang dikonfirmasi wartawan melalui handphone kemarin, mengatakan, pihaknya sedang mempersiapkan administrasi dan merancang gambar serta rancangan berbagai sarana dan prsarana pra pembangunan Porprov. “Kita memang belum mengerjakan atau belum turun ke lapangan, namun sedang membuat berbagai perencanaan sarana olahraga, seperti stadion dan berbagai sarana dan prasarana lainnya. Sedangkan kegiatan pembangunan mau pun rehab sarana dan prasarana itu belum dimulai,” jawabnya. Sementara Bendaharawan Panitia Porprov, Tarmizi yang dikonfirmasi terpisah, membenarkan Rp7 miliar telah masuk kas bendahara panitia Porprov. Namun dana tersebut sudah ada yang direalisasikan atau digunakan untuk persiapan pembangunan sarana dan prasarana. “Anggaran itu ada yang sudah direalisasi, bidang sarana dan prasarana yang lebih tahu tentang kemana saja uang tersebut telah digunakan,” jelas Tarmizi seraya menambahkan, sisa dana Rp5 miliar yang belum dicairkan tidak akan mati anggarannya, karena dana itu bukan untuk kas Pemkab Bireuen, tetapi untuk kas panitia Porprov. “Jadi meski tahun anggaran berakhir, namun sisa uang itu dapat dicairkan lagi tahap berikutnya setelah kita membuat laporan penggunaan dana Rp7 miliar itu, meski pun sudah memasuki tahun berikutnya.”(b03)

Rampok Berlian Rp3 M Milik ... jenis Colt kaliber 38 dan 5 butir peluru. Tato tercatat pernah melakukan perampokan di sejumlah tempat, termasuk merampok saudara dari penyanyi Ebiet G Ade. Warga Sidempuan, Tapanuli Selatan, Sumatera Utara, ini juga pernah merampok rumah pengusaha di kawasan Sunter, Jakarta Utara, dan membawa perhiasan hasil kejahatannya senilai total Rp 2 miliar.

Ketenangan ... keluh kesah, takut ditimpa bencana, bahkan ada yang takut kepada maob(padahal makhluk itu tak pernah ada). Anehnya manusia takut juga kepada ilusinya sendiri. Ketakutan yang berlebihan disebut juga pengecut. Orang yang sangat pengecut sama dengan orang mati sebelum mati. Orang mukmin tak pernah takut kepada siapapun, kecuali kepada Allah Azzawajalla. Takut kepada Allah tidak sama dengan takut kepada makhluk, takut kepada Allah bermakna taqarrub ( mendekatkan diri kepada Allah), ta’dzim ilallah (penghormatan kepada Allah), dan mudanat hamilah (pendekatan diri yang membawa) ridha Allah. Jika halhal tersebut sudah menjadi bagian dalam diri mukmin maka lahirlah ketenangan (ketenteraman) yang membawa kenikmatan beragama. Siapapun yang telah dicelupkan ketenangan dalam hatinya, maka taka ada musibah apapun di dunia ini yang dapat mempengaruhinya menjadi gelisah. Sejumlah syuhada Islam yang akan dieksikusi oleh musuh pada zaman perang Salib, masih tersenyum dan tak pernah menampakkan wajah putus asa. Kematian adalah haq, siapapun akan menemuinya bila sudah tiba ajalnya. (Ucapan as-Syahid Sayed Quthub menjelang eksikusi dirinya pada zaman Presiden Mesir Gamal Abdul Natseer. Ketenangan jiwa berasal dari Allah. Cuma Allah memberikan karunia itu hanya kepada hamba-hamba-Nya yang bersih lahir batin. Hamba Allah yang banyak mengingat Allah (zikir) baik dalam keadaan senang maupun susah. Para pendosa tak akan memperoleh ketenangan tersebut. Mereka tetap resah gelisah takut ditimpa bencana atas diri mereka.

Berita Utama

WASPADA Rabu 28 Oktober 2009

Agung: Enggak Naik Gaji SBY Kaji Wakil Ya Enggak Apa-apa Menteri Dua Pekan JAKARTA (Waspada): Presiden Susilo Bambang Yudhoyono akan menuntaskan permasalahan wakil menteri dalam waktu dua minggu. Dalam waktu dua minggu tersebut, SBY juga akan menunjuk staf khusus berikut dewan pertimbangan presiden yang akan membantu dalam waktu lima tahun mendatang. Hal ini ditegaskan Menko Perekonomian Hatta Rajasa di kompleks Istana Negara, Jakarta, Selasa (27/10). Menurut Hatta, merujuk UU Nomor 39 Tahun 2008 tentang Kementerian Negara, kewenangan menunjuk wakil menteri sepenuhnya berada di tangan Presiden. “Jadi, ini hak prerogatif Presiden,” paparnya. Kendati memastikan akan dituntaskan dalam waktu dua hari, mantan Menteri Sekretaris Negara ini mengaku, tidak terlalu mengetahui calon wakil menteri yang akan ditunjuk SBY. “Saya tak mau berspekulasi. Nanti dibilang, wah silver hair lagi. Repot kita nanti,” ujar Hatta seraya memastikan

1 November Sumbar ... kesejahteraan rakyat, di kantornya, Selasa (27/10). Agung menyebut, delapan Kabupaten/Kota yang terkena bencana gempa Sumbar hampir merampungkan penanganan dalam masa tanggap darurat. Diharapkan, pada akhir Oktober ini telah rampung sehingga pada 1 November 2009 nanti dapat dimulai masa rehabilitasi dan rekonstruksi. “Ini dipercepat dari rencana semula. Semula kan rencananya masa tanggap

Gubernur Jangan Ragu ... bentuk kemaksiatan lainnya hadir di daerah ini,” ujar Abu Paloh Gadeng. Qanun-qanun itu, tidak dijalankan secara serta merta. Contoh, sebutnya. Pemerintah melalui pengadilan menghukum pelaku pezina dicambuk, dirajam dan potong tangan bagi pencuri. Tentu dalam pelaksanaan diawali dengan menunjukkan dalil, seperti ada

wakil menteri berasal dari pejabat karier, bukannya sosok yang disodorkan partai politik. ”Mereka profesional,” katanya. Mantan Menteri Perhubungan ini mengatakan, Presiden Yudhoyono sempat menyebut enam departemen yang kemungkinan memiliki wakil menteri. Keenam departemen ini memiliki tensi kerja yang berlebih dari Presiden Yudhoyono. Enam departemen yang diungkapkan SBY sewaktu berada di Hua Hin, Thailand, adalah Departemen Luar Negeri, Departemen Keuangan, Departemen Perindustrian, Departemen Pendidikan Nasional, Departemen Pertanian, dan Departemen Perdagangan. “Kita tunggu saja,” tutur Hatta. Sebelumnya Menko Perekonomian Hatta Rajasa memastikan wakil menteri tidak akan diberikan untuk kalangan partai politik. Wakil menteri hanya akan diisi pejabat karir atau orang yang profesional di bidangnya. “Tidak... tidak (parpol), profesional. Itu adalah pejabat karir,” tegas Hatta usai bertemu Presiden Susilo

Bambang Yudhoyono di Kantor Presiden, Jakarta, Selasa kemarin. Dari sejumlah wakil menteri yang disiapkan, Hatta mengakui ada beberapa yang berada di bawah koordinatornya. Siapa saja dan apa saja kementeriannya sekarang sedang digodok. Presiden saat di Hua Hin, Thailand sempat menyebutkan wakil menteri akan ditempatkan di sejumlah departemen, seperti Departemen Pertanian, Departemen Keuangan, Departemen Perindustrian, Departemen Tenaga Kerja, dan Departemen Luar Negeri. Yang pasti jumlahnya tidak akan sampai setengah jumlah menteri yang ada, yakni 34 orang. “Separuh itu banyak, saya nggak usah berspekulasi. Tapi kalau separuhnya tidak,” kata dia. Kementerian itu, menurut Hatta memiliki intensitas dan frekuensi kerja yang tinggi sekali, sehingga dirasakan perlunya posisi wakil menteri sesuai UU Nomor 39 tahun 2008. Soal namanama calon wakil menteri ini, Hatta memilih bungkam. “Kalau nama-namanya saya tidak berani menyebutkan,” kata dia.(kps/VIVANEWS)

darurat mestinya selesai akhir November, tetapi menjadi akhir Oktober saja.” Saat ini, menurut Agung, tengah dilakukan inventarisasi bangunan untuk dihitung jumlah dampak kerugian yang timbul. Termasuk, beberapa infrastruktur, sarana negara, rumah sakit dan sekolah yang rusak akibat gempa. Kendati demikian, dia mengakui hingga kini masih ada beberapa daerah di dua Kabupaten yakni Agam dan Pariaman yang menjalani masa tanggap darurat karena kondisinya yang masih rusak berat. Karena itu,

dua Kabupaten ini belum akan memasuki masa rehabilitasi dan rekonstruksi pada awal November mendatang. “Ada dua kabupaten yang tetap dilakukan masa tanggap daruratnya. Ini dikecualikan karena keadaan situasi lapangan sehingga bantuan lauk pauknya tetap berjalan,” jelasnya. Rencananya, hari ini pelaksana jabatan Gubernur Sumbar akan mengirim surat kepada Presiden dan kantor Menko Kesra agar dilaksanakan masa rekosntruksi dan rehabilitasi pada 1 November 2009 mendatang.(kps)

empat saksi, ada bukti dan pengakuan pelaku, setelah ada ketetapan hukum seadil-adilnya baru dilaksana hukuman yang diputuskan. Soalnya kini yang perlu dipertanyakan, “apakah dengan lahirnya hukum Jinayat ini, pusat serius atau ngak memberikan Syari’at Islam untuk Aceh. Kalau serius, saya rasa tak masalah,” lanjut Abu Paloh Gadeng. Terkait qanun Syariat Islam, Senin (26/10) di Lhokseumawe, Kesatuan

Mahasiswa Muslim Indonesia (Kammi) melakukan demo damai dari Lapangan Hirak ke Bundaran dekat kantor Walikota Lhokseumawe, dengan mengusung poster, minta pemerintrah Aceh dan daerah melaksanakan Qanun Syari’at Islam yang telah disahkan agar dilaksanakan. “Hukum Syariat Islam bukan hanya disebut-sebut dibibir saja, tapi pelaksanaan lebih penting,” kata Ketua KAMMI Irza Ismail ST dalam orasinya.(b10)

Luput Dari Tiang Gantungan, Air Mata Tumpah Di KBRI KL AIR MATA bercucuran di lobby KBRI Kuala Lumpur Selasa (27/10) ketika tiga perempuan tua warga Afdeling I, Desa Aek Loba, Kecamatan Aek Kuasan bertemu ketiga putra masing masing, Haliman bin Herlan Sihombing, Wahyudi bin Boini dan Erik Kartem yang luput datri tiang gantungan, dibebaskan Mahkamah Tinggi Shah Alanm Kuala Lumpur tanggal 21 Oktober 2009. Haliman, Wahyudi dan Erik sebelumnya didakwa hukuman mati lewat tiang gantungan dalam perkara pembunuhan yang menewaskan TKI asal Air Joman, Kabupaten Asahan diidentifikasi bernama Iman, tiga tahun silam. Dikatakan Iman dan Dody terlibat baku hantam dengan senjata tajam di pasar sayur mayur Pasar Borong, Klang, Malaysia, mengakibatkan Iman meninggal dunia sedangkan Dody kritis dilarikan Wahyudi dan Erik ke rumah sakit. Haliman mengaku di rumah kos, pasca kejadian didatangi kelompok teman Iman dan dianiaya hingga koma tujuh hari. Polis Diraja Malaysia akhirnya menetapkan Haliman, Wahyudi dan Erik sebagai tersangka pembunuhan Iman, sedangkan Dody kabur dari rumah sakit, dan pengeroyok Haliman sampai saat ini tidak ditemukan. Dalam persidangan akhir di Mahkamah Tinggi Shah Alam, pengacara pengamat Sebastian Cha Tean An bersikukuh kliennya tidak bias dihukum sebab dakwaan Jaksa Penuntut Umum lemah karena kunci masalah Dody dan kelompok pengeroyok Haliman tidak bias dihadirkan Jaksa Penuntut Umum. Sejak bergulirnya perkara ini tiga tahun silam Pemkab Asahan c/q Dinas Tenaga Kerja Asahan dengan Zasnis Sulungs dari LBH Publiek Asahan-Tanjungbalai aktif memberikan dukungan hukum bersama pihak KBRI Kuala Lumpur, termasuk mendapatkan pengacara Sebastian Cha Tean An dari Sebastian Cha & Co Advocaters & Solicitors/Peguambela&Peguamcara, Johor Baru, Johor, Malaysia. Prihatin Ketiga perempuan, ibu kandung dari ketiga TKI yang luput dari tiang gantungan terdiri dari Ny Jessi (ibu

Haliman), Ny Inah (ibu Wahyudi), Ny Jariah (ibu Erik) datang ke Kuala Lumpur Malaysia didampingi Bupati Asahan Drs H Risuddin,MSi, Ketua TPPKK Asahan yang juga anggota FPG DPRD Sumut daerah pemilihan Asahan, Tanjungbalai, Batubara Hj Helmiati, Kadisnaker Asahan H Erwis Edi Pauja Lubis, SH.MAP, dan Kabag Humas Rahmat Hidayat Siregar, S.Sos.MSi. Rombongan dipandu Drs Mustafa Bakri, MA (Ketua Partai Golkar Luar Negeri) warga asal Asahan yang sedang study S3 di Kuala Lumpur Malaysia. Bupati Asahan sempat berbincang dengan Dubes RI untuk Malaysia Da’i Bachtiar sekira 15 menit, di mana Risuddin menyampaikan terimakasih atas kepedulian KBRI mengurusi persoalan masyarakat Indonesia di Malaysia, termasuk warga Kabupaten Asahan, seperti kasus tiga TKI yang diurus KBRI Kuala Lumpur sampai selesai proses keimigrasiannya, dan direncanakan Rabu (18/10) dideportasi kembali ke tanah air via Bandara Polonia. Pemkab Asahan menyediakan bus khusus untuk tiga TKI dan ibu mereka masing masing ditambah Kepala Desa Aek Loba Muhammad Tukidi. Dalam perbincangan itu Dubes Da’i Bachtiar menyatakan merupakan kewajiban pihaknya memfasilitasi urusan warga Indonesia di Malaysia, namun menyangkut masalah hukum harus diselesaikan secara hukum yang berlaku di Malaysia. Bupati dan Dubes sependapat sangat prihatin dengan kejadian tiga tahun silam, baku hantam sesamaTKI, warga satu nusa satu bangsa, bahkan satu Kabupaten di Pasar Borong, Klang, Malaysia. “Dengan siapapun harus dihindari perkelahian, apakah dengan warga dari asal negara atau asal daerah lain yang berbeda, apalagi dengan sesama warga satu kabupaten pula. Kami sangat prihatin. Kepada keluarga korban Iman kami harapkan ketabahan, dapat menerima putusan Mahkamah Tinggi Shah Alam, kemudian kepada ketiga TKI bersikap baik setelah pembebasan dari tiang gantungan. Cobaan

Waspada/Nurkarim Nehe

MEMELUK: Erik, satu dari tiga TKI yang dibebaskan Mahkamah Tinggi Shah Alam Malaysia dari tiang gantungan, memeluk Bupati Asahan Drs H Risuddin MSi di lobby gedung KBRI Kuala Lumpur Malaysia Selasa (27/10). Ketiga TKI ini dipulangkan ke tanah air Rabu (28/10) setelah proses imigrasinya selesai.

berat bagi ketiga TKI ini dalam menjalani tahanan di penjara Sungai Buloh selama tiga tahun,” ujar Risuddin. Dalam hal ini, lanjutnya, tidak ada yang menang dan tidak ada yang kalah, sebab dalam konteks kebangsaan kerugianlah yang timbul akibat baku hantam sesama warga Indonesia, bahkan sesama warga Kabupaten Asahan di perantauan pula. Risuddin berharap Disnaker Asahan ke depan dalam penataran, pelatihan dan pembekalan TKI yang akan disalurkan ke luar negeri menanamkan semangat kebangsaan yang tinggi agar hal seperti perkelahian sesame TKI akibat dipicu persaingan majikan seperti kasus almarhum Iman dapat dihindari. “Tanamkan semangat merah putih yang menggelora bagi pejuang pejuang devisa negara sepertiTKI yang bekerja di luar negeri, rasa senasib dan sepenanggungan di perantauan, silaturahmi sesame TKI tanpa memandang etnis, suku bangsa, agama, dan daerah, sebab kita adalah satu Indonesia,”tukas Risuddin. Usai berbincang dengan Dubes Da’i Bachtiar, Bupati Asahan Drs H Risuddin, MSi, Ny Hj Helmiati, Kadisnaker Asahan Erwis Edi Pauja Lubis, SH.MAP ditemukan Biro Hukum KBRI Kuala Lumpur Amiruddin Panjaitan (asal Bagan Asahan kecamatan Tanjungbalai, Asahan) di lobby gedung KBRI Kuala Lumpur. Yang duluan berhasil memeluk ibunya adalah Haliman, disusul Erik dan Wahyudi. Tangisanpun berhamburan. Mereka sudah lima tahun tidak bersua (ketiga TKI ini mulai merantau ke Malaysia tahun 2004). Lepas dari pelukan ibu masingmasing, ketiga TKI berhamburan memeluk Bupati Asahan dan rombongan.“Rajin shalat kalian ya. Jadi orang baik-baik ya nak..,” ucap Ny Hj Helmiati sambil mengusap bahu ketiga TKI saat bergiliran memeluk Bupati Asahan Drs H Risuddin, MSi. Derai tangis di lobby depan gedung KBRI Kuala Lumpur itu menjadi tontonan ekstra pegawai KBRI dan warga Indonesia yang berurusan di gedung itu, ditutup dengan doa bersama oleh Kepala Desa Aek Loba Muhammad Tukidi. “Kendati ketiganya bebas dari hukuman mati berdasarkan hukum yang berlaku di Malaysia, kami salut dengan jerih payah Zasnis Sulungs dari LBH Publiek Asahan-Tanjungbalai yang memberikan perhatian cukup serius. Kami juga prihatin dan menyesalkan terjadinya baku hantam tiga tahun silam sesama warga Asahan di Pasar Borong Klang Malaysia mengakibatkan Iman meninggal dunia. Semoga tidak terulang kembali,” ujar Risuddin. Bupati Asahan dan rombongan khusus menjemput ketiga TKI untuk dibawa pulang Rabu (28/10) via Bandara Polonia, setelah proses keimigrasian mereka selesai. Rombongan ini dijadwalkan tiba di Bandara Polonia Medan menumpang pesawat MAS (Malaysia Air System) Rabu (28/10) dan disambut Muspida Plus Asahan di ruang tunggu VIP Bandara Polonia Medan. (a10)

JAKARTA (Waspada): Di tengah pro dan kontra kenaikan gaji Menteri Kabinet Indonesia Bersatu II, Menteri Koordinator Kesejahteraan Rakyat Agung Laksono mengaku tidak mempermasalahkan jika gajinya tidak naik tahun 2010 mendatang. “Kalau buat saya, enggak naik (gaji) ya enggak apa-apa,” ujarnya, di kantornya, Jakarta, Selasa (27/10). Mantan Ketua Dewan Perwakilan Rakyat (DPR) ini mengaku lebih memprioritaskan pada pembicaraan program 100 hari kerja para menteri. Saat ini, program kerja ini tengah digodok di jajaran meteri KIB II.”Ngomongin program 100 saja dulu,” tandasnya. Ketika ditanya apakah gaji yang diterima menteri terbilang layak dan mencukupi, Agung mengaku tidak tahu. Pasalnya, dirinya baru bekerja beberapa hari menjadi menteri dan belum menerima gaji. “Belum gajian ini. Kerja dululah. Belum gajian sudah ditanya,” tandasnya. Fokus Kerja Polemik kenaikan gaji pejabat negara tidak menyita pikiran Menteri Riset dan Teknologi (Menristek) Suharna Suryapranata. Kader PKS yang baru menanggalkan jabatannya se-

bagai Ketua Majelis Pertimbangan Partai (MPP) ini mengaku hanya fokus pada kerja. “Sesuai arahan Presiden kita fokus pada program kerja, kita nggak mikirin gaji,” kata Suharna saat ditemui wartawan dalam acara Serah Terima Jabatan Presiden PKS di kantor DPP PKS, Jl TB Simatupang, Jakarta, Selasa kemarin. Jabatan Ketua MPP yang ditinggalkan Suharna kini diisi oleh Untung Wahono. Suharna mengaku gaji sebagai menteri sudahlah cukup. “Yang sudah ada, sudah sangat cukup. Saya tidak berpikir tentang itu (kenaikan gaji),” ujarnya. Saat ini, pria yang mendapat gelar sarjana dari Fakultas Matematika dan Ilmu Pengetahuan Alam Universitas Indonesia, mengaku sedang konsen menyusun rencana strategis dan program 100 hari untuk kementerian yang dipimpinnya. Badan Usaha Milik Negara Industri Strategis (BUMNIS), katanya, mejadi salah satu program kerja yang akan ia kembangkan. “Itu (BUMNIS) sesuai dengan arahan Presiden,” kata Suharna seraya mengatakan program 100 hari akan diumumkan Presiden SBY pada 5 November mendatang. (kps/dtc)

Kloter IV Risiko Tinggi ... Kata Juniazi, dengan berangkatnya Kloter IV, maka total jamaah yang sudah diberangkatkan dari kloter I sampai dengan IV sebanyak 1.292 orang jamaah dengan jumlah open seat 9 orang. “Jamaah termuda kali ini berumur 20 tahun berasal dari Gleumpang Tiga, Pidie. Sedangkan yang tertua berusia 88 tahun dari Mutiara, Pidie,” sebut dia. Data lain yang disodorkan Humas PPPIH ini menunjukkan, dengan berangkatnya kloter IV jumlah Calhaj yang sudah mendaftar dan mendapat seat dalam waiting list (daftar tunggu) untuk musim haji yang akan datang ikut berkurang. “Kini jumlah calon haji yang ada di waiting list sebanyak yaitu sebanyak 27.308 orang. Butuh waktu sekitar delapan tahun untuk memberangkatkan semuanya,” ujar Juniazi. “Kuota kita masih sekitar 3.500 setiap tahunnya.” Tahun ini, Aceh memberangkatkan 3.599 calhaj, namun yang dapat dipenuhi adalah 3.585 orang. Ke 3.585 Calhaj ini diberangkatkan dalam 11 kloter, yang dimulai pemberangkatannya pada Jumat (23/10) lalu. (b05)

Banyak Fakultas Di Unigha ... tuntutan mahasiswa. Setelah itu dengan berjalan kaki sepanjang satu kilometer, para demonstran menuju kantor Bupati Pidie. Munculnya mahasiswa Unigha di kantor pusat pemerintah daerah emping melinjo itu, sempat mengagetkan para pegawai yang sedang sibuk melayani masyarakat. Kegiatan kantor bupati sempat terhenti karena unjuk rasa yang dilakukan mahasiswa. Kehadiran mahasiswa Unigha di kantor bupati Pidie diterima Sekdakab Pidie Ir. M. Iriawan. Dalam sambutannya M. Iriawan mengatakan menyambut baik keinginan mahasiswa terkait persoalan akreditasi dan penegrian Unigha. Namun ia mengingatkan mahasiswa tidak melakukan perbuatanperbuatan yang dapat menimbulkan anarkis.” Itu kami tidak mendukungnya” tegas M. Iriawan. Amatan Waspada, kemarin ribuan mahasiswa Unigha sebelum melakukan unjuk rasa ke kantor DPRK dan kantor bupati Pidie terlebih dahulu menyegel sejumlah pintu kampus toko yang disewa pihak yayasan universitas tersebut yang sehari-hari digunakan sebagai kelas tempat belajar dan pusat administrasi Unigha yang terletak di Jalan Lingkar Keunire, Jalan Pasi Rawa, Kota Sigli dan di Kampus Unigha Gle Gapui, Kec. Indra Jaya. Kunci-kunci pintu toko kampus itu diserahkan kepada bupati Pidie yang diterima Sekdakab Pidie M. Iriawan dan pimpinan DPRK Pidie yang diterima langsung Ketua DPRK Muhammad AR. Usai melakukan unjuk rasa di dua kantor lembaga negara itu, lalu ribuan mahasiswa membubarkan aksinya dengan tertib. (b20)

Dilaporkan Ke Polisi, Muhyan ... dibangun pemerintah Aceh bukan buatan HPH, melainkan jalan yang sudah ada sejak lama. “ Karenanya sekali lagi saya katakan Walhi salah minum obat, bila tidak percaya ayo kita lihat bersama ke tengah hutan sana,” tantang Muhyan. Sementara Walhi menilai Muhyan melakukan tindak pidana perusakan hutan lindung berupa pembangunan jalan tanpa izin pinjam pakai kawasan hutan dan Analisa Mengenai Dampak Lingkungan (AMDAL) di ruas Jalan Jantho-Lamno. Sedikitnya ada tiga perundang-undangan dan peraturan pemerintah yang telah dilanggar.Yakni UU No 41 tahun 1999 tentang kehutanan, UU No 26 tahun 2006 tentang penataan ruang dan UU No 32 tahun 2009 tentang perlindungan dan pengelolaan lingkungan hidup. Kronologi dugaan pelanggaran pidana dilakukan Muhyan Yunan selaku penanggung jawab pelaksanaan pekerjaan pembangunan Jalan JanthoLamno pada 26 Mei 2008. Saat itu, jelasnya, kadis Bina Marga dan Cipta Karya, Muhyan Yunan, menerbitkan pengumuman pelelangan No 01/PAN-GAB/APBA/DBC/2008 di media massa, Senin, 26 Mei 2008. Dalam pengumuman pelelangan itu, pada paket pekerjaan bidang pembangunan jalan Jantho-Batas Aceh Jaya (Multy Years) dengan hasil akhir perkerasan, grade 7, kode/bidang 22001/Sipil Jalan dengan nilai anggaran Rp30 miliar. Diuraikan, berdasarkan hasil investigasi Walhi di ruas jalan tersebut pada 12-14 September 2009, fakta di lapangan menunjukkan bahwa, MuhyanYunan, telah merealisasikan pembangunan jalan tersebut hingga posisi koordinat 5013-32,6 LU dan 95026-42,5 BT dan berada di dalam kawasan hutan lindung. Dampak dari pembukaan ruas jalan itu telah mengakibatkan maraknya kegiatan pembalakan kayu di sepanjang ruas jalan tersebut.“Hal ini bertentangan dengan semangat kebijakan moratorium logging dan visi Aceh Green yang dicanangkan gubernur,” ungkapnya. Ditambahkan, perbuatan kadis Bina Marga dan Cipta Karya Aceh sebagai penanggung jawab proyek pembangunan jalan Jantho-Lamno, melanggar UU No 41/1999 jo Permenhut No P43/Menhut-II/2008 tentang pedoman pinjam pakai kawasan hutan. Selain itu, melanggar pasal 50 ayat (3) UU No 41/1999 huruf b dan huruf e, yang berbunyi, setiap orang dilarang merambah kawasan hutan, menebang pohon atau memanen atau memungut hasil hutan di dalam hutan tanpa memiliki hak atau izin dari pejabat yang berwenang. Ancaman pelanggaran tersebut diataur di dalam pasal 78 ayat (2), (5) dan ayat (14) UU 41/1999 dengan pidana penjara paling lama 10 tahun dan denda paling banyak lima miliar rupiah. Tindak pidana sebagaimana dimaksud dalam pasal 50 ayat (1), ayat (2) dan ayat (3) apabila dilakukan oleh dan atas nama badan hukum atau badan usaha, tuntutan dan sanksi pidananya dijatuhkan kepada pengurusnya, baik sendiri-sendiri maupun bersama-sama, dikenakan sanksi pidana sesuai dengan ancaman pidana masing-masing ditambah dengan 1/3 (sepertiga) dari pidana yang dijatuhkan. Selain itu, pembangunan ruas jalan Jantho-Lamno oleh dinas Bina Marga dan Cipta Karya dilakukan tanpa adanya dokumen Amdal. Pembahasan dokumen Amdal ruas jalan Jantho-Lamno baru memasuki tahap pembahasan oleh komisi penilai Amdal provinsi pada 16 Oktober 2009. Hal ini membuktikan bahwa pembangunan ruas jalan Jantho-Lamno dilakukan tanpa Amdal sebagai mana diwajibkan di dalam UU No 32/2009 tentang pokok- pokok pengelolaan lingkungan hidup. Dokumen Amdal, menurutnya, diperlukan sebagai bahan lampiran untuk mengajukan permohonan izin pinjam pakai kawasan hutan kepada Menteri Kehutanan. “Oleh karena Amdal ruas jalan Jantho-Lamno belum disahkan dan baru dibahas oleh komisi penilai Amdal provinsi, maka izin pinjam pakai kawasan hutan untuk kegiatan pembangunan infrastruktur jalan dipastikan belum dimiliki oleh Dinas Bina Marga dan Cipta Karya Aceh,” tegasnya. Fakta perbuatan melawan hukum lain yang dilakukan Kadis Bina Marga dan Cipta Karya Aceh adalah dengan merealisasikan ruas jalan Jantho-Lamno pada wilayah lain yang telah ditetapkan. Menurutnya, realisasi pembangunan jalan dengan Rencana Tata Ruang Wilayah Aceh tahun 1999 jauh berbeda. Begitu pula pada dokumen Amdal yang pada 16 Oktober 2009 disidangkan. “Pada Amdal disebutkan bahwa jalan Jantho-Lamno akan dibangun pada wilayah yang sesuai dengan RTRW Aceh tahun 1999, namun kenyataan yang ada bahwa jalan dibangun ditempat lain,” katanya. Terkait banyaknya pelanggaran dilakukan Kadis Bina Marga dan Cipta Karya Aceh, akhirnya Walhi Aceh meminta pihak Polda Aceh menindak tegas pelanggaran-pelanggaran yang dilakukan.(b32)

Berita Utama



Rabu 28 Oktober 2009

BPK Takut ... Dalam menggulirkan hak angket ini, kata Drajad, anggota DPR hendaknya tidak melihat dari perspektif anggota koalisi partai pemerintah atau di luar koalisi partai pemerintah, tapi melihat dari perspektif penegakan kebenaran demi kepentingan bangsa dan negara yang lebih besar. Anggota Komisi XI DPR periode 2004-2009 ini mengatakan, pembentukan panitia khusus hak angket BC harus segera dilakukan dan tidak perlu menunggu laporan final BPK, karena prosesnya akan bergulir cepat. “Kalau anggota DPR terlmbat dan ketinggalan informasi, maka akan sulit mengungkapkanya dan upaya mendeponiran Bank Century bisa terlaksana dengan baik,” katanya. Drajad menyambut positif renacana beberapa fraksi di DPR yang akan menggulirkan hak angkut untuk mengugkap kasus BC. Sementara itu, pengamat politik dari Lembaga Survei Indonesia (LSI), Burhanuddin Muhtadi mengatakan, pengungkapan kasus BC saat ini baru pada tahap awal, belum ada pengungkapan yang berarti. Laporan yang dibuat BPK, kata dia, baru berupa laporan awal dan belum ada tindakan lebih lanjut, sedangkan hak angket dari DPR juga baru berupa rencana dan belum terlaksana. Burhanuddin berharap, setelah persoalan BC dibahas di Bamus akan ada pertemuan untuk menetapkan hak angket DPR. Dikatakannya, untuk mengungkapkan pelanggaran aliran dana di BC, harus diungkap, berapa kali dialirkan dana ke BC setelah Perppu No 4 tahun 2008 tentang Jaring Pengaman Sistem Keuangan (JPSK) ditolak DPR pada 18 Desember 2008, berapa nilainya dan siapa yang menandatanganinya. “Jika hal ini diketahui, maka bisa ditelusuri lebih lanjut aliran dana tersebut,” katanya.

Kitab Kuning Indonesia ... diterbitkan penerbit Darul Fiqr, juga dari Beirut. Sirajul Thalibin mendapatkan pujian luas dari ulama Timur Tengah dan menjadi referensi utama para mahasiswa di Mesir dan negara-negara Timur Tengah yang lain, serta dikaji di beberapa majelis taklim kaum muslimin di Afrika dan Amerika. Ketua Umum Pengurus Besar Nahdlatul Ulama (PBNU) KH Hasyim Muzadi mengaku lega dengan selesainya kasus pembajakan tersebut. Hasyim sempat menyayangkan kurangnya perhatian berbagai pihak terhadap kasus tersebut, padahal menyangkut karya intelektual anak bangsa.

Gaji Menteri Sudah ... Selain itu, mengenai isu kenaikan gaji pejabat negara lima tahun ke depan, menurut Dino, Presiden mengharapkan agar hal itu dimasukkan dalam kerangka yang tepat dan adil. “Jangan bersifat parsial atau situasional dan dilakukan sesuai dengan kaidah tata kelola yang baik,” katanya. Persoalan rencana kenaikan gaji menteri belakangan menjadi polemik setelah pemerintah melontarkan rencana tersebut, namun beberapa pihak menolaknya karena dianggap kabinet belum lama dibentuk dan belum bekerja banyak.

Keluarga Pejabat ... diumumkan kepada publik, berikut penjelasan dan alasanalasannya. “Sebagai pejabat negara atau pejabat BUMN/BUMD memang sulit menghindari konflik kepentingan seperti itu. Tapi masalah ini perlu mendapatkan perhatian serius karena konflik kepentingan mendominasi sejumlah kasus korupsi yang ditangani KPK,” katanya. Oleh sebab itu, lanjut dia, masalah konflik kepentingan itu menjadi perhatian KPK dengan keluarnya Undang-Undang Nomor 7 Tahun 2006 sebagai upaya meratifikasi Konvensi Perserikatan Bangsa Bangsa (PBB) tentang korupsi. Sosialisasi undang-undang itu dilakukan KPK dengan mengadakan workshop tentang “Strategi Implementasi Penanganan Konflik Kepentingan di Indonesia”. “Hari ini workshop kami gelar di Surabaya. Selanjutnya kegiatan ini akan kami lakukan di Makassar, Bandung, Medan, Jakarta, dan Semarang,” katanya. Pemberlakuan UU 7/2006 itu, kata dia, dilatarbelakangi oleh sempitnya ruang lingkup pasal-pasal korupsi dalam UU 31/1999 yang diubah menjadi UU 20/2001 tentang Tindak Pidana Korupsi dalam menjerat koruptor. “Kami juga ingin memberikan efek jera terhadap para pelaku korupsi dengan berlakunya UU 7/2006 itu,” kata Jasin.

Calhaj Sumut ... zikir dan doa bersama serta mendoakan kota Medan agar tetap aman. Sayangnya, sambung dia, para calhaj sudah pula mulai mengeluhkan pengadaan makanan yang mulai terlambat dengan alasan kehabisan stok. Bahkan menjelang ashar, masih ada calhaj yang belum mendapat jatah makanan. Imbauan sabar menunggu dan banyak berdoa dan minum air zam-zam adalah obat hati para calhaj, demikian Hatta melalui telefon seluarnya. (m36)

Airmata Kebahagiaan ... Polis Diraja Malaysia akhirnya menetapkan Haliman, Wahyudi dan Erik sebagai tersangka pembunuhan Iman, sedangkan Dody kabur dari rumah sakit, dan pengeroyok Haliman sampai saat ini tidak ditemukan. Dalam persidangan akhir di Mahkamah Tinggi Shah Alam pada 21 Oktober 2009, pengacara pengamat Sebastian Cha Tean An bersikukuh kliennya tidak bisa dihukum sebab dakwaan Jaksa Penuntut Umum lemah karena kunci masalah Dody dan kelompok pengeroyok Haliman tidak bias dihadirkan Jaksa Penuntut Umum. Sejak bergulirnya perkara ini tiga tahun silam Pemkab Asahan c/q Dinas Tenaga Kerja Asahan dengan Zasnis Sulungs dari LBH Publiek Asahan-Tanjungbalai aktif memberikan dukungan hukum bersama pihak KBRI Kuala Lumpur, termasuk mendapatkan pengacara Sebastian Cha Tean An dari Sebastian Cha & Co Advocaters & Solicitors/Peguambela & Peguamcara, Johor Baru, Johor, Malaysia. Prihatin Ketiga perempuan, ibu kandung dari ketiga TKI yang luput dari tiang gantungan terdiri dari Ny Jessi (ibu Haliman), Ny Inah (ibu Wahyudi), Ny Jariah (ibu Erik) datang ke Kuala Lumpur didampingi Bupati Asahan Drs H Risuddin,MSi, Ketua TP-PKK Asahan yang juga anggota FPG DPRD Sumut daerah pemilihan Asahan, Tanjungbalai, Batubara Hj Helmiati, Kadisnaker Asahan H Erwis Edi Pauja Lubis, SH.MAP, dan Kabag Humas Rahmat Hidayat Siregar, S.Sos.MSi. Rombongan dipandu Drs Mustafa Bakri, MA (Ketua Partai Golkar Luar Negeri) warga asal Asahan yang sedang study S3 di Kuala Lumpur, Malaysia. Bupati Asahan sempat berbincang dengan Dubes RI untuk Malaysia Da’i Bachtiar sekira 15 menit, di mana Risuddin menyampaikan terimakasih atas kepedulian KBRI mengurusi persoalan masyarakat Indonesia di Malaysia, termasuk warga Kabupaten Asahan, seperti kasus tiga TKI yang diurus KBRI Kuala Lumpur sampai selesai proses keimigrasiannya, dan direncanakan Rabu (18/10) dideportasi kembali ke tanah air via Bandara Polonia. Pemkab Asahan menyediakan bus khusus untuk tiga TKI dan ibu mereka masing masing ditambah Kepala Desa Aek Loba Muhammad Tukidi. Dalam perbincangan itu Dubes Da’i Bachtiar menyatakan merupakan kewajiban pihaknya memfasilitasi urusan warga Indonesia di Malaysia, namun menyangkut masalah hukum harus diselesaikan secara hukum yang berlaku di Malaysia. Bupati dan Dubes sependapat sangat prihatin dengan kejadian tiga tahun silam, baku hantam sesama TKI, warga satu nusa satu bang-

Dari Periperal Menuju Poros


MENAIKKAN KAKI: Menteri Kelautan dan Perikanan Fadel Muhammad bersama istri dan pejabat eselon I Departemen Kelautan dan Perikanan mengunjungi Pelabuhan Pendaratan Ikan di daerah Pohe, Gorontalo, Selasa (27/10), guna menyaksikan secara langsung pendaratan ikan tuna hasil tangkapan nelayan. Fadel Muhammad menaikkan kakinya ke atas meja pedagang ikan dalam peninjauan tersebut. Kunjungan kerja Fadel ke Gorontalo adalah kunjungan kerja yang pertama Menteri Kabinet Indonesia Bersatu jilid II.

Petani Asal Humbahas Lahirkan Bayi Kembar Siam MEDAN (Waspada): Seorang ibu rumah tangga yang berprofesi sebagai petani asal Desa Sibaban, Kecamatan Pakkat, Kabupaten Humbang Hasundutan (Humbahas) melahirkan bayi kembar siam dempet bokong di RS Tarutung, Senin (26/10) malam sekira pukul 20:00. Bayi yang diperkirakan berjenis kelamin perempuan itu, kemudian dirujuk ke RSUP H. Adam Malik untuk menjalani perawatan intensif. Keduanya tiba di ruang Instalasi Gawat Darurat (IGD) Selasa (27/ 10) sekira pukul 06:30.

Kabag Hukum dan Humas RSUP H. Adam Malik drg. Atma Wijaya menjelaskan, bayi tersebut merupakan anak dari pasangan M. Sidabutar, 40 dan Letti Manalu, 37, yang berprofesi sebagai petani. Bayi tersebut lahir melalui operasi caesar di RS Tarutung dengan kondisi dempet pada bokong atau disebut conjoint twin abdomino caudal. Keadaan umumnya, kedua bayi memiliki berat badan 5.000 gram dan panjang 62 cm. Dari hasil amnanese (serangkaian wawancara medis), lanjut Atma, orangtua bayi ter-

sebut mengaku tidak pernah mengkonsumsi berbagai obatobatan termasuk obat tradisional (jamu). Jadi, belum diketahui faktor pemicu lahirnya bayi kembar dalam kondisi dempet bokong ini. Hasil pemeriksaan sementara diketahui kedua bayi tersebut memiliki empat kaki dan empat tangan. Sedangkan anus dan jenis kelamin belum diketahui. “Pihak keluarga menolak jika bayi itu difoto. Alasannya, ibu bayi yang masih dirawat di RSU Tarutung belum mengetahui kondisi bayinya,” ujar Atma.(m26)

Majikan Yang Siksa TKI Ditangkap KUALA LUMPUR, Malaysia (AP/Bernama): Seorang pria berusia 35 tahun dan istrinya ditangkap sehubungan dengan kematian seorang pembantu rumahtangga Indonesia, Mantik Hani, demikian menurut Direktur Reskrim Polisi Malaysia Mohd Bakri Mohd Zinin Selasa (27/10). Dia mengatakan polisi ingin meyakinkan semua pihak bahwa penyelidikan dilakukan secara profesional dan proses penyelidikam belum

akan disiarkan kepada publik. Media Malaysia lainnya menyebutkan pasangan majikan Mantik Hani itu adalah Vanitha dan Murugan — warga Malaysia keturunan India. Mantik, 36, dari Jombang, diduga dianiaya dan ditemukan dalam keadaan terkurung di kamar mandi sebuah rumah di Taman Sentosa, Klang. Mantik meninggal dunia dalam perawatan di ruang ICU RS Tengku Ampuan Rahimah di Klang sekitar pukul 10:00 Senin.

Dia mengalami cedera parah di beberapa bagian tubuhnya dan telah diselamatkan oleh polisi dari rumah itu. Menlu sedih Menteri luar negeri Malaysia Anifah Aman menyatakan kesedihan yang dalam atas meninggalnya Munti Senin kemarin. Pemerintah Malaysia menyatakan simpati sedalam-dalamnya dan ikut berduka cita kepada keluarga yang ditinggalkannya, juga kepada seluruh rakyat Indonesia. (ant/m18/m07)

Presiden Bantah ...

wartawan. Dalam transkrip percakapan tersebut, diduga ada upaya rekayasa kriminalisasi pimpinan KPK yaitu Chandra M Hamzah dan Bibit Samad Rianto yang saat ini sudah diberhentikan sementara karena sudah berstatus tersangka dalam kasus penyalahgunaan wewenang dan dugaan menerima suap. Sebelumnya, Ketua sementara KPK, Tumpak Hatorangan Panggabean menegaskan, KPK memiliki rekaman yang terkait dengan kasus itu. Menurut Tumpak, rekaman itu adalah hasil penyelidikan kasus dugaan korupsi Sistem Komunikasi Radio Terpa-

du (SKRT). Menurut Tumpak, KPK hanya akan memberikan rekaman itu kepada penegak hukum untuk memperjelas perkara. “Sepanjang aparat penegak hukum memerlukan untuk membuat perkara menjadi terang, tentunya kami selaku pimpinan KPK akan memberikan,” kata Tumpak. Tumpak tidak membenarkan maupun membantah ketika ditanya tentang transkrip rekaman yang beredar di sejumlah media massa. “Saya tidak bisa mengatakan itu benar atau tidak benar karena saya tidak akan menyampaikan isinya ke pers,” kata Tumpak.

Pria Asal Sidimpuan ...

mewah. Namun polisi belum mengetahui komplotan Tato, bahkan polisi menduga Tato adalah kepala komplotan pencurian dan perampokan itu. Sebagaimana catatan pihak kepolisian, Tato telah melakukan perampokan terhadap seorang dokter pribadi Ny. Ani Yudhoyono (ibu negara). Tato berhasil membawa berlian seharga Rp3 miliar dari hasil curiannya. Selain itu, melakukan perampokan di rumah salah seorang saudara dari penyanyi Ebiet G Ade. Kemudian berhasil menggondol perhiasan senilai Rp2 miliar dari rumah pengusaha itu di kawasan Sunter, Jakarta Utara. Dari tangan Tato, polisi menyita satu pucuk senjata api jenis colt kaliber 38 dan 5 butir peluru yang digunakannya melawan polisi. Kini jenazah Tato Purba masih terbaring di kamar mayat RS Polri. (j02)

Dino mengatakan, Presiden mengharapkan masyarakat tidak terpengaruh atas berita yang belakangan ini sering menyeret-nyeret nama Presiden dalam kasus dugaan rekayasa kriminalisasi pimpinan KPK. Nama Presiden Yudhoyono muncul dalam transkrip pembicaraan antara Anggodo dan Wisnu yang disadap oleh KPK antara Juli - Agustus 2009, dan telah beredar di kalangan

sa, bahkan satu Kabupaten di Pasar Borong, Klang, Malaysia. “Dengan siapapun harus dihindari perkelahian, apakah dengan warga dari asal negara atau asal daerah lain yang berbeda, apalagi dengan sesama warga satu kabupaten pula. Kami sangat prihatin. Kepada keluarga korban Iman kami harapkan ketabahan, dapat menerima putusan Mahkamah Tinggi Shah Alam, kemudian kepada ketiga TKI bersikap baik setelah pembebasan dari tiang gantungan. Cobaan berat bagi ketiga TKI ini dalam menjalani tahanan di penjara Sungai Buloh selama tiga tahun,” ujar Risuddin. Dalam hal ini, lanjutnya, tidak ada yang menang dan tidak ada yang kalah, sebab dalam konteks kebangsaan kerugianlah yang timbul akibat baku hantam sesama warga Indonesia, bahkan sesama warga Kabupaten Asahan di perantauan pula. Risuddin berharap Disnaker Asahan ke depan dalam penataran, pelatihan dan pembekalan TKI yang akan disalurkan ke luar negeri menanamkan semangat kebangsaan yang tinggi agar hal seperti perkelahian sesama TKI akibat dipicu persaingan majikan seperti kasus almarhum Iman dapat dihindari. “Tanamkan semangat merah putih yang menggelora bagi pejuang pejuang devisa negara seperti TKI yang bekerja di luar negeri, rasa senasib dan sepenanggungan di perantauan, silaturahmi sesama TKI tanpa memandang etnis, suku bangsa, agama, dan daerah, sebab kita adalah satu Indonesia,”tukas Risuddin. Usai berbincang dengan Dubes Da’i Bachtiar, Bupati Asahan Drs H Risuddin, MSi, Ny Hj Helmiati, Kadisnaker Asahan Erwis Edi Pauja Lubis, SH.MAP ditemukan Biro Hukum KBRI Kuala Lumpur Amiruddin Panjaitan (asal Bagan Asahan kecamatan Tanjungbalai, Asahan) di lobby gedung KBRI Kuala Lumpur. Yang duluan berhasil memeluk ibunya adalah Haliman, disusul Erik dan Wahyudi. Tangisanpun berhamburan. Mereka sudah lima tahun tidak bersua (ketiga TKI ini mulai merantau ke Malaysia tahun 2004). Lepas dari pelukan ibu masing-masing, ketiga TKI berhamburan memeluk Bupati Asahan dan rombongan. “Rajin shalat kalian ya. Jadi orang baik-baik ya nak..,” ucap Ny Hj Helmiati sambil mengusap bahu ketiga TKI saat bergiliran memeluk Bupati Asahan Drs H Risuddin, MSi. Bupati Asahan dan rombongan khusus menjemput ketiga TKI untuk dibawa pulang Rabu (28/10) via Bandara Polonia, setelah proses keimigrasian mereka selesai. Rombongan ini dijadwalkan tiba di Bandara Polonia Medan menumpang pesawat MAS (Malaysia Air System) Rabu (28/10) dan disambut Muspida Plus Asahan di ruang tunggu VIP Bandara Polonia Medan. (a10)

Tato Purba yang dikenal sebagai perampok miliaran dan dikenal nekad itu, tewas ditembak di Jl. Daan Mogot, Jakarta Barat. Tato yang diintai polisi saat itu tengah turun dari sebuah taksi yang ditumpanginya. Tato tidak menduga diintai polisi, dia bermaksud memasuki salah satu hotel di kawasan Jakarta Barat. Ketika diminta berhenti dan menyerah, Tato tidak menghiraukannya, kemudian melakukan perlawanan, dimana dia sempat mengeluarkan tembakan yang akhirnya membuat polisi mengeluarkan tembakan dan berhasil melumpuhkannya.Setelah tertembak, polisi melarikan Tato ke RS Polri Kramat Jati, namun akhirnya meninggal dunia. Tato merupakan spesialis perampokan rumah dan toko

Wakil Jaksa Agung ... “Kemudian, pada suatu malam, kami diperintahkan untuk menerima pemerasan dan penyalahgunaan aparat KPK yang penyidiknya dilakukan oleh Mabes Polri. Saat itu saya sebagai Jampidum (Jaksa Agung Muda Pidana Umum),” katanya. Ia menambahkan, selanjutnya ada gelar perkara atau ekspos kasus tersebut, dengan dihadiri Kabareskrim Mabes Polri. “Dalam paparan ekspos yang disajikan, perbuatan yang disangkakan adalah penyalahgunaan wewenang, penipuan dan sebagainya,” katanya. Saat itu, ia mengatakan, dirinya tengah menangani kasus dugaan pembunuhan Direktur PT Putra Rajawali Banjaran (PRB), Nasruddin Zulkarnaen, dengan tersangka pim-

pinan KPK, Antasari Azhar. “Kemudian saya tolak ekspos (soal penetapan tersangka pimpinan KPK) karena tidak ada kaitannya dengan jampidum,” katanya. Ia menambahkan jaksa agung muda tindak pidana khusus (Jampidsus) menyatakan bahwa pasal yang disangkakan kepada dua pimpinan KPK, yakni, Pasal 12E UU Tindak Pidana Korupsi dan waktu itu saksi utamanya adalah Ari Muladi, orang yang langsung melakukan penyerahan uang. “Kemudian saksi utama lainnya, Anggodo Widjoyo, Edi Sumarsono dan Testimoni Antasari Azhar,” katanya. “Dan kami berkesimpulan bahwa kasus ini memenuhi syarat lalu dilakukan penyidikan dan konsultasinya dengan jampidsus. Kasus itu ditangani jampidsus,” katanya.

Meski perhatian umat Islam dari seluruh penjuru dunia saat ini tertuju ke Haram, mereka mengumpul sejumlah harta untuk dapat mengunjunginya dalam rangka menunaikan rukun Islam kelima, dam merasa suci dan terbebas dari dosa saat kembali dari sana. Namun tempat suci dengan segala ritual yang dilakukan disana tidak sepi dari kritikan, baik yang bersifat strategis maupun yang bersifat sinis. Salah satu kritikan itu berbunyi: “Bagaimana mungkin sebuah agama yang mengaku paling monoteis mengajarkan sebuah ritual yang sama sekali bertentangan dengan Tauhid dan bahkan memelihara tradisi kaum pagan?” Kritik paling krusial tentu saja tentang Ka‘bah (Baitullah) dan Hajar al-Aswad. Para jama‘ah yang datang dari segenap penjuru dunia mementaskan suatu ritus yang merupakan darah dan daging kaum yang tak berperadaban: Berkeliling mengitari sesembahan sesekali menciumi, memeluk atau melambaikan tangan kepada batu hitam tersebut. Bagai budaya suku terasing mengelilingi api pepohonan atau altar sesembahan yang dipercaya memiliki kekuatan supernatural yang membawa dampak negatif kalau mereka tidak melakukannya. Kritik itu amat pedas, sinis, dan sangat tidak beralasan, karena didasarkan pada ketidakpahaman terhadap makna dan hakikat ibadah haji, termasuk thawaf. Disinilah engkau perlu mempertahankan aqidahmu, membuktikan bahwa tauhid adalah poros (pusat), bukan periperi (di pojok) kehidupan umat manusia. Umat Islam adalah penentu dan pemain utama pembangunan peradaban, bukan komunitas marginal (yang terpinggirkan). Kedatanganmu ke sini untuk itu. Sebab pemilik pusat bumi ini tidak saja orang Arab tetapi juga kaum muslimin dari seluruh penjuru. Yang harus memperjuangkan agar Islam menjadi pusat peradaban tidak saja kumintas Arab yang berjubah dan berjenggot tetapi juga komunitas kaum sarungan dan pengena ‘pitulun’ dari daerah yang jauh, Asia Timur atau Asia Tenggara, bahkan dari Afrika, Eropa, dan Amerika. Kalau engkau melakukan shalat di tanah air dengan menghadap kiblat (Ka‘bah), mata ke arah tempat sujud, kalbu menghadap (‘menemui’) Allah Swt., maka kini engkau berada diporos, di sisi Ka‘bah, di depan kiblatmu, lalu kalbumu akan engkau arahkan ke mana? Disinilah engkau harus menyadari bahwa yang engkau sembah bukan batu itu, tetapi Tuhan dari batu itu. (Q.S. Quraisy [106]:3). Kalau Allah hanya hadir di sini (di Ka‘bah), tidakkah Dia hadir juga dalam shalat dan hidup kita di tanah air?, Bagaimana mengorientasikan hati, kalbu, ruhani, atau apapun istilahnya saat jasadmu berkeliling atau shalat di sisi Ka‘bah?. Di sinilah perlu adanya penyelaman batinmu lebih dalam ke tujuan tertinggi ibadah ini yaitu Allah Swt yang Maha Esa dan tanpa sekutu bagi-Nya. Ka‘bah adalah bangunan peribadatan tertua yang ada di muka bumi. Ia merupakan poros dari ketundukan dan pertemuan seorang hamba dengan Tuhannya. Dalam hal ini amat menarik penjelasan Jawad Amuli: Ka‘bah sejajar dengan Bait al-Ma‘mur dan ‘Arasy Allah yang merupakan tempat thawaf para malaikat. Manusia, termasuk jama‘ah haji yang melakukan thawaf di Ka‘bah sama seperti yang dilakukan para malaikat di langit yang suci. Artinya ‘Arasy dan Bait al-Ma’mur ada di bumi dalam bentuk Ka‘bah. Dalam thawaf-nya, jiwa suci para jama‘ah haji akan naik menuju maqam yang tinggi menemui Tuhannya. Sebagaimana firman Allah Swt.: Kepada-Nyalah naik perkataan-

MUI Turunkan 20 Ulama ... dampak gempa. “Tim ini nantinya yang akan melakukan peninjauan pemberian bantuan dari pihak asing,” katanya. Kekhawatiran ini muncul karena masyarakat Sumbar yang dalam kesusahan cenderung mengubah tabiat menjadi menerima apa saja tanpa menelisik keberadaan bantuan itu sendiri.Karenanya ia mengaku kaget saat mengetahui bantuan masyarakat Israel sebesar US $ 500 ribu disalurkan Himpunan Mahasiswa Islam (HMI). “HMI yang menyalurkan bantuan masyarakat Israel, siapa orangnya?” kata Gusrizal.

Cerita Hantu ... “Tapi sudah jalan agak jauh, seluruh penumpang dari Hotel Ambacang itu hilang semua.” Ternyata cerita ini juga sampai ke kuping seorang dosen Universitas Andalas Dr. Ir. Arfa’i, MS. Kebetulan saja dosen ini menemani Waspada dalam menyalurkan bantuan pembaca Waspada ke beberapa daerah terisolir di Kenagarian Kuranji Hulu, Kab. Padang Pariaman. Dia menceritakan hal yang sama dengan apa yang diceritakan tukang ojek tersebut. Bahkan, dia ada satu cerita lagi yang tidak tahu asal cerita itu darimana, tapi dia dapat cerita itu dari temannya. Arfa’i menuturkan, yang mengalami kejadian ini adalah seorang TNI yang kebetulan saja lewat di lokasi hotel yang ambruk tersebut pada malam hari. Saat TNI ini lewat, dia melihat banyak orang di depan hotel tersebut. Tapi, saat dilihatnya lagi kebelakang semua orang yang tadi dilihatnya sudah tak ada lagi. Ketika ditanya tentang itu, Arfa’i mengatakan, tidak percaya. Tapi, banyak orang yang cerita tentang ini. Dan semua yang diceritakan itu kejadiannya sama. “Entah darimana cerita itu dapat. Kalau saya sih nggak percaya.” Salah seorang warga di sekitar hotel Ambacang Marni mengaku mendengar cerita yang serupa hanya saja dia tidak percaya mengenai cerita mistis itu. “Tapi kalau dilihat-lihat terus sih seram juga, apalagi puing-puingnya belum dibersihkan. Dan diperkirakan masih ada mayat yang tertimbun. Dan katanya lagi, saat TNI membersihkan puing-puingnya, TNI tersebut menemukan jari seseorang.” Kirim sms Vivanews juga mewartakan soal hantu gentayangan tersebut. Disebutkan, Seorang sopir angkutan kota jurusan Pasar Raya - Air Tawar, Tabing tanpa sengaja melihat sosok anak perempuan berada di antara reruntuhan. Waktu itu pukul 01:30 malam. “Aneh anak kecil ngapain malam-malam di hotel itu,” ujar Edi kepada vivanews.

perkataan baik dan amal yang shaleh menaikkannya. (Q.S. Fâthir [35]: 10). Kenaikan yang dimaksud di sini adalah kenaikan secara ruhani (Sha’ûd al-Ruhânî) bukan kenaikan jasad yang memerlukan ruang dan waktu. Dengan demikian prosessi ritualnya adalah thawaf atau shalat di sisi Ka‘bah. Namun hakikatnya ruhani manusia naik menemui Allah swt. Bukan menyembah benda di hadapannya, tetapi ruhani manusia naik ke hadirat Allah. Saat engkau berada di poros, ada dua hal yang perlu kau sadari. Pertama, engkau merasakan kehadiran Allah Swt, sehingga dapat menguatkan keimanan dan ketaatannmu serta menguatkan kembali janji penghambaan diri pada Tuhanmu. Bahkan di sini dapat muncul rekaman ulang (review) sejarah panjang kehidupan, kebaikan, kekhilafan, kesalahan, bahkan keburukan, semuanya diakui di hadapan-Nya, dan di tengah do‘a serta bacaan yang disampaikan, hatipun merasa tentram dan mendapat siraman rahman dan rahim Allah Swt. yang dirasakan hampir tidak diperoleh dimanapun di permukaan bumi. Menurut Ibn ‘Abbas, Hajar al-Aswad adalah simbol tangan Allah di bumi: Sesungguhnya rukun Hajar al-Aswad adalah “tangan Allah” di bumi, yang dengan itu ia menyalami hamba-hamba-Nya bagai seorang menyalami temannya.(Atiq Ghys al-Bilâdî: 19890. Di sinilah engkau melapor, mengaku, meminta ampun, dan memohon kepada Allah. Sebab sebagaimana sabda Rasulullah: Orang yang berhaji dan ber‘umrah ke Baitullah adalah tamu Allah. Jika mereka berdo‘a dikabulkan Allah, dan jika mereka meminta ampun, diampuni Allah. (H.R. al-Nasâ’î, Ibn Mazah, Ibn Khuzaymah dan Ibn Hibbân). Kesadaran tentang kehadiran Allah dan naiknya manusia secara ruhani menemui Allah swt., bukan dalam arti fisik dan waktu, akan tetapi makna simbolik dihadapanNya. Hal ini amat penting sebab tempat itu harus terjaga dari segala bentuk kesyirikan. Firman Allah: “Dan sucikanlah rumahKu ini bagi orang-orang yang thawaf dan orang-orang yang ruku’ serta sujud”. (Q.S. al-Hajj [22]:26). Bahkan Allah menyindir orang yang tidak memahami makna ritual ibadah ini dengan nada keras: (Q.S. al-Anfâl [8]:35). Kedua, Thawaf dan shalat di dekat Ka‘bah juga merupakan simbol kemerdekaan seorang manausia atas penghambaan terhadap apapun selain Allah swt. Hal ini dapat dipahami dari makna Ka‘bah sebagai “Bait al‘Atîq” (Rumah Kebebasan). Berthawaf di sekeliling Ka‘bah memberikan sebuah pelajaran tentang kemerdekaan dan kebebasan, sehingga seseorang tidak menjadi budak dari apa pun kecuali sebagai hamba Allah yang taat kepada-Nya. Firman Allah swt.: Dan hendaklah mereka melakukan thawaf sekeliling Baitul ‘Atîq (Rumah Kemerdekaan) (Q.S. al-Hajj [22]: 29). Ketiga, Pengalaman seorang jama‘ah haji saat thawaf di sekeliling Ka‘bah atau shalat di dekatnya dapat memberikan pencerahan bagi batinmu bahwa sebenarnya agama yang engkau anut ini bukanlah agama pinggiran dan yang termarginalkan. Dalam sejarahnya agama ini pernah menjadi poros sebagaimana dipentaskan oleh para Nabi dan khalifah yang ‘arif bijaksana. Oleh karenanya jangan sekali-kali engkau menganggap bahwa poros peradaban dunia itu adalah Washington DC atau New York, Paris atau Peking (Beijing) dan Tokyo. Sebab poros yang sesungguhnya ada di tanganmu. Banggalah dengan agama dan keimananmu. Wa Allâhu A’lamu bi al-Shawâb. Ia terkejut kenapa HMI bersedia menyalurkan bantuan dari masyarakat Israel yang dinilainya akan menjadi polemik di tengah ummat. “Kita khawatir, anak-anak ini (HMI) dimanfaatkan untuk kepentingan Israel,” kata Gusrizal. Siang kemarin, bantuan obat-obatan dari ma-syarakat Israel sampai di Bandara Internasional Minangkabau dengan menggunakan pesawat komersil. Bantuan ini langsung didistribusikan Ketua PB HMI Pusat Arif Mustofa ke Rumah Sakit Umum Daerah Pariaman. Menurut Arif, bantuan ini murni atas nama kemanusiaan sehingga pihaknya meminta tidak terjadi polemik atas bantuan tersebut. (VIVAnews) Memang sulit dibuktikan cerita sopir itu. Namun sejumlah sopir lain yang sempat melintas merasakan hal serupa. “Tidak hanya penampakan, terdengar juga suara-suara aneh minta tolong dan tangisan,” kata Edi, 35, diamini sopir lainnya. Masyarakat meyakini masih banyak korban tertimbun dan masih hidup di antara reruntuhan dan puing-puing hotel. “Menurut ceritanya masih ada orang yang belum dievakuasi dari reruntuhan hotel, bahkan suarasuara orang minta tolong masih terdengar jelas,” aku Edi. Tidak hanya itu, sempat beredar di masyarakat pesan pendek tentang salah seorang korban berinitial T. Dalam short message service (SMS) yang dikirim T secara berantai itu sempat menghebohkan warga kota. Dalam pesan pendek itu dikabarkan T, siswi salah satu Sekolah Menengah Kejuruan di Padang kehilangan kepalanya di reruntuhan Hotel Ambacang. “Dia meminta agar kepalanya dicarikan,” kisah Kustiah Reni Putri, 27, mengaku menerima sms menyeramkan itu. Karena tak ingin menanggung sendiri beban tersebut, pesan diteruskan berantai ke sejumlah rekannya. “Reni juga dengar, kalau gak salah siswi itu merupakan salah satu korban yang dievakuasi dari reruntuhan hotel,” katanya. Sejumlah orang mengaku menerima pesan pendek tersebut mencoba menghubungi nomor telefon selular milik T. “Hanya nada sambung pribadi yang terdengar dan tidak ada jawaban,” ungkap Reni. Saat gempa mengguncang Sumbar, Hotel Ambacang ambruk dan menimbun puluhan pengunjung. Saat gempa ratusan orang terkurung di dalam karena tidak berhasil menyelamatkan diri dari reruntuhan gedung. Terakhir, pihak Korem 032 Wirabraja mengaku masih mencari sejumlah korban yang masih tertimbun di reruntuhan gedung. Namun setelah tiga pekan, penghentian pencarian korban dihentikan karena sudah tidak mungkin ada korban masih hidup. * Mursal AI/Aidi Yursal

Luar Negeri

WASPADA Rabu 28 Oktober 2009

Pelaku Pengeboman Baghdad, Kelompok Asuhan Al-Qaida

Iran Setujui Rencana PBB TEHERAN, Iran (AP): Jaringan televisi pemerintah mengatakan Iran akan menyetujui ‘kerangka umum’ dari naskah rencana PBB untuk mengirimkan uranium yang diperkaya keluar negara itu guna diproses, namun akan berusaha ‘melakukan perubahan penting’ dalam perjanjian tersebut. Laporan Selasa (27/10) itu di saluran televisi pemerintah Al-Alam tidak menyebutkan secara spesifik amandemen yang diinginkan Iran. Televisi itu mengatakan Iran secara resmi akan menjawab dalam waktu 48 jam. Rencana itu menyerukan pada Iran agar mengirimkan 70 persen dari uraniumnya yang diperkaya keluar negeri untuk pengayaan lebih lanjut. AS dan sekutunya melihat perjanjian itu sebagai satu cara sekurangkurangnya untuk menangguhkan kemampuan Iran membangun persenjataan nuklir. Iran membantah adanya keinginannya untuk membuat bom nuklir. Saluran televisi pemerintah Iran lainnya, Press TV, mengatakanTeheran menentang untuk mengirimkan seluruh pengayaan ke luar negeri. (m07)

BAGHDAD, Irak (AP): Kelompok asuhan al-Qaida di Irak mengaku bertanggungjawab atas dua serangan bom bunuhdiri di Baghdad yang menewaskan sedikitnya 155 orang itu minggu ini. Kelompok yang dikenal bernama Islamic State of Iraq itu mengatakan dalam satu pernyataan yang disiarkan di Internet bahwa ‘para pejuangnya tengah mengarahkan serangan ke sarang-sarang para pengkhianat.’ Kebenaran pernyataan itu, yang disiarkan Senin (26/10) di situs yang biasa digunakan

untuk menyiarkan pesan-pesan militant, tidak bisa dikonfirmasi. Kelompok yang sama juga mengaku bertanggungjawab atas serangan bom terhadap dua gedung kementrian di Baghdad Agustus lalu, ketika lebih 100 orang tewas. Tiga gedung pemerintah hancur atau rusak berat dalam serangan Minggu. Korban tewas termasuk 24 anak-anak yang terperangkap di dalam bus yang baru saja meninggalkan satu pusat penitipan anak.(m18)

Wanita Besi Serbia-Bosnia Dibebaskan Dari Penjara

The Associated Press


Seorang petugas darurat berjalan di dekat reruntuhan satu pesawat jet bisnis Rusia yang jatuh dekat Minsk, Belarus, Selasa (27/10). Sekurang-kurangnya lima orang tewas dalam kecelakaan yang terjadi Senin malam itu.

Sri Lanka Selidiki Kejahatan Perang KOLOMBO, Sri Lanka (Antara/AFP): Pemerintah Sri Lanka menyatakan segera menyelidiki tuduhan mengenai kejahatan perang yang dilakukan pasukannya dalam sebuah laporan yang dikeluarkan Kementerian Luar Negeri AS. Menteri Hak Asasi Manusia Mahinda Samarasinghe mengatakan Senin (26/10), Presiden Mahinda Rajapakse segera membentuk sebuah komite untuk menyelidiki insiden-insiden yang tercantum dalam laporan itu, yang diajukan ke Kongres AS pekan lalu. “Presiden memutuskan bahwa dia akan membentuk komite untuk menyelidiki isi laporan itu,” kata menteri itu kepada wartawan di Kolombo. “Setelah itu, kami akan menyatakan sikap kami mengenai masalah ini.” Namun, Kementerian Luar


Negeri Sri Lanka membantah laporan itu dan menyebutnya sebagai “tidak benar dan tanpa bukti nyata”. Sri Lanka mendapat tekanan internasional agar menyelidiki tuduhan-tuduhan mengenai pelanggaran hak asasi manusia dan kejahatan perang selama tahaptahap final perangnya terhadap pemberontak Macan Tamil, yang dikalahkan pada Mei lalu. Termasuk klaim-klaim yang dirinci dalam laporan AS itu adalah tuduhan bahwa para pemimpin Macan Tamil telah mencapai kesepakatan penye-

rahan diri degan pasukan pemerintah namun mereka kemudian dieksekusi. Senin, pemerintah Sri Lanka menolak lagi tuduhan baru bahwa pemimpin Macan Tamil Velupillai Prabhakaran dibunuh setelah menyerah kepada pasukan keamanan. The Sri Lanka Guardian, sebuah situs berita berpusat di AS yang menyebut dirinya sebagai organisasi berita independen, melaporkan bahwa Prabhakaran menyerah namun disiksa dan dibunuh oleh militer. Situs itu mengutip tiga sumber, termasuk seorang pengawal yang mengatakan bahwa dia berhasil menyelamatkan dari ofensif final dan meninggalkan Sri Lanka, serta pejabat-pejabat dari badan intelijen dan kementerian pertahanan Sri Lanka.

Namun, kementerian itu mengatakan dalam sebuah pernyataan, ada kampanye untuk menerbitkan ‘cerita-cerita rekayasa’ dalam upaya menyeret militer Sri Lanka ke pengadilan kejahatan perang. Pemerintah ultranasionalis Sri Lanka sejauh ini menolak seruan-seruan bagi penyelidikan kejahatan perang selama penumpasan militer terhadap pemberontak separatis Macan PembebasanTamil Eelam (LTTE) dan berhasil terhindar dari debat Dewan Keamanan PBB mengenai masalah itu berkat dukungan dari China dan Rusia. PBB menyatakan, lebih dari 7.000 warga sipil mungkin tewas dalam lima bulan sebelum perang berakhir pada Mei dengan kekalahan Macan Tamil. Pemerintah Sri Lanka pada

18 Mei mengumumkan berakhirnya konflik puluhan tahun dengan Macan Tamil setelah pasukan menumpas sisa-sisa kekuatan pemberontak tersebut dan membunuh pemimpin mereka, Velupillai Prabhakaran. Pernyataan Kolombo itu menandai berakhirnya konflik etnik paling lama dan brutal di Asia yang menewaskan puluhanribu orang dalam berbagai pertempuran, serangan bunuh diri, pengeboman dan pembunuhan. Macan Tamil juga mengakui bahwa Velupillai Prabhakaran tewas dalam serangan pasukan pemerintah Sri Lanka. Juga dinyatakan tewas dalam operasi final militer adalah dua deputi Prabhakaran — pemimpin Macan Laut Kolonel Soosai dan kepala intelijen LTTE Pottu Amman.

