Issuu on Google+

Daftar Tunggu Sudah Tembus Tahun 2019

WASPADA Demi Kebenaran Dan Keadilan

Harga Eceran Rp2.500,-

Kontras Catat 145 Kasus Pelanggaran HAM Di Sumut

MEDAN (Waspada) : Antusias masyarakat Kota Medan MEDAN (Waspada): Komisi untuk Orang Hilang dan untuk melaksanakan ibadah haji terus mengalami peKorban Tindak Kekerasan (Kontras) mencatat, sampai ningkatan. Setiap hari, sedikitnya ada 50 orang yang meladengan akhir 2011 terjadi 145 kasus pelanggaran Hak Asasi kukan pendaftaran. “Waiting list (daftar tunggu) sudah Manusia dan kekerasan yang melibatkan aparat penegak memasuki tahun 2019 dengan jumlah jamaah mencapai hukum di Sumatera Utara. 18.932 orang. Demikian PLH Kepala Kantor Kementerian Dari jumlah itu, 107 kasus pelanggaran dilakukan oleh Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 1995), Hj. Ani Idrus (1918 1999) Agama Kota Medan, Drs Ahyu melalui Kasi Haji Drs H Ahmad oknum-oknum polisi berdasarkan hasil pemantauan dan Qosbi, Selasa (27/12) di sela kegiatan Sosialisasi Undanglaporan masyarakat, ujar Koordinator Kontras Sumut, RABU, Kliwon, 28 Desember 2011/2 Safar 1433 H No: 23727 Tahun Ke-65 Terbit 24 Halaman Muhrizal Syahputra, di Undang No 13 Tahun 2008 Medan, Selasa (27/12). Tentang PenyelenggaHal ini menunjukkan, raan Ibadah Haji di Aula lanjutnya, ketidakprofeKantor Kementerian Agasionalan anggota Polri di ma Kota Medan. Hadir dalam menghormati hak dalam kegiatan itu, Kepala Kantor Kementerian asasi manusia (HAM). “Ya Agama Wilayah Provinsi kita melihat bahwa instiSumatera Utara, Drs Abd tusi Polri yang masih noRahim M.Hum, Kabid mor satu pelanggar HAM,” Haji dan Umroh, Drs Abd ujarnya didampingi SekRahman Harahap MA, retaris Eksekutif Bakumpara Ka. KUA, perwakilan su, Banget Silitonga di Bank Penerima Setoran sela-sela refleksi akhir Haji (BPSH), pengelola tahun pelanggaran HAM. Kelompok Bimbingan Adapun jenis tindaIbadah Haji (KBIH) serta kan kekerasan yang dilaundangan lainnya. kukan oknum Polri, lanLebih lanjut Ahmad jutnya, seperti penganiaQosbi menyebutkan, yaan 31 kasus, pembiaran tingginya angka waiting 20 kasus, pembunuhan/ list ini diharapkan setiap diluar prosedur hukum 9 tahun ada solusi yang dikasus, penangkapan seberikan oleh pemerinwenang-wenang 8 kasus, tah agar percepatan kepenyalahgunaan senjata berangkatan bisa dilakapi/penembakan 7 kasus, sanakan seperti musim perjudian 7 kasus, narkohaji 2011 ini. tika 6 kasus, penyiksaan “Kalau tahun 2012 6 kasus, teror dan intimimendatang ada penamdasi 5 kasus, pencurian/ bahan diharapkan bisa penipuan/penggelapan 4 mengurangi angka waitkasus, pelecehan seksual ing list meskipun jumlahdan perkosaan 3 kasus, dan nya terbatas, apalagi UU perampokan 1 kasus. menyebutkan, setiap “107 Pelanggaran itu warga negara yang berahanya untuk periode Jagama Islam berhak untuk nuari hingga November. menunaikan ibadah haji Belum Desember belum bagi mereka yang berusia terdata karena masih 18 tahun atau sudah meberjalan,” terang Benget nikah dan mampu memsembari mengaku 55 perbayar Biaya Penyelengsen dari 107 merupakan Waspada/Surya Efendi g a r a a n I b a d a h Ha j i pelanggaran HAM hak CUACA BURUK:Satu pesawat komersil lepas landas dari Bandara Polonia Medan di tengah cuaca buruk beberapa saat menjelang turun hujan, Selasa (27/12). Demikian juga di Tapanuli (BPIH),“ kata Qosbi. Utara. Pesawat carter Menteri Koordinator Perekonomian Hatta Rajasa gagal mendarat di Bandara Silangit karena cuaca buruk. Pesawat terbang dari Jakarta itu akhirnya mendarat di Lanjut ke hal A2 kol. 1 Lanjut ke hal A2 kol. 3 Palembang. Seyogianya Hatta Rajasa membuka Pesta Danau Toba.

CUACA SUMUT BURUK Pesawat Hatta Gagal Mendarat Di Silangit

MEDAN (Waspada): Kondisi cuaca di beberapa kawasan Sumatera Utara terlihat buruk kemarin dan curah hujan dikabarkan akan meningkat dalam beberapa hari ke depan.

Kondisi cuaca di Laut China Selatan (LCS) semakin bergolak, menyebabkan gangguan cuaca akan terjadi di kawasan Medan khususnya dan

Sumatera Utara umumnya. Imbas di LCS terasa kemarin, menyebabkan sungai Tenang di Langkat meluap dan membanjiri desa di sekitarnya (beri-

Masyarakat Diminta Waspadai Banjir

tanya dimuat di halaman ini). Sedangkan di Silangit, Kabupaten Tapanuli Utara, pesawat yang ditumpangi oleh Menteri Koordinator Perekonomian

Hatta Rajasa tidak bisa mendarat di Bandara sehingga dia gagal membuka Pesta Danau Toba. Kepala Bandara Silangit,

Poltak Siburian, Selasa (27/12), mengatakan bahwa pesawat yang ditumpangi Hatta Rajasa itu awalnya akan mendarat sekira pukul 11:00. Namun,

sekira lima menit sebelum mendarat, cuaca di Bandara Silangit tidak kondusif.

Lanjut ke hal A2 kol. 3

Wanita Dibunuh Di Kamar Hotel MEDAN (Waspada): Seorang wanita tanpa identitas, ditaksir berusia 35 tahun, ditemukan tewas dalam kondisi mengenaskan di sebuah kamar hotel di Jl. Jamin Gintings km 11,5, Selasa (27/12) sekira pukul 15:00. Peristiwa tersebut terungkap setelah korban ditemukan di kamar No.17 oleh seorang pelayan kamar hotel bernama Bambang, 23, yang curiga melihat pintu kamar terbuka. Saat ditemukan, korban tergeletak di lantai kamar hotel, dalam keadaan bersimbah darah tanpa mengenakan busana. Menurut keterangan, korban bersama seorang pria berusia sekitar 30 tahun datang ke hotel tersebut sekitar pukul 14:00 dengan mengendarai sepeda motor. Saat datang, korban bersama teman prianya mengenakan helm. Lanjut ke hal A2 kol. 3 Waspada/Ibnu Kasir

WARGA mengungsi dengan mengarungi banjir akibat meluapnya Sei Tenang, Kec. Batangserangan, Langkat.