STOCKHOLM, Swedio (CNN): Mantan pemimpin Serbia-Bosnia Biljana Plavsic telah dibebaskan dari penjaraa di Swedia Selasa (27/ 10) setelah menjalani sepertiga masa hukumannya yang 11 tahun karena tuduhan kejahatan terhadap kemanusiaan. Plavsic, 79, yang pernah dijuluki ‘Wanita Besi’ pada masa perang Bosnio tahun 19921995 , meninggalkan negeri itu setelah dibebaskan, kata dinas penjara Swedia. Pembebasan dini Plavsic pekan lalu telah mengundang protes marah di Sarajevo, ibukota Bosnia-Herzegovina, setelah dia menghabiskan waktunya hampir empat tahun di penjara. Pembebasan itu juga dilakukan pada saat peradilan atas pendahulunya, Radovan Karadzic, yang sedang berlangsung di Denhaag, Belanda. Karadzic ditangkap tahun lalu setelah lebih dari satu dasawarsa diburu. Plavsic menggantikan Karadzic sebagai pemimpin Serbia-Bosnia ketika dia digulingkan dari kekuasaan tahun 1995. Keduanya dituduh

sebagai penjahat perang oleh Mahkamah Kejahatan Internasional untuk Bekas Yugoslavia tahun 2001, bersama dengan mantan ketua parlemen Serbia-Bosnia Momcilo Krajisnik. Tahun berikutnya, dia mengaku bersalah atas satu kejahatan terhadap kemanusiaan sebagai tukarannya para jaksa penuntut menggugurkan tujuh tuduhan kejahatan perang lainnya, termasuk dua tuduhan genosid. Mahkamah Kejahatan Perang PBB yang menghukumnya 11 tahun penjara, mengatakan dalam keputusannya Februari 2003 bahwa Plavsic ikut berpartisipasi dalam ‘suatu kejahatan paling berat’ dan ‘tidak ada hukuman yang sepenuhnya dapat merefleksikan horor dari apa yang terjadi atau dampak mengerikan pada ribuan korban.’ Sesuai dengan UU Swedia, dia pantas dibebaskan setelah menjalani 2/3 masa hukumannya. (m07)

AI: Israel Siksa Warga Palestina Dengan Batasi Air JERUSALEM (AP): Amnesti Internasional (AI) menuduh Israel memompakan air minum dengan jumlah yang tidak sepadan dari akses yang dikuasai mereka di Tepi Barat, yang menyebabkan warga lokal Palestina memperoleh pasok air dalam jumlah kecil. Kelompok pembela HAM yang bermarkas di London itu juga mengatakan dalam laporannya yang disiarkan Selasa (27/10) bahwa Israel telah memblokade berbagai proyek infrastruktur yang akan memperbaiki arus pasok air kepada masyarakat Palestina — baik di Tepi Barat maupun mereka yang tinggal di Jalur Gaza. “Tindakan ini telah mempengaruhi setiap langkah kehidupan warga Palestina,” demikian menurut periset AI mengenai Israel, Donatella Rovera, kepada The Associated Press dalam satu wawancara khusus Senin, sebelum disiarkannya laporan itu. Para pejabat Israel membantah tuduhan itu.

Israel mengkonsumsi air empat kali lebih banyak dibandingkan dengan orang Palestina, yang memanfaatkan rata-rata 70 liter per hari per orang, kata laporan itu —yang berjudul Troubled water - Palestinians denied fair access to water. AI menyatakan ketidaksamaan bahkan lebih mencolok di sebagian daerah Tepi Barat, di mana pemukiman menggunakan air sampai 20 kali lebih banyak per kapita dibandingkan masyarakat Palestina di wilayah tetangganya yang harus bertahan hidup dengan kurang dari 20 liter air per orang per hari. “Kolam renang, lapangan yang diairi dengan baik dan pertanian dengan irigasi besar di permukiman Israel di OPT (wilayah pendudukan Palestina) sangat bertolak-belakang dengan desa Palestina di dekatnya yang warganya bahkan harus berjuang untuk memenuhi kebutuhah air buat rumah tangga mereka.”(m07)



WASPADA Rabu 28 Oktober 2009

Kiwil: Pikir 1000 Kali Bila Ingin Berpoligami Pelawak Kiwil mengaku pada awalnya dia tak pernah berniat berpoligami. Karena dia memandang tak mudah untuk melakukan hal itu. “Sebenarnya saya tak suka. Karena itu berpikirlah 1000 kali lebih dahulu kalau mau berpoligami. Karena untuk berpoligami itu bukanlah hal yang gampang,” kata Kiwil saat dihubungi Senin (26/10) malam. Kiwil mengaku dirinya tak pernahmemilikikeinginanuntuk berpoligami. Tetapi, ternyata dia menikah lagi dengan wanita lain. Dia pun tak menyesali telah

melakukan poligami. “Penyesalan itu percuma ya. Itu kan masa lalu saat awal-awal semuainikanprosesberkeluarga. Kenapa sih masalah poligami harus dipermasalahkan?,” ujarnya. Kiwilmengakudirinyaberniat untuk bergabung dengan klub poligami di Bandung. Tak hanya itu, dia juga senang mengikuti seminar-seminar yang membahas soal poligami. Klub Poligami Aneh Sementara pedangdut Kristinamengakutidaksetujudengan adanyaklubpoligamidiBandung. Dia khawatir kehadiran klub

tersebutakanberdampaknegatif. Kristina menilai kehadiran klub poligamidiBandungituadalahsuatu hal yang aneh. “Aneh aja, nggak usah bikin klub kayak gitulah. Aku sihnggaksupport,nantimalahtambahbanyaklagi,”kataKristinasaat dihubungi Senin (26/10) malam. Pelantun ‘Jatuh Bangun’ ini mempertanyakan maksud dibuatnyaklubpoligamitersebut. Pedangdut bertubuh mungil ini merasakeberatandenganadanya klub poligami tersebut. “Lagian nanti laki-laki tambah belagu, tambah sombong lagi,” ucapnya.(VIVAnews) Kiwil

Maxima Siap Kontrak Miyabi Tiga Film

Julia Robert berada di lokasi syuting/ist/dth

Eat, Pray, Love Rombak Kawasan Kuta Jadi Nuansa Ubud Eat, Pray, Love, film dibintangi Julia Roberts melanjutkan proses syuting di Ungasan, Kuta Selatan. Demi film itu, kawasan Ungasan pun dirombak untuk menciptakan nuansa Ubud. Berdasarkan pantauan di Ungasan,Selasa(27/10),beberapa kios di sana diubah menjadi kios khas Ubud. Kios-kios biasanya menjual bunga pun dirombak menjadi kios furniture. Tak hanya kios furniture, kru film Eat, Pray, Love juga memba-

ngun sebuah restoran, kios menyajikan sarana prasarana upacarakeagamaandanspa.“Ngurah Balinese Therapic & Relaxing, Jl Jembawan 9X Ubud” tulisan di salah satu plang kios. Sementara saat ini syuting berlangsung di rumah kecil berada di bawah pohon Beringin. Di dekatnya juga terdapat pura Prapatan. “Mereka kayaknya lagi mencarisuasanapuradanpohon Beringin,” ujar salah satu warga. Penjagaan di lokasi syuting

pun masih sangat ketat. Saat sutradara meneriakan ‘rolling’, kru film pun langsung menghentikanmobildanmintasupaya wargasekitartidakmengeluarkan suara sedikit pun. Selain kru film, beberapa pecalang pun tampak berjagajaga di lokasi syuting. Bahkan salah satu pecalang sempat menangkap warga yang kedapatan mengeluarkan kamera.(dth)

G-String Isi Kekosongan FORMASI grup vokal kuintet atau berlima yang langka di blantika musik Indonesia, secara jeli dimanfaatkan G-String. Didukung lima dara muda nan seksi dan berbakat – Araky, Dewa, Saqe, Nonie dan Landa, grup vokal terbentukmedio2008silamini,mencoba mengisi kekosongan tersebut dengan merilis single Honey, Bunny, Sweety (HBS) bergenre Pop dengan tempo Up-beat ke pasaran. “Selain mengisi kekosongan formasi kuintet - lewat tembang bertema romantisme kehidupan percintaan anak muda, G-String pun berupaya menggebrak blantika musik pop Indonesia. Pasalnya, single HBS berpotensi besar menjadi semacam Soundtrack bagi kaula muda menjalin kisahcinta,”paparDewapentolan G-String kepada Waspada di Jakarta, baru-baru ini. Menurutnya, ditopang formasi lima cewek dan kesemuanya memiliki karakter vokal ma-

07.30 Kuis Siapa Lebih Berani 09.00 Musik : Dahsyat 11.00 Silet 12.00 Seputar Indonesia 12.30 Sergap 13.00 Sinema Siang 15.00 Cek & Ricek 15.30 Mata Mata 16.00 Minta Tolong 17.00 Seputar Indonesia 17.30 Rumah Hadiah 18.00 Doa Dan Karunia 19.00 Safa dan Marwah 20.30 Cinta Dan Anugerah 22.00 Tak Ada Yang Abadi 23.00 Box Office 01.00 Seputar Indonesia Malam


sing-masing yang saling menunjang satu sama lain, G-String mempersembahkan sebuah konsep baru hiburan memikat. “Penikmat musik di tanah air tak hanyamemperdengarkankepiawaian vokal grup kami, tapi bakal terpikat koreografi yang aduhai di setiap aksi panggung. Lengkap dengan kostum penunjang guna menciptakan imej - Girly, Sporty

07.30 Musik : Inbox 09.30 Halo Selebriti 10.00 Sinema Pagi 12.00 Liputan 6 Siang 12.30 Sinema Siang 13.30 Kasak Kusuk 14.30 Status Selebriti 15.00 Playlist 16.00 Kepompong 17.00 Liputan 6 Petang 18.30 Uya Emang Kuya 19.00 Bayu Cinta Luna 20.00 Cinta Fitri 21.30 Musik Spesial Ancol 23.30 Barometer 00.30 Liputan 6 Malam 01.00 Buser

danSexy,”jaminDewadanempat rekannyayangmerupakanjebolan ajangpencarianbakatsebuahtelevisi swasta nasional. ”G-String juga memiliki jam terbang memadai kenyang menjadi penyanyi latar berbagai band papanatas.Jadi,kepiawaianolahvokal mereka sudah teruji,” tambah Ande Opa, pengamat musik pop modern. * (AgusT)

07.00 Tom & Jerry 09.00 Layar Pagi 10.30 Nekad’z 11.00 Sidik 12.00 Layar Kemilau 13.30 1001 Cerita 14.30 Go Show 15.00 Upin & Ipin 17.00 Ninja Warrior 18.00 Si Mamat 19.00 Sinema Spesial 20.30 Sinema Asyik 22.00 Sinema Malam 00.00 Cerita Malam 01.30 Cerita Dinihari

07.00 Pororo The Little Penguin 07.30 Star Kids 08.30 Espresso 10.00 Heboh 11.30 Topik Siang 12.00 Musik : Klik 13.30 Justiriser 14.30 Panji Sang Penakluk 15.00 Djarum Indonesia Persijap vs Bontang 17.30 Topik Petang 18.00 Mantap 19.00 Segeerr 20.00 Tawa Sutra 21.30 Movies Spesial 23.00 Telisik 00.00 Topik Malam 00.30 Lensa Olahraga Malam 01.00 Luar Biasa


Protes terhadap kedatangan bintang film porno asal Jepang, Miyabi ke Indonesia tidak membuat Maxima Picture gentar. PH juga menggarap ‘Paku Kuntilanak’ itu pun siap mengontrak Miyabi untuk tiga film sekaligus. “Saya akan kontrak Miyabi tiga film nanti,” Odi Mulya Hidayat saat ditemui di Senayan City, Jakarta Selatan, Senin (26/10). Rencananya Odi akan menemuimanajemenMiyabidiJepang Selasa (27/10). Ia akan memberikan tawaran kontrak beberapa judul film kepada Miyabi. “Kita berusaha baik saja, jangan sampai nol nggak bawa hasil lah,” jelasnya. Saat wawancara, Odi juga sempat mengkomentari soal

Raditya Dika yang mundur sebagai penulis naskah ‘Menculik Miyabi’. Pihaknya memaklumi alasan kenapa si Kambing Jantan hengkang dari film itu. “Dia memang sudah ada kepentingan lain,” ucapnya. Namun, Maxima masih membuka kesempatan kepada Dika untuk bisa beraksi bareng Miyabidifilmitu.Saatini,Maxima berusaha untuk menjalin komunikasi lagi dengan Dika. Miyabi Bingung Bintang porno asal Jepang, Maria Ozawa alias Miyabi dikecam syuting film di Indonesia. Menurut produser Maxima, Miyabi bingung punya salah apa hingga dikecam.

“Dia bertanya kenapa pada benci saya. Saya salah apa,” ujar Oddy, sang produser ‘Menculik Miyabi’ ditemui di Senayan City, Senin (26/10) malam. Miyabi menyayangkan sikap orang-orang yang selamanya mencap dia sebagai bintang porno. Padahal Miyabi telah meninggalkan dunia tersebut. “Kita juga harus bangun psikologisdia.Akubilangmasyarakat Indonesia suka kamu jadi datang ya,” jelas Oddy. Untuk film‘Mengejar Miyabi’, Maxima masih berusaha untuk mendapatkan Miyabi bermain di film tersebut. Mereka berencana berangkat ke Jepang untuk kembali mendapatkan hati sang aktris.(dth)

Uma The BeAT dan Miracle Nite With Afgan “ Hati Uma penuh warna warni seperti indahnya pelangi, taktergambarkansenang,bangga, penuh kejutan dan rada bingung ”ungkap Agustina, ibunda Uma The BeAT yang juga bertindak sebagai manajer Uma di acara Miracle NiteWith Afgan. Sebagai ikon Honda BeAT 2009 Uma mendapat kesempatan tampil bersama Afgan, ikon Honda BeAT nasional dalam acara ‘Miracle Nite With Afgan’ yang bertempat di Tiara Convention Centre tanggal 23 Oktober 2009. Sebagai penyanyi yang telah berhasil menggondol berbagai prestasi, tidak tampak keraguan sedikitpun terpancar dari wajahnya saat diberikan kesempatan tampil bersama Afgan. Soal prestasi, Patricia Uma Keshia Tobing adalah rajanya karena segudang prestasi telah raihnya. Berkat bakat menyanyi yang dimilikinya mengantarkan Uma menjadi sang juara di beberapa kontes menyanyi, seperti

07.00 I Love You Full 09.30 FTV Drama 11.30 Patroli 12.00 Fokus Siang 12.30 Happy Song 14.30 KiSS 15.30 FS Starlit 17.00 Tangisan Isabella 18.00 Laila 19.00 Jiran 20.00 Inayah 22.00 Sinema Asia 00.00 FS The Hospitals

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

juara1 kontes nyanyi melodi perdamaian dunia. Dan selalu menjadi pemenang saat mengikuti kontes menyanyi di PRSU sejak 2007 – 2008, dan banyak lagi prestasi lainnya. Diawali dengan penampilan yang memukau melalui dua tembang kesayangannya ‘Masih Ada’ dan ‘Stand Up For Love‘, gadisberusia16tahuninimampu memukau penonton dengan lengkingan suaranya yang tinggi. Dankepiawaiannyasemakinjelas, saat tampil duet bersama Afgan menyanyikan lagu Let’s Get The BeAT. Kemampuannya memang pantasdiacungijempol,gadisbelia penggemar Agnes Monica ini mampu memaksimalkan penampilan Afgan dalam mengeBeAT penonton. Sebagai penghargaan atas penampilan luar biasa ini, Afgan menghadiahkan ciuman pipi kiri kanan kepada Uma. Teriakan histeris memenuhi pentas acara saatkejadiantakterdugainiterjadi

07.05 Indonesia This Morning 07.30 Metro Xin Wen 09.05 Expedition 09.30 Market Review 10.30 The Interview 11.05 Oasis 12.05 Metro Siang 13.30 Todays Dialogue 14.30 Metro Sore 15.00 Bisnis Hari Ini 15.30 Public Corner 16.05 Secret Operation 19.05 Suara Anda 20.30 News Maker 21.05 Top Nine News 21.30 Otoblitz 22.05 Save Our Nation 23.00 Metro Realitas 23.30 Metro Sports 00.05 Metro Malam

terutama dari fans berat Afgan yang tergabung dalam Afganisme. “Secara umum acara yang digagas oleh Afganisme ini telah mampu menyampaikan komunikasi produk matik Honda yang fun dan stylish. Dan yang tidak kalah penting adalah remaja Kota Medan menjadi lebih peduli terhadap matik yang aman yang nyaman yang dihadirkan oleh Honda melalui Honda BeAT dengan fitur pengaman cagak samping, dimana sepeda motor tidak dapat dihidupkan jika cagak samping tidak dihidupkan sehingga memberikan rasa aman kepada pengendarayangtidaksiapmenjalankan sepeda motor. Di samping itu Honda BeAT juga dilengkapi ParkingBrakeLockyangmemberikan kenyamanan dan keamanan pengendara parkir dan jalan di tanjakan.”UngkapLeoWijaya,MarketingManagerCV.IndakoTrading Co, Main Dealer sepeda motor Honda di Sumatera Utara.(adv)

07.30 Musik Derings 09.00 Sketsa 09.30 D’ Show 11.00 Insert 12.00 Reportase Siang 14.30 Missing Lyrics 15.30 Tangan DI Atas 16.00 Insert Sore 16.30 Orang Ketiga The Series 17.00 Reportase Sore 17.30 Kejar Tayang 18.00 Suami Suami Takut Istri 19.30 Maju Terus Pantang Mundur 20.30 Realigi 21.00 Bioskop Trans TV 23.00 Bioskop Trans TV 01.30 Reportase Malam

Afgan memberikan kecupan pernghargaan kepada Uma The BeAt sebagai penghargaan atas Prestasinya di atas panggung dalam acara Miracle Nite With Afgan di Medan.

08.30 Bang One Show 09.00 Kabar 9 09.30 Kabar Pasar 10.00 Documentary One 11.00 Opini 12.00 Kabar Siang 13.30 Expose 14.00 Kamus Kuliner 14.30 Jejak Islam 15.00 Kabar 15 15.30 Kabar Pasar 17.30 Kabar Petang 19.30 Janji Wakil Rakyat 20.30 Tanpa Tanda Jasa 21.00 Apa Kabar Indonesia Malam 23.00 Di Balik Tragedi 23.30 Kabar Arena

08.00 Chalkzone 09.00 Obsesi 10.00 Bukan Sinetron 11.00 Bukan Pemimpi 12.00 Abdel & Temon 13.00 Global Siang 14.30 Petualangan Panji 16.00 Obsesi 16.30 Berita Global 18.00 Naruto 19.00 Awas Ada Sule 20.00 Big Movies 22.00 Big Movies 00.00 F 1 Sensation 00.30 Global Malam 01.00 MTV Insomnia

07.30 I Gosip Pagi 08.00 Selamat Pagi 09.00 Dorce 10.00 Dengarlah Aku 10.30 60 Minutes 11.30 Redaksi Siang 12.00 I Gosip Siang 12.30 Bocah Petualang 13.00 Laptop Si Unyil 13.30 Jalan Sesama 14.00 Cita Citaku 14.30 Dunia Bintang 15.00 Koki Cilik 15.30 Asal Usul Fauna 16.00 Jejak Petualang 16.30 Redaksi Sore 18.30 On The Spot 20.00 Opera Van Java 20.45 OKB 22.00 Bukan Empat Mata 23.30 Begadang 00.30 Sport 7 Malam 01.00 Redaksi Malam


Nusantara 5 Dubes Indonesia Untuk Thailand Jadi Tersangka

WASPADA Rabu 28 Oktober 2009

JAKARTA (Antara): Duta Besar (Dubes) RI untuk Thailand, Muhammad Hatta ditetapkan sebagai tersangka oleh Kejaksaan Agung (Kejagung) terkait dugaan korupsi penyimpangan penggunaan dana DIPA tahun anggaran 2008/2009 pada KBRI di Bangkok. “Berdasarkan hasil evaluasi pemeriksaan terhadap saksi dan para tersangka dalam penyidikan korupsi tersebut, terdapat cukup bukti keterlibatan Muhammad Hatta,” kata Kepala Pusat Penerangan Hukum (Kapuspenkum) Kejagung, Didiek Darmanto di Jakarta,


LONGSOR: Sejumlah warga berada di lokasi tempat terjadinya bencana tanah longsor di Desa Kedung Winong, Kecamatan Sukolilo, Kabupaten Pati, Jateng, Selasa (27/10). Peristiwa yang terjadi pada Senin (26/10) malam itu mengakibatkan lima orang meninggal ditempat kejadian dan tiga rumah rusak berat karena tertimpa longsoran tanah kapur dan batu.

BUMD Kepri Tak Mengandalkan Proyek Pemerintah TANJUNGPINANG, Kepri (Waspada): Badan Usaha Milik Daerah (BUMD) di Provinsi Kepulauan Riau (Kepri) tidak pernah mendapatkan proyek dari pemerintah daerah setempat, ujar Asisten Ekbang Setdaprov Kepri Nuraida Husin. “BUMD di Kepri mampu mandiri dalam waktu hanya dua-tiga tahun dan itu sama sekali tidak pernah mendapatkan proyek dari pemerintah,” katanya ketika menerima kunjungan jurnalistik rombongan wartawan Sumatera Utara dipimpin Kepala Dinas Kominfo Sumut H Eddy Syofian di Tanjungpinang, Senin (26/10). Provinsi Kepri memiliki sebuah BUMD yang bertindak sebagai holding company. Perusahaan yang diberinama

PT Pembangunan Kepri itu dewasa ini memiliki cukup banyak anak perusahaan. Anak-anak perusahaan tersebut kemudian secara aktif menjalin berbagai kerja sama dengan pihak ketiga dan kemudian bertumbuh dan berkembang menjadi anakanak perusahaan yang maju dan mandiri. Menurut Nuraida Husin, sejak berdiri hingga saat ini BUMD tersebut hanya sekali mendapatkan bantuan dari Pemprov Kepri dan besar bantuan yang diberikan pun hanya Rp10 miliar. “Dalam dua tahun pertama kita memang belum bisa berharap BUMD itu menyetor pendapatan ke kas daerah, tapi setelah itu dia justru mampu

ikut bersama-sama pemerintah membantu percepatan pembangunan daerah,” ujarnya. Ditanya kiat memajukan BUMD di provinsi kepulauan yang berdiri tahun 2002 itu, ia menyebut sejauh ini tidak ada seorang pun unsur dari pemerintahan yang masuk ke BUMD itu maupun anak-anak perusahaannya. Perusahaan-perusahaan BUMD di daerah itu dikelola oleh tenaga-tenaga profesional di bidangnya. “Jadi sama sekali tidak ada unsur pemerintahan di dalamnya, semuanya profesional,” tegasnya. Lebih jauh Nuraida Husin mengatakan sejauh ini BUMD di Kepri telah bergerak di berbagai bidang usaha, mulai dari mengelola sisi darat bandar

udara dan penyediaan avtur, sampai mengelola pergudangan dan membersihkan limbah laut. Dalam waktu dekat PT Pembangunan Kepri juga akan mele-barkan sayap ke bidang telekomunikasi serta minyak dan gas. “Dalam waktu dekat BUMD kita juga diproyeksikan ikut mengelola blok minyak dan gas di Natuna,” katanya. Kepala Dinas Kominfo Sumut H Eddy Syofian kepada wartawan seusai pertemuan itu mengaku sangat terkesan dengan konsep yang diterapkan Pemprov Kepri dalam mengembangkan BUMD-nya. “Apa yang dilakukan Kepri terhadap BUMD-nya sangatsangat luar biasa dan bukan tidak mungkin juga bisa kita terapkan di Sumut,” katanya. (m19)

JAKARTA (Waspada): Sejak penggunaan hak angket Bank Century digulirkan, perhatian fraks-fraksi di DPR begitu serius. Bahkan penggunaan hak angket itu kini sudah di depan mata karena beberapa fraksi sudah menyatakan kesiapannya, khususnya tiga fraksi besar di DPR yakni Partai Demokrasi Indonesia Perjuangan (PDIP), Partai Golkar dan Partai Persatuan Pembangunan (PPP). Melihat wacana penggunaan hak angket Bank Centry itu, Fraksi Partai Demokrat (FPD) langsung memberikan reaksi melalui ketua fraksinya Anas Urbaningrum meminta agar semua pihak menunggu hasil audit BPK. “Kita harus menghormati kerja lembaga yang mempunyai otoritas untuk melakukan audit, yaitu BPK. Sekali lagi kami mesti menunggu apa hasil audit itu,” katanya sebelum memasuki ruang sidang paripurna di Ge-

Kalau Menunggu Bantuan Pemerintah, Kapan? lantakkan kediamannya yang selama ini aman dan damai. Dia hanya bekerja seorang diri, sebab tak ada tukang pasca gempa. Dan, kayunya pun dia peroleh dari pohon durian dekat rumahnya, kemudian ditempahnya menjadi balok kayu. Lelaki tua itu adalah Ali Basyir, 64, kakek dari empat cucu, warga Dusun Tangah, Korong Ladang Rimbo, Kenagarian Kuranji Hulu, Kec. Sungai Men-

cirim, Kab. Padang Pariaman. Ali Basyir bekerja dengan peralatan seadanya. Tekadnya membangun rumah kembali semata agar anak cucunya tak lagi tidur di tenda atau menumpang tidur di madrasah. “Kalau menunggu bantuan dari Pemerintah, kapan? Sampai kapan kami harus menunggunya? Tidak pastikan? Sementara cucu-cucu saya kedinginan tidur di tenda,” ujar Ali Basyir ke-

Waspada/Mursal AI

ISTIRAHAT: Ali Basyir ditemani istrinya Martini beristirahat sejenak usai memotong balok kayu di Kampung Tangah, Korong Ladang Rimbo, Kenagarian Kuranji Hulu, Kec. Sungai Geringging, Kab. Padang Pariaman.

pada Waspada, Senin, (26/10). Dengan logat Padangnya yang kental, Basyir menuturkan, sebanyak 10 orang anggota keluarganya tidur di satu tenda sangatlah tidak nyaman. Apalagi di saat hujan, rasa dingin menyelimuti kami. “Bantuan yang datang itu hanya berupa bahanbahan pokok, Tapi, bahan bangunan belum ada. Nggak mungkinkan kami hanya menunggu terus.” Pekerjaan Basyir tidak tetap. Terkadang sebagai tukang ojek, lalu kuli bangunan, dan terkadang jadi petani. Dengan pekerjaan yang hanya seperti itu, dia mengaku tidak sanggup membeli bahan-bahan bangunan sekaligus. “Cicil, Minggu ini beli pasir, kalau ada rezeki beli semen. Apalagi sejak gempa ini bahan bangunan naik. Jadi belum tahu kapan siapnya, yang penting saya berusaha dulu. Entah siap pun atau nggak ini,” ujarnya pesimis. Basyir sangat berharap, pemerintah segera memberikan bahan-bahan bangunan kepada warga korban gempa. “Saat ini, itu saya rasa yang diperlukan warga, nggak mungkinkan warga harus tidur terus menerus di tenda-tenda darurat.” Tempat tinggal Basyir termasuk daerah yang terisolir. Untuk menuju rumahnya saja, harus melewati jalan yang berbukit yang kanan kirinya masih hutan. Masih banyak permasalahan lain di desa ini. Seperti, air. Untuk mandi dan minum saja mereka terpaksa harus ke sungai yang jaraknya dua

sangka Muhammad Hatta akan diperiksa dan didengar keterangannya pada Rabu (28/10) mendatang. Hal senada dikatakan Direktur Penyidikan (Dirdik) pada Jampidsus, Arminsyah yang menyatakan tim penyidik memiliki bukti cukup kuat terlibat dalam kasus tersebut. “Ini hasil keterangan dari pemeriksaan saksi dan tersangka,” katanya. Keterkaitannya dalam kasus itu kata dia, melakukan kebijakan dengan tidak menyetor uang dana DIPA ke negara. Kasus itu diduga bermula saat KBRI Thailand dalam Tahun Anggaran Daftar Isian Proyek Anggaran (DIPA) 2008 menyisakan

anggaran DIPA sebesar Rp2,5 miliar. Dana itu tidak disetorkan kembali ke kas negara namun oleh oknum pejabat KBRI dipergunakan untuk kepentingan lain, tanpa dilakukan revisi anggaran dari Departemen Keuangan (Depkeu). Dana dari DIPA diduga untuk pembentukan panitia penyelenggaraan Indonesia Day 2008 di Bangkok, pembentukan Satgas Penanggulangan WNI yang tertahan di Bangkok, pembentukan panitia penyelenggaraan serta pelaksanaan KTT ASEAN ke-14. Selanjutnya untuk pembayaran tunjangan kemahalan bagi pegawai setempat dan guru pada KBRI di Thailand.

Hak Angket Bank Century Bergulir

Demi Cucu, Ali Basyir Berusaha Bangun Rumah LELAKI tua itu terlihat sangat serius mengukur-ukur balok kayu di bawah tenda plastik berukuran kecil. Usai mengukur, kemudian dia memotong balok-balok kayu itu dengan gergaji. Peluh membasah di sekujur tubuhnya. Lelaki tua itu adalah salah seorang korban gempa di Sumatera Barat. Dia sangat ingin segera membangun rumahnya kembali, setelah gempa 7,9 SR meluluh-

Selasa (27/10). Sebelumnya, Kejagung telah menetapkan dua tersangka lainnya yakni, Djumantoro Purbo (Wakil Dubes) dan Suhaeni (Bendahara KBRI di Thailand). Kapuspenkum menambahkan, tersangka Muhammad Hatta secara bersama-sama dengan tersangka Suhaeni dan tersangka Djumantoro Purbo melakukan tindak pidana korupsi. “Penetapan Muhammad Hatta sebagai tersangka berdasarkan surat perintah penyidikan direktur penyidikan jaksa agung muda tindak pidana khusus nomor print-79/F.2/Fd.1/ 10/2009tanggal23Oktober2009.” Dia menambahkan, ter-

kilometer. Sementara itu, Wali Nagari (Lurah-red) Kuranji Hulu Ali Umar mengatakan, sebanyak sembilan puluh lima persen mata pencaharian warga di sini hanyalah petani. Jadi, tidak mungkin rasanya mereka akan membangun rumah sendiri tanpa ikut andil pemerintah. “Ini termasuk daerah yang terisolir. Di sini tak ada pengusaha maupun pejabat. Umumnya warga sini petani, selebihnya tukang ojek dan buruh bangunan. Mereka tidak mungkin membangun rumahnya sendiri. Kalau adapun hanya satu dua orang,” katanya. Di Desa Ladang Rimbo ini, menurut Wali Nagari, sebanyak 623 rumah rusak berat dihantam gempa. Sementara di seluruh Korong sebanyak 7.030 rumah rusak berat maupun ringan. Pantauan Waspada, banyak rumah yang sudah tak layak pakai masih dihuni warga Nagari Kuranji Hulu ini. Pada temboktembok yang hampir roboh, mereka pasangkan kayu penyanggah. Itu tentunya berbahaya, karena jika saja ada gempa sedikit, rumah mereka bisa langsung roboh. Tetapi akibat tidak nyaman tidur di tenda dan kedinginan di saat hujan datang, mereka memberanikan diri untuk menempati rumahnya yang sudah retak-retak tersebut. “Kami sangat berharap para donator dan pemerintah untuk memperhatikan warga sini. Kasihan membiarkan warga sini berlama-lama tidur di tenda,” ujar Umar. * Mursal AI/Aidi Yursal

dung DPR Jakarta, Selasa (27/10). Hal sama disampaikan anggota Komisi III DPR dari FPD Ruhut Sitompul. Dia berharap semua menunggul hasil audit BPK. “Hak angket itu politis, jadi tunggulah hasil BPK dan biarlah ini mengalir seperti air,” ujar Ruhut mengingatkan akan adanya kontrak politik antar SBY dan beberapa partai politik Ruhut juga menyatakan, wacana hak angket ini ujian loyalitas dan komunikasi dalam koalisi pendukung pemerintahan SBY-Boediono. Sedangkan anggota Komisi III dari Fraksi PG, Bambang Soe-

satyo mengakui bahwa saat ini sedang diedarkan usulan hak angket Bank Century. “Fraksi Partai Golkar mendukung dan mengisiasi hak angket sambil menunggu hasil kerja BPK,” katanya. Fraksi PPP DPR juga siap mendukung terbentuknya panitia angket untuk mengusut tuntas kasus bailout Bank Century. Menurut Ketua DPP PPP yang juga Wakil Ketua MPR, Lukman Hakim Saefuddin, skandal Century itu tidak boleh dibiarkan begitu saja. “Kami mendukung pengusutan kasus Century ini dan upaya itu harus

segera dilakukan,” katanya. Sementara FPDIP sudah mempunyai tim investigasi yang dibentuk mengumpulkan bahan dan draf bahan itu tengah digodok. “Pengumpulan bahan angket sudah selesai. Diharapkan minggu depan drafnya bisa selesai untuk di bawa ke Badan Musyawarah,” kataWakil Ketua FPDIP, Arya Bima. Menurutnya, PDIP tidak akan menunggu hasil audit investigatif BPK untuk mengajukan hak angket. “Sekarang yang diperlukan sikap dewan. Biarlah BPK kerja, tapi dewan juga harus punya sikap,” tegasnya.(aya)

Gaji Menteri Sebaiknya Disumbang Ke Penduduk Miskin JAKARTA (Antara): Sekjen DPP Partai Buruh, H Sonny Pudjisasono mengharapkan para menteri Kabinet Indonesia Bersatu (KIB) II menyumbangkan separuh gajinya untuk meningkatkan kesejahterakan penduduk miskin, termasuk para buruh yang terkena pemutusan hubungan kerja (PHK)

sebagai wujud kepedulian, bukan justru gajinya dinaikkan sampai 3-4 kali dari sekarang. Sonny mengemukakan itu di Jakarta, Selasa (27/10), terkait rencana pemerintah yang akan menaikkan kenaikan gaji para menteri KIB II, termasuk para pejabat tinggi negara yang mencapai 3-4 kali lipat dari gaji

PTPN III Bantu Korban Gempa MEDAN (Waspada): Dirut PT Perkebunan Nusantara III Ir Amri Siregar Minggu (25/10) melepas keberangkatan empat truk besar berisi bahanbahan bantuan kepada korban gempa di Sumbar dan Jambi di halaman kantor direksi PTPN III. Dana bantuan tersebut merupakan program BUMN Peduli PTPN III yang berasal dari dana PKBL yang total keseluruhannya sebesar Rp 2,1 milyar untuk Sumatera Barat, KerinciJambi, Jawa Barat dan Mandailing Natal-Sumatera Utara yang telah diserahkan sebelumnya oleh Distrik Manager Tapanuli Selatan, Rafel Sibagariang kepada masyarakat korban banjir bandang di Kec. Muara Batang Gadis, Mandailing Natal awal bulan kepada Sekda Pemkab madina. Drs. H. Azwar Indra Nasution, MM. Amri Siregar mengharap-

kan bantuan dapat meringankan para korban gempa di Sumbar dan Jambi sehingga segera pulih dan siap untuk bangkit kembali menghadapi hidup di masa depan. Ir. Mailanta Bangun, Kepala Bagian PKBL mengatakan, untuk memudahkan penyaluran bantuan tersebut ke pihak yang tepat dan lebih efektif dilakukan kerja sama dengan PT PNM di Sumatera Barat dan PTPN VI di Jambi yang diserahkan langsung oleh para petugas dari pengurus SPBUN PTPN III. Hadir dalam acara pelepasan bantuan untuk Sumbar dan Jambi pada pagi itu antara lain Direktur Utama, Ir. Amri Siregar, Direktur SDM, Rachmat Prawira Kesumah, MM dan Direktur Pengembangan dan Perencanaan, DR. Ir. Chairul Muluk dan para kepala bagian serta pengurus SPBUN PTPN III. (m05)

sekarang. Menurut Sonny, usulan menyumbangkan sebagian gajinya, karena pendapatan menteri dinilai sudah memadai, termasuk adanya fasilitas diberikan negara dan para menteri juga mendapatkan dana taktis yang jumlahnya mencapai ratusan juta rupiah per bulannya. Apalagi keadaan ekonomi negara dan bangsa Indonesia belum membaik akibat krisis ekonomi global, sejak pertengahan 2008 hingga saat ini. Dia mengatakan, seharusnya para menteri sebelum dilantik menyadari bahwa jabatan menteri adalah kehormatan sebagai pengabdian kepada bangsa atas prestasi dan dedikasinya, sehingga diharapkan tidak menuntut kenaikan gaji yang besar. Sonny yang partainya tidak memiliki wakil di DPR RI karena suara yang diperolehnya kurang 2,5 persen pada pemilu 2009, mengharapkan, DPR ikut mengkritisi tentang rencana kenaikan gaji para menetri, termasuk para pejabat tinggi negara yan nilainya mencapai 3-4 kali dari gaji sekarang. Dia berencana membentuk forum 19 parpol yang tidak lolos di DPR RI yang kini mempunyai belasan ribu legislator di DPRD provinsi, kabupaten/kota seIndonesia. Forum lintas prapol itu akan mengkritisi kebijakan pemerintah yang tidak sesuai dengan UU yang berlaku.



WASPADA Rabu 28 Oktober 2009

Juve Yakin AP

Ferguson Bantu Transfer Ronaldo SUPERSTAR anyar Real Madrid Cristiano Ronaldo mengungkapkan bahwa manajer Manchester United Sir Alex Ferguson dan bundanya Maria Dolores dos Santos Aveiro, tokoh penting yang membantu proses transfernya dari Old Trafford ke Santiago Bernabeu. “Bermain untuk Real Madrid merupakan sebuah impian. Saya mengatakan itu kepada Ferguson dan dia menghormati opini saya. Dia memahami dan membantu saya keluar dari United, karena saya ingin sesuatu yang berbeda,” beber Ronaldo dalam TribalFottball, Selasa (27/10). Diplomasi Ferguson pula yang membuat manajemen The Red Devils sepakat melepas bintangnya tersebut. Ronaldo pun mendarat di Madrid dengan status pemain termahal pada musim panas lalu.

Torres Terinspirasi Gerrard MESIN gol Liverpool Fernando Torres mengaku terinspirasi kapten Steven Gerrard saat memutuskan tampil melawan Manchester United di Liga Premier akhir pekan lalu. “Saya benar-benar berharap bisa ikut membela Liverpool, serupa seperti Gerrard ketika memutuskan main lawan Lyon. Dia merupakan pemimpin sejati,” tukas Torres AP kepada Daily Mail, Selasa (27/10). Jika Gerrard bernasib sial karena cederanya makin parah saat memaksakan tempur lawan Lyon di Liga Champions, Torres justru beruntung karena menjadi bintang pembuka kemenangan 2-0 The Reds atas MU. “Saya tidak seratus persen fit ketika itu. Saya paham risikonya, tapi saya tak sabar ingin tempur,” tegas Torres.

Fabregas Sadar Bukan Favorit KAPTEN Arsenal Cesc Fabregas sadar timnya bukan favorit kampiun musim ini di Liga Premier, tetapi mereka terus akan berjuang untuk merampas gelar Manchester United. “Tidak ada yang tak mungkin. Kami memang bukan favorit musim ini, tapi kami akan terus bertarung. Tim ini makin matang dan terus berkembang dari waktu ke waktu,” jelas Fabregas dalam AP blog arsenal, Selasa (27/10). “Tentu kami di bawah tekanan untuk memenangkan gelar, karena Arsenal klub besar dan selalu diharapkan mencapai yang tertinggi. Namun klub lain telah mengeluarkan uang banyak dalam beberapa tahun ini untuk membangun skuad, itu yang sebenarnya membuat mereka lebih tertekan sebagai konsekuensi investasinya,” tambah gelandang Spanyol tersebut.

ROMA (Waspada): Playmaker Diego Ribas da Cunha yakin, Juventus masih berpeluang besar menyabet trofi scudetto Liga Seri A musim ini.

Rabu, 28 Oktober SS Lazio vs Cagliari AC Parma vs Bari Genoa vs Fiorentina Udinese vs AS Roma Napoli vs AC Milan Livorno vs Atalanta Catania vs Chievo Bologna vs Siena Juventus vs Sampdoria *RCTI Live pk 02.30 WIB


Sedih Totti Operasi

Kamis, 29 Oktober Inter Milan vs Palermo

Klasemen Liga Seri A “Kami ingin menjadi juara. Untuk itu kami tak boleh kalah dari pemuncak klasemen sementara di liga (Inter-red),” tegas Diego seperti dilansir, Selasa (27/12). Setelah peceklik kemenangan dalam satu bulan terakhir di Seri A, The Old Lady kembali memetik poin penuh diTuscany, markas Siena, akhir pekan lalu. Kini Juve yang mengoleksi 18 poin dari sembilan laga hanya terpaut empat poin dari Inter Milan. Diego pun langsung mengirim pesan kepada Nerazzurri bahwa mereka siap kembali bertarung memperebutkan gelar. “Tim ini menampilkan permainan yang sangat bagus dan kami mampu membongkar pertahanan Siena. Jadi, saya sangat bahagia dengan kemenangan itu,” ujarnya lagi. “Kami berhasil menang kendati bermain jauh dari markas kami. Itu membuat kami yakin mampu bersaing memperebutkan posisi puncak,” tambah mantan gelandang Werder Bremen kelahiran Brazil tersebut. Optimisme Diego didukung bek sentral Fabio Cannavaro. Karenanya mantan bek AC Parma dan Real Madrid itu bertekad meraih poin penuh saat menghadapi Sampdoria di Olimpico Turin dinihari WIB nanti. “Di Italia hal terpenting adalah kemenangan, tak penting jumlah golnya. Kami bermain buruk saat menghadapi Siena, tapi kami mampu memetik nilai penuh,” ucap Cannavaro. “Sampdoria, sementara ini juga sedang di atas angin, namun partai Rabu nanti tidak

Inter Milan 9 Sampdoria 9 Juventus 9 Palermo 9 Fiorentina 9 AC Milan 9 Bari 9 AC Parma 9 Napoli 9 Genoa 9 Chievo 9 AS Roma 9 Udinese 9 Cagliari 9 SS Lazio 9 Atalanta 9 Catania 9 Bologna 9 Livorno 9 Siena 9


Giorgio Chiellini, Diego Ribas dan kawan-kawan mengembalikan Juventus ke jalur juara. akan kami lepaskan. Masih ada 29 laga lagi yang harus kami jalani, dan perjalanan sangat panjang.

“Saya rasa kami hanya akan bertarung dengan Inter dan Milan hingga akhir musim nanti, karena sejauh ini susunan pe-

7 6 5 4 4 4 3 4 4 4 3 3 3 3 2 2 1 1 1 1

1 2 3 3 3 3 5 2 1 1 2 2 2 1 4 3 4 3 3 2

1 1 1 2 2 2 1 3 4 4 4 4 4 5 3 4 4 5 5 6

21- 6 17- 8 13- 7 12- 9 8- 6 8- 9 10- 5 10-12 12-14 16-19 11-10 15-16 12-13 10-12 7-10 9-11 9-13 7-14 3-10 7-13

22 20 18 15 15 15 14 14 13 13 11 11 11 10 10 9 7 6 6 5

main terbaik ada di klub tersebut. Kami akan mengambil keuntungan ketika Tiago Mendes, Claudio Marchisio dan terutama Alex Del Piero kembali berlaga di atas lapangan,” katanya menambahkan. “Rabu kami akan melawan Sampdoria, salah satu klub Italia yang tengah bermain sangat baik. Maka kami harus tetap fokus,” timpal kiper Gianluigi Buffon. Namun Si Nyonya Tua dipastikan tempur tanpa kehadiranVincenzo Iaquinta. Striker Italia itu mendapat cedera dalam latihan Sabtu lalu dan menjalani operasi pada Selasa (27/10). “Ada otot di lutut kirinya yang harus dioperasi. Operasi akan dilakukan di Klinik Fornaca Turin dan ditangani Profesor Falvio Quaglia,” bunyi pernyataan resmi Juve. (h01/vvn/chan/tf)

Terry Agungkan Stamford Bridge BEK andalan Chelsea John Terry mengagung-agungkan keangkeran Stadion Stamford Bridge sebagai markas mereka. “Bukan mengenai kalah di Stamford Bridge, tapi soal menang,” sesumbar Terry kepada Daily Mail, Selasa (27/10). Stamford Bridge musim ini memang lebih bersahabat bagi The Blues. Dari delapan kali mentas di sana, Terry cs selalu AP meraih hasil sempurna dengan menyarangkan 24 gol dan hanya kemasukan satu gol. Setelah mempermalukan Atletico Madrid 4-0 di Liga Champions, Sabtu lalu giliran Blackburn Rovers yang dibantai Si Biru 5-0 di Liga Premier. “Sekali lagi kami sedang membangun benteng di Stamford Bridge. Tidak pernah kalah di kandang tentu sesuatu yang harus terus kami pertahankan,” tekad kapten tim Inggris itu.

M Affan Lubis (kiri) akan dimaksimalkan Pelatih PSMS Suimin Dihardja di lapangan tengah.

Arif pun berharap Ketua Umum PSMS Drs H Eldin Dzulmi MSi dapat membawa kemajuan dalam kondisi apapun. “Karenanya, ketika Pemko Medan memperhatikan sepakbola, itu merupakan kepentingan masyarakat dan bukan sia-sia. Namun sebuah investasi bagi daerahnya,” ujar Arif. Arid menganalogikan ketika dibangunnya kawasan Gelanggang Bung Karno yang masih sepi. “Kini, kawasan itu telah ramai dan menjadi kawasan ekonomis,” sebutnya menirukan ucapan Ketua Umum PSSI H Nurdin Halid. “Ini kan pembangunan yang

Waspada/Austin Antariksa

Suimin Coba Skuad Inti Jamu PSGL MEDAN (Waspada): Suimin Dihardja mendapat kesempatan mencoba skuad inti dengan hadirnya Nyeck Nyobe dan Osas Saha saat menjamu PSGL Gayo Lues di Stadion Kebun Bunga, Rabu (28/10) sore ini. Walaupun beda kasta, na-

Pembangunan Sepakbola Merupakan Investasi MEDAN (Waspada): Orang yang memimpin olahraga khususnya cabang sepakbola harus dinamis, tidak boleh defensif dan pesimis serta harus mendedikasikan dirinya bagi kemajuan sepakbola. Lagipula sepakbola memiliki dampak besar bagi daerah dan masyarakat. Pembangunan olahraga di cabang tersebut bukan merupakan pembangunan sia-sia, namun investasi bagi daerah dan masyarakat. Demikian diungkapkan salah seorang penggemar berat PSMS Medan Muhammad Arif SE ketika dihubungi di Medan, Selasa (27/10).

Puji Perubahan Nesta SETELAH pelatih Leonardo de Araujo, giliran Wakil Presiden AC Milan Adriano Galliani yang memuji perubahan penampilan bek sentral Alessandro Nesta yang memborong dua gol ketika menaklukkan Chievo Verona 2-0 akhir pekan lalu di Liga Seri A. “Untuk Nesta, dia sangat fantastis. Setelah cedera dan risiko terancam AP karirnya, dia telah berubah,” tutur Galliani dalam TribalFottball, Selasa (27/10). “Hari ini kami bahkan bisa mengatakan, dia lebih baik dibanding seorang Nesta yang brilian sebelum cedera sekalipun. Mereka bilang kami mudah lelah dan telah tua, tapi kami telah memperlihatkan bukan seperti itu. Tim ini berkembang dengan sendirinya dan kami tetap bersatu,” tambah Galliani.

Napoli Siap Barter Pazzini PRESIDEN Napoli Aurelio De Laurentiis siap menjadikan Daniele Mannini sebagai alat barter untuk mendapatkan striker Giampaolo Pazzini (foto). “Status Mannini masih kami miliki sebesar 50 persen. Jika mereka menginginkan Mannini, maka kami akan meminta Pazzini,” jelas De Laurentiis dalam Goal, Selasa (27/10). Mannini dimiliki bersama oleh AP Napoli dan Il Samp. Sejak musim panas lalu, Mannini dipinjamkan ke Luigi Ferraris dan berandil besar mengangkat Samp ke papan atas Liga Seri A, sehingga I Blucerchetti ingin menguasai hak kepemilikannya.

Prandelli Tersanjung Award ALLENATORRE Fiorentina Cesare Prandelli tersanjung, setelah didaulat menjadi penerima Giacinto Facchetti Award yang diselenggarakan koran olahraga terkemuka Italia, La Gazzetta Dello Sport. “Saya tak kuasa menahan emosi ketika menerima penghargaan ini. Saya sangat tersanjung, namun jujur saya calcio merasa bukan orang yang layak menerimanya,” papar Prandelli kepada Goal, Selasa (27/10). Penghargaan yang diberikan kepada para tokoh yang telah menjunjung tinggi esensi sepakbola itu bahkan sempat mengagetkan mantan pelatih AS Roma dan Parma tersebut. Sebab Prandelli sama sekali tak pernah berpikir bisa menerima penghargaan berupa patung perunggu dan cek sebesar 10 ribu euro itu.

Livorno Jawab Kerinduan Cosmi

Proposal Stadion Fantastis Spurs PRESIDEN Tottenham Hotspur Daniel Levy (foto) kepada BBC, Selalu (27/10), mengajukan proposal kepada pemerintah kota London untuk membangun stadion baru yang fantastis dengan kapasitas 56 ribu kursi dan selesai tahun 2012. “Stadion akan memiliki tribun satu tingkat dengan desain fantastis. Setiap penonton akan memiliki pemandangan luar biasa dan ruang lingkup yang sangat hidup,” beber Levy. Reuters Stadion yang akan dibangun dekat White Hart Lane, London Utara itu, memiliki tingkatan seperti halnya tribun The Kop di Anfield yang mendekatkan penonton dengan lapangan. Dalam kompleks stadion juga akan terdapat 434 rumah, 150 kamar hotel dan satu supermarket modern. “Kami ingin menciptakan skema keuntungan bagi masyarakat lokal dan membangun stadion yang paling digemari di Eropa,” tambah Levy. (jonny/dari berbagai sumber)

MANAJEMEN AS Roma sedih karena kapten tim Francesco Totti kembali mengalami cedera pada otot ligamen lututnya, sehingga mesti menjalani operasi lagi. Cedera yang diderita Totti pada April 2008 itu kembali kambuh awal musim ini dan telah membuatnya absen dalam dua laga Il Lupo. “Tak ada kesedihan selain melihatnya menjalani operasi lagi,” ungkap manajemen Roma dalam situs resmi klub itu yang dikutip Selasa (27/10). Sang kapten sempat menjalani performa bagus awal musim ini di Liga Seri A, tapi kemudian merasa nyeri ketika mengikuti sesi latihan tim Serigala Merah pada Senin. Dokter klub menyatakan, dia harus menjalani operasi lagi dan memulai masa pemulihannya kemarin.

tidak sia-sia, tapi investasi di masa depan. Semoga saja pengurus PSMS dapat melakukan terobosan dan pengembangan serupa bagi kemajuan sepakbola ini,” tambah Arif. Dia juga mengingatkan manajemen agar tetap memperhatikan kesejahteraan pemain baik lokal maupun asing yang dipercaya memperkuat PSMS pada kompetisi Divisi Utama PSSI, November mendatang. Ditambahkan,dengandiperhatikannya kesejahteraan dan lancarnya pembayaran gaji, jelas semakin menambah semangat pemain dan rasa tanggungjawab untuk membelaThe Killer. (m24)

mun PSGL dipastikan akan tampil habis-habisan dalam duel ujicoba tersebut. Suimin pun telah menyiapkan strategi dan hanya menggelar latihan ringan pada Selasa (27/10). Melawan PSGL, tentunya M Affan Lubis cs tidak ingin kehilangan muka di hadapan pendukungnya. Pada laga ujicoba tersebut, Suimin juga akan mencoba duet Nyeck Nyobe dan Osas Saha yang sudah deal dengan manajemen PSMS. Edu Juanda, salah satu pemain yang melamar, belum mengikuti latihan Selasa tapi akan dipasang bila datang

sebelum laga versus PSGL Suimin didampingi asisten Suyono, Jamaluddin Hutauruk dan pelatih fisik Nimrot Manalu mengakui, laga ujicoba besar manfaatnya sebelum berlaga di kompetisi. Nyeck berada di lini pertahanan bersama Slamet Riyadi, sedangkan di depan akan diisi Osas Saha. Striker yang mencetak 18 gol musim lalu bersama PSDS Deli Serdang ini nantinya akan ditandemkan dengan pemain lokal. Kesempatan Ariel Guiterez juga masih terbuka di lini tengah. Pemain Chile itu mungkin akan

ditandemkan dengan Affan Lubis untuk menguasai lapangan tengah. “Kita mencoba formasi yang tepat dengan harapan kerjasama tim dapat solid serta komunikasi pemain berjalan dengan baik,” terang Suimin. Di bawah mistar, PSMS memiliki empat kiper yaitu M Halim, Sony Gunawan, Irwin dan Deli Sulistiyo. Dari keempat kiper tersebut, Jamaluddin Hutauruk mengaku masih terus berbenah. “Ya, kita lihat saja perkembangannya,” kata Jampi, mantan kiper PSMS era 80-an itu. (m20)

KERINDUAN Serse Cosmi untuk kembali menangani klub Liga Seri A, akhirnya terjawab setelah Livorno menunjuknya sebagai bos baru awal pekan ini. “Saya sungguh merindukan Seri A. Mungkin tingkat tekanan jauh lebih rendah dibandingkan beberapa tahun lalu, namun juga memberikan ruang lebih banyak kepada pemain muda untuk unjuk AP kemampuan,” tutur Cosmi, seperti dilansir Channel4, Selasa (27/10). Mengenai komposisi skuadnya melawan AS Roma dalam debutnya, Cosmi mengaku; “Saya tidak akan mengubah susunan dan komposisi pemain sejak awal penunjukan ini. Saya malah berpikir, keberuntungan ada di pihak kami melawan Roma,” optimisme Cosmi.

Capello Sedih Penurunan Italia PELATIH Inggris Fabio Capello kagum dengan antusias orang Inggris terhadap sepakbola dengan selalu memenuhi stadion, dus sedih melihat penurunan yang terjadi di negaranya, Italia. “Saya sedih melihat apa yang terjadi di Italia. Penurunan penonton jelas terlihat dan satu-satunya cara adalah menerapkan hukum lebih tegas. Sebuah keputusan harus Reuters diambil pihak berwenang dan juga klub,” saran Capello, Selasa (27/10), seraya menuding kelompok fans garis keras (Ultras) menjadi penyebab utama penurunan. “Ultras melakukan apa yang mereka mau, mereka bisa menghina semuanya dan siapa pun,” ujarnya lagi. (jonny/dari berbagai sumber)


WASPADA Rabu 28 Oktober 2009


Sumut MintaTuan Rumah PON 2016

Waspada/Surya Efendi

Gubsu H Syamsul Arifin SE didampingi Kadispora Sumut menyalami para atlet junior Sumut yang akan mengikuti Popnas X dan Popcanas IV di Yogyakarta 2-11 Nopember 2009 usai acara pelepasan di Aula Martabe kantor Gubsu Jl. Diponegoro Medan, Selasa (27/10).

Gubsu Lepas Kontingen Popnas

Beban Berat 3 Besar

Tiket Milik TGM, Persati KUALASIMPANG (Waspada): PS Thamrin Graha Metropolitan (TGM) dari Medan dan Persati Kualasimpang berhasil lolos ke babak berikutnya dari kompetisi Divisi III Grup I Sumbagut di Lapangan Petroria Pertamina Rantau, Kabupaten Aceh Tamiang, Selasa (27/10). PS TGM tampil sebagai juara grup setelah tiga kali main tidak pernah kalah dan mengoleksi sembilan point hasil mengalahkan PSBB Batubara 1-0, Persati 1-0 dan terakhir menggilas PSKBS Kota Binjei, Kab Aceh Timur 2-1. Persati meraih predikat runnerup grup setelah mengumpulkan empat poin hasil kalah 0-1 dari TGM, menang 1-0 atas PSKBS dan terakhir imbang 1-1 saat melawan PSBB. Melawan PSBB, Persati tampil penuh semangat di hadapan pendukungnya termasuk Wakil Bupati Aceh Tamiang yang juga Ketua Umum Persati H Awaluddin SH SpN MH. Meskipun begitu, gol bagi tim asuhan Zulkifli Codet itu tercipta juga pada menit 26 lewat kaki Bagus Suhendro. Gol balasan dari PSBB diciptakan Hefrizal pada menit 74 setelah terjadi kemelut di depan gawang Persati. (b24)

Sudoku Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tidak ada keterlibatan matematika, hanya perlu pertimbangan dan logika. Jawaban di kolom 8.


3 7


7 6 2 5 2 9 1 5

2 8 5 9 4 6 3 2 7 9 1 8 6


9 3


3 9 4 1 5 4 2 1

Sumut pada tahun anggaran 2010, sangat diharapkan olahraga dan pemuda di daerah tersebut bisa kembali bangkit. Dalam pertemuan tersebut juga dibahas mengenai kemungkinan mengkariakan para atlet Sumut yang berprestasi, baik nasional maupun internasional, yakni dengan menjadikan mereka Pegawai Negeri Sipil (PNS) di lingkungan Pemprov

Sumut. “Kami memang berharap para atlet peraih medali emas di PON bisa mendapat kesempatan menjadi PNS di Pemprov Sumut. Semua ini tentu menjadi wewenang dari pemerintah daerah. KONI Sumut hanya bisa meminta, karena semua itu tergantung kebijakan Gubsu (Gubernur Sumut),” kata Chairul. (yuslan)

KFC Reli Lain Dari Biasa

Waspada/Setia Budi Siregar

Manajer tim Sugiarto SH bersama pelatih Nurhasim, Lilik Herianto dan Mardi Lestari diabadikan dengan atlet Popnas X di Yogyakarta, Selasa (27/10).

Atletik Tekad Primadona Popnas MEDAN (Waspada): Kontingen atletik Sumut yang diperkuat 13 atlet bertekad menjadi cabang olahraga primadona dengan mendulang medali emas terbanyak pada Pekan Olahraga Pelajar Nasional (Popnas) X di Yogyakarta, 2-11 November mendatang. “Peluang mendulang emas dari cabang atletik cukup berpeluang,” kata manajer tim atletik Sumut Sugiarto SH kepada Waspada di sela-sela pelepasan kontingen Popnas dan Popcanas di ruang Martabe kantor Gubernur Sumut, Selasa (27/10). Ke-13 atlet Sumut itu masing-masing Chandra Hotma, Saddam Harahap, Irawan Syahputra, Irfani, Krisna Hadi S, Nur Ainun Perangin-angin, Putra

Aulia, Endang Sari Sitorus, Elvi Alvriani, Tetti Suastri, Nur Ika, Deby Siregar dan Sri Astuti yang didampingi pelatih Mardi Lestari, Lilik Herianto dan Nurhasim. “Kita berharap prestasi lebih baik yang diperoleh dari Popnas di Kalimantan Timur dua tahun lalu,” kata Sugiarto menambahkan Sumut memperoleh dua emas pada Popnas 2007 dari Edi Herianto Harahap yang kini absen karena melanjutkan studi. “Insya Allah atletik dapat menjadi primadona bagi kontingen Sumut di Popnas,” harap Sugiarto mengingatkan rasa kebersamaan, semangat pantang menyerah dan kesehatan menjadi nilai penting. Peluang meraih emas diha-

rapkan diperoleh Elvi Alvriani dari nomor jalan cepat. Elvi sendiri adalah pemegang rekor nasional jalan cepat 3.000 meter pada Kejurnas Atletik Remaja dan Junior beberapa waktu lalu. Peluang lainnya diharapkan dari Nur Ainun Perangin-angin yang berpeluang di nomor 800 meter dan 1500 meter. Pelari Karo ini nyaris memperoleh medali emas pada ASEAN School di Singapura beberapa waktu lalu namun terkena diskualifikasi karena salah lintasan. Sedangkan, Tetti Suastri terakhir memperoleh medali perunggu pada Kejurnas Senior kendati berusia junior. Pelari jarak jauh 5.000 meter dan 10.000 meter ini pun diharapkan dalam kondisi prima. (m20)

SEA Games PR Pertama Andi MEDAN (Waspada): Pesta olahraga Asia Tenggara (SEA Games) XXV di Laos Desember mendatang adalah pekerjaan rumah (PR) pertama bagi Menteri Negara Pemuda dan Olahraga (Mennegpora) Andi Alfian Malarangeng. “Atlet, pelatih dan kalangan peduli olahraga berharap pembangunan olahraga di Indonesia terus meningkat namun tantangan di depan mata Mennegpora adalah SEA Games,” kata mantan pesepakbola Drs Benny Tomasoa di Medan, Selasa

(27/10). Untuk mewujudkan tekad meraih prestasi gemilang pada ajang SEA Games, telah dicanangkan Mennegpora sebelumnya Adhyaksa Dault melalui program Pelatnas jangka panjang. “Kita berharap Mennegpora Andi Malarangeng tidak ikutikutan membuat terobosan baru hanya karena wacana kinerja 100 hari,” katanya. Yang lebih penting adalah fokus pada persiapan kontingen Indonesia menghadapi SEA Games agar tekad menempat-

kan diri pada peringkat tiga menjadi kenyataan,” kata pengurus PSMS itu. “Andi harus lebih baik dari pendahulunya. Karena jujur saja Adhyaksa Dault telah banyak berbuat dan meninggalkan jasa bagi kemajuan olahraga nasional, antara lain pengangkatan ribuan atlet, mantan serta pelatih menjadi Pegawai Negeri Sipil (PNS) dan pemberian bonus rumah,” tambah Ketua DPD Himpunan Hama Indonesia Sumut itu. (m24)

MEDAN (Waspada): Go Serge Motorsport kembali menggelar kejuaraan reli KFC Rally Championship 2009 dengan mengagendakan pelaksanaan seri III dan IV masingmasing di area parkir Pekan Raya Jakarta (PRJ) dan di Areal Mandalapratama Permai Dawuan, Cikampek, Jabar, 2022 November. Pimpinan Go Serge Motorsport Ricardo Gelael dalam rilisnya, Selasa (27/10) menyebutkan, acara telah dirancang lain dari yang biasa, yakni menggelar Super SS di Parkir Barat PRJ Kemayoran pada Jum’at malam, 20 November. “Even didahului acara Ceremonial Start jam 19.00 dan dilanjutkan dengan Super SS mulai pukul

20.00,” ungkap Ricardo. Menurut pereli nasional itu, kontinitas dari penyelenggaraan KFC Junior Rally Championship adalah sebagai ajang pembinaan anak-anak muda agar bisa secara konsisten meningkatkan prestasinya sebagai pereli Indonesia masa depan, yang lebih berbobot dan mempunyai skill lebih baik lagi. “Apalagi, kami juga akan memadukan antara kegiatan reli dengan entertainment bagi para keluarga pereli, simpatisan dan masyarakat umum hingga didapat suatu tontonan dan hiburan yang menarik,” sebutnya. Panitia akan berusaha menampilkan pereli-pereli junior maupun seeded agar dapat menampilkan kehebatan mereka

melintasi trek sepanjang 1.500 meter pada malam hari itu. Di antara peserta yang bakal tampil tercatat pereli muda Robin Tato, Ananda Putranto, Sean Gelael, Oke, Dodi Idishah, Sultan Djorgi, De’yang, bersama pereli Seeded Rifat dan Rizal Sungkar, Subhan Aksa, Akbar Hadianto, serta Ijeck. “Inilah salah satu even akbar di penghujung 2009 yang perlu kita dukung dan saksikan guna mendukung peningkatan prestasi para pereli muda menuju jenjang yang lebih tinggi,” tambah Koordinator Humas Helmy Sungkar, didampingi Hervian Soejono selaku Event Project Officer serta Pimpinan Lomba Poedio Oetojo. (h09)

Waspada/Hasuna Damanik

Bupati Simalungun diwakili Sekda Mahrum Sipayung saat melepas peserta lomba gerak jalan menyambut HUT Sumpah Pemuda, Selasa (27/10).

Lomba Gerak Jalan KNPI Simalungun SIMALUNGUN (Waspada): Dalam rangka memeriahkan Hari Sumpah Pemuda ke- 81, Komite Nasional Pemuda Indonesia (KNPI) Kabupaten Simalungun menggelar lomba gerak jalan beregu untuk tingkat pelajar SMA sederajat, Selasa (27/10). Pelepasan lomba oleh Bupati Simalungun diwakili Sekretaris Daerah Ir Mahrum Sipayung MS didampingi Ketua DPRD Binton Tindaon SPd, unsur muspida dan Ketua KNPI Evra Sassky Damanik SSos. Menurut panitia, Henri G Purba, lomba diikuti 64 regu dari

31 sekolah setingkat SMA seKab Simalungun dengan mengambil start dan finish di depan kantor Inspektorat Pemkab Simalungun sepanjang 3 km. Ketua KNPI Kab Simalungun H Evra Sassky Damanik mengatakan, kegiatan lomba dilaksanakan untuk menyambut dan memeriahkan Hari Sumpah Pemuda ke-81, sedangkan puncak acara digelar di lapangan Rambung Merah. Ketua DPRD Simalungun Binton Tindaon menyambut baik kegiatan gerak jalan tersebut. Sedangkan Bupati Simalungun melalui Sekretaris Da-

erah Mahrum Sipayung mengharapkan, lomba itu dapat memberikan semangat baru bagi para pelajar dalam meningkatkan pendidikannya di sekolah. (a15)

5 2 5 9 6 3 8 7 4 9 6 2

MEDAN (Waspada): Kursus wasit sepakbola C-I Nasional untuk wilayah Sumatera akan digelar di Medan oleh Pengprov PSSI Sumut pada 16-27 November 2009. “Kegiatan ini merupakan program kerja PSSI Sumut di tahun 2009 dan didukung PSSI Pusat,” ujar Ketua Pengprov PSSI Sumut Drs Chaerullah melalui bendahara Sugeng Rahayu didampingi ketua panitia Drs Mondan Tarigan di Medan, Selasa (27/10). PSSI Pusat akan menurunkan lima instruktur kursus, yakni Purwanto, Bambang Irianto, H Mulyana Sobandi, R.A Razak dan M Achwani. “Kita harapkan kesempatan ini dapat dimanfaatkan para wasit khususnya di Sumut, sehingga jumlah wasit yang dapat memimpin pertandingan tingkat nasional kian bertambah,” harap Sugeng. Menurut Sugeng, Sumut telah memiliki 43 wasit bersertifikat C-I Nasional. “Dari 43 wasit tersebut, tujuh di antaranya telah memimpin pertandingan Super Liga, divisi utama (7), divisi I (5), divisi II (5) dan 19 orang memimpin pertandingan divisi III,” jelasnya. Lebih lanjut Sugeng mengatakan, pendaftaran peserta kurus telah dibuka sejak 15 Oktober hingga 15 November, di Sekretariat Pengprov PSSI Sumut, Jl. Sekip Baru No.50 telp/fax (061) 4527376. Ketua Panitia Drs Mondan Tarigan menambahkan, peserta kursus kali ini dibatasi hanya berjumlah maksimal 30 orang dengan usia maksimum 30 tahun dibuktikan dengan akte kelahiran. (m42)

infrastruktur itu adalah hal utama yang harus diperhatikan. Tanpa itu, sulit bagi Sumut menjadi tuan rumah PON. Menyedihkan memang, karena Sumut pernah mencatat sukses menjadi tuan rumah pada PON III/ 1953,” beber Johar. Dikatakan, dengan adanya bantuan dari pemerintah pusat melalui kantor Mennegpora sebesar Rp8 milyar lebih untuk


PSSI Sumut Gelar Kursus Wasit C-I

Begitu juga dengan 12 cabang lain, di antaranya tenis meja, tenis lapangan, gulat, judo, voli, basket, panahan dan renang. (m20)

Waspada/Yuslan Kisra

Sekum KONI Sumut Drs Chairul Azmi Hutasuhut MPd, Deputi Mennegpora Prof Dr Johar Arifin Husein, Mennegpora Andi Malarangeng, Ketua Komisi E DPRD Sumut Brilian Moktar, SE dalam pertemuan di Jakarta, Selasa (27/10).

9 1 4

bisa saya minta bisa mencapai target tiga besar,” kata Syamsul. Apalagi lanjutnya, pemerintah daerah saat ini telah benar-benar memperhatikan kesejahteraan dan masa depan atlet. Terbukti dengan meningkatnya pemberian bonus untuk atlet berprestasi, serta formasi penerimaan Pegawai Negeri Sipil (PNS) juga menyediakan kuota untuk atlet berprestasi yang telah membawa nama Sumut untuk tingkat nasional maupun internasional. Namun target tiga besar itu, menurut Sakiruddin belum mampu disanggupi. Dari posisi rangking delapan yang telah diraih Sumut, pada Popnas 2005 di Medan dan 2007 di Kalimantan Timur, untuk Popnas tahun ini menurutnya paling Sumut akan terdongkrak di posisi empat besar. “Kita upayakanlah paling berada di posisi empat besar,” ujarnya. Dia memaparkan, peluang medali akan bisa diraih dari cabang atletik dengan prediksi empat medali emas.

Dalam pertemuan yang turut dihadiri Sekum KONI Sumut Drs Chairul Azmi Hutasuhut MPd dan juga Deputi Mennegpora, Prof Dr Johar Arifin Husein, Komisi E DPRD Sumut yang dipimpin Brilian Moktar SE meminta pemerintah pusat memberi kesempatan kepada Sumut untuk menjadi tuan rumah event akbar olahraga di tanah air, PON.

“Pada prinsipnya, pemerintah tidak masalah namun itu semua harus kita lihat lagi kemungkinannya. Secara kebetulan, saya memang akan melakukan repitalisasi secara nasional. Baik di bidang pemuda maupun olahraga,” kata Mallarangeng dalam sambutannya menanggapi permintaan puluhan anggota dewan dari Sumut tersebut. Meski demikian, lanjutnya, semua masih harus dilihat kemungkinannya seperti apa termasuk kesiapan Sumut sendiri, terutama dalam hal sarana dan prasarana. Hal tersebut imbuhnya, karena memang regulasinya seperti itu. Senada itu, Johar Arifin yang melanjutkan pertemuan dengan anggota Komisi E DPRD Sumut menyatakan, jika Sumut benarbenar ingin menjadi tuan rumah, maka sarana dan prasarana harus disiapkan. “Butuh kerja keras bagi Sumut, jika ingin menjadi tuan rumah PON. Bagaimana pun,

4 1 8 6 3 7 4 7 4 1 3 9 5 7 5 9 8 8 7 6 9

MEDAN (Waspada): Target tiga besar yang dicanangkan Gubernur Sumatera Utara H Syamsul Arifin SE merupakan beban berat bagi kontingen Sumut menuju Pekan Olahraga Nasional (Popnas) Yogyakarta, 2-11 November. Pimpinan kontingen Sumut H Sakiruddin SE, juga mengaku tak menyanggupi target tersebut. “Kalau target tiga besar, ya belum sangguplah kita. Jangan nantinya jadi asal ngomong saja,karena kita juga sangat sulit memprediksi kekuatan atlet dari Pulau Jawa,” kata Sakiruddin yang juga Kasubdis Olahraga Disporasu, menjawab wartawan usai acara melepas kontingen Sumut oleh Gubsu di Aula Martabe, Rabu (28/10) pagi. Di hadapan 170 atlet dan para ofisial, Gubsu berharap kontingen bisa membawa harapan masyarakat Sumut. “Hari ini dan kedepan harus lebih baik dari pada masa lalu. Jadi prestasi para atlet yang akan membawa nama besar Sumut juga harus ada peningkatan. Kalau

JAKARTA (Waspada): Sumut berharap bisa diberi kepercayaan menjadi tuan rumah Pekan Olahraga Nasional (PON) XVIII 2016. Hal itu terungkap dalam pertemuan 16 Anggota Komisi E DPRD Sumut dengan Mennegpora Andi Alfian Mallarangeng di Kantor Mennegpora di Jakarta, Selasa (27/10).




Rabu 28 Oktober 2009

Toyota Pasang Kobayashi COLOGNE, Jerman (Waspada): Timo Glock dipastikan absen pada seri terakhir Formula 1 musim ini di GP Abu Dhabi, 1 November nanti. Kamui Kobayashi pun dipercayakan tampil sebagai pengganti. Cedera tulang belakang di sesi kualifikasi di Suzuka telah memaksa pembalap Jerman ini melewati GP Jepang dan Brazil. Toyota pun siap menunggu dia pulih demi performa terbaik di seri final. Sayang, kondisinya belum membaik hingga skuad manufaktur Jepang itu tak mau ambil resiko lebih besar. “Kami sangat menyesal Timo, yang secara impresif telah menyumbangkan dua podium, harus bernasib seperti ini,” ungkap Presiden Tim John Howett, Selasa (27/10). “Tapi kami tak mau memperparah kondisinya. Kami sudah meminta rekap medis, meminta saran dokter dan manajemen Timo. Tim memutuskan mengganti posisinya dengan Kamui,” terangnya. (m33/ini)

Toyota kembali mempercayakan kursi pembalap kepada driver asal Jepang, Kamui Kobayashi.


The Doctor Lupakan Roda Empat AP

Massa Asah Diri Lewat Gokart RIO DE JANEIRO (Waspada): Gagal tampil pada balapan Formula One (F1) seri terakhir di Abu Dhabi, pembalap Ferrari Felipe Massa (foto) akhirnya memastikan diri terjun di ajang gokart Granja Viana 500. Meski telah dinyatakan pulih dari cedera kepala yang menimpanya pada babak kualifikasi GP Hongaria, Massa harus memendam dulu keinginannya membalap di ajang F1, setelah Ferrari tidak ingin mengambil resiko.

Salah satu cara agar Massa tetap menjaga performanya adalah ikut ajang gokart. Sebelumnya, pembalap Brazil tersebut sudah mendaftarkan diri pada ajang gokart Challenge of the Stars, 27-29 November mendatang. Namun Massa merasa satu kejuaraan saja tidak cukup. Xinhua melansir Massa juga telah resmi mendaftarkan diri pada ajang Granja Viana 500, 5 Desember mendatang. Massa sendiri mengaku kondisinya saat ini sudah

kembali normal dan berjanji akan tampil ‘garang’ pada musim depan. Meski begitu, Massa tidak ingin melewati seri terakhir di Abu Dhabi akhir pekan ini. Pasalnya, musim depan Massa akan mendapat rekan setimnya yang anyar dengan datangnya Fernando Alonso. Pembalap Spanyol tersebut menggantikan posisi Kimi Raikkonen yang memutuskan untuk berpisah dengan Ferrari. (m33/ini)

GERNO DI LESMO, Italia (Waspada): Juara dunia MotoGP, Valentino Rossi, mengindikasikan akan tetap bertahan di ajang balap motor bergengsi tersebut untuk tahun depan. Rossi yang meraih gelar juara dunia tujuh kali ini akan mengakhiri kontrak dengan Yamaha pada 2010. Ia disebut-sebut berminat untuk ikut dalam ajang reli dunia (WRC). Namun pembalap Italia ini mengaku masih mencintai lomba balap motor. Ditanya kemungkinan mundur dari ajang balap motor pada akhir 2010, Rossi tidak memberi jawaban pasti. “Saya rasa tidak. Jika mundur saya berusia 31, apa yang akan saya lakukan? Saya harus mulai bekerja dan saya pikir akan tetap berlomba hingga usia 33 atau 34,” papar

The Doctor. Tahun lalu, Rossi memecahkan rekor pembalap legendaris Italia, Giacomo Agostini dalam jumlah kemenangan di ajang lomba premier. Kini, Rossi berharap dapat memecahkan rekor Agostini lainnya yang mencatat 122 kemenangan dalam semua lomba Grand Prix. “Saya telah mencapai 100 kemenangan, mungkin saya akan mencoba mengejar kemenangannya di 122 seri lomba,” kata Rossi yang masih terpaut 19 kemenangan di belakang Agostini. “Semua tergantung keputusan saya pada 2011, apakah akan memperpanjang kontrak untuk satu atau dua tahun. Jika saya lakukan sekarang, saya akan memilih kontrak dua tahun,” tutup jawara dunia itu. (m33/vvn)

Jackson Minta Lakers Fokus LOS ANGELES, AS (Waspada): Pelatih Phil Jackson mengingatkan para pemain Los Angeles Lakers untuk tak terlalu emosional saat menerima cincin juara NBA. Ia meminta skuadnya tetap fokus menghadapi LA Clippers di laga pembuka. Lakers yang merebut juara NBA yang ke-15 kalinya setelah mengalahkan Orlando Magic di final NBA Juni lalu, akan memulai laga pertamanya di musim 2009/2010 menghadapi rival sekotanya, Clippers, di Staples Center, Rabu (28/10) ini. Namun, sebelum laga digelar para pemain Lakers akan menerima cincin juara NBA. Hal itu tentu saja akan membuat suasana kegembiraan bagi pemainnya. Jackson pun mengingatkan para pemainnya agar merayakan tak berlebihan karena akan menghadapi Clippers. “Sangat sulit bermain di malam pemberian cincin. Ini merupakan sebuah gangguan

yang besar karena orang merasakan seperti kehidupan di masa lalu,” ungkap Jackson, Selasa (27/10). “Anda dapat sukses di saat ini ketika Anda melengkapinya dengan sikap yang baik. Itu hal yang kami tetap katakan kepada pemain. Sukses tahun lalu telah berakhir di bulan Juni,” tambah Master Zen, julukan sang pelatih semasa di Chicago Bulls. Meski demikian, Jackson tak terlalu khawatir karena beberapa pemain sudah tahu akan hal itu. Apalagi Lakers tetap mempertahankan para pemain pentingnya yang akan menjadi kunci penting keberhasilan mereka di masa depan. “Beberapa dari mereka belum pernah berada di dalam tim kejuaraan, tapi (Derek) Fisher dan Kobe (Bryant) sudah pernah. Mereka tahun risiko memasuki malam pemberian cincin ini, sebagai contoh dan memulainya sebagai juara bertahan,” ungkap Jackson. Bukan hanya Jackson, Kobe


Wang Dihukum Seumur Hidup BEIJING (Antara/Reuters): Juara 100 meter putri China Wang Jing (foto) mulai Senin dihukum larang tampil seumur hidup setelah dinyatakan gagal dalam pemeriksaan penggunaan obat terlarang dalam pekan olahraga nasional di negara itu. Wang diperiksa positif menggunakan obat perangsang metabolisme penampilan epitestosterone dan testosterone setelah memenangi nomor 100 meter pada perlomaban Kamis lalu di PON di Jinan, Provinsi Shandong. Panitia pertandingan mencoret raihan medali emas atlet berusia 21 tahun itu dan Pusat Administrasi Atletik China (CAAC) melarang Wang dan pelatihnya tampil seumur hidup. Sprinter China itu mengakui hasil pemeriksaan itu, tetapi menyatakan bahwa dia tidak pernah secara sengaja menenggak zat terlarang dan meminta agar pemeriksaan dilakukan lebih mendalam. Kemenangannya dengan waktu 11,50 detik, lebih lamban satu detik dari rekor dunia 10,49 detik. Wang merupakan atlet ketiga yang diketahui menggunakan obat terlarang sejak PON negara itu diadakan mulai 16 Oktober, menyusul pedayung Guo Linna dan petembak Li Jie.

Valentino Rossi (kanan) setia di ajang balap MotoGP.

Phil Jackson (duduk) berharap banyak pada trio Paul Gasol (kiri), Kobe Bryant dan Ron Artest. pun menyadari bahwa pertandingan pembuka ini akan dihadapi lebih berat dengan suasana emosional. “Selalu jadi salah salah satu laga terberat yang Anda mainkan karena emosional,” ujarnya seperti dilansir LA Times. (m33/rtr)

Pasang Iklan Hub.� 4528431 HP. 081370328259 Email:


Medan Metropolitan Medan Berpeluang Raih Adipura



Rabu 28 Oktober 2009

MEDAN (Waspada): Kota Medan masih berpeluang men-dapat piala Adipura, sebuah penghargaan kota terbersih dari presiden. Sebelumnya, Ibukota Provinsi Sumatera Utara ini mendapat predikat kota terjorok akibat vakumnya kebijakan dan pembangunan di segala sektor ketika pada masa Pj Walikota Afifuddin Lubis. Pasalnya, Pemko masih bisa melakukan pembenahan kota yang diharapkan sampai rentang waktu Juni 2010. Tim Adipura masih melakukan dua tahapan penilaian. “Dengan rentang waktu itu, Pemko dapat memperbaiki dan menata sejumlah titik yang menjadi penilaian untuk mendapatkan piala itu,” kata Jaya Arjuna, pengamat lingkungan dari Universitas Sumatera Utara yang juga unsur penilai Adipura dari kalangan LSM ketika meninjau tempat pembuangan akhir (TPA) sampah di Kecamatan Medan Marelan bersama Kepala Dinas Bina Marga Kota Medan, Gindo Marganti Hasibuan, kemarin. TPA salah satu dari puluhan titik yang menyumbang poin besar dari sejumlah lokasi penilaian Adipura. Selain drainase dan jalan. Menurut Jaya, dari hasil peninjauan tim pada tahap pertama ke sejumlah lokasi penilaian Adipura, sudah ada pergerakan perubahan tetapi belum maksimal. Namun, lanjutnya, hal itu sudah baik dibanding kondisi

sebelumnya di mana-mana semrawut. Jaya mengatakan, jika Pemko terus melakukan pembenahan, Adipura bukan tidak mungkin diraih kembali dengan memanfaatkan waktu sampai Juni mendatang untuk membenahi drainase, mengurangi genangan air, pengelolaan TPA dan kebersihan di gedung instansi ataupasaryangjadititikpenilaian. Masyarakat dan aparat Pemko, lanjutnya, harus mendukung upaya penataan kota ini agar Medan tidak lagi semrawut dan kembali seperti semula. Tanpa dukungan masyarakat dan aparat, ujarnya, Medan akan sulit meraih predikat kota yang bersih dan nyaman. Jaya menilai dari hasil peninjauan di lapangan, masyarakat kurang maksimal mendukung upaya ini. Tidak hanya masyarakat, kata Jaya, banyak aparat Pemko sendiri yang tidak sepenuhnya mendukung program Pj Walikota Rahudman Harahap untuk menata kembali kota ini agar mendapatkan Adipura.

“Tidak usah saya sebutkan nama pimpinan SKPD-nya. Di lapangan sudah kelihatan siapa yang mendukung dan siapa yang tidak,” katanya. Jaya mengatakan, fakta ini sangat ironis. Pj Walikota harus jeli melihat persoalan ini dan mengambil tindakan tegas demi kepentingan pembangunan kota ke depan. Menurut Jaya, jangan karena persoalan Pilkada mendukung sana dan sini, para pimpinan SKPD dan staf di Pemko Medan tidak menunjukkan kinerja yang positif untukmendorongprogrampembenahan kota yang juga dikaitkan dengan penilaian Adipura. Jaya menyesalkan hanya beberapa pimpinan SKPD yang siang-malam mencurahkan perhatiannya untuk melakukan pembenahan kota sesuai harapan masyarakat. Mana peran pimpinan SKPD lain? “Saya kira Pak Rahudman sudah bisa melihat staf yang mana tidak mendukung dan mendukung pembenahan kota yang juga dikaitkan dengan penilaian Adipura,” katanya. Jaya mengimbau kepada masyarakat agar membantu program Pemko untuk menata kembali kota ini agar tidak lagi mendapat predikat kota terjorok. Jaya optimis mimpi kota ini bisa kembali meraih Adipura dengan komitmen Pj walikota menata kembali kota sampai

rentang waktu Juni mendatang, jika didukung partisipasi masyarakat dan kinerja positif dari staf walikota. Sementara itu, Kadis Bina Marga yang juga koordinator tim Adipura Pemko Medan, Gindo Maraganti Hasibuan, mengatakan, pihaknya terus melakukan pembenahan. Pembenahan itu, lanjutnya, tidak terbatas pada titik-titik penilaian Adipura saja tetapi seluruh lini yang selama ini semrawut. Apa yang menjadi masukan masyarakat dan tim penilaian Adipura yang sudah turun beberapa hari ini, ujar pengamat pengairan itu, kita akan laksanakan dalam tempo cepat seperti pengorekan sendimentasi ratusan kilometer parit, perbaikan jalan, mengurangi genangan air, menata pasar tradisional dan mengendalikan sampah. “Memperbaiki kota ini tidak zamannya lagi bertele-tele. Karena ini berkaitan dengan pelayanan publik. Kita terus laksanakan dan berkoordinasi dengan pimpinan SKPD yang terkait. Mengenai ada staf atau SKPD terkait yang tidak mendukung program pembenahan kota, hal itu kita serahkan kepada PakWalikota. Terpenting kita terus bekerja untuk masyarakat dan pembangunan kota ini,” katanya seusai meninjau sejumlah titik penilaian Adipura, termasuk TPA di Kelurahan Terjun, Medan Marelan. (m15)

Tidak Ada Sumpah Pemuda Pada 28 Oktober 1928 Hanya Ada Poetoesan Congres MEDAN (Waspada): Berdasarkan catatan dan dokumen sejarah diketahui bahwa hari ‘sumpah pemuda’ yang diperingati sebagai peristiwa nasional merupakan suatu hasil rekonstruksi dari para pembangun bangsa (founding father) yang didasarkan pada ideologiideologi dari generasi yang berbeda sebelumnya. “Peristiwa 28 Oktober 1928, yang diperingati sebagai hari “sumpah pemuda’ adalah rekonstruksi simbol yang sengaja dibentuk kemudian setelah sekian lama peristiwa tersebut berlalu, yaitu adanya pembelokan kata ‘Poetoesan Congres’ menjadi kata ‘Sumpah Pemuda’,” kata sejarawan Kota Medan Dr. Phil. Ichwan Azhari dalam Dialog Interaktif ‘Refleksi Dan Eksistensi Pemuda 81 Tahun Sumpah Pemuda Menuju Reformasi Bangsa’, di Universitas Negeri Medan (Unimed), Selasa (27/10). Ichwan Azhari yang juga Kepala PUSSIS Unimed ini menegaskan, apabila teks asli hasil kongres pemuda 28 Oktober 1928 diteliti, maka tidak akan ditemukan kata ‘sumpah pemuda’ melainkan ‘Poetoesan Congres’. Menurutnya, hal tersebut dilakukan sebagai cara Soekarno untuk menghardik dan memberi peringatan keras kepada dalang gerakan separatis yang

mulai muncul menentang keutuhan Bangsa Indonesia. “Pembelokan kata ‘Poetoesan Congres’ menjadi kata ‘Sumpah Pemuda’ ditujukan dan digunakan sebagai senjata idologi terhadap pihak separatis yang dinyatakan melanggar ‘sumpah pemuda’ tahun 1928,” ujarnya. Sebagaimana diketahui bahwa, pada 28 Oktober 1954, Presiden Soekarno dan Muhammad Yamin membuka Kongres Bahasa Indonesia yang kedua di Medan, dan Yamin dalam kapasitasnya sebagai menteri Pendidikan dan Kebudayaan Kabinet Ali Sastroamijoyo. Pada saat itu, Soekarno dan Yamin sedang membangun simbol yang menjadi bagian dari susunan ideologi sebuah bangsa dan negara, dimana pilihannya jatuh pada tanggal 28 Oktober 1928 dan pada saat itu pula kata ‘Poetoesan Congres’ dibelokkan menjadi ‘Sumpah Pemuda’. Sejak saat itu (tahun 1954), lanjut Ichwan, 28 Oktober dianggap sebagai ‘hari kelahiran sumpah pemuda’ untuk pertama kalinya. Dengan kata lain bahwa Kongres Bahasa Indonesia kedua di Medan tahun 1954 itu, telah menjadi awal yang menganggap tanggal 28 Oktober 1928 sebagai hari kelahiran Sumpah Pemuda.

Demi Kepentingan Idiologi Sementara itu, Erond Damanik (peneliti Pussis-Unimed) mengemukakan, Soekarno dalam pidato-pidato selanjutnya, khususnya sejak tahun 1954 sebagaimana yang dimuat pada koran Merdeka 1955, Soekarno berpidato di hadapan publik di Solo dengan menggunakan kata ‘Sumpah Pemuda, jang berisikan djandji berbahasa satu, bertanah air satu dan berbangsa satu’ untuk melayani kepentingan dari sebuah idiologi negara kesatuan. Lebih lanjut ditegaskannya, sejak tahun 1956, Soekarno menggunakan kata Sumpah Pemuda sebagai senjata Idiologi. Pada pidatonya, pada Oktober 1956, Soekarno membicarakan perihal ‘penjimpangan dari Sumpah 1928’ sebagai cara untuk memberi peringatan keras terhadap merebaknya gerakan separatis di Indonesia. Selain itu, Soekarno juga menggunakan kata Sumpah Pemuda untuk menuding meningkatnya faham fanatisme kedaerahan dan federalisme sebagai orang yang tidak setia kepada Proklamasi Kemerdekaan Indonesia. Selanjutnya, pada tahun 1955, Yamin menerbitkan selebaran dengan tema Sumpah Indonesia Raja, yang diklaimnya bahwa peristiwa 1928 merupakan reinkarnasi dari masa lalu

Indonesia dan juga menempatkan Sumpah Pemuda sejajar dengan Sriwijaya dan Majapahit sebagai tiga peristiwa dalam sejarah ‘Nusantara’ yang secara mutlak memberi jalan terbentuknya suatu negara dan komunitas yang baru disadari oleh kebanyakan orang pada proklamasi 1945. Erond menyebutkan, pada intinya pembelokan kata ‘Poetoesan Congres’ menjadi ‘Sumpah Pemuda’ khususnya sejak tahun 1954 adalah sebagai senjata idiologi untuk menuding orang-orang atau kelompok yang dinilai tidak setia kepada proklamasi kemerdekaan Indonesia sekaligus sebagai cara untuk membentuk kesadaran nasional atas kemerdekaan itu. Upaya tersebut, lanjutnya, adalah proses penciptaan makna dan transformasi nilai untuk membentuk khazanah ke-Indonesia-an. Namun demikian, tidak semestinya peristiwa tersebut melahirkan kontroversi baru dalam pembelajaran sejarah nasional Indonesia yang sudah semestinya mendapat penjelasan yang baik dalam pembelajaran sejarah Indonesia. Ini berarti bahwa, perlu dilakukan pengkajian dan penelitian komprehensif sehingga peristiwa 28 Oktober 1928 tersebut dapat dipahami secara detail dan benar. (m41)

Tiga Fly Over, Satu Under Pass Segera Dibangun MEDAN (Waspada): Beberapa proyek infrastruktur jalan yang bersumber dari anggaran APBN, untuk menunjang Medan sebagai kota jasa, satu per satu mulai dilaksanakan. Setelah dua jembatan layang (fly over) dibangun, fly over di Pulo Brayan dan terakhir baru rampung di Amplas, kini satu dari tiga rencana pembangunan fly over mulai dilakukan pengukuran lahan seperti, di Simpang Pos Jalan Jamin Gintings-Ngumban Surbakti akan dibangun sepanjang 500 meter. Pemerintah pusat melalui Departemen Pekerjaan Umum akan menyediakan anggaran fisiknya. Sedangkan pembebasan lahan ditanggung APBD. “Saat ini sedang berlangsung tahap pengukuran lahan di lokasi,” kata Kepala Badan Perencanaan Pembangunan Daerah (Bappeda) Kota Medan, Syaiful Bahri Lubis, kemarin. Menurut insinyur yang sedang konsern dalam perencanaan pembangunan kota ini ke depan, Pemko menargetkan pembebasan lahan untuk jalan layang Jamin Gintings tuntas pada awal 2010, sehingga PU dapat mengerjakan fisik proyek dalam tahun itu juga. Beberapa proyek lain menyusul, baik studi kelayakannya yang sudah rampung dan sedang tahap pengerjaan, seperti rencana pembangunan under pass atau kebali-

kan dari jembatan layang yang akan dibangun di Jalan Brigjen Katamso-Jenderal Besar AH Nasution. Untuk proyek ini, lanjutnya, Bappeda sedang melakukan studi kelayakan. “Diharapkan dari studi kelayakan itu, under pass cocok dibangun di kawasan itu untuk mendukung perkembangan transportasi di kota ini,” katanya. Kemudian, untuk rencana proyek jembatan layang di Kampung Lalang dan Pondok Kelapa sudah ada pembicaraan dengan pemerintah pusat untuk segara dilakukan studi kelayakan sebagai tahap awal, setelah itu membuat desain fisik berkoordinasi dengan PU. “Perencanaan itu sudah matang di Bappeda.” Menurut Syaiful, alokasi dana APBN untuk pembangunan infrastruktur jalan di Kota Medan tidak terlepas dari lobi ke pemerintah pusat. Kemudian, pemerintah pusat memberikan kepercayaan kepada Pemko untuk menyukseskan program pembangunan dengan catatan Pemko dibantu Pemprovsu harus mampu membebaskan lahan. Tentunya hal ini tidak mudah berdasarkan pengalaman, seperti pembangunan jalan lingkar luar (outer ring road) dan jalan layang karena bersinggungan dengan pembebasan lahan masyarakat. Namun, ka-

tanya, kita harus optimis bahwa tantangan sebagai pemicu bagi aparat pemerintah untuk terus mendorong pembangunan kota ini ke depan. “Tidak ada kata mundur untuk pembangunan kota ini. Harus berpikir ke depan. Masalah yang bersinggungan dengan masyarakat bisa dibicarakan secara baik-baik dan pasti ada jalan keluar,” katanya seraya mencontohkan bagaimana sulitnya Pemko melanjutkan pembebasan lahan Fly Over Amplas yang sempat terkendala akibat penolakan warga dan sengketa lahan yang akhirnya ketika ditanganinya bersama tim didukung Pj walikota dapat dituntaskan meskipun molor. Ke depan, lanjutnya, Pemko bersama Pemprovsu harus siap dalam hal apapun, terutama pembebasan lahan, agar proyek infrastruktur jalan bisa terwujud di Medan seperti kota-kota besar lainnya. Untuk berbagai proyek penunjang transportasi di Medan, ujar mantan Kabid Fisik di Bappeda Medan, pihaknya siap mendukung proyek itu karena program-program PU sesuai perencanaan yang sedang disusun Bappeda untuk pembangunan Medan sebagai kota jasa. Syarat kota jasa, lanjutnya, infrastruktur jalan harus memadai untuk mendukung arus barang dan transportasi. Keterse-

diaan infrastruktur jalan agar transportasi tidak macat syarat mutlak bagi kota ini ke depan. “Sehingga proyek-proyek APBN itu harus didukung dengan kesiapan SDM dan aparat yang berfikir maju,” ujarnya. Bahkan, kata Syaiful, pihaknya merencanakan perluasan dan penambahan jalan lingkar luar. “Ini sedang kita jajaki dengan pemerintah pusat,” ujarnya. Sementara itu, Satker Pembangunan Jalan dan Jembatan Bina Marga Departemen Pekerjaan Umum, Simon Ginting, mengakui pihaknya telah memprogramkan pembangunan proyek-proyek itu di Kota Medan seperti sedang dilakukan pengukuran lahan untuk jalan layang Jamin Gintings. Anggarannya sudah diprogramkan dalam Departemen PU. “Fisik Fly Over Jamin Gintings siap dikerjakan. Kita tinggal menunggu pembebasan lahan seratus persen,” katanya. Untuk proyek Fly Over Lalang dan Pondok Kelapa, Simon mengatakan, akan dilakukan studi dulu mana yang layak baru tahun berikutnya menyiapkan desain dan sekaligus pembebasan tanah. Pembangunannya direncanakan tahun 2011. Untuk proyek under pass Simpang Jalan Katamso-AH Nasution studi kelayakan dilakukan tahun 2010. (m15)

PENANGGULANGAN KEMISKINAN: Gubsu H Syamsul Arifin, SE menyampaikan paparannya dalam Rapat Koordinasi Penguatan Kelembagaan Tim Koordinasi Penanggulangan Kemiskinan (TKPK) Sumut di Hotel Asean Medan, Selasa (27/10). Masalah kemiskinan di daerah ini merupakan masalah yang serius dan harus segera ditangani dengan baik.

Kebijakan Rahudman Butuh Dukungan Aparatur Dan Masyarakat MEDAN (Waspada): Kebijakan Pj Walikota Medan Rahudman Harahap, mendapat dukungan banyak pihak, termasuk mantan anggota DPR RI asal Sumut H.M. Yusuf Pardamean. Untuk mempertahankannya dibutuhkan didukung seluruh aparat Pemko dan masyarakat. H.M. Yusuf Pardamean, berbicara kepada wartawan, Selasa (27/10). Katanya, gairah pembangunan di Medan kini bangkit kembali, setelah ‘terpuruk’ sejak tahun 2006. DisebutkanYusuf Pardamean, sejak mantan walikota Abdillah dan mantan wakil walikota Ramli, terjerat hukum, sejak itu pula pembangunan di Medan berhenti. Seluruh aparat Pemko takut menjalankan program. Berbagai masalahpun timbul. Sejak tahun 2006, kota Medan bagai berjalan tanpa pemerintahan. Pelayakan publik tidak berjalan baik. Pembangunan infrastruktur, seperti jalan dan drainase terhenti. Sampah tidak terangkut dan lain sebagainya. Kini kondisi itu mulai dapat diatasi. Rahudman Harahap, yang ditunjuk sebagai PjWalikota Medan, dinilai mampu membangkitkan kembali semangat

birokrasi. Kata Yusuf Pardamean, setidaknya ada lima sisi yang dikedepankan Rahudman, dalam menjalankan pemerintahan. Pertama, menurut mantan anggota DPRD Medan periode 1982-1997 ini, Rahudman, sangat peduli dengan pemerintahan dan aparatur. Dia sadar benar, hal yang harus ditata untuk kembali membangun Medan adalah dengan mengembalikan semangat aparatur dalam dalam bekerja. Kedua, Rahudman Harahap, sangat aktif berkomunikasi dengan masyarakat. Dengan begitu dia memahami benar apa yang diharapkan masyarakat dalam penyelenggaraan pemerintah. Kaitannya dengan itu, sisi ketiga yang dikedepankan Rahudman, adalah dia sangat peduli dengan kebutuhan masyarakat. Karena itulah Rahudman, segera memenuhi kebutuhan rakyatnya dengan memperbaiki jalan. Selama ini, kata Yusuf Pardamean, masyarakat (terutama di pinggiran Medan) membutuhkan perbaikan jalan. Beberapa tahun terakhir, masyarakat di sana merasa tidak diperhatikanlagiolehPemko.Hampirselu-

ruh jalan di pinggiran kota rusak, dan tak tahu kapan diperbaiki. Dalam kondisi hampir putus asa, Rahudman Harahap, hadir menjawab kekecewaan masyarakat tersebut. Kata Yusuf Pardamean, dengan kepeduliannya terhadap kebutuhan masyarakat, Rahudman, memperbaiki jalan-jalan yang rusak. ‘’Agar perbaikan jalan dapat segera dilakukan, pengerjaannya dilakukan dengan sistem swakelola,’’ kata Yusuf Pardamean. Tidak saja perbaikan jalan, Rahudman, juga melaksanakan pengorekan parit untuk memperlancar saluran air. Tujuannya tidak saja untuk mengurangi genangan air ke badan jalan saat hujan turun, tapi juga menghindakan masyarakat dari penyakit demam berdarah dan malaria. Sisi keempat yang dikedepankan Rahudman, adalah peduli terhadap pengelolaan pasar. Untuk kebijakan ini, dia mendapat banyak pujian dari masyarakat. Menurut Yusuf Pardamean, setidaknya, aa 11 pasar yang berada di tengah kota, kini sudah terta rapi. Keberadaan pedagang kaki lima yang selama ini sangat dikeluhkan masyarakat, sudah dapat

diatasi. Terahir, kata Yusuf, Rahudman, peduli terhadap penataan parkir. ‘’Kesemua program yang dilaksanakannya itu benarbenar menjawab hal yang dikeluhkan masyarakat selama ini,’’ katanya. Kelima program yang dijalankan Rahudman Harahap ini, menurut Yusuf Pardamean, hanya merupakan cikal bakal bagi bangkitnya kembali semangat kerja aparat Pemko Medan. Ke depan, Rahudman, masih membutuhkan kerjasama semua pihak untuk paling tidak mempertahankan program yang telah dibuatnya sekarang ini. KataYusuf Pardamean, mulai dari walikota sampai kepada kepala lingkungan, harus saling mendukung melaksanakan program ini. Peran serta masyarakat juga tidak kalah pentingnya. Terutama untuk menggalakkan kembali gotong royong, membersihkan saluran air. ‘’Yang dibuat Rahudman, ini adalah fakta publik yang tidak dapat dibantah. Persoalan ada hal-hal lain yang mungkin menjadi tujuannya, bukan kapasitas saya menilainya,’’ kata Yusuf Pardamean. (m17)

Medan Metropolitan

10 Dua Mayat Ditemukan Di Sungai Belawan BELAWAN (Waspada): Masyarakat di bantaran sungai Belawan, Dusun 4, Desa Hamparan Perak, Kecamatan Hamparan Perak, Deli Serdang, Selasa (27/10), dihebohkan dengan penemuan dua sosok mayat pada waktu yang bersamaan. Informasi diperoleh Waspada di lapangan, dua mayat yang ditemukan tersebut yakni bayi laki-laki dan seorang bocah berusia tujuh tahun. Bocah tersebut diidentifikasi sebagai Govinda Oktovinda penduduk Jln. Sei Mencirim Dusun I, Paya Geli, Deli Serdang. Mayat tersebut ditemukan warga setempat yang hendak turun di sungai. Petugas Polsek Hamparan Perak yang menerima laporan adanya penemuan

mayat tersebut, segera turun ke lapangan dan mengevakuasinya ke Instalasi Jenazah RSU Dr. Pirngadi Medan. Kapolsek Hamparan Perak AKP Azuar, SH menjelaskan, sebelumnya Govinda dilaporkan hanyut ketika mandi di Sungai Sunggal bersama temantemannya, Sabtu (24/10). “Pada tubuh korban tidak ditemui tanda-tanda kekerasan,” katanya. Sementara itu, Kanit Reskrim Polsek Hamparan Perak,

Pemerintah Menaruh Harapan Besar Terhadap Pemuda MEDAN (Waspada): Pemerintah tetap menaruh harapan besar dan masih membutuhkan peran pemuda untuk membangun bangsa ini. Untuk itu dibutuhkan pemuda-pemuda yang cerdas, trampil dan berwasasan. Kepala Dinas Pemuda dan Olahraga Sumatera Utara, Parlautan Sibarani, menegaskan hal itu kepada Waspada di kantornya Jalan KH.Wahid Hasyim Medan, Selasa (27/10), menanggapi pandangan pemerintah terhadap pemuda, berkaitan Peringatan Hari Sumpah Pemuda Ke-81 yang jatuh pada 28 Oktober 2009 hari ini. “Untuk mewujudkan pemuda yang cerdas, trampil dan berwasasan kebangsaan, Dinas Pemuda dan Olahraga tetap konsern berkewajiban melakukan pembinaan, baik formal dan non formal,” ujarnya. Kata Sibarani, pembinaan formal antara lain menggelar berbagai kegiatan ketrampilan. Kepemimpinan (leadership) agar memiliki wawasan dan peka disertai iman dan taqwa. Sedangkan non formal dengan memberikan dukungan dan bantuan-bantuan terhadap Organisasi Kemasyarakat Pemuda (OKP) di lintas strategis. Menjawab pertanyaan, bagaimana pemerintah dalam memberdayakan pemuda kita yang makin kritis, Sibarani mengatakan pemuda yang kritis adalah harapan bangsa. Pemuda harus bersikap kritis dalam menilai dalam upaya pengawasan segala bidang. Pemerintah, lanjutnya, tetap konsern terhadap keberadaan OKP yang diharapkan dapat semakin mencerdaskan pemuda dan menyadari akan tanggungjawab terhadap masa depan bangsa. Maka pemuda harus mengerti berorganisasi sehingga semakin pintar dan cerdas. Sibarani membantah rasa nasionalisme pemuda menipis rasa nasionalismenya. Katanya, pemuda tetap peka dan peduli terhadap situasi baik dalam maupun luar negeri. Seperti kasus Ambalat dan pulau-pulau terluar. Pemuda juga tanggap terhadap tindak pidana korupsi maupun ketidakadilan yang menjadi topik pembicaraan di negara kita. “Sifat nasional pemuda kita karena Pemerintah lahir sifat nasional. Namun cara penyampaiannya berbeda karena saat ini era reformasi. Selain pemuda tetap memegang Sumpah Pemuda, yaitu mengaku tumpah darah satu, tanah air Indonesia, mengaku berbangsa satu bangsa Indonesia dan menjunjung tinggi bahasa persatuan bahasa Indonesia.(m25)

PD Washliyah Didesak Usung Kader Di Pilkada MEDAN (Waspada): Generasi Muda Al Washliyah (GM AW) yang terdiri dari Gerakan Pemuda Alwashliyah (GPA) Ikatan Putera Puteri Al Washliyah (IPA) dan Himpunan Mahasiswa Al Washliyah (HIMMAH) mendesak Pimpinan Daerah AlWashliyah Kota Medan untuk segera menentukan sikap dengan mengusung kader sendiri pada Pemilihan Kepala Daerah (Pilkada) Kota Medan 2010 mendatang. Hal ini harus segera dilakukan mengingat pelaksanaan Pilkada sudah semakin dekat. Demikian disampaikan Ketua GPA Kota Medan, Mahrizal, SE, Ketua IPA Kota Medan Dedi Suhairi dan Ketua HIMMAH Kota Medan, Abdul Rahim Lubis kepada wartawan, Senin (26/10). Menurut Mahrizal, Al Washliyah sebagai ormas Islam terbesar di Kota Medan sudah selayaknya tampil mengajukan kader sendri pada Pilkada mendatang mengingat peluang calon independen terbuka lebar. Kendati demikian, koalisi terhadap partai politik juga bisa dilakukan selama platfon partai tersebut sesuai dengan khittah dan arah perjuangan Al Washliyah yang didirikan oleh para ulama. “Berdasarkan perhitungan yang matang serta dialog yang dilakukan secara intensif, kami generasi muda washliyah sepakat kalau Al Washliyah harus mengusung kadernya sendiri untuk menjadi calon pada Pilkada Kota Medan mendatang. Langkah ini harus segera diambil sebelum adanya keputusan calon tetap dari KPU.Jika itu dilakukan, maka sama saja Al Washliyah menjadi pengikut dan korban politik orang lain,” ujar Mahrizal. Hal senada juga dikatakan Dedi Suhairi. Menurutnya, Al Washliyah tidak pernah kekurangan kader yang berkompeten untuk memimpin Kota Medan. Banyak nama yang bisa diajukan dan diterima ditengah-tengah masyarakat, apalagi lanjut Dedi, nama tersebut kompak diusung secara institusi. (m10)

Pedagang Pagaruyung Harus Ciptakan Kebersihan MEDAN (Waspada): Pedagang kuliner Pagaruyung Kota Medan gelar gotong royong bersihkan drainase. Bahkan, para pedagang tersebut sekarang sedang mencari sponsor untuk penyeragaman tenda, sebab pedagang sedang menyiapkan grand desain Pagaruyung. Puluhan pedagang Pagaruyung sepakat melakukan kebersihan dan akan membuat jadwal tetap untuk pembersihan. Bahkan para pedagang memiliki komitmen bersama melakukan kebersihan. Demikian dikatakan, Rahmadsyah, koordinator pedagang Pagaruyung kepada wartawan, Minggu (25/10), saat melakukan gotong royong yang dihadiri Pj Walikota Medan, Rahudman Harahap dan anggota DPRD Kota Medan dari Fraksi PKS, Surianda Lubis bersama Hasyim dari Fraksi PDIP. Dikatakan Rahmadsyah, para pedagang sempat terkejut ketika diminta bongkar ikon wisata kuliner Kota Medan itu. Tapi setelah bertemu dengan camat, maka dibuat kesimpulannya pedagang harus menyeragamkan tenda dan menjaga kebersihan. “Setiap minggu kami akan jadwalkan menjaga kebersihan, khususnya menjaga drainase agar tak tersumbat,” ucapnya. Ditambahkannya, pihaknya sudah mendesain penataan Pagaruyung mulai dari keseragaman tenda sampai ke perlengkapan dagangan. Hal ini setelah adanya koordinasi dengan Camat Medan Petisah, minggu lalu. “Kami juga membuat peraturan dan tata tertib berdagang di sini,” paparnya. Sementara itu, Pj Walikota Medan, Rahudman Harahap yang hadir pada gotong royong tersebut meminta kepada pedagang agar tetap menjaga kebersihan dan terus melakukan penataan Pagaruyung. “Saya sangat tertarik dengan kawasan Pagaruyung, pastinya lokasi ini menguntungkan bila dijadikan wisata kuliner Kota Medan, makanya harus lakukan penataan sebaik-baiknya,” katanya. Demikian juga dikatakan, Surianda Lubis, anggota DPRD Medan. Dia mengharapkan pedagang harus mampu menjaga kebersihan lokasi tersebut, kerana ikon wisata kuliner harus menjadi garda terdepan untuk ciri khas kuliner di Kota Medan. “Desain dan tatatertib berdagang harus sebaik-baiknya, sehingga Pagaruyung lebih bagus dipandang mata, dan benar tercipta wisata kulinernya,” paparnya. (h10)

Ipda Ade Haryono mengatakan, saat ditemukan jarak antara kedua mayat itu sekitar 50 meter. Tidak ditemukan petunjuk kalau kedua mayat itu saling berkaitan. “Tali pusat bayi itu masih lengket dan kebetulan saja mayat keduanya ditemukan bersamaan,” tambahnya. Di tempat terpisah, tim forensik RSU Dr. Pirngadi Medan yang melakukan identifikasi

memperkirakan bahwa mayat bayi laki-laki tersebut adalah korban aborsi dan sengaja dibuang di sungai. Sedangkan pada mayat Govinda tidak ditemukan tanda-tanda penganiayaan. Sebelumnya, Dayat, 25, tetangga Govinda, mengatakan kepada wartawan, awalnya bocah tersebut terlihat mandi sungai bersama teman-teman-

kan orang-orang mapan secara ekonomi. Tanpa disadari harga manusia saat ini lebih murah dari hewan, karena dengan Rp50 ribu suara manusia sudah dapat dibeli,” sebutnya. Sementara itu para pemuda yang memiliki kualitas, kapabilitas, dan kapasitas yang tepat, tidak akan diberikan kesempatan oleh masyarakat karena mereka telah memilih yang memberikan uang. Untuk itu pemuda harus menunjukan kepeloporannya secara lebih keras lagi diberbagai lini sesuai tingkatan pengabdiannya, agar dapat bersaing dan menggeser kaum tua yang hanya mengandalkan kemapanan secara materi, sambungnya. Yasir menuturkan, kiprah pemuda dalam pembangunan telah terjadi pergeseran nilai nyata dari bentuk seremonial dan sebagai pendukung kekuasaan saat orde baru menjadi pelaku utama yang ikut berperan nyata di era reformasi. Diantaranya banyak kaum muda yang duduk di lembaga eksekutif dan legislatif sehingga berperan besar dalam pengambil keputusan berbagai program

dan kebijakan pemerintah dalam pembangunan. Ketika disinggung kurang semaraknya perayaan Sumpah Pemuda pada tiga tahun terakhir, Yasir menyebutkan hal itu terjadi akibat bergesernya peran pemuda dari bentuk seremonial ke arah yang lebih nyata dalam pembangunan. Penegakkan supremasi hukum khususnya di era reformasi sudah berjalan sangat baik, hingga saat ini terjadi peningkatan kualitas pengawasan yang dilakukan legislatif, masyarakat, pemuda dan penegak hukum terhadap jalannya pembangunan. Pemuda juga ikut serta menciptakan keamanan dan kenyamanan di tengah masyarakat dengan bersikap taat hukum dan peraturan pemerintah, dan tidak ada organisasi kepemudaan yang memerintahkan kadernya melanggar hukum, pungkasnya. Untuk itu pemuda diimbau tetap bersatu dalam kesatuan NKRI dengan berbahasa satu dan berpedoman kepada Pancasila dan UUD 1945 serta melestarikan nilai-nilai perjuangan bangsa.(m40)

Soal Kecurigaan Bantuan Asing

MUI Sumut Dukung Ulama Sumbar MEDAN (Waspada): Majelis Ulama Indonesia Sumatera Utara memberikan dukungan penuh terhadap ulama dan elemen masyarakat di Sumatera Barat, terutama kalangan pemuda dan mahasiswa muslim untuk membantu menjadi tim sosialisasi kepada masyarakat agar tidak goyah imannya karena bantuan material dari negara asing. “Terhadap pemberi bantuan, seharusnya menekankan pada prinsip kemanusiaan dan tidak ada embel-embel lain atas bantuan itu apalagi menyangkut akidah,” kata Sekjen MUI

Sumut Hasan Bakti Nasution, Selasa (27/10) terkait kekhawatiran MUI Sumbar atas bantuan Israel ke daerah itu. Menurut Nasution, kekhawatiran itu pastilah beralasan dan umumnya pernah terjadi di kawasan yang mendapat bantuan dari asing. Sistem yang dilakukan umumnya menyisipkan pemahaman agama lain dengan apa yang mereka kirimkan. Hal itu, lanjutnya, menyinggung perasaan orang beragama. Karenanya, ujar Nasution, tindakan ulama untuk segera memberikan ultimatum agar pemberian bantuan harus

murni kemanusiaan harus disahuti oleh masyarakat luas. Di samping itu, segera memberitahukan kepada para tokoh adat dan agama apa yang mereka rasa janggal dari pemberian negara asing. “Banyak sekali bantuan diberikan secara langsung karenanya pemerintah setempat tidak bisa melakukan sortir atau filter terhadap bantuan yang diterima,” katanya seraya menambahkan untuk kawasan lain perlu memberikan masukan ide serta saran agar persoalan bantuan asing ini tidak menjadi persoalan baru. (m36)

Karya Ilmiah Dosen Perlu Disampaikan Melalui Media MEDAN (Waspada): Sudah saatnya dosen mampu menuangkan pemikirannya maupun karya ilmiahnya dalam sebuah karya tulis melalui media massa, karena karya ilmiah maupun pemikiran dosen juga perlu disampaikan kepada masyarakat, selain kepada mahasiswa. Rektor Unimed diwakili Pembantu Rektor III, Biner Ambarita mengatakan, oleh karena itu pihaknya menggelar ‘Pelatihan Jurnalistik dan Kehumasan’ yang kedua kalinya dengan peserta 40 orang terdiri dari dosen dan pegawai kehumasan Unimed, Selasa (27/10). Biner Ambarita menyebutkan, pada pelatihan pertama sudah ada 5 orang dosen yang bisa membuat tulisan ke beberapa media massa di medan dan diharapkan setelah mengikuti pelatihan yang kedua ini, akan banyak lagi dosen-dosen yang bisa menulis karya ilmiahnya ke media. Sementara itu Ketua Panitia, Aulia Andri menyebutkan, kegiatan tersebut untuk meningkatkan dan mengembangkan kemampuan menulis karya ilmiah para dosen yang selama ini. Banyak para dosen menulis

karya ilmiah dan pemikirannya, namun gaya penulisan mereka berbeda dengan gaya penulisan yang ada di media massa. Dia berharap, dengan pelatihan ini, para dosen dapat menuangkan karya ilmiahnya dalam bentuk gaya tulisan jurnalistik dan dapat diterbitkan di media. Sehingga hasil penelitian dan pemikiran pada dosen dapat disebarluaskan dan dimanfaatkan dengan baik dalam rangka mengembangkan pembangunan di tengah-tengah masyarakat. Dalam pelatihan jurnalistik dan kehumasan yang dilaksanakan di lantai-3 gedung Biro Rektor Unimed tersebut, diisi dengan para narasumber dari beberapa media massa cetak di Medan seperti Muhammad Zeini Zen, selaku Redaktur Harian Waspada, Hartono Tugiman dari Harian Sumut Pos dan Deddy Ardiansyah dari Harian Global. Muhammad Zeini Zen dalam pemaparannya menyebutkan, tujuan menulis ada empat hal, pertama menyampaikan informasi, kedua, memperluas wawasan dan pengetahuan pembaca, ketiga menyalurkan aspirasi, kata hati, pendapat dan


Narasumber pelatihan Jurnalistik dan Kehumasan di Unimed, Deddy Ardiansyah memaparkan materi tentang pembuatan karya jurnalistik di hadapan dosen Unimed.

Rabu 28 Oktober 2009

nya pada Sabtu (24/10) sekira pukul 14:30. Setahu bagaimana, Govinda terpeleset dan jatuh ke sungai. Hingga saat ini Polisi belum mengetahui siapa pelaku yang telah membuang mayat bayi laki- laki tersebut ke sungai. Sedangkan pihak keluarga Govinda telah mendatangi RSU Dr. Pirngadi untuk menjemputnya jenazahnya. (cre/m26)

Pemuda Harus Tunjukkan Kepeloporan MEDAN (Waspada): Para pemuda bangsa ini harus lebih berani menunjukkan kepeloporan dengan mengusung nilai-nilai nyata di tengah beratnya tantangan zaman yang dihadapi setelah terjadinya degradasi moral di era reformasi. Demikian dikatakan Ketua Komite Nasional Pemuda Indonesia (KNPI) Sumut, Ir Ahmad Yasir Ridho Loebis, Selasa (27/ 10), sehubungan peringatan Sumpah Pemuda 28 Oktober (hari ini, red). Para pemuda dituntut harus lebih keras menunjukkan kepeloporannya di berbagai lini dan bidang yang digelutinya secara profesional sehingga dapat lebih berperan dalam pembangunan dibanding kaum tua, ujarnya. Namun, untuk melakukan hal tersebut diakuinya tidak mudah. Di era reformasi telah terjadi degradasi moral di tengah masyarakat ke arah materialistis, sehingga dalam menilai personal masyarakat mengenyampingkan kualitas, kapasitas dan kapabilitas. “Kualitas, kapasitas dan kapabilitas saat ini diukur masyarakat dengan uang yang diberi-


sebagainya, dan keempat melakukan kontrol sosial. Agar tulisan mencapai tujuan tersebut, lanjutnya, ada empat cara yang perlu dilakukan, pertama eksposisi yaitu menjelaskan, membeberkan, menerangkan. Kedua argumentasi yaitu meyakinkan orang lain dengan disertai bukti atau alasan yang memengaruhi serta mengubah sikap dan pendapat orang lain untuk menerima suatu kebenaran dengan mengajukan bukti mengenai objek yang diargumentasikan. Ketiga, Deskripsi yaitu menggambarkan, memaparkan, menjelaskan dengan kata-kata secara jelas dan rinci yang tujuannya menyajikan suatu objek atau peristiwa, sehingga seolah-olah pembaca melihat, mendengar dan merasakan sendiri hal itu. Keempat Narasi yaitu menuturkan, menceritakan atau mengisahkan yang tujuan utamanya menceritakan suatu peristiwa, mengisahkan apa yang terjadi dan bagaimana kejadian itu berlangsung. Sementara itu, Hartono Tugiman menyebutkan, setidaknya terdapat dua poin penting dalam penulisan artikel dan keduanya menjadi barometer baik tidaknya sebuah artikel. Pertama, bagaimana si penulis mampu mendapatkan ide dan bahan-bahan yang akan ditulisnya. Kedua, bagaimana si penulis mampu menuangkan bahan-bahan yang sudah ada dalam bentuk tulisan yang menarik komprehensif dan berstruktur. Sedangkan Deddy Ardiansyah mengatakan, menurut seorang tokoh jurnalis Indonesia, Ashari Siregar, untuk menghasilkan sebuah karya tulis yang menarik dan hebat hanya dibutuhkan 20 persen keterampilan teknis menulis, selebihnya atau 80 persen sangat tergantung kepada kekuatan pikiran dan wawasan penulis yang bersumber dari pengalaman hidupnya. (m41)

Waspada/ME Ginting

MENINJAU: Pj Walikota Medan, Rahudman Harahap (tengah depan) meninjau Jalan Bulan Lingkungan II, Kelurahan Pusat Pasar, Kec. Medan Kota yang baru diperbaiki Pemko Medan, Senin (26/10) malam. Sebelumnya jalan itu kondisinya seperti kubangan kerbau, kini sudah mulus untuk dilalui para pengendara kendaraan.

DPRD Medan Curigai Dinkes Selewengkan Dana JPKMS MEDAN (Waspada): Pelaksanaan Program Jaminan Pemeliharaan Kesehatan Medan Sehat (JPKMS) tahun 2009 dinilai anggota DPRD berantakan. Ada indikasi dana yang dialokasikan untuk program ini diselewengkan. Anggota Komisi B DPRD Medan T. Bahrumsyah berbicara kepada Waspada di gedung dewan, Selasa (27/10). Bahrum mengaku berpengalaman mendampingi rakyat miskin yang merasa kecewa dengan program ini. Setidaknya ada tiga hal yang menjadi pertanyan besar dalam pelaksanaan JPKMS ini seperti, tentang data peserta JPKMS, hubungan dengan program pusat Jamkesmas dan keberadaan rumah sakit yang melayani peserta JPKMS. Disebutkan, Dinas Kesehatan sebagai penyelenggara program ini tidak memperlakukan peserta JPKMS dengan baik. Banyak peserta yang telah masuk dalam database, tapi tidak memperoleh pelayanan masyarakat yang sakit. Dinas Kesehatan dengan gampangnya menolak

masyarakat dengan alasan tidak tertampung lagi. Pemko Medan tahun 2009 ini mengalokasikan dana Rp18,5 miliar untuk JPKMS. Masyarakat yang ditanggung mencapai 500.000 orang. Setiap peserta seharusnya mendapat kartu kepesertaan JPKMS. Namun, menurut Bahrumsyah, karena bobroknya manajemen kerja Dinas Kesehatan, mereka tidak mampu melengkapi seluruh peserta dengan kartu. Mereka membuat lagi kebijakan yang merugikan peserta, yakni masyarakat yang tidak punya kartu baru dapat dilayani bila ada rekomendasi dari Dinas Kesehatan. Syaratnya, masyarakat tersebut harus sudah terdaftar dalam database. Namun kebijakan ini, menurut Bahrumsyah, juga tidak berjalan. Sudah satu minggu ini, Dinas Kesehatan, tidak mengeluarkan lagi rekomendasi. Alasannya, dana JPKMS sudah habis. Hal lain dari masalah JPKMS ini adalah tentang indikasi manipulasi data oleh Dinas Kesehatan berkaitan dengan

program Departemen Kesehatan, yakni Jamkesmas. Menurut Bahrumsyah, lewat program Jamkesmas, masyarakat miskin di Kota Medan yang ditampung 412.000 orang lebih. Bila masih ada yang tidak terlayani akan ditampung dalam program JPKMS. ‘’Bayangkan, berapa sebenarnya masyarakat miskin kita. Dari dua program ini saja sudah hampir 1 juta orang tercover,’’ ujarnya. Kemudian yang dikeluhkan lagi dari program ini adalah keberadaan rumah sakit tempat melayani masyarakat. Bahrumsyah, menduga ada kolusi didalamnya. Karena standar rumah sakit yang ditunjuk tidak jelas. Kata Bahrum, ada rumah sakit yang tidak memiliki fasilitas apapun ditunjuk untuk menampung masyarakat miskin. Akibatnya, banyak peserta JPKMS yang harus dirujuk lagi ke rumah sakit lain. ‘’Semua pertanyaan ini harus dijawab oleh Dinas Kesehatan. Komisi B menduga sangat banyak permainan di sana,’’ ujarnya. (m17)

Tunggakan Rekening Listrik Rp50 M MEDAN (Waspada) : Perusahaan Listrik Negara (PLN) Persero tidak akan dapat bekerja maksimal didalam menyuplai listrik jika tidak didukung oleh beberapa aspek. Yang pertama dana, SDM dan masyarakat. Gubernur Sumatera Utara, Syamsul Arifin, pada peringatan Hari Listrik Nasional (HLN) ke64 di kantor wilayah PLN, Selasa (27/10) menyatakan, adanya kendala didalam mengakomodir kebutuhan listrik dikarenakan kurangnya dana didalam pembangunan pembangkit, sumber daya manusia (SDM) yang handal, dan masyarakat. “Sehingga perlu ada sikap untuk memperbaiki tiga aspek tersebut, yang pertama adalah dengan mengundang investor luar dan lokal untuk berinvestasi, kemudian pengembangan SDM, dan ketiga adalah adanya kerjasama dari masyarakat,” ujarnya. Untuk tahap awal, lanjutnya, masyarakat adalah hal utama didalam mendukung pengembangan listrik di Sumatera Utara dengan tidak melakukan pencurian. Dengan demikian, hal ini akan membantu kondisi kelistrikan di Sumut. “Jika hal ini berhasil, otomatis investasi ke daerah akan semakin baik dan hal ini berdam-

pak terhadap pendapatan masyarakat didalamnya khususnya perkapita Sumatera Utara,” ujarnya. Secara nasional, lanjutnya kembali, pemerintah menargetkan penambahan daya listrik 10.000 MW. Sumut akan merebut daya itu sebesar-besarnya bahkan dapat menyumbang daya. “Dan kita cukup senang, karena PLN lebih mengutamakan Pembangkit Listrik Tenaga Air (PLTA) karena ramah lingkungan,” ujarnya. Pemimpin PT PLN (Persero) Wilayah Sumatera Utara, Manerep Pasaribu mengakui, bahwa mereka kesulitan di dalam dana karena dana tunggakan rekening listrik sampai Oktober 2009 telah mencapai Rp50 miliar. “Untuk itu kita berusaha bekerjasama dengan berbagai pihak kususnya kejaksaan untuk pelanggan yang melakukan tunggakan listrik. Hampir 80 persen merupakan pelanggan umum dan hanya sebagian kecil saja yang perusahaan,” ujarnya. Kadis Pertambangan Sumut, Washington Tambunan menambahkan, dari 10.000 MW secara nasional maka Sumut dapat jatah 1000 MW. Kini sedang tahap persiapan

Pembangkit Listrik Tenaga Uap (PLTU) Batubara 2 x 200 MW di Pangkalan Susu milik PLN yang diharapkan tiga tahun lagi atau tahun 2012 bisa masuk sistem. “Kita berharap, PLTA Asahan I masuk sistem Januari 2010. Sedangkan soal PLTP Sarulla belum bisa tahu kapan masuk sistem karena negosiasi harga jual antara PLN dengan Sarulla Operation Limited (SOL) belum jelas. Harga jual 7 sen dolar AS per Kwh belum rampung dibahas oleh pemerintah pusat. Cuma sekarang banyak pembangkit-pembangkit kecil yang justru membantu kelistrikan di Sumut dan memberikan nilai tambah bagi masyarakat,” ujarnya. Pada peringatan HLN ke64 itu dihadiri Gubsu H Syamsul Arifin, SE, Pemimpin PT PLN (Persero) Pikitring Sumut-AcehRiau (Suar) Bintatar Hutabarat, Pemimpin PT PLN (Persero) Pembangkitan Sumbagut Misbachul Munir, Kadis Pertambangan Sumut Washington Tambunan, Deputi Manager Hukum dan Humas PT PLN (Persero) Wilayah Sumut Raidir Sigalingging dan Deputi Manager PT PLN (Persero) Pembangkitan Sumbagut Marojahan Batubara dan ribuan karyawan PLN di daerah ini. (m38)

Mewaspadai Bahaya Komunisme MEDAN (Waspada): Alih generasi fisik dalam kehidupan manusia ditandai oleh pertukaran aktor, dari bapak ke anak. Dari anak ke cucu dan seterusnya. Demikian dikatakan Antropolog Universitas Negeri Medan, Prof. Dr. Usman Pelly, MA pada saresahan Angkatan 66 Peduli Bangsa dalam konteks Komunis Dalam Sejarah Bangsa, di Hotel Dharma Deli Medan, Sabtu (24/10), dibuka oleh ketua Komisi II DPR-RI Drs. H. Burhanuddin Napitupulu. Tetapi alih generasi dalam kehidupan politik ditandai oleh pertukaran ideologi pemerintahan atau penguasa. Setiap generasi fisik dan politik disamping tampil dengan nilai dan struktur kehidupan budaya yang baru, tapi juga memperlihatkan kesinambungandari generasi lama. Karena itu, kata Usman, setiap generasi baru akan tampil beda, walaupun masih memiliki kesamaan-kesamaan dari pendahulunya. Berbeda dengan alih generasi fisik, pada alih generasi politik yang bertukar bukan aktornya, tetapi ideologinya atau paradigma politiknya. Pertukaran atau alih generasi fisik tidak selalu berimpit (coincide) dengan alih generasi politik. Seperti Cina dengan ideologi komunisnya sejak generasi Mao Tse-tung sampai sekarang, telah berganti aktor

penguasanya, tetapi ideologi negara mereka masih tetap komunisme, walaupun aktor penguasanya telah berganti. Republik Indonesia telah memiliki empat alih generasi politik, (1) Demokrasi Liberal 1945-1959 (Kabinet Presidentil dan Parlementer: Sukarno, Syahrir, Hatta s/d Juanda). (2) Demokrasi Terpimpin 19591967 (Kabinet Presidentil Sukarno), (3) Demokrasi Pancasila 1967-1998 (Kabinet Suharto), dan (4) Demokrasi Reformasi 1998 sampai sekarang (Kabinet Habibie, Abdurrahman Wahid, Megawati dan SBY-I). Dijelaskannya, walaupun keempat ideologi politik diatas memiliki simbol-simbol bersamaan, yaitu demokrasi dan Pancasila, tetapi secara esensial terutama pada tataran praksisnya, masing-masing telah mempratekkan ideologi politik yang berbeda. Karena itu pada setiap pergantian (suksesi) kekuasaan politik pemerintahan diawali dan diakhiri oleh konflik terbuka yang berdarah-darah (bloody succession). Depounding father Penggagas Saresahan Angkatan 66 Peduli Bangsa dengan thema bahasan NKRI, Komunis, Generasi Bangsa M. Yusuf Pardamean Nasution dan Drs. H. Amran YS (ketua Yayasan Pembangunan Pemuda Indonesia Angkatan 66 Sumut) serta Rid-

wan Matondang mengatakan, Negara Kesatuan Republik Indonesia (NKRI) yang dimerdekakan pada 17 Agustus 1945, diproklamirkan oleh depounding father bangsa Indonesia, dengan semboyan “merdeka atau mati”. Dari perjalanan sejarah bangsa Indonesia, kita sekarang ini berada pada era reformasi, Angkatan 66 tidak menaruh keberatan adanya transparansi dan kebebasan, sepanjang transparansi dan kebebasan tersebut untuk tegaknya Pancasila dan UUD 1945 serta kebersamaan kita tetap kondusif didalam Bhineka Tunggal Ika, dan sang saka merah putih tetap berkibar sebagaimana mestinya. “Setiap musuh Pancasila adalah musuh bangsa Indonesia, tidak terkecuali komunisme yang sangat biadab terhadap NKRI. Maka untuk meningkatkan kewaspadaan terhadap bahaya laten komunis, marxisme dan leninisme, sudah sewajarnya para penggerak dan pelaku Angkatan 66 serta generasi penerusnya bertatap muka untuk kelestarian perjuangan sehingga semua bentuk berbau komunis, marxisme, leninisme, harus disingkirkan dan dicegah dari bumi Nusantara ini,” tegas Yusuf menambahkan komunisme, marxisme, leninisme musuh bangsa Indonesia, musuh Pancasila. (m25)

Medan Metropolitan


Rabu 28 Oktober 2009


Dua Lagi Terdakwa Protap Dihukum Enam Tahun MEDAN (Waspada): Majelis Pengadilan Negeri Medan, Selasa (27/10), menjatuhkan vonis dua tahun penjara kepada Erwin Josua Tarigan dan empat tahun penjara kepada Ungkap Parasian Sihombing dalam kasus demo anarki massa pendukung pembentukan Propinsi Tapanuli (Protap) di gedung DPRD Sumut Februari 2009. Dalam amar putusannya, Ketua Majelis Hakim diketuai Yunilawaty menyatakan terdakwa Erwin Josua Tarigan terbukti secara sah dan meyakinkan bersalah sebagaimana diatur dan diancam pasal 146 KUHP tentang kekerasan yang menceraiberaikan persidangan Dewan. Yunilawaty mengatakan berdasarkan fakta hukum di persidangan, terpidana Erwin Josua Tarigan turut bersama-

sama dengan massa pendukung Provinsi Tapanuli masuk secara paksa ke dalam ruangan gedung saat anggota Dewan sedang bersidang. Selama berada di dalam gedung, sebut Yunilawaty, terpidana bersama massa pendukung Provinsi Tapanuli melakukan perusakan fasilitas gedung dewan sembari meneriakkan yel-yel “Hidup Provinsi Tapanuli”. Menurut Yunilawaty, per-

Pengedar Ganja Dan Togel Masuk Sel MEDAN (Waspada): Tiga tersangka kasus narkoba dan judi toto gelap dibekuk Polsekta Medan Kota dan Polsekta Medan Baru secara berbeda, Selasa (27/10). Dari tersangka Hmt, 26, (kasus ganja) penduduk Jalan Brigjen Katamso Gang Merdeka Kelurahan Sei Mati Kecamatan Medan Maimoon, RM, 27, (pengedar ganja) penduduk Jalan Pematang Pasir Kawat I, Kel. Tanjung Mulia, dan MBS, 42, (pengedar togel) penduduk Jalan Bunga Cempaka Kelurahan Padang Bulan Selayang, disita barang bukti, 38 bungkus ganja, handphone Nokia type 2100, 2 lembar kertas berisikan rekap nomor togel, uang Rp130.000, pulpen. Kapolsekta Medan Kota AKP Amri Z, SH, kepada Waspada mengatakan, sebelumnya polisi melakukan hunting di delapan titik kawasan Jalan Mayjen Suprapto, SM Raja, Imam Bonjol kawasan Warkop, Ir H Juanda, Pemuda, Pasar Merah, Haryono MT, Hj.Ani Idrus. Saat di Jalan Brigjen Katamso, Gang Merdeka, polisi melihat gerak-gerik tersangka Hmt mencurigakan lalu disuruh memperlihatkan isi dalam sakunya. Ketika dikeluarkan, terdapat 1 bungkus ganja. Selanjutnya ditersangka dijebloskan ke dalam tahanan Mapolsekta Medan Kota. Sedangkan tersangka, RM ditangkap Polsekta Medan Baru dari Jalan Bunga Cempaka, Kelurahan Padang Bulan, beserta barang bukti 37 bungkus ganja siap untuk dipasarkan kepada peminatnya. Sementara MBS ditangkap dari dalam warung kopi Jalan Sendok, Ayahanda Medan, ketika melayanani pembeli togel. Kemudian tersangka RM dan MBS menjalani pemeriksaan di Mapolsekta Medan Baru. (m31)

Penahanan 7 Siswa SPAN Ditangguhkan MEDAN (Waspada): Setelah menginap selama seminggu di sel tahanan, Poltabes Medan akhirnya menangguhkan penahanan tujuh siswa Sekolah Menengah Kejuruan Penerbang Angkasa Nasional (SPAN) yang diduga terlibat penganiayaan terhadap Jimmy teman satu kelasnya. Ke tujuh siswa SPAN tersebut mendapat penangguhan penahanan, Senin (26/10) malam, setelah orangtua mereka mengajukan permohonan penangguhan penahanan ke Kapoltabes Medan. Siswa SPAN yang menghirup udara segar itu M. Fadlan Fattah Lubis, Purwoko, Hogaita Tarigan, Dimas Bayu Irawan, Junior R panjaitan, Oktavianus Bukit dan M. Arief Mihandar. Semua siswa kelas 3 SPAN. Kasat Reskrim Poltabes, Kompol Gidion Arif Setyawan ketika dikonfirmasi Waspada, Selasa (27/10) mengatakan, penangguhan itu diberikan mengingat mereka (tujuh siswa SPAN) masih berstatus pelajar dan tidak akan melarikan diri. Ditanya mengenai proses kasus tersebut, Gidion menjelaskan, proses kasus penganiayaan tetap dilanjutkan. “Proses penyidikan tetap lanjut,” jelas mantan Kapolsekta Pancur Batu ini. Seperti diberitakan, kemarin, setelah melakukan pemeriksaan terhadap 16 siswa SPAN yang diadukan teman sekelasnya Jimmy, Poltabes Medan menetapkan tujuh siswa sebagai tersangka dan ditahan. Orangtua murid dan pihak sekolah kemudian mengajukan surat permohonan penangguhan penahanan namun Poltabes Medan tidak mengabulkan dengan pertimbangan belum selesai dilakukan pemeriksaan. (m39)

Tiga Pengedar Ganja Ditangkap MEDAN (Waspada): Tiga pengedar ganja asal Aceh diringkus petugas Polsekta Medan Timur di kawasan Jalan Tanjungraya Perumnas Helvetia, Medan, Senin (26.10) sekira pk 19:00. Dari ketiga tersangka, polisi menyita 11 kilogram daun ganja kering dan 1 unit mobil Suzuki BL 777 LY. Ketiga tersangka masing-masing Rusli Hasbi, 27, warga Pantonlabu, Aceh Utara, Herizaldi, 26, warga Banda Aceh dan Mashur, 39, asal Aceh yang tinggal di Jalan Tanjungraya Blok III Perumnas Helvetia. Informasi yang diperoleh di kepolisian menyebutkan, Senin sekira pk 04:00, dua tersangka Rusli Hasbi dan Herizaldi tiba di Medan setelah menempuh perjalanan darat dari Banda Aceh. Mereka tiba di Medan, setelah mobil Suzuki Vitara BL 777 LY yang dikendarai tersangka berhasil lolos dari pemeriksaan polisi di perbatasan Kabupaten Besitang dengan Aceh Tamiang. Sekira pk 19:00, tim Reskrim Polsekta Medan Timur yang dipimpin Iptu Aron Siahaan mendapat informasi keberadaan kedua tersangka segera mengatur siasat melakukan pengintaian. Saat mobil tersebut berada di Jalan Tanjungraya, polisi langsung menyergapnya, namun seorang lagi tersangka berada di kawasan Jalan Kemiri Sukadono Helvetia. Berdasarkan petunjuk dari kedua tersangka itu, akhirnya polisi meringkus tersangka Rusli Hasbi. Dari pengakuan ketiganya, polisi menemukan 11 bal daun ganja kering yang disimpan di kolong mobil SuzukiVitara. Mereka menyimpan ganja itu cukup rapi sehingga mengelabui petugas kepolisian yang berada di perbatasan Sumut-Aceh. Tersangka Mashur mengakui, 11 bal ganja tersebut rencananya akan dijual kepada pemesannya berinisial Bandot di Jalan Kemiri dengan harga Rp1 juta perkilogram. Namun, belum sempat daun ganja tersebut dijual, ketiganya keburu ditangkap polisi. Sementara itu, tersangka Rusli Hasbi mengakui daun ganja tersebut dibawanya dari Banda Aceh dengan tujuan pemasaran ke Kota Medan. Kapolsekta Medan Timur, AKP Yatim Syahri Nasution mengatakan, ketiga pelaku merupakan sindikat peredaran ganja antar provinsi yang sudah berkali-kali memasok daun ganja kering dari Provinsi Aceh ke Kota Medan. “Pemesannya yang berada di Medan masih diburon,” tegasnya kepada Waspada. (cat)

buatan terpidana itu telah merusak citra demokrasi dan merugikan keuangan negara. Berdasarkan catatan Sekretariat DPRD Sumut, kerugian yang ditimbulkan akibat demo anarki pendukung Provinsi Tapanuli di gedung DPRD Februari 2009 sekitar Rp350 juta. Selain itu, peristiwa itu mengakibatkan Ketua DPRDSU H. Abdul Azis Angkat tewas. Atas putusan itu, terpidana menyatakan banding, hal senada juga

disampaikan Jaksa Penuntut Umum (JPU) Umriani. Pada sidang terpisah, Ketua Majelis Hakim diketuaiWahidin menyatakan terdakwa Ungkap Parasian Sihombing juga terbukti melakukan tindak pidana sebagaimana yang diatur dan diancam pasal 146 KUHP. Wahidin mengatakan berdasarkan keterangan sejumlah saksi mata, terdakwa Ungkap Sihombing bersama massa pendukung Propinsi Tapanuli

masuk secara paksa ke ruangan sidang Dewan sambil melakukan perusakan sejumlah fasilitas Dewan. Dalam kasus ini, sedikitnya 38 terdakwa sudah dijatuhi hukuman beragam mulai 1,5 tahun hingga 6 tahun. Mereka dijerat pasal 1456 yo pasal 55 KHUPIdana. Sedangkan terdakwa yang dijerat pasal 340 yo pasal 338 KHUPidana hingga saat ini masih dalam tahap pemeriksaan sejumlah saksi. (h05)

Dugaan Korupsi Rp26 M Kejati Kembali Tahan Pejabat BPN MEDAN (Waspada): Kejaksaan Tinggi Sumut (Kejatisu), Selasa (27/10) kembali menahan seorang tersangka baru, Samuel Simatupang, terkait kasus dugaan korupsi Program Pembaharuan Agraria Nasional (PPAN) dan Inventarisasi Pemanfaatan Penggunaan Pemanfaatan Pengawasan Pemilikan Tanah (IP4T) tahun 2008 senilai Rp26 miliar Menurut Asisten Pidana Khusus Kejatisu Erbindo Saragih, posisi tersangka Samuel Simatupang pada program tersebut sebagai pejabat pembuat komitmen (PPK). “Temuan penyidik tersangka terlibat kuat dalam pengajuan nota-nota pembayaran kepada bendahara yang diduga fiktif,” tegas Saragih didampingi Kasi Penkum/Humas Kejatisu, Edi Irsan Tarigan. Kata Saragih, atas buktibukti ditemukan itu, tim saya akhirnya menetapkan dan menahan tersangka PPK Samuel Simatupang pada hari ini. Penambahan satu tersangka baru ini, tambah Saragih, tim Pidana Khusus Kejatisu sudah menjerat tiga orang dalam penyalahgunaan anggaran program PPAN dan IP4T tahun 2008 itu. Dua pejabat sebelumnya yang sudah ditetapkan tersangka dan ditahan yaitu man-

tan Kanwil BPN Sumut Horasman Sitanggang dan Kasubbag Perencanaan Keuangan BPN Sumut R Jojor br Sitorus. “Kami akan terus dalami kasus ini, apakah ada tersangka baru lagi yang akan kita tahan. Kita lihat saja. Kemungkinan ke arah sana ada, makanya kita lihat dari perkembangan penyidikan nanti,” pungkas Saragih. Saat ini, lanjutnya, sudah 15 saksi yang diperiksa dalam perkara dugaan korupsi tersebut. Saksi tersebut diantaranya KepalaKantorBPNKabupatenKota, dan pejabat di Kantor Wilayah BPN Sumut, serta pihak ketiga. “Sejauh ini perhitungan kerugian negara dari BPK belum kita lakukan, namun itu pasti dilakukan ke depan,” jelasnya. Sejauh ini hasil perhitungan tim Pidana Khusus Kejatisu selama proses penyidikan kerugian negara akibat perbuatan korupsi yang dilakukan tersangka sebesar Rp2,4 miliar. Hal itu didapatkan dari bukti dan penuturan para saksi dari anggaran yang diberikan tersangka kepada para pejabat BPN yang melaksanakan pengerjaan program nasional itu. “Kemungkinan bisa lebih dari pada itu, kita lihat pastinya nanti dari audit BPK. Ini masih estimasi penyidik berdasarkan keterangan saja,” tambah Edi

Irsan Kurniawan Tarigan. Dia menambahkan, ketiganya dipersalahkan pasal 2 dan 3 UU No 31 tahun 1999 tentang tindak pidana korupsi, dan pasal 55 ayat I ke 1 KUHP. Dimana, hasil penuturan para saksi bentuk penyimpangan yakni dengan melakukan potongan anggaran sebelum dana tersebut dikucurkan. “Sementara dana yang pertanggungjawabkan kepada pimpinan untuk anggarannya 100%. Makanya untuk menghitung kepastiannya ini kita minta BPK melakukan auditnya nanti,” terangnya. Program PPAN dan IP4T adalah program nasional yang dikerjakan di 10 Kabupaten Kota yakni adalah Kabupaten Serdang Bedagai, Kabupaten Langkat, Kabupaten Deliserdang, Kabupaten Mandailing Natal, Kabupaten Simalungun, Kota Binjai, Kota Pematang Siantar, Kabupaten Asahan, Kabupaten Labuhan Batu dan Kabupaten Tapanuli Tengah. Untuk program PPAN dikucurkan pemerintah pusat senilai Rp23 miliar untuk mensertifikasi 57.674 bidang tanah masyarakat dengan biaya persilnya sebesar Rp239.087. Sedangkan proses IP4T yang dikucurkan senilai Rp3 miliar untuk 12.500 bidang tanah. (h05)

Pembongkaran Villa Kembar

Walikota Panggil Developer MEDAN (Waspada): Penjabat Walikota Medan, Rahudman Harahap, mengaku telah memanggil pihak pengusaha yang membongkar bangunan tua villa kembar yang berlokasi di Jalan Pangeran Diponegoro. Rahudman mengatakan hal itu kepada perwakilan masyarakat peduli warisan budaya dan bangunan tua Kota Medan yang terdiri dari Rika Susanto dari Badan Warisan Sumatera (BWS), Tavip Kurniadi dan Ahmad Arianto dari Ikatan Arsitektur Indonesia (IAI) Sumut, Eron Damanik (Pusat Studi Sejarah dan Ilmu Sosial Unimed) serta sejumlah elemen lainnya saat audiensi di Balai Kota Medan, Selasa (27/10). Sekretaris BWS, Rika Susanto, mengatakan, dalam pertemuan sekitar satu jam dengan Pj Walikota, ada beberapa hal yang disampaikan terutama

soal keberadaan dan konservasi bangunan tua di Kota Medan. Secara makro, lanjutnya, Rahudman memberikan komitmen pembuatan peraturan daerah (Perda) tentang gedung dan bangunan bersejarah. Karena sudah ada daerah lain yang membuat perda tersebut. Khusus untuk bangunan tua Vila Kembar di Jalan Pangeran Diponegoro yang baru dibongkar minggu lalu, Pemko, menurut Rika, sudah memanggil pengembang yang melakukan pembongkaran. “Pak Rahudman bilang mereka sudah memanggil pengusahanya untuk minta penjelasan terkait izin pembangunan, izin pembongkaran, penebangan pohon. Karena Izin Mendirikan Bangunannya, menurut Pj Walikota dikeluarkan tidak di masanya. Ada izin, tapi bukan saat kewenanganya,” kata Rika.