Sungai Tenang Meluap 500 KK Mengungsi LANGKAT (Waspada): Sungai Tenang yang merupakan salah satu anak Sungai Batangserangan, Langkat, Selasa (27/12) pagi meluap mengakibatkan ratusan rumah warga Pujidadi Desa Sei Bamban, Karyajadi dan Lingkungan Benteng Titi Besi Kelurahan Batangserangan, digenangi air bah setinggi 30 – 70 centimeter. Meluapnya Sungai Tenang ke pemukiman warga terjadi setiap tahun, benteng yang ada sudah kropos sehingga kawasan desa kerap jadi langganan banjir bila musim penghujan. Warga yang rumahnya

kebanjiran sudah mengungsi dengan membuat tenda di tempat yang agak tinggi dan terhindar dari banjir. Sebagian lagi mengungsi di teras masjid setempat. Biasanya, kata mereka, air sungai naik dan sorenya menyusut. Tapi kalau curah hujan lebat, mereka menjadi cemas. Syaifullah, Camat Batangserangan ketika dihubungi melalui handphone selularnya, mengemukakan lebih dari 500 KK warga mengungsi sejak pagi. Pemkab Langkat melalui Kantor Sosial difasili-

Al Bayan

tasi camat telah membuat posko dan dapur umum, sekaligus menempatkan 30 personil Taruna Siaga Bencana (Tagana) untuk membantu masyarakat. Selain itu posko kecamatan telah mengupayakan nasi dari para dermawan, namun pada malam hari diperkirakan dapur umum telah beroperasi sesuai mekanisme tanggap darurat, khususnya pemenuhan bagi kebutuhan sembako warga di pengungsian. “Ini bila hal terburuk terjadi,” kata Kabag Humas Pemkab Langkat, H. Syahrizal.(a01/a03)

Korban Mutilasi Tinggal Tulang Di Dalam Koper LHOKSEUMAWE (Waspada): Warga menemukan sebuah koper berisikan tulang belulang manusia di kawasan pantai Racong, Kecamatan Muara Satu, Lhokseumawe, Selasa (27/12). Warga memperkirakan tulang belulang itu hasil pembunuhan dengan cara dimutilasi karena tengkorak kepalanya terpisah dan terbungkus plastik. Marzuki, 43, warga Muara Satu kepada Waspada menjelaskan, koper ditemukan Abdalsyah,70, ketika sedang mencari kayu di kawasan pantai itu. “Sekira pukul 11:30 tadi, Abdalsyah sedang mencari kayu, dia melihat koper di pantai,” jelas Marzuki. Kemudian warga Batupat Timur membuka koper dengan menggunakan parang yang biasa digunakan untuk memotong kayu. Namun ketika koper kulit berwarna hitam terbuka, dia terkejut. Ternyata isi koper itu tulang belulang manusia. Selanjutnya, Abdalsyah melaporkan temuan itu kepada pihak berwajib. Sementara itu, Kapolsek Muara Satu, Iptu Ichsan mengakui temuan di dalam koper itu. Menurutnya, kemungkinan koper berasal dari daerah lain yang hanyut dibawa arus laut. “Kita akan pastikan dulu, apakah itu hasil mutilasi atau bukan,” jelasnya. (b15)


PESTA DANAU TOBA: Sejumlah penari membawakan tarian tor-tor pada pembukaan Pesta Danau Toba 2011 di Parapat, Kab. Simalungun, Selasa (27/12).

Hatta Rajasa Tidak Hadir, PDT 2011 Dibuka Plt Gubsu PARAPAT ( Waspada): Pembukaan Pesta Danau Toba (PDT) tahun 2011 terkesan kurang meriah, ditambah lagi dengan gagalnya Menko Perekonomian RI, M. Hatta Rajasa membuka pesta tahunan itu, Selasa (27/12), karena pesawatnya dihalau cuaca buruk di Bandara Silangit. Pantauan Waspada, pelaksanaan PDT 2011 yang dijadwalkan berlangsung hingga 30 Desember ini, jauh berbeda dengan pelaksanaan sebelumnya. Kegiatan dan hiburan yang ditampilkan tidak mampu mengundang pengunjung


Amal Saleh

dari berbagai daerah. Hal ini diakui oleh seorang pemerhati budaya, warga Pematangsiantar. “Saya melihat PDT hanya kegiatan biasa (lokal), yang tak mampu mengundang pengunjung dari berbagai daerah. Berbeda pada pelaksanaan PDT-PDT sebelumnya, jumlah pengunjung sejak pembukaan hingga hari penutupan selalu ramai, baik oleh masyarakat yang datang dari sekitar Parapat maupun dari luar daerah,” cetus Januarison Saragih, akademisi dan pemerhati budaya daerah warga Pematangsiantar, usai

menyaksikan pembukaan PDT. Dikatakan, kesuksesan pelaksanaan PDT-PDT sebelumnya tak terlepas dari keberhasilan panitia mengundang peserta dari berbagai daerah tingkat II di Sumut, bahkan dari luar provinsi seperti dari Aceh, Riau, Padang dan Jakarta. “Ini cenderung bernuansa politis, sehingga mengurangi antusias masyarakat untuk mensukseskan pelaksanaannya.” Acara pembukaan PDT kali ini terlihat ‘hubar habir’.

Lanjut ke hal A2 kol. 5

Ada-ada Saja Siti Maimunah Resmi Jadi Pria

Oleh Tgk. H. Ameer Hamzah SEORANG muslim yang baik senantiasa berusaha untuk mengerjakan amal yang baik (saleh) dan senantiasa pula memelihara dirinya dari perbuatan keji dan mungkar. Setiap amal salehnya selalu diniatkan sebagai bagian dari ibadahnya kepada Allah SWT. Orang-orang saleh beribadah karena Allah, bukan karena ilah. Lanjut ke hal A2 kol. 3

Foto kiri: 8 Agustus, seorang wanita terjebak dalam sebuah gedung yang terbakar setelah kerusuhan hebat melanda London, Inggris. Foto kanan: 11 September, seorang warga Amerika Serikat mengekspresikan cara unik saat mengenang tragedi serangan gedung kembar WTC yang terjadi sepuluh tahun lalu, tepatnya 11 September 2001.

SENYUM tak pernah lepas dari bibir Siti Maimunah. Dia resmi menjadi laki-laki dengan nama baru Muhamad Prawirodirjoyo. Pengadilan Negeri Semarang mengabulkan permohonan Siti untuk merubah status kelaminnya dari perempuan menjadi laki-laki.“Mempertimbangkan keterangan para saksi dari keluarga dan saksi ahli dari tim medis kami mengabulkan permohonan ganti status Siti Maimunah sebagai laki-laki. Dan sejak hari ini, Siti Maimunah berhak

Lanjut ke hal A2 kol. 2


SITI Maimunah memutuskan jadi lelaki dengan nama Muhammad Prawirodijoyo.

Serampang - Cuaca mendung bikin lapar dan menguap - He...he...he...

Terlibat Narkoba, 284 WNI Divonis Mati Di Malaysia

JAKARTA (Waspada): Dari catatan Badan Narkotika Nasional (BNN) hingga penghujung 2011 ini, sebanyak 501 orang warga negara Indonesia menjadi tahanan di luar negeri karena terlibat dalam jaringan sindikat narkoba internasional. Dari total itu, ada 284 orang yang sudah divonis hukuman mati. Sebanyak Lanjut ke hal A2 kol 1

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) RABU, Kliwon, 28 Desember 2011/2 Sapar 1433 H z zNo: 23727 Tahun Ke-65

Terbit 24 Halaman

Golkar Tak Bisa Katakan Hasil AF Century Salah Atau Benar

JAKARTA (Antara): Ketua Umum DPP Partai Golkar, Aburizal Bakrie, mengatakan bahwa partainya tak bisa menyatakan hasil audit forensik Badan Pemeriksa Keuangan (BPK) yang diserahkan pada tanggal 23 Desember 2011 adalah benar atau salah. “Hasil audit forensik BPK tentang Lanjut ke hal A2 kol 6

Menko Perekonomian Gagal Buka PDT

Pesawatnya Tak Bisa Mendarat Di Silangit

PDT 2011 Hilang Semangat

MEDAN (Antara): Menteri Koordinator Perekonomian Hatta Rajasa gagal membuka Pesta Danau Toba karena pesawat yang ditumpanginya tidak bisa mendarat di Bandara Silangit, Kabupaten Tapanuli Utara, Sumatera Utara (Sumut). Kepala Bandara Silangit, Poltak Siburian, Selasa (27/12), mengatakan bahwa pesawat yang ditumpangi Hatta Rajasa itu awalnya akan mendarat sekira pukul 11.00 WIB. Namun, ia mengemukakan, sekira lima menit sebelum mendarat, ternyata cuaca di Bandara Silangit tidak kondusif untuk pendaratan pesawat jenis jet pribadi yang ditumpangi Hatta Rajasa, yang juga Ketua Umum Partai Amanat Nasional (PAN) itu. Selain angin yang cukup kencang, menurut dia, awan di sekitar Bandara Silangit juga