Kemudian hal cukup penting dan krusial yang ditegaskan Rahudman adalah Pemko komit untuk tidak lagi melakukan tukar guling (ruislag) terhadap aset-aset Pemko yang bentuknya berupa gedung dan bangunan bersejarah. “Tentunya ini menjadi pegangan kami ke depan. Karena selama ini banyak aset Pemko yang ditukar-guling dan hilang. Kami akan membuat komitmen ini secara tertulis berikut langkah-langkah penyelamatan gedung tua sebagai manifestasi pertemuan ini,” ungkapnya. Menurut Rika, dalam pertemuan itu, sebagai langkah cepat, pihaknya meminta Pj Walikota melakukan penghentian pembongkaran bangunan tua itu. Namun, Rahudman mengaku karena sudah ada izin yang dikeluarkan, maka Pemko tidak ingin menggugat masalah itu. (h10)

Pengusaha Dan Karyawan Restoran Kritis Dibacok MEDAN (Waspada): Seorang ABG keturunan Tionghoa membacok pengusaha dan karyawan restoran Umi Sea Food di Jalan Jenggala, Kel. Madras Hulu, Kec. Medan Polonia, Senin (26/10) dinihari. Keterangan Waspada peroleh di lapangan, tersangka Wdd, 16, penduduk Jalan Timah, Kel. Sei Rengas II, Kec. Medan Area, merupakan karyawan restoran itu. Tersangka dan korban Syahbudin, 22, warga Stabat, samasama tinggal di rumah makan milik Syahrul Munawi alias Awi. Dua hari sebelum kejadian, tersangka dengan Syahbudin terjadi kesalahpahaman sehingga keduanya tidak saling tegur. Hingga puncaknya, Minggu (25/10) malam pukul 21:00, tersangka Wdd mengambil pa-

rang stainless stell berbentuk segi empat dari dapur restoran lalu menyembunyikan di bawa bantal tempat tidurnya. Kemudian tersangka tidurtiduran menunggu korban Syahbudin yang malam itu bersama majikan mereka Syahrul Munawi, 47, penduduk Jalan Dr Cipto, sedang duduk-duduk santai di pelataran depan restoran tersebut. Sekira pukul 24:00, Syahbudin bersama majikannya masuk ke dalam kamar masingmasing. Korban Syahbudin naik ke atas tempat tidur. Selanjutnya, Senin (26/10) dinihari pukul 02:30, tersangka mengambil parang yang sudah dipersiapkan langsung secara membabi buta membacok tubuh Syahbudin secara bertubi-

Waspada/Ismanto Ismail

DIPERIKSA: Juper Polsekta Medan Baru melakukan pemeriksaan terhadap tersangka Wdd terlibat kasus pembacokan teman sekerja dan majikanya, Selasa (27/10).

tubi hingga korbannya terkapar bermandikan darah. Mendengar suara gaduh, korban Syahrul Munawi terbangun dan melihat tersangka membacok Syahbudin yang sudah tidak berdaya di lantai. Diduga takut perbuatannya diketahui, tersangka lalu membacok majikannya sehingga terkapar bermandikan darah. Petugas Polsekta Medan Baru mendapat informasi seputar kejadian itu langsung turun ke lokasi. Tim yang dipimpin Kanit Reskrim Iptu M Faruk Rozi dalam tempo singkat berhasil meringkus Wdd yang belum sempat kabur dari lokasi. Kedua korban dengan kondisi kritis dibawa ke RS Deli untuk menjalani perawatan. Kapolsekta Medan Baru AKP M Adenan AS,SH,SIK, kepada Waspada, Selasa (27/10) mengatakan, tersangka masih menjalani pemeriksaan, sedangkan korban satu diantaranya masih kritis berada di ruang ICU. Tersangka Wdd saat ditanya Waspada mengatakan, nekat ingin menghabisi nyawa teman sekerjanya karena dendam. “Dua hari sebelumnya kami bertengkar dan setelah itu tidak cakapan walaupun kami satu pekerjaan,” ujarnya. Ketika ditanya kenapa majikan juga dibantai parang, dia mengatakankarenatakutperbuatannya diketahui. “Saya menyesal,” ungkap tersangka. (m31)

Waspada/Surya Efendi

BERBURU FOTO KOPI PENERIMAAN CPNS: Warga berkerumun di samping kantor Gubsu Jl. RA Kartini untuk melihat syarat penerimaan CPNS dari sejumlah daerah, Selasa (27/10). Pedagang menjual foto kopi syarat dan formasi penerimaan serta contoh surat lamaran ini masing-masing Rp5.000 per tiap daerah.

Senpi Empat Oknum Polisi Pukuli Warga Ditarik Kasusnya Diproses Poldasu MEDAN (Waspada): Senjata api (senpi) empat oknum polisi yang menjadi tersangka pemukulan Syahrul, 42, warga Tembung ditarik oleh Polda Sumut. Kabid Humas Poldasu, Kombes Pol. Baharuddin Djafar kepada wartawan, Senin (26/10) mengatakan, telah mengambil tindakan terhadap keempat oknum anggota Dit Narkoba Poldasu itu, dengan menarik senpinya. “Tindakan pertama menarik senpi mereka, setelah itu memproses kasus pemukulan tersebut,” kata Baharudin. Kasus ini kata dia, akan ditindaklanjuti sampai pengadilan. Penanganannya, tegasnya, tidak ada istilah pandang bulu, siapa saja yang melanggar hukum atau tindak pidana meski pelakunya polisi akan diproses hukum. Sementara dua saksi korban, Bolo, 53, dan Amir, 48, warga Jl. Jainul Hamid Medan, sebelum diminta keterangannya oleh Dit Reskrim Poldasu, kepada wartawan mengatakan, dua dari pelaku yang memukuli Syahrul, warga Jl. Pasar 10 Tembung itu, menggunakan senjata

api jenis pistol hingga kepala korban bocor. “Walaupun saya sudah melerai, tapi keempat pelaku tidak berhenti menghajar korban. Setelah itu saya juga dihajar dan ditunjangi hingga gigi saya goyang dan bibir pecah. Kepala saya juga bengkak akibat pukulan dan tendangan. Setelah itu saya dan korban dibawa para pelaku ke dalam cafe dan kembali dihajar. Saya dan korban juga dipaksa meminum dua botol minuman keras,” jelas saksi Bolo. Sementara saksi Amir yang berusaha membawa korban berobat ke rumah sakit dibentak tidak diberi seorang pelaku yang diketahui bernama Refli berpangkat Aipda. “Saya tidak tahu persoalannya kenapa mereka berkelahi, tapi yang saya tahu korban datang minum. Sewaktu beranjak pulang, di tengah jalan becak bermotor yang ditumpangi korban dihadang para pelaku, kemudian korban dihajar,” terangnya. Sedangkan istri korban, Nova yang membuat pengaduan ke Poldasu meminta Kapoldasu menindak tegas anggota yang

bertindak ala preman. Juga berharap Kapoldasu memproses serta memberikan sanksi tegas, bila perlu pemecatan. “Saya meminta supaya kasus ini ditindaklanjuti dan diproses sampai pengadilan. Saya tidak terima suami saya dianiaya bagaikan binatang,” katanya. Pemberitaan sebelumnya, kejadiannya berawal, Jumat (23/ 10) malam, saat korban Syahrul menaiki becak bermotor dikemudikan Bolo, warga Tembung, datang ke cafe di kawasan Jl. Lau Dendang simpang Jl. Beo dengan tujuan minum-minum. Setibanya di cafe, korban bersama Bolo minum dua gelas sambil dihibur musik keyboard. Usia minum, keduanya beranjak pergi, namun empat oknum polisi itu dengan kondisi mabuk menghadang keduanya. Karena jalannya terhalang, korban bertanya, “Ada apa bang.” Tetapi keempat pelaku langsung menarik kera baju korban dan memaksanya turun dari atas becak. Lalu memukuli korban. Sementara Bolo langsung memeluk korban berusaha melerai, sehingga tidak luput dari pukulan.(m11/m39)

Pelaku Pembunuhan Di Pasaman Diringkus MEDAN (Waspada): Reskrim Unit Jatanras Poltabes Medan membekuk pelaku pembunuhan disertai perampokan yang terjadi di Pasaman Timur dari tempat persembunyiannya di Jalan Sentosa Lama Medan, Selasa (27/10) pagi. Tersangka Muhamad Jali Siregar, 23, kemudian diboyong ke Poltabes Medan sebelum diserahkan ke Polres Pasaman, Sumatera Barat, karena keluarga korban membuat pengaduan di Polres Pasaman. Korban yang dibunuh tersangka adalah uwaknya. Dengan sadis korban dibunuh di kediamannya di Desa Sukadamai III, Jorong Bahagia, Kecamatan Panti, Kabupaten Pasaman Timur, Rabu (21/10). Kasar Reskrim Poltabes Medan, Kompol Gidion Arif Setyawan, melalui Kanit Jatanras, AKP Faidir Chan mengaku, tersangka berhasil dibekuk berkat informasi dari masyarakat yang mengaku adanya seseorang tidak dikenal tinggal di salah satu rumah kos-kosan di kawasan Jalan Sentosa Lama.

Mendapat laporan tersebut, polisi melakukan pengecekan ke salah satu rumah kos di Jalan Sentosa Lama. Saat diinterogasi petugas, tersangka terlihat gerogi sehingga menimbulkan kecurigaan. Hingga akhirnya, tersangka mengaku kalau dirinya dalam pelarian usai membunuh uwaknya. “Sebelumnya, kita juga mendapat informasi dari kepolisian setempat (Polres Pasaman) kalau terjadi pembunuhan dan tersangka dicurigai kabur ke Medan,” jelas Faidir di Mapoltabes. Dijelaskan Faidir, selain membunuh, tersangka juga mengambil perhiasan korban seperti kalung, gelang dan cincin, yang kemudian hasil kejahatannya dijual tersangka Rp 3 juta. “Uang hasil penjualan tersebut, sudah dihabiskan tersangka dalam pelariannya yang terus berpindah-pindah,” paparnya. Sementara itu, tersangka yang ditemui mengakui, perbuatan itu dilakukannya lantaran sakit hati karena korban

tidak memperbolehkannya lagi tinggal di rumah tersebut. “Uwak ku itu sepertinya dendam kepada ku. Ia selalu berbuat jahat sama aku. Bahkan, aku diusirnya,” terang tersangka sembari mengaku usai diusir menumpang di rumah temannya tak jauh dari kediaman korban. Atas perlakuan korban, tersangka menjadi dendam yang kemudian dilampiaskan melakukan pembunuhan disertai perampokan Rabu sekira pukul 11:00, tersangka mendatangi rumah korban. Saat itu, korban seorang diri berada di dapur. Kesempatan itu langsung dipergunakan tersangka membekap mulut korban dari belakang, namun mendapat perlawanan. Melihat aksi itu, tersangka langsung mencekik dan mengikat leher korban dengan menggunakan kain yang ditemukannya di dapur. Mengetahui korbannya tewas, tersangka mempereteli perhiasannya dan selanjutnya kabur. (m39)



WASPADA Rabu 28 Oktober 2009

Golkar: HipokrisiVs Rekonsiliasi Oleh Ir.H.Chaidir Ritonga,MM


Salah Pilih Ketua Baru Golkar Sumut ‘Kiamat’


asca Munas Partai Golkar di Pekanbaru yang dimenangkan Aburizal Bakrie (Ical) terjadi gejolak di beberapa daerah, termasuk di Sumut untuk menyelenggarakan Musda Partai Golkar. Kelihatannya gerbong Surya Paloh yang kalah dalam Munas semakin terdesak, termasuk upaya menggantikan Ali Umri sebagai Ketua DPD Partai Golkar Sumut. Semakin tipis kemungkinan Ali Umri bisa mempertahankan jabatannya itu, setelah muncul sejumlah tokoh senior di Golkar, seperti Syamsul Arifin, Amru Daulay, Muhyan Tambuse dll. Ketiganya dikenal sebagai tokoh yang memiliki kelebihan dan dukungan dalam partai.Tapi, belum tentunya ketiganya memiliki visi yang pas untuk membesarkan partai ke depan. Padahal, tokoh visioner sangat diharapkan memimpin Golkar Sumut periode ke depan agar kekuatannya kembali menyatu, tidak terpecah belah lagi menjadi beberapa kelompok. Kekalahan calon Golkar Sumut dalam Pilkada Gubsu lalu tidak lepas dari terpecahnya kekuatan Golkar yang sebenarnya memiliki jaringan sangat luas, namun apa boleh buat karena ‘’infrastruktur’’ partai yang seharusnya solid ternyata keropos, akhirnya semua berantakan. Mesin Partai Golkar tidak berjalan mulus alias tersendat-sendat sehingga perolehan jagonya pun tertatih-tatih di perjalanan. Menjelang Musda Partai Golkar Sumut kiranya perlu kita ingatkan kepada semua tokoh yang ingin mencalonkan diri untuk mempersiapkan konsep dan program kerja ke depan guna membesarkan partainya. Ketua Umum Partai Golkar Aburizal Bakrie sudah mengingatkan agar para kadernya di kewilayahan tidak saja dapat menyukseskan pemilihan kepala daerah kabupaten dan kota, tetapi juga mampu memperjuangkan aspirasi rakyat untuk meningkatkan kesejahteraan mereka. Dengan demikian, partai ini akan semakin dicintai rakyat. Kepada seluruh jajaran pengurus partai diminta terus berupaya membangun citra partai di masyarakat. Intisari Tugas ketua Partai Golkar Sumut ke depan pasti jauh lebih berat setelah mengalami keterpurukan dalam Pilgubsu, Pileg. Apalagi Kader Golkar harus dalam Pilpres lalu Jusuf Kalla kalah telak dan berusaha mendukung kebijakan pemekritis memilih ketua baru kini rintah. Dipastikan beban ketua Golkar Sumut jika tidak ingin‘’kiamat’’. mendatang cukup kompleks. Tantangan Golsemakin berat untuk menyatukan kekuatJangan berprinsip‘’right kar an yang sudah terpecah akibat ambisi oknum pengurus yang lebih mementingkan diri or wrong my boss’’ sendiri (pribadi) dan kelompoknya semata ketimbang kepentingan partai. Apalagi Golkar sudah pasti merapat ke pemerintahan SBY, sehingga daya kritis Golkar akan melempem. Beda kalau Surya Paloh yang menang dalam Munas lalu. Paloh tegas menyatakan akan membawa Golkar sebagai oposisi. Kondisi yang berkembang saat ini membuat masyarakat termasuk kadernya apatis dengan kemajuan Golkar dapat diraih kembali. Sebab, kalau jalannya pemerintahan bagus yang mendapat nama jelas SBY dengan Demokrat, kalau pemerintahan gagal Golkar ikut menerima dampak negatifnya. Kesan negatif lainnya, elite Golkar pada umumnya tidak terbiasa menjadi oposisi, tidak mau menderita, inginnya terus dekat dengan kekuasaan dan bersenangsenang di tengah penderitaan rakyatnya. Justru itu, Golkar perlu melakukan perubahan, kembali mendekati rakyat. Kalau ada pihak yang menyatakan Partai Golkar Sumut perlu melakukan reformasi mencari tokoh-tokoh yang gigih dalam membesarkan partai, tokoh visioner yang memiliki ‘’track record’’ positif di mata rakyat dengan menempatkan tokoh yang mampu menjadi pengumpul suara, jelas hal itu diperlukan. Semua parpol pun melakukan hal sama. Apakah Syamsul Arifin mampu membesarkan Golkar Sumut ke depan? Masih tanda tanya besar. Sebab, sebagai Gubsu pun belum teruji. Visi dan misinya yang muluk-muluk; rakyat tidak sakit, tidak bodoh, tidak lapar, dan punya masa depan belum berjalan. Kalau di provinsi lain gubernurnya sudah mampu menjalankan sekolah gratis yang benar-benar gratis, kita di Sumut belum terealisasi. Jadi, apa yang disebut pemerhati politik dari Universitas Negeri Medan Eddiyanto, PhD bahwa reformasi Golkar di tingkat pusat harus diiringi juga oleh Sumut agar partai ini tidak semakin ditinggalkan konstituennya, hal itu perlu menjadi pemikiran kader Golkar menjelang suksesi pada Musda Golkar Sumut. Event Musda Golkar menjadi penting dan strategis. Diharap tidak hanya semata-mata memilih ketua, atau mengganti Ali Umri semata yang sudah kehilangan ‘’power’’, sementara program kerja yang menantang guna membesarkan Golkar Sumut malah diabaikan. Tak berlebihan kalau disebutkan Golkar Sumut memasuki fase’’kiamat’’ jika dalam Musda nanti hanya menargetkan Asal Bukan Umri. Sebab, yang sangat penting saat ini adalah membicarakan program kerja ke depan, termasuk di dalamnya upaya melakukan rekonsiliasi dan upaya mendekati lagi hati rakyat yang kadung sudah lari ke parpol lain. Dari sejumlah nama yang beredar saat ini, tokoh Golkar berpengalaman Amru Daulay merupakan kandidat utama bersama Syamsul dan Muhyan. Amru, salah satu yang layak diperhitungkan dalam Musda nanti karena kemampuan dan ‘’track record’’nya di atas rata-rata, di mana jiwanya benar-benar untuk membesarkan Golkar termasuk di Madina. +

Hubungi kami KANTOR PUSAT

Penerbit: PT Penerbitan Harian Waspada

Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi:

Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002

KANTOR PERWAKILAN � Bumi Warta Jaya Jalan Kebon Sirih Timur Dalam No. 3 Jakarta 10340 Tel: (021) 31922216, Faks: (021) 3140817. � Jalan Ratu Syafiatuddin No. 21 C Banda Aceh 23122 Tel & Faks: (0651) 22385 � Jalan Iskandar Muda No. 65 Lhokseumawe Tel: (0645) 42109 � Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412

Percetakan: PT Prakarsa Abadi Press Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 6612681 Isi di luar tanggung jawab percetakan Harga iklan per mm kolom: BW Rp. 11.000,FC Rp. 30.000,Halaman depan BW Rp. 33.000,Halaman depan FC Rp. 90.000,Ukuran kolom: 40,5 mm

usyawarah Daerah Partai Golkar Sumatera Utara beberapa waktu mendatangakanmenjadiagenda yang menarik perhatian banyak pihak. Penting karena memang Golkar baru saja selesai menyelenggarakan Munas. Sebagaimana kita ketahui, Munas Golkar ke delapan itu dimenangkan oleh Aburizal Bakrie. Inilah untuk pertama kali Munas dilakukan berpola top-down. Munas diselesaikan lebih dahulu, baru kemudian diikuti Musda Propinsi, Kabupaten dan Kota. Berbeda dengan MunasMunas sebelumnya yang berpola bottom-up, dimana Musda Kabupaten/ Kota lebih dahulu dilaksanakan, baru kemudian diikuti Musda Propinsi dan lalu kemudian diakhiri dengan Munas. Siapapun yang pada akhirnya terpilih memimpin Partai Golkar, ia akan langsung berhadapan dengan dua arus besar cara berpikir dan bertindak pada sebagian besar kader Golkar. Arus besar itu ialah kultur apriori dan hipokrisi yang sudah menjadi momok besar, bagian dari budaya bangsa, tidak terkecuali di partai sebesar Golkar. Perilaku apriori dan hipokrisi itu menjadi arus yang terus terpelihara karena di zaman Orde Baru, banyak para oportunis mendapat tempat yang layak di Golkar tanpa harus menunjukkan kapasitas profesionalisme dan prestasi. Pola berpikir dan bertindak apriori dan hipokrit mendapat tempat yang layak di Golkar dalam kurun waktu yang panjang sehingga sebagian diantaranya yang masih tersisa kini tetap ingin memanfaatkan Musda Golkar Sumut ini dengan pendekatan yang sama, mengadu domba kader satu sama lain. Melakukan pembuhunan karakter kader yang baik di satu sisi dan membangun kelompok kecil eksklusif untuk meningkatkan nilai tawar di sisi yang lain. Dan membangun halang rintang terhadap kaderkader muda yang potensil-prospektif sehingga kaderisasi menjadi mandeg dan mandul. Kemampuan Homeostasi Perilaku kontraproduktif apriori dan hipokrit itu menjadi jawaban atas pertanyaan mengapa Golkar yang tiga dekade terakhir berjaya menjadi partainya penguasa (the ruler’s party bukan the ruling party) gagal meraih du-

kungan yang konsisten dari rakyat. Banyak kader yang berasumsi bahwa seorang kader tidak mungkin seorang diri membenahi partai. Sebagaimana asumsi apatisme yang selama ini terbangun: kita tidak mungkin seorang diri membenahi bangsa. Jadi, mamfaatkanlah setiap kesempatan yang ada. Bukankah kesempatan tidak datang dua kali? Lagi pula sebagaimana tubuh manusia yang memiliki kemampuan untuk bertahan hidup, Partai Golkar pun diyakini, sebagaimana tubuh manusia, memiliki kemampuan homeostasi, melawan berbagai serangan penyakit, membangun pertahanan dan kekebalan tubuh dan mampu bertahan dari segala macam hambatan dan tantangan. Keyakinan bahwa Golkar memiliki kemampuan homestasi itulah yang juga menjadi alasan mengapa perilaku apriori dan hipokrit itu masih terus terpelihara. Apakah kemampuan homeostasi itu akan tetap ampuh sepanjang masa? Ternyata tidak. Kemampuan Golkar untuk sekedar lolos parliamentary treshold (PT) yang diperkirakan akan menjadi sekitar 5 persen pada Tahun 2014, tidak akan dengan mudah dicapai apabila perilaku apriori dan hipokrisi itu masih terpelihara. Apabila konflik internal masih berkelanjutan dan semangat balas dendam kelompok yang menang di Munas terhadap kelompok yang kalah terulang kembali seperti yang terjadi pada Munas 2004. Apabila apriori dan hipokrisi mewujud dalam bentuk balas dendam yang bersiklus, Golkar sesungguhnya sudah tamat. Sia-sialah energi yang terkuras begitu besar. Ekspektasi yang begitu tinggi diletakkan diatas tubuh Golkar hanya akan menjadi mimpi buruk. Label sebagai partai yang paling moderen hanyalah penamaan yang meninabobokkan tanpa berarti apa-apa sepanjang kader masih saling mendiskreditkan satu sama lain dan tidak perduli apakah perilaku itu akan menghancurkan partai. Kemampuan homeostasi Golkar haruslah diperkuat. Semangat rekonsiliasi harus ditumbuhkan, mengalahkan perilaku apriori dan hipokrisi. Munas Golkar yang baru lalu dan Musda Golkar Sumut dihadapan haruslah mampu memberikan jawaban. Kaderkader muda yang berpikir, berperilaku

serta bertindak rekonsiliatif seyogianya mendapat tempat yang terhormat. Apalagi manakala kader-kader muda itu telah membuktikan kapasitas dirinya secara terukur melalui perolehan suara yang nyata di akar rumput yang akan menjadi basis utama partai pada Pemilu Legislatif yang lalu. Elit partai pun harus memastikan perlunya memberlakukan kultur meritokrasi sekecil apapun. Kader yang terbukti meraih dukungan suara rakyat, konstituen partai apalagi berperilaku rekonsiliatif, haruslah mendapatkan bukan hanya apresiasi melainkan perlindungan yang memadai dari upayaupaya pembunuhan karakter dari internal dan eksternal partai. Dengan cara itu kemampuan homeostasi semakin diperkuat dan arus rekonsiliatif mengalahkan perilaku kontraproduktif yang apriori dan hipokrit. Sulitkah Rekonsiliasi? Begitu sulitkah rekonsiliasi di tubuh Golkar. Pertanyaan besar yang harus dijawab dengan langkah besar agar Golkar kembali besar. Filosofinya sederhana tentang bangun organisasi yang yang memerlukan dukungan akar rumput yang luas: “Satu musuh terlalu banyak, dan seribu kawan terlalu sedikit”. Saatnya energi rekonsiliatif didorong membentuk arus yang terus membesar lebih-lebih di tengah ancaman yang sangat serius terhadap Golkar menyusul kekalahan yang dialami pada berbagai perhelatan politik. Aburizal Bakrie menyadari hal itu dan berusaha keras melakukan langkah-langkah rekonsiliasi internal yang nampaknya akan menghadapi tantangan yang kuat dan serius. Perspektif Musda akan diperkaya pada upaya ke arah itu, ke arah rekonsiliasi yang teramat mendesak. Pertanyaannya, siapakah yang menang pada tarik menarik dua arus besar itu? Disinilah juga letak pentingnya Musda Golkar Sumut kali ini. Sekaligus dengan itu akan tercermin sejauhmana sudah institusi Partai Politik membangun kepercayaan publik bahwa institusi Parpol memang sudah pantas menjadi kenderaan politik melahirkan para pemimpin. Apakah teladan yang telah ditampilkan beberapa negara demokrasi belum cukup menjadi pembelajaran? Beberapa saat setelah perhitungan akhir Pemilu Presiden Amerika Serikat, Mc.Cain langsung melayangkan ucapan selamat kepada Sang Pemenang, Barrack Obama. Demikian juga pada saat Obama menang pada pertarungan Konvensi Partai Demokrat melawan

saingan kuatnya, Hillarry Clinton, keduanya langsung berangkulan. Obama pun langsung memberi isyarat akan mengajak Hillary Clinton bekerjasama apabila Obama kelak memenangi Pilpres melawan Mc.Cain dari Partai Republik. Dan Obama membuktikan ucapannya, menunjuk Hillary pada pos yang teramat penting bagi AS, sebagai Menteri Luar Negeri, segera setelah Obama memenangkan Pilpres melawan Mc.Cain. Itulah pembelajaran politik yang teramat berarti bukan hanya bagi kita di Indonesia, melainkan juga bagi semua negara-bangsa di dunia yang telah meyakini bahwa hanya dengan demokrasi yang sehat sebuah negarabangsa bisa bertahan, tumbuh, makmur dan sejahtera ditengah persaingan global yang semakin sengit. Kata kuncinya: semangat rekonsiliasi. Di Indonesia, kitapun menyaksikan betapa dua negarawan kita telah memberikan pembelajaran dan teladan yang baik. Beberapa saat setelah perhitungan cepat (quick count) menyatakan SBY menang Pilpres, JK langsung merespons dengan mengucapkan selamat. Meskipun dengan catatan ‘menurut hasil hitung cepat’, tetapi hemat saya itu mencerminkan keduanya memang negarawan sejati yang pernah dimiliki bangsa ini. Semangat rekonsiliasi memenangkan pertarungan melawan hipokrisi. Sayangnya, dalam banyak hal, seringkali perilaku hipokrit mengalahkan akal sehat. Keinginan sebagian orang untuk memamfaatkan momentum Munas untuk melampiaskan siklus dendam kesumat yang hipokrit nampaknya akan juga membayangi Musda Golkar Sumut. Pertarungan semangat rekonsiliasi melawan hipokrisi akan sangat menentukan perjalanan Partai Golkar selanjutnya apakah akan tetap terbelenggu dengan konflik internal yang berkepanjangan, terperangkap dalam kubangan lumpur yang akan terus mendegradasi partai ini secara berkelanjutan. Atau semangat rekonsiliasi akan menguat dan memenangkan pertarungan, mengeluarkan Golkar dari perangkap keterpurukan yang mengungkungnya selama ini untuk keluar menjadi pemenang dalam setiap langkah selanjutnya. Musda Golkar Sumut seyogianya bisa memberikan jawaban. Penulis adalah Wakil Ketua DPRD Sumut SMS: 081962 0123

Gaya Soekarno, Pola Soeharto Oleh Muchsin Lubis


enampilan politik Presiden Susilo BambangYudhoyono (SBY) dalam membentuk Kabinet Indonesia Bersatu Kedua yang diumumkan pukul 22.00 WIB 21 Oktober lalu, mengingatkan pada Presiden Soekarno dan Presiden Soeharto. Presiden Soekarno dikenal sebagai presiden charming dan selalu ingin tampil populis. Sedangkan Presiden Soeharto memiliki pola dan struktur tersendiri dalam membentuk kabinet. Model kedua mantan presiden ini sangat menonjol pada penampilan SBY. Gaya populis Soekarno tampak pada penampilan SBY berpidato yang selalu menggerakkan tangan pada setiap kalimat pidatonya, walaupun terlihat kaku dan datar, tanpa tekanan aksentuasi pada kalimat yang diucapkannya. Sedangkan Soekarno mempunyai gerak tubuh yang ekspresif diikuti mimik yang kuat dalam tiap kalimat yang diucapkan serta menjaga aksentuasi dan vibrasi. Soekarno memang seorang aktor panggung, karena pada dasarnya beliau seorang seniman dan dramawan yang mempunyai grup teater (tonil) sebelum menjadi presiden. Kesamaan SBY dan Soekarno, keduanya tampil sebagai tokoh penggemar popularitas sesuai dengan kondisi zamannya masing-masing. Di zaman Soekarno terutama di era awal kemerdekaan sampai awal 1960-an, beliau senang tampil dalam rapat massa berpidato dengan gegap gempita dan disambut dengan tepuk tangan. Pidatonya disiarkan secara langsung oleh Radio Republik Indonesia (RRI) ke seluruh nusantara dan masyarakat ramai-ramai mendengarkan. Bahkan satu radio bisa dikerumuni orang sekampung, karena radio masih sangat langka saat itu. Dengan gaya populis, Soekarno kemudian membangun simbol-simbol kemegahan dengan patung-patung di Jakarta seperti “Patung Selamat Datang,” “Patung Pembebasan Irian Barat”, “Patung Pak Tani,” “Monumen Nasional (Monas)” dan lainnya. Tak hanya itu, Soekarno melekatkan gelargelar istimewa buat dirinya seperti “Pa-

duka Jang Mulia” “Pemimpin Besar Revolusi,” dan gelar-gelar lainnya. Tak mengherankan, pada era Demokrasi Terpimpin di awal 1960-an, Indonesia sempat digelar sebagai “Opera State” (Negara Opera). Presiden SBY juga menampilkan pertunjukan opera ketika membentuk kabinetnya. Televisi sepanjang hari menampilkan calon-calon menteri yang dipanggil, lengkap dengan “acara tebaktebakan” saat konferensi pers singkat saat keluar dari rumahnya di Cikeas, Bogor. Televisi dan media pun sibuk ikut main tebak-tebakan dan mengumbar berbagai analisa. Tragedi gempa di Jawa Barat dan Sumbar pun lenyap dari pantauan. Perekrutan menteri pun akhirnya menjadi sinetron reality show. SBY tak mau ketinggalan ikut keluar rehat sejenak tampil di televisi saat mewawancarai calon menterinya. Sangat populis dan teatrikal sekali. Bila dicermati, perekrutan menteri oleh SBY, mirip dengan pola yang dilakukan Presiden Soeharto ketika berkuasa dari 1966 sampai 1998. Menteri dan calon menteri beberapa pekan sebelum Sidang Umum MPR yang akan memilih kembali Soeharto, dengan jantung berdebar menunggu telepon langsung dari Soeharto. Begitu juga saat ini, banyak yang berharap ditelepon orang dekat SBY, Hatta Rajasa Andi Mallarangeng, dan Sudi Silalahi. Posisi Hatta Rajasa, Andi Mallarangeng dan Sudi Silalahi, mengingatkan pola Soeharto dengan era pemerintahannya setelah Pemilu 1971 dengan lembaga Asisten Pribadi (Aspri) yang dipegang oleh Ali Moertopo dan Soedjono Hoemardani. Aspri merupakan orang kepercayaan Soeharto. Aspri kemudian dibubarkan setelah demonstrasi 15 Januari 1974 (Malari) oleh Hariman Siregar Cs. Soeharto mempunyai tangki pemikir (think tank) Centre Strategic for International Study (CSIS) yang dikoordinir Ali Moertopo dan teknokrat seperti Daoed Joesoef. Calon-calon menteri teknokrat kebanyakan diambil Soeharto dari CSIS yang bermarkas di Jalan Tanah Abang Timur, Jakarta.

Mirip dengan itu, SBY juga membentuk Dewan Pertimbangan Presiden (Wantimpres) yang saat ini diketuai Adnan Buyung Nasution. Bila Soeharto berkuasa dengan dominasi militer dengan dukungan teknokrat ditambah Golkar sebagai partai mayoritas tunggal (single majority), era SBY kini berkuasa dengan koalisi partai politik. Koalisi parpol tersebut kini sudah menjelma menjadi mayoritas tunggal pendukung SBY di DPR. Sehingga kini istilah oposisi menjadi “lenyap” di khasanah demokrasi Indonesia. Tak mengherankan bila kabinet SBY masih dido-minasi kader parpol. Dalam membentuk kabinet, Soeharto, untuk pos ekonomi dipercayakan pada teknokrat, selebihnya diberikan kepada militer dan Golkar. Demikian pula SBY, pos ekonomi dipercayakan pada teknokrat, selebihnya diberikan pada parpol atau orang yang berjasa dan dekat dengan dirinya secara pribadi. Seperti saat Soeharto memberikan jabatan Menteri Sosial kepada anaknya Mbak dan Menperindag kepada sahabatnya pengusaha Bob Hasan. Seperti era Soeharto, pada kabinet sekarang, SBY berencana akan membentuk 3 wakil menteri, mirip dengan Soeharto yang sempat membentuk menteri muda. Seperti Soeharto pula, SBY kembali mengaktifkan kembali lembaga Badan Koordinasi Penanaman Modal (BKPM) setingkat menteri yang kini dipegang Gita Wirjawan. Bila di zaman Soeharto militer memegang kendali keamanan sepenuhnya, tak mengherankan bila intelijen dipegang oleh militer (angkatan darat). Tapi kini di zaman SBY polisi dipercayakan sepenuhnya untuk keamanan. Untuk itu, tak mengherankan bila mantan Kapolri Jenderal Polisi (Purn) Sutanto dipercayakan menjadi Kepala Badan Intelijen Negara (BIN). Pertama kali dalam sejarah, polisi menjadi kepala intelijen. Sutanto sukses memberantas terorisme dan premanisme. Ke depan, dengan gaya Soekarno dan pola Soeharto ini, kabinet segera bekerja. Lepas sebagal pro dan kontra, terutama rakyat kecil, mampukah kabinet SBY ini meningkatkan kesejahteraan. Sebab makin banyak orang yang menge-

mis di pinggir jalan, banyak rakyat yang menangis kelaparan dan banyak bayi yang kekurangan gizi. Sementara infrastruktur banyak yang hancur. Jalan di Trans Sumatera, Trans Sulawesi, Trans Kalimantan masih belum lancar. Bis dari Medan ke Jakarta belum bisa lancar 48 jam seperti dulu. Petani jeruk dan pisang di Sumut tak bisa lagi mengirim buahnya ke Jakarta karena jalan negara rusak. Sementara itu perekonomian masih sangat timpang di mana 70 persen uang beredar di Jakarta, 15 persen beredar di kota besar di daerah dan hanya 15 persen yang beredar di desa. Otonomi daerah masih berpusat di Jakarta, walaupun SBY sudah merekrut menteri dari berbagai provinsi di seluruh Indonesia. Ketika menteri itu disebutkan masuk dalam kabinet, semua tertawa gembira. Tak satu pun tampak dari wajah mereka bahwa banyak tantangan yang bakal dihadapi. Sementara sebagian besar rakyat Indonesia hidup dalam kemiskinan. Apakah jabatan menteri hanya disambut sebagai naiknya status sosial dan cuma berhenti di situ saja? Ini yang kita pertanyakan ke depan. Penulis adalah pengamat politik dan sosial

SUDUT BATUAH * Kenaikan gaji menteri belum mendesak - Maklum baru dilantik * Banyak RS Swasta tak punya dokter tetap - Dokter keliling banyak * Warga Tionghoa dukung Rahudman - Apa maksud?


D Wak


Dewan Redaksi: H. Prabudi Said, H. Teruna Jasa Said, H. Azwir Thahir, H. Sofyan Harahap, H. Akmal Ali Zaini, H. Muhammad Joni, Edward Thahir, M. Zeini Zen, Hendra DS. Redaktur Berita: H. Akmal Ali Zaini. Redaktur Kota: Edward Thahir. Redaktur Sumatera Utara: M. Zeini Zen. Redaktur Aceh: Rizaldi Anwar. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara & Features: Gito Agus Pramono. Redaktur Opini: H. Sofyan Harahap. Redaktur Ekonomi: Armin Rahmansyah Nasution. Redaktur Olahraga: Johnny Ramadhan Silalahi. Redaktur Minggu/Humas: Hendra DS, Redaktur Agama: H. Syarifuddin Elhayat. Asisten Redaktur: Rudi Faliskan (Berita) Zulkifli Harahap, Muhammad Thariq (Kota Medan), Feirizal Purba (Sumatera Utara), T. Donny Paridi (Aceh), Syafriwani Harahap (Luar Negeri), Setia Budi Siregar (Olahraga), Hj. Hoyriah Siregar (Ekonomi), T. Junaidi (Hiburan), Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zein (Remaja), Austin Antariksa (Kreasi), Armansyah Thahir (Otomotif), Anum Purba (Wanita), Hj. Ayu Kesumaningtyas (Kesehatan), Denny Adil (Pelangi). Sekretaris Redaksi: Hj. Hartati Zein. Iklan: Hj. Hilda Mulina, Rumondang Siagian (Medan), Lulu (Jakarta). Pemasaran: Andi L. Said (Medan), H. Subagio PN (Sumut), S. Manik (NAD). Wartawan Kota Medan (Umum): H. Erwan Effendi, Muhammad Thariq, Zulkifli Harahap, David Swayana, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Feirizal Purba, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, M. Ferdinan Sembiring, M. Edison Ginting, Surya Effendi, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Hasanul Hidayat, Aidi Yursal, Rustam Effendi. Wartawan Kota Medan (bidang khusus): H. Syahputra MS, Setia Budi Siregar, Austin Antariksa, Dedi Riono (Olahraga), Muhammad Faisal, Hang Tuah Jasa Said (Foto), Armansyah Thahir (Otomotif), Dedi Sahputra (Penugasan Khusus). Dedek Juliadi, Zulfan Efendi, Tetty Rosiana, Handaya Wirayuga (Koran Masuk Sekolah/KMS). Wartawan Jakarta: Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian W, Aji K. Wartawan Sumatera Utara: H. Riswan Rika, Nazelian Tanjung (Binjai), H.M. Husni Siregar, Hotma Darwis Pasaribu (Deli Serdang), Eddi Gultom (Serdang Bedagai), H. Ibnu Kasir, Abdul Hakim (Stabat), Chairil Rusli, Asri Rais (Pangkalan Brandan), Dickson Pelawi (Berastagi), Muhammad Idris, Abdul Khalik (Tebing Tinggi), Mulia Siregar, Edoard Sinaga (Pematang Siantar), Ali Bey, Hasuna Damanik, Balas Sirait (Simalungun), Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan (Batubara), H. Abu Bakar Nasution, Nurkarim Nehe, Bustami Chie Pit (Asahan), Rahmad Fansur Siregar (Tanjung Balai), Indra Muheri Simatupang (Aek Kanopan), H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan (Rantau Prapat), Hasanuddin (Kota Pinang) Edison Samosir (Pangururan), Jimmy Sitinjak (Balige), Natar Manalu (Sidikalang), Arlius Tumanggor (Pakpak Bharat)Parlindungan Hutasoit, Marolop Panggabean (Tarutung), Zulfan Nasution, Alam Satriwal Tanjung (Sibolga/Tapanuli Tengah), H. Syarifuddin Nasution, Mohot Lubis, Sukri Falah Harahap, Balyan Kadir Nasution (Padang Sidimpuan), Idaham Butarbutar (Gunung Tua), Iskandar Hasibuan, Munir Lubis (Panyabungan), Bothaniman Jaya Telaumbanua (Gunung Sitoli). Wartawan Aceh: H. Adnan NS, Aldin Nainggolan, Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah (Banda Aceh), Iskandarsyah (Aceh Besar), Maimun (Lhoksukon) Bustami Saleh, M. Jakfar Ahmad, Jamali Sulaiman, Arafat Nur, M. Nasir Age, Fakhrurazi Araly, Zainal Abidin (Lhokseumawe), Muhammad Hanafiah (Kuala Simpang), H. Syahrul Karim, H. Ibnu Sa’dan, Agusni AH, H. Samsuar (Langsa), Amiruddin (Idi), HAR Djuli, Zainuddin Abdullah (Bireuen), Bahtiar Gayo (Takengon), Muhammad Riza, H. Rusli Ismail (Sigli), T. Zakaria Al-Bahri (Sabang), Khairul Boang Manalu (Subulussalam), Rusli Idham (Meulaboh), Jaka Rasyid (Blang Pidie), Zamzamy Surya (Tapak Tuan), Ali Amran, Mahadi Pinem (Kutacane), Bustanuddin , Wintoni (Blangkejeren), Khairul Akhyar (Bener Meriah), Tarmizi Ripan, Mansurdin (Singkil), Rahmad (Sinabang).

� Semua wartawan Waspada dilengkapi dengan kartu pers. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �


WASPADA Rabu 28 Oktober 2009


Anggota DPR (Harus) Wakili Suara Rakyat Oleh DR. Drs. H. Ramli, MM


ara anggota Dewan Perwakilan Rakyat (DPR) RI periode 20092014 yang dilantik pada 1 Oktober 2009 akan segera pindah dari daerahnya masing-masing ke Jakarta. Kepindahan mereka ke Jakarta adalah untuk menjadi telinga, mata, dan mulut para konstituennya di masing-masing daerah. Sistem perwakilan dalam demokrasi kita memberi ruang bagi satu orang untuk mewakili puluhan ribu bahkan suara ratusan ribu masyarakat, sesuai dengan harga sebuah kursi yang diperebutkan dalam Pemilu Legislatif lalu. Sesungguhnyalah ini adalah sebuah tugas yang berat karena seorang anggota dewan harus bisa merepresentasikan keinginan dan kemauan masyarakat konstituennya untuk kemudian diperjuangkan

di tingkat regulasi. Seorang anggota dewan tidak saja dituntut punya hati nurani dan ‘political will’ atau kemauan politik untuk mewakili suara rakyat yang menjadi konstituennya. Tapi lebih dari itu, mereka juga dituntut untuk bisa menerjemahkan apa kebutuhan dan keinginan masyarakat konstituen tersebut. Seorang anggota dewan yang punya keinginan kuat untuk memperjuangkan hak-hak konstituennya saja tidak cukup, apabila dia tidak punya kemampuan untuk mengetahui keinginan atau kebutuhan yang sebenarnya dari masyarakat. Apalagi kalau seorang anggota dewan sudah tidak punya keinginan untuk itu, maka dia akan sangat sulit memiliki kemampuan merekam keinginan warga masyarakat, kalaupun dia bisa melakukannya, hal tersebut tidak lebih dari komoditas politik semata. Itulah sebabnya, seorang anggota dewan dikatakan sebagai orang-orang yang terhormat. Tidak lain karena beratnya tugas dan tanggung jawab yang mereka miliki. Selain ini juga mereka harus punya kemampuan dan mental pribadi yang baik karena mereka menjadi orang tempat digantungkan harapan orang banyak. Karena tugas dan tanggungjawab itu pula, seorang anggota dewan diberikan berbagai fasilitas yang istimewa. Dari mulai gaji yang tinggi, fasilitas hidup lainnya telah menanti se-

orang anggota dewan. Sekarang ini sedang musimnya anggota dewan untuk hijrah ke Jakarta. Khususnya anggota DPR-RI dari daerah yang terpilih, maka mereka harus sering menetap di Jakarta. Tidak tanggung-tanggung untuk biaya pindah anggota dewan tersebut, SekretariatJenderalDewanPerwakilanRakyattelah mengalokasikan dana sebesar Rp26 miliar. Sekjen Dewan Perwakilan Rakyat, Nining Indra Shaleh menjelaskan, biaya pindah anggota dewan tersebut, terdiri dari tiket untuk keluarga anggota dan biaya pengepakan. Sekjen DPR kabarnya juga mengalokasikan dana untuk orientasi anggota dewan sebesar Rp6 miliar.Selanjutnya biaya yang dikeluarkan untuk kebutuhan anggota dewan ini semuanya dalam hitungan jumlah uang yang besar. Baik biaya pelantikan maupun sidang-sidang pemilihan pimpinan dan lain sebagainya. Kabarnya biaya pelantikan wakil rakyat menelan Rp46 miliar. Jumlah ini tentu besar dan tidak mengherankan jika kemudian muncul suara-suara yang menganggapnya sebagai pemborosan uang negara. KPU pun dianggap telah mendesain pola perilaku buruk kepada anggota dewan periode 2009-2014. Banyak pihak menilai anggaran Rp46 miliar untuk pelantikan seluruh wakil rakyat tidak efektif. Hal itu tidak mencermin-

kan spirit rasa kebersamaan dan menghormati rakyat yang kesusahan. Apalagi pelantikan dilakukan ditengarai terjadinya bencana alam gempa bumi yang menewaskan ribuan orang di Sumatera Barat.Banyak pihak yang kemudian menilai penggunaan hak DPR untuk mengamandemen RAPBN yang diajukan pemerintah bukan diprioritaskan untuk peningkatan kesejahteraan rakyat. Tapi justru dijadikan lahan mencari keuntungan. Meningkat Wacana yang berkembang tentang anggota dewan ini sebenarnya sudah sejak lama terjadi. Tahun lalu muncul tudingan masyarakat tentang masih rendahnya kinerja dewan, tetapi alih-alih lembaga itu justru meningkatkan anggarannya dari Rp1,6 triliun pada 2008 menjadi Rp1,9 triliun pada 2009. Argumen bahwa peningkatan anggaran untuk dapat lebih memacu kinerja anggota dewan. Tetapi argumen ini dengan segera disanggah karena pada Masa Sidang II DPR Tahun Sidang 20082009 lalu, cuma dihadiri 135 anggota dari 550 anggota dewan. Dari total anggaran DPR sebesar Rp1,9 triliun itu, lebih dari Rp118 miliar diaokasikan untuk kegiatan ke luar negeri. Angka itu dua kali lipat dari jumlah anggaran pada 2007 yang mencapai Rp53 miliar. Kegiatan

Kabinet Akomodatif Oleh H IrhamTaufik Umri,SH,MAP


eka teki siapa yang akan diangkat menjadi Menteri Kabinet Indonesia Bersatu jilid II terjawab sudah. Hal itu diketahui, setelah Presiden Dr. H. Susilo BambangYudhoyono mengumumkan susunan kabinet, Rabu malam (17/10) di Istana Merdeka Jakarta. Bahkan secara cepat esok harinya Presiden juga legalitas telah melantik pembantupembantunya itu di Istana Negara yang dipublikasikan secara luas oleh media massa. Mengacu kepada Undang-Undang Nomor: 39 tahun 2008 tentang Kementerian Negara, Presiden telah menggunakan hak prerogatifnya dalam menentukan jumlah menteri dengan pola maksimal. Dengan demikian jumlah menteri yang duduk dalam kabinet SBY – Boediono berjumlah 34 orang. Sebagaimana lazim yang terjadi di negeri ini, suatu kebijakan ataupun keputusan, apalagi bersifat strategis seperti penghunjukan menteri pasti mengundang tanggapan kontroversi berbagai pihak ter-

utama dari kalangan akademisi. Pascapenetapan susunan kabinet yang dipersoalkan hilangnya nama Prof. Dr.Nila Juwita Anfasa Moeloek dalam susunan KIB II, padahal ia telah mengikuti audisi dan wawancara dengan Presiden. Namun Presiden telah menjelaskan bahwa isteri mantan Menteri Kesehatan Anfasa Moeloek itu tidak lolos karena alasan kesehatan. Namun persoalan itu tidaklah esensi. Akan tetapi yang mengundang kontroversi terutama dari kalangan akademisi adalah begitu banyaknya kalangan politisi bahkan ketua partai politik langsung mengisi jabatan strategis dibandingkan kalangan profesional. Pakar dan akademisi mempertanyakan kapabilitas, akseptabilitas dan kredebilitas mereka berkiprah di tataran eksekutif, karena selama ini yang mereka geluti pada tataran legislatif. Pakar dan akademisi mengkhawatirkan Kabinet Indonesia Bersatu II tidak bisa banyak berbuat untuk melaksanakan tugas pokoknya dalam meningkatkan kesejahteraan masyarakat sebagai prioritas utama program KIB II selama 100 hari hingga lima tahnan yang akan datang, karena interest politik melekat pada dirinya. Empat faktor Memilih 34 menteri sebagai pembantu Presiden tidaklah mudah dan gegabah. Sejak dipilih rakyat secara langsung melalui Pilpres 2009 Dr. H Susilo Bambang Yudhoyono dan Profesor Dr. Boediono, sudah

barang tentu melakukan observasi, evaluasi, kajian mendalam, penuh kehati-hatian dengan mempertimbangkan segala aspek baik politis, sosiologis. logis maupun moralis Hal itu terlihat sebelum menjatuhkan pilihan, sejak dua bulan lalu, SBY – Boediono telah memberi sinyal kepada publik bahwa di saku mereka sudah terdapat 100 nama yang akan digodok, dibahas dan diteliti jati dirinya Kurun waktu itulah publik menunggu, apalagi bakal calon menteri penuh harap menunggu formula “AIDS” akronim dari Aku Ingin Ditelepon SBY dari Cikeas. Momentum yang ditunggu publik akhirnya datang juga, dengan diumumkannya 34 orang putra terbaik di negeri ini yang akan duduk di kursi KIB II. Kalau dicermati dengan seksama, penetapan Menteri Kabinet Indonesia Bersatu II setidak-tidaknya ada empat aspek utama pertimbangan yang melatar belakangi SBY – Boediono memilih para pembantunya : Pertama : Koalisi. Faktor dukungan partai politik yang telah berkoalisi dengan partai Demokrat merupakan hal yang dominan yang mewarnai postur dan komposisi KIB II. Rekrutmen kader partai politik duduk dalam kabinet merupakan konsekunsi logis dalam politik dan pemerintahan. Tidak dapat dipungkiri peran partai politik cukup besar dalam mengusung SBY – Boediono saat bertarung pada Pilpres yang lalu. Kubu “golden bridge” yang terdiri dari Partai Keadilan Sejahtera, Partai Persatuan Pembangunan, Partai Kebangkitan Bangsa, Partai Amanat Nasional dan Partai Demokrat sendiri sebagai koordinator

Kepala MIN Medan Deliana Rasyid Lubis, S.Ag Mengetahui Ketua Komite MIN Medan, Drs Sahdin Hasibuan, M.Ag (Catatan Redaksi: Dengan adanya klarifikasi dari pihak MIN Medan, maka dengan ini polemik terkait persoalan MIN dianggap selesai, terima kasih)

Jalan Pancing Luar Biasa....! Sadar atau tidak, sengaja atau tidak, melihat kondisi Jln. Pancing/Willem Iskandar Medan, persis di depan ruko MMTC, sangat luar biasa!. Luar biasa karena sudah sedemikian lama, sudah banyak korban, masyarakat mengutuk, pemuda/mahasiswa demo, hingga kini tak ada yang menggubris. Ada apa?. Setiap hari terlihat kenderaan mogok, rusak terperosok ditempat itu. Pengendara roda dua apalagi, orang yang berpakaian rapi mau kerja/kantor, anak sekolah/mahasiswa mau ke kampus/sekolah, banyak yang jadi basah kuyup dan kotor sebab jatuh ditempat itu. Luar biasa! Akibat lain, banyak pengendara kenderaan datang dari arah simpang

Penutup Tulisan ini diawali dengan diskripsi sukses SBY – Boediono pada saat Pilpres 2009 tidak bisa diabaikan begitu saja. Sebagai ‘incumbent’ tentu saja banyak menguntungkan SBY, namun peran tim sukses dalam mendesain kemenangan SBY cukup spektakuler. Begitu apiknya skenario politik lebih-lebih pada saat kampanye, sehingga kepopuleran SBY tak dapat ditandingi oleh Capres-Capres lainnya. Kemasan kampanye SBY – Boediono ibarat magnit mampu memukau atensi publik menjatuhkan pilihannya kepada sang incumbent, sehingga menang mutlak hanya satu putaran dengan capaian 60 persen lebih dari pemilih negeri ini yang menggunakan hak suaranya.Tidak mengherankan atas jasa-jasanya tim sukses mendapat porsi di KIB II yang diberikan kepada Marsekal (TNI) Joko Suyanto sebagai Menko Polhukam. Gubernur Sumatera barat Gamawan Fauzi dihunjuk mejadi Menteri Dalam Negeri. Sudi Silalahi yang terus menerus mendampingi SBY baik sebagai Presiden maupun sewaktu berkiprah di TNI diposisikan sebagai Menteri Sekretaris Negara. Ketiga : Kompetensi dan profesi. Faktor kompetensi dan profesional dijadikan rujukan dalam menyususn KIB II. Fenomena itu tercermin dari jabatan strategis khususnya di bidang perekonomian dialokasikan kepada para profesional. Ada sebelas orang Menteri berasal dari kalangan profesional seperti : Sri Mulyani, Maria Pangestu, Mustofa Abu Bakar, Armida Alisyahbana, Joko Kirmanto, Muhammad Nuh, Marty Natalegawa, Linda Agum Gumelar, Purnomo Yusgiantoro, Endang Rahayu Setianingsih serta Gusti Muhammad Hatta. Keempat : bingkai NKRI. Selain faktor politis, tim sukses serta kompetensi/profesi, SBY juga mempertimbangkan aspek persatuan dan keatuan dalam bingkai Negara Kesatuan Republik Indonesia (NKRI). Aspek ini sangat penting mengingat era oto-

betapa pentingnya institusi DPR RI dalam sistem politik kita dan betapa strategisnya posisinya untuk menjadi penyeimbangan bagi eksekutif. Ini juga yang menjadi alasan mengapa berbagai fasilitas dan kewenangan melekat pada diri para anggota dewan. Maka sudah saatnya dewan wajib membuatrencanakerjadananggaranyangterbuka untuk publik dan dipublikasikan agar kerja dewan bisa lebih teratur dan terukur. Hal ini untuk menghilangkan kesan tertutup. Saya kira jika semua dilakukan secara transparan dan para anggota dewan melakukan tugasnya dengan benar, membawa aspirasi dan kepentingan rakyat dilapisan bawah maka berbagai persoalan yang selalu muncul menyangkut kinerja dewan tidak akan muncul lagi. Rakyat akan lebih mudah memahami apabila dewan menunjukkan kinerja yang baik, dan apalagi dapat dirasakan langsung oleh masyarakat kostituennya. Anggota dewan seperti pada umumnya kumpulan manusia, mereka terdiri orangorang yang baik, memiliki komitmen memperjuangkan hak-hak rakyat dan memiliki kemampuan untuk menangkap keinginan dan kebutuhan rakyat. Oleh karena itulah seorang anggota dewan, siapapun dia harus mewakili suara rakyat. Penulis adalahWakilWalikota Medan Non-Aktif.

nomi daerah sebagai aktualisasi reformasi di negeri ini. Karenanya tidak mengherankan hampi semua Provinsi ada perwakilan yang menghias komposisi KIB II. Dari mulai Mustafa Abu Bakar,Tifatul Sembiring, Hatta Rajasa, Gamawan Fauzi, Sri Mulyani, Zulkifli Hasan (pulau Sumatera), JeroWacik (Bali), Suharsa (NTB), Gusti Muhammad (Kalimantan) EE Mangindaan, Fadel Muhammad (Sulawesi), Freddy Numberi (Papua). Selainnya berasal dari pulau Jawa. Arif dan bijak Berdasarkan keempat faktor analisis pertimbangan tersebut, nyatalah Presiden SBY cukup arif dan bijaksana mengakomodasi seluruh kepentingan dalam menetapkan personil KIB II. Sebagai negarawan ia sudah memikirkan dengan matang siapa yang mempunyai prestasi, dedikasi, loyalitas, moralitas dan profesionalitas. Oleh karena itu tak perlu lagi dipersoalkan banyaknya polititisi ketimbang kalangan profesional yang duduk di kabinet.Yang sangat penting bagaimana pengisian jabatan eselon I di setiap Departemen yang akan melaksanakan kebijakan Menteri. Karena eselon I merupakan dapur olah untuk mengaktualisasikan secara teknis operasional segala kebijakan yang ditetapkan Menteri. Berikanlah waktu bagi Menteri KIB II untuk bekerja dan berkarya nyata mengemban amanah dalam rangka melakukan “change and continued” perubahan dan kelanjutan meningkatkan kesejahteraan rakyat di negeri ini. Rakyat tentu menantikan kiprah Menteri KIB II dalam mengaktualisasikan program 100 hari, tahunan maupun lima tahunan yang telah digariskan oleh Presiden.Penulis adalah Dosen Sekolah Tinggi Agama Islam Al Hikmah Kota Tebingtinggi.

Mencari Format Pendidikan Di Tapsel

Klarifikasi Atas Pemberitaan HarianWaspada15 Dan 27 Oktober 2009 Sehubungan dengan pemberitaan di surat kabar Harian Waspada pada kolom surat pembaca tanggal 15 Oktober 2009 dengan judul: ‘Kutipan di MIN Medan Memberatkan’ dan tanggal 27 Oktober 2009 dengan judul ‘Di MIN Medan, Keluhan Orang Tua Murid Tak Ditanggapi, perlu kami berikan klarifikasi sebagai berikut: 1. Pada pemberitaan tanggal 15 Oktober 2009 dinyatakan, pihak madrasah mewajibkan siswa/i kelas 1 (satu) mengikuti les tambahan dengan membayar uang sebesar Rp75.000 untuk semua mata pelajaran dan membeli semua buku mata pelajaran seharga Rp70.000 adalah tidak benar (fitnah), karena les tambahan yang diberikan oleh guru/wali kelas hanya sebanyak 13 orang dari 40 orang jumlah siswa kelas I-A atau hanya 25 persen yang ikut les dari total 190 orang siswa/i Kelas I yang mengikuti les tambahan. Kemudian, les tambahan itu diberikan adalah atas dasar suka rela (permintaan beberapa orang tua tanpa ada paksaan) untuk mengikutinya. Sementara pembelian buku dengan harga Rp70.000 untuk beberapa mata pelajaran, juga tidak benar (fitnah) karena semua buku mata pelajaran diberikan oleh pihak sekolah (MIN Medan) secara pinjampakai bagi setiap siswa. 2. Pada pemberitaan tanggal 27 Oktober 2009, dinyatakan, keluhan orangtua tak ditanggapi, di sini juga kami nyatakan tidak benar (fitnah). Karena atas pemberitaan sebelumnya (15/10), saya selaku Kepala MIN Medan langsung memanggil para guru/wali kelas dan meminta klarifikasi/ penjelasan berita itu. Ternyata kami peroleh informasi bahwa berita itu tidak benar (fitnah). Namun demikian, saya sudah mengkonsultasikan hal ini dengan pihak Komite MIN Medan, akhirnya disepakati untuk melakukan pertemuan antara pimpinan madrasah, ketua komite dan seluruh orangtua/wali murid Kelas I. Pertemuan ini dilaksanakan pada Rabu, 21 Oktober 2009 di MIN Medan. Salah satu pon yang disepakati dan hasil kesepakatan rapat adalah les tambahan yang diberikan oleh guru/ wali kelas, dibenarkan oleh pihak sekolah atas permintaan orangtua/wali murid (secara sukarela) tanpa ada paksaan dari pihak guru/MIN Medan. Keputusan rapat sudah disampaikan kepada seluruh orangtua/wali murid Kelas I, baik yang hadir maupun tidak hadir dalam rapat pada tanggal 24 Oktober 2009. Demikian bantahan dan klarifikasi ini, semoga berbagai pihak/ pembaca maklum.

koalisi cukup solid menghadapi Partai Demokasi Indonesia Perjuangan, Partai Gerindra, Hanura yang dikenal dengan kubu “golden triangle”. Belakangan pasca Munas di Pekan Baru, Partai Golkar juga merapat ke Partai Demokrat. Adalah hal yang logis, partaipartai yang berkoalisi dengan partai demokrat direkrut SBY sebagai pembantunya di KIB II. Dari 34 menteri 20 orang berasal dari partai politik bahkan di antaranya ketua umum langsung mengisi jajaran KIB II. Dari Partai Demokrat : Darwin Zahedi Saleh (Menteri ESDM), JeroWacik (Menteri Budpar), Syarif Hasan (Menteri Koperasi & UKM), EE Mangindaan (Meneg PAN), Andi Mallaranggeng (Menpora) dan Freddy Numberi (Menteri Perhubungan). Selanjutnya dari Partai Keadilan Sejahtera terpilih Tifatul Sembiring (Meneg Kominfo), Salim Assegaf Al Jufri (Menteri Sosial), Suharsa Surapranata (Menristek) dan Suswono (Menteri Pertanian). Berikutnya dari Partai Amanat Nasional Hatta Rajasa (Menko Perekonomian), Patrialis Akbar (Menhum dan HAM), Zulkifli Hasan (Menteri Kehutanan). Demikian pula Partai Kebangkitan Bangsa mendudukkan Muhaimin Iskandar (Menakertrans), dan Helmi Faisal Zaini (Menteri PDT). Partai Persatuan Pembangunan mendapat dua kursi yaitu Suryadharma Ali (Menteri Agama) dan Suharso Monoarfa (Menteri PDT). Sedangkan partai Golkar mendapat 3 kursi Agung Laksono (Menko Kesra), Fadel Muhammad (Menteri Kelautan dan Perikanan) serta MS Hidayat (Menteri Perindustrian). Kedua : Jasa tim sukses. Eksistensi tim

seperti perjalanan ke luar negeri dengan nama studi banding memang sering dilakukan para anggota dewan tersebut. Meski tidak banyak publik yang memahami substansi studi banding ke luar negeri itu. Ada banyak lagi keistimewaan yang didapat seorang anggota dewan tersebut. Itu semua bisa terjadi karena hak yang melekat dalam diri dewan terus bertambah. DPR tak hanya punya kekuasaan di lingkup pengawasan, anggaran, dan perundangundangan. Tetapi, DPR juga diberi hak mengelola keuangan sendiri. Meski penilaiannya dari tahun lalu, kinerja dewan mendapat “rapor merah” namun tetap saja tidak menghilangkan atau mengurangi pentingnya lembaga dewan ini dalam sistem politik kita. Oleh karenanya hingar bingar pada Pemilu Legislatif 2009 lalu tidak kalah semaraknya dengan tahun-tahun sebelumnya. Orang boleh bilang bahwa segudang kekuasaan yang dimiliki anggota dewan tidak sebanding dengan apa yang diberikan kepada negara dan rakyat. Minimnya kuantitas dan kualitas UU yang dihasilkan DPR serta tiadanya target waktu yang jelas tentang kapan sebuah RUU selesai, bisa menjadi indikator ukuran kinerja dewan.

Oleh Arifin Saleh Siregar


abtu (18/10), Gerakan Mahasiswa Angkola Sipirok menggelar seminar Strategi Peningkatan Kualitas Pendidikan di Tapanuli Selatan di Hotel Grand Antares Medan. Seminar yang dihadiri beberapa profesor asal Tapsel, tokoh masyarakat, utusan Pemkab Tapsel dan mahasiswa asal Tapsel yang kuliah di Medan berlangsung menarik. Tulisan ini adalah pokok pikiran yang disampaikan penulis yang kebetulan saat itu menjadi salah satu pembicara. Berbicara tentang pendidikan Tapsel tidak ada salahnya mengulang kisah Raja Dima Siregar. Pria ini menjadi guru kelas 1 hingga kelas 6 di SD Dusun Sigoring-goring, Desa Pangirkiran Dolok, Kecamatan Barumun Tengah (dulu Tapanuli Selatan sekarang wilayah Padang Lawas). Imbalan yang diterimanya bukan uang, tapi 80 kaleng beras per tahun (satu kaleng beras setara dengan 16 kilogram). Semua itu dilakukannya karena merasa terpanggil sebab saat itu anak- anak tidak sekolah selama tiga bulan karena tidak ada guru. Raja Dima tidak tega melihat kondisi itu. ”Penderitaan” sekaligus perjuangannya sempat menyita perhatian nasional. Tidak tanggungtanggung, Wakil Presiden RI Jusuf Kalla mengundangnya ke Jakarta. Ia bertemu dengan isteri Wapres dan juga beberapa pejabat penting Departemen Pendidikan Nasional RI. Raja Dima juga diundang dan hadir dalam acara Kick Andi di Metro TV. Selain jadi “tamparan” karena kondisi pendidikan yang belum memuaskan, kisah di atas juga seharusnya jadi motivasi. Cerita itu mestinya menyadarkan kita, terutama pemerintah untuk segera meletakkan pendidikan sebagai ranah terpenting. Jika se-

orang Raja Dima Siregar, yang sehari-harinya juga merangkap jadi petani mampu menyisihkan waktu dan tenaganya, selayaknyalah pemerintah memeras lebih banyak keringat untuk memperbaiki kondisi dan kinerja pendidikan. Pendidikan Belum Memuaskan Langkah ini perlu dipercepat karena hingga hari ini kondisi dan kualitas pendidikan di Tapsel belum memuaskan dan masih kalah dengan daerah lainnya. Beragam persoalan pendidikan juga masih terus mendera daerah yang baru memekarkan beberapa wilayahnya menjadi kabupaten baru. Dari masalah kurikulum sekolah, kualitas guru dan kesejahteraannya, lokasi atau jarak sekolah yang jauh dengan rumahrumah penduduk, motivasi orang tua dalam menyekolahkan anaknya, sarana dan prasarana pendidikan, hingga peran serta masyarakatnya (stake holders). Begitu juga soal pencapaian anggaran 20 % APBD untuk pendidikan, pencapaian wajib belajar 12 tahun (SD-SMA), distribusi guru dengan kualifikasi yang layak (sesuai antara latar belakang pendidikan dengan mata pelajaran yang diajarkan), penyediaan laboratorium, perpustakaan sekolah dengan basis ICT (Information Communication andTechnology), menyediakan librarian (pustakawan), laboran (guru lab) hingga manajemen sekolah. Semua itu belum memuaskan dan masih butuh perbaikan. Hal lainnya yang juga merisaukan adalah semakin tersingkirnya siswa asal Tapsel dalam persaingan untuk masuk ke PTN. Meski di sejumlah PTN ada mahasiswa asal Tapsel, tapi itu karena adanya jalur khusus

Unimed, mau menghindar jalan yang rusak parah dan banjir, memotong kekanan dan “terpaksa” melawan arah, tiba-tiba distop polisi tampaknya sengaja menunggu ditempat itu pada waktu-waktu tertentu saja. Jadi pengendara hanya berucap dalam hati, “mau jalan yang lurus, tapi resiko celaka. Mengambil jalan pintas, kena tilang. Jadinya bagaimana ya?”. Jalan siapa ini?. Sebenarnya tak perlu dipertanyakan, yang jelas adalah kepentingan umum. Siapa yang bertanggungjawab? Siapa yang peduli?. Entahlah. Astagaa.... Luar biasa....! Hormat saya Syamsul Bahri Ritonga Jl.Walet I No. 318 P.Mandala Medan 20226

yang disiapkan sejumlah perguruan tinggi negeri lainnya untuk memberikan peluang pemerataan bagi setiap kab/kota masuk di PTN, seperti jalur PMP (Pemanduan Bakat dan Prestasi). Baru-baru ini PemkabTapsel mengirimkan dan memberi beasiswa kepada seorang siswa terbaiknya untuk kuliah di salah satu perguruantinggiterbaikdiAustralia.Beberapa siswa lainnya juga sedang dipersiapkan dan diseleksiuntukdikirimkeluarnegeri. Gebrakan ini tentu harus didukung. Tapi beragam pertanyaansepertinyaharusdijawabPemkab Tapsel; sudah mendesakkah atau sebegitu pentingkah pengiriman siswa ke luar negeri? Apakah pengiriman siswa ke luar negeri itu nantinya memberi manfaat yang signifikan terhadap kemajuanTapsel? Apakah nantinya mereka yang dikirim itu akan kembali ke Tapsel? Bagaimana kalau mereka tidak mau kembali? Apakah ilmu yang diperolehnya di luar negeri sana bisa diterapkan di Tapsel? Bagaimana kalau misalnya nanti mereka justru membawa ideologi/ajaran atau konsepkonsep yang tidak cocok dengan budaya dan kehidupan sosial masyarakat Tapsel, misalnya ideologi kapitalis atau neoliberalis yang belakangan ini banyak diperdebatkan? Apakahprogramitujugadiikutidenganpemberian beasiswa kepada siswa yang lulus di USU, Unimed, IAIN, ITB, UGM, UI dan PTN lainnya? Bagaimana dengan siswa lainnya yang tidak bisa bersaing tapi keinginan untuk melanjutkan pendidikan dan motivasi belajarnya cukup tinggi? Sekali lagi, semua upaya peningkatan kualitas pendidikan harus tetap didukung. Hanya saja harus dicatat, program di dunia pendidikan sebisa mungkin harus jauh dari konsep menara gading. Program pendidikanharusbisadirasakansemuakalangan,tidak seperti menara gading yang sulit untuk diraih dan mungkin hanya bisa disentuh sebagian orang. Guru Berkarakter dan Sekolah Berasrama Ada beberapa solusi alternatif dalam upaya peningkatan pendidikan di Tapsel. Sembaripemerintahmelengkapifasilitaspendidikan, upaya-upaya membangun guru yang berkarakter juga harus terus dilakukan. Sebutan guru kampung tidak jadi persoalan bilamana guru tersebut memang memiliki karakter dan moralitas yang baik. Bila pemerintah terkesan lebih peduli pada angka statistik persentase kelulusan Ujian Nasional, guru kampung yang sejati lebih peduli pada pendidikan anak-anak kampung agar menjadi manusia berkarakter.