PARAPAT (Waspada): Pagelaran Pesta Danau Toba (PDT) tahun 2011 tampaknya seperti kehilangan semangat, setelah Menko Perekonomian RI, M. Hatta Rajasa yang seyogianya membuka pesta tahunan itu, Selasa (27/12), gagal hadir sehingga pembukaan dilakukan Plt. Gubsu, H. Gatot Pujo Nugroho. Pantauan Waspada, pelaksanaan PDT 2011 yang dijadwalkan berlangsung hingga 30 Desember ini, jauh berbeda dengan pelaksanaan sebelumnya. Terlihat antusias warga karena kegiatan dan hiburan yang ditampilkan mampu mengundang pengunjung dari berbagai daerah. Sedangkan acara pembu-

terlalu rendah sehingga menutupi pandangan menuju landasan pacu (runway). “Jadi, gagal mendarat karena cuaca buruk,” katanya. Awalnya, kata dia, pihaknya menyarankan pilot pesawat tersebut untuk memutar guna mencari posisi yang tepat untuk mendarat. Namun, ia menimpali, dengan pertimbangan khawatir kehabisan bahan bakar, maka pesawat batal mendarat di Silangit. Pada saat itu, sejumlah Lanjut ke hal A2 kol 2

Polisi Mayoritas Pelaku Pelanggaran HAM Di Sumut MEDAN (Waspada): Komisi untuk Orang Hilang dan Korban Tindak Kekerasan (Kontras) mencatat sampai dengan akhir 2011 tercatat terjadi 145 kasus pelanggaran Hak Asasi Manusia dan kekerasan yang melibatkan aparat penegak hukum di Sumatera Utara. “Dimana, 107 kasus pelanggaran dilakukan oleh instansi kepolisian. Dan ini merupakan hasil pemantauan dan laporan masyarakat sehingga kita menyimpulkan aktor dominan pelaku pelanggaran HAM adalah institusi kepolisian,” ujar Koordinator Kontras Sumut, Muhrizal Syahputra, di Medan, Selasa (27/12). Hal ini menunjukkan, lanjutnya, ketidakprofesionalan anggota Polri didalam menghormati hak asasi manusia. “Ya kita melihat bahwa institusi Polri yang masih nomor satu pelanggar HAM,” ujarnya didampingi Sekretaris Lanjut ke hal A2 kol 6

kaan PDT kali ini, ‘hubar habir. Selain diwarnai turunnya hujan, panitia juga dinilai tidak profesional dimana pelaksanaannya terkesan sangat dipaksakan. Seperti terlihat pada saat penyambutan kedatangan Plt. Gubsu, Gatot Pujo Nugroho bersama Dirjen Nilai Budaya, Seni dan Film Kementerian Pariwisata, Ukus Kuswara, unsur Muspida Sumut, Bupati Simalungun JR Saragih, dimana pihak panitia terpaksa ‘puntang-panting’ mengangkat perlak merah dan para penari pun lari lintang pukang karena arah kedatangan tamu terhormat berbeda dengan Lanjut ke hal A2 kol 1

Waspada/Surya Efendi

CUACA BURUK: Satu pesawat komersil lepas landas dari Bandara Polonia Medan di tengah cuaca buruk, Selasa (27/12). Pesawat jet pribadi yang ditumpangi Menteri Koordinator Perekonomian Hatta Rajasa gagal mendarat di Bandara Silangit karena cuaca buruk di sebagian daerah di Sumatera Utara. Pesawat tersebut terbang dari Jakarta terpaksa balik dan mendarat di Palembang. Seyogianya Hatta Rajasa membuka Pesta Danau Toba.

Banjir Bandang Landa Sabang Puluhan Rumah Hancur Dan Tergenang Air SABANG (Waspada): Banjir bandang secara tiba-tiba melanda Kawasan Sabang dan sekitarnya, banyak pohon kayu besar tumbang, ratusan rumah tergenang air bah, puluhan rumah rusak parah.

Dilaporkan, hujan yang mengguyur kawasan sabang sejak pukul 22:00, Senin (26/ 12) hingga pukul 00: 30, Selasa (27/12) mengakibatkan di beberapa titik terjadi kerusakan infrastruktur yang amat parah

dan beberapa pohon kayu tumbang. Pohon kayu yang tumbang di sekitar Gampong Kuta Timur sempat mengenai beberapa rumah, sehari sebelumnya satu batang kayu ber-

umur ratusan tahun di Gampong Ie Meulee, Kecamatan Sukajaya Sabang juga tumbang yang mengakibatkan macetnya lalu lintas jalan raya. Lanjut ke hal A2 kol 2

Waspada/Hasuna Damanik

PLT GUBSU H. Gatot Pujo Nugroho didampingi Ny. Sutias Handayani Pujo Nugroho turun dari tangga menuju open stage sebelum dimulainya pembukaan PDT 2011.

Waitinglist Calon Haji Medan Hingga 2019 Capai 18.932 Orang

Presiden Perintahkan Kapolri Usut Insiden Bima

MEDAN (Waspada): Antusias masyarakat Kota Medan untuk melaksanakan ibadah haji terus mengalami peningkatan. Setiap hari, sedikitnya ada 50 orang yang melakukan pendaftaran. “Waitinglist sudah masuk di tahun 2019 dengan jumlah jamaah mencapai 18.932 orang. Demikian PLH Kepala Kantor Kementerian Agama Kota Medan, Drs Ahyu melalui Kasi Haji Drs H Ahmad Qosbi, Selasa (27/12) disela kegiatan Sosialisasi Undang-Undang No 13 Tahun

JAKARTA (Antara): Presiden Susilo Bambang Yudhoyono memerintahkan Kapolri Jenderal Pol Timur Pradopo untuk mengusut insiden kekerasan di sekitar Pelabuhan Sape, Bima, Nusa Tenggara Barat, oleh aparat kepolisian. Di Kantor Kepresidenan, Jakarta, Selasa (27/12), Juru Bicara Kepresidenan Julian Adrin Pasha mengatakan Presiden Yudhoyono telah menerima laporan dari Kapolri tentang peristiwa kekerasan yang menurut Komnas Hak Asasi Ma-

2008 Tentang Penyelenggaraan Ibadah Haji di Aula Kantor Kementerian Agama Kota Medan. Hadir dalam kegiatan itu, Kepala Kantor Kementerian Agama Wilayah Provinsi Sumatera Utara, Drs Abd Rahim M.Hum, Kabid Haji dan Umroh, Drs Abd Rahman Harahap MA, para Ka.KUA, perwakilan Bank Penerima Setoran Haji (BPSH), pengelola Kelompok Bimbingan Ibadah Haji (KBIH) serta undangan lainnya. Lanjut ke hal A2 kol 6

Besok, Road To Dakwah Waspada Di Lhokseumawe LHOKSEUMAWE (Waspada): Road to Dakwah Waspada ke-2 di Aceh akan dipusatkan di Masjid Islamic Center Lhokseumawe. Kegiatan dakwan menyambut Hari Ulang Tahun ke-65 Harian Waspada bersama Pemimpin Umum dr Hj Rayati Syafrin akan disampaikan dai kondang Tgk H Jamaluddin, Kamis (29/12) pukul 13:30. Acara tidak lepas dari dukungan Pemkab Aceh Utara dan Kota Lhokseumawe, seperti bantuan materil beru-

pa tempat pelaksanaan di Masjid Islamic Center yang merupakan masjid kebanggaan masyarakat dua kabupaten kota itu. “Saya sebagai Kepala Perwakilan Waspada Lhokseumawe membawahi Aceh Tamiang, Aceh Timur, Langsa, Aceh Utara, Bireuen, Aceh Tengah, Bener Meriah, Pidie Jaya dan Pidie mengucapkan terima kasih kepada Pj Bupati Aceh Utara M Alibasyah dan


PERDAGANGAN ANAK. Petugas Kepolisian berbincang dengan sejumlah korban perdagangan anak di Mapolres Pelabuhan Tanjung Perak, Surabaya, Jatim, Selasa (27/12).

Polisi Bongkar Sindikat Perdagangan Manusia Korban Dijual 2.000 Ringgit, Tiga Tersangka Ditahan LHOKSUKON (Waspada): Aparat Polres Aceh Utara membongkar sindikat kasus perdagangan manusia (trafficking) untuk dipekerjakan di Malaysia. Tiga tersangka ditangkap, termasuk dua ibu rumah tangga. Sementara seorang lagi, yang juga perempuan dan diduga sebagai otak pelaku dinyatakan buron.

Al Bayan Oleh: H. Ameer Hamzah SEORANG muslim yang baik senantiasa berusaha untuk mengerjakan amal yang baik (saleh) dan senantiasa pula memelihara dirinya dari perbuatan keji dan mungkar. Setiap amal salehnya selalu diniatkan sebagai bagian dari ibadahnya kepada Allah SWT. Orang-orang saleh beribadah karena Allah, bukan karena ilah. Karena selalu di jalan benar, mereka mendapat petunjuk Allah dan memeliharanya dari segala yang buruk. Allah ridha kepada mereka dan mereka ridha kepada Allah SWT. Mereka selamat di dunia dan selamat pula di akhirat kelak. Tempat kembali mereka adalah surga yang abadi sebagaimana firman Allah, “Dan orang-orang yang saleh berada di dalam taman-taman surga. Mereka memperoleh apa yang mereka kehendaki di sisi Tuhan

Tersangka yang kini mendekam di sel Mapolres Aceh Utara, berinisial FT, 28, asal Kampong Baro, Kota Langsa, SY, warga Desa Labuhan Keudee, Kecamatan Sungai Raya, Aceh Timur dan MY, 55, lelaki asal Desa Paya Naden, Lanjut ke hal A2 kol 6

7 Tahun Lalu, Bumi Hampir Kiamat

Lanjut ke hal A2 kol 2

Amal Saleh


KASAT Reskrim Polres Aceh Utara menginterogasi ketiga tersangka kasus trafficking di ruang kerjanya, Selasa (27/12) siang.

SEBUAH lontaran energi sinar gamma menghantam bumi selama 0,2 detik. Tetapi jumlah energi yang dihantarkan sama dengan energi sinar matahari selama 500 ribu tahun.

PADA 27 Desember 2004, mendadak sebuah lontaran energi tak kasat mata menghantam Bumi. Ia diperkirakan berasal dari jarak yang cukup jauh, yakni dari konstelasi Sagitarius yang jaraknya mencapai sekitar 50 ribu tahun cahaya atau kurang lebih 473 ribu triliun kilometer. Ledakan dan hantaman sinar gamma ini pertamakali terdeteksi oleh satelit Swift milik NASA. Adapun bagi astronom, pengamatan terhadap kejadian tersebut memberikan contoh paling detail dari lontaran energi yang pernah terekam sepanjang sejarah. Meski lontaran energi itu hanya menyerang selama sekitar 0,2 detik, tetapi energi itu sama banyak dengan energi sinar matahari yang menyinari Bumi hingga 500 ribu tahun lamanya. Lanjut ke hal A2 kol


Warga Lhokseumawe Temukan Mayat Mutilasi Dalam Koper LHOKSEUMAWE (Waspada): Warga menemukan sebuah koper berisikan tulang di kawasan pantai Racong, Kecamatan Muara Satu, Pemko Lhokseumawe, Selasa (27/12). Warga memperkirakan mayat itu hasil pembunuhan dengan cara dimutilasi karena kepalanya terpisah dan terbungkus plastik. Marzuki,43, warga Muara Satu kepada Waspada menjelaskan, koper ditemukan Abdalsyah,70, ketika sedang mencari kayu di kawasan pantai itu. “Sekira pukul 11:30 tadi, Abdalsyah sedang mencari kayu, dia melihat koper di pantai,” jelas Marzuki. Kemudian warga Batupat Timur membuka koper dengan menggunakan parang yang biasa digunakan untuk memotong kayu.

Ada-ada Saja

Resep Kue Bikin Celaka

Lanjut ke hal A2 kol 2

Foto kiri: 8 Agustus, seorang wanita terjebak dalam sebuah gedung yang terbakar setelah kerusuhan hebat melanda London, Inggris. Foto kanan: 11 September, seorang warga Amerika Serikat mengekspresikan cara unik saat mengenang tragedi serangan gedung kembar WTC yang terjadi sepuluh tahun lalu, tepatnya 11 September 2001.

nusia (HAM) menewaskan tiga orang warga sipil tersebut. “Itu yang telah diinstruksikan oleh Presiden kepada Kapolri dan meminta segera koordinasi di Polda setempat untuk melakukan pengusutan,” ujarnya. Pengusutan tersebut, lanjut Julian, untuk mengetahui apakah aksi unjuk rasa yang berujung pada insiden kekerasan tersebut diprovokasi atau didalangi oleh pihak tertentu. Lanjut ke hal A2 kol 5

GARA-gara mencoba resep kue yang diterbitkan oleh sebuah surat kabar, 13 orang di Chile menderita luka bakar. Pengadilan Tinggi di Chile akhirnya memerintahkan surat kabar tersebut membayar ganti rugi sebesar US$125.000 atau sekira Rp1,1 miliar kepada para korban, yang telah celaka setelah mencoba resep itu. Kue Churro merupakan makanan populer di kalangan masyarakat Amerika Latin, yang dimasak dengan cara digoreng. Surat kabar ‘La Tercera’ diwajibkan membayar ganti Lanjut ke hal A2 kol 5

Namun ketika koper kulit berwarna hitam terbuka, dia terkejut. Ternyata isi mayat manusia yang sudah menjadi tulang. Selanjutnya, Abdalsyah melaporkan temuan itu ke pihak berwajib. Sementara itu, Kapolsek Muara Satu, Iptu Ichsan mengakui temuan mayat di dalam koper. Menurutnya, kemungkinan koper berasal dari daerah lain yang hanyut dibawa arus laut. “Kita akan pastikan dulu, apakah hasil multilasi atau bukan,” jelasnya. (b15)

Kasus Pembunuhan Sales Obat

Satpam Exxon Diganjar 10 Tahun

LHOKSUKON (Waspada): M Tahar, 35, satpam Exxon Mobil, terdakwa pembunuh Fakhruddin alias Fazil, 37, sales obat asal Desa Pasir Putih, Kecamatan Perlak Kota, Aceh Timur, yang terjadi di areal persawahan Desa Rangkileh, Kecamatan Meurah Mulia, Aceh Utara, 24 Mei 2011 lalu, diganjar 10 tahun penjara, di Pengadilan Negeri Lhoksukon, Aceh Utara, Selasa (27/12) pagi. Majelis hakim diketuai Zainal Hasan, SH didampingi hakim anggota Riswandi, SH Lanjut ke hal A2 kol 5

Serampang - Buat bubur merah putih supaya kembali semangat - He.... he....he....