Guru berkarakter yang sanggup memimpin dirinya sendiri sebelum menjadi pemimpin bagi orang lain, yang peduli pada harkat, martabat, dan harga diri sesamanya. Guru berkarakter yang berani menolak tegas penyalahgunaan jabatan dan kuasa untuk memenuhi ambisi dan nafsu rendah keluarga, kelompok, golongan, dan kronikroninya. RajaDimaSiregarjugasudahmelakukannya.DiaharusdijadikanmodelgurudiTapsel. Diisilain,PemkabTapselharusbisameyakinkan bahwa guru kampung, adalah guru yang memang bersedia menetap di kampung bersama anak-anak didiknya dan tentu harus dihargai dengan selayaknya. Selain itu, format sekolah berasrama (boarding school) juga cocok sebagai solusi alternatif peningkatan mutu pendidikan Tapsel. Sesuai namanya, sekolah berasrama memang memiliki sarana asrama bagi peserta didiknya. Siswa yang sekolah di sini tidak perlu lagi pulang hari ke rumahnya, tapi tinggal di asrama. Hal ini juga didukung karena secara geografis wilayah Kabupaten Tapsel sedikit unik. Jarak antara kecamatan dengan kecamatan lainnya begitu jauh, bahkan bisa dikatakan di belah Kota Sidimpuan. Kalau mau menuju kecamatan seberang, harus melewati kota Sidimpuan dulu. Di sisi lain, jarak desa di dalam satu kecamatan juga tidak dekatdekat kali. Begitu juga dengan akses ke sekolah-sekolah relatif sulit dan lama karena jaraknya yang tidak dekat. Bahkan ada yang harus naik turun gunung atau melewati perkebunan dan persawahan. Sementara transportasi belum ikut mendukung. Makanya, sekolah berasrama cukup efektif diterapkan di Tapsel. Dengan format sekolah berasrama ini, pendidikan disajikan secara menyeluruh, selama 24 jam. Tidak secara terpisah seperti pada pendidikan reguler. Jika pendidikan reguler hanya fokus kepada pendidikan akademis saja, maka pendidikan di sekolah berasrama memuat pendidikan di semua aspek. Mulai dari akademik, agama, keterampilan (life skill), hingga pembinaan karakter. PemkabTapsel memang harus berada di depan. Sinergi dengan pengusaha, tokoh pendidikan,danlembagalainnyawajibdilakukan dalam upaya peningkatan kualitas pendidikan di Tapsel. *** Penulis adalah mantan Ketua Umum Imatapsel USU sekarang Dosen Kopertis dpk Fisip UMSU dan sedang mengikuti program Magister Studi Pembangunan Pascasarjana USU

14 1 CM 2 CM


Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000


AUTOMOTIVE Informasi Pembaca


Bursa Automotive

: Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower

PS : Power Stearing PW : Power Window RT : Radio Tape VR : Velg Racing EW : Electric Window

BMW 5301 HITAM 92/93 Mdn Asli Jok Kulit No. 1 AC, TV, TP, CD (Audio) +/- 20Jt. H. 42Jt Nego. Hub. 0812 602 5621

CHEROKEE 4x4 M/T ‘95, Biru Dongker, Ban 31” Velg Asli, Orisinial, DP 23Jt, Angs: 2,4Jt. Hub. 76700976 / 0813.7588.7306. DAIHATSU Espass 1.6 SLIDING DOOR ‘96/’97. Mrh. Maron Met, AC, RT, VS, BR, BK Mdn, DP 15Jt, Angs: 1 jt. Hub. 76700976 / 0813.7588.7306

DAIHATSU Rocky 4x4 Th. 94. W. Hitam metalic. AC, Tape, VR, BR, BK Medan. Body Kaleng. Mulus Seperti baru H. Nego. Hub. 0813 6233 0595

DAIHATSU Zebra 1.3 Th. 92. W. Biru metalic. Tape, VR, BR, BK Medan. 1 nama body kaleng. Mulus Hub. 061-7620 9937

DAIHATSU Zebra MB 1.3 Th. 92. BK Pjg. Ban Baru. Mesin sehat. H. 24Jt Nego. Hub. 0812 6462 960 PROMO DAIHATSU BARU (Diskon + Hadiah)

Xenia DP 12 Jt-an dan angs 2 Jt-an Terios DP 20 Jt-an dan Angs 3 Jt-an Luxio DP 8 Jt-an dan Angs 4 Jt-an Gran Max PU DP 8 Jt-an dan Angs. 2 Jt-an Hub. 0813 7694 1988 / (061) 77722561

100% BARU GranMax PU.......DP 10Jt-an, Angs 2Jt-an Xenia................DP 12 Jt-an, Angs 3 Jt-an Terios...........................DP 20, Angs 4Jt-an “Terima Tukar Tambah” Hub. 0852 7003 9888 / 7630 4788 (AGUSTINA)


- Daihatsu Zebra Prima 21. Thn. 94. W. Abu2 metalic. Hrg. 18.5Jt. - Daihatsu Espass Pick Up Thn. 2001. W. Biru, Metalic. Hrg. 28Jt. Hub. HP. 0813 6105 2828 - 0811 6525 69

ISUZU PANTHER LDX THN. 92. W. Merah. AC Dingin, Tape, CD, Power, VR, BR, Body Kaleng, mulus. H. Nego. Hub. 0813 9754 5210 ISUZU Panther Total Assy Thn. 95, Mulus, Body orisinil, Asli, BK Medan, VR, BR, PS, PW, CL, RTP, AC Dingin, Hrg. 58Jt. Nego. Hub. 0813 7644 7297 ISUZU Panther LV, 2002 Biru Tua metalik. BPKB 1 nama, BK Medan, Pajak panjang. AC, VCD, VR, BR, Siap pakai. Harga Rp. 107Jt. Hub. 0813 9786 4691

ISUZU Panther Tugas Anda Thn. 94/95. AC, Tape, Power Window, Remot Alarm. Mobil Pakai Peredam Dalam Mulus, cantik Luar dalam. H. 43Jt/damai. Hub. Ibu Hajjah Mualimah. (061) 7757 2509 - 0812 6359 9200 Maaf sms TP.

KIA Picanto Sporty Thn. 2005. Biru met. BK Mdn Asli Rp. 92Jt. Hub. 0812 6594 2789

5 CM 6 CM

Rp. 65.000 Rp. 78.000

SUZUKI Katana, Thn. 94, Hitam, mulus, AC, Tape + Power. Central Lock. VR. P. Steering. Hrg. Rp. 43Jt. Hub. 0813 6156 0500 / 061.7365944 (Klinik Mena) SUZUKI Katana Thn. 89, Body Sgt istimewa orisinilnya, barang simpanan, masih mulus dan kilat, sound sistem, RTP dan Power, AC Dingin. Hrg. 35Jt Nego. Hub. 0812 64777 088

SUZUKI Carry M. Bus Th. 85. BK Medan, Kars. Alexander. VR, Tape, W. Biru cantik. RWT BK Aja. Hg. 13,5Jt Nego. Hbs. Hub. 0812 6046 6036 / 0852 6133 7824 Dapatkan Diskon s/d Rp. 18Jt/Hadiah sepeda motor. Ready Stock. New 6 Vitara, APV Arena, SX4, Swift, New Estilo, Carry Pick Up. DP 10% luar kota ok. DP Mulai Rp. 4 Jt-an. Hub. 0812 6570 683

SUZUKI Escudo 2.0 Thn. 2004. Coklat met original. Plat BH Rp. 124Jt. Hub. 0816 3113 953 SUZUKI APV E (baru)....Total DP 40Jt Angs. 3.434.500 x 35

APV L...........Total DP 50Jt angs. 3.337.400 x35 APV X..........Total DP 50Jt angs. 3.774.600 x35 Swift..............Total DP 50Jt angs. 4.252.900x35 Grand Vitara Hub. 0816 3101 455 / (061) 776 12356

SUZUKI AERIO (2005) Kondisi bagus, Km 55.000. Tangan pertama, warna biru mica, harga Rp. 120Juta. Hubungi 0812 6055 088 / 0852 6120 1056 SUZUKI Grand Escudo XL - 7 ‘04. Pajak baru, Lkp TV, Dobel din, kondisi sgt memuaskan. Siap pakai. Harga Nego. Hub. 66900693, 0813 6240 4002. Jl. Setia Budi No. 4246 dkt simp. Psr.3 TOYOTA 100% BARU

TIMOR SOHC ‘97 Sedan Merah, BK Mnt, VR, BR, AC, PW, PS, Mulus, DP 14Jt. Angs. 1,1Jt. Hub. 76700976 / 0813 7588 7306 DIOVER KREDITKAN TOYOTA Soluna ‘02. Biru, D. Taruna FLT ‘05. MB G. Max ‘07. Hub. 0813 9611 5768




1 - 2 %, 1 Jam Cair. Jaminan, SHM, SK Camat, BPKB Mobil, Truk, Kreta dan Juga mobil yang masih kredit. Over Leasing dan Bantu Pelunasan BPKB. Hub. (061) 8445716, 0813 7044 6633 (Heny)


Jaminan Apa Saja, Sertifikat Tanah. Proses Cepat, Syarat Mudah. Hub. 061-8222774, HP. 0816 314 1807


Jaminan BPKB Semua Tahun. Proses Cepat, Syarat Ringan. Hub. (061) 77052032 0815 3476 7327 ANDA BUTUH DANA TUNAI??? Kontan dan Cepat, Jaminan BPKB Mobil Thn. ‘92 Up. Proses Cepat, BPKB Aman, Dana Langsung Cair Hub. Mr. Yan’s: 061-91099966, 0815 34470666


AVANZA, RUSH, INNOVA, FORTUNER, YARIS, VIOS, ALTIS, CAMRY Hub. 0813 7512 7297 - (061) 7795 1428

Jaminan BPKB Spd. Motor, mobil Bunga ringan, data dijmpt. BPKB Aman. Hub. 061-6647 7734 / 0813 9779 1077 (TP)

TOYOTA Corona GL Thn. ‘85 AC, Tape, VR, W. Biru metalik. Kondisi cat, body mulus. Baru Siap cat. Hub. HP. 0819 2175 890


DIJUAL SALAH SATU 1.Toyota Kijang Green Extra Thn. 1995. Long Medan, Asli, warna abu2 Met. sound complit. Mobil sgt cantik terawat Hrg. Nego. 2.Toyota Kijang LGX Diesel. Thn. 1999. Medan asli, ada TV warna coklat susu. Mobil sgt cantik, terawat. Hg. Nego. Hub. 0812 6096 3457 - (061) 77036152

TOYOTA Starlet Kapsul 1,3 SEG. Th. 95. BK Asli Medan. W. Abu2, PS, PW, CL, Remot, AC, TV, CD, Body kaleng, mesin sangat sehat. V. Racing import. Hrg. Bisa Damai. Hub. 0813 7051 3271

TOYOTA Starlet ‘86, 1000cc, BK Mdn. Biru metalik, AC, Tape, VR, BR, Mulus. Ban Baru. Rp. 26Jt/Nego. Hub. 0812 6062 556 TOYOTA Kijang Grand Extra Thn. 94. Warna biru metalic. AC, DVD, VR, PS, SL, PR. Terawat. Siap pakai. Hub. 0813 9724 1789 TOYOTA Kijang Commando Thn. 88 Long. 6 Speed. Cakram Gril depan udh green. AC, VR, BR, Tape. Mdn asli. biru, mls. siap pakai. H. 42Jt. Nego. Hub. 0813 7513 6475


MERCY Tiger Thn. 77 Dijual. W. Hitam. Komplit. Hrg. Rp. 24Juta. Nego. Hub. 0811 600 967

TOYOTA Corolla SE Saloon Thn. 87. Merah, BK Medan 2 nama. CL, BR, AC, Tape. Full Original. Sangat mulus. Hub. 0812 6554 3654

MERCY BOXER 88 (200) BK Asli Medan, Warna putih. Kondisi mulus sekali, original. Hub. 061-9114 5520

Rp. 91.000 Rp. 104.000

TOYOTA Kijang LGX- DSL, ‘01/02, HTM, Mulus, Ban Maxxis, DVD, Bluetoo th, DP 36,5Jt, Angsuran 3,6Jt. Hub. 76700976 / 0813 7588 7306



Bawa Pulang L300 Angs. 3Jt-an. T 120 ss, Colt 110, 125 PS, Pajero Sport, L200,... Serius Hub. (061) 76728071 / 0812 653 3319

7 CM 8 CM

Warna biru metalik. Kondisi sangat mulus. Siap pakai. Full Original. Hub. 0812 6060 6959, 0813 6712 5700 (TP)

MERCY BOXER E 200 THN. 87/88 Mdl MP. EL Sun Roof. Silver. BK Medan Ex Mutasi Rp. 37Jt. Hub. 77863981

- Toyota Kijang Innova Tipe G Thn. 2005. Warna hitam, silver - Bensin - Toyota Kijang LX - Up Thn. 2003 Warna hitam, biru - Bensin - Toyota Kijang LSX Thn. 2000 Warna abu2 metalik - Diesel - Toyota Kijang Super Thn. 1996. Warna hijau metalik - Bensin - Toyota Kijang Pick-Up Thn. 2005 Warna hitam - Daihatsu Taruna CSR Thn. 2000 Warna hitam - Suzuki Katana GX Thn. 2000 Warna Hitam Cash / Kredit - Tukar (+) Hub. Jl. Mustafa Depan Bulog Telp. (061) 6641 366

MAZDA VANTREND 94 BK Asli Medan, warna merah. Kondisi cantik sekali. Hub. 0616878 4368 - 0815 3374 8820

TIMOR SOHC Thn. 97. BK Mdn, Biru met. Lengkap, cat dan mesin mulus. Siap pakai. Hrg. 40Jt Nego. Daihatsu Taft GT 4x4 Th. ‘89. Hijau met. AC, BR, AC, PW, PS, Siap pakai. Hrg. 39Jt Nego. HP. 0811 652 506. Tel. 061.6626705


DIJUAL MURAH Velak 16” + Ban Merk Valken Baru Pake 2 Bulan. Hub. 0812 6519 9971



HONDA Supra X 125, Thn. 2009, Warna hitam, mulus, Km. +/- 7.000. 10.5Jt. Nego. Hub. 0813 706 99990

HONDA Supra Fit New 2006 Dijual. Terawat Dr. Pertama dari baru. Hrg. 7 Jt Hub. 76331741




With GPS Tracking System

Dengan iTrack anda setiap saat dapat mengetahui * Keberadaan Mobil anda * Laju Kecepatan Mobil * Rute Perjalanan * Berbagai Aktifitas Lainnya Hub. Kami:

ITrack Medan

Komp. Asia Mega Mas Blok LL No. 32 Telp. 0813 6075 0388 - 7321 726 - 77872232 Kunjungi Situs kami:


WASPADA Tempat Iklan Anda


9 CM Rp. 126.000 10 CM Rp. 140.000



11 CM Rp. 165.000 12 CM Rp. 180.000

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000






SIGIT. 76547004 - 0812 6067 7344

REPARASI AC, KULKAS, MESIN CUCI Kompor Gas, Dispenser H & C TV, M. Pompa Air Sanyo

Hub. SURYA TEKNIK SERVICE Telp. 66482216 - 0813 7589 8757 Siap Ketempat



AC, KULKAS, M. CUCI, P. CLINER, GENSET AC, 1 Pk, 1,5 Pk, 2 Pk=1,3Jt s/d =1,9Jt. AC Air Cooler= 975rb. Kulkas 1 Pt=450rb s/d =900rb, 2pt=650rb s/d=1,3Jt, K. Mini = 500rb. K. 2 Pt. Jumbo= 2 jt. M. Cuci, 2tb=600rb, 1tb=900rb s/d =1,4jt. P. Cliner = 1,2Jt, Genset, 9000w, 7500W, 1200W=950rb s/d=6000jt.


HP. 0812 6053690



KHUSUS REPARASI / SERVICE Kulkas, M. Cuci, Sanyo air, Dispencer, Bongkar pasang AC Hub. PRATAMA ELECTRIC GARANSI Telp. 7343789

TV, PS, DVD, Handicam, Camera, Proyejtor, Laptop, Fax. TV, LCD, 32” Samsung=4,5Jt - 53” LCD Proyejtion. Toshiba=6Jt, 34” Sony=2,5Jt. 32” M. Bishi=2Jt - 29” Baru / Bekas= 900rb s/d 2,3Jt 14/21 300rb s/d =975rb. DVD=260rb, TV DVD, Vortable = 1,2jt, PS 1=400rb, PS2=1 Jt, Handicam/Camera=500rb, s/d 2,3, Proyejtor Epson=4Jt. Laptop Dual Core =3,5Jt- Fax, dll (Jual/Beli/T.T.) Hub. Senang Hati: 4577146 - 7707 3637.


Jl. Sekip 67 A


ZID AN GAME Jual / Beli Playstation ZIDAN 1, 2 & 3. PSP, TV, HDD, Handy Cam, Laptop, LCD, dll. Hub. 77418902 Jl. AR. Hakim 104 / Sei BT. Hari No. 2. NB: Terima Service PS1, 2 & 3




Masih ada kesempatan berlatih test kami buka: - Super Intensive CPNS, membahas soalsoal test CPNS, dan tip dan trik menjawal soal dengan cepat, tepat dan akurat. Materi lengkap (TPU, TBS, TSK) ‘09, Lama: 1 minggu, jam 15.00, 18.00. BIaya: Rp. 250 Rb. 12 Pertemuan - Try Out CPNS (Minggu 1 Nov. ‘09, 15.00-17.35) - Ada Soal/ Modul CPNS, berisi teori dan soalsoal Prediksi, Pengetahuan Umum + Skolastik NB. - Tutor Kwalitas S1/ S2, berpengalaman/ PNS - Kantor buka jam 14.00, Gratis modul soal & tryout Hubungi: Gratia. Jamin Ginting 303, Pasar Sore P. Bulan (061) 7769.5393/ 0812.6086.9938



Aplikasi Window XP/ Internet................ 200 Rb (2 minggu) Komputer Aplikasi Perkantoran Lengkap350 Rb (1 bulan) Autocad 2D/ 3D/ 3D Max......................... 300 Rb (10 hari) SAP/ EBTAB (Tehnik Sipil)....................... 400 Rb (10 hari) Merakit Komputer/ Lengkap................... 400 Rb (6 hari) Autocad 2D + 3D + 3D Max/ SAP............. 1,2 Jt (4 bulan) Desain Grafis Komplit............................. 500 Rb (1 bulan) Kurikulum Standar Nasional (SKNI)

Daftar langsung belajar, Waktu Bebas, Tanpa batas usia Jl. Sei Batang Hari Ujung 170 Medan Telp. 844.2158 - 844.2159 Website:





Pakaian Wanita dan Tukang jahit bordir, yang berpengalaman yang berminat hub. 0852.7016.6065 0812.6306.2313


CANON 40, 41, 830, 831. HP 21, 22, 60B, 60C, 27, 28, 56, 57 Laserjet. HP 12A, HP 36A, HP 35A, dll. Baru / Bekas Dengan Harga Tinggi Hub. 061-76699002 / 0878 682 44474






BARU GARANSI FULL 1 TAHUN Speek: PIV INTEL 2,9 GHZ M. MEDIA Rp. 2.098.000 Case USB, 512MB, Rp. 1.998.000 PIV INTEL CEL 3,0 GHZ M. MEDIA HD80GB PIV INTEL 3,0 GHZ M. MEDIA Rp. 2.198.000 PIV INTEL DUO CORE 1,8 GHZ M.M Rp. 2.248.000 CD ROOM 52X (Black) Mont ‘15 Dig (Black) PIV INTEL DUO CORE 2.2 GHZ M.M Rp. 2.288.000 PIV INTEL CORE 2 DUO 2.9 GHZM. M Rp. 2.988.000 Key, Mouse, Speaker PLUS BONUS SEKEN GARANSI 1 BULAN PIII - 600 128 MB/6GB/CDROOM/M.M Rp. 898.000 MON 15” DIG PIII - 700 128MB/6GB/CDROOM/M.M Rp. 928.000 CASE USB, PIII - 800 128MB/20GB/CDROOM/M.M Rp. 968.000 KEYBOARD, PIV - 1,7 128MB/20GB/CDROOM/M.M Rp. 1.058.000 MOUSE, PIV - 1,8 128MB/20GB/CDROOM/M.M Rp. 1.098.000 SPEAKER PIV - 2,0 256MB/20GB/CDROOM/M.M Rp. 1.198.000 BARU PIV - 2,4 256MB/20GB/CDROOM/M.M Rp. 1.288.000 MONT 15” 17” FLAT PUTIH/HITAM MULUS (DELL, LG, SAMSUNG) MURAH....

Jl. Karya No. 68 Sei Agul Medan Telp. 061 6639308 - 6620533 HP. 0816 301761 - 0813 70900400 0852 6144 8000 - 061 77009000



MOBIL SEDO T : 77737996 SEDOT WC MAJU JJA AYA : 0852 7093 3649 0819 33 408099: MURAH : GRS. 1 THN.

ADHIKA COMP COMP.. (4150371) Jl. M. IDRIS 23 (77426432)


WC TUMP AT, Sal. AIR, K. Mandi TUMPA Tel. 7878078, 77008458 NARO SERVICE Jl. Sisingamangaraja




Tukang Pangkas, Baru akan buka Jl. Gaperta Ujung, Pangkas RIZKI Hub. 0812.602.4482



Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput



OBRAL PLAYSTATION PS1 Rp. 350rb, PS2 Rp. 750rb, 1 Jt. PS 3 Lkp STIK Wirelles Ori 2 bh Rp. 3,5Jt, PSP Rp. 1,5Jt. Hub. Market Electronic Telp. 8210097, 66900693 Jl. Setia Budi 424b. dkt Simp. Psr. 3




TOKO STAR ELECTRONIC (100% BARU & BERGARANSI RESMI) JL. DENAI NO. 67 ±200M DARI BANK SUMUT TELP. 734.7024/ 7741.7260 DVD MP4.......................... Rp. 200 RB KULKAS LG 1 PT................. Rp. 1.360 RB TV 14”...............................Rp. 450 RB KULKAS LG 2 PT ................ Rp. 1.900 RB TV 21” LG SLIM FLAT......... Rp. 980 RB M. CUCI LG 1 TBG............. Rp. 1.830 RB TV 29” LG SLIM FLAT.......... Rp. 1.900 RB M. CUCI LG 2 TBG............ Rp. 1.260 RB LCD 32” LG....................... Rp. 4.050 RB AC LG 1 PK....................... Rp. 2.300 RB SPEAKER AKTIV 12”........... Rp. 450 RB DVD COMPO LG 30 DISC.. Rp. 1.150 RB

Rabu, 28 Oktober 2009


WC 0812 642 71725 Mobil. Sedot

Jl. Brayan Medan







845.8996 0812.631.6631

Bergaransi/ Setia Luhur 160 F

8442271 0813 7035 7291 Jl. Setia Budi


Hub. 8219951 Jl. Setia Budi No. 2 TUMPAT/PENUH


812.6469 4776 (P AK RIAN) HP. 0812.6469 (PAK Flexi: 061-7673 5534 Garansi


Tenaga Penjahit Busana Wanita / Kebaya, Hub. 0812.6589.1953 Pada jam kerja LOWONGAN KERJA

Dibutuhkan beberapa karyawati penjaga Stand Makanan: - Jujur, Rajin, Rapi, Berpenampilan menarik - Pendidikan/ Pengalaman tidak diutamakan Lamaran ke: S u n P l a z a L a n t a i I V Food cord dan langsung inter viwe hub. 0815.339.0738 sebelumnya


Perusahaan Expedisi Muatan Kapal Laut sedang membutuhkan:


Kriteria: - Pria atau wanita min. 25 thn max. 45 thn - Pendidikan min. D3 - Pengalaman dibidangnya min. 2 thn - Memiliki kendaraan sendiri - Disiplin, jujur, ramah, komunikatif, loyal, rajin & bertanggung jawab Kirim lamaran ke: Komplek Griya Riatur Indah Jl. Krisan Blok E No. 44 Medan Kode pos 20124




Min SLTA, Cpt krj usia max. 35 th Hub Jl. KH. Wahid Hasyim 92 Medan Tp. 4533.875 / 456.9269 Jl. Karya Wisata No. 23A Johor, TP. 786.1690 Medan

DIBUTUHKAN 3 Orang T. Pangkas yg berpengalaman, Jujur & bertanggung jwb, Keterangan lebih lanjut Hub. JHONS PANGKAS Jl. Halat 171-169 Mdn LOWONGAN BUTUH SECEPATNYA

Perusahaan swasta bertaraf INT’L butuh tenaga kerja P/W (17 - 30thn) untuk dposisikan di kantor Syarat: - Pend. Min SMU/ sederajat - Pas photo + Foto copy KTP 2 lembar - Guntingan iklan ini untuk proses intervew Syarat lain bisa menyusul setelah diterima Penghasilan: Rp. 1,5 Jt s/d 3,5 Jt/ bln (Sesuai posisi anda di kantor) HUB. AISYAH/ IBU LINA LUBIS, SE HP. 0812.6388.5458/ 0852.8850.2411 Alamat Kantor: Jl. KH. Wahid Hasyim No. 118A, Simpang Barat, masuk dari Gatot Subroto Medan NB. 5 Pelamar pertama langsung diterima


Kami P L A S A 9 9 Perusahaan yang bergerak di bidang jasa layanan MULTIMEDIA yang sedang berkembang membutuhkan karyawan dengan posisi: A. Marketing Executive (15 Orang) B. Web Design (7 Orang) C. SPG (15 orang) Kualifikasi sebagai berikut: 1. Pria (A, B) Wanita (A, C) 2. Min. D3 T. Komp (B), Sgl Jur (A), SMU Sederajat (C) 3. IPK Min. 2,7 (B), 2,0 (A) 4. Menguasai photoshop, Corel, Flash (B) 5. Menguasai Macromedia (CSS, CMS, Web Programming dengan PHP My SQL) (B) 6. Memiliki SIM C (A) 7. Membawa Softcopy contoh Design Website (B) Lamaran paling lambat 31 Oktober 2009 diantar ke:


Jl. Bono No. 20B (dekat UMSU) Glugur Darat (061) 7643.5007 Atau lihat di dan kirim Via email di Fasilitas: Gaji, Tunjangan Transport, Komisi, THR


Dibutuhkan Tenaga Kerja Indonesia di beberapa Perusahaan Elektronik di Malaysia (COMPANY): 1. KNOWLES ELECTRONICS (M) SDN. BHD di B. Lepas - Penang Pendapatan Minimal sebelum OT/ lembur RM 900 Per bulan 2. FINISAR (M) SDN. BHD di Ipoh Pendapatan minimal sebelum OT/ Lembur RM 839 per bulan 3. MINEBEA ELECTRONICS MOTOR (M) SDN. BHD di Kedah Pendapatan minimal sebelum OT/ Lembur RM 636 per bulan 4. BROTHER INDUSTRIES TECHNOLOGY (M) SDN. BHD di Johor Bahru Pendapatan minimal sebelum OT/ lembur RM 615 per bulan FASILITAS: - Levi Free/ Gratis 100% - WAJIB OT/ LEMBUR 3 JAM PER HARI - Bonus sesuai dengan kriteria kerja - Diasuransikan di Indonesia dan Malaysia - Transport, Uniform, Klinik disediakan - BIAYA BISA POTONG GAJI DI MALAYSIA - Berangkat dengan pesawat terbang DENGAN PERSYARATAN: 1. Wanita usia 18 s/d 30 tahun 2. Pendidikan min. SLTP/ SLTA sederajat 3. Membawa STTB, KTP, KK (asli dan fotocopy) 4. Pas photo 3x4: 2 lembar 5. Mendapat izin keluarga Untuk pendaftaran dan informasi lebih lanjut hubungi:


Jl. Kapt. Muslim No. 68-69A Komp. Ruko Griya Riatur Indah Helvetia Telp. (061) 847.6662 - 847.6663 HP. 0813.9741.4546 (Dekat GRIYA SWALAYAN HELVETIA) SELEKSI SETIAP HARI KERJA


Perusahaan Elektronik UNISEM (M) BERHAD di IPOH, PERAK (COMPANY), membutuhkan 100 Orang Tenaga Kerja PEREMPUAN sebagai OPERATOR FASILITAS: - Gaji Pokok : RM 440/ bulan - Tj. Kedatangan : RM 60/ bulan - Tj. Makan : RM 30/ bulan - Tj. Transport : RM 30/ bulan - Insentif Shift : RM 30/ bulan - Insentif lain-lain : RM 25/ bulan - Tj. Shift Pagi : RM 3/ hari - Tj. Shift Malam : RM 6/ hari - Levy : RM - Kerja 4 hari/ minggu - Pendapatan min. RM 687 (sebelum OT) FASILITAS: - Asrama Gratis - Transport gratis - Seragam disediakan - Klinik disediakan - Asuransi di Indonesia & Malaysia SELEKSI DIADAKAN SETIAP HARI KERJA PUKUL: 09.00 WIB Dengan syarat sbb: - Umur 18 - 30 thn - Pendidikan minimal SLTP - Mendapat izin dari orang tua “BIAYA BISA DIPOTONG SEBAGIAN DI MALAYSIA” “BERANGKAT DENGAN PESAWAT TERBANG” Interview dengan membawa: 1. Copy ijazah, KTP, KK: 2 lbr, 2. Pass photo 3x4: 2 lbr Untuk informasi dan pendaftaran hubungi:


SIPPTKI NO: KEP.310/MEN/IX/2007 Jl. Tengku Amir Hamzah, Komp. Griya Riatur Blok A No. 100 & 102 Medan Helvetia (± 25m dari Simp. Gaperta) Telp. (061) 846.0205 (Tidak dipungut biaya pendaftaran)





RAIH: - UANG - SEPEDA MOTOR - RUMAH - MOBIL - WISATA, DLL PRODUK BERMACAM2 DAN LENGKAP HUB: DEPOT MELAWATI TAMORA Jl. Pahlawan No. 7 Tg. Morawa Medan (Sumatera Utara) Telp/ Fax: (061) 794.7364 HP. 0813.6229.7935 0812.654.8425 0819.601.5795

Harga Ter Murah

Model Terbaru


1. Pemasangan Depot Air Minum Dengan Sistem Filtrasi & Ro

Rp. 22 Jt s/d 38Jt

2. Air Pegunungan 6700 s/d 7000 Liter

Rp. 230.000 / Tangki

Menyediakan Mesin RO dan Yamaha Hubungi: CV. HYDRO UTAMA Jl. Kapt. Muslim No. 53-d Medan Telp. (061) 8457879 / (061) 77839790 HP. 0812 600 5410



TERCECER 1 (Satu) Bundel Surat Tanah No. 593.83/041/0076/009/KM/ 94. atas nama: SUTRISNO. Beralamat Jl. Jermal XIV Lingk. I Kel. Denai. Luas tanah L=7x P14 M (98M). Tercecer antara jalan Panglima Denai, Mandala dan Letda Sujono. TERCECER ! BPKB No. 5612160-B. a/n. Sudaryanto. Jl. Aspol Salembo No. 12 Medan. TERCECER 1 Bh. BPKB BK 2482 DQ. a/n. Sumardi. Jl. Dwikora No. 48 Tj. Rejo. M. Sunggal TERCECER

1 Bh. BPKB BK 4070 DE. a/n. Benny Aminter Siahaan. Gg. Sejarah Lk. III T. Morawa.


1 (Satu) Buah BPKB. Asli STNK BK 5287 UJ. a/n. Kartika Sari. Alamat Jl. Gaperta Gg. Pembangunan No. 5 Medan.

TELAH TERCECER Satu buah BPKB Honda BK 2862 HS an. Deni Ramadhan Dsn. VI DS Firdaus Kec. Sei Rampah Serdang Bedagai. TERCECER / HILANG

1 Bh. STNK Spd. Motor BK 5330 UN. a/n. Dharma Brata. Jl. Antariksa Gg. Pipa IV No. 2 Kesari Medan. NB: Bagi yang menemukan akan diberi hadiah sepantasnya. Hub. 0819 2122 723


1 (Satu) Buah STNK No. Polisi BK 6606 XC. A/n. Tomom Sinaga. Dan SIM C a/n. Erick Sinaga. Tercecer disekitar Jl. Aluminium, Krakatau, Adinegoro Medan. Bagi yang menemukan mohon dikembalikan ke: Bpk. Tomom Sinaga. Jl. Bawang 2 No. 28 P. Simalingkar Medan. HP. 0813 7607 0710 akan diberikan hadiah sepantasnya.

HILANG Surat Penting (Sertifikat Tanah). No. 59. Hilang. Luas Tanah 1 Hektare. Letak Tanah di Dusun Buket Nibong, Gampong (Desa) Buket Jrat Manyang, Kec. Tanah Jambo Aye, Aceh Utara. A/n. Hasbi, Alamat Gampong Matang Teungoh, Kec. Tanah Jambo Aye, Aceh Utara. Kehilangan Tgl. 25 Maret 2009, Pk. 15.00 Wib.


1 Bundel Surat Tanah SK Camat P. Sei Tuan No. 592.2/3255/1998. Tgl. 31/7 1998 a/n. IR Rahmad Musi Siregar Dan Akta Pelepasan Hak Dgn Ganti Rugi a/n. Hardiman Perkasa Alam. Ttg. 07-09-2004 No. 1 dibuat Reno Yanti SH Not. Di D. Serdang. Bagi yang menemukan Hub. HP. 0812 6588 2641

Ekonomi & Bisnis

WASPADA Rabu 28 Oktober 2009


BI Perlonggar Aturan Dukung Industri Kreatif JAKARTA (Antara): Menperin MS Hidayat meminta Bank Indonesia (BI) memperlonggar aturan perbankan dalam penyaluran kredit terkait soal agunan untuk mendukung pengembangan industri kreatif di tanah air. “Industri kreatif terbukti telah menjadi faktor penggerak perekonomian masyarakat yang sangat bernilai,” ujarnya pada pameran produk distro, di plasa Depperin, Jakarta, Selasa (27/10). Dia mengatakan selama ini pengembangan industri

kreatif lebih pesat terhambat oleh masalah permodalan karena industri kreatif sebagian besar tidak memiliki agunan. “Agunan mereka ya otak mereka itu, dan itu tidak bisa menjadi jaminan ke bank. Saya mengharapkan BI bisa melonggarkan aturannya,” ujar Hidayat. Dia menjelaskan ada sejumlah alasan industri kreatif perlu dikembangkan lebih pesat yaitu industri kreatif memiliki kontribusi ekonomi signifikan, dapat menciptakan iklim bisnis positif, memper-

kuat citra dan identitas bangsa, serta merupakan pusat penciptaan inovasi ataupun pembentukan kreativitas. “Nilai ekspor produk kreatif Indonesia tahun lalu mencapai sekitar Rp26 triliun, dan itu akan terus berkembang,” katanya. Hidayat menilai tanpa peranan perbankan laju perkembangan industri kreatif, termasuk produk “clothing” dan distro (“distribution outlet”) yang sebagian besar dikelola wirausaha muda, tidak akan tumbuh dengan pesat.

“Saya berharap produk kreatif seperti clothing dan distro ini kelak bisa diekspor,” ujarnya. Tahun lalu, kata dia, omzet produk distro di Bandung bisa mencapai Rp243 miliar . Industri pakaian dengan merek independen itu telah menyerap sekitar 300 ribu orang dari 400 unit usaha. Ditambahkan Dirjen Industri Kecil dan Menengah (IKM) Depperin Fauzi Aziz, empat industri kreatif yang menjadi tanggung jawab Depperin dalam pembinaannya.

Telkom Resmikan Taman Digital Binjai, Stabat

Waspada/Surya Efendi

UANG RIYAL: Seorang karyawan Bank Mandiri Syariah menunjukkan ratusan lembar uang kertas Riyal Arab Saudi di outlet penukaran uang di Asrama Haji Medan, Selasa (27/10). 1 Riyal sama dengan Rp3.100. Selama musim haji, Asrama Haji Medan membuka outlet penukaran uang riyal oleh Bank BNI, Mandiri Syariah, BRI dan Bank Muamalat.

MEDAN (Waspada): Telkom Kandatel Medan meresmikan dua taman digital di dua kota berbeda, Senin (26/10) yakni Binjai dan Stabat, Sumatera Utara. Di Binjai, Taman Digital di Lapangan Merdeka, Binjai itu diresmikan Wakil Walikota Anhar A, Monel. Sedangkan di Stabat, taman digital diresmikan Sekda Langkat Surya Djahisa. Bersama kegiatan itu juga berlangsung kegiatan lomba pembuatan blog puluhan siswa SMA/ SMK di Binjai dan Langkat. Pemerintah Kota Binjai dan PT Telkom Kandatel Medan menjalin kerjasama dalam pengembangan infrastruktur ICT (information, communication & technology). Pengembangan infrastruktur yang dilakukan menyediakan ”taman digital” di kawasan alun-alun Kota Binjai. Diharapkan taman digital ini akan menjadi taman yang sehat dan mencerdaskan, kata wakil walikota. Wakil Walikota Binjai Ahnar A. Morel mengatakan kerjasama dan komitmen yang dibangun Telkom dan Pemko sangat strategis dalam mencerdaskan anak bangsa. Dia

menagatakan perkembangan ICT sebuah perkembangan peradaban yang sangat dahsyat. Dengan teknologi dunia terasa demikian dekat, tidak berjarak dan nyaris tanpa rahasia. Sementara itu Sekda Langkat Surya Djahisa mengatakan perkembangan teknologi ICT saat ini menjadi kata kunci bagi peradakan masa depan. Untuk itulah, atas nama pemerintah kota Binjai, menyambut gembira atas sinergi yang dilakukan PT Telkom dengan Pemkab Langkat dalam melengkapi infrastruktur lewat taman digital di kabupaten itu. Bupati juga menyambut baik, tawaran yang disampaikan GM Telkom untuk pengembangan Taman Digital di kota lainnya, seperti Kuala, Tanjung Pura, Pangkalan Susu dan Pangkalan Brandan. GM Telkom Medan Overlis mengatakan perkembangan ICT secara global seharusnyalah disikapi dengan mengembangkan infrastruktur di daerah. Untuk itulah, Telkom menggunakan sebuah kawasan yang sangat strategis, yakni taman kota atau alun-alun Kota Binjai dengan melengkapi-

nya fasilitas internet. Diharapkannya, dengan infrastruktur ini dapat menjadi media mencerdaskan masyarakat. Overlis menambahkan Telkom Kandatel Medan sudah membangun tiga taman digital, di Medan diberi nama taman digital Ahmad Yani, kemudian taman digital Binjai (Kota Binjai) dan taman digital Stabat (Langkat). Selain Taman Digital, Telkom juga mengembangkan beberapa layanan publik lainnya. Usai peresemian Overlis langsung menyerahkan pengelolaan taman digital Binjai kepada Pemko melalui Walikota Binjai. Selanjutnya pengoperasian dan pengelolaan taman itu dilakukan Pemko Binjai sedangkan Tel-



TANAH Dijual Jl. Dahlia I Komp. Pemda TK I/ B. Sumut Tj. Sari Medan, Uk. 5x20m, SHM Hub. (061) 7785.4238/ 0888.780.0011




Informasi Pembaca Bursa Property

GR : Garasi KM : Kamar Mandi KP : Kamar Pembantu KT : Kamar Tidur SHM: Sertifikat Hak Milik


: Luas Bangunan : Luas Tanah : Ruang Makan : Ruang Tamu


Jl. Mongonsidi I No. 17 Mdn, LT. 301m2, SHM Hub. (061) 7785.4238 - 0888.780.0011


Di Griya Riatur Blok A Jl. Kapten Muslim No. 87 Hub. (061) 9114.5520


Di Pasar Petisah Tahap II Blok D (Lokasi sudut), Menghadap jalan Rotan Baru), Kios sudah di renovasi habis-habisan Harga nego Hub. 0819.846.900 - (061) 3009.9905


Jl. Jamin Ginting Km. 14 Simp. Gardu ±800m Homix Hanya DP 5 Jt, Langsung KPR Bank Harga mulai 75 Jutaan (Harga promosi) Utk Type 36 Plus & Type 45 Harga akan segera naik....!!!!

Hotline: (061) 7665.9000 0812.6579.9000

Jl. Puri 223 Medan (Warnet Puribunda) Plus 4 Rumah Kontrakkan Uk. 13,5x31mtr Hub. 0813.9653.0166 0812.7445.1666 (Harga nego)

DIJUAL CEPAT 1 Unit Rumah Kondisi 90% Selesai. Jl. Eka Suka Depan Gang Eka Suka 9 Gedung Johor. Ukuran tanah 15 x 24 M2. Ukuran rumah 12 x 16 M2. Kamar 4 buah, Garasi 1 buah, SHM, IMB. Hub.0878.6829.4842


Jl. Setia Luhur Gg. Langsat 187C (dekat outer Ringroad), LT/ LB. 198/ 130m², SHM, 5 KT, 3 KM, Gudang, Dapur, Garasi, Kitchen set, 2 AC, Full keramik, Khusus Muslim Hub. (061) 7704.6454/ 0813.604.1357

RUMAH DIJUAL CEPAT Jl. Setia Budi/ Jl. Mesjid Komp. Kyoto Blok C 6 Harga nego B.U Hub. 0813.7563.2174

RUMAH DIJUAL CEPAT Jl. Garu VI Gg. Cendarawih No. 32/ SP Medan Amplas, 2 Tkt, KT 3, KM 2 Harga Rp. 120 Jt/nego B.U Hub. 0813.7563.2174

RUMAH & TANAH DIJUAL LT. 1528m², LB. ±200m Jl. Tamrin, L. Pakam Kota Hub. 0812.650.3242


Jl. SM. Raja/ Bajak 2 H, Perumahan Villa di Mutiara Blok BG Type 55 Sudah renovasi + Kel. Tanah Luas 149m² Hub. 0813.7053.8715



kom memberikan support dalam pemeliharaan akseds hotspotnya. Suasana peresmin Taman Digital Binjai dan Stabat ditandai dengan berlangsungnya lomba blog antar pelajar SMA/SMK yang ada di kota itu. Seperti harapan GM Telkom Medan, kehadiran Taman Digital itu dapat memberikan ruh pada proses pencerdasan anak bangsa. Dengan internet maka banyak hal yang dapat dilakukan. Berbagai informasi global dapat diperoleh dengan cepat di sini. Antusiasme pelajar kota Binjai dan Stabat dengan hadirnya hampir seratusan pelajar. (a01)


TAMAN DIGITAL: Suasana peresmian taman digital di Binjai.

Sergai Fasilitasi Bantuan Mesin Produk UMKM SEI RAMPAH (Waspada): Untuk meningkatkan mutu produk Usaha Mikro Kecil dan Menengah (UMKM) termasuk bentuk kemasan menarik dan berkualitas, Dewan Kerajinan Nasional Daerah (Dekranasda) Kabupaten Serdang Bedagai yang dipimpin Evi Diana Erry Nuradi memfasilitasi terwujudnya pengadaan mesin kemasan (packaging) yang akan diperuntukan bagi pelaku UMKM Sergai. Mesin kemasan otomatis saat ini sudah disediakan Pemkab Sergai dan dapat dimanfaatkan pelaku UMKM di Sergai terutama yang berdomisili di Pasar Bengkel, Kecamatan Perbaungan yang terkenal sebagai salah satu kawasan produksi Industri Rumah Tangga Pangan (IRTM) dan banyak dikunjungi konsumen. Mesin kemasan dengan teknologi terkini diopera-

sikan di kantor Dinas Perindagkop Sergai di Desa Pasar Bengkel itu telah diperkenalkan dan disosialisasikan kepada ratusan pelaku UMKM Sergai dalam satu acara khusus di ruang pertemuan/aula Dinas Perindagkop Sergai, Jumat (23/10). Selain pelaku UMKM, hadir dalam kesempatan sosialisasi itu Bupati Sergai HT Erry Nuradi, Ketua Dekranasda Sergai Evi Diana Erry Nuradi, Sekdakab Sergai Haris Fadillah, Ketua Forda UKM Sergai M Yusuf, pejabat Dinas Perindagkop dan Uspika Kecamatan Perbaungan. Ketua Dekranasda Sergai di sela-sela acara sosialisasi mesin packaging itu dalam sambutannya mengatakan, untuk memajukan UMKM yang ada di Sergai, pihak Dekranasda bekerjasama dengan Dinas Perindagkop secara terus-menerus memberikan bantuan kepada pelaku


Daerah Kowilhan Namurambe, SK Camat 1. Jl. Madrasah Uk. 14x19m, Harga RP. 40 Jt 2. Jl. Pertanian Uk. 11x17m, Harga Rp. 20 Jt Yang berminat hubungi: (061) 7663.9199 - 0813.9719.9199





Ukuran 30x15m, Jalan Bunga Rinte, Simpang Selayang Padang Bulan HP. 0813.6172.3497



HUB: SIAR TOUR (HOTEL GARUDA PLAZA) TELP. 732.3519/ 736.7132/ 732.3524 CONTACT PERSON: 0811.649.262 - 0812.606.4373 0812.609.4090

Sebidang Tanah Kebun, Seluas 18 Ha, terletak di Desa Hutaraja/ Rainate I Kec. Batang Toru Tapsel Hub. 0811.6022.006 0812.6000.8332


WASPADA Media yang Tepat untuk Iklan Anda




Jl. Laksana No. 33 O HP. 0813.7087.8289

Hub. (061) 9122.4332


Anda Butuh Perabot Jepara Asli?

AMANDA TELP. (061) 9135.7070


(6 orang) dan Lemari hias, 5 Pintu Kayu jati ukir jepara, Mau pindah rumah, Harga Rp. 8 Jt

MENJUAL PECI TEMPAHAN Berbagai Model Dan Warna Jl. Prof. H.M. Yamin SH. No. 340 / Jl. Serdang Depan Gg. Sadu Medan



Women Lifestyle

Hubungi: Jl. Bilal No. 90 P. Brayan Medan Telephone Toko : 661.6285 Rumah : 661.1540 Fax : 661.6285 (061) Jl. K.L. Yos Sudarso depan SMA Negeri 1 Tebing Tinggi Telp. (0621) 24243


Hubungi: IBU TINI HP. 0852 7524 0184 Jl. Seser No. 65 dari Jl. Suluh depan Kantor Gubernur Pancing/ Willem Iskandar






SUDAH KEMANA-MANA Tidak Sembuh? Jangan Putus Asa

Kelumpuhan/ Stroke, Pinggang, Syaraf terjepit, Pengapuran, Kaki tangan lutut linu & nyeri, Sulit jongkok - bangun, Diabetes, Asam urat, Rematik, L. Syahwat, dll (Reaksi langsung ringan)

Hub. SIN SHE Spesialis Syaraf & Otot Jl. Imam Bonjol No. 46 Telp. (061) 415.5432 Flex. 7750.6827













Melayani: 1. TIKET MURAH: MEDAN JAKARTA - BATAM - PENANG, DLL (TIKET DAPAT DIANTAR LANGSUNG KE ALAMAT) 2. UMROH MURAH & HAJI PLUS (KHUSUS) 3. MANASIK HAJI Hubungi: TIKET : (061) 456.7532/ 0812.6302.6293 UMROH & HAJI : (061) 457.6116 (061) 7731.3385 0813.6137.2321 / 0812.656.6807

Dapat mengobati segala macam penyakit: - Gula - Pinggang/ Ginjal - Angin duduk - Lemah syahwat/ - Belum mendapat Impoten keturunan




berupa bantuan modal kerja secara bergulir, bantuan peralatan/mesin industri kecil dan pembinaan dalam bidang manajemen usaha. Salah satu upaya dalam meningkatkan pemasaran hasil produk UMKM Sergai dan mampu bersaing dengan produk UMKM daerah lainnya, maka Pemkab Sergai bekerjasama dengan Dekranasda Sergai sepakat mengadakan mesin kemasan dapat dimanfaatkan pelaku UMKM untuk mengkemas barang hasil industri masyarakat. Melalui kemasan yang menarik, produk pangan olahan UMKM yang higienis maka diharapkan ke depan pihak konsumen akan lebih tertarik lagi untuk membeli produk hasil buatan masyarakat Sergai, ujarnya. Namun demikian, Bupati berharap produsen terutama pedagang yang ada di kawasan Jalinsum Desa Bengkel, Kecamatan Perbaungan.(a07) PENGOBATAN KUSUK TERAPI TRADISIONAL



Hub. (061) 7790.7140, TP

Sertifikat, Luas Tanah ± 700m Luas Bangunan ± 180m Lokasi: Jl. Sempurna No. 107 Belakang UISU Medan Hubungi: M. Simatupang, BA (TP) HP. 0812.6460.3976 Telp. Rmh 786.9807

Ingin Promosikan Produk Anda Harian

JL. LAKSANA NO. 62 HP. 0813.9611.3753

Tanah 16x25 Lokasi Desa Kolam Kec. Percut Sei Tuan, SK Camat


UMKM baik permodalan, pelatihan, pemasaran hasil produksi termasuk pengadaan mesin kemasan. Salah satu unsur pendukung dalam bidang pemasaran menurut Evi Diana Erry adalah kemasan produk pangan yang dipasarkan karena kemasan (packaging) memiliki beberapa fungsi diantaranya sebagai alat perlindungan terhadap barang, sebagai alat promosi dan media informasi. Sedangkan Bupati Sergai Erry Nuradi dalam kesempatan sama mengatakan Pemkab terus berupaya memajukan pelaku UMKM di Sergai di berbagai sektor usaha karena salahsatu prioritas program pembangunan ekonomi ditujukan untuk mengembangkan UMKM baik kuantitas maupun kualitas. Program bantuan yang telah dan akan diberikan kepada pelaku UMKM di Sergai menurut Bupati Erry Nuradi yaitu


Metode ini dengan cara di totok di bagian syarat2 penyakitnya yang lemah dan pengobatan ini di Trapi langsung dlm waktu 30 mnt stlh itu diberikan ramu2an alami dan terjamin, tanpa efek samping dan bisa menyembuhkan berbagai penyakit yg dideritanya 100% obat alami, bebas semua Agama *MENGOBATI LAKI-LAKI Impotensi Kurang Keras/ Loyo + Ukuran Panjang - 11 - 12 - 13 - 14 - 15 - 16 - 17 - 18 + Besar 4 - 4 - 5 - 5 - 6 Lemah Syahwat/ Ejakulasi MAHAR Tahan Lama Diabetes/ Gula 600.000 Hernia/ Bro Alamat Praktek Jl. SM. Raja depan Garuda Plaza masuk Gg. Keluarga Belok Kiri No. 4

HP. 0812.6057.6444

Ingin Promosikan Produk Anda Harian

WASPADA Media yang Tepat untuk Iklan Anda


Hub. MBAK DINA 0812.6499.1979 Bersedia dipanggil ditempat


PERABOT TEMPAHAN MURAH -Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan -Kursi Sofa Kulit 3 ,2 1 pakai Spring Rp. 1.300.000 Hub Telp. (061) 6618116 - 6616802

SPRING BED DIJUAL MURAH Spring Bed 6 kaki 2 lapis Spring Bed 5 kaki 2 lapis Spring Bed 4 kaki 2 lapis Spring Bed 3 kaki 2 lapis Spring Bed 3 kaki Dorong

Rp. 1.100.000 Rp. 1.075.000 Rp. 1.000.000 Rp. 900.000 Rp. 1.000.000

Garansi Per 10 tahun Hub. 061-661.8116 - 661.6802


1. Ajian Prabu Sliwangi, Kekebalan, T. Dalam, Hipnotis, Silat Ghaib 2. Susuk Sekar Mayang, Penunduk, Pengeretan, Daya tarik, Iner biuti 3. Pelat, pelaris usaha, buka aura, Masalah RT, Seret rezeki, Pesugian, Khodam pendamping, Bekam Tanduk, Alat Vital, Tdk punya keturunan

Hub Jl. Sentosa Lama Gg. Keluarga No. 11 081397317485 - (061) 77046185


Jangan Lewatkan Interaktif langsung dengan PASAK BUMI di DELI TV Tgl. 5 September ‘09 Pkl. 22.30 Wib (Live)

Call Center: 0818 090 73481

Ekonomi & Bisnis Harga Bahan Pokok Masih Stabil


WASPADA Rabu 28 Oktober 2009

MEDAN (Waspada): Distribusi bahan kebutuhan pokok seperti beras, gula pasir, minyak goreng dan tepung terigu serta lainnya disaat seringnya turun hujan tidak mengalami gangguan, sehingga harga pasar masih stabil. Pantauan Waspada di Pusat Pasar, Petisah, Aksara, Lalang dan Sikambing, Selasa (27/10), harga sejumlah bahan kebutuhan pokok sehari-hari seperti minyak goreng masih stabil serta tidak mengalami ganggua pasokan karena distribusi lancar. Harga minyak goreng dijual Rp7.500 per kg, gula pasir

Rp9.500 per kg, beras IR 64 kualitas I Rp6.000 per kg, tepung trigu Rp6.000 per kg. Menurut Dahlan, pedagang bahan pokok di Pasar Petisah Medan, hingga akhir Oktober pasokan bahan pokok ke para pedagang pengecer di pasar tradisional masih tetap lancar dan tidak mengalami gangguan distribusi. Kondisi tersebut didukung menurunnya konsumsi masyarakat diantaranya pedagang makanan olahan industri kecil usai lebaran, sementara itu konsumsi akan meningkat pada awal tahun, ujarnya. Sementara itu, menurut

Hendra, salah seorang distributor beras di Jalan Gunung Sibayak, pasokan beras dari kilang padi berbagai daerah sentra produksi beras di Sumut ke Medan masih berjalan lancar. Kondisi cuaca yang biasanya menghambat proses penggilingan yakni terkendalanya penjemuran gabah belum menjadi hambatan yang berarti terhadap produksi beras dihasilkan pengusaha kilang, sebutnya. Pihaknya mengharapkan kondisi tersebut dapat berlangsung hingga menjelang Februari, yakni saat tibanya masa panen petani disebagain besar

daerah kabupaten, sedangkan saat ini sebagian besar memasuki masa tanam, urainya. Dalam kesempatan itu, Hendra menyebutkan ratarata per bulan kilang padi masih sanggup memasok 50 ton beras ke distributor untuk disalurkan ke Medan dan berbagai daerah lainnya, sementara itu stok beras di pasaran saat ini masih cukup, katanya. Di samping itu pasokan beras dari Provinsi Aceh ke Medan masih berjalan lancar, sehingga belum ada kekhawatiran terjadinya kenaikan harga beras seperti terjadi akhir tahun sebelumnya, paparnya.(m40)

Harga Emas Lokal Berfluktuasi Waspada/Armin Nasution

KESEPAKATAN: M. Amin Lubis (paling kanan) menyaksikan Sukardi, direktur utama Fasbiru, Selasa (27/10), menandatangani nota kesepakatan. Hadir juga di situ Usman Lubis, direktur utama BMS (dua kiri) dan Kaswinata (paling kiri)

Bank Sumut Syariah Targetkan KPR Tak Terbatas MEDAN (Waspada): Bank Sumut cabang Syariah Medan menargetkan untuk melakukan pembiayaan kredit pemilikan rumah tak terbatas hingga tahun ini. “Pokoknya sebanyak-banyaknya kita biaya,” kata pemimpin cabang Bank Sumut cabang Syariah Medan. M. Amin Lubis, pemimpin cabang Bank Sumut Syariah Medan berbicara kepada wartawan di sela-sela penadatanganan kesepakatan pembiayaan perumahan antara bank itu dengan dua pengembang yaitu Bersama Mandiri Sejahtera (BMS) dan Fasbiru. Hadir di situ Kaswinata, pemimpin bidang Pembiayaan Dana Jasa Bank Sumut, Usman Hasibuan, direktur utama PT BMS, Sukardi, direktur utama Fasbiru dan notaris Ernawati Lubis. Menurut Amin, kerjasama ini merupakan salah satu pendorong agar pengembang lain bisa bekerja sama. “Banyak kemudahan yang kita berikan

jika mengikat akad dengan syariah,” jelasnya. Dia mengatakan berapa pun permintaan pasar akan dilayani. Amin menegaskan sekarang Bank Sumut Syariah sudah melakukan pembiayaan untuk rumah bersubsidi atas kerjasama Dekopin dan Perumnas yang berlokasi di Martubung. “Itu jumlahnya sekira 150 rumah. Sampai akhir tahun jika realisasi kerjasama lancar kita akan membiayai sekira 300 rumah kelas menengah ke atas,” ungkapnya. Amin mengungkapkan dalam pembiayaan perumahan ini persyaratan administrasi lebih simpel. “Begitu pula dengan margin. Karena kita menggunakan margin paling rendah hanya sekira 9,37 persen flat,” tegasnya. Dia mengatakan sejak nasabah akad sampai rumah selesai cicilan sama saja. “Sistem seperti ini sesuai untuk pembiayaan masyarakat berpendapatan tetap atau

karyawan yang menerima gaji,” tegasnya. Amin mengatakan KPR ini boleh diakses perorangan maupun developer. Di kawasan Martubung, kata dia, umumnya untuk perorangan dengan gaji Rp1,5 juta sebulan. Sementara Usman Hasibuan yang memiliki proyek perumahan di Budi Luhur mengatakan ada sekira 30 unit rumah dengan harga Rp300 juta dengan tipe 100 dan 125. Masuknya Bank Sumut Syariah ke bisnis KPR semakin memudahkan pengembang. “Kita harapkan proses pembiayaan semakin cepat. Sebab kalau perbankan tidak support pengembang kewalahan,” tegasnya. Dia mengaku bangga dengan KPR Bank Sumut Syariah sebagai bank-nya orang Sumut. Sementara Sukardi mengatakan dari tiga proyeknya Griya Raihan, Citra Seroja dan Puri Zahara mengarahkan semua konsumen yang mau membeli rumah ke bank

Penerbitan Surat Utang AS Tak Ganggu Rupiah JAKARTA (Antara): Ekonom Standard Charthered Bank, Fauzi Ikhsan mengatakan, penerbitan surat utang oleh pemerintah AS pada tahun depan tidak akan mengganggu stabilitas nilai tukar rupiah. “Penerbitan surat utang Pemerintah AS tidak akan mengganggu stabilitas rupiah, saya kira tidak akan ada ‘crowding out’ (dolar keluar dengan besar-besaran) ke AS,” katanya, Selasa (27/10). Hal ini, menurut dia, karena saat ini dana yang menganggur masih sangat besar. Ia mengatakan, diperkirakan, dana menganggur ini mencapai 20 triliun dolar AS. Menurut dia, dana-dana menganggur ini siap mencari tempat yang paling menguntungkan. Ia mengatakan, Indonesia merupakan salah satu tempat dinilai masih sangat menguntungkan. Hal ini karena selain ekonomi Indonesia memiliki daya tahan terhadap krisis yang lebih kuat, juga menawarkan yield (bunga bagi hasil) yang tinggi. “AS tahun depan kita perkirakan masih mempertahankan suku bunganya 0-0,25 persen. Bunga obliglasinya jadi sekitar 2,5 persen. Indonesia saat ini saja bunga yieldnya mencapai 8,5-9 persen, jadi Indonesia masih menguntungkan,” katanya. Dia menambahkan, untuk itu, pada 2010 rupiah diperkirakan akan tetap stabil di level

Rp9.000an. Ia mengatakan, rupiah akan berada pada level rata-rata Rp9.200 per dolar AS pada tahun ini dan stabil hingga akhir 2010 yang diperkirakan Rp9.100 per dolar AS. Sementara itu, beberapa negara seperti Inggris, Perancis, Jerman, dan Amerika Serikat berencana menerbitkan surat utang sebagai salahsatu

sumber pendanaan fiskal masing-masing negara. AS misalnya, dipastikan bakal menerbitkan surat utang sekurangnya 1 triliun dolar AS pada tahun depan. Sedangkan Indonesia, juga berencana menerbitkan surat utang senilai Rp116 triliun. Rinciannya, Rp9 triliun obligasi berdenominasi valuta asing dan berdenomi-

syariah. “Termasuk ke Bank Sumut ini. Griya Raihan itu 150 rumah, Citra Seroja 100 dan Puri Zahara 235 unit. Semua sudah terjual 80 persen dengan proses pembiayaan di bank syariah,” tegasnya. Menurut Sukardi, urusan di bank syariah seperti Bank Sumut lebih gampang. “Kita harus angkat terus bisnis syariah. Saya selalu tertarik menggunakan fasilitas yang ada sehingga mendorong semua konsumen ke bank syariah,” ungkapnya. Dia mengatakan harusnya bank syariah juga mempercepat langkah menangkap peluang pasar agar jangan mengecewakan. Amin Lubis menambahkan di Bank Sumut Syariah mereka sudah menyiapkan layanan maksimal. “Paling lama dua minggu sudah selesai. Itu paling la-ma. Tergantung syarat dan kelengkapan administrasi pembeli rumah,” ujarnya.-(m13)

nasi rupiah Rp107 triliun. Saat ini, Selasa, rupiah di pasar spot antar-bank, telah menembus Rp9.500, meningkat hingga Rp125 per dolar AS. Nilai tukar rupiah terhadap dolar AS merosot tajam menjadi Rp9.555-Rp9.565 per dolar dibanding penutupan hari sebelumnya Rp9.430-Rp9.445 atau turun 125 poin.

Harga Emas Di Medan Jenis



London Murni London 24 Karat Emas Putih 22 Karat Suasa

99% 97% 90 s/d 93% 75 % 70% 20 s/d 35%

Rp320.000 Rp290.000 Rp260.000 Rp230.000 Rp165.000 Rp100.500

ngan fasilitas elektronik disebut sistem administrasi badan hukum ini, pemerintah akan melakukan beberapa program seperti pembuatan iklan dan brosur elektronik. Selain itu, pembuatan situs yang menyediakan dokumen standar untuk pedaftaran badan hukum perusahaan oleh masyarakat. “Dalam situs ini, kami menyediakan dokumen standar untuk badan hukum. Dulu pelayanan masih menggunakan notaris, sekarang bisa diakses melalui online,” ujar Aidir. Layanan online Aidir menyatakan, dengan layanan online ini, pemerintah akan mendaftar nama-nama persusahaan yang sudah berbadan hukum. Selain itu, pemerintah akan memberlakukan sistem pembayaran elektronik melalui bank pemerintah untuk mempermudah

sional di level 900 dolar AS per ounce. Jika rupiah anjlok hingga mencapai Rp11 per dolar AS ditengah harga pasaran diatas 1000 dolar AS per ounce, kenaikan harga emas lokal tidak akan tertahankan lagi bahkan dapat melampaui kenaikan tertinggi yang terjadi Februari lalu. Rizal, pedagang emas Singgalang Indah, Selasa (27/ 10), mengatakan harga emas awal pekan ini turun dari Rp320 ribu per gram menjadi Rp318 ribu per gram, namun fluktuasi tersebut belum mampu mendorong minat masyarakat membeli emas perhiasan. Sementara itu di tengah menurunnya transaksi emas di perdagangan lokal, tingkat penjualan emas milik masyarakat ke pedagang meningkat tajam menjadi 70 persen dibanding beli yang hanya berkisar 30 persen, sebutnya. Turunya harga pasaran internasional menjadi 1.040 dolar AS per ounce belum mampu mendorong optimisme pengusaha emas lokal karena harga tersebut berada di level tertinggi ditengah rentannya

nilai tukar rupiah terhadap dolar AS, ujarnya. Pihaknya juga mengkhawatirkan harga emas akan kembali melonjak ke level tertinggi

pembayaran pembayaran dalam proses administrasi pembuatan badan hukum. Dalam proses realisasi reformasi birokrasi untuk sistem pendaftaran usaha badan hukum, pemerintah mendapat bantuan dari Investment Climate Advisory Services salah satu program dibiayai dari Kelompok Bank Dunia (IFC, MIGA, dan Bank Dunia) serta lebih dari 15 mitra donor yang bekerja sama melalui organisasi multidonor FIAS. Program ini untuk membantu pemerintah negaranegara di Asia Timur dan Pasifik untuk mengimplementasikan reformasi guna meningkatkan kualitas iklim usaha, serta mendorong dan menarik investasi yang dapat mendorong terciptanya pasar yang kompetitif, pertumbuhan ekonomi, dan peluang kerja.(dtc)

Valuta Asing Di Medan Mata Uang



Dolar AS Dolar Australia Franc Swiss Poundsterling Inggris Dolar Hongkong Yen Jepang Dolar Singapura Euro Ringgit Malaysia

9.560 8.860 9.566 15.587 1.271 105,11 6.884 14.369 2.690

9.340 8.815 9.162 15.147 1.170 100,50 6.649 13.955 2.640

jika nilai tukar rupiah merosot tajam sehubungan membaiknya perekonomian internasional di akhir tahun, terangnya kepada wartawan.(m40)

Bunga Kredit Terus Turun Tapi Sedikit JAKARTA (Waspada): Beberapa bank sudah mulai menurunkan tingkat suku bunga kreditnya. Walaupun penurunan tersebut cenderung lambat, penurunan suku bunga ini diharapkan dapat menopang pertumbuhan kredit hingga akhir tahun 2009. Wakil Direktur Utama PT Bank Central Asia Tbk (BCA) Jahja Setiaadmadja mengatakan saat ini suku bunga kredit BCA per Oktober 2009 sudah turun sebesar 1 bps dari bulan Agustus 2009 sebesar 13 persen. “Saat ini bunga kredit sudah turun disekitar 12 persen,” ujar Jahja kepada di Jakarta, Senin (26/10) malam. Jahja juga mengatakan untuk suku bunga Kredit Kepemilikan Rumah (KPR) saat ini berada di posisi 9,9 persen dan Kredit Kendaraan Bermotor (KKB) diposisi 5,3 persen (flat). Sejak Februari 2009, sambung Jahja, suku bunga kredit terus turun dari 15 persen. Dengan adanya penurunan ini BCA sampai dengan bulan Oktober 2009 telah menurunkan tingkat bunga kreditnya sebesar 300 bps. Senada dengan Jahja, Direktur Utama PT Bank Mandiri Tbk (Mandiri) Agus Martowardoyo mengatakan suku bunga kreditnya sudah turun sampai dengan 50 bps. “Penurunan terakhir tersebut akan berlaku efektif pada 1 November 2009,” ujar Agus. (dtc)

Medan Green And Clean

Dewi Teruna Jasa Said saat memperagakan cara pengolahan sampah kering kepada para Koppling dan membuktikan sampah dapat memiliki suatu nilai jual sehingga memiliki nilai ekonomi.

Dewi Teruna Jasa Said saat memberikan arahan kepada Koppling kelurahan Sei Kera Hilir 1 selepas serapan pagi bersama yang berharap semoga Koppling tersebut dapat menjadi contoh yang positif terhadap lingkungan.

Dua Daerah Percontohan Fokus Kebersihan, Penghijauan

Pembentukan Badan Usaha Dipermudah JAKARTA (Waspada): Persyaratan yang sulit dan waktu lama menjadi kendala tersendiri dalam pembentukan badan usaha untuk memulai usaha di Indonesia, dan ini menjadi penghambat pertumbuhan kewirausahaan di sektor formal. Karena itu pemerintah melalui Departemen Hukum dan Hak Asasi Manusia akan merealisasikan layanan pendaftaran usaha secara online, sehingga lebih cepat. Demikian disampaikan oleh Direktur Direktorat Jenderal Administrasi Hukum Umum Departemen Hukum dan Hak Asasi Manusia Aidir Amir Daud “Pemerintah sudah menggunakan internet sebagai egovernment . Untuk mempercepat pelayanan publik tapi tetap akuntabel,” papar Aidir, Selasa (27/10). Aidir menambahkan de-

MEDAN (Waspada): Harga emas kualitas 99,99 persen awal pekan ini mulai berfluktuasi dari Rp320 ribu per gram pada penutupan perdagangan pekan lalu menjadi Rp318 ribu per gram di tengah melemahnya rupiah terhadap dolar AS awal pekan ini. Perkiraan beberapa pedagang emas di Pusat Pasar dan Pasar Petisah Medan, Selasa (27/10), harga emas di perdagangan lokal dipengaruhi pasaran internasional yang mersosot dari 1.064 dolar AS per ounce menjadi 1.040 dolar AS per ounce. Namun turunnya harga emas di pasaran lokal tersebut melawan arus pelemahan nilai tukar rupiah yang merosot ke Rp9.550 per dolar AS, sehingga dikhawatirkan harga emas lokal seperti saat ini tidak akan bertahan lama. Harga emas diperkirakan dapat melambung hingga Rp400 ribu per gram jika nilai rupiah tidak dapat stabil di level Rp9.000-an, harga emas lokal pernah mencapai Rp380 ribu per gram Februari lalu saat pasaran interna-

PROGRAM lingkungan percontohan yang diselenggarakan Badan Lingkungan Hidup Pemko Medan yakni di kelurahan Sei Kera Hilir I dan Kelurahan Bantan. Program ini lebih menekankan kepada pembenahan lingkungan baik dari aspek kebersihan dan penghijauan dan juga pembentukan komunitas pemuda peduli lingkungan yang akan bertanggung jawab penuh terhadap lingkungan sekitarnya. Seperti yang dilakukan fasilitator dari Sei Kera Hilir Abdul Khalik yang telah membentuk Koppling di lingkungannya yang mana pada saat itu dibina langsung Dewi Budiati Teruna Jasa Said selaku aktifis lingkungan dengan memberikan pengetahuan dan arahan tentang pengolahan sampah tepat guna yakni dengan metode pilah tanam (Pita). Dewi berharap semoga ilmu-ilmu yang diajarkan kepada Koppling tersebut dapat diterapkan dan ditularkan kepada Koppling lainya.