Berita Utama

A2 PDT Hilang ....

yang telah ditetapkan. Sebelumnya, penyambutan dilakukan di gerbang open stage, tapi ternyata para tamu terhormat datang dari tangga atas, membuat para penari yang menyambut lari terbirit-birit ke arah tamu. Demikian juga tingkat keinginan masyarakat untuk menyaksikan, sangat rendah, sehingga pelaksanaan pembukaan terlihat sepi. Yang ada hanya sejumlah pejabat serta para kontingen yang akan mengikuti berbagai perlombaan PDT. “Saya melihat PDT hanya kegiatan biasa (lokal), yang tak mampu mengundang pengunjung dari berbagai daerah. Berbeda pada pelaksanaan PDT-PDT sebelumnya, jumlah pengunjung sejak pembukaan hingga hari penutupan selalu ramai, baik oleh masyarakat yang datang dari sekitar Parapat maupun dari luar daerah,” cetus Januarison Saragih, akademisi dan pemerhati budaya daerah warga Pematangsiantar, usai menyaksikan pembukaan PDT di open stage Parapat. Dikatakan, kesuksesan p e l a k s a n a a n P D T- P D T sebelumnya tak terlepas dari keberhasilan panitia mengundang peserta dari berbagai daerah tingkat II di Sumut, bahkan dari luar provinsi seperti dari Aceh, Riau, Padang dan Jakarta. “Ini cenderung bernuansa politis, sehingga mengurangi antusias masyarakat untuk mensukseskan pelaksanaannya.” Sementara, setelah Menko Perekonomian Hatta Rajasa dan Menteri Kehutanan Zulkifli Hasan gagal mendarat di Bandara Silangit, akhirnya Plt. Gubsu Gatot Pujo Nugroho, dengan resmi membuka PDT 2011.

Terlibat Narkoba....

390 orang atau 78 persen di antaranya ditahan di Malaysia. Kebanyakan dari mereka berperan sebagai kurir narkoba. “Di China 35 orang, Jepang 13 orang, Hongkong 10 orang, Arab Saudi 9 orang, dan 44 orang ditahan di 17 negara lainnya seperti di Australia, Peru, Pakistan, AS, Brazil dan Ekuador,” ujar Ketua BNN, Gories Mere di Kantor BNN Jakarta, Selasa (27/12). Hingga akhir 2011 ini, warga Indonesia yang divonis hukuman mati di luar negeri akibat kasus narkoba sebanyak 284 orang. “Dengan rincian 271 orang di Malaysia dan 13 orang di China,” ungkap Gories. Mayoritas WNI yang terlibat dari jaringan narkoba di luar negeri adalah wanita. Mereka biasanya direkrut dengan modus ditawari pekerjaan di luar negeri, dijadikan teman dekat, diajak berwisata, ataupun menikah di luar negeri. “Wanita itu dititipi koper atau tas yang berisi narkoba tanpa sepengetahuan mereka,” ungkap Gories. Gories juga menambahkan, modus lain adalah menawari para TKW yang dipecat dari pekerjaannya diluar negeri. (vn/m09)

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Bg4+, Rh8. 2. Bf1f6, d3. 3. Bf6xh6+mat.

Kesehatan, Kode Etik



Jawaban Sudoku:

1 8 7 5 6 9 2 3 4

4 5 3 2 7 8 9 1 6

9 6 2 4 1 3 7 5 8

3 4 6 7 9 5 1 8 2

5 7 9 8 2 1 4 6 3

Banjir Bandang ....

Pantauan Waspada di Sabang, Selasa dini hari terlihat Walikota Sabang beserta jajarannya dan Kapolres Sabang sedang berada di lokasi bencana alam Gampong Kuta Timu, Kec. Sukakarya Sabang. Seluruh komponen tim penanggulangan bencana alam sudah berada di lokasi seperti mobil pemadam kebakaran, mobil ambulans, mobil siaran keliling Dishubkominfo Sabang, truk, patroli Satpol PP, mobil TNI dan Polri semua dikerahkan untuk mengantisipasi kemungkinan terjadi ben-

Menko ....

pejabat dari pemerintah provinsi Sumut dan panitia Pesta Danau Toba telah menanti kedatangan Menko Perekonomian, Hatta Rajasa. “Pejabat yang menunggu cukup banyak,” katanya. Pesawat jet pribadi yang ditumpangi Hatta Rajasa itu tidak beralih ke Bandara Polonia Medan. “Pesawatnya dialihkan ke Palembang, Sumatera Selatan,” demikian Siburian.

7 Tahun Lalu ....

Akibat hantaman energi sinar gamma dahsyat tersebut, banyak satelit elektronik yang mengorbit Bumi mengalami kerusakan. Atmosfir teratas Bumi juga mengalami ionisasi luar biasa. Setelah diteliti lebih lanjut, astronom mendapati bahwa sumber serangan adalah magnetar langka yakni SGR 180620 yang berada di sisi lain galaksi Bima Sakti. Soft gamma ray repeaters (SGRs) ini terjadi saat medan magnet yang tengah terbelit berupaya untuk merapikan kembali dirinya dan memecah

Besok, Road ....

Jawaban TTS: TTS Topik


Pada kesempatan itu, Gatot menyampaikan permohonan maaf Menko Perekonomian Hatta Rajasa yang tidak dapat mendarat di Bandara Silangit akibat kondisi cuaca yang tidak memungkinkan untuk mendarat. “Sebenarnya tadi, pak menteri sudah berada di bandara Silangit, karena cuaca yang tidak menguntungkan akhirnya pilot mengurungkan untuk mendarat,” jelas Plt. Gubsu. Gatot juga menyampaikan pesan-pesan Menko Perekonomian, antara lain menyangkut komitmen tentang kelanjutan penghijauan Danau Toba. Kemudian menyangkut pembangunan kawasan Danau Toba agar dibangun sebagai simbol keberagaman masyarakat Sumatera Utara. Kemudian, Plt. Gubsu juga menyampaikan ide Menko Perekonomian, agar Danau Toba dapat dijadikan ikon pariwisata nasional, serta menggagas Danau Toba menjadi strategi kawasan ekonomi khusus kepariwisataan. Menyangkut infrastruktur, Gatot berjanji memperjuangkan terlaksananya pembangunan jalan tol Medan, Kualanamu dan Tebingtinggi. Menurutnya, saat ini sedang berlangsung proses pembebasan lahan dan tahapannya sudah mencapai 54 persen. “Mari kita bangun Danau Toba dengan pendekatan komprehensif, sebagai ciptaan Tuhan bagi masyarakat,” kata Gatot sembari menambahkan, pada pelaksanaan PDT mendatang agar ditingkatkan lagi, serta penyesuaian jadwal sesuai keinginan masyarakat di saat hari libur. “Kepanitiaan juga diserahkan kepada kepala daerah yang menjadi tuan rumah PDT.” (a29)

8 2 1 3 4 6 5 7 9

7 3 4 6 5 2 8 9 1

6 1 5 9 8 4 3 2 7

2 9 8 1 3 7 6 4 5

Wali Kota Lhokseumawe Munir Usman serta Pemkab Bireuen atas dukungannya,” ucap Bustami Saleh. Acara Road To Dakwah menyambut 65 tahun Waspada yang diperingati setiap 11 Januari di Lhokseumawe merupakan acara yang kedua yang dilaksanakan di Provinsi Aceh. Selama ini telah berlangsung di 9 kabupaten/kota

Al Bayan ....

mereka. Yang demikian itu adalah karunia yang besar” (QS. Asy-Syuura:22). Orang saleh termasuk dalam kelompok manusia yang beriman yang disebut Allah dalam Alquran sebagai khalifah di bumi (QS. an-Nur:55) tetap menyembah Allah, tidak menyekutukan-Nya dengan apapun. Allah juga berjanji kepada mereka kebahagiaan di dunia dan di akhirat. Sebagai manusia yang masih diberi kesempatan hidup, kita punya peluang untuk menjadi orang-orang yang saleh. Kita harus menempuh beberapa syarat berikut. Pertama, melaksanakan perintah-

Polisi Mayoritas ....

sember belum terdata karena masih berjalan,” terang Benget sembari mengaku 55 persen dari 107 merupakan pelanggaran HAM (hak sipil dan hak ekosob (ekonomi sosial dan budaya) ), 23 persen merupakan bentuk tidak profesional serta 22 persen merupakan kriminalitas. Untuk tertinggi tingkat kekerasan, tambah Muhrizal, paling banyak terjadi di Medan disusul Deli Serdang. “Kasus tertinggi terjadi di Medan 36 kasus, Deli Serdang 219 kasus, dan Langkat 13 kasus, disusul kab/kota lainnya masih berkisaran 1 hingga 7 kasus,” bebernya. Muhrizal melanjutkan, beberapa kasus kekerasan dan pelanggaran yang perlu mendapat sorotan yaitu kriminalisasi terhadap 7 orang petani

di Desa Dagang Kerawan, Tanjung Morawan, Deli Serdang. Kriminalisasi anggota kelompok tani MBK dan kelompok tani Disodadi di Desa Merbau Selatan, Labura. Bentrokan masyarakat dengan Brimob di Kampung Sei Jernih. Kasus pelanggaran HAM dalam konflik masyarakat lokal Mandailing Natal d e n g a n P T S M M . Ka s u s pengusuran lahan seluas 7,5 hektar di Jalan Jati. “Kami melihat polisi sekarang menjadi satpam para pemilik modal karena kenetralannya bisa dibeli. Termasuk dalam kasus penggusuraan lahan di jalan Jati, kami menemukan polisi malah menjadi garda terdepan yang melakukan penggusuran,” ucap Muhrizal. (m38)

Waitinglist ....

Sumatera Utara, Drs Abd Rahim M.Hum mengatakan, pelaksanaan ibadah haji sangat diperhatikan oleh pemerintah, hal ini sesuai dengan Undang-Undang Nomor 13 Tahun 2008 tentang penyelenggaraan ibadah haji, seperti yang tertuang pada pasal 6 yakni pemerintah berkewajiban melakukan pembinaan,pelayanan dan perlindungan dengan menyediakan layanan administrasi, bimbingan ibadah haji, akomodasi, transportasi, pelayanan kesehatan, kemanan dan lainnya yang diperlukan oleh jamaah haji. “Setiap tahun saat penyelenggaraan ibadah haji, pemerintah terus melakukan perbaikan-perbaikan terhadap hal-hal yang dianggap kurang

memberikan kenyamanan kepada jamaah, saat keberangkatan, saat di Arab Saudi maupun setelah kembali. Untuk memudahkan pemerintah mendapatkan masukan tentang pelaksanaan haji, dilakukan juga evaluasi guna mendapatkan berbagai pemikiran yang digunakan untuk pelaksanaan tahun berikutnya,” kata Rahim. Ka.KUA Medan Tembung Drs H Sutan Syahrir menyebutkan, untuk memberikan pelayanan dan kemudahan bagi calon jamaah haji di kecamatan, juga dilaksanakan bimbingan manasik haji selama beberapa bulan. “Sebelum musim haji dilaksanakan bimbingan terhadap jamaah selama beberapa bulan,”kata Syahrir kemarin. (m37)

Golkar Tak Bisa ....

Ia tak setuju bila DPR RI ingin menggunakan Hak Menyatakan Pendapat (HMP) karena berbagai alasan, seperti tidak puas dengan hasil audit forensik, kinerja KPK yang hingga saat ini belum terlihat sama sekali mengungkap kasus Century sebagaimana rekomendasi Pansus Century yang telah memilih opsi C. “Belum ada alasan gunakan HMP. Memang ada yang tak puas dengan hasil audit BPK itu, kita minta dipuaspuaskan hasil audit forensik itu,” kata Ical. Dalam kesempatan tersebut, Ical mengatakan, selama

tahun 2011, cenderung terjadi intrik dan politiking. “Dalam pandangan saya dan Golkar, cenderung terjadi politik pembongkaran yang tidak bisa menghasilkan sesuatu yang permanen. Misalnya, politiking, terjadi fitnah, intrik-intrik. Ini kontraproduktif bagi kehidupan berbangsa,” kata Ical. Oleh karena itu, Partai Golkar menawarkan solusi untuk masa depan untuk halhal yang prinsip, mendasar, bukan yang remeh temeh, saling menuding. “Periode sekarang ini periode penataan,” kata Ical.

Polisi Bongkar ....

Utara. “Kasus ini terungkap setelah Ibnu Hajar, mengirim SMS ke ayahnya sepekan lalu. Ibnu Hajar dan sejumlah temannya mengaku bekerja sebagai pembantu rumah tangga di Malaysia dan telah dijual ke majikan seharga 2.000 ringgit. Tak terima anaknya diperlakukan seperti itu, Bukhari lalu membuat pengaduan ke polisi dan tak lama berselang, petugas mengamankan FT, MY dan SY,”tutur AKP Marzuki. Menurut Kasat Reskrim, para tersangka yang sudah ditahan itu mengaku mendapat komisi dari setiap korban sekitar Rp500 ribu-Rp1 juta per orang. Khusus untuk kasus Ibnu Hajar yang merekrut MY, lalu korban diserahkan ke SY dan FT. FT kemudian menyerahkan lagi korban keY, lalu baru diberangkatkan ke Malaysia. “Sejauh ini, korban yang sudah terdata empat orang, yakni Ibnu Hajar, yang saat ini masih di Malaysia, lalu pasangan suami istri Junaidi, 30, warga Desa Paya Dua Uram, Seunuddon, Aceh Utara dan

Fitriati, 27, asal Desa Lam Duroe, Darussalam, Banda Aceh (tidak jadi berangkat karena curiga dengan gelagat tersangka) dan Nurjannah, 40, asal Desa Lhokseutui, Baktiya, Aceh Utara. Dia sempat bekerja sebagai PRT di Malaysia tanpa digaji, namun berhasil kabur dari majikan dan kini sudah pulang lagi ke Baktiya,” kata Kasat. Kasat Reskrim menyebutkan, kasus itu akan terus dikembangkan hingga semua tersangka tertangkap. Bahkan untuk mempercepat proses itu, Polres Aceh Utara akan bekerjasama dengan sejumlah Polres terkait, termasuk Polres Aceh Timur dan jajaran Polda Sumut. FT, yang ditanya terpisah mengatakan, dirinya hanya sebatas membantu Y dan tidak tahu menahu soal korban dijual ke Malaysia. “Saya kenal Y ketika dia bertamu ke rumah saya sekitar 6 bulan lalu. Katanya dia perlu orang untuk dipekerjakan di pabrik di Malaysia, bukan untuk dijual. Makanya saya mau bekerjasama,” katanya. (b19)

Eksekutif Bakumsu, Banget Silitonga disela-sela refleksi akhir tahun pelanggaran HAM. Adapun jenis tindakan kekerasan yang dilakukan oknum polri, lanjutnya, seperti penganiayaan 31 kasus, pembiaran 20 kasus, pembunuhan/diluar prosedur hukum 9 kasus, penangkapan sewenang-wenang 8 kasus, penyalahgunaan senjata api/penembakan 7 kasus, perjudian 7 kasus, narkotika 6 kasus, penyiksaan 6 kasus, teror dan intimidasi 5 kasus, pencurian/ penipuan/penggelapan 4 kasus, pelecehan seksual dan perkosaan 3 kasus, dan perampokan 1 kasus. “107 pelanggaran itu hanya untuk periode Januari hingga November. Belum DeWaspada/Gito Rolies

WALI KOTA Banda Aceh Mawardi Nurdin dan Kapolresta Kombes (Pol) Armensyah Thay didampingi wakil wali kota Illiza Sa’aduddin Djamal, Ketua DPRK Banda Aceh Yudi Kurnia, Sekda Banda Aceh T Saifuddin sedang memegang komitmen bersama kota bebas rokok.