Sistem pelubangan resapan air (biopori) selain berfungsi untuk mengurangi intensitas air juga dapat dimanfaatkan untuk menanam sampah basah untuk dijadikan kompos.

Sumatera Utara

WASPADA Rabu 28 Oktober 2009

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane

Zhuhur 12:11 12:25 12:12 12:19 12:19 12:15 12:12 12:08 12:14

‘Ashar 15:30 15:44 15:31 15:39 15:38 15:33 15:31 15:27 15:34

Magrib 18:12 18:24 18:13 18:19 18:19 18:18 18:14 18:09 18:16



Shubuh Syuruq


19:22 20:34 19:23 19:28 19:28 19:28 19:23 19:19 19:25

04:42 04:57 04:43 04:51 04:51 04:45 04:43 04:38 04:45

04:52 05:07 04:53 05:01 05:01 04:55 04:53 04:48 04:55

Langsa 12:14 L.Seumawe 12:17 L. Pakam 12:10 Sei Rampah12:10 Meulaboh 12:21 P.Sidimpuan12:09 P. Siantar 12:10 Balige 12:10 R. Prapat 12:06

06:08 06:23 06:09 06:17 06:16 06:10 06:08 06:06 06:11

Zhuhur ‘Ashar 15:34 15:37 15:30 15:29 15:41 15:27 15:29 15:28 15:25





Shubuh Syuruq


Zhuhur ‘Ashar




Shubuh Syuruq


18:14 18:17 18:12 18:11 18:22 18:12 18:11 18:12 18:09

19:24 19:27 19:21 19:20 19:31 19:21 19:21 19:21 19:18

04:46 04:50 04:42 04:41 04:53 04:38 04:40 04:40 04:36

04:56 05:00 04:52 04:51 05:03 04:48 04:50 05:50 04:46

Sabang Pandan Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan

12:24 12:11 12:11 12:12 12:22 12:15 12:12 12:18 12:07 12:17

18:24 18:13 18:13 18:14 18:22 18:17 18:13 18:19 18:09 18:19

19:33 19:23 19:23 19:23 19:31 19:26 19:22 19:28 19:18 19:28

04:57 04:40 04:40 04:43 04:55 04:45 04:43 04:50 04:37 04:48

05:07 04:50 04:50 04:53 05:05 04:55 04:53 05:00 04:47 04:58

Tarutung 12:10 T.Tinggi 12:09 Panyabungan 12:08 Teluk Dalam12:15 Salak 12:13 Limapuluh 12:08 Parapat 12:10 GunungTua 12:07 Sibuhuan 12:07 Lhoksukon 12:17

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

06:11 06:16 06:07 06:07 06:19 06:04 06:06 06:05 06:02

15:44 15:29 15:29 15:31 15:42 15:33 15:31 15:38 15:26 15:36

BINJAI (Waspada): Emi Suriani, SPd guru SD di kawasan Jalan Turiam, Kec. Binjai Timur, warga Dusun XII, Desa Sei Semayang, Kec. Sunggal, Kab. Deliserdang, Selasa (27/10) menjadi korban perampokan dua pria mengendarai sepeda motor. Dalam kejadian itu, korban mengalami kerugian surat-surat penting beserta uang Rp 300 ribu dalam tas sandang miliknya yang dibawa kabur perampok. Kejadian itu di Jalan Sukarno - Hatta, Simpang Turiam, Kec. Binjai Timur. Kapolresta Binjai AKBP Robets Kennedy melalui Kasat Reskrim AKP HM Taufiq ketika dikonfirmasi membenarkannya. Korban dalam peristiwa mengendarai sepeda motor Honda Supra X BK 2285 OA berangkat dari rumah menuju tempat mengajar di Turiam. Namun, di Simpang Turian dua pria tidak dikenalnya, mengendarai sepeda motor datang dari belakang langsung merampas tas sandang serta segera tancap ke arah Kota Binjai. (a04)

Polisi Ringkus Tersangka Pencuri Sawit PTPN II Tj. Jati

PT Al Hikmah T.Tinggi Buka Program S2 Pendidikan TEBING TINGGI (Waspada): Perguruan Tinggi Al Hikmah Kota Tebingtinggi yang mengasuh Sekolah Tinggi Ilmu Tarbiyah dan Sekolah Tinggi Ilmu Ekonomi, rencananya akan membuka program pasca sarjana bidang pendidikan. Khususnya program magister manajemen pendidikan. Hal itu disampaikkan Ketua STIT Al Hikmah Salman Rasidi, SE.MA, di sela-sela pelaksanaan stadium general STIT dan STIE, menghadirkan guru besar IAIN SU Prof Dr H Hasan Bakti Nasution, MA, belum lama ini. Pembukaan program S2 MMPd itu dilaksanakan PT Al Hikmah Medan bekerjasama dengan Sekolah Tinggi Manajemen IMNI Jakarta. Sedangkan pengajar deprogram itu, terdiri dari dosen berpendidikan S3, S2 tamatan dari dalam dan luar negeri. (a08)

Waspada/Abdul Khalik

AMBRUK : Proyek pembuatan bronjong di anak Sungai Sigiling, Jalan Sofyan Zakaria, Link.02, Kel. Tebingtinggi, Kec. Padang Hilir, ambruk. Senin (26/10), warga sekitar mengatakan pengerjaan pembuatan bronjong itu sebelum Ramadhan. Artinya, umur bronjong baru dua bulan. Tidak diketahui siapa pelaksana pekerjaan sepanjang 20 meter di sisi kiri dan kanan badan sungai. Proyek pembuatan bronjong juga dilaksanakan di pinggiran Sungai Sigiling, namun tidak ada keterangan apakah proyek yang telah ambruk itu satu paket dengan pekerjaan pada sungai induk.

Suami Istri Tewas Berlumuran Darah SIMALUNGUN (Waspada): Sepasang suami istri ditemukan tewas berlumuran darah di dalam rumahnya di Huta I Nagori Bandarmanis, Kec. Pematangbandar, Kab. Simalungun, Selasa (27/10) pagi. Kejadian menghebohkan itu mengundang ratusan warga daerah itu mendatangi TKP.

tangan dan kaki. Mulai dari ruang depan hingga ruang dapur rumah itu juga ditemukan bercak dan tetesan darah. Petugas Polsek Perdagangan dipimpin Kanit Reskrim, Iptu JW Sitompul dan Aiptu Agus Ginting serta Aiptu A Soyan Damanik, setelah menerima laporan langsung turun kelapangan untuk mengamankan TKP. Setelah melakukan lidik, kedua korban dibawa keRumahSakituntukdiambilvisumnya. Petugas menyita sebilah pisau sebagai barang bukti dan belum dapat memastikan motif peristiwa itu. Dugaan sementara, Romasti tewas akibat ditikam Beston Pardede. Tak berapalamakemudiansetelahmenikam istrinya, Beston Pardede langsung melakukan bunuh diri dengan cara menikamkan pisau yang sama ketubuhnya sendiri hingga ususnya terburai. Peristiwa itu diperkirakan terjadi sekira pukul 03:00 hingga pukul 04:00 dan saat kejadian tiga dari empat anak korban yang masihkecil-kecilsedangtertidurdiruang kamar,sedangkananakpalingbesarbernamaLena,11,tidurdirumahoppungnya. Tetangga korban yang ditanyai juga tidak mendengar suara gaduh dari rumah tersebut. Bahkan dikatakan, pasangansuamiistriitupadapukul23:00 sebelum kejadian masih terlihat samasama naik sepeda motor, baru pulang berobat dari arah Bandar. “ Mungkin kejadiannya saat kami tertidur lelap, sehingga sama sekali tidak

mendengar suara ri-but-ribut,” sebut salah seorang tetangga korban kepada Waspada. Stres Dan Cemburu Informasi dari warga, Beston Pardede dikenal pendiam dan rajin bekerja ke sawah. Namun beberapa tahun belakangan ini, Beston selalu terlihat seperti orang stres (mengidap gangguan kejiwaan ). Selain itu, Beston juga dikatakan sangat pencemburu. Diduga, peristiwa pembunuhan terhadap istrinya dilakukan Beston sendiri. Kemudian setelah melakukan penikaman, Beston kebingungan dan mungkin menyesali dirinyadantanpapikirpanjanglagilangsung bunuh diri dengan cara menikamkan pisau yang sama kebagian perut hingga ususnya terburai. Kapolres Simalungun AKBP Rudi Hartono, SH, SIK saat dikonfirmasi melalui Pahumas Kompol Ramli Sirait dan Kasat Reskrim AKP Tito Travolta Hutauruk, SH, SIK di Mapolres, Selasa (27/10) membenarkan. Dijelaskan, dalam peristiwa pembunuhan dan bunuh diri itu dan sudah menyita barang bukti berupa sebilah pisau dan pakaian suami istri. Menurut Pahumas, karena kedua suami istri itu meninggal, penyelidikan terhadap kejadian itu dihentikan dan tidak ditindaklanjuti. Beston diduga stres hingga membunuh istrinya dan membunuh dirinya sendiri, katanya.(a15/a14)

PANGKALANSUSU (Waspada): Sikap tegas Bupati Langkat, Ngogesa Sitepu, menutup operasional mega proyek Perusahaan Listrik Tenaga Uap (PLTU) New Sumbagut 2 x 200 MW di Desa Tanjungpasir, Kec. Pangkalansusu, mendapat apresiasi dari sejumlah kalangan. Tarulisani, mantan anggota Komisi I DPRD Langkat kepada Waspada, Sabtu (24/10) mengatakan, langkah tegas bupati menghentikan pelaksanaan proyek dengan nilai invstasi triliunan rupiah itu pantas dihargai. Dukungan senada juga disampaikan anggota DPRD Langkat dari PPP, Syahrial Simanjuntak, SH. Ia mengatakan, pemerintah daerah dan dewan pada prinsipnya tidak apriori atau menutup diri terhadap pelaku usaha yang ingin menanamkan investasinya di daerah ini asal mengikuti aturan. (a02)

Keterangan diperoleh, pasangan suami istri masing-masing Beston Pardede, 35, dan Romasti Lumbanraja, 30. Tewasnyakeduakorbanbarudapatdiketahui setelah salah seorang anak pasangan ini bernama Andreas,9, datang ke rumah oppungnya (kakek) yang tidak jauh dari TKP melaporkan, ibunya telah tewas sekira pukul 06:00. Setelah menerima laporan dari cucunya, serta merta sang kakek dan beberapa warga langsung ke TKP dan menemukan Beston Pardede dan Romasti Lumbanraja sudah tidak bernyawa. PengamatanWaspada diTKP (Tempat Kejadian Perkara), mayat kedua korbanditemukandibagianruangtamu dan dalam kondisi berlumuran darah. Posisi keduanya saling berdekatan. TubuhBestonPardededalamposisitelungkup, usus terburai dan ditangannya memegang sebilah pisau dapur. Sedangkan posisi tubuh Romasti Lumbanraja telentang dengan luka dibagian perut,

Tak Ada Plank Proyek Renovasi Titi Gantung

Hindari Perpecahan Partai Golkar Binjai

GEBANG (Waspada): Pekerjaan renovasi sarana perhubungan titi gantung di Dusun-II Tambang perbatasan Desa Dogang dengan Kel.Pekan Gebang, Langkat panjang 100 meter dan lebar 1,5 meter dengan dana dari APBD sebesar Rp 160 juta sebelum dan selesai pekerjaannya tanpa plank proyek. Menurut Kades Dogang Zainal Abidin kepada Waspada yang pernah mendapat Desa Percontohan tahun 2007 itu, mengatakan titi gantung yang dibangun sejak tahun 1970-1973 dan saat ini baru memperoleh rehab pada badan jalan ujung dan pangkalnya dicor, tambahnya. (c02)

BINJAI (Waspada):Wakil Ketua DPD Partai Golkar Binjai M Chairwandi, SP minta kader Golkar menghindari perpecahan. Sesuai keputusan DPP Partai Golkar, kepimpinan Golkar Binjai yang sah diketuai Haris Harto. Tidak ada caretaker di kepengurusan DPD Partai Golkar Binjai. MChairwandi,SPmenegaskanSelasa ( 27/10), klaim 32 pengurus Kelurahan Partai Golkar Binjai menolak H Haris Harto merupakan rekayasa. Buktinya sembilan pengurus Golkar kelurahan di Binjai Utara tidak ada membuat pernyataan. Kepimpinan H Haris Harto sebagai ketua dibuktikan ketika Munas Partai Golkar di Pekanbaru, Riau. Carateker Sofyan Effendi tidak dibenarkan ikut Munas, berarti kepimpinan Sofyan Effendi ilegal. Saat ini Partai Golkar

Sikap Tegas Pemkab Langkat Diapresiasi

Anggota DPRD Sergai Diminta Lebih Aspiratif SEI RAMPAH (Waspada): Anggota DPRD Kab.Serdang Bedagai yang baru dilantik, Senin(26/10) hendaknya aspiratif kepada kepentingan rakyat. Sebab DPRD adalah mewakiki rakyat untuk penyambung lidah kepada pemerintah. Kalau dewan tetap juga kurang aspiratif sebagai mana kebanyakan dewan yang lalu, maka nasib rakyat tetap saja seperti biasa, yang akhirnya menjadi kejenuhan bagi warga untuk menyalurkan hak politiknya kepada seseorang. Hal itu ditegaskan Ketua Umum Gerakkan Pemuda Islam(GPI)Kab.SerdangBedagaiMawardiAgusHasibuandigedung dewankepada Waspadaseusai pelaksanaanpelantikan45anggota DPRD Serdang Bedagai. Selain itu Mawardi Agus Hasibuan mengharapkan para wakil rakyat nantinya dapat menjalankan tugas dengan baik dan bijaksana,bekerja sama dan jangan saling menyalahkan. (a07)

Video Kekerasan Pada Anak Mengkhawatirkan T. TINGGI (Waspada): Video kekerasan terhadap anak diperkirakanberusia1,5tahunyangdilakukanseorangperempuan diduga ibunya, beredar dari handphone ke handphona sesama pelajar di Kota T. Tinggi. Video kekerasan itu diperoleh melalui kurir wartawan, di arena balapan sepeda motor, Minggu (26/10) dari beberapa pelajar yang semual enggan memberikannya kepada wartawan. Tidak diketahui asal sekolah pemilik video pertama. Dalam video handhone berdurasi 4 menit lebih itu, terlihat seorang perempuan dengan rambut keriting sebahu, berpakaian kaos putih dan celana jeans seponggol, tengah duduk bersama dua anak lainnya. Tiba-tabi datanglah, seorang anak perempuan berpakaian putih juga, merengek kepada perempuan itu. Entah apa yang ditangisinya, tiba-tiba kaki permpuan it melayang menendang sang anak hingga terjengkang. Tunjangan ala smack down itu, dilakukan si perempuan beberapa kali, hingga anak itu menjerit kesakitan. Tak cukup dengan tunjangan itu, perempuan yang diduga ibu atau mungkin juga pembantunya, sempat menginjak si anak dengan cara tegak sambil bergoyang-goyang ke atas punggung anak balita itu. Hingga anak itu menjerit ditengah tindihan perempuan itu.(a08)

Zhuhur ‘Ashar 15:29 15:28 15:25 15:32 15:31 15:27 15:29 15:25 15:25 15:37




Shubuh Syuruq

18:13 18:11 18:11 18:18 18:15 18:10 18:12 18:10 18:10 18:17

19:22 19:20 19:20 19:28 19:24 19:19 19:21 19:20 19:20 19:26

04:40 04:40 04:36 04:43 04:43 04:39 04:41 04:37 04:36 04:49

04:50 04:50 04:46 04:53 04:53 04:49 04:51 04:47 04:46 04:59

06:06 06:06 06:02 06:09 06:08 06:05 06:06 06:02 06:02 06:15

Lulusan SMA, Keperawatan Dan Komputer, Terbesar Penerimaan CPNSD T. Tinggi

Dua Pria Rampok Guru Di Binjai

BINJAI (Waspada): Polisi dari Satuan Brigade Mobil (Brimob) meringkus dua tersangka pencurian Tandan Buah Sawit Segar (TBS) PTPN II Perkebunan Tanjungjati, Kec. Binjai, Kab. Langkat, Senin (26/10). Kedua tersangka, S, 20, dan J, 21, warga Limau Manis, Desa Sambirejo, Kec. Binjai Langkat. Tersangka diringkus ketika sedangmencuridiarealperkebunansawitmilikPTPNIITanjungjati Guna pengusutan, kedua tersangka diserahkan ke Polresta Binjai bersama barang bukti 7 janjang (tandan) sawit. Keduanya dituduh melanggar Pasal 363 KUH Pidana dengan ancaman 7 tahun penjara. Kapolresta Binjai,AKBP Robets Kennedy SIk SH,melalui Kasat Reskrim AKP HM Taufiq SE MHum, membenarkan. Sedangkan tersangka S dari balik jeruji besi tahanan Reskrim Polresta Binjai, mengaku, ia mencuri karena tidak memiliki perkerjaan tetap. Sedangkan isteinya sedang hamil 8 bulan. (a04)

06:23 06:06 06:06 06:08 06:20 06:11 06:09 06:16 06:03 06:14

melakukan konsolidasi partai,hal ini ingin dikacaukan pihak tertentu guna kepen-tingan pribadi.Oleh karena itu M Chair-wandi,SP diminta pengurus kecamatan dan kelurahan serta kader Golkar di Binjai tetap bersatu.Jangan mau dika-caukan oknum dari Partai Golkar sendiri yang hanya berjuang sesuai permintaan penguasa. Menurut M.Chairwandi, bisa dibuktikan beberapa pengurus Golkar ketika rapat pleno 25 Juli 2009 menolak Hj Rini Sofyanti menjadi calon Ketua DPRD Binjai. Sebelumnya 32 Ketua Kelurahan Partai Golkar Kota Binjai menolak Haris Harto memimpin kembali partai itu karena tersangkut kasus dugaan korupsi anggaran Komite Olahraga Nasional Indonesia (KONI) 2007 Rp1,7 miliar. Hal itu diungkapkan Plt Ketua DPD

Dakwah 6 orang. Sekdako Tebingtinggi H. Irham Taufik Umri, SH, MAP, di ruang kerjanya, mengatakan untuk lulusan SMA/ MA/SMK hanya Pemko Tebingtinggi yang menerima. Sedangkan daerah lain tidak. Hal itu dusulkan ke pusat dan mendapat persetujuan setelah diajukan berbagai alasan. “Salah satu alasannya hingga kini terjadi ketimpangan struktur birokrasi di KotaTebingtinggi, di mana level PNS di atas dan dibawah sangat kecil, sedangkan level menengah gemuk. Kondisi ini berbahaya, sehingga perlu adanya penyeimbangan,” ujar Sekdako.Atasdasaritulah,Pusatkemudian menerimausulan untukformasiSMA/ MA/SMK, tandas Sekdako. Ujian penyaringan CPNS akan dilaksanakan 30 Oktober sampai 13 November 2009. Pengambilan nomor ujian mulai 22 November 2009 hingga 23 November 2009 di aula TC Sosial, Jalan RSU. Sedangkan berkas pelamaran disampaikan melalui PT Pos Indonesia. (a08)

PGSI Binjai Laporkan Penyimpangan Dana BDB 2009 BINJAI (Waspada): Badan Pengurus Daerah ( BPD) Persatuan Guru Swasta Indonesia (PGSI Kota Binjai melaporkan penyelewengan dana Bantuan Daerah Bawahan (BDB) 2009 kepada Gubernur Sumatera Utara, Kapolda Sumatera Utara dan Kejati Sumut. Ketua PGSI Binjai Erry Abimanyu menjelaskanSelasa(27/10),pemberian bantuan dana bersumber APBD Provinsi Sumut menyalahi aturan dan UU Sisdiknas No.20/2003. Dana BantuanDaerah(DBD)diKotaBinjaisenilai Rp. 3.577.620.000 terindikasi disalahgunakan. Seluruhnya diberikan kepada sekolah negeri. BDB Kota Binjai diberikan kepada 15 sekolah negeri, bahkan ada sekolah menerima BDB, sebelumnya menerima Dana Alokasi Khusus (DAK) PGSI Binjai bersama pimpinan sekolah swasta sangat kecewa, Pemko Binjai tidak memperhatikan pembinaan sekolah swasta.”Padahal peran sekolah swasta di Binjai sangat tinggi, “

ujar H Sufrie Hamdani. Sekolah negeri penerima Bantuan Daerah Bawahan ditentukan penjabat DinasPendidikanBinjai dengansistem pengaturan. Proyek BDB di sekolah juga dilaksanakan tanpa plank proyek dan terkesan tumpang tindih. Hal itu menurut Erry dan Sufri,sebagai usaha manipulasi ini diperlukan pemeriksaan kualitas dan standar proyek oleh BPK, Poldasu dan DPRD Sumut. 15 Sekolah negeri yang memperoleh BDB SD 020265 Rp 198.660.000. SDN 0207950 Rp193.660.000. MTsN Rp 145.500.000, MAN Rp145.500.000, padahal Madrasah Aliyah Negeri di Kelurahan Rambung Barat, Kec. Binjai Selatan tahun lalu juga memperoeh BDB. SMPN I Rp242.500.000, SMPN IV Rp. 194 juta, SMPNV Rp242.500.000, SMPNVII Rp 145.500.000. SMPNVIII Rp145.500.00,SMPN12Rp.145.500.000. SMAN I Rp376.320.000, SMAN 2 Rp388 juta, SMAN 3 Rp388 juta, SMAN 5 Rp480.980.000 dan SMAN 6 hanya Rp145.500.000. (a03)

Waspada/HM Husni Siregar

Partai Golkar Kota Binjai Sofyan EffendidansejumlahpengurusDPDPartai Golkar Kota Binjai di kantor Jalan Candrakirana, Senin (26/10). Sofyan Effendi mengatakan, akan membawa permasalahan tersebut ke DPP Partai Golkar agar dapat mempertimbangkan keputusan DPP Partai Golkar yang menetapkan Haris Harto sebagai Ketua DPRD Binjai. Sementara, Wakil Sekretaris DPD Partai Golkar Kota Binjai Sri Noor Alamsyah Putra menambahkan, selain tersangkutkasuskorupsi,penolakansejumlah pengurus DPD Partai Golkar Binjai dan 32 ketua kelurahan terhadap kepemimpinan Haris Harto karena yang bersangkutan dinilai tidak loyal pada bawahan termasuk dalam mempertanggungjawabkan laporan keuangan partai. (a03a04)

Kawasan Pantai Cermin Kembali Dihijaukan PANTAICERMIN (Waspada): Saudara adalah seorang wisatawan, karena saudaradatangkemariselainturutmelakukan penaman pohon juga berekresi, saya imbau saudara jadilah saudara turis yang berwawasan lingkungan. Hal itu diungkapkan Wakil Bupati Kabupaten Serdang Bedagai H. Soekirman di hadapan 150 mahasiswa AMIK Medan pada acara penanaman pohon Minggu (25/10) di pantai PT Indosat Cabang Lubuk Pakam di Desa Pantai Cermin Kiri, Kec. Pantai Cermin, Sergai. Sebelumnya Kepala North Sumatera Regan (NSR)Waris Sulaiman, mengucapkan terimakasih kepada Pemkab SergaiyangdalamhalDinasPerkebunan dan Kehutanan Sergai dan Yayasan Perguruan Harapan Medan serta pihakpihak yang terkait. untuk melakukan penanaman di Pantai/lokasi PT Indosat Pantai cermin ini. Kegiatan penanaman kerjasama Pemkab Sergai (Dinas Kehutanan Dan Perkebunan), PT Indosat (Persero), Yayasan Pendidikan Harapan Medan, KNPI dan Dinas Pemuda Sergai dengan menanam bibit mangrove sebanyak 4000 pohon di sepanjang alur pantai Indosatserta20pohonBedagaidi tanam di kawasan pematang. Berkenaan penaman bakau Direktur LSM Bestari Indonesia Ir. Mhd. Rizwan MP, di sela-sela kegiatan mengatakan penanaman pohon bakau saat baik

TEBINGTINGGI (Waspada): Lulusan SMA/MA/SMK, DIII Keperawatan dan DIII Komputer menjadi formasi terbesar penerimaan CPNS 2009 di Pemko Tebingtinggi. Masing-masingformasiitu(SMA/ MA/SMK) diterima 50 orang, D III Keperawatan35,S1EkonomiAkutansi 35, dan D III Komputer 30. Selain itu, jumlah formasi terbesar lainnya, yakni D III Akutansi 22, Analis Kesehatan 13, dokter umum 11 serta S1 Pendidikan Bahasa Inggris 10 . Sedangkan formasi lain D III, Kebidanan 9, D III Rekam Medik 8, D III KimiaAnalis8, DIVGizi7,S1Ekonomi Manajemen 7. Data diperoleh, total formasi yang diterima kali ini, terdiri dari tenaga guru 45, tenaga kesehatan 123 dengan 17 formasi, formasi tenaga teknis 234 dengan 44 formasi. Dengan demikian total jumlah penerimaan 402 orang. Sementara, formasi lain yang muncul dan menarik tahun ini adalah denganditerimanyaalumniS1alumni Fakultas Ushluddin, Syariah dan

SERAHKAN : Wakil Bupati Deli Serdang H Zainuddin Mars menyerahkan beasiswa kepada anak berprestasi anggota KPRI Departemen Agama Kabupaten Deliserdang, Senin ( 26/10 ), di Aula Kandepag Deliserdang, Lubuk Pakam.

Wabup DS Serahkan Beasiswa LUBUKPAKAM (Waspada):Wakil BupatiDeliserdangHZainuddinMars menyerahkan beasiswa kepada Tiga puluh lima anak berprestasi anggota KPRI Departemen Agama Kabupaten Deliserdang, Senin ( 26/10 ), di Aula Kandepag Lubuk Pakam. Wabup dalam sambutannya menyampaikan terima kasih dan bangga kepadapengurusKPRI Kandepagyang telah memberikan beasiswa kepada anak-anak berprestasi, Program ini sejalan dengan visi nisi kabupaten Deliserdang untuk memajukan dunia pendidikan. Wabup H Zainuddin Mars yang juga Ketua PKP RI Kabupaten Deliserdangmemotivasiagar kitajadikanDeli Serdang ini sebagai Kabupaten Pendidikan, sehingga lulusannya mampu

menembus PerguruanTinggibergengsi yang ada di Indonesia maupun di luar negeri,yangpadagilirannya melahirkan generasi penerus bangsa yang handal danberkualitas,sertadapatmenjaditokoh tokoh nasional maupun internasional. Kakandepag HM Adlin Damanik, MAPmenginginkanKPRIinilebihmaju lagi ke depan. Sebelumnya Ketua KPRI Depag DeliserdangSyawalHarahapS.Agdalam laporannya mengatakan program pemberianbeasiswakepadaanak-anak anggota merupakan program setiap tahunnya, UntuktahuniniKPRIDepag Deliserdang memberikan beasiswa kepada35orangyangterdiridari17 orang tingkat SD/MI, tingkat SLTP/MTS sebanyak 10 orang, dan untuk tingkat SLTA/MA sebanyak 8 orang. (a05)

Enam Desa Kec. Sunggal DS Adakan Pilkades Desember 2009

Waspada/Eddi Gultom

TANAM POHON: Wakil Bupati Sergai H Soekirman menanam pohon “Bedagai” didampingi Sekdakab Drs H Haris Fadillah di areal pantai PT Indosat Persero Minggu (25/10) dilakukan karena akan melindungi pantai dari abrasi air laut. Menurutnya, jika tidak sekarang kapan lagi abrasi pantai akan dikurangi. Makanya, kata dia, pihaknya sangat mendukung kegiatan yang digagas Dishutbun Sergai itu. Penanaman juga turut dilakukan Sekdakab Sergai Drs. H.Haris Fadillah, MSi, Kasdim 0204 DS Mayor Inf Budi Kurnianto, Ketua GOPTKI Sergai Ny Hj Marliah Soekirman, KetuaYayasan Pendidikan Harapan Medan Drs Awaluddin Sibarani, Kepala North Sumatera

Regan (NSR) Waris Suilaiman, Kacab Indosat Medan Adil Darwan, TransmisionWest Area Abraham Sugewa, Head RO Lubuk Pakam Ismet Rizani Siregar SE, Ka Bappeda Ir H Safaruddin, Kadis Hutbun Sergai Ir M. Taufiq Batubara, MSi, Kadis Pora Drs, Joni W. Manik, Kadis Pariwisata dan Budaya H Ikrom Helmi Nasution, SH, Plt. Kadis Kesahatan drg Zaniar, Direktur LSM Bestari Indonesia Ir Mhd. Rizwan MP, dan ratusan mahasiswa Yayasan pendidikan Harapan Medan. (a07)

SUNGGAL(Waspada):Enamdesa di wilayah Kec. Sunggal, Kab. Deliserdang dijadwalkan Desember 2009 mendatangsegeramenyelenggarakan Pemilihan Kepala Desa (Pilkades) secara serentak. Demikian keterangan Camat Sunggal HMA Yusuf Siregar selaku mediator melalui Kepala Seksi Pemerintahan(Kasipem)Kec.SunggalJahar Rambe, S.Sos, kepadaWaspada,Senin (26/10) di ruang kerjanya. Keenam desa tersebut Muliorejo, Sumber Melati Diski, Pujimulio, Payageli, Telagasari dan Sunggal Kanan. Sedangkan terkait dengan Pilkades di enam desa tersebut, pada 8 Oktober 2009 telah dilaksanakan santiaji di aula kantor Kecamatan Sunggal. Peserta santiaji terdiri dari para ketua dan sekretaris Panitia Pemilihan Kepala Desa (P2K) masing-masing desa, Badan Perwakilan Desa (BPD) dan para Kades. Sedangkan pembinaan, selain oleh camat juga disam-

paikan unsur Kantor Pemerintahan Desa (PMD) Kab. Deliserdang. Jahar Rambe menyebutkan, hingga saat ini tahapan menjelang pelaksanaan Pilkades di enam desa tersebut memasuki tahap seleksi berkas di P2K masing-masing desa sebagai pihak berkompeten. Setelah itu, barulah dikirimkan ke kecamatan untuk seleksi berikutnya, dan kemudian diserahkan ke PMD Pemkab Deliserdang. Dalam Pilkades itu, lanjutnya, pendidikan paling rendah bakal calon dalamPilkadesadalahSLTP.Initertuang dalam Peraturan Daerah (Perda) Kab. Deliserdang No. 7 tahun 2007 tentang tata Cara Pemilihan, Pencalonan, Pengangkatan, Pelantikan dan Pemberhentian Kepala Desa. ‘’Jika calon Kades lebih dari lima di masing-masing desa tersebut, maka diadakan ujian tertulis yang dilaksanakan oleh Pemkab Deliserdang. Ini juga sesuai Perda No. 7 tahun 2007 tersebut,’’ jelas Jahar Rambe. (m34)


Sumatera Utara

Dua Konsumen Narkoba Tertangkap 12 Butir Pil Ekstasi Disita

LIMAPULUH (Waspada): Pembangunan sejumlah perkantoran SKPD di lingkungan Pemkab Batubara yang telah ditenderkan di Dinas PUD diprediksi akan gagal dibangun. Sekretaris Gakindo Batubara Arsyad Nainggolan kepada Waspada, Senin (26/10) mengatakan lambannya pembangunan perkantoran yang telah ditenderkan mulai mengkhawatirkan. Selain waktu pengerjaan yang semakin menyempit, anggaran yang direncanakan juga diperkirakan menjadi masalah untuk membangun perkantoran yang isunya akan dilaksanakan di Prupuk. Hasil pantauan sejumlah kalangan, lokasi pembangunan perkantoran yang akan dibangun di Perupuk itu membutuhkan biaya yang tidak sedikit untuk pematangan lahannya. Hal itu dikarenakan kontur lahan yang dekat laut itu rendah dan masih berupa rawa yang tergenang air. Sementara itu Ketua Umum Front Pembebasan Tanah Rakyat (FPTR), MrCJabielManikkepada Waspada,Senin(26/10)mengatakan pembelian lahan di Prupuk untuk pembangunan kantor adalah pemborosan yang merugikan rakyat. (a31)

Perekrutan CPNS Batubara Utamakan Anak Daerah LIMAPULUH (Waspada): Dalam perekrutan penerimaan CPNS di lingkungan Pemkab Batubara untuk mengutamakan putra daerah demi terciptanya kekondusifan yang lebih baik lagi pada kabupaten pemekaran dari Asahan. Di samping dilakukan pengawasan secara ketat. Demikian Ketua Fraksi PAN DPRD Kab Batubara,Hidayat SPd MSI saat menyampaikan pandangan umum fraksi atas nota keuangan bupati terhadap RAPBDTahun 2010 dan penyampaian dua Ranperda dalam sidang paripurna dewan Jumat (23/10). SementaraitukalanganmasyarakatmenilaiPemkabtelahmemberi seluas-luasnya kepada putra daerah dalam mengikuti CPNS karena memberi percayaan kepada seluruh desa maupun kelurahan sebagai tempat pendaftaran peserta. “Ini mencerminkan Pemkab memberi seluas-luasnya peluang penerimaan abdi negara tersebut kepada anak daerah,” sebut Ramadhan salah seorang aktivis mahasiswa warga Batubara, Senin (26/10). (a11)

Santri MATFA Sumut Gelar Zikir Akbar Dan Doa Tolak Bala TANJUNGPURA (Waspada): Lebih dari seribu santri Majelis Ta’lim Fardhu A’in (MATFA) Sumatera Utara melaksanakan zikir akbar dan doa tolak bala di halaman Surau MATFA Jalan Khairil Anwar no.66 Tanjungpura,Langkat, Minggu (25/10). Kita melaksanakan zikir dan doa untuk memohon kehadirat Allah SWT, agar masyarakat terhindar dari sebagal bencana dan musibah, kata Tuan Guru Al Muqharam Syekh H Ali Mas’ud seraya menambahkan selain melafazkan zikir Allah sebanyak 300 kali juga dilaksanakan pembacaan ayat suci Al Quran surat Al An’Am ayat 103 sebanyak 60 kali . Ketua MATFA Sumatera Utara, Prof Dr Syamsul Arifin di tempat yang sama mengungkapkan, saat ini sudah banyak cobaan yang diterimasaudara-saudarakitaditanahairterhadapterjadinya bencana. (a01)

Gubsu Diminta Tolak P APBD DS DELITUA (Waspada): Dilayangkannya surat oleh DPRD Deliserdang kepada Gubernur Sumatera Utara 13 Oktober 2009 sehari sebelum pelantikan anggota DPRD Deliserdang yang baru sebagai bentuk penolakan Kebijakan Umum Anggaran dan Perubahan Prioritas Plafon Anggran Sementara (KUA PPAS) dan disahkannya P.APBD 2009 dalam keputusan rapat Paripurna DPRD Deliserdang periode lalu pada 12 Oktober lalu dinilai menyalahi prosedur. “Upaya itu adalah wujud tendensius dan sentimen pribadi ketua DPRD Deliserdang yang tidak sesuai dengan prosedur dan mekanisme yang ada,” tegas Zulkifli Barus, anggota DPRD Deliserdang periode lalu dari Fraksi Golkar, Sabtu (24/10 ). (m39)

Pinjam Sepeda Motor Tidak Dikembalikan Dilaporkan BINJAI (Waspada): Sangkot, 47, warga Jalan Bangau lingkungan VII Kelurahan Mencirim, Kecamatan Binjai Timur Senin (26/10) mengadukan EYR, 38, warga Jalan Dipenogoro, Lingkungan VIII, Kelurahan Mencirim, Kecamatan Binjai Timur. Pasalnya, pelaku setelah meminjam sepeda motor Suzuki Smash BK 3861 SR miliknya sejak Rabu (21/10) sekira pukul 19:30 tidak dikembalikan. Kapolresta Binjai,AKBP Robets Kennedy melalui Kasat Reskrim AKP Muhamad Taufiq ketika dikonfirmasi membenarkan. (a04)

PAN Jaring Balon Walikota Binjai BINJAI(Waspada): Menjelang pilkada Binjai 2010-2015, Dewan Pimpinan Daerah Partai Amanat Nasional (DPD-PAN) Kota Binjai membentuk Tim Penjaringan Balon Walikota Binjai, Senin (26/10). Hal itu sesuai hasil rapat harian, DPD-PAN Kota Binjai membentuk Tim Penjaringan Pilkada Balon Walikota 2010-2015, dengan Ketua Tim, Kastalani,SE,SPd, Wakil Ketua M Ridwan Hasibuan, Serkretaris Juriadi, SAg, S.Pd.I dan sejumlah anggota, Suherman, Rudi Alfahri Rangkuti,SH.MH, Rahmat Taufiq Hadibrata, AMd, Ahmad Haris Nasution, Edi Yanto dan H Yan Hendri,SE. Sekretaris Tim Penjaringan, Juriadi, saat dikonfirmasi menyebutkanakanmembukapendaftaranBalonWalikotaBinjai,diKantornya Jalan Kartini No 27 Binjai, tanggal 30 Oktober mendatang dan ditutup tanggal 30 November 2009. (a04)

70 Calhaj P. Brandan Ditepungtawari P. BRANDAN (Waspada): Sebanyak 70 Calhaj P.Brandan, Kecamatan Babalan 30 orang dan Sei Lepan, Brandan Barat 40 orang yang akan berangkat ke tanah suci Makkah pada kloter XIII, 6 November dari Bandara Polonia Medan, Sabtu malam (24/10) ditepungtawari oleh Badan Kenaziran Masjid Raya P.Brandan dan IPHI Babalan di Masjid Raya P.Brandan Langkat. Hadir Camat Babalan, Nanang Hadi Irawan, S.Sos, Lurah Brandan Timur, Ketua Kenaziran H Muhidi Rokan dan para jamaah. Camat Babalan dalam sambutannya mengatakan, terima kasih kepada panitia, kenaziran dan IPHI mari kita saling men-doakan, saling silaturahim segala yang baik mari kita meningkatkan lagi. Ketua Kenaziran Muhidi Rokan dalam sambutannya, kepada calon Haji yang akan berangkat menunaikan ibadah haji ketanah suci diberi kesehatan dan kemudahan. (c02)

Rabu 28 Oktober 2009

Galian C Liar Di Na IX-X Perlu Penertiban

T. TINGGI (Waspda): Dua tersangka konsumen narkoba jenis pil estasi tertangkap petugas Satuan Narkoba Polresta T. Tinggi di sebuah halte pemberhentian bus jalan besar Gatot Subroto, ketika hendak menuju P. Siantar, Sabtu (24/10) petang sekira pukul 18.30. Dari kedua tersangka ditemukan masing-masing 6 butir pil estasi, selanjutnya disita petugas sebagai barang bukti. Kedua tersangka HY alias Ahwi,35, warga Jalan Tengku Hasyim, Perumahan TPI, Kel. Bandar Sono, Kec. Padang Hulu, dan temannya ES alias Asiong,36, warga Jalan KFTandean, Ling.IV,Tebingtinggi selanjutnya digelandang ke Mapolresta Tebingtinggi. Tertangkapnya kedua tersangka, menurut keterangan yang diperoleh di kepolisian, Senin (26/10) dari informasi masyarakat yang menyebutkan kedua tersangka sering menggunakan narkoba jenis pil estasi. Mendapat informasi tersebut, petugas melakukan penyelidikan ke lokasi sasaran. Dalam pemeriksaan petugas, keduanya mengaku mendapat pil ekstasi dari seorang pria yang mengaku bernama panggilan Andi di sebuah diskotik di Medan. Barang haram itu dibeli seharga Rp 50.000 per butir. (a09)

Perkantoran Di Prupuk Dikhawatirkan Tak Selesai


Waspada/Rahmad F Siregar

MUNCUL LAGI : Demam berdarah dengue muncul kembali di Kota Tanjungbalai. Selama sepekan ini, sedikitnya 4 pasien demam berdarah terpaksa dirawat inap di RSUD Tanjungbalai. Butuh perhatian serius dari Pemko Tanjungbalai untuk memutus mata rantai penyebaran nyamuk aedes aeygepty di kota itu. Foto direkam, Selasa (27/10).

Pasien DBD Dirawat Di RSUD T. Balai TANJUNGBALAI (Waspada): Seorang siswa Kelas II SMA Negeri 5 menjalani perawatan intensif di RSUD Tanjungbalai akibat terjangkit Demam Berdarah Dengue (DBD), Selasa (27/10). Pasien itu, Ulfa Miandra Putri Hasibuan, 16, warga Jalan DI Panjaitan, Kel. TB Kota III, Kec. Tanjungbalai Utara. Dia dibawa ke rumah sakit setelah mengeluh kedinginan meskipun suhu tubuhnya panas tinggi. Selain itu, dia juga mengaku kena gangguan pinggang saat batuk dan kedua kakinya tak bisa

digerakkan. “Tiba-tiba saja dia demam, dan kalau batuk pinggangnya sakit, serta kakinya tak bisa menopang tubuhnya berdiri,” kata Ummiati Syam, ibu kandungnya. Ditambahkannya, karena kondisi anaknya terus menurun, maka diputuskan untuk membawanya berobat ke RSUD Tanjungbalai. Hasil pemeriksaan paramedis di sana, Ulfa positif terjangkit DBD dengan jumlah trombosit hanya 75 ribu, padahal idealnya150 ribu. Di samping itu, HB Ulfa hanya 11,4 gram persen. Direktur RSUDTanjungbalai Diah Retno melalui Bagian HumasCosmasSiagian,membenarkan. Kata dia pasien DBD itu dirawat di ruang internis. Dan, kata

Siagian, kondisi pasien itu masih stabil,sebabsaatdibawakerumah sakit, keadaannya belum parah. “Sampaihariinikondisinyacukup stabil setelah dirawat intensif oleh paramedis,” jelas Siagian. Sementara, berdasarkan data Waspada,Ulfamerupakanpasien demam berdarah ke 286 yang dirawat RSUD Tanjungbalai terhitung sejak Januari sampai Oktober 2009. Dari 286 pasien demam berdarah, lima di antaranya meninggal dunia, dan pasien terakhir yang meninggal dunia Destiani, 6, putri pasangan Sangkot Hasibuan dan Syamsiah Manurung, warga Link IV, Jalan Sipori-pori, Kel. Kapias Pulau Buaya, Kec. Teluk Nibung, Kota Tanjungbalai. (a37)

Kantor DPRD Dan Kejaksaan Tanjungbalai Didemo

Tuntut Dugaan Korupsi MTQN Ke 31 Dituntaskan TANJUNGBALAI (Waspada): Puluhan mahasiswa berunjuk rasa ke kantor DPRD dan Kejaksaan Negeri Kota Tanjungbalai, menuntut agar dugaan korupsi dana MTQN ke 31 senilai Rp 5,6 miliar dituntaskan, Selasa (27/10). Dikawal ketat aparat keamanan, massa menyampaikan aspirasinya sambil membawa spanduk dan pengeras suara. Dalam orasinya di kantor DPRD, massa meminta dukungan moral kepada para wakil rakyat agar menyikapi dan mempertanyakan perkembangan penanganan kasus tersebut. Kasus itu kata mahasiswa, sudah sepuluh bulan mengambang, padahal Kejari telah menetapkan Walikota Tanjungbalai sebagai salah satu tersangka dan surat izin pemeriksaannya telah dilayangkan kepada Presiden Susilo Bambang Yudhoyono. Setelah berorasi, massa kemudian diterima oleh Ketua sementara DPRD Tanjungbalai Artati dan seluruh anggota dewan. Pada pertemuan itu, anggota DPRD dari Partai Golkar,

Wahyu Junedi, sempat meminta massa menunjukkan kartu identitas sebagai mahasiswa. Akan tetapi, permintaan anak WalikotaTanjungbalai itu, ditolak massa. “ Anda tidak punya hak meminta kartu mahasiswa kami dan kami semua bertanggung jawab kami memang mahasiswa,” tegas massa kepada wakil rakyat itu. Sementara, Ketua sementara DPRD mengatakan, dugaan korupsi MTQN Ke 31 itu, telah ditangani pihak Kejaksaan. Dan, DPRD kata Artati, tidak dapat mencampurinya, karena itu merupakan kewenangan Kejaksaan. Berbeda dengan anggota DPRD lainnya, Hariono dan Ainul Fuad. Keduanya sepaham dengan mahasiswa, yakni dugaan korupsi MTQN Ke 31 yang melibatkan Walikota Tanjungbalai, harus dituntaskan. Dan, keduanya juga memberikan dukungan moral kepada mahasiswa untuk mendesak penuntasan kasus itu. Dari kantor DPRD, massa kemudian bergerak ke kantor

Kejari Tanjungbalai untuk menyampaikan aspirasi yang sama. Di sana, massa diterima langsung oleh Kajari Tanjungbalai Heri Sunaryo dan Kasi Intel Kadlan Sinaga serta Kasi Pidsus PDE Pasaribu. Kepada mahasiswa, Kajari menegaskan, penyelidikan dugaan korupsi dana MTQN ke 31, tidak pernah dihentikan, bahkan kasusnya telah diekspos di Kejagung. “ Hasil ekspos di Kejagung, masih diperlukan lagi kelengkapan berkas, salah satunya hasil audit BPKP tentang adanya kerugian negara dalam penyenggaraan MTQN itu,” jelas Kajari. Ditambahkannya, pihak Kejari Tanjungbalai masih menanti hasil audit BPKP serta petunjuk dari Kejatisu tentang dokumen-dokumen yang harus dilengkapi. “ Kejari Tanjungbalai tidak pernah berniat menghentikan penyelidikan dugaan korupsi MTQN ke 31,” tegas Kajari. Setelah menerima penjelasan Kajari, massa kemudian membubarkan diri dengan tertib. (a37)

Mereka Rusak Jalan Kami JALANAN berlubang, bergelombang, bahkan berlumpur sudah jadi santapan sehari-hari warga Seikepayang Timur, Kab. Asahan. Jalan semakin parah, perbaikan tak kunjung datang. Ironisnya, menjelang akhir 2009 ini, kerusakannya kian bertambah diduga akibat banyaknya truk pengangkut material proyek yang melintas di jalan itu. “ Jika melintas di desa kami ini, harus ekstra hati-hati, selain sempit, badan jalan rusak, sehingga harus memperlambat laju kendaraan,” ujar Solihin Darma Panjaitan, warga Dusun IV, Desa Sei Taman, Kec Seikepayang Timur kepadaWaspada, Minggu (25/10). Katanya, di sini sering terjadi kecelakaan, akibat kondisi jalan yang rusak parah. “ Ban kereta masuk lubang, itu sudah biasa, bahkan pengendaranya juga sudah banyak yang terjatuh akibat menghantam lubang di badan jalan,” ujar Solihin. Truk Proyek Solihin mengungkapkan, kerusakan badan jalan di daerah mereka, memang bukan hal baru, tapi kondisinya kian mengkhawatirkan sejak dilintasi truk pengangkut material proyek yang sarat muatan. Setiap truk melintas, kata Solihin, sangat mengganggu pengguna jalan, khususnya pengendera sepeda motor. Penyebabnya, selain seenaknya saja melintas di tengah badan jalan, truk juga mengakibatkan peningkatan polusi debu di desa mereka. “ Truk-truk inilah yang me-

AEKKANOPAN (Waspada): Penjabat Bupati Kabupaten Labuhanbatu utara Drs H Daudsyah MM, diminta melakukan penertiban penambangan batu galian C yang beroperasi secara liar dan tidak memiliki izin di Kecamatan Na IX-X dan Kecamatan Aek Natas. “ Demi pemasukan bagi pendapatan Asli Daerah (PAD) sudah sepantasnya penjabat Bupati Labura Drs H Daudsyah MM, menertibkan usaha galian C yang kini kian marak beroperasi tanpa izin,” ujar warga Labura yang tidak ingin disebutkan namanya kepada Waspada, Senin (26/10). Menurutnya, saat ini ada sekitar 15 titik Lokasi yang melakukan penambangan batu mengunakan alat berat dimana mereka beroperasi dari siang hingga malam hari, dimana di antara sekian banyak pengusaha yang membuka usaha galian C hanya hitungan jari saja, yang sudah mengantonggi Surat Izin Pertambangan Daerah (SIPD) tentang pengalian sebagai syarat kelengkapan yang ditandatangani oleh Penjabat Bupati Kabupaten Labuhanbatu Utara, selebih nya masih beroperasi secara liar. “Pengurusan itupun mereka lakukan sekira bulan Juni 2009 kemarin kala itu ada razia besarbesaran yang dilakukan petugas dari Polres Labuhanbatu terhadap para pengusaha galian C. Dalam rajia tersebut sejumlah alat berat yang beroperasi tak mengantongi ijin sempat disita oleh petugas, namun tak tau apa sebabnya

kemudian para penambang liar kembali beroperasi melakukan galian C tanpa melengkapi izin dahulu,” ujarnya. Pantauan Waspada, lokasi yang dilakukan kegiatan penambangan batu di Kabupaten Labuhanbatu Utara mengunakan alat berat antara lain dikecamatan Na IX-X di daerah PT KD ada 5 Lokasi mereka melakukan penambangan batu petrun untuk suplier material proyek pengaspalan dan pengerasan jalan. Selanjutnya di daerah Kongsi Enam, Kecamatan Aek natas ada 4 lokasi pengalian tanah sertu dan di dekat Simpang menuju Dusun Sirata-rata, Desa terang Bulan ada 3 lokasi, kemudian Di Desa Kuala Beringin, Kecamatan Kualuhhulu ada 2 titik serta yang paling baru di pinggir Jalinsum, di Desa Siamporik, Kecamatan Kualuh Selatan, yakni lokasi pengalian tanah timbun lokasi itu diduga belum mengantonggi izin resmi. Belum lengkapnya izin para penambangan galian C juga dibenarkan Ir Paijo, Kepala Dinas Pekerjaan dan Pertambangan Energi. Menurutnya, pihaknya telah mengirimkan surat teguran kepada pengusaha penambangan batu agar melengkapi ijin. Selain izin dari kita, katanya, mereka juga harus melengkapi izin dari Dinas Kehutanan tentang rencana lokasi selanjutnya mereka harus melengkapi izin Amdal dari Dinas Lingkungan hidup. (a29)

Anggota Dewan Tidak Tahu Anggaran Pendidikan Batubara Lebih 30 Persen LIMAPULUH(Waspada):Anggota DPRD Batubara mengaku tidak mengetahui bahwa anggaran untuk bidang pendidikan 30 persen lebih dari target 20 persen karena hanya mengamati dari laporan nota keuangan bupati atas RAPBD Tahun 2010 yang disampaikan. “Makanya kami menginterupsi kepada pimpinan terkait pandangan umum fraksi sebelumnya menyoroti anggaran pendidikan,’’ sebut H Amin, LC Anggota Fraksi Partai Bintang Reformasi (FPBR) DPRD Kab. Batubara dalam sidang paripurna jawaban bupati atas RAPBD Tahun 2010 dan dua Ranperda, Senin (26/10). Sidang yang dipimpin Ketua H Surya, BSc dihadiri 27 anggota dewan yang menanda tangani daftar abstain,Bupati Batubara diwakili Asisten I Sakti Alam Siregar, SH dan para pejabat maupun Muspida. Selain itu juga dilakukan pembentukan Pansus A dan B untuk membahas dua Ranperda yang diajukan eksekutif terdiri dari Ranperda pokok pengelolaan keuangan daerah dan organisasi tata kerja penangulangan bencana alam.

Bentuk Pansus Sidang sempat diskor selama 15 menit oleh pimpinan dewan karena meminta masingmasing fraksi untuk mengajukan anggotanya kedalam Pansus dan memilih kepengurusan Pansus. Hasil rapat anggota dewan Pansus A (Tentang pokok pengelolalaan keuangan daerah) Ketua Sahari, SH, Wakil Ketua Hidayat, SPd.MSi, Sekretaris Suharto, BA, H Amin Lc, Faisal SP, Usman Siddik, Drs Usman Marpaung, Drs Syahroni dan Effendi Tanjung (anggota). Pansus B (Organisasi tata kerja penangulangan bencana alam) terpiih sebagai Ketua Ir Koesmayadi, Wakil Ketua, Suriyono, Sekretaris, Herwan Hendra Koto, Syahlan, SH, Ramli Hsb, H Nadjanul Fadli,Usman Sani dan Selamat Arifin, SE. “Dalam hal ini Pansus benar-benar bekerja melakukan pembahasan tehadap Ranperda agar nantinya menjadi acuan Pemkab menjalankan program pembangunan,” harap Surya.(a11)

Hj Fatmawaty Ketua DPRD DS 2009-2014 LUBUK PAKAM ( Waspada) : Dewan Perwakilan Rakyat Daerah (DPRD) Deliserdang masa jabatan 2009-2014 dalam sidang paripurna dewan dipimpin Ketua sementara Hj Fatmawati didam pingi Wakil Ketua sementara Ruben Tarigan SE, Senin (26/10) menetapkan pimpinan DPRD Kabupaten Deliserdang masa jabatan 2009-2014. Penetapan pimpinan DPRD Deliserdang 2009-2014 berdasarkan surat rekomendasi DPP Partai Demokrat nomor 158/RKMD/ DPP.PD/VIII/2009 tentang penjaringan unsur pimpinan DPRD Kabupaten Deliserdang.Surat DPP PDI Perjuangan nomor 2795/IN/DPP/ VIII/2009 perihal pengesahan calon pimpinan DPRD kabupaten Serdang. Selanjutnya surat keputusan DPD Partai Golkar Sumut nomor : KEP.270/GK-SU/IX/ 2009 tentang penetapan pimpinan DPRD kabupaten Deliserdang serta surat keputusan

Ketua Umum DPD PKS Deliserdang nomor 050/Skep/AB-03-PKS/1430 tentang penunjukan wakil ketua DPRD Deliserdang. Kemudian memperhatikan surat Menteri Dalam Negeri nomor 161/3405/SJ perihal pelaksanaan tugas dan fungsi DPRD Provinsi/Kabupaten/Kota masa jabatan 2009-2014 serta hasil rapat paripurna DPRD Kabupaten Deliserdang, sidang hari itu (Senin,26/10) menetapkan pimpinan DPRD Kabupaten Deliserdang masa jabatan 2009-2014 terdiri dari satu ketua dengan tiga wakil ketua masing-masing Hj Fatmawaty.T (Ketua), H Wagirin Arman (Wakil Ketua), Ruben Tarigan, SE (Wakil Ketua) dan H Dwi Andi Syahputra Lubis (Wakil Ketua) Hadir pada penetapan pimpinan DPRD Kabupaten Deliserdang masa jabatan 20092014, Wakil Bupati Deliserdang H Zainuddin Mars, Muspida Deliserdang serta sejumlah Kadis, Kakan, Kaban sejajaran Pemkab Deliserdang.(a05)

Mobil Dinas DPRD Langkat Belum Dikembalikan STABAT (Waspada): Beberapa mobil dinas DPRD Langkat hingga kini belum dikembalikan pejabat lama. Sejumlah mobil yang dimaksud di antaranya mobil dinas Ketua DPRD merek Nissan X Trail, mobil ketua komisi, fraksi dan mobil operasional dewan. Hal itu dibenarkan Ketua DPRD Langkat sementara, Rudi Hartono Bangun, Senin (26/ 10). Secara terpisah juga dibenarkan Sekwan, Supono. Menurut Supono sebelumnya mereka telah mengingatkan kepada pejabat lama untuk mengembalikan mobil dinas, tetapi hanya sebagian kecil yang mentaatinya. Pihaknya masih menunggu pengembalian itu, jika dalam waktu yang belum ditentukan mantan anggota dewan

belum mengembalikan mobil dinas, Sekwan akan menyurati Bupati Langkat untuk menegur. Sementara data yang diperoleh dari Kabag Umum Pemkab Langkat, Suprianto dan juga beberapa staf di DPRD, beberapa mobil yang dipakai mantan anggota dewan ada telah dikembalikan, tetapi belum secara resmi diserahterimakan kepada pejabat baru. Begitupun dominan masih dipakai pejabat lama. Akibat diulurnya pengembalian itu, pejabat baru terpaksa tidak menggunakan fasilitas negara yang seharusnya diperuntukkan untuk melancarkan aktifitas mereka. Sebagian mobil yang belum dikembalikan masih dipakai dan disimpan di rumah pejabat lama masingmasing. (a38)

Tuan Guru Babussalam: Thariqat Naqsyabandiyah Terus Berkembang SWADAYA MASYARAKAT : Badan Jalan di Kec Seikepayang Timur, Kab Asahan rusak parah diduga akibat banyaknya truk pengangkut material proyek yang melintas. Permohonan perbaikan kepada Pemerintah telah disampaikan, namun tak kunjung terealisasi sehingga masyarakat bergotong royong memperbaiki sendiri jalan yang rusak itu. Foto direkam, Minggu (25/10). ngakibatkan jalan kami semakin rusak parah, sudahlah melintas sambil beriring-iringan, eh malah menimbulkan polusi debu dan mengancam kesehatan masyarakat di sini,” tukas Solihin. Jalan yang rusak, sudah dilaporkan Solihin dan warga lainnya kepada Pemkab Asahan melalui Dinas Pekerjaan Umum. Akan tetapi, lanjut Solihin, aspirasi mereka tak kunjung disahuti. “Sudah capek kami melaporkannya ke Dinas PU tentang jalan kami yang rusak parah akibat dilintasi truk-truk pengangkut material proyek dengan sarat muatan, tapi tak pernah digubris,” ketus Solihin. Oleh sebab itu, lanjut Solihin, akhirnya warga bergotong royong memperbaiki badan jalan yang rusak dengan memanfaatkan dana swadaya

masyarakat. Lobang di badan jalan, ditimbun batu dan dilapisi tanah serta pasir. Semuanya dikerjakan masyarakat secara manual dan bergiliran. “ Capek kami menunggu janji Pemerintah, jadi lebih baik kami bergotong royong memperbaiki jalan yang rusak,” ujar Solihin. Pantauan Waspada, truk yang diduga sebagai penyebab kerusakan jalan di Seikepayang Timur, mengangkut material proyek untuk kegiatan yang dikelola Dinas Pekerjaan Umum, di antaranya rekonstruksi tembok penahan tanah pada ruas jalan Gertak Serang-Sei Pasir di Desa Sei Lunang serta peningkatan jalan dan pemasangan tembok penahan tanah jalan jurusan Desa Sei Pasir-Sarang Helang sepanjang 4 kilometer di Seikepayang Timur. Rahmad F Siregar

STABAT (Waspada): Ajaran Thariqat Naqsyabandiyah terbuka bagi setiap muslim yang ingin mengetahui, mempelajari dan mengamalkannya. Thariqat Naqsyabandiyah yang dikembangkan Tuan Guru Babussalam yang pertama Syekh Abdul Wahab Rokan hingga kini terus berkembang ke seluruh pelosok tanah air bahkan ada di sejumlah negara ASEAN seperti Malaysia, Singapura dan Brunai Darussalam. ‘’Silahkan datang ke Babussalam di Langkat untuk mengetahui ajarannya secara mendalam,’’ kata Tuan Guru Babussalam Syekh Hasyim Al Syarwani seusai menerima kunjungan Pengurus Lembaga Dakwah Islam Indonesia (LDII) Medan yang diketuai H. Agus Purwanto

di Madrasah Besar Babussalam , Sabtu (24/ 10). Menurut Syekh Hasyim , ajaran thariqat hingga kini tetap relavan , walau ada sejumlah pihak ketiga yang membuat beragam isu yang menyesatkan. Silang pendapat mengenai ajaran Thariqat naqsyabandiyah, dapat terjadi bila umat yang memahaminya setengah-setengah, karena itu kata Tuan Guru Babussalam Syekh Hasyim Al Syarwani, sebaiknya datang ke Babussalam dan mempertanyakannya secara jelas dan transparan. Dalam kesempatan itu Tuan Guru juga menjelaskan riwayat singkat keberadaan Thariqat Naqsyabandiyah yang dikembangkan oleh Syekh Abdul Wahab Rokan sejak dulu hingga sekarang ini. (a01/a38)

DS Harus Mampu Dijadikan Daerah Wisata Pertanian LUBUK PAKAM (Waspada) : Deliserdang yangsudahdikenalsebagaidaerahsentrapertanian dan buah-buahan unggulan dan dibanggakan harus memiliki obsesi yang besar dalam mewujudkan wisata pertanian. Hal itu ditekankanWakil Bupati Deliserdang H. Zainuddin Mars di hadapan ratusan peserta dan pengunjung pada pembukaan Pekan Pasar Petani dan Tanaman Hias Deliserdang di gedung Dewan Kerajinan Nasional (Dekrnasda) Deliserdang, Lubuk Pakam, Kamis (22/10). Hadir Wakil Ketua TP PKK Ny Hj. Asdiana Zainuddin Mars, Kadis Pertanian Ir. H. Wirdan Yusuf Rangkuti, MMA, Kadis Perindag Ir. H. Marapinta Harahap, MM, MAP, Kadis Kehutanan Ir. Arli, Pl Asisten I Ir. H. Irman Dj Oemar, Kadis Pariwisata dan Kebudayaan Drs. M. Iqbal Nasu-

tion, Kacab BRI Lubuk Pakam Kusnadi serta para camat se Deliserdang. Kadis Pertanian Deliserdang melalui panitia pelaksana yang juga Kabid Pertanian Ir. H. Maimuddin Nasution menjelaskan, Deliserdang memiliki potensi pertanian bidang pangan dan holtikultura seluas 109.251 hektare terdiri dari lahansawah42.842hektaredanlahankeringseluas 66.409 hektare. Sedangkan komoditas pertanian terdiri dari padi sawah, padi ladang, palawija, dan holtikultura. Sebagai komoditas unggulan, kata Maimuddin, Deliserdang mengutamakan pisang barangan, belimbing, jambu biji deli, duku, manggis, durian, salak ponti (salak pondok Tiga Juhar) dan sebagai komoditas andalan adalah padi, jagung dan kedelai. (a05)

Sumatera Utara

WASPADA Rabu 28 Oktober 2009

Lagi, Proyek Dinas Pekerjaan Umum Tanjungbalai Diduga Asal Jadi TANJUNGBALAI (Waspada) : Proyek pembangunan yang dikelola Dinas Pekerjaan Umum Kota Tanjungbalai, kembali diduga asal jadi atau menyalahi bestek. Peningkatan Jalan HM Nur, Kel Pahang, Kec Datuk Bandar, senilaiRp795.103.000bersumberdaridanaAPBDTA2009,pekerjaannya menjadi sorotan masyarakat, karena pemasangan batu padas tanpa melalui proses penimbunan tanah uruk. Pengakuan warga kepada Waspada, Selasa (27/10), mereka kecewa, karena melihat proses pekerjaannya banyak yang diduga menyimpang. “ Seharusnya, badan jalan yang akan dibangun itu, ditimbun tanah uruk, baru ditimpa lagi dengan batu padas dan padatkan dengan alat berat. Akan tetapi, realita di lapangan, batu padas langsung dipasang, tanpa pemadatan menggunakan tanah uruk,” ungkap warga. Selain itu, lanjut warga, batu padas yang disusun di badan jalan itu, ukurannya diragukan sesuai dengan ketentuan. Di samping ukurannya kecil, usia batu padas juga masih muda, sehingga rapuh dan dikhawatirkan tidak akan mampu menahan beban kenderaan yang melintas di badan jalan tersebut. Lebih parahnya lagi, kata warga, sejak pekerjaan itu dimulai, tidak ada satupun pengawas dari Dinas PU Tanjungbalai yang turun kelokasi.Haliniterungkapberdasarkanhasilpantauanwargaditambah lagi dengan keterangan sejumlah pekerja. “ Pengakuan pekerja, pengawas dari Dinas PU Tanjungbalai tak pernah datang ke lokasi kegiatan,” ungkap warga. Kepala Dinas Pekerjaan Umum Kota Tanjungbalai, Abdul Aziz, dicoba dikonfirmasi di kantornya, tidak berhasil. Menurut sejumlah stafnya, Kepala Dinas jarang masuk kantor. (a37)

KPU Batubara Tepis Isu Penambahan Kursi LIMAPULUH(Waspada):KPUBatubaramenepisisupenambahan kursi legislatif di daerah pemilihan empat Kecamatan Tanjung Tiram dan Talawi, Kab. Batubara. Melalui anggota KPU Divisi Hubungan Masyarakat dan Antar Lembaga Taufik Abdi Hidaya.S,Sos kepada Waspada, Selasa (27/ 10) mengakui ada mendengar isu tentang penambahan kursi di dapil empat Batubara. Tapi hingga hari ini kabar itu masih sebatas isu saja. Namun ia mengakui ada permohonan dari pihak tertentu seperti partai politik yang mengajukan opsi penambahan kursi sekaitan dengan perimbangan jumlah pemilih dengan kuota kursi yang ada di dapil empat. “ KPU Batubara tidak memiliki wewenang untuk memutuskan penambahan atau pengurangan kursi, meskipun aturan untuk itu memang membolehkan, keputusan itu hanya dapat dilakukan KPU pusat,” kata Taufik. Untuk itu KPU Batubara hanya mengetahui jumlah anggota DPRD yang akan dilantik pada 24 November mendatang masih tetap berjumlah 35 orang. (a31)

Satu Keluarga Keracunan Jamur TANJUNGBALAI (Waspada) : Satu keluarga di Jalan PT Timur Jaya, Kel. Beting Kwala Kapias, Kec. Teluk Nibung, keracunan jamur, sehingga dilarikan dan dirawat intensif di RSUD Tanjungbalai, Senin (26/10) malam. Informasi yang dihimpun Waspada, Senin sore, keluarga yang terdiri dari 3 orang ini, yakni Rohani, 48, Wartia, 45, dan Kartika Ayu, 27, diduga keracunan karena kondisi tubuhnya lemas, mual dan pusing disertai muntah. Sebelumnya, mereka menyantap jamur yang diperoleh dari sekitar rumahnya, untuk disantap sebagai lauk makan siang. Akan tetapi, seusai menyantai makanan itu, ketiganya merasa mual dan lemas. Dan, 4 jam berikutnya, mereka muntah-muntah, sehingga langsung dilarikan ke RSUD Tanjungbalai. Hasil pemeriksaan medis, ketiganya positif keracunan jamur. Oleh sebab itu, untuk memulihkan kondisinya, maka mereka terpaksa menjalani rawat inap di rumah sakit. Satu malam dirawat dan ditangani dr Jalil Rambe, SpPD, ketiganya akhirnya dinyatakan sembuh dan diizinkan pulang ke rumah, Selasa pagi. Direktur RSUD Tanjungbalai Diah Retno dikonfirmasi melalui Bagian Humas Cosmas Siagian, membenarkan ketiga pasien itu keracunan jamur. “ Setelah dirawat intensif, ketiganya dinyatakan sembuh dan diizinkan pulang,” ujar Siagian. (a37)

Spanduk Prihatin Terpampang Di Rantauprapat RANTAUPRAPAT(Waspada):“Selamat Datang, di Kota Pendidikan Prostitusi Rantauprapat”. Setidaknya itu yang tertulis pada sebuah spanduk yang mengatas namakan Himpunan Mahasiswa Islam (HMI) Cabang Labuhanbatu, yang masih terlihat terpasang Minggu (25/10) di Jalinsum, tepatnya sekira 30 meter mendapatkan tugu selamat datang Kota Rantauprapat, yang juga sekira 70 meter mendapatkan gubuk tenda biru/warung esek-esek. Tidak diketahui pasti apa tujuan pesan spanduk itu. Namun setiap pengendara yang melintas memaknakan slogan itu sebagai pesan moral yang ditujukan bagi warung–warung yang menggelontor di sepanjang pinggiran Jalinsum, yang memakai tenda biru, tepatnya di areal perkebunan PTPN3 Janji Rantauprapat, yang hingga kini belum mampu ditertibkan Pemkab Labuhanbatu. Sumber mengatakan, beberapa waktu lalu pihak PTPN menyerahkan sepenuhnya kepada Pemkab Labuhanbatu terkait penggusurannya. Sebab dalam bertindak, mereka selalu melayangkan surat guna meminta bantuan Kepada Satuan Polisi Pamong Praja (Satpol PP). Kabag Humas Pemkab Labuhanbatu Drs Sugeng, ketika dikonfirmasi wartawan terkait keberadaan warung esek-esek dan juga spanduk milik HMI Labuhanbatu mengatakan, dalam waktu dekat, tim terpadu akan melakukan rapat terkait akan adanya penggusuran. (c01)

Pendukung Gugatan DPRD Batubara Bertambah LIMAPULUH (Waspada): Kisruh legalitas DPRD Batu Bara yang tetap melaksanakan kegiatan dinas dewan setelah masa bakti berakhir menambah panjang barisan elemen yang akan menggugat lembaga legislatif itu ke lembaga hukum. Ketua DPC Partai Patriot Batubara Ahmad Zainuri kepada Waspada, Selasa (27/10) menyatakan, SK Gubsu itu dalam konsiderannya dengan tegas menyatakan, masa bakti DPRD hasil pemekaran Kab. Asahan telah habis pada 7 September 2009. “Yang harus dilakukan DPRD adalah mempersiapkan pelantikan, bukan malah membahas RAPBD 2010,” kata Zainuri. Politisi muda dari Partai Patriot ini juga menyoroti kegiatan dinas kedewanan yang mengakibatkan keluarnya dana negara. DPC Partai Patriot Batubara menilai kegiatan itu bisa saja berdampak pada pelanggaran hukum.. Ia juga menyayangkan sikap anggota DPRD dari partainya yang terus saja mengikuti kegiatan kedewanan meskipun masa baktinya telah berakhir. (a31)

Kondisi Jalan Tarutung-Sibolga Mulus


JALAN MULUS: Kondisi Jalan Tarutung-Sibolga sudah mulus setelah diperbaiki Dinas Bina Marga Provsu. Sebelumnya jalan ini rusak berat sehingga para pengendara kendaraan selalu resah.