Banda Aceh Terapkan Kota Bebas Rokok BANDA ACEH (Waspada): Wali Kota Banda Aceh Mawardi Nurdin, Selasa (27/12) mengeluarkan peraturan wali kota tahun 2011 tentang larangan merokok di tempat umum wilayah Kota Banda Aceh. Peraturan itu dikeluarkan mengingat perokok aktif terus meningkat setiap tahunnya. Dalam peraturan itu, wali kota melarang merokok di kawasan sarana kesehatan, tempat proses belajar mengajar, arena kegiatan anak, tempat ibadah, tempat kerja, sarana olahraga, angkutan umum dan tempat umum yang tertutup. Peraturan dilarang merokok itu diberlakukan mulai

Selasa (27/12) ditandai dengan penandatanganan komitmen muspida terhadap penerapan kawasan tanpa rokok Kota Banda Aceh, oleh Wali Kota Banda Aceh Mawardi Nurdin, Wakil Wali Kota Illiza Saaduddin Djamal, Ketua DPRK Banda Aceh Yudi Kurnia, Kapolresta Kombes (Pol) Armensyah Thay, Sekda Banda Aceh T Saifuddin dan Ketua MPU Banda Aceh. Mawardi mengatakan, peraturan dikeluarkan setelah menimbang untuk melaksanakan ketentuan pasal 25 peraturan pemerintah nomor 19 tahun 2003 tentang pengamanan rokok bagi kesehatan, sehingga dipandang perlu untuk mengatur kawasan

cana susulan. Di Komplek BTN Gampong Ie Meulee Sabang juga hampir semua rumah tergenang air bah yang turun dari gunung. Demikian juga di Lingkungan Taqwa Gampong Ie Meulee beberapa rumah pagarnya diterjang air hujan. Pagar stadion Sabang Meroke sekira 100 meter ambruk. Sementara di Gampong Kuta Timur, Kec. Sukajaya, Sabang lereng gunung galian C longsor dan satu rumah rusak parah diterjang tanah longsor. Tidak ada korban jiwa dalam peristiwa itu, namun kerugian harta benda bisa mencapai ratusan juta rupiah. Jalur lalu lintas jalan raya dari arah kota menuju Gampong Anek Laot di samping terhalang dengan pohon kayu tumbang juga ditutupi dengan tanah lumpur yang turun dari gunung. Selasa pagi aparat dari Dinas Pekerjaan Umum dan Bapedalkep Sabang serta Dishubkominfo Sabang menurunkan peralatan berat dilengkapi dengan personil untuk membersihkan lokasi bencana alam. Sekira pukul 13:00. Menurut pantauan Waspada

di sabang lalu lintas kembali normal meskipun kondisinya masih ditutupi lumpur. Wakil Wali Kota Sabang, Islamuddin, Selasa pagi berkeliling ke beberapa titik bencana dan mengatakan kepada wartawan, belum dapat dipastikan berapa rumah yang hancur dan tergenang air. Pihaknya akan memanggil seluruh Kechik dalam dua kecamatan daerah itu untuk mendata jumlah rumah yang terkena banjir bandang. Menurut Islamuddin, keadaan Sabang sudah kembali normal. Dua titik longsor sudah selesai dikerjakan dan rumah-rumah yang terkena banjir sedang dibersihkan oleh pemiliknya dengan bantuan para tetangga. Sementara PDAM masih dalam perbaikan. Saat ini, kata dia, Pemko Sabang sedang menyiapkan bantuan-bantuan yang diperlukan sesuai aturan. ‘’Wellcome to Sabang, kami siap menerima kembali para tamu. Tapi sebelum ke Sabang kami minta untuk men-check juga keadaan laut, karena terlihat gelombang agak tinggi,” pinta Islamuddin. (b31/b04)

kerak magnetar tersebut. Akibatnya, terjadi lontaran energi dengan zona mematikan yang bisa mencapai beberapa tahun cahaya. Magnetar sendiri punya medan magnet 1.000 kali lipat dibanding pulsar (bintang neutron bermedan megnet tinggi yang memancarkan radiasi elektromagnetik) biasa. Ia sangat kuat dan bisa mengakibatkan kehancuran apapun yang ada dalam jarak 1.000 kilometer di sekitarnya. “Satelit Swift didesain untuk menemukan lontaran yang tidak lazim,” kata Neil Gehrels, peneliti dari Goddard

Space Flight Center, NASA, dikutip dari Daily Galaxy, Selasa (27/12). “Kita benarbenar terhantam telak dengan yang satu ini,” ucapnya. Beruntung bagi Bumi, jarak sumber ledakan itu sangat jauh. Dan gamma-ray burst (GRB) berikutnya yang akan datang, kemungkinan hadir dari jarak ribuan tahun cahaya dari Bumi. Fenomena seperti ini juga kemungkinan hanya terjadi satu kali dalam satu dekade. Artinya, GRB yang menghantam atmosfir Bumi pada tahun 2004 lalu merupakan kejadian yang sangat langka. (vn/m09)

di Sumatera Utara, dan terakhir 17 Desember lalu di Peureulak Barat, Aceh Timur. Bustami membuka pintu bagi masyarakat di bawah kabupaten/kota perwakilannya untuk datang pada acara itu. Karena selain acara puncak dakwah juga diselingi penyampaian apresiasi khusus yang dikemas sedemikian rupa kepada masyarakat Aceh.

Selama ini sudah menjadikan media Harian Umum Nasional Waspada sebagai pusat pemberitaan yang melekat di hati. Kegiatan ini, kata Bustami yang didampingi Mustapa Kamal selaku Bendahara Panitia mengatakan, selain menyambut HUT Waspada, juga bagian dari menyemarakkan Tahun Baru Islam 1433 Hijirah. (cmk)

perintah Allah SWT yang telah diwajibkan kepada kita, seperti shalat lima waktu, mengeluarkan zakat, memberi infaq dan sedekah, tidak riya dalam beribadah, tidak kikir, tidak zalim. Kedua, kita harus berusaha menjauhkan diri dari segala perbuatan dosa. Jangankan turut terlibat, simpatipun tidak, sebab maksiat itu larangan Allah. Dengan memelihara diri dari berbagai jenis maksiat, InsyaAllah anda akan dimasukkan Allah dalam kelompok salihin (orang-orang saleh). Orang saleh itu tidak akan merugi hidup di dunia (QS. alAshr:2), mendapat rezeki yang mudah, lepas dari kesusahan

(QS. at-Thalaq: 2 - 3), merasa aman dan tenteram, bahagia sepanjang hari, tidak bersedih hati (QS. al-A’raf:35), berani berkata benar, tidak akan terjangkit penyakit hati, cerdas dan berwawasan luas. Dan masih banyak sifat-sifat utama lainnya. Mereka (orang-orang saleh) sangat berbeda dengan orang jahil dan bakhil. Kalau orang jahil dan bakhil memperturutkan hawa nafsunya di dunia, beribadah bukan karena Allah, bersifat munafik, cepat marah, hatinya penuh dengan rasa dengki, dendam, takabbur, riya dan sebagainya. Semoga kita menjadi orangorang yang saleh.

tanpa rokok di Kota Banda Aceh. “Kawasan tanpa rokok adalah ruangan atau area yang dinyatakan dilarang untuk kegiatan penjualan, iklan, promosi dan penggunaan rokok,” terang wali kota. Pemerintah kota juga menerapkan sanksi administrasi kepada pimpinan atau penanggungjawab kawasan tanpa rokok dan kawasan terbatas merokok bila melanggar atau tidak melarang perokok aktif, sanksinya peringatan tertulis, penghentian sementara kegiatan dan pencabutan izin. Dalam hal ini masyarakat juga mempunyai peran serta dengan memberikan peringatan kepada setiap orang yang melanggar ketentuan berlaku pada kawasan tanpa rokok, kemudian berhak melaporkan setiap orang yang terbukti melanggar ketentuan peraturan. (cb01)

Ada-ada Saja ....

rugi kepada 11 wanita dan dua pria yang menderita luka bakar meledak saat pembuatannya dipraktekkan oleh para korban. Keputusan pengadilan ini diumumkan Senin lalu, tujuh tahun setelah para pembaca koran tersebut mengalami penderitaannya. Para hakim memutuskan bahwa koran tersebut gagal melakukan tes menyeluruh sebelum menerbitkan artikel tentang pembuatan kue itu, dan jika para pembaca mengikuti panduan resep secara tepat, kue itu punya kemungkinan meledak jika panas minyak mencapai suhu yang disarankan dalam resep itu. Grupo Copesa, sang pemilik surat kabar mengatakan akan mematuhi keputusan yang telah dibuat oleh pihak pengadilan. Beberapa hari setelah resep itu diterbitkan di surat kabar tahun 2004, korban mulai berjatuhan dan beberapa rumah sakit di penjuru negara Chile mulai kedatangan pasien luka bakar yang disebabkan kue yang meledak dalam minyak panas. (msnbc/rzl)

Satpam ....

dan Mustabsirah, SH, menyatakan terdakwa terbukti bersalah, melaggar Pasal 340 ayat (1) KUHP tentang pembunuhan berencana. Vonis itu sendiri lebih ringan dari tuntutan Jaksa Penuntut Umum (JPU) yang menuntut terdakwa dihukum 15 tahun penjara. Meski begitu, JPU dari Kejaksaan Negeri Lhoksukon Indra Nuatan SH belum memastikan apakah akan melakukan banding atau tidak. Demikian pula terdakwa M Tahar menyatakan masih pikir-pikir. Seusai mendengar tanggapan JPU dan terdakwa, Majelis Hakim langsung menutup sidang. (b19)

Presiden ....

“Kalau memang benar bahwa aksi tersebut ada yang memprovokasi atau mendalangi, maka harus ditangkap kemudian diproses atau diadili siapa pun dia yang berada di balik peristiwa yang mengakibatkan korban jiwa tadi,” tuturnya. Julian mengatakan peristiwa tersebut agar jangan dilihat secara parsial sehingga cepat disimpulkan bahwa aparat kepolisian bertindak di luar prosedur. “Namun, kita juga harus melihat sebetulnya seperti apa yang terjadi di lapangan saat kejadian itu. Mungkin saja ada kejadian tindakan atau peristiwa di luar kelaziman atau kepatutan sehingga kemudian tindakan-tindakan yang intinya mengandung unsur kekerasan tidak bisa dihindari,” tuturnya.

WASPADA Rabu 28 Desember 2011

Lebih lanjut Ahmad Qosbi menyebutkan, tingginya angka waitinglist ini diharapkan setiap tahun ada solusi yang diberikan oleh pemerintah agar percepatan keberangkatan bisa dilaksanakan seperti musim haji 2011 ini. “ Kalau tahun 2012 mendatang ada penambahan diharapkan bisa mengurangi angka waitinglist meskipun jumlahnya terbatas, apalagi Undang-undang telah menyebutkan bahwa setiap warga negara yang beragama Islam berhak untuk menunaikan ibadah haji bagi mereka yang berusia 18 tahun atau sudah menikah dan mampu membayar Biaya Penyelenggaraan Ibadah Haji (BPIH), “kata Qosbi. Kepala Kantor Kementerian Agama Wilayah Provinsi

Century, Partai Golkar tidak pada tempatnya mengatakan, apakah benar atau tidak hasil audit tersebut. Kami serahkan ke BPK,” kata Ical saat bincang santai dengan wartawan di Gedung DPP Partai Golkar, Jakarta, Selasa (27/12). Menurut Ical, apa pun hasil audit forensik tersebut, semua pihak harus menerima. “Kalau perlu telaah yang mendalam, maka kami akan telaah. Kasus Bank Century harus dibongkar sampai ke akarakarnya, jangan bilang bahwa semua salah dan terlibat dalam kasus Bank Century,” ujar Ical. Kecamatan Madat, Aceh Timur. Sementara tersangka yang buron berinisial Y, warga Tandem, Deliserdang, Sumut. “FT, SY dan MY ditangkap terpisah di kawasan Sungai Raya Aceh Timur, Minggu (25/ 12) siang. Mereka dibekuk berdasarkan laporan Bukhari, 45, ayah Ibnu Hajar, 21, salah seorang korban asal Desa Pantee Gaki Balee, Kecamatan Langkahan, Aceh Utara. Dia direkrut tersangka sekitar tiga bulan lalu,” kata Kapolres Aceh Utara AKBP Farid melalui Kasat Reskrim AKP Marzuki, di ruang kerjanya, Selasa (27/12). Berdasarkan hasil pemeriksaan sementara, para tersangka diduga sudah bertahun-tahun menjadi agen trafficking. Mereka merekrut calon korban dengan imingiming akan dipekerjakan di sejumlah pabrik di Malaysia, lalu dijual ke sejumlah majikan di negeri jiran itu dengan harga mencapai 2.000 ringgit atau sekitar Rp4 juta per orang. Para k o r b a n d i b e ra n g k a t k a n dengan kapal feri lewat perairan Tanjungbalai, Sumatera

Berita Utama


Polisi Tangkap 1.106 Orang Pemakai Dan Bandar Narkoba 709 Kg Ganja, 3.366.522 Gram Sabu Dan 16.780,5 Butir Ekstasi Disita

Waspada/Abdul Hakim

API membubung tinggi dari sumur minyak yang meledak di Kec. Padangtualang Kab. Langkat.

Sumur Minyak Di Langkat Meledak STABAT (Waspada): Satu sumur tua mengandung minyak dan gas di Dusun JatiTegal Desa BuluhTelang, Kec. Padangtualang, Kab. Langkat meledak jelang waktu Subuh, Selasa (27/12). Tidak ada korban jiwa maupun korban luka, namun hingga kemarin sore api masih berkobar dan belum dapat dipadamkan. Petugas PT. Eksindo selaku pemegang amanah dari Pertamina untuk mengelola minyak di sana, kewalahan memadamkan api. Meski petugas menyemprotkan zat foam, api api tak berkurang, sebaliknya semakin membubung tinggi karena terkena air yang disiramkan. Beberapa saat kemudian api semakin menjulang tinggi akibat hujan sehingga menimbulkan titik-titik kecil api di sekitarnya. Pantauan Waspada, sebelum petugas dari PT Eksindo datang ke lokasi kejadian untuk memadamkan api, masyarakat berusaha menutupi lubang sumber minyak yang terbakar dengan dedaunan dan batang pohon pisang, agar kobaran api mengecil namun hasilnya terlihat. Ketika petugas datang, dedaunan dan batang pisang di lubang sumber gas kembali mereka buka agar mampu meredam kobaran dengan semprotan, tapi api malah kembali menyembur. Lokasi kejadian jauh dari pemukiman penduduk hingga tidak berdampak lebih buruk. Di sekitarnya terdapat puluhan titik pengeboran minyak yang dilakukan masyarakat secara tradisional. Meski eksploitasi itu ilegal, tidak ada pihak yang mampu membendungnya, termasuk dari pihak Eksindo. Sementara sumur yang meledak juga dikuasai salah seorang warga yang kini dalam pengejaran aparat kepolisian. “Identitasnya telah kita ketahui, kasus ini dalam penyelidikan,” kata Kasat Reskrim Polres Langkat AKP Aldi Subartono di lokasi kejadian. Menurut Aldi, sebagaimana keterangan yang mereka himpun, di saat salah seorang warga hendak mengambil minyak menggunakan pipa dan mengandalkan mesin menyedot, entah bagaimana bahan bakar minyak di mesin tersebut mengeluarkan percikan api dan menyambar lubang sumber gas hingga terjadi kebakaran. Di lokasi kejadian juga masih terdapat beberapa pipa sebagai barang bukti. Kasat Reskrim mengaku kecewa dengan sikap kepala desa maupun camat yang tidak mau tahu dengan kejadian itu. Faktanya aparatur tersebut tidak terlihat di lokasi. “Seharusnya ada sosialisasi terus menerus kepada masyarakat, agar jangan mengeksploitasi minyak secara ilegal, dan harus memahami dampak buruk yang ditimbulkan,” katanya. “Bukan tidak mungkin beberapa kilometer dari lokasi kejadian ini juga akan terbakar karena di bawah tanah masih terdapat kandungan minyak dan gas,” lanjut AKP Aldi. Terkait meledaknya sumur tersebut, Kadis Pertambangan dan