Balita Di Asahan, Tiga Kali Masuk Rumah Sakit Akibat Gizi Buruk TANJUNGBALAI (Waspada): Seorang balita asal Kabupaten Asahan, kembali dirawat inap di RSUD Tanjungbalai akibat terjangkit gizi buruk, Selasa (27/10). Pasien itu, Fadli, 14 bulan, anak pasangan Juli, 33, dan Titit, 32, warga Dusun III, Desa Bagan Asahan Pekan, KecTanjungbalai, Asahan. Dia dirawat di rumah sakit untuk ketiga kalinya dengan penyakit yang sama. Berat badan anak ke 7 dari 8 bersaudara itu, hanya 5 kg, atau di bawah berat badan standar menurut Departemen Kesehatan. Selain itu, wajahnya cekung dan kelihatan seperti orang tua. Rambut kemerah-merahan, dan kulitnya mengendur serta banyak yang terkelupas. “ Kondisinya cukup parah, dan ini merupakan kali ketiga dia dirawat di sini. Selain sesak nafas, di lehernya terjadi pembengkakan,” kata Direktur RSUD Tanjungbalai Diah Retno melalui Bagian Humas Cosmas Siagian. Dijelaskan Siagian, pertama kali dirawat di rumah sakit, korban sudah dinyatakan sembuh dan diizinkan pulang. Akan tetapi, pertengahan 2009 lalu, jelas Siagian, Fadli kembali masuk dan dirawat di rumah sakit dalam kondisi kritis. “ Setelah dirawat dan diobati secara

Waspada/Rahmad F Siregar

DIRAWAT: Fadli, 14 bulan, anak pasangan Juli, 33, dan Titit, 32, warga Dusun III, Desa Bagan Asahan Pekan, Kec. Tanjungbalai, Asahan, dirawat inap ketiga kalinya di RSUD Tanjungbalai akibat gizi buruk. Selain cekung, wajahnya seperti orang tua, rambut kemerah-merahan dan kulitnya mengendur serta terkelupas. Foto direkam, Selasa (27/10). intensif, dia sembuh dan diizinkan pulang, namun hari ini pasien ini datang lagi dan terpaksa dirawat inap kembali karena kondisinya cukup parah akibat gizi buruk,” jelas Siagian. Dikatakan, penyebab balita itu kembali terjangkit gizi buruk diduga akibat pola makan yang buruk dan kurangnya kebersihan lingkungan di tempat tinggalnya. Siagian menambahkan, meskipun pasien ini warga Kabupaten Asahan, tapi pihak rumah sakit akan berupaya maksimal merawat dan mengobati-

Tinjau Ulang Penyaluran Beasiswa Labuhanbatu MEDAN (Waspada): Himpunan Mahasiswa Labuhanbatu (Himlab) minta Pemkab Labuhanbatu meninjau ulang penyaluran beasiswa kepada 35 mahasiswa senilai ratusan juta rupiah yang direalisasikan 19 Oktober 2009 karena diduga sarat Korupsi Kolusi dan Nepotisme (KKN). “Kami minta Bapak Bupati Labuhanbatu meninjau ulang dan mengaudir kembali namanama penerima beasiswa,” kata Ketua Umum Himlab Musrizal Satria didampingi Nasruddin, senior DPP Himlab Medan, Senin (26/10) di Medan. Musrizal mengatakan proses seleksi calon penerima beasiswa Pemkab Labuhanbatu Induk yang dilakukan panitia penyelenggara dan penyalur beasiswa hanya sebagai formalitas karena proses penyeleksiannya dilakukan secara sepihak dan tidak transparan atau tidak sesuai petunjuk Pemkab Labuhanbatu. “Sejatinya, beasiswa diberikan kepada mahasiswa dari keluarga miskin dan memiliki prestasi baik. Tapi sebaliknya malah beasiswa dialihkan kepada mahasiswa dari keluarga kaya dan mampu yang semestinya dianggap tidak layak untuk menerimanya,” ujar Musrizal. Disinyalir telah tejadi penyaluran beasiswa kepada kelompok mahasiswa fiktip yang mengatasnamakan Himlab Jakarta. Padahal menurut Musrizal Himlab yang sah adalah DPP Himlab Medan. Menurut Musrizal hal ini juga pernah diucapkan Sekda

Kisaran Mustopa melalui Wakil Panitera Armiwaty dikonfirmasi Waspada, Selasa (27/10) di ruang kerjanya. “ Gugatan cerai ini banyak dari kalangan kaum istri yang ditinggal suaminya, dan juga faktor ekonomi,” ujar Darwati. Selain itu, katanya, perceraian antara suami dan istri ini disebabkan kurangnya har-

monis dalam rumah tangga, sehingga perceraian menjadi jalan terbaik bagi pasangan tersebut. “ Bila pasangan merasakan tidak ada kecocokan lagi, maka perceraianlah yang akan ditempuh mereka,” ujar Darwati. Lebih lanjut Darwati menjelaskan, Pangadilan Agama tidak menerima semua kasus gugatan

MEDAN (Waspada): Kondisi Jalan TarutungSibolga saat ini kembali mulus setelah beberapa lama mengalami kerusakan. Saat ini jalan tersebut tidak berlobang lagi, sehingga para pengendara kendaraantidakresahlagimelintas.Denganadanya perbaikan jalan tersebut, maka perekonomian warga akan semakin meningkat. “Masyarakat di sini tidak resah lagi melintas di jalan ini. Sebelumnya, para pengendara yang hendak melewati jalan ini selalu resah karena kondisinya sangat parah. Tapi setelah ada perbaikan dari Dinas Bina Marga Provinsi Sumatera Utara, pengendara tidak kesusahan lagi lewat dari jalan tersebut,” kata T Silaban warga Desa Tahuis, KecamatanTahuis,Tarutung kepada Waspada, Senin (27/10). Silabanmengungkapkan,terjadinyakerusakan di beberapa titik jalan, salah satunya diakibatkan banyaknya bangunan warga yang menutup saluran parit atau membuka usaha door smeer sehingga airnya selalu mengalir ke jalan. Selain itu, bila hujan turun, maka aliran air naik ke jalan karena tersumbat oleh bangunan itu. “Kalau saat ini kondisi jalan ini sudah bagus. Kita minta kepada pemerintah agar tetap memperbaikinya supaya tetap bagus. Namun, diminta kepada Pemkab Tarutung agar kiranya dapat menertibkanbangunanyangberadadiatassaluran parit yang digunakan untuk door smeer,” ucap Silaban. Ditambahkan, warga di sana sangat berterima kasihkepadapemerintahyangsetiapsaatmemperbaiki jalan itu. Saat ini kami merasa lega karena kondisi jalan lebih baik, namun sangat diharapkan agar seterusnya diperbaiki.

Labuhanbatu Aspan Ritonga usai menghadiri acara silaturahim dan halal bi halal Ikatan Keluarga Labuhanbatu (IKLAB) Medan dan sekitarnya di Hotel Madani Medan beberapa waktu lalu, Himlab DPP Medan menyatu ke Himlab Medan di bawah naungan IKLAB Medan tidak pernah dilibatkan dalam penyelenggaraan beasiswa. Musrizal juga menjelaskan, ketika pihaknya menanyakan soal pelaksanaan interview terhadap calon penerima beasiswa kepada ketua panitia penyelenggara beasiswa Rahman yang mengaku dari Aliansi Mahasiswa se-Indonesia menjawab interview dilakukan dari kalangan Pemkab Labuhanbatu. Namun setelah ditelusuri, katanya, kenyataannya pelaksana interview bukan dari kalangan Pemkab Labuhanbatu melainkan dari kalangan aliansi itu sendiri. “Ini jelas tidak transparan dan tidak murni dalam penyeleksian beasiswa,” tegasnya. Sekretaris Umum Himlab Medan Fakhruddin Nasution menyebutkan pengumuman pendaftaran beasiswa yang dilakukan Pemkab Labuhanbatu sangat singkat dan sangat tertutup sehingga sebagian kecil saja mahasiswa yang mendapatkan informasi. Itupun hanya mahasiswa yang memiliki kedekatan emosional dengan panitia. “Kami melihat dari tahun ke tahun proses penyaluran beasiswa dilakukan seperti ini dan pembagiannya dilakukan sesuai porsi masing-masing dengan melakukan negosiasi,” tudingnya. (m07)

cerai, disebabakan tidak memenuhi persayaratan yang berlaku, dan ada juga gugatan yang dicabut oleh penggugat. “ Selama sembilan bulan kami menerima 749 gugatan, namun yang kami terima hanya 352 gugatan, selainya batal atau dicabut oleh penggugatnya,” ungkapnya. (csap)

nya hingga sembuh total. Penanganan terhadap korban, kata Siagian, akan diprioritaskan pada perbaikan gizi terlebih dahulu. Dan, lanjutnya, untuk mempercepat pemulihan Fadli, pihaknya akan memberikan makanan tambahan pengganti ASI dan vitamin lainnya, termasuk mineral mix. (a37)

“Kami sangat mengharapkan agar pemerintah terus menerus memperbaiki jalan tersebut. Karena bila jalan ini rusak, maka penghasilan kami juga akan menurun. Selain itu, arus lalulintas juga menjadi lancar,” pungkas Silaban. Demikian juga dikatakan, Samuel Sinaga salah seorang sopir yang setiap saat melintas di jalan itu. Menurut dia, adanya program pembangunan jalan diTarutung-Sibolga sangat menunjang kesejahteraan masyarakat. Para sopir tidak lagi resah melintas di jalan itu karena sudah mulus. “Selama ini kondisi jalan ini cukup memprihatinkan, namun sekarang sudah kembali mulus. Para pengendara tidak perlu lagi ragu untuk melintas karena jalan sudah baik. Kami mengucapkan terimakasih kepada Dinas Bina Marga yang telah memperbaiki jalan tersebut,” ucapnya. Ditambahkannya, biasanya bila hujan sudah turun, maka para sopir selalu pusing. Pasalnya kondisi jalan itu sudah seperti kubangan kerbau, tapi saat ini sudah mulus. Diharapkan setelah adanya perbaikan jalan ini, maka diharapkan kepada pemerintah Kabupaten agar dapat menertibkan bangunan-bangunan yang berada di atas saluran parit. Karena bila bangunan itu tidak dibongkar, maka bila hujan turun selalu menggenangi jalan. Selain itu, truk yang melebihi tonase agar segera ditindak bila melintas di jalan ini. Kalau truk itu bebas melintas, maka sudah pasti jalan tidak tahan lama. “Kami harapkan perbaikan jalan ini jangan menunggu sampai rusak berat. Pemkab harus bertindak dengan melakukan pengawasan ketat terhadap truk yang melebihi tonase melintas di jalan ini,” papar Sinaga. (h10)

Berat Badan Akbar Risuddin Turun LIMAPULUH (Waspada) : Muhammad Akbar Risuddin (bayi Besar) kembali sakit, dan berat badannya turun 3 gram. “ Akbar menderita batuk-batuk, demam dan berat badannya turun 3 gram,” ungkap ayah bayi Hasanuddin yang dikonfirmasi Waspada, Senin (26/10) di kediamannya di Dusun I, Desa Bulanbulan, Kec. Limapuluh, Kab. Batubara. Namun demikian, kata Hasanuddin, kesehatan bayi sudah diperiksa oleh pihak Dinas Kesehatan Batubara dan sudah diberi obat. “ Pihak Dinas Kesehatan telah memeriksa bayi saya, dan kata mereka Akbar dalam kondisi sehat,” kata Hasanuddin. Sementara Kabag Humas Batubara Efrianis menyatakan tetap memantau kesehatan bayi, dan pihaknya sudah berkordinasi dengan pihak RSU H Abdul Manan Simatupang Kisaran.

Selama 9 Bulan Pengadilan Agama Asahan Tangani 352 Kasus KISARAN (Waspada): Selama 9 bulan Pengadilan Agama Kab Asahan menerima 352 kasus gugatan percerai, dan yang diputuskan hanya 306 kasus. “ Sembilan bulan ini, kami terima 352 kasus gugatan cerai, dan yang diputuskan hanya 306 kasus, dan berhasil didamaikan (mediasi) sebanyak 32 kasus,” jelas Ketua Pengadilan Agama


Sedangkan,DokterSpesialisAnakRSUHAbdul Manan Simatupang Kisaran mengakui, Pemkab Batubara dan orang tua bayi belum ada menghubunginya tentang perkembangan bayi tersebut. “ Hingga saat ini saya tidak tahu keadaan bayi, karena tidak ada laporan dari orang tuanya, atau pemerintah setempat,” ujar Alfian. Padahal, kata Alfian, sebelumnya saat mereka pulang dari rumah sakit, diminta untuk segera melaporkankepadanya,apabilaadaterjadisesuatu pada bayi itu. “ Bayi itu tergolong risiko tinggi terkena penyakit (high risk), jadi harus dipantau terus kesehatannya,” ungkapnya. Sebelumnya, pantauan Waspada, Selasa (10/ 10) berat bayi mencapai 9,4 kg dan meminum susu 120 gram per harinya, namun sekarang berat badanbayiturun3grammenjadi9,1kg,danminum susunya belum ada perubahan. (csap)

Ketua DPRD Asahan Ditetapkan, Golkar Pegang Kendali KISARAN (Waspada) : Ketua danWakil ketua DPRD Asahan priode 2009-2014 secara resmi ditetapkan pada Sidang Paripurna DPRD, Selasa, (27/10), dan pada hasil pentapan Golkar pegang kendali. Ketua Defenitif DPRD Asahan Benteng Panjaitan menjelaskan, berdasrakan hasil rapat DPD dan DPC masing-masing partai yang berhak mendapatkan kursi, mengajukan calonnya sebagi Ketua dan Wakil Ketua DPRD Asahan dan

berdasarakan surat Mendagri No.161/3405/SJ maka sidang ini digelar untuk menetapkan Ketua danWakil Ketua DPRD Asahan priode 2009-2014. “ Dengan demikian terpilih ketua DPRD Benteng Panjaitan, Wakil Ketua Arif Fansury Nasution (Fraksi Demokrat) dan Daron Hutagaol (Fraksi PAN), serta Armen Margolang (Fraksi PDI P),” ungkap Panjaitan, didampingi Wakil Ketua Defenitif Arif Fansury saat membacakan penetapan. (csap)

20 Serikat Pekerja Jadi Penyeimbang SOSA (Waspada): Serikat pekerja harus mampu menjadi penyeimbangmenciptakan perusahaanyangsehatdanparakaryawan atau pekerja yang sejahtera. Demikian kata Ketua Federasi Serikat Pekerja Perkebunan Indonesia (FSPPI), Ir H Syahruddin Ali, SH.MSi di aula Gedung Sopo Godang PTPN IV Kebun Sosa, Senin (26/10). Dia menyampaikan itu dalam acara pengukuhan Pengurus SP Bun PTP N IV Basis Kebun Sosa yang dipimpin ketua terpilih Rapotan Hasibuan untuk masa bhakti 2009-2014. Sementara, manejer PTP N IV Kebun Sosa, Ir. H. Sulaiman Lubis jugamenyampaikanhal senada,tetapidiamenekankanagarpengurus SPBun yang baru dilantik dapat bekerjasama dengan baik sebagai mitra perusahaan dalam meningkatkan produktivitas. Rapotan Hasibuan sebagai Ketua SP BUN PTP N IV Basis Kebun Sosa dalam kesempatan itu juga menyampaikan, kedudukan SP BUN memiliki peran penting sebagai mitra kerja dalam meningkatkan produktivitas perusahaan. Hadir dalam acara itu anggota DPRD Palas, Ir. H. Syarifuddin Hasibuan, Idham Hasibuan, Rinaldiansyah Hartas Hasibuan dan Amar Makruf Lubis yang juga Mantan Ketua SP BUN PTP N IV Basis Kebun Sosa, unsur Muspika, kepala desa, alim ulama, OKP dan tokoh masyarakat sekitar lingkungan perusahaan. (a32)

Dukungan Untuk H Akhmad Yasyir Ridho Lubis Mulai Mengalir MEDAN (Waspada): Dukungan terhadap Ketua KNPI Sumut, Ir. H AkhmadYasyir Ridho Loebis menjadi bakal calon bupati Madina mengalir.SebagaimanayangdiungkapkanWakilKetuaDewanPimpinan Pusat (DPP) Partai Persatuan Keadilan Indonesia (PKPI) Sumut Zaharuddin, Yasyir Ridho Loebis adalah sosok muda yang paling pantas untuk memimpin Kabupaten Madina lima tahun ke depan. “ Untuk itu, maka kita mengimbau kepada Dewan Pimpinan Kabupaten (DPK) Partai Persatuan Keadilan Indonesia (PKPI) Madina agar merapatkan barisan dan membangun komunikasi politik dengan H. AkhmadYasyir Ridho agar dapat mempersiapkan barisan supaya menang pada pilkada yang akan digelar,” ujar Zaharuddin didampingi Wakil Sekertaris DPP PKPI Sumut, Taufiq Hilmi Lubis Amd, Selasa (27/10). Dukungan tersebut menurut Zaharuddin benar- benar didasari penelitian dan kondisi yang objektif terhadap sosok calon Bupati Madina yang paling pantas ke depan. Sebab, jika salah memilih pemimpin maka pertama sekali di korbankan adalah rakyat Madina. “ Untuk itu kita ingin Madina ke depan lebih maju dan lebih sejahtera baik segi ekonomi maupun sosial, politik dan budaya. Sebab, dengan pemimpin muda yang energik dan memiliki sense of belonging, maka persoalan- persoalan yang ada diMadina dapat dituntaskan,” ujar Zaharuddin yang juga menjabat sebagai Sekretaris MPI KNPI Sumut ini. SudahsaatnyamasyarakatMadinamendapatkananginperubahan menuju ke arah yang lebih menjanjikan di masa era globalisasi ini. Dan itu hanya dapat dilakukan oleh seorang pemuda yang memiliki semangat juang dan komitmen membangun Madina menuju masa keemasan. (m43)

Guru Diminta Tingkatkan Mutu Pendidikan SIBOLANGIT (Waspada): 21 kepala sekolah dan 21 guru dari 21 Sekolah Dasar Negeri dan Swasta di Kecamatan Sibolangit, Kabupaten Deliserdang diberi pembekalan selama dua hari (1920/10). Bimbingan teknis tentang Rencana Kerja Sekolah (RKS) dan Rencana Kerja Tahunan (RKT) dilaksanakan di gedung SDN 101843 Bandarbaru. Narasumber terdiri dari Drs Tikwan Siregar, MPd mantan guru berprestasi tingkat nasional dan Dra Jumiem MM pengawas berprestasi TK, SD tahun 2008. Bimtek RKS dan RKT dilaksanakan berdasarkan surat Kadis Dikpora Kabupaten Deliserdang No: 800/8378/SKR/2009 tanggal 19 Agustus 2009. Sekaligus sebagai langkah menyahuti Permendagri No 19 tahun 2007 tentang Standar Pengelolaan Pendidikan oleh Satuan Pendidikan Dasar dan Menengah. KepalaCabangDinasPendidikan,PemudadanOlahraga(Kacabdis Dikpora) Kecamatan Sibolangit Amir Siddik, SPd dalam sambutannya saat membuka kegiatan menekankan pendidikan di Kecamatan Sibolangit harus mampu sejajar dengan kecamatan-kecamatan lain di Kabupaten Deliserdang yang selama ini tertinggal terus. Bimtek RKS dan RKT Kecamatan Sibolangit dipandu panitia pelaksana diketuai Rosen Tarigan,SPd, Sekretaris Yonny Bangun masing-masing Pengawas TK/SD, Bendahara Sinar Sembiring,SPd (Ka SDN 101845 Sukamakmur) dan anggota Carin Tarigan,SPd (Ka SDN 101843 Bandarbaru. (cat)

Syarfi Dan Marudut Resmi Maju SIBOLGA ( Waspada): Pasangan Syarfi-Marudut resmi mendaftarkan diri jadi balon Walikota Sibolga 2010-2015 melalui sejumlah parpol yakni PAN, PDIP dan Gerindra, secara terpisah Senin (26/10). Syarfi dan Marudut merupakan pasangan pertama mendaftar melalui jalur parpol sejak dibukanya pendaftaran penjaringan bakal calon (balon) Walikota dan Wakil Walikota oleh sejumlah partai politik (parpol) di Kota Sibolga. Pantauan pendaftaran pasangan Syarfi-Marudut ke sejumlah parpol itu dilaksanakan secara marathon diawali dari rumah PAN Sibolga, rumah rakyat PDIP Sibolga dan Kantor DPC Gerindra Sibolga. (a34)

Sumatera Utara Terkait Korupsi, Kadis PUD Sibolga Diperiksa SIBOLGA (Waspada) : Sejak bergulirnya kasus dugaan korupsi pengerjaan proyek pembuatan bronjong di lokasi sport centre tepat di Aek Parombunan, Kecamatan Sibolga Selatan, Sibolga yang dilaporkan oleh LSM TUMPAS yang dikerjakan CV DT berbiaya Rp870. 800.000 pada tahun anggaran 2007 lalu, tim tindak pidana korupsi (Tipikor) Polresta Sibolga sejak beberapa bulan lalu hingga sekarang belum dapat menetapkan tersangka yang terlibat dalam perkara itu. Menurut pantauan di kepolisian, pihak penegak hukum yakni tim Tipikor Polresta Sibolga sejauh ini masih berkutat kepada pemeriksaan saksi–saksi. Pada Selasa (27/10), Tipikor kembali memeriksa dua saksi yang diduga kuat terlibat langsung dalam proyek bermasalah itu yakni Kepala Dinas Pekerjaan Umum Daerah (Kadis PUD) Sibolga berinisial Ir RFL dan salah seorang rekanan berinisial PP. Keduanya, diperiksa kurang lebih selama dua jam di ruang Ketua tim Tipikor Polresta Sibolga, Ipda Erwin Tito, SH. Usai pemeriksaan Kadis PUD Sibolga Ir RFL yang mengenakan kemeja coklat dan celana coklat yang sempat akan dikonfirmasi sejumlah wartawan seperti gugup dan tidak memberi-

kan keterangan dengan berlalu dari kejaran wartawan menuju mobil Dinas PUD Sibolga pick up BB 8060 N yang diparkirkannya di samping Kantor Pos Sibolga. Usai dua saksi diperiksa secara intensif, Kapolresta Sibolga melalui Kepala tim Tipikor Ipda Erwin Tito, SH mengaku akan menyelesaikan perkara ini secepat mungkin, sebab pihaknya sangat berhati–hati dalam persoalan itu sebelum menetapkan siapa tersangka di balik kasus dugaan penyelewengan keuangan Negara tersebut. “Kasus ini cukup rumit, makanya Kita (Tipikor) sampai sekarang masih melakukan pemeriksaan kepada para saksi sebelum melangkah ke tahap selanjutnya. Artinya, kita harus hati–hati sebelum menentukan siapa tersangka dalam kasus ini,” katanya. Ipda Tito mengaku, dari hasil pemeriksaan sejumlah saksi, pihaknya telah menemukan benang merah (arah konkrit) siapa yang bakal ditetapkan menjadi tersangka. Tetapi, hal tersebut belum dapat secara gamblang ditentukan sebelum hasil pemeriksaan benar–benar akurat. Sebelumnya, tim Tipikor Polresta Sibolga segera mene-

tapkan tiga bakal calon tersangka utama kasus dugaan korupsi pengerjaan proyek pembuatan bronjong di lokasi sport centre tepat di Aek Parombunan, Kecamatan Sibolga Selatan, Sibolga yang dikerjakan CV. DT dengan biaya Rp870.800.000 anggaran 2007 lalu. Begitupun, Ipda Tito mengaku tidak menutup kemungkinan bakal terjadi penambahan jumlah tersangka lainnya yang terlibat. Sejauh ini, kata dia, tim Tipikor Polresta Sibolga sudah memeriksa sebanyak 14 orang saksi yang diduga terlibat langsung ataupun mengetahui pekerjaan proyek bronjong yang diadukan oleh LSM Tumpas. Namun, pihak Tipikor Polresta Sibolga masih harus berhati-hati untuk menetapkan tersangkanya, karena tidak ingin keliru dalam melaksanakan penyidikan untuk memastikan sampai sejauh mana dan apa peranan masingmasing dalam pekerjaan proyek bronjong di Aek Parombunan Sibolga tersebut. Setelah adanya penetapan status sebagai tersangka, pihak Polresta Sibolga akan langsung melakukan penahanan badan kepada para tersangka demi kelancaran pemeriksaan, dan untuk mempermudah pengembangan.(a18)

Trafo PLN Terbakar, Aliran Listrik Di Sibolga Terganggu SIBOLGA (Waspada): Satu unit trafo gardu PLN di Kec. Sibolga Selatan, Kota Sibolga berkapasitas 100 KVA terbakar, Minggu (25/10), akibatnya arus listrik padam lebih dari 20 jam dan baru menyala, Senin (26/10) sore. Lamanya proses pemadamanitumembuatpelanggan mengalamikeresahandanterganggu dalam melaksanakan aktivitas yanghanyamenggunakanlampu

penerang dari minyak tanah dan lilin. “Kerusakan sudah berhasil kita perbaiki dan arus listrik sudah mengalir dengan baik kembali ke rumah-rumah pelanggan,” kata Kepala PLN Cabang Sibolga melalui Manajer Umum Indra Ritonga, ketika dihubungi wartawan melalui telefon selularnya, Senin (26/10). Kerusakan, ujar Indra terjadi

Walikota P. Siantar Harus Berani Buat Perubahan P. SIANTAR (Waspada):Walikota Pematangsiantar ke depan harus berani membuat perubahan dan memiliki konsep yang jelas serta jangan seperti kepemimpinan 10 tahun sebelumnya jalan di tempat dan malah dalam era reformasi saat ini mengalami kemunduran dibanding masa orde baru. Berbagai harapan itu mengemuka saat berlangsungnya dialog publik dengan tema ‘Siantar 2010, Kepemimpinan Lokal dan Posisi Kaum Muda’ yang diselenggarakan Kelompok Kerja Studi Otonomi Politik dan Demokrasi (SOPo) yakni Ketua Armada Purba, SH dan Sekretaris Rudi Saragih, SE bersama Ketua BPH SOPo Kristian Silitonga, SH di Conventian Hall, Siantar Hotel, Kota Pematangsiantar, Senin (26/10). Dialog menghadirkan pembicara Sekda Pemkab Simalungun Ir Mahrum Sipayung, MSi, mantan Direktur RSUD Dr. Djasamen Saragih Dr. Ria Novida Telaumbanua, MKes dan mantan anggota DPRD Simalungun Ir Ilhamsyah Nasution bersama Sarbudin Panjaitan, SH, seorang pengamat politik dan kepemudaan serta

aktivis Octavianus Rumahorbo dengan moderator Fetra Tumanggor, SSos. Dua pembicara yang diundang terdiri Barkat Shah (Ketua Umum KONI) dan Ir Rajit Charamsar (mantan USAID) dinyatakan berhalangan. Sedang peserta yang mencapai seratusan lebih terdiri para generasi muda yang berasal dari berbagai latar belakang diantaranya organisasi kepemudaan seperti BKPRMI pimpinan Zainul Arifin Siregar, para aktivis LSM, mantan anggota DPRD seperti Achmad Mangantar Manik, tokoh agama, pendidikan seperti Ketua Dewan Pendidikan Kota Drs HM Natsir Armaya Siregar, Ketua PGRI Drs. Daniel Siregar dan lainnya. Mahrum Sipayung dan Ilhamsyah Nasution tidak menampik dan malah menegaskan akan maju sebagai calon walikota pada Pilkada tahun 2010, sedang Ria Novida Telaumbanua awalnya tidak terbuka, namun akhirnya tidak menampik ketika moderator menyebutkan berbagai kegiatan yang dilakukannya saat ini sudah menunjukkan hal itu. (a14)

secara alamiah dan bukan karena adanya gangguan akibat faktor lain seperti cuaca tetapi murni karena tingginya beban arus yang diterima trafo. Sehingga trafo tidak mampu menahan dan akhirnya terbakar secara mendadak. “Sejak terjadinya kerusakan itu, kita langsung menurunkan anggota untuk memperbaikinya. Tetapi karena proses perbaikan sulit, sehingga memakan waktu yang cukup lama,” tuturnya. Untuk mengantisipasi persoalanyangsama,pihakPLNtutur Indra akan melakukan perbaikan terhadap sejumlah trafo yang sudah termakan usia. Dan sejauh ini pihaknya sudah melakukan pergantian terhadap sejumlah trafo di Kota Sibolga khususnya yang memiliki kapasitas dibawah 100 KVA. (a34)

WASPADA Rabu 28 Oktober 2009

Kapoldasu Diminta Usut Kematian Wartawan Tobasa SAMOSIR (Waspada): Para jurnalis di Kabupaten Samosir merasa prihatin terhadap kasus kematian seorang wartawan yang bertugas di Kabupaten Tobasa. Para insan Pers di Kab. Samosir mohon KapoldasuseriususutkasuspembunuhanAgusHutapea yang terjadi beberapa waktu lalu. Seperti yang dituturkan seorang wartawan Mahadi Sitanggang, SE kepada Waspada, Selasa (27/10), Kapoldasu harus mengusut kasus ini dan menangkap pelakunya yang secepatnya melimpahkankasusinike pengadilan.Kepadaseluruh rekan pers, diminta tetap waspada terlebih akan ada pihak-pihak yang tersinggung akibat pembe-

ritaan khususnya di tahun politik jelang pilkada di masing-masing daerah, ujarnya. Demikianjuga,wartawanlainnyaBentusManurung,SHmengatakan, pengusutankasuskematian AgusHutapeadiharapkanjanganhanyakatabelece karena sudah berdampak kepada pengekangan kebebasan pers sebagaimana yang diatur di dalam UU Pers Nomor 40 tahun 1999. Pengusutan kasus kematian ini diminta agar transparan sehingga kepastian hukum di NKRI tidak abu-abu, ujar Charles Rumapea, SE wartawan Harian Realitas menjawab Waspada, Selasa (27/10) di Pangururan. (c10)

Anggota Dewan Dilantik, Wartawan Dilarang Meliput SALAK, Pakpak Bharat (Waspada):Wartawan dilarang masuk gedung dewan dan meliput pelantikan 20 anggota DPRD Kab. Pakpak Bharat periode 2009 - 2014, Selasa (27/10). Pelarangan itu oleh aparat Polisi dan Satpol PP dengan menyatakan, yang menghadiri acara harus memiliki undangan dari panitia pelantikan. Kejadian tersebut membuat Elson Angkat, anggota DPRD Pakpak Bharat yang dilantik heran karena ketidakhadiran wartawan yang dihubungi untuk memplublikasikannya. Parlemen Sinamo, Sekretaris Dewan (Sekwan) Pakpak Bharat saat dikonfirmasi menyebutkan, sebelumnya ada 3 undangan diberikan kepada aliansi wartawan di Pakpak Bharat. Namun, dia tidak dapat menjelaskan siapa dan aliansi apa ataupun nama wartawan yang

mendapatundanganitu.Diajugamemintakepada wartawan agar permasalahan ini tidak dibesarbesarkan. Sementara,informasidiperolehanggotadewan yang dilantik oleh Abner Situmorang, SH selaku Ketua Pengadilan Negeri Sidikalang-Pakpak Bharat adalah Midun Angkat dan Sauli Imran Parningotan Habeahan (Hanura), Mhd. Said Darwis Boangmanalu (PKPB), Mansehat Manik (PPRN), Rincong Boangmanalu (PAN), Antoni Efendi Berutu (PPD), Juanda Banurea (PKB), Rajiun Limbong (PPI), Sonni Berutu (PDK), Anggiat Banurea (RepublikaN), Muda Mawardi Banurea dan Habonaran Cibro(Pelopor),ElsonAngkatdanAgustinusManiki (Golkar),EdisonManikdanLukmanPadang(PNBK), GendiBanurea(PDIP),NuraidaManik(Patriot),Serru Berutu (PD) dan Alam Padang (PKB). (c08)

Semburan Lumpur Panas Hebohkan Warga Tapteng TAPIANNAULI,Tapteng(Waspada):Semburan lumpur panas yang terjadi diperumahan PT Mujur Timber, Dusun Pargodungan, Kelurahan Tapian Nauli II, KecamatanTapian Nauli hebohkanWarga. Informasi dihimpun dari Rangkuti,42, selaku penjagarumahmenjelaskan,Sabtu (24/10)mereka sengaja membuka keramik lantai garasi rumah majikannya, karena lantai keramik terasa panas. “Sekitar seminggu yang lalu kami sudah merasakan ada yang aneh di sekitar garasi rumah bos ini, karena keramiknya terasa hangat. Kami rasa itu hal biasa saja. Namun lama kelamaan semakin panas sampai tidak bisa diinjak lagi tanpa menggunakan alas kaki,”ungkap Rangkuti, Selasa (27/ 10). Awalnya, dirinya merasa curiga rasa panas berasal dari hubungan pendek panel listrik yang kebetulanpusatnyadigarasimobil.Namunsetelah panel listrik dimatikan tetap saja rasa panas itu tidak berkurang dan akhirnya kami membuka keramik rumah dan menggalinya. Saat itu juga langsung menyembur uap panas yang baunya seperti lumpur terbakar. “Kita cukup kaget melihat kejadian itu, karena semburanasaptersebutcukupmenyengathidung. Maka kami pun langsung menggali tanah asal asap tersebut dan kita menemukan mata air yang mengeluarkan air cukup panas. Karena suhu air cukup panas, kita campurkan dengan air dingin, namun suhu air tersebut tetap panas bahkan bisa merebus telur,” terang Rangkuti. Melihat keanehan itu, lanjutnya, dia langsung melaporkannya kepada pimpinan, dan pimpinan meminta agar kejadian itu dilaporkan kepada

polisi dan Dinas terkait. Untuk menindaklanjuti laporan itu, Sekretaris daerahKabupaten(Sekdakab)Tapteng,Baharuddin Manik bersama tim SKPD dari Bapedalda dan Pertambangan langsung turun ke lapangan untuk melakukan penelitian. Bersama dengan tim ahli dari Bapedalda Tapteng kembali mengambil sampel air, karena uap dari air tersebut sudah berubah menjadi bau belerang. Saat itu juga sebanyak tiga botol sampel air dibawa dan langsung dikirim ke laboratorium Bapedalda Sumut. Sekdakab Tapteng, Baharuddin Manik saat dikonfirmasi di lokasi kejadian, mengatakan, sampel air akan dikirim langsung ke Laboratorium Bapedalda di Medan dan hasilnya sekitar 5 - 7 hari. Sementara itu, Ayu selaku Tim ahli Bapedalda Tapteng mengatakan, keberadaan air banyak mengandung lumpur sehingga tidak bisa dikonsumsi. “Selain itu, suhu panas air ini diatas rata - rata pemakaian yakni 37,6 Derajat Celsius, sementara standar air antara 25 - 27 Derajat Celsius. Sedangkan kadar oksigen air 0,8 persen O2 yang artinya kadar oksigennya sangat rendah dan tidak bisa dikonsumsi,”tukasnya. Yakini Air Bisa Jadi Obat Santernya berita semburan lumpur panas ini langsung menyebar ke segala penjuru wilayah Tapteng. Anehnya masyarakat langsung berasumsi lain dan meyakini kejadian itu adalah peristiwa anehdanlangka,bahkanairitudiyakinibisamenjadi obat.(a34)

Sumatera Utara

WASPADA Rabu 28 Oktober 2009

Masih Banyak Kepala SDN Tapsel Belum Sarjana P.SIDIMPUAN (Waspada): Hingga kini masih banyak Kepala SD Negeri di wilayah Kabupaten Tapanuli Selatan yang belum berkualifikasi pendidikan sarjana (S1) atau Dimploma Empat (DIV) Kependidikan. Padahal Menteri Pendidikan Nasional melalui Permendiknas No.13tahun2007tentangStandar Kepala Sekolah/Madrasah, pada pasal 1 huruf (a) telah jelas-jelas mengamanatkan itu. Namun di Tapsel, sudah dua tahun lebih Permendiknas itu disahkan, tapi realisasinyamasih‘jauhpanggang dari api’. Informasi diperoleh Waspada, Selasa (27/10), jumlah Kepala SDNyangbelumsarjanaituhampir menyebar di seluruh atau 12 kecamatan se-Tapsel.Tidak terlepas di Kec. Batang Angkola, Sipirok, dan Batang Toru sebagai

wilayah termaju di daerah itu. “Kita juga heran, kenapa di Tapsel masih banyak kepala SD yang belum sarjana. Bagaimana generasi bangsa mau pintar, jika aturan mengenai tenaga kependidikannya saja diacuhkan,” kata Marwan Dalimunthe, warga Kelurahan Bintuju, Kec.Batang Angkola. Marwan yang mengaku tidak punya lembaga apapun namun peduli pada pendidikan daerahnya menyebutkan, di Tapsel banyak guru yang telah memenuhi kulaifikasimenjadikepalasekolah, khususnya SD, tapi tidak diperhatikan. Kepada Pemkab Tapsel khususnyaDinasPendidikanDaerah, dia berharap agar benar-benar menginvetarisir guru-guru yang sudah layak diangkat jadi kepala sekolah dan memberinya per-

hatian prioritas. Tidak perlu harus adausulanuntukjadikepalasekolah baru diberi perhatian. “Bukankah salah satu tugas Dinas Pendidikan itu menilai dan menginvetarisir guru-guru yang mampu dan berbakat untuk diberi perhatian.Kaluhanya menunggu ada usulan, sampai kapan pendidikandaerahiniakanmaju?” ucapnya. Menyikapi hal tersebut, dua pejabat eselon di Dinas Pendidikan Daerah Tapsel yang menolak disebut identitasnya karena belum mendapat izin menjawab konfirmasi wartawan, dan ditemui secara terpisah mengakui hal itu. “Memang benar kalau di Tapsel masih banyak kepala sekolah khususnya SD yang belum sarjana. Permasalahannya, saat ini guru yang memiliki kulifikasi

seperti diamanatkan Permendiknas No 13 tahun 2007 masih minim,” kata keduanya. Disinggung mengenai Permendiknas tersebut sudah disahkan sejak dua tahun lalu. Apa mungkintidaksatupungurudiTapsel yang lulus sarjana dan sertifikasi. KeduanyaberalasansaatiniDisdik sedang mendatanya. Menyikapi pernyataan dua pejabat eselon Disdik Tapsel itu, Sahrul Siregar, warga BatangToru yang ditemui di Padangsidimpuan menganggapnya sebagai alasan yang dibuat-buat. “Sebenarnya banyak yang memenuhi kualifakasi, tapi kurang beruntungkarenatidakadanyajaringan ke Disdik,” tegasnya Sedangkan Marihot Hutasuhut, warga Sipirok, berharap kepadaDisdikTapseldankhususnya kepaladinasyangbaru,Marasaud

Pemko P. Siantar Terima CPNS 251 Orang Harahap,untuk membuat terobosan baru. Yakni menginventarisirseluruhsekolahyangkepala sekolahnya belum sarjana. Kemudian menginventarisir seluruh guruyangmemilikikulaifikasi untuk menggantikan para kepala sekolah yang saat ini menjabat dan sebenarnya tidak memenuhi kualifikasi seperti diamanatkan Permendiknas No.13 tahun 2007, tapi masih dipertahankan. “Ini hanya sumbang saran dari kami wargaTapsel.Tidak ada niat politisasi apapun dan semata atas kepedulian terhadap pendidikan daerah. Hitado nasadarion, hita juodo naatcogotan. Anggo inda hita marsipaingotan, ise muse dope (hanya kita sama kita jualah yang saling mengingatkan dan tak mungkin orang lain),” katanya. (a20)

Pemko P. Sidimpuan Terima 410 CPNSD P.SIDIMPUAN (Waspada): PemkoPadangsidimpuanmelalui pengumuman No: 800/6524/ 2009 tentang Penerimaan Calon Pegawai Negeri Sipil Daerah Dari Pelamar Umum Formasi 2009, menerima 410 CPNSD dan 40 di antaranya lulusan Sekolah Menengah Kejuruan (SMK). Pengumuman didasari SK Walikota Padangsidimpuan No: 800/6523/2009 itu menerima CPNS untuk formasi guru 186 orang,tenagakesehatan99orang, dan tenaga teknis 125 orang. Untuk melihat syarat-syarat kelengkapan administrasi, calon pelamar dapat melihatnya di papan informasi Badan Kepegawaian Daerah Pemko P.Sidimpuan di Jalan Kenanga. Karena pengumuman ditempel sejak Selasa (27/10). Adapun formasinya, 2 orang untuk Guru TK (S1 PGTK/D-II PGTK). Guru SD, 13 orang guru Penjaskes (S1 Penjaskes/S1 Olahraga). 16 orang Guru Kelas (S1 PGSD/D-II PGSD), dan 5 orang GuruAgamaIslam(S1Pendidikan Agama Islam/S1 Agam Islam) Guru SMP, 2 orang Guru Agama Kristen (S1 Pendidikan Agama Kristen/ S1 Theologi). 2 Guru Biologi (S1 Pend Biologi/ S1 Biologi), 3 Guru Pendidikan Seni (S1 Pend Seni/S1 Seni)

5 Guru Penjaskes/Olahraga (S1 Penjaskes/S1 Olahraga), 5 Guru BP/BK (S1 Pend BP/BK atau S1 BP/BK). 6 Guru TIK Komputer (S1 Pend Teknik Komputer/S1Teknik Komputer) Guru SMA, 4 Guru Agama Kristen (S1 Pendidikan Agama Kristen/S1 Theologi). 6 Guru Geografi (S1 Pend Geografi/S1 Geografi). 10 Guru Sosiologi (S1 Pend Sosiologi/S1 Sosiologi). 3 Guru Antropologi (S1 Pend Antropologi/S1 Antropologi). 5 GuruTata Negara (S1 Pend Tata Negara/S1 Tata Negara). 8 Guru Fisika (S1 Pend Fisika/S1 Fisika). 8 Orang Guru Kesenian, 2 orang untuk kualifikasi S1 Pend Seni Kerajinan/S1 Seni Kerajinan), 3 orang untuk S1 Pend Seni Tari/S1 Seni Tari, dan 3 S1/Pend Seni Rupa/S1 Seni Rupa). 2 Guru Penjaskes (S1 Pend Jaskes/S1 Olahraga), 14 Guru Bimpingan Penyuluhan (BP)/Bimbingan Konseling (BK) (S1 Pend BP/BK atau S1 BP/BK ). 13 guru Teknologi Informasi Komputer ((S1 PendTeknik Komputer/S1Teknik Komputer). Guru SMK, semuanya harus S1 Pendidikan atau S1 di bidang masing-masing dan sudah memiliki sertifikat Akta Empat (A.IV) serta memiliki Sertifikasi Profesi, 1 Guru Agama Kristen, 2 Guru

Pendidikan Kewarganegaraan, 2 Guru Bahasa Indonesia, 4 Guru matematika, 3 Guru Bahasa Inggris. 2 Guru Sejarah Umum, 2 GuruEkonomi,1GuruAkuntansi, 2 Guru tata Niaga, 2 Guru Kimia. 1 Guru Teknik Bangunan/ Mesin Perkakas, 3 Guru Elektronika, 6 Guru Teknik Elektro/ Listrik Intalasi. 5 Guru Teknik Mesin/Mekanik Otomotif.1 guru Tata Busana, 2 Guru tata Kecantikan, 4 guru Penjaskes/Olahraga, 6 Guru Komputer/Guru TIK, 3 guru Administrasi Perkantoran. Formasi Tenaga Kesehatan , masing masing 1 orang untuk Dokter Spesialis Bedah, Penyakit Dalam, Anak, Radiologi, Anastesi, Jiwa, Kulit, Kardiologi, Syaraf, Mata, Paru-Paru, Orthopedi, Rehab Medik, Bedah Mulut, dan Patologi Anatomi. 4 Dokter Umum, 2 Dokter Gigi, 3 Apoteker, 3 Penyuluh Kesehatan Masyarakat (S1 Ilmu KM), 2 Psikolog Klinis (S1 Psikolog),3PengawasFarmasidanMakanan (D-III Farmasi), 2 Teknisi Elektro Medis (D-III TEM), 3 Perawat Gigi (D-III PG), 2 Nutrisionis (D-III Ilmu Gizi). 2 Penata Anastesi ((D-III Anastesi), 3 Sanitarian (D-III Kesling), 1 Analis Kesehatan (DIII AK), 5 Perawat (S1 Keperawatan), 31 Perawat (D-III Keperawa-

Pemkab Paluta Terima 507 CPNS GUNUNG TUA (Waspada): Pemerintah Kabupaten Padanglawas Utara menerima 507 Calon Pegawai Negeri Sipil (CPNS) formasi umum tahun 2009. Penerimaaan CPNS itu berdasarkan surat Menteri Negara PendayagunaanAparaturNegara (Menpan)Nomor:485.P/M.PAN/ 9/2009 tanggal 25 september 2009. Hal senada diungkapkan Bupati Padang Lawas Utara Drs BachrumHarahapmelaluiPelaksana Tugas Kepala Badan Kepegawaian Daerah (BKD) Padang Lawas Utara, H.Mara Lobi Siregar, S. Sos kepada Waspada, Selasa, (27/10) di Gunung tua.

Berdasarkan Pengumuman Bupati Padang Lawas Utara Nomor: 810/4364/2009 perihal penerimaan CPNSD di Lingkungan pemerintah Kabupaten Padanglawas Utara yang akan diterima alokasi formasi umum tahun 2009 yakni 507 CPNS meliputi tenaga guru 152 orang (SD, SMP, SMA dan SMK), tenaga kesehatan 148 orang dan tenaga teknis 207 orang. Pendaftaran/penerimaan berkas lamaran pada tanggal 30 Oktober hingga 13 November 2009, seleksi administrasi 30 Oktober hingga 19 November 2009, pengambilan nomor ujian 19 November 2009 hingga 24

November 2009, pengumuman lokasi ujian 23 November hingga 24 November 2009, pelaksanaan ujian 25 November 2009, pengumumanpelamaryangdinyatakan Lulus dan diterima pada tanggal 7Desember2009danpenyerahan kelengkapan berkas lamaran bagi yang dinyatakan lulus dan diterima pada tanggal 8 Desember 2009 hingga 17 Desember 2009. Dimana berkas lamaran diantar langsung ke Kantor Badan Kepegawaian daerah ,Perpustakaan dan Arsip daerah Kabupaten Paluta Jalan Lintas Gunung tuaPadangsidimpuan Km 3,5 setiap hari kerja. (csp)

Pemkab Padanglawas Terima 450 CPNSD 2009 SIBUHUAN (Waspada): Pemerintah Kabupaten Padang Lawas membuka penerimaan dan penyaringan Calon Pegawai Negeri Sipil Daerah (CPNSD). Demikian keterangan yang diperoleh Waspada, Senin (26/ 10), sesuai pengumuman Bupati No. 810 / 5116 / 2009 tanggal 23 Oktober 2009 tentang penerimaan dan penyaringan CPNSD Kab. Palas 2009. Hal itu menyusul surat Menpan RI No. 112.P / M. PAN / 9 / 2009, perihal persetujuan rincian formasi CPNSD. Penerimaan CPNSD itu, di

antaranya 291 tenaga pendidikan yakni 27 guru SMA termasuk guru Matematika, Bahasa Inggris, Bahasa Indonesia, Ekonomi/Akuntansi, Fisika, Seni Rupa, Seni Tari, Muatan Lokal dan guru bimbingan konseling, 26 guru SMK, 28 guru SMP, dan 108 guru TK/SD. Untuk tenaga kesehatan 102, terdiri dokter umum, dokter gigi, asisten apoteker, penyuluh kesehatan masyarakat, fisioterpis, perawat, bidan, nutrisionis, perawat gigi, refraksionis optisien dan analis kesehatan, serta 158 tenaga teknis

dan administrasi umum. Kepala Badan Kepegawaian Perpustakaan dan Arsip Daerah Kabupaten Padang Lawas, Drs H Nasruddin Hasibuan, didampingi Kabid Penram dan Disiplin Barani Siregar, SPd, pendaftaran calon peserta seleksi mulai 30 Oktober sampai 13 November 2009 di kantor Badan Kepegawaian Perpustakaan dan Arsip Daerah Kab. Padang Lawas, Jalan Sisingamangaraja No. 6 Sibuhuan, sementara ujian seleksi 25 November 2009. (a32)

Pemkab Tapsel Terima 45 CPNSD P.SIDIMPUAN (Waspada): Pemkab Tapanuli Selatan menerima 45 Calon Pegawai Negeri Sipil Daerah (CPNSD) 2009 dan tidak ada formasi untuk pelamar berpendidikan SMA maupun sederajat. Penerimaan itu berdasarkan Surat Keputusan Bupati No: 191/KPTS/2009 tentang rincian alokasi formasi calon pegawai negeri sipil daerah. Demikian keterangan yang diterima Waspada dari Badan Kepegawaian dan Diklat Daerah, Selasa (27/10) di Padangsidimpuan. Rincian formasi itu terdiri dari 33 guru berpendidikan Strata (S) -1 dan 11 dokter spesialis serta 1 penyuluh perindustrian dan perdagangan dengan pendidikan Diploma–III (D-III). Usia calon pelamar serendah-rendahnya 18 tahun dan setinggi-tingginya 35 tahun terhitung sampai 1 Januari 2010. Berkas lamaran diantar langsung ke kantor BKD Tapsel cq Sekretariat Penerimaan CPNSD Formasi 2009, Jalan Kenanga, No.2 Padangsidimpuan mulai 30 Oktober sampai 13 November 2009. Pelamar formasi jabatan

tenaga guru yang memiliki kualifikasi pendidikan non keguruan harus melampirkan surat pernyataan bermaterai bila dinyatakan lulus akan mengikuti pendidikan Akta IV atas biaya sendiri dan selambatnya 1 tahun setelah diangkat menjadi CPNS. Adapun formasi CPNSD tersebut, 3 Guru Seni dan Budaya (S1 Pendidikan Seni/S1 Seni/A.IV) untuk SMKN Sipirok, SMKN 1 Batang Toru dan SMKN 1 Marancar, 4 Guru KPPI (S1 Pendidikan Komputer/S1 Komputer/A.IV) untuk SMKN 1 Batang Angkola, SMKN 1 Batang Toru, SMKN 1 Marancar, dan SMKN1 Sipirok. Tiga Guru Teknik Informasi Komputer (S1 Teknik Komputer dan Jaringan/S1 Komputer dan Jaringan/A.IV) untuk SMKN 1 Sipirok, 8 Guru Otomotif (S1 Pendidikan Mekanik Otomotif/ S1 Teknik Mesin/A.IV) untuk SMKN 1 Batang Angkola. Tujuh Guru Budi DayaTanaman (S1 Pendidikan Budi Daya Tanaman/S1 Budi Daya Tanaman/A.IV) untuk SMKN 1 Arse 2, SMKN 1 Marancar 2, SMKN 1 Batang Toru 3. Seorang Guru Budi Daya

Ikan (S1 Pendidikan Budi Daya Ikan/S1 Budi Daya Ikan/A.IV) untuk SMKN 1 Arse, 3 Guru Tanaman Pangan (S1 Pendidikan Tanaman Pangan/S1 Tanaman Pangan/A.IV) untuk SMKN 1 Batang Toru. Tiga Guru Teknologi Tenun (S1 Pendidikan Teknologi Pembuatan Kain Tenun/S1 Tekstil/ A.IV) untuk SMKN 1 Sipirok, 1 Guru Bimbingan Konseling (S1 Pendidikan Bimbingan Konseling/S1 Psikologi/A.IV) untuk SMKN 1 Sipirok. Sebelas dokter spesialis untuk Rumah Sakit Umum Daerah (RSUD) Sipirok, terdiri dari Spesialis Bedah 2, Kandungan dan Kebidanan 2, Penyakit Dalam 1, Patologi Klinik 1, Anastesi 1, Radiologi 1, Penyakit Mata 1, Penyakit Syaraf 1, dan Penyakit Telinga Hidung Tenggorokan 1. Kemudian formasi terakhir adalah tenaga teknis Penyuluh Perindustrian dan Perdagangan dengan kualifikasi pendidikan Diploma III (D-III) Akademi Tekstil untuk ditempatkan di Dinas Perindustrian Perdagangan dan Koperasi UKM. (a20)

tan), 18 Bidan (D-III Kebidanan). Formasi Tenaga Teknis, 40 orang lulusan SMK untukTenaga Teknis Substansif dan Adminsitrasi yakni, 2 Pengawas Lapangan (Lulusan SMK Teknologi), 5 Teknisi Alat Berat (SMK Teknologi Jurusan Otomotif dan Listrik), 8 Operator Komputer (SMK Bisnis Manajemen). 3 Pengatur Benih Tanaman (SPMA), 5 Penyuluh KB (SPK), 2 Teknisi Mesin (SMK Mesin/ Otomotif). Kemudian Tenaga Administrasi Arsiparis, 5 orang lulusan SMK Perkantoran, 5 SMK Bisnis Manajemen, 2 D-III Administrasi Perkantoran, 1 D-III Administrasi Niaga. 5 Pengadministrasi Keuangan (SMK Akuntansi), 3 Verifikator Keuangan dari D-III Akuntansi dan 1 dari D-III Perbankan. 1 Penyuluh Pajak Daerah (D-III Perpajakan), 2 Penyusun Program dan Evaluasi (1 D-III Manajemen dan 1 D-III Ekonomi Manajemen), 1 Pranata Komputer (D-III Komputer), 4 Penyuluh pertanian, Perikanan Dan Peternakan (D-III). 1 PemanduWisata ((D-III Kepariwisataan), 2Teknisi Otomotif (D-III Otomotif ), 2 Teknisi Pengairan (D-III Teknik Sipil), 1 Auditor (D-III Ekonomi Perbankan dan Statistik), 2 Penguji Kendaraan bermotor (D-III Otomotif), 1 Teknisi Jalan dan Jembatan (D-III Teknik Sipil). 3 Analis Kepegawaian (S1 Sospol/S1 Psikolog), 4 Penyuluh Sosial (S1 Sospol/S1 Fisip komunikasi/S1 Hukum). 3 Auditor (S1 Hukum/S1 ekonomi Akuntansi/ S1 Ekonomi), 2 Pengawas Perizinan (S1 Hukum/S1/Ekonomi). 2 Penyusun Program dan


Evaluasi (S1 Sospol), 2 Penata Ruang (S1 Teknik Planolog/S1 Teknik Arsitektur), 4 Pengawas Tata Bangunan dan Perumahan (S1 Teknik Sipil), 5 Penyuluh Perindag (S1 Teknik Industri/S1 Ekonomi/S1Hukum),1Mediator HubunganIndustrial(S1Hukum), 1 Pengawas Sistem Kelistrikan (S1 Teknik Elektro). 2 Analis Potensi Kepariwisataan (S1Pariwisata), 3 Perencana (S1 Ekonomi/S1 Hukum/ S1 Sospol),4PenyuluhPertanianPerikanan Peternakan (S1 Perikanan/ S1 Peternakan/S1 Pertanian). 2 Analis Pembangunan (S1 Teknik Sipil). 3 Analis Program Komputer (S1 Komputer Manajemen Informatika), 3 Penata Laporan Keuangan (S1 Ekonomi Akuntansi/ S1 Ekonomi/S1 Perbankan). 3 Penggerak Swadaya Masyarakat (S1Sospol/S1Hukum),3Penyuluh KoperasidanUKM(S1Ekonomi), 3 Pekerja Sosial (S1 Sospol/S1 Hukum/S1 Ekonomi). 4 Pengendali Dampak Lingkungan(S1TeknikkimiaIndustri/ S1 Teknik Kimia/S1Teknik Lingkungan/S1 Mipa Kimia), 2 Pranata Komputer (S1 Komputer Manajemen Informatika), 1 Pustakawan (S1 Perpustakaan), 1 Analis Programer Komputer (S1 Teknik Informatika). Pendaftaran mulai 30 Oktober sampai 13 Nopember 2009 di Gedung SMK Negeri 2 (STM Negeri) Jalan Sutan Soripada Mulia No.36 Sadabuan. Pelamar diminta agar tidak percaya atau terpengaruh kepada oknum atau pihak manapun yang mengaku dapat mengurus atau menjamin untuk kelulusan CPNSD 2009. (a20)

P. SIANTAR ( Waspada): Kepala Badan (Kaban) Kepegawaian, Pendidikan dan Pelatihan Pemko Pematangsiantar Drs Donver Panggabean, MSi terkesan tertutup dan cukup sulit ditemui. Wartawan yang mencoba konfirmasi seputar penerimaan CPNS di lingkungan Pemko mendapat jawaban kurang simpatik dan terkesan bermainmain dari Sekretaris Badan Kepegawaian, Pendidikan dan Pelatihan Drs Dahlan S, Selasa (27/10). Kabag Humas dan Protokoler Pemko Drs. Julham Situmorang turut mengeluh dengan sikap Kaban Kepegawaian, Pendidikan dan Latihan ketika hendak bertamu. “Sudah sejak pagi saya menunggu, namun sampai menjelang tengah hari ini belum ada kejelasan apakah saya bisa bertamu atau tidak.” Ketika diminta keterangan tentang surat keputusan walikota seputar penerimaan CPNS itu, dengan gaya tidak perduli, Sekretaris Badan Kepegawaian, Pendidikan dan Pelatihan itu mengatakan beli saja di luar sudah ada dijual. Sesuai dengan surat keputusan walikota nomor 800/2213/ X/WK-Thn 2009 tentang pengadaan CPNS Pematangsiantar dari pelamar umum untuk mengisi tambahan formasi tahun anggaran 2009 sebanyak 251 orang terdiri tenaga guru 174 orang, tenaga kesehatan 24 orang dan tenaga teknis lainnya 53 orang. Jenis jabatan, tingkat pendidikan kualifikasi pendidikan dan jumlah yang akan diterima yakni guru SD Negeri 50 orang terdiri guru kelas dengan kualifikasi pendidikan S1 PGSD/ DII PGSD sebanyak 32 orang, guru agama Islam dengan kualifikasi pendidikan S1 sebanyak tujuh orang, guru agama Protestan dengan kualifikasi pendidikan S1 sebanyak lima orang, guru agama Katolik dengan kualifikasi pendidikan S1 sebanyak enam orang. Guru SMP Negeri sebanyak 60 orang terdiri guru agama Islam sebanyak tiga orang, guru agama Katolik sebanyak sembilan orang, guru pendidikan jasmani sebanyak enam orang, guru fisika sebanyak satu orang, guru kimia sebanyak sembilan orang, guru geografi sebanyak empat orang, guru teknik informatika komputer sebanyak 12 orang, guru pendidikan seni budaya sebanyak enam orang, guru bimbingan konseling sebanyak delapan orang dan guru

ekonomi akuntansi sebanyak dua orang serta kualifikasi pendidikan yang diterima seluruhnya S1. Guru SMA Negeri sebanyak 45 orang terdiri guru PPKn sebanyak tiga orang, guru agama Islam sebanyak tiga orang, guru agama Katolik sebanyak tujuh orang, guru matematika sebanyak dua orang, guru sosiologi sebanyak lima orang, guru geografi sebanyak empat orang, guru tata negara sebanyak empat orang, guru bahasa Inggris sebanyak satu orang, guru antropologi sebanyak empat orang, guru teknik informatika komputer sebanyak tujuh orang, guru pendidikan seni budaya sebanyak tiga orang dan guru bahasa Jerman sebanyak dua orang serta seluruhnya dengan kualifikasi pendidikan S1. Guru SMK Negeri sebanyak 19 orang terdiri guru PPKn sebanyak satu orang, guru agama Islam sebanyak satu orang, guru agama Katolik sebanyak dua orang, guru matematika sebanyak empat orang, guru biologi sebanyak tiga orang, guru bimbingan konseling sebanyak satu orang, guru teknik informatika komputer sebanyak satu orang, guru administrasi perkantoran sebanyak tiga orang dan guru tata kecantikan sebanyak tiga orang serta seluruhnya dengan kualifikasi pendidikan S1. Tenaga kesehatan yang diterima sebanyak 24 orang terdiri dokter spesialis anestesi sebanyak satu orang, dokter umum sebanyak empat orang, dokter gigi sebanyak dua orang, semuanya dengan kualifikasi pendidikan S1, keperawatan sebanyak lima orang, bidan sebanyak tiga orang, fisioterapis, penata anastesi dan teknisi elektro medis masing-masing satu orang, sanitarian, pranata leboratorium kesehatan dan perawat gigi masing-masing dua orang, semuanya dengan kaulifikasi pendidikan DIII. Tenaga teknis sebanyak 53 orang terdiri penyuluh perikanan sebanyak dua orang dengan kualifikasi pendidikan S1 dan DIII, perencana sebanyak tiga orang dengan kualifikasi pendidikan S1, pengawas teknis tata bangunan dan perumahan sebanyak tiga orang dengan kualifikasi pendidikan S1, pengawas pengoperasian alat berat sebanyak satu orang dengan kualifikasi pendidikan S1, penguji mutu barang sebanyak dua orang dengan kualifikasi pendidikan S1, pranata komputer sebanyak dua orang dengan kualifikasi pendidikan S1,

pengawas teknis tata bangunan dan perumahan sebanyak dua orang dengan kualifikasi pendidikan S1. Kemudian, penyuluh Perindag dan analis dampak lingkungan masing-masing satu orang dengan kualifikasi pendidikan DIII, inspektur ketenagalistrikan sebanyak dua orang dengan kualifikasi pendidikan S1, teknisi konservasi energi dan teknisi sistem jaringan listrik masingmasing satu orang dengan kualifikasi pendidikan DIII, penata laporan keuangan sebanyak tujuh orang, penyusun program dan evaluasi sebanyak enam orang dan analis kepegawaian sebanyak satu orang, semuanya dengan kualifikasi pendidikan S1. Pengolah data penerimaan pendapatan sebanyak empat orang dengan kualifikasi pendidikan DIII, pranata komputer sebanyak satu orang dengan kualifikasi pendidikan S1 dan empat orang dengan kualifikasi pendidikan DIII, perancang peraturan perundang-undangan sebanyak lima orang dengan kualifikasi pendidikan S1 dan S2, pranata Humas sebanyak dua orang dan analis tata praja sebanyak dua orang dengan kualifikasi pendidikan S1. Persyaratan yang harus dipenuhi khusus usia serendahrendahnya 18 tahun dan setinggi-tingginya 35 tahun per 1 Januari 2010 dan 40 tahun pada 1 Januari 2010 bagi mereka yang sudah mengabdi pada instansi pemerintah pusat/daerah atau lembaga swasta yang sudah berbadan hukum yang menunjang kepentingan nasional dengan ketentuan minimal lima tahun secara terus menerus sampai ditetapkannya PP nomor 11 tahun 2002 tanggal 17 April 2002 yang dilengkapi dengan bukti otentik serta masih melaksanakan tugas pada instansi pemerintah/daerah atau lembaga swasta itu secara terus menerus tanpa terputus sampai dengan pendaftaran. Pendaftaran pelamaran dilaksanakan dari tanggal 30 Oktober sampai 13 November 2009 mulai pukul 08:30-15:00 untuk hari Senin sampai Jumat di Jalan Porsea nomor 3 Pematangsiantar. Sedang pelaksanaan ujian penerimaan CPNS pelamar umum itu dilaksanakan pada Rabu 25 November 2009 pukul 09:00 dan tempat ujian ditentukan kemudian. Materi yang akan diujikan terdiri tes kemampuan dasar (TKD) dan tes kemampuan bakat. (a14)



WASPADA Selasa 27 Oktober 2009

Kembali Empat Pengedar SS Digulung

Waduk Tak Berfungsi, Ratusan Ha Sawah Terlantar BATEE, Pidie (Waspada): Sekira 860 hektar areal persawahan di Kecamatan Batee, Kabupaten Pidie terlantar tak bisa digarap karena Waduk Lhokseumani peninggalan Belanda di daerah itu tidak lagi berfungsi. Sementara waduk baru belum juga dibangun, akibatnya petani setempat terpaksa mengandalkan air hujan untuk bercocok tanam. Beberapa warga Kecamatan Batee kepada Waspada, Selasa (27/10) mengatakan, masyarakat setempat tidak dapat menggarap lahan sawahnya karena Waduk Lhokseumani peninggalan Belanda sejak puluhan tahun lalu tidak berfungsi lagi. “Kami di sini terpaksa menggarap sawah dengan mengharapkan air dari langit,” sebut Abdullah, 25, salah seorang petani di Desa Alue Lada, Kecamatan Batee, Selasa kemarin. Akibat tidak berfungsinya lagi Waduk Lhokseumani itu, kata Abdullah, lahan perswahan yang terhampar di beberapa desa di Kecamatan Batee selama ini hanya menjadi lahan terlantar (tidur). (b21)

Seorang DPO, 8 Gram SS Disita

Mahasiswa Teknik Unmuha KKN Di Aceh Besar BANDA ACEH (Waspada): Sebanyak 79 mahasiswa Fakultas Teknik Universitas Muhammadiyah Aceh (Unmuha), melakukan Kuliah Kerja Nyata (KKN) di Aceh Besar. Para mahasiswa teknik dari jurusan Sipil dan Arsitektur ini akan melakukan pengabdian selama sebulan di 17 desa di Kecamatan Ingin Jaya. Ke-79 mahasiswa peserta KKN tersebut, diserahkan secara resmi oleh Dekan Fakultas Teknik Unmuha, Ir. HM. Zardan Araby Ahmad, MT, kepada pihak Kecamatan Ingin Jaya yang diwakili Sekcam, Mahdi, dalam suatu acara sederhana di aula Kantor Camat Ingin Jaya, Senin (26/10). Dalam kesempatan itu, Dekan FT Unmuha, Zardan Araby, mengharapkan para mahasiswa peserta KKN dapat memanfaatkan waktu selama sebulan ini dengan sebaik-baiknya untuk memberikan pengabdian kepada masyarakat di desa masing-masing. “Ciptakanlah sesuatu yang bermanfaat bagi masyarakat,” katanya. (b07)

Mu’allim Jamal Ketua DPRK Aceh Utara ACEH UTARA, (Waspada): Jamaluddin Jalil alias Mu’allim Jamal terpilih sebagai ketua DPRK Aceh Utara, periode 2009 – 2014 dengan memperoleh 33 suara (76,74 persen) dari 43 anggota dewan yang ikut memberi hak suara, Senin (26/10). Pemilihan ketua Dewan Perwakilan Rakyat Kabupaten (DPRK) daerah ini, berlangsung di gedung DPRK Aceh Utara, Jl T Nyak Adam Kamil Lhokseumawe, Senin kemarin, diikuti 43 dari 45 anggota dewan setempat, dua anggota dewan di antaranya tidak hadir. Mu’allim Jamal (Jamaluddin Jalil) tampil sendirian (tunggal) selaku calon ketua DPRK daerah ini, dua calon lain lainnya yang diharapkan tidak muncul, sehingga politisi Partai Aceh (PA) ini, terpilih tanpa persaingan. Wakil ketua I DPRK Aceh Utara, tampil empat orang calon masing-masing Misbahul Munir, H Ibrahim Ali Syech alias H Ibras, A Junaidi, SH dan Hj Ida Suryana, A.Md. Naumun, suara terbanyak (36 suara) diraih Misbahul Munir, H Ibras 6 suara, A Junaidi, SH (0) dan Hj Ida Suryana A.Md (1 suara). Sementara wakil ketua II DPRK tersebut, dari tiga calon yang maju, Hj Ida Suryana, A.Md terpilih dengan suara terbanyak (24 suara). Rival lainnya H Ibras memperoleh 17 suara dan A Junaidi, SH 1 suara, sedang satu suara di antaranya absten.(b10)

Warga Permasalahkan Pembangunan SMP 2 Lembah Sabil BANDA ACEH (Waspada) : Pembangunan SMP Negeri 2 Kecamatan Lembah Sabil, Kabupaten Aceh Barat Daya dipermasalahkan warga, karena dinilai pengerjaan bangunan itu terkesan asal jadi. Akibatnya, panitia pembentukan dasar pembangunan SMP tersebut mempertanyakan bestek bangunan tersebut, terlebih bangunan itu rencananya akan digunakan murid-murid lanjutan sekolah dasar dalam enam desa di wilayah itu. Safril kepada Waspada menyebut, pondasi pembangunan sekolah itu asal jadi, sehingga dikhawatirkan akan roboh dan menimpa anak-anak. “Ini amat membahayakan, bila kontraktornya membangun berdasarkan gambar, maka kami melihat sebuah bangunan dari kualitasnya, kami tidak ingin anak-anak menjadi korban karena pembangunan sekolah ini asal jadi,” ungkap Safril kepada Waspada, Senin (26/10) siang. Menurut Safril sejumlah warga dari warga Desa Ujong Tanoh, Desa Ladang Tuha-I, Desa Ladang TuhaII, Desa Alue Rambot, Desa Padang Kelele dan Desa Kuta Paya telah menyampaikan keberatan pada panitia karena galian dasar pondasi yang dangkal dan banyak akar-akar pohon yang tidak diangkat sehingga kekuatan pondasi diragukan. “Kami melakukan protes ini agar penegerjaannya berjalan baik, ini bagian pegawasan warga, kami tidak ingin mencari kambing hitam ketika bangunan roboh karena tidak diawasi,” ungkap Safril.(b32)

SKKAT Dan IPMAT Medan Diharapkan Bantu Petani MEDAN (Wasapada): Bupati Aceh Tenggara mendukung keberadaan organisasi Sepakat Segenep Keluarga Kutacane Aceh Tenggara (SKKAT) dan Ikatan Pelajar Mahasiswa Aceh Tenggara (IPMAT) di Medan. Bupati menilai keberadaan SKKAT dan IPMAT Medan diharap mampu menjembatani ketimpangan ekonomi dan membantu petani-petani di Aceh Tenggara yang saat ini lebih banyak dicengkram tengkulak. Demikian Bupati Aceh Tenggara H. Hasanuddin, SE, MM pada halal bi halal warga Aceh Tenggara di Medan dan pengukuhan pengurus SKKAT dan IPMAT Medan di Uni Plaza, Minggu (25/10). “Kita harapkan SKKAT dan IPMAT mampu menjembatani dan membuka hubungan perdagangan dengan para importir maupun eksportir dengan pihak luar. Hal ini untuk membantu perdagangan komoditas hasil pertanian dan perkebunan di Aceh Tenggara,” kata Hasanuddin. Untuk mahasiswa Aceh Tenggara yang sedang menimba ilmu di Medan, bupati menekankan sarjanasarjana alumni perguruan tinggi (PT) tidak hanya merengek-rengek meminta untuk jadi PNS. Dia sangat mendukung keinginan sarjana-sarjana asal Aceh Tenggara yang mau bergerak di bidang kewirausahaan. Sementara Ketua IPMAT Hajrin menjelaskan saat ini keberadaan mahasiswa asal Aceh Tenggara yang menimba ilmu di Medan berjumlah lebih dari 800 orang yang masuk dalam data base, sedangkan yang tidak terdaftar diperkirakan berjumlah lebih banyak lagi.(m29)


PEDAGANG KERIPIK: Sejumlah pedagang keripik di kawasan pingir jalan nasional, Kota Bireuen, Senin (26/10), sedang menunggu pembeli. Kerpik merupakan satu penganan khas kota tersebut yang sudah lama terkenal diketahui banyak masyarakat selama ini.

Ketua DPRA:

Pemerintah Aceh Jangan Larut Berbisnis

“Kami akan selalu berpikir lebih dulu mensejahterakan rakyat dari pada memikir masalah lainnya,” kata politisi Partai Aceh itu kepada Waspada, Selasa (27/10) di Banda Aceh. “Karena itu, kita juga mengajak pemerintah untuk lebih fokus melayani masyarakat.” Pada sisi lain dia juga mengingatkan Pemerintah Aceh agar tidak larut dalam pikiran berbisnis seperti membeli pesawat dan urusan lain. “Masih banyak yang perlu diurus, dan meningkatkan kesejahteraan rakyat Aceh,” kata Hasbi. Dia mengingatkan pemerintah agar paham apa tugas yang diamanatkan kepada mereka, yaitu untuk melayani rakyatnya. Karena itu, kata Hasbi, ma-

sih banyak yang perlu dibenahi oleh pemerintah saat ini, khususnya menyangkut tentang pelayanan publik, meningkatkan kesejahteraan rakyat dan mengurangi pengangguran. “Saya tidak setuju dengan itu, belum saatnya pemerintah Aceh untuk berbisnis yang tujuannya hanya untuk mengejar keuntungan. Masyarakat masih banyak hidup dibawah garis kemiskinan, itu yang perlu diperhatikan,” ujarnya. Seperti diketahui, Pemerintah Aceh berencana ingin membeli pesawat yang bernaung di bawah bendera Air Aceh. Pesawat itu diharapkan mampu melayani penumpang layaknya seperti pesawat regular lainnya yang beroperasi hingga ke seluruh pelosok nusantara. Pada sisi lain, Gubernur Irwandi Yusuf sendiri tak ingin disamakan Air Aceh bernasib serupa dengan Seulawah NAD. Untuk realisasi maksud itu, beberapa waktu lalu, Irwadi Yusuf telah melakukan kunjungan China untuk melihat pabrikan pembuatan pesawat. Sementara Ketua Pansus tata tertib (Tatib) DPRA Abdullah Saleh,

SH kepada wartawan menyebutkan, dalam pembahasan tatib pihaknya juga tetap berfokus pada kemajuan Aceh ke depan. Katanya, perangkat kerja dewan ke depan ada banyak perubahan sebagai upaya mendukung hal tersebut. Mantan politisi PPP ini menyebutkan, untuk menangani bidang pendidikan, pihaknya membentuk satu komisi tersendiri, yaitu bidang pendidikan sains dan teknologi digabung dengan bidang sumber daya Alam dan lingkungan hidup. “Tahun sebelumnya bidang pendidikan ditangani oleh Komisi F, namun pada periode sekarang, ditangani sendiri. “Ini dilakukan agar kedua bidang tersebut lebih terfokus demi kemajuan pendidikan di Aceh serta terfokus pada lingkungan hidup yang saat ini terus memprihatinkan,” urai dia. Abdullah Saleh menambahkan, “pembahasan tatib saat ini sudah mencapai 80 persen dari isi rancangan yang telah disepakati sebelumnya oleh anggota dewan, dan saat ini pembahasannya masih terus diburu karena tatib ini harus rampung pada awal November,” ujarnya.(b05)

ACEH UTARA (Waspada): Ratusan unit rumah duafa di Kabupaten Aceh Utara, bantuan dari Pemerintah Provinsi Aceh tahun anggaran 2008, diterlantarkan. Pihak kontraktor baru berhasil mengerjakan proyek tersebut sekitar 60-70 persen. “Sudah hampir 6 bulan, proyek rumah dhuafa di Kecamatan Baktya diterlantarkan kontraktor. Realisasinya baru sekitar 60-70 persen,” sebut Nurman, tokoh masyarakat Baktiya, Aceh Utara, Selasa (27/10) pagi. Karena itu, sejumlah penerima bantuan terpaksa menempati rumah yang belum selesai dibangun, dengan cara memasang daun rumbia sebagai atap. Umumnya, rumah bantuan belum ada jendela, masih berlantai tanah dan belum memiliki pintu. Hal ini dilakukan, karena masyarakat sangat butuh dengan bantuan tersebut. “Kepada pihak terkait, baik pihak kontraktor maupun Pemerintah Pro-

vinsi Aceh, untuk segera menyelesaikan pembangunan rumah duafa. Mengingat, bantuan tersebut sangat dinanti-nantikan oleh masyarakat,” pinta Nurman. Informasi di lapangan, para pekerja, hingga saat ini masih belum menerima gaji dari pihak kontraktor. Alasannya, belum ada pencairan dana dari pihak provinsi yang menangani bantuan rumah dhuafa. Sehingga gaji pekerja dan pembangunan rumah tidak bisa direaliasasi. “Ini jawaban kontraktor ketika ditanyai oleh sejumlah pekerja,” sebut Nurman. Data yang berhasil diperoleh dari beberapa sumber, jumlah rumah duafa dari Provinsi Aceh tahun 2008 untuk Aceh Utara jumlahnya mencapai 400-an unit. Ke semua rumah bantuan itu kondisinya sama di seluruh kecamatan. Fuad Muchtar, Camat Geureudong Pase, Aceh Utara kepada Was-

pada, Selasa (27/10) di Lhokseumawe menjelaskan, di daerahnya terdapat sekitar 8 unit rumah dhuafa bantuan Provinsi Aceh tahun 2008. Dan hingga saat ini, realiasasinya baru sekitar 60 persen. Rata-rata, rumahrumah itu belum dilengkapi dengan kuda-kuda, jendela dan pintu. Padahal, rumah tersebut sangat diharapkan oleh penerima manfaat. Disebutkan, sejak pembangunan rumah itu dilaksanakan di kecamatannya, pihak kontraktor tidak pernah berkoordinasi dengan pihak kecamatan. “Makanya, ketika ditelantarkan seperti ini, kita tidak tahu harus komplain kemana. Harusnya, hubungan koordinasi tetap terjalin dengan pihak kami. Kami berharap, kontraktor segera menyelesaikan pembangunan rumah-rumah itu, karena memang sudah dinanti-nantikan masyarakat,” pinta Fuad Muchtar.(cmun)

BANDA ACEH (Waspada): Ketua sementara DPRA Hasbi Abdullah menegaskan pihaknya ingin memfokuskan diri pada peningkatan kesejahteraan rakyat. Karena itu, program pembangunan ke depan diharapkan bisa menyentuh langsung dengan hajat orang banyak.

Ratusan Rumah Duafa Terlantar

Tiga Pengedar Ganja Dan SS Diringkus Pelaku Curanmor Ditembak SINGKIL (Waspada): Jajaran Polres Aceh Singkil meringkus tiga pengedar barang haram berupa ganja dan sabu– sabu dalam sebuah operasi gabungan di dua lokasi berbeda di Aceh Singkil dan Pemko Subulussalam. Selain mengamankan pelaku masing–masing AR, 34, Sup, 41, serta ESH, dan barang bukti berupa 4 Kg ganja kering dan sabu–sabu seberat 0,1650 mg. Satuan Intel Polres Aceh Singkil juga berhasil menangkap dua pelaku pencuri sepeda motor yang beraksi di Pemko Subulussalam Jumat (24/10) lalu, Her, 19 dan Sam, 19, warga kecamatan Singkil. Satu di antara tersangka Her, 19, terpaksa dilumpuhkan dengan tembakan di paha kirinya karena berusaha kabur. Sementara rekannya Sam, 19, warga yang sama sempat dihakimi massa sebelum diamankan di Mapolres Aceh Singkil. Kapolres Aceh Singkil AKBP Helmi Kwarta R. S.Ik, MH didampingi KBO Reskrim Ipda Aries Diego Kokari dan Kapolsek Pulau Banyak Ipda Antoni Tarigan Serta Aipda Safari Kanit Narkoba Polres Aceh Singkil kepada wartawan Senin (26/10) menjelaskan, pelaku AR, 31, dan rekannya Sup, 41, keduanya warga Tembung Medan berhasil ditangkap setelah diintai oleh personel Intel dan Reskrim Polres Aceh Singkil di cafe Penang Pemko Subulussalam sekira pukul 19.30, Sabtu (24/10) setelah mendapat informasi dari masyarakat. Dari tangan tersangka ditemu-kan barang bukti berupa sabu–sabu seberat 0,1650 Mg dan satu unit sepeda motor sebagai barang bukti serta masih

memburu Jul diduga pemasok barang haram itu dari Medan ke Aceh Singkil. Kejar–kejaran Kendati tidak melakukan perlawanan, namun untuk meringkus ESH, petugas Polsek Pulau Banyak terpaksa kejar–kejaran dengan pelaku di perairan laut Pulau Banyak Aceh Singkil. Upaya pengejaran sejak Senin (19/10) baru berhasil Rabu (21/10) sekitar pukul 10.00 Wib di laut Pulau Banyak. Kapolres Aceh Singkil AKBP Helmi Kwarta R. S.Ik . MH menyebut-

kan, penangkapan ESH itu dilakukan setelah mendapat informasi dari masyarakat terhadap tersangka yang rencananya akan transaksi ganja yang dibawa dari Sibade, Kecamatan Bakongan, Aceh Selatan ke Kec. Pulau Banyak, Aceh Singkil. Hingga berita ini diturunkan tiga tersangka pelaku pengedar ganja, sabu–sabu yang terancam hukuman penjara Maksimal 15 hingga 20 tahun itu dan dua pelaku pencurian kendaraan sepeda motor mendekam di sel Polres Aceh Singkil untuk proses hukum selanjutnya.(cb02)

BIREUEN (Waspada): Tim Elang Polres Bireuen. Kamis (22/10), berhasil menggulung enam pengedar SS dalam waktu enam jam. SS 8 gram atau senilai Rp8 juta SS ikut disita, seorang diantaranya masuk DPO mereka. “Kita masih memburu seorang DPO kelompok mereka dan mungkin masih ada beberapa calon terrangka lainnya yang terus dikembangkan, sehingga terlambat publikasi,” kata Kapolres Bireuen, AKBP T Saladin SH didampingi Kasat Reskrim, AKP Trisna Safari di Mapolres setempat, Senin (26/10). Diceritakan, berhasil menggulung para tersangka setelah pihaknya menindaklanjuti informasi dari masyarakat DPO Polres Bireuen sedang berada di suatu desa yang mungkin akan melakukan transaksi sabu-sabu. Informasi penting ditindaklanjuti tim elang dengan kendaraan roda empat ke titik sasaran, tim elang pertama menangkap Bud, 38, warga Cot Gapu Bireuen yang sedang dengan sepeda motor di kawasan Desa Lhok Awe, Kota Juang Bireuen. Tersangka saat akan ditangkap

hendak kabur, anggota menggeledah tersangka ditemukan SS seberat 1 gram di saku celana. Hasil pengembangan, lalu diciduk tersangka lain Mus, 24, warga Cot Tarum Baroh, Kota Juang. Darinya disita SS seberat 1 gram. Dari dua tersangka ternyata barang itu diperoleh dari Saf, 24, juga warga Cot Tarum Baroh kemudian dilakukan penangkapan yang saat itu, Saf sedang di salah satu warung kopi. “Dari interogasi terhadap ketiga mereka ada tersangka lain, petugas kemudian menangkap YA, 18, warga Desa Kareung, Kecamatan Kuala yang sedang menunggu orang lain di salah satu lapangan sepakbola,” kata Kasat Reskrim. Di tangan Yu, diperoleh SS seberat 5 gram atau senilai Rp6,5 juta. Seorang tersangka lain dan sudah diketahui identitasnya menghilang saat dicari dan dimasukkan sebagai DPO. Jadi total barang bukti SS seberat delapan gram setara Rp8 juta terus dikembangkan.(b03)

Masyarakat Dukung Mosi Tak Percaya, Ganti Sekwan LHOKSEUMAWE (Waspada): Sebagian besar masyarakat Kota Lhokseumawe kini memberikan reaksi positif mendukung mosi tak percaya yang digalang oleh 16 orang anggota dewan setempat, Selasa (27/10) agar segera menggantikan posisi Sekwan dengan wajah orang baru. Mosi tak percaya yang ditandatangani 16 orang DPRK Lhokseumwe itu mendapat dukungan positif dari sebagian kalangan masyarakat Kota Lhokseumawe karena menginginkan perubahan lebih baik di masa mendatang. Salah satu Lembaga Swadaya Masyarakat (LSM) dari Masyarakat Transparansi Aceh (MaTA) juga ikut memberikan tanggapan positif dengan tujuan untuk memberi pencerahan dan perubahan yang baik di masa mendatang. Koordinator MaTA Alfian mengatakan dirinya tidak mau berkomentar terlalu jauh dalam persoalan intern DPRK, karena menilai mosi tak percaya itu adalah haknya para dewan yang

menginginkan perubahan ke arah lebih baik. Sementara Sekwan DPRK Lhokseumawe Dasni kepada Waspada mengatakan meski dirinya tidak mau mengundur diri, namun dirinya hanya pasrah dan menerima keputusan dari Walikota Lhokseumawe Munir Usman. Sementara Ketua sementara DPRK Lhokseumawe Mujiburrahman ditemani Wakil Definitif DPRK Lhokseumawe Ir. Az hari Nurdin membantah langkah yang sedang dilakukan 16 dewan itu bukan mosi tak percaya. Karena pihaknya tidak tahu sama sekali tentang baik atau buruknya sosok Dasni sebelumnya. “Sebenarnya itu bukanlah mossi tak percaya. Tapi saran permintaan dewan ke Walikota, itu pun kalau diterima. Paling jelasnya, ide ini dilakukan oleh orang-orang baru yang menginginkan adanya wajah baru. Anggota dewan baru, maka sekwan juga harus baru,” ungkap Mujiburrahman. (b15)

M Yusuf Ketua DPRK Abdya BANDA ACEH (Waspada) : Rapat paripurna istimewa DPRK Aceh Barat Daya (Abdya) pada Senin (26/10) yang di pimpin oleh Reza Mulyadi secara resmi menetapkan M Yusuf sebagai Ketua DPRK Defenitif DPRK Abdya untuk masa bhakti 2009-2014. Pelantikan Yusuf sesuai dengan surat keputusan Gubernur NAD bernomor 171.21/571/2009, Selain Yusuf yang berasal dari Partai Aceh sebagai Ketua, sidang juga menetapkan Drs. Rusman Alian dari Partai Demokrat dan Elizar Lizam,SE dari Partai Amanat Nasional masing-masing sebagai Wakil Ketua. Pimpinan DPRK Abdya yang baru itu langsung diambil sumpahnya oleh Kadim, SH, Ketua Pengadilan Negeri Tapaktuan atas nama Ketua Mahkamah Agung Republik Indonesia. Hadir sejumlah pejabat serta tokoh masyarakat saat kegiatan penetapan yang berlangsung pada Sekretariatan DPRK Abdya itu. Selain itu hadir juga dalam acara Bupati Aceh Barat Daya Abdya, Akmal Ibrahim, wakil Bupati Ir. Syamsurijal, M.Si, Kapolres Abdya AKBP Eddy

Djunaidi,S.Ik, Dandim 0110 Abdya Letkol Inf Purnomo, dan Wakil Kajari Blangpidie, Resmen,SH. M.Yusuf usai ditetapkan mengharapkan agar seluruh elemen dapat bersatu padu untuk mewujudkan daerah dan masyarakat Abdya yang lebih baik. Harapan Yusuf disambut baik Akmal. Dalam sambutannya Akmal juga meminta agar fungsi pengawasan yang melekat pada lembaga legislative dapat digunakan seketatnya sehingga Satuan Kerja Perangkat Dinas (SKPD) bisa bekerja lebih maksimal. “Selama ini sering timbul politisasi masalah hanya karena sikap yang tidak transparan, semestinya tidak perlu ditutup-tutupi sehingga data yang ada sesuai fakta yang sebenarnya, sebab jika sebuah persoalan sudah dipolitisasi maka yang muncul tentu bukan lagi fakta yang sebenarnya karena sudah kabur dan tidak lagi jelas, sebab telah berlandaskan kepentingan,” demikian Akmal Ibrahim.(b32)

LBH Sesalkan Kasus Penembakan Hasan Basri LHOKSEUMAWE (Waspada): Kasus penembakan yang dilakukan seorang oknum aparat dari Polres Lhokseumawe yang menewaskan Hasan Basri seorang sipil sakit jiwa di depan warkop Gampong Atjeh, Selasa (26/ 1) akhirnya menuai reaksi kritik dan disesalkan Lembaga Bantuan Hukum (LBH). Ungkapan menyesali tindakan oknum polisi menembak sipil hingga tewas itu tertuang dalam siaran pers dari LBH Banda Aceh Pos Kota Lhokseumawe yang diterima Waspada kemarin. Melalui salah seorang staf LBH Banda Aceh Pos Kota Lhokseumawe Zul Azmi, SH menanggapi aksi penembakan terhadap Hasan Basri alias Mak Hasan hingga tewas di tempat merupakan tindakan berlebihan. Sebagaimana yang diberitakan Waspada, Selasa (26/10), singkatnya Hasan Basri alias Mak Hasan pemuda mengalami gangguan jiwa atau stress warga Besi Tua, Desa Hagu Teungoh,

kecamatan Banda Sakti, Kota Lhokseumawe. Hasan Basri tewas ditembak seorang anggota Polres Lhokseumawe Iptu Suh, Sabtu (24/ 10) sekira pukul 22.00 WIB. Penembakan itu diduga dilatarbelakangi adanya praduga Hasan Basri menghisap ganja di tempat umum. Oleh karena itu, LBH Banda Aceh Pos Lhokseumawe menilai tindakan itu berlebihan dan tidak sesuai dengan UU No.2 Tahun 2002 Tentang Kepolisian Negara Republik Indonesia. Akibat insiden itu LBH Banda Aceh Pos Lhokseumawe menegaskan kembali pihaknya sangat menyesalkan tindakan berlebihan tersebut Apalagi mengingat pelakunya adalah kanit P3D Polres Lhokseumawe yang semestinya dengan jabatan yang dimiliki lebih mengerti dalam penanganan hukum sesuai ketentuan dan peraturan yang berlaku.(b15)

PT. Pelabuhan Indonesia 1 Salurkan Rp1.303 M Bantuan Pinjaman Mitra Binaan


BARANG BUKTI: Tersangka pengedar sabu – sabu Abd Rahman dan Suparman diapit oleh KBO Reskrim Polres Aceh Singkil Iptu Aries Diego Korari dan Kanit Narkoba Aipda Safari beserta barang bukti berupa sabu – sabu seberat 0,1650 Mg dan 4 Kg ganja kering poto direkam Senin (26/10)

ACEH UTARA (Waspada): Sejak 1994 PT. Pelabuhan Indonesia 1 (Persero) Cabang Lhokseumawe menyalurkan bantuan pinjaman mitra binaan Rp1.303 miliar, dengan rincian tahap pertama dan ke dua Rp449 juta, tahap ke tiga Rp854 juta. Hal itu disampaikan Samsul Bahri, General Manejer Pelabuhan Umum Krueng Geukueh Aceh Utara, didampingi S. Manik, Asisten Manajer Hukum dan Pengaman, serta Zulkarnaen, Asisten Manejer Kemitraan dan Bina Lingkungan, Kamis (22/10) pagi di ruang kerjanya. “Ini merupakan program rutin PT. Pelabuhan Indonesia 1 khusus untuk membantu masyarakat lingkungan

pelabuhan yang berekonomi lemah. Program ini masih berlangsung hingga sekarang,” sebut Manik. Sistem pinjaman jenis bantuan ini sangat mudah dan ringan, peminjam hanya diperintahkan membuat proposal sesuai jenis usaha yang digeluti. Jika telah melengkapi semua persyaratan, peminjam hanya diwajibkan mengembalikan pinjaman dengan bunga 6 persen. “Sebagai jaminan, kita minta agunan. Misalkan peminjam mau mengambil modal Rp20 juta, maka agunan yang harus diberikan minimal setengah dari pinjaman. (cmun)


WASPADA Rabu 28 Oktober 2009


LP Klas II B Kualasimpang Full KUALASIMPANG ( Waspada): Lembaga Pemas-yarakatan (LP) Klas II B penghuninya sudah full (penuh) kapasitas ,sehingga sejumlah narapidana (Napi) yang tersangkut berbagai kasus terpaksa harus tidur di mushala Komplek LP Kualasimpang, Kabupaten Aceh Tamiang. “LP Kualasimpang sudah penuh, sehingga sejumlah narapidana terpaksa tidur di mushala LP ini,” ungkap Kalapas Klas II B Kualasimpang, Drs Marasidin, Bcip ketika dikonfirmasi Waspada, Senin (26/10). Marasidin menjelaskan, kapasitas LP Kualasimpang yang terdiri 7 blok hanya dapat menampung 150 orang, namun sampai kemarin tercatat 289 penghuni terdiri atas Narapidana, tahanan Kejaksaan, polisi dan tahanan hakim. “Benar-benar daya tampung Lembaga Pemasyarakatan Kualasimpang sudah tak memadai, penghuninya membludak, sedangkan kamar yang tersedia amat terbatas,” katanya. Penghuni LP Kualasimpang, sebut Marasidin, diperkirakan sebanyak 45 persen adalah napi dan tahanan yang terlibat dalam kasus narkotika dan psikotropika, sisanya yaitu yang terlibat dalam kasus pencurian, pembunuhan, asusila, Tipikor dan kriminalitas lainnya. “Kasus narkotika dan psikotropika menduduki urutan teratas penghuni

LP Kualasimpang, “ tegas Marasidin. Kalapas itu juga merincikan jumlah penghuni kamar (sel) ada yang 26 orang dalam satu kamar, ada juga 10 orang dan 7 orang. “Bayangi saja yang satu kamar 26 orang tentu saja untuk tidur disusun seperti ikan kemasan kaleng yang berjepitan,” terangnya. Menurutnya lagi, kamar yang seharusnya untuk 10 orang terpaksa diisi 26 orang. “Sehingga untuk tidur harus diatur selangseling antara kaki dan kepala, ada kaki yang menghadap ke kepala napi dan ada juga kepala yang menghadap kaki napi, tahanan lainnya,” tutur Marasidin. Marasidin juga menjelaskan, napi yang boleh tidur di mushala napi masa hukumannya hampir habis atau hampir selesai antara 1 s/d 2 bulan lagi bebas dari LP Kualasimpang. Persoalan lainnya, ungkap Kalapas, jumlah pegawai juga relatif kurang . “Di LP Kualasimpang ada tiga regu yang bertugas secara aplusan. Masing-masing regu bertugas 24 jam, seharusnya hanya 8 jam, tetapi karena jumlah pegawai 15 orang untuk tiga regu, masing-masing regu berjumlah 5 orang, sedangkan idealnya satu regu berjumlah 10 orang dan jam tugasnya 8 jam untuk mengawasi napi dan tahanan di LP Kualasimpang,” rinci Marasidin. (b24)

Pemeriksaan Kadis PU Abdya Jangan Setengah Hati BLANGPIDIE(Waspada): Pemeriksaan Kadis Pekerjaan Umum (PU) Kab. Aceh Barat Daya (Abdya) oleh Kejaksaan Tinggi (Kejati) Aceh, dalam kasus dugaan penyimpangan proyek saluran pembuangan di areal perkebunan rakyat Unit Babahrot, Kab. Abdya mendapat dukungan dan apresiasi dari lembaga dewan. Para wakil rakyat di daerah produsen bre’h sigeupai itu minta kejaksaan mengusut kasus dugaan penyelewengan ini sampai tuntas dan jangan setengah hati. Ketua sementara DPRK Abdya Reza Mulyadi, didampingi sejumlah anggota lainnya kepada wartawan di Blangpidie, Sabtu ((24/10) mengatakan sangat mendukung Kejati Aceh mengungkap kasus korupsi yang terjadi di Abdya. “Kita harapkan pemeriksaan dilakukan hingga tuntas, jangan setengah hati,” ujarnya. Pemanggilan dan pemeriksaan Kadis PU

Abdya Ir. M. Tavit, pekan lalu di Banda Aceh, terkait kasus penyimpangan proyek saluran di Kec. Babahrot, dibiayai dua sumber anggaran, yakni APBK Abdya tahun 2007 sebesar Rp4 miliar dan APBA 2008 Rp4,35 miliar. Reza Mulyadi menilai, pengusutan kasus dugaan korupsi itu sudah tepat dan siapa pun yang terlibat harus diseret ke pengadilan. “Kami sangat mendukung apa pun yang dilakukan Kejati Aceh dan Kejari Blangpidie untuk memberantas korupsi di Abdya,” tambahnya didampingi Hermasyah (PPP), Elizar Lizam (PAN), RS. Darmasyah (P. Golkar) dan Samsul Bahri (PBB). Berdasarkan riset Forum Antikorupsi dan Transparansi (FAKTA) Aceh, sebelumnya melaporkan dana proyek saluran pembuangan di Kec. Babahrot bersumber dari dua sumber anggaran berbeda APBK tahun 2007 senilai Rp4 miliar dan APBA tahun 2008 senilai Rp4,35 miliar.(b19)

MPD Sampaikan Beberapa Masalah Pendidikan Kepada Walikota Langsa LANGSA (Waspada) : Majelis Pendidikan Daerah (MPD) berhasil menjaring dan menghimpun beberapa masalah pendidikan untuk selanjutnya akan disampaikan kepada Walikota Langsa Drs Zulkifli Zainon, MM. Masalah itu termasuk soal kinerja pejabatnya yang dihimpun dari berbagai masukan setelah mengamati dari perkembangan akhir yang mewarnai perjalanan pendidikan di Kota Langsa. Dalam rapat rutin bulanan dengan jajaran pengurus, Ketua MPD Kota Langsa Drs H. Djamaluddin AR yang memimpin pertemuan mengatakan lembaga organisasinya telah berhasil menyerap beberapa masalah pendidikan yang berkembang dalam masyarakat, mulai dari soal proses penerimaan murid baru tahun 2009/2010, sampai kepada masalah mutasi dan pengangkatan pejabat kepala sekolah. Beberapa kasus diantaranya, belakangan ini sempat menyita perhatian terutama dari kalangan tokoh pendidikan. Kebijakan yang cenderung bernuansa KKN tersebut kemudian mengundang kontroversial. “Ada guru SD yang diangkat menjadi kepala SMP,” ungkap Drs H. Zulkifli Usman Ali, SH, MBA, Wakil Ketua MPD yang pernah memangku jabatan Kakandep Dikbud Kabupaten Pidie, sebelum dia memasuki masa pensiun. Sederetan persoalan lain seperti terungkap dalam rapat pengurus MPD belum lama ini, melaporkan beberapa masalah pendidikan itu dipandang serius, sehingga memerlukan perhatian dan penanganan dari Walikota Langsa Zulkifli Zainon. Salah satu yang perlu

mendapat perhatian karena telah menjadi perbincangan adalah soal kurang selektifnya pejabat pengambil keputusan ketika mengangkat kepala sekolah. Menurut hasil investigasi dan masukan dari beberapa sumber menyebutkan bahwa dalam pengangkatan pejabat kepala sekolah di semua jajaran lembaga, ternyata belum sepenuhnya mengacu kepada jenjang karier dan mekanisme baku. Malah sumber Waspada mengatakan, kalangan unsur pengawas kurang dilibatkan dalam mengambil keputusan terhadap figur pejabat yang akan ditetapkan sebagai calon. Sebab itu, tak aneh jika kemudian di temukan ada kejanggalan dalam pengangkatan pejabat kepala sekolah. Ada juga kepala sekolah yang baru setahun diangkat, terpaksa diturunkan lagi karena ‘berbuat ulah’. Hal ini membuktikan karena tidak selektifnya dalam proses calon kepsek. Uniknya lagi, sang guru tadi (mantan kepala) yang belum sempat masuk tugas ini, lantas lalu diangkat menjadi pengawas. Dasar pertimbangan acuan apa yang dipakai pejabat pengusul. Kepala Dinas Pendidikan Kota Langsa Drs Abdullah Gade, M.Pd yang dikonfirmasi Waspada tentang beberapa masalah pendidikan yang menjadi sorotan seperti diperoleh MPD, mengakui sebahagian dari masalah tersebut ada benarnya. Namun sebahagian lainnya, kata dia, tidak sepenuhnya benar. Sudut pandang dalam melihat masalah juga beda sehingga penjabaran praktis berbeda pula.(b26)

RUSAK BERA T: BERAT Kondisi jembatan di Dusun Rawamas, Desa Teupin Pukat, Kecamatan Nurussalam, Aceh Timur, rusak berat dan terancam ambruk. Akibatnya, nelayan dan petani tambak di daerah itu resah. Apalagi di saat mengangkut hasil panen dari tambak ke pasar. Jembatan yang panjangnya lebih kurang 15 meter itu didesak untuk direhab. Foto diambil Minggu (25/ 10). Waspada/Muhammad H. Ishak

Selat Malaka Rawan Penyelundupan IDI, Aceh Timur (Waspada): Pasca tenggelamnya KM Harapan Makmur yang mengangkut monza dari Malaysia ke Aceh di perairan Kuala Peureulak, Kab. Aceh Timur, Provinsi Aceh, Selasa (20/10) dini hari, seolah makin terkuak informasi terkait aksi penyelundupan yang marak di perairan Selat Malaka. Informasi yang diperoleh Pol Air Polda NAD dalam kurun waktu dua bulan terakhir menyebutkan, perairan selat malaka selaku jalur perdagangan Internasional itu ternyata benar digunakan para pelaku dalam sejumlah aksi kriminalitas dan pelanggar hukum. “Karena selama ini polisi fokus ke darat, sehingga wilayah hukum kita di laut terabaikan. Karena itu kini kita mulai

mendeteksi aksi para penyelundup dan pelanggar hukum yang isunya kian menjadi-jadi di perairan Aceh,” ungkap Kasubdit Bin Ops Ditpol Air Polda NAD, AKBP Faisal Rifai, S.Ik. Karenanya, lanjutnya, polisi kini akan komit memberantas segala aktivitas yang kian meresahkan masyarakat, seperti aksi trawl Thailand dan aksi PI dan PU asal Belawan, Sumatera Utara, yang masuk ke perairan tanpa izin resmi. Disebutkan, untuk mengantisipasi itu, pihaknya telah menyiapkan segala bentuk fasilitas dan persiapan di laut, seperti kapal. Dimana semua kapal dilengkapai dengan senjata mesin canggih dan siap berperang jika konflik di laut dengan para perompak. Dikatakannya, dari beberapa informasi pengembangan di lapangan, selat malaka rawan aksi penyelundupan. Hal itu terkuak dari pelaku dalam kasus-kasus yang berhasil dibongkar petugas keamanan, baik itu kasus senjata api dan kasus shabu atau sejenisnya.

Kepada Waspada pekan lalu di Kuala Idi, Kab. Aceh Timur, Faisal Rifai mengatakan, pengakuan pelaku saat menjalani pemeriksaan bahwa semua barang illegal itu diperolehnya dari aksi penyelundupan di jalur selat malaka. AKBP Faisal Rifai menjelaskan, barang illegal seperti monza, pupuk dan gula diduga masih dipasok dari negara tetangga ke Aceh melalui jalur laut. Karenanya, keamanan di perairan perlu ditingkatkan guna mengatasi aksi tersebut. “Ini jelas mengganggu ekonomi dunia Internasional, dan bagi Indonesia itu semua aksi terlarang yang harus dibasmi,” tegas Faisal Rifai. Untuk itu, tambahnya, selat malaka kini menjadi target operasi keamanan laut, baik itu Pol Air Polda NAD untuk meng-bac-up polisi di daerah, maupun TNI AL. “Polisi telah siagakan dua unit kapal di Idi, Aceh Timur, satu kapal di Kota Langsa, dan satu kapal besar di Pelabuhan Kota Sabang,” tandas Faisal Rifai. (cmad)

350 Pengungsi Konflik Satwa Tinggalkan Barak SIMPANG JERNIH (Waspada): Setelah mengungsi lima hari yang lalu akibat konflik satwa, 350 jiwa warga Beudari, Desa Ranto Panjang, Kec. Simpang Jernih, Kab. Aceh Timur, memilih pulang meninggalkan barak pengungsian, Selasa (27/10) pagi. 67 Kepala keluarga (KK) di pedalaman Aceh Timur itu mengungsi, Kamis (22/10) sore. Pasalnya, belasan ekor gajah mengamuk dan merubuhkan sejumlah rumah penduduk dalam tiga hari terakhir. Namun, setelah dihalau dengan cara tradisional, keganasan satwa itu menurun. “Hanya beberapa hari warga di pengungsian. Setelah amukan gajah menurun, kini ratusan jiwa yang sebelumnya mengungsi di Masjid Nurul Iman, Kec. Simpang Jernih, kini kembali ke pemukimannya masing-masing,” sebut Camat Simpang Jernih, Dahnil Harmy, SH, menjawab Was-

pada, Selasa (27/10). Melalui telefon genggamnya, Dahnil Harmy mengatakan, amukan gajah dalam sepekan terakhir telah merubuhkan tujuh rumah warganya. Selain itu, puluhan hektar lahan gabah siap panen ikut diporak-poranda hingga rata dengan tanah. Menurut Camat Dahnil, gajah yang sebelumnya mengamuk di wilayah kerjanya, kini mulai bisa dikendalikan. Pengakuan warga kepadanya, amukan gajah yang secara tiba-tiba itu terjadi akibat pembalakan liar yang kerap terjadi di gunung Leuser. Tetapi, kawanan hewan berbelalai itu telah berpindah ke barat Kecamatan Simpang Jernih (mulai ke daerah Lokop—Serbajadi). Dahnil atau akrab disapa Ayah menyebutkan, seluruh bantuan yang diberikan Pemkab Aceh Timur telah disalurkannya kepada seluruh peng-

ungsi. Ketika disinggung bagaimana kondisi rumah pasca mengganasnya gajah? Dahnil mengaku, warga yang rumahnya dihantam gajah mencoba membangunnya kembali dengan swadaya. “Warga yang kembali mulai menempati rumah-rumah yang serba darurat itu. namun kita berharap, jika amukan gajah kembali terjadi diharapkan warga segera mencari perlindungan ataupun mengungsi ke titik yang lebih aman,’ ungkap Camat Dahnil. Dia menuturkan, tidak tertutup kemungkinan amukan gajah akan terjadi lagi di wilayahnya, karena posisi gajah kini hanya berjarak dua kilometer dari pemukiman warga (dari Dusun Beudari—lokasi amukan gajah). “Gajah itu tetap mengamuk jika habitatnya diganggu, namun kita penebangan hutan dapat dihentikan disana,” tandas Camat Dahnil Harmy. (cmad)

Warga Sawang Ba’U Protes Pemindahan Lokasi Proyek Tanggul

Waspada/ Bahtiar Gayo

COPOT LENCANA: Kapolres Aceh Tengah AKBP Edwin Rachmat Adikusumo menangalkan lencana Kasat Lantas AKP. Nur Khamid yang akan menempati posisi baru sebagai kasat Lantas Pidie.

Serah Terima Kasat Lantas TAKENGON (Waspada): Baru dua bulan bertugas di Lantas Polres Aceh Tengah, AKP Nur Khamid, sudah ditarik dan dipercayakan menjadi Kasat Lantas Polres Pidie. Nur Khamid sedang mengalakkan disiplin berlalu lintas di Aceh Tengah, baru saja membagikan helm gratis. Nur Khamid selama ini dikenal disiplin dan rajin memberikan pengertian kepada pengguna jalan untuk tertib berlalu lintas. Setelah diberikan sosialisasi, dan masih ada pengguna jalan, baru mereka mengambil tindakan. Operasi rutin dilaksanakan, karena

Aceh Tengah menjadi kawasan tertib lalu lintas di Aceh. Serah terima yang mendadak itu berlangsung di halaman Mapolres Aceh Tengah, Selasa (27/10). Jabatan Kasat Lantas dipercayakan kepada Iptu Agung, sebelumnya KBO lantas Polres Aceh Timur. Selain serah terima jabatan Kasat Lantas, Kapolres Aceh Tengah AKBP. Edwin Rachmat Adikusumo, juga menerima komando Polsek Silih Nara yang ditinggalkan M. Andrean.N, yang diberikan tugas baru di Kalimantan Timur.(b18)

TAPAKTUAN (Waspada): Warga Gampong Sawang Ba’u Kecamatan Sawang Kab.Aceh Selatan memprotes Dinas Pekerjaan Umum Aceh Selatan, gara-gara lokasi proyek pembangunan pengaman tebing yang semua di daerah mereka kemudian dipindah ke lokasi lain tanpa alasan yang jelas. Meski diprotes, proyek itu terus dilaksanakan kontraktor berinisial Ir dengan dalih telah mendapat restu dari kepala Dinas PU Aceh Selatan H. Jufri Azman, ST, berikut pedoman gambar lokasi yang diterima dari Dinas PU setempat. Menurut Kepala Gampong Sawang Ba’u, Kecamatan Sawang Aceh Selatan Ali Wardhana, S.Ag, akibat pengalihan lokasi pembangunan proyek pengaman pantai yang bersumber dari dana Otsus senilai Rp1 miliar itu, warga setempat nyaris bentrok dengan warga Gampong Ujung Padang

Sawang. “Oleh karena itu kami buat laporan kepada pimpinan daerah dan kepolisian agar dapat dicarikan penyelesaiannya,” katanya kepada wartawan di Tapaktuan, Minggu (25/10) kemarin. Keyakinan kepastian pemindahan lokasi proyek di desa itu, setelah ditelusuri ke Dinas Pengairan Provinsi Aceh, beberapa waktu lalu. Dari dokumen itu, diketahui proyek pengaman pantai dari ancaman abrasi laut Samudera Indonesia terhadap pemukiman, maka lokasi proyek tetap di kawasan pantai Ujung Sawang Ba’u Kecamatan Sawang Aceh Selatan, sebagamana nama paket proyek yang tercantum dalam pelelangan pasca kualifikasi Nomor: 03/PENG/PAN/V/2009. Sementara Kepala Dinas PU Aceh Selatan H. Jufri Azman yang ditanyai Waspada

melalui Kabid Pengairan Nesal Putra, ST secara terpisah mengakui munculnya aksi protes dari masyarakat Sawang Ba’U. Namun katanya, protes itu muncul karena adanya pihak provokator yang mempengaruhi masyarakat dan diyakini terkontaminasi unsur politis. Padahal katanya proyek itu sama sekali tidak dipindahkan dan tetap di lokasi semula yaitu di Ujung Padang dan bersambung ke Sawang Ba’U. “Cuma pekerjaannya dimulai dari Gampong Ujung Padang sehingga dipolitisir telah dipindah ke Ujung Padang,” katanya. Nesal mengaku tak terpengaruh dengan aksi protes warga itu karena protes ini selain berbau politis juga salah paham, jadi tak perlu ditanggapi. “Pekerjaan kita di lapangan terus berlangsung guna menghindari ancaman luncuran hingga awal Desember mendatang,” tambahnya.(b19)

Dua Remaja Langkat Tewas Tenggelam Di Tamiang KUALASIMPANG (Waspada): Dua remaja, Yopi Mahendra, 19, dan Aidil Saputra, 16, keduanya warga Dusun III Desa Palang Merah Kecamatan Pamatang Jaya, Kabupaten Langkat, Sumatra Utara Sumut) tewas ketika sedang mandi di waduk Desa Bukit Selamat, Kecamatan Tenggulun, Kabupaten Aceh Tamiang, Minggu (25/10) sekira pukul 17: 00. Kapolres Aceh Tamiang AKBP Drs Hariyanta melalui Kapolsek Kejuruan Muda, Iptu Muhajir ketika dikonfirmasi, Senin (26/10) menjelaskan, Pada hari naas itu, kedua korban sedang duduk di pinggir kolam, tiba-tiba Yopi Mahendra melompat ke dalam waduk, namun daerah yang dilompati merupakan kawasan lubuk yang dalam dan airnya mengalir amat deras. Menurut Kapolsek , sesaat setelah meloncat, Yopi muncul ke permukaan dan korban ketika itu meminta tolong kepada temannya, Aidil Saputra. Aidil langsung meloncat berupaya menolong, namun malah ikut tenggelam, sehingga keduanya tewas tenggelam di Waduk. Melihat kejadian itu, lanjut Kapolsek, warga setempat langsung mencari kedua korban yang tenggelam dan mengangkatnya ke permukaan. “Saat diangkat nyawa korban sudah tidak ada lagi. Keduanya langsung dibawa ke Pukesmas Simpang Kiri, dari hasil visum tidak ditemukan tanda-tanda kekerasan. Korban hanya kekurangan oksigen untuk bernafas. Hari itu juga keduanya diserahkan ke rumah duka untuk dikebumikan,” kata Kapolsek Kejuruan Muda. (b24)

Rumah Pekebun Ludes Terbakar PEUREULAK, Aceh Timur (Waspada): Satu unit rumah petani panggung miliknya M. Yunus Husen, di Desa Seunebok Dalam, Kecamatan Peureulak Timur, Kab. Aceh Timur, Senin (26/ 10) sekitar pukul 09.00, ludes dilalap si jago merah. Tidak ada yang mengetahui persis penyebab kebakaran itu, karena saat itu seluruh penghuni rumah berada di kebun. Meski tidak menimbulkan korban jiwa dalam insiden itu, namun kerugian diperkirakan puluhan juta rupiah, mengingat tidak ada satupun harta benda yang sempat diselamatkan. Muzakir, tokoh pemuda setempat mengatakan, pada saat musibah kebakaran itu terjadi pemilik rumah ketika itu sedang berada di kebun. Warga baru mengetahui adanya rumah terbakar saat melihat api sudah menjalar dan membakar seluruh ruangan rumah yang berkonstruksi kayu itu. Mengetahui hal itu, sejumlah warga saat itu berusaha memadamkan api dengan menyiram air seadanya, namun hal itu kurang memadai. Sehingga api berhasil melahap seluruh bangunan serta isi rumah itu. Mengingat api sulit dipadamkan, lalu warga saat langsung memberitahukan hal itu pada pemilik rumah, yang lagi di kebunnya. Warga sudah berusaha memadamkan api, namun rumah dan isinya tidak juga dapat diselamatkan bahkan sang pemilik terkejut, karena saat sampai di rumah, bangunan rumah itu telah menjadi arang dan debu. Muzakir menyebutkan, keluarga M. Yunus Husen kini mengungsi ke rumah tetangganya yang berdekatan dengan lokasi. (cmad)

Anak PNS Dapat Bantuan Pendidikan Askes TAKENGON (Waspada): 29 Anak Pegawai Negeri Sipil, (PNS) yang berprestasi di lingkungan Setdakab Aceh Tengah mendapat bantuan biaya pendidikan dari PT. Askes. Bantuan itu berupa uang senilai Rp6 juta untuk tingkat mahasiswa dan Rp3 juta untuk tingkat SLTA. Penyerahan beasiswa diserahkan Sekda Aceh Tengah, Muhammad Ibrahim, SE Selasa (27/10) di Gedung Pendari Takengon. Dalam acara itu selain diserahkan beasiswa juga dilakukan pelayanan medical chek up terhadap anggota Korpri, serta bantuan perangkat komputer untuk Rumah Sakit Umum Datu Beru Takengon. Menurut Direktur Askes Cabang Lhokseumawe, Zulfaddin, SE, tidak seluruh provinsi telah melaksanakan penyerahan beasiswa kepada anak PNS yang berprestasi. Seperti Sumatra Utara misalnya, sampai sekarang belum dilaksanakan. Selain Aceh Tengah yang menerima beasiswa 24 untuk mahasiswa dan 5 untuk SLTA, Lhokseumawe juga mendapatkan paket bantuan untuk 26 orang. Kabupaten Bireuen hanya 1 orang. Program bantuan pendidikan ini telah digulirkan sejak tahun 2005 lalu, sebut Zulfadin. Sekda Aceh Tengah, Muhammad Ibrahim, SE menyampai-kan rasa terima kasihnya kepada PT. Askes.(cir)

Gedung RSUD Bantuan Jerman Difungsikan BIREUEN (Waspada): Setelah mendapat izin pemakaian dari pihak donatur pihak Rumah Sakit Umum Daerah (RSUD) dr Fauziah Bireuen, mulai memfungsikan gedung baru di sampingnya yang baru-baru ini pembangunannya sudah rampung. Informasi yang diiperoleh Waspada kemarin, berfungsinya gedung baru itu telah mampu menampung 60 pasien rawat inap lagi dan mulai sedikit mengurangi kesemrawutan yang selama ini kerap terjadi. Seperti pasien rawat inap yang ditempatkan di sejumlah luar ruangan rawat inap atau di loronglorong dalam kawasan rumah sakit setempat. Direktur RSUD dr Fauziah Bireuen, dr H Irwan A Gani, kepada wartawan mengatakan, saat ini pihaknya telah mendapatkan izin penggunaan gedung baru bantuan GITEC Jerman tersebut.(b03)


0651-22385 0645-42109


VCD/DVD BELAJAR SULAP Berminat Hubungi: Zaky 081361637291

Liputan Haji 1430 H



Rabu 28 Oktober 2009

PPIH Bekali Calhaj Agar Tetap Prima

Waspada/Abdullah Dadeh

PASPOR : Jamaah Kloter 04 asal Tapanuli Selatan (Tapsel) dan Padang Lawas (Palas) terlihat berbaris teratur menunggu diperiksa kelengkapan dokumen paspor saat hendak bertolak ke tanah suci melalui Embarkasi Polonia Medan, Senin (26/10) sore.

MEDAN (Waspada): Panitia Penyelenggara Ibadah Haji (PPIH) Embarkasi Medan selalu berusaha agar para calhaj tetap prima, saat berada di asrama maupun ketika akan berangkat. Hal itu ditandai dengan pemeriksaan kesehatan calhaj secara menyeluruh sejak kedatangan sampai keberangkatan. Jika ada yang bermasalah, pihak kesehatan segera memberikan antisipasi berupa obat-obatan. Bahkan kepada mereka diberikan pula 20 masker dalam tas yang diberikan oleh PPIH. Demikian dikatakan Drs H Sazli Bidang Penerangan dan Bimbingan Pusat Informasi Haji Embarkasi Medan, Selasa (27/ 10), terkait upaya perhatian yang penuh terhadap kesehatan para calhaj. Sazli menyebutkan setibanya di asrama, panitia langsung memberikan pelayanan dan pengecekan. Demikian pula sebelum berangkat dari asrama, dilakukan pengecekan suhu tubuh yang langsung dilaksanakan oleh dokter ahli. Bagi mereka yang bermasalah, tentu harus diberikan obat agar suhu tubuh mereka normal kembali. “Dalam perjalanan, ada juga dokter yang memberikan pelayanan itu. Jadi, semua calhaj dipersiapkan secara prima kesehatannya agar bisa melaksanakan ibadah dengan baik. Demikian pula saat sudah sampai di Madinah atau Makkah. Para petugas siap sedia memberikan pelayanan dan memberikan obat-obatan yang mereka perlukan. Dari data sistem komputerisasi haji terpadu (Siskohat), disebutkan saat ini suhu di sana 25 derajat yakni di Madinah. Tentu, calhaj kita sudah punya antisipasi karena sudah mendapatkan sosialisasi dari tenaga kesehatan,” kata Sazli. (m36)

Waspada/Anum Saskia

PERIKSA SUHU TUBUH: Dokter yang bertugas dalam tim kesehatan memeriksa suhu tubuh calhaj sebelum mereka diberangkatkan ke Bandara Polonia menuju Madinah.

Waspada/Surya Efendi

Waspada/Abdullah Dadeh

SELAMAT TINGGAL : Terlihat raut wajah kegembiraan sejumlah jamaah calhaj Kloter 04 asal Padang Lawas (Palas) menjelang meninggalkan tanah air menuju ke tanah suci. Mereka melambaikan tangan menandakan selamat tinggal kepada para pengantar dari atas tangga pesawat haji Garuda Indonesia di Embarkasi Medan, Senin (26/10) sore.

NAIK KURSI RODA: Seorang jamaah calon haji lanjut usia terpaksa dibantu petugas haji dengan menaikkannya ke kursi roda ketika jamaah calon haji Kloter 4 asal Padang Lawas memasuki Asrama Haji Medan, Minggu (25/10). Banyak jamaah calon haji kesehatannya terganggu dan terpaksa dibantu kursi roda.

Waspada/Surya Efendi

MENELEFON: Dua jamaah calon haji Kloter 4 asal Padang Lawas langsung menelefon sanak keluarganya ketika tiba di Asrama Haji Pangkalan Mansyur Medan, Minggu (25/10). Karena jam bertamu ditiadakan di asrama tersebut, para jamaah calon haji terpaksa memanfaatkan telefon seluler sebab nantinya tidak bertemu sanak keluarga selama 40 hari ketika berada di tanah suci.

Nama Calon Jamaah Haji Embarkasi Medan Kloter 6 Asal Tebingtinggi dan Medan, Masuk Asrama Haji Rabu (28/10), Berangkat Kamis (29/10) Melalui Bandara Polonia Medan 01. Hamdani Chairuddin Sarwan Bin Chairudin.02. Sutan Sahrir Bin Raup Bin Raup.03. Fatimah Handayani Saragih Binti Amat.04. Rohmasinta Saragih Salasim Binti Salasim.05. Muhammad Adhar Bin Bakri Bin Bakri.06. Agustri Heriyanto Bin Bedjo Suwarso.07.Ary Susiani Binti Abdul Mukti.08. Aminah Binti Bakri.09. Hasdar Amir Saragih Bin Hasyim Saragi h.10. Abdul Hafiz Hasibuan,H,Ir Bin M. Akub.11.Nuraisyah Siregar, Hj Binti Manawi Siregar.12.Rini Rusdi Benyamin Binti Rusdi Benyamin.13.Riza Abdillah Bin Abdul Hafiz Hasibuan.14. Esti Lubis Binti Sungkun Lubis.15. Sukmariatna Binti Saitak. 16.Srimani Binti Untung (Alm).17.Adil Sinaga Bin Jahalim Sinaga .18. Surasman Bin Sarnak .19. Purwani Binti Sukoyo.20.Rosdiati Binti Sutarji. 21.Hadi Asidiq Bin Usman Sugiono. 22.Burhanuddin Bin Gaya (Alm).23. Aminatun Sahra Siregar Binti U.Siregar. 24.Fauziah Binti Hasan Qadry Rambe .25.Rona Murniati Binti Mhd. Thoyib Damanik.26.Marlinah Binti Sutan Basah.27.Dumaria Nainggolan Binti Alm.Togihon .28.Andika Abdi Sumarto Bin Alm.Ngadi.29. Abd.Lian Nasution Bin Abdul Rahman Nasution. 30.Syahni Binti Amir Hamzah (Alm).31. Marianum Harahap Binti Abdul Latif Harahap. 32. Ade Irma Lubis Binti Jauhari Lubis .33.Abdul Jarot Tanjung Bin H.Abdul Wahab.34.Abdul Manan Nasution Bin M.Yusuf Nasution.35.Siti Aminah Pohan Binti Amir Pohan,H.36. Mahniar Binti Jamaluddin Isa .37. Sannah Br.Saragih Binti Alm.Ramaizi. 38.Siti Nurbanun Br.Saragih Binti Alm.Ramizin Saragi.39. Nur Aini Situmorang Binti Jailing Situmorang.40. Ahmad Haris Bin Ismail. 41.Djannah Harahap Bin Pandito Rajo Harahap.42. Mukhtar Drs Bin Djannah Harahap.43. Faridah Hanum Dra Binti Ja’far H.44. Laida Anum Binti Abd Manan.45. Naisyah Binti M. Thoyib.46. Nuraini Br Sitorus Binti Soman Sitorus. 47.Lahmuddin Bin Macin. 48. Wastrak Bin Nuradi.49.Ishak Ibrahim Bin Ibrahim.50.Farida Binti A. Rahman .51. Asmanan Bin Jumari.52. Yudernis Drs Bin Ayun.53.Nurzalmi Binti Djalioes. 54.Nur Aini Binti Usman. 55.Muhari Bin Kasim.56.Abdul

Kadir Nasution Bin Jafar Sidik. 57.M. Nurdin Bin Kamaruddin. 58. Maimunah Binti Abd. Malik.59.Zainab Saragih Binti Mahmud Saragih.60. Syadiah Binti Maskana Lubis. 61. Nurbaiti Batu Bara Binti Maskana Lubis.62. Umiyah Binti Usman.63. Husni Thamrin Simamora Bin M Kasim Simamora.64. Nina Zahara Mz, Sh Binti H.Muhamma.65. Sri Suharti, Dra Binti Tukidjo Sofjan. 66.Elfi Susianty Binti Tukidjo Sofjan, H .67.Umi Kalsum Binti Sulaiman .68 .Sinam Ariaty Binti Semin Atmawijaya.69. Farida Hariani Harahap Binti Amsarud.70.Safniwati Binti H. M. Sidik.71Emmy Julia Binti M.Hadiran Ulung.72. Siti Hajar Binti Syakban.73. Bainuddin Harun, Ba,H Bin Harun .74. Safii Edi Bin H.Muhammad Said Alm. 75.Sulasmi Binti Wiryo Sukarto.76. Nurmigianti Binti H Darsum. 77.Parsaulian Siregar Bin Zainuddin Siregar.78. Misli Bin Asidi. 79.Irawani Binti Tasngin. 80. Sunarti Binti Sastro Tambeng. 81.Maslan Satari Bin Satari. 82.Syamsiah Sinaga Binti Tasmin S. (Alm).83. Mursinah Tanjung Binti Munaf.84.Rosnah Koto Binti Kutar.85. Erwan Putranto Bin Sutirto Sagoro. 86.Henny Binti Abdul Roiny.87.Nuraini Binti Wakidi.88.Sumardi Bin Turman .89.Tety Suryati Binti Abd.Wahab.90. Effendi M.Noor Bin M.Noor.91. M.Zein Bin H.Abdul Karim.92. Syafrah Binti H.Abul.93. Latipah Binti Mahidin.94. Fatimah Syam Binti Ibrahim.95.Leginem Binti Salim.96. Abdul Roni Manurung Bin Haddam Manurung.97.Sri Hanum Sinaga Binti Mat Surung Sinaga.98. Budiman Bin Mangun Diharjo.99. Suhasna Nasution Binti H. Hasim Nasution.100. Napsah Br. Purba Binti Uteh Purba. 101. Yusnani Binti Uteh Purba .102.Sudari Bin Ahmad Darwis.103.Sumaryono Bin Supangat.104.Wakijo Bin Kimin.105. Yusuf Lubis, Sh Bin Alimun Lubis 106. Zainab Binti Harun.107. Ngadijah Binti Dul Mukmin.108. Misdi Bin Toyomo 109.Ngatemi Binti Sajio.110. Sri Rahayu Binti Jailani. 111.Nurhakimah Pulungan Binti Sallim Pulu.112.Juwariyah Binti Poniman.113. Hanifah Khan Binti Sobat.114.Sri Ariawaty Binti Abdul Gafar.115.Nurilas Binti Muhammad Danil.116.Welas

Binti Misar.117.Marliana Binti Ngabeni. 118.Ilham Pane Bin H.Hamzah Pane, Alm.119.Zul Syahrial Bin Sastro Djamian. 120. Yetti Fauziah Syahputra Binti Matdin. 121. Siti Aisyah Binti Jaffar Hsb.122. Rohani Sulaiman Binti Daeng Sulaiman.123. Fatimah Binti Ngadi.124. Elly Eltika Binti Muhammad Puteh. 125.Juraidah Binti H. Amran.126.Aini Saragih Binti Arifin Saragih 127.Asmawati Binti H.M. Mhd. Ilyas.128. Adnan Sinaga Bin Ali Nudin 129.Taufiq Anwar Soleh Siregar Bin Sakiri.130.Supeno Prayitno Bin M Jasmo.131.Raji Bin Marto Dikromo.132.Mhd. Nurdin Bin Abd. Rahman. 133.Siti Aisyah Binti Paiman. 134. Elisnawati, Ir Binti Djunam (Alm) .135. Suriati Binti Markimin.136.Rohani Binti Gagah 137.Rosiah Binti Uyub.138. Abd Roni Damanik Bin Ingah .139. Zainuddin Situmorang Bin Muhammad Amin. 140.Sunarwan Bin Selamat Basuki. 141.Suwito Bin Mhd. Banjar 142.Syawal Marjuki Bin Topo. 143.Paham Harahap Bin Pirman Harahap.144. Samsinar Binti Moget.145. Nurti Asli Siregar Binti H. Amir.146.Bahori Harahap Bin Ajib.147. Paruhum Harahap Bin Dompak.148.Siti Hawa Binti Bariun.149.Arbanun Binti Mamad.150. Leha Binti H.Muhammad Saleh .151. Wardah Binti Muhammad Zein,H. 152.Sutar Bin Dullah Kosim. 153.M.Hafiz Yazid,Ba Bin Hm. Yazid .154. Abdul Wafi Hawari Bin Hafiz Yazid.155. Dahler, Ir Bin Sutan Suleman Lubis .156. Lely Sulastri Binti Legiman.157. Drs Imran Nasution Bin Abd Moncot Nasution.158. Mifhahnur Nasution Ba Binti H Mhd Sal.159. Agus Salim Nasution Bin Abd Moncot Nasuiton.160. Farida Hawani Lubis Binti H.Mhd Ridwan. 161. Ernawaty Binti M. Basri.162.Suryani Binti H.Ngadiran .163. Saponah Binti Wong Sukario.164. Tumeri Bin Legiso. 165. Mhd. Azrai Prayogi P. Bin Sarbaini Pa.166.Nuraini Binti Jusan.167.Syarwani.Sh Bin H.Ismail Ben.168. Dwi Kumala Sari Binti Supriyanto. 169. Rahayu Ningsih Binti Djojo Astro. 170.Refiati Binti Mukamat. 171.Tasmi Binti Taslam. 172.Suparni Binti Selamat. 173.Leginem Binti Mariun.174.Kartini Binti Mariun.175.Aisyah Binti

Kamaruddin.176. Alianis Retong Bin Kumbut .177. Khairil Ansari,Dr,Mpd,Prof. Bin H. Umar.178. Bakri Tanjung Bin Tk.Suan.179.Asrul Bin H.Mhd. Nuzid Tanjung. 180.Hasmaladewi Binti H. Hasan Basri. 181.Iriani Rangkuti Binti H Mahmud Rangkuti.182. Ridwan Nasution Bin H Azrai Nasution.183.Mahmud Nasution Bin Arsad Nasution.184.Sarmini Binti Ngalirin.185.Anizar S Pelawi Binti Aminullah Pelaw. 186.Sutarno,M Bin Sakino.187. Faisal Putra. Sh. Bin Abdul Wahab. 188.Hirawati Binti Wagiman.189.Nani Sundari Spd Binti Tukirin.190. Ir.Sukardi Msi Bin Amat Rebin.191. Tukirin Bin Tirto Karyo.192.Wainem Binti Kasmo Rejo.193.Nuraini Binti Sutrisno .194.Shanty Dewi Binti Muhammad Husni.195. Bina Waty Br. Bangun Binti R. Bangun. 196. Lina Br. Bintang Binti Ali Bintang.197. Budin Bancin Bin Jamudi Bancin. 198.Jalaluddin Abdulhalim, Sag Bin Abdulah.199. Chairuddin Harahap Bin H. Pontas Harah.200. Endang Dwi Yustianti,Se Binti Bambang. 201. Irwan Sulaiman Lubis Bin Baginda Sulaiman.202. Elfida Rahman Lubis Binti Abdul Rahman.203.Sujono Bin Marjikun.204.Zairinawati Lubis Binti Sayutin Lubis.205.Darlina Syani Binti Abdulah Syani.206.Yusniar Binti Abdullah. 207.Asnidar Binti Ayub.208. Ruslan Effendi Harahap Bin Jamin Harahap. 209 Siti Chadijah Siregar Binti Muhammad. 210 .Drs. Zulkarnain Bin Muchni.211.Kapanah Bin Wakid.212. Masnah Binti Maknur. 213.Adek Zulfansyah Noor Bin Minoh H.214. Adek Sopiansyah Noor Bin Minoh H.215.Nuraisyah Nasution Binti H.Nurdin Mah.216.Sri Helmi Pangesty Binti R. Sri Isman.217. Kartini Binti Dono Kromo.218. Anisyah Br. Damanik Binti Djaiman. 219.Wardiah Binti MahmudNasution.220.ZullinialPanggabean Binti Ismail Panggabean. 221.Siti Romlah Kurnia Ningsih Binti Atan.222.Agus Wijayanto Bin Sutarno.223. Eddy Saryanto,Se Bin Wiryorjo .224.Maryam Binti Muhammad Harun .225. Asnidar Binti Muhammad Abu Karim. 226.Baihaqiah Binti Mhd.Ali. 227.Kartini Binti Suaib.228.Sunarki Bin Poniman.229. Puspa Iriani Binti Sarbini.230. Tengku Hamzah Bin Tengku Amar.231. Suti

Rahmawani Binti Farid Wajdi .232. Abdul Wahid.Se.Msi Bin Irwan Aritonan.233. Siti Aminah Pane Binti Ms Pane.234.Yubhar Rusli Bin Muhammad Rusli. 235.Yohani Lubis Binti Abdul Mutholib Lubis. 236. Hamidah Nasution Binti Qolu Nasution.237.Irwan Nuh Abdul Muthalin Bin Abdul Muthalin. 238.Maini, Dra Binti Kliwon.239. Drs.Jarman Bin Jakimin.240. Nurhayati Binti Ali Nafiah. 241. Netty Herawaty Binti R.S Pranowo.242. Berliana Elisabeth Binti Joyowijoyo.243. Jakfar Bahara.Sh Bin Abdullah Hamid.244. Agus Salim Nasution,Se Bin Amir Husin.245. Rahmadhanie,Amd Binti Razali.246.Titin Swartini Pane Binti H.Abdullah.247. Surnanty Binti Suriono.248. ChiciWinda Astuti Binti H.Amran.249. Wirnayati Nasution Binti Mesir Nasution. 250. Daniar Lubis Binti H.Ali Daud Lubis.251.Siswati Binti H Atmo Suharjo 252. Abdul Mukit Drs Bin Ahmadriduan.253. Nurdin Bin Kurung.254.Idris,Drs Bin Nurdin 255.Anuar Bin H. Abusamah.256.Yuslinawati Binti H.Sainan.257.Leli Afriani Pane Binti Damlen Pane.258. Subur Bin Saiman.259.Suriyani Binti Sainan.260.Sri Purnamawati.Sh Binti Sainan. 261. Erniwaty Harahap Binti Janamora Harahap.262. Maria Binti Julim, 263.Rohana Binti Zakaria.264.Yusmarida Binti Indrabuana .265.Hari Ismail Bin Tugono, 266.Suwito Bin Samin Subroto.267. Nurcahaya Binti Atek Ulung.268.Nur Imbun Binti Atek Ulung.269.Nur Isnaini Binti M Aiman.270. Nani Binti Poniran .271. Hersutami Binti Gondo Wimono.272. Mukardi, Be Bin Sarimoharjo Suparno. 273. Salmasita Binti Kamaliun. 274.Koriyanto Bin H.Majailani. 275.Chairuna Mudya Binti M.SidikYatim.276.Rachmad Sukarja Bin H.Abd.Djalil .277. M.Supriadi Bin Abdul Basyar.278. Imran Habibi Bin Indra Wisnu Siregar.279. Mardiana Batu Bara Binti Abd Rahman.280. Irma Siregar Binti IndraWisnu Siregar. 281.Irhamnah Binti Indra Wisnu Siregar.282. Ikromah Binti Indra Wisnu Siregar.283. Indra Wisnu Siregar Bin M.Undang Siregar.284. Mursal Effendy Parapat Bin Rosul Parapat. 285. Ernita Binti Sadimin.286. Nurhayati Binti Ismail.287. Amiruddin, Drs Bin Kanuddin Batu-

bara. 288. Gembira Karokaro Bin Mulia Karokaro. 289.Linawatni Binti H. Kudin Lubis.290. Musdalifah Binti H.Kudin Lubis. 291. Darwan Rangkuti Bin Muhammad Daim.292. Siti Ramadan Nasution Binti Sutan Kum. 293.Maslaini Lubis Binti H Maksum Lubis.294. Marida Nur Lubis Binti H. Maksum Lubis. 295.Zuraidah,Spd Binti Muchtar Lubis.296.Enny Holilah Nasution Binti Amrul Nasution. 297.Mariana Lubis,Spd Binti Abdul Muluk Lubis.298. Rusmaini Binti Rusli Adam, 299. Syahwir M. Lubis Bin Sulaiman Lubis. 300. Nuralin Ritonga Binti Nagari Ritonga. 301.Syahman Harahap Bin Raja Uhum Harahap.302 Farida Siregar Binti Fakih Zainuddin. 303.Basirus Syawal Nasution, Drs Bin Ali.304. Surbani, Dra Binti Ibrahim Aji.305.Djarum Sunesti Binti Asmaradji. 306. Nurdiah Nasution Binti H.Ali Usman Nasution.307.Sabariah Binti Muhammad Siddik.308. Erlin Parinduri Binti Zainuddin Parin.309.Evy Rita Royani Harahap Binti Harun.310. Alamsyah Siregar, Ir Bin Firman Siregar. 311. Nurhayati Binti H Ngatmin. 312.Dagor Matondang Binti Marzuki Matonda.313. Farida Hamzah, Dra Binti Hamzah Jamil, 314.Zulnedi Agus, Drs Bin Agus Syamsuddin.315. Duma Sari Hasibuan Binti H. Sutan Hasibuan.316.Muhammad Nur Hasibuan Bin H. Fully Hasibuan.Wagini Binti Loso, 318. Kamsariah Binti Karto Pawiro. 319. Dahlia Dra Binti Husen, 320. Aswini Binti Ismail Lubis. 321 Kh.Mahyuddin Nasution Bin H.Jamangiot, 322.Alimuddin Saragih,Bba Bin H.Anwar Saragih.323.Asnita Nasution, Dra Binti Achmaddin Nasuiton. 324. Sukinah Nur Binti Midi 325. Sanurdin Lubis,Sh Bin Sanusi Lubis, 326. Nurlina Batu Bara Binti H Nakman Batu, 327. Nurul Huda Nasution,Sag Binti Sarbain, 328.Titik Puspa Siregar, Ba Binti H.Abd K, 329. Suzanna Binti Zainuddin, 330. Rukimah Binti Abdul Somad 331. Rosmila,Ir Binti H.Bahrum Batubara, 332. Leny Marlina,Ssi Binti H.Bahrum Batub, 333. Ferry Amd Bin Agus Salim H 334.Abdi Rizal Bin Drs. Sarpin 335. Gabenawati Binti H. Marhan Siahaan 336.Tatin Rosdiana,Sh Binti Susilo Hadi 337. Syaiful Nasution Bin Muhammad

Nawi Na 338.Bgd.Hasian Pohan Bin Jatarup 339. Op.Riski Rambe Binti Vasorip 340. Roslian Dalimunthe Binti Gaib Dalimun 341. Sawani Pulungan Binti Baharuddin Pulu 342.Setia Welas BintiWagimin 343.Baiyah Binti Uddin Matondang 344. Hasnah Binti H.Muslim Siregar 345. Nurhayati Binti Chatib 346 Zainuddin Bin Bauddin 347 Nur Haidah Binti Sulaiman 348.Fatimah Daulay Binti Aminuddin 349. Burhana Binti Muhammad Djamil 350.Siti Pangasonna Hsb Binti Tongku Bila 351. Zubaidah Rangkuti Binti Mhd. Isa Rang 352. Haris Fadillah, Drs Bin H.Ismail 353.Mhd Yusuf Abdul Kadir Bin Abdul Kadir 354. Halimah Binti S Alauddin 355. Hindun Binti Abdul Latif 356. Latifah Hanum Binti H.Ahmad Liat 357. Abdul Rahman Bin R Wahyu Supangkat 358.T Matsyah Bin T Husin, Haji 359.Darwisah Binti H.Dario 360.Baniyem Binti Sutoderono. 361. Salmah Binti S Alauddin 362. Nurdiana Binti Abdul Gani 363.Hj Nurbaiti Binti Muhammad Idris 364. Fani Binti Setu 365. Muhammad Rizal Bin H Muchtar K 366. Siti Khadijah Binti Asmuni 367. H. Muslim Putra, Ba Bin Ulung Putra 368. Amer Juno Bin Djuno 369. Mariyam Binti Ulung Putra 370. Teti Arwini Binti Salio 371.Rostina Harahap Binti Baginda Marisi 372. Tinah Binti Suwarno 373. Ermi Afrayani Harahap Binti Hasbullah 374.Dra.Rosnaini Lubis Binti Sulaiman Lub 375. Drs.H.Mohd.Syuaib Saragih Bin Musa Ul 376. Masri Bin Abu Bakar 377. Nurbaini Binti Nurdin 378. Asnani Binti T. Sekah 379. M. Nur Abduh Bin Umar 380.Darwis Bin Hasan Basri. 381. Nurjani Binti Nak Ali 382. Nurjani Binti M.Nur 383. Zuraidah Tarigan Binti Jemali Tarigan 384. Yuni Warni Binti Mukti Nasution 385.Nurjana Hasibuan Binti H Ahmad Syukur 386. Aswin,Se Bin Amin Bey 387. Masriani Binti M.Salim 388.Ari Wahyuni Ir Binti H Raden Margono 389. R Siswanto Ir Bin H.R.Sutejo Prawoto 390.Sabariah Binti Sanusi 391. Nurma Binti Abdul Halim 392. Drs.H.Ibnu Saud Nasution Bin H.Rahmat 393.Hj.Lisna Sari Binti Gazali 394.Didi.Julfikar Bin Samsul Bahri 395. Dien Barkah Dalimunthe Bin Amir Azib 396. Riduan,Se Bin Harun Samad

397. Ruslila Binti Muhammad Said Nasution 398. Gopar Ismail Bin Mhd. Sanusi 399.Syahriruddin Bin Zainal Abidin 400. Syafrida Lubis Binti Syariful Bahar. 401. Susilawaty Siregar Binti Ahmad Ramadhan 402.Irmawati Binti Nazaruddin Lubis 403. Suardi. Ir Bin Mari 404. Delvida Husnita, Ir Binti Drs. H. M. 405 .Rinaldi Rais, Ir Bin H. Rais 406. Abidin Azhar Lubis, Drs Bin Awaluddin 407.Drs.Adi Kesuma Bin H.Muhammad Ali Usm 408. Iskandar,Sh Bin Zainuddin Muhammad 409.Yulisa Mandala,Dra Binti Anjasmanan 410. Didi Badiah Binti Keteng 411. Baru Adil Bin Raja Amansyah 412. Agustina Binti Musa Mhd 413. Roswita Yetty Binti Martion 414. Hafni Hanum Harahap Binti Hasanuddin 415. Amran Ritonga Bin Mhd.Nasir Ritonga 416. Mohammad Lizardy,Sp.S.Sit Bin H.Ahmad 417 . Lisda Sari Harahap, Dr Binti Hamdan 418. Armida Nst Binti Abdul Latif Nasution 419. Muhammad Husni Bin H.Abdul Aziz As’ar 420 . Suparlan Bin Wagio Darmo Bin Romotaru. 421. Meskiah Binti H Mhd Kasni Bin Krawang B, 422. Nuriyah Binti Wagimin 423. Eni Wasistati Binti Tugimin Wasisto 424. Maryati Binti M.Saleh 425. R.Hariyanto Bin H.Hasan Karim 426. Keliwon Bin Sumo Ramin 427. Edy Rusli Bin Karimin 428. Tamariah Munthe, Hj Binti Djemat Munt 429. Mariani Harahap Binti Mara Saman Hara 430. Sutrisno Bin Tio 431. Kasiem Binti Bibit 432.Syamsir Bin Aminuddin 433. Hadisyah Binti Putra Uteh 434. Mawarni Binti Cut Syahdan 435. Aisyah Lubis Binti Jaris Lubis 436. Saminem Binti Kamari 437. Tuty Melawati Binti Hamonangan Haraha 438. Maria Sofia Binti Ramli Wim Poluan 439. Suryadi Bin Ahmad Sardi440.MisyatiBintiNgatiman. 441. Muhammad Asri Ir Bin Baharuddin Yacub 442. Khamsuhaini Binti Bukhari 443. Bakhri Efendi, Drs Bin Bachrum Arif N 444. Afrida Lubis, Dra Binti Amir Husin Lu 445. Rohana Harahap Binti Nurdin Harahap, 446. Bachrum Arif Nasution Bin M.Syarif Na 447. Jarot Suharto Bin Sudaryanto 448. Warni Sari Binti Sukarni 449. Nurlely Harahap, Sp Binti Syaifullah 450. Evi Armila Nasution, Ir Binti Achmad 451. Sunariati Binti Sudarjo. (m36/m14/m32)

Waspada, Rabu 28 Oktober 2009  

Waspada, Rabu 28 Oktober 2009

Waspada, Rabu 28 Oktober 2009  

Waspada, Rabu 28 Oktober 2009
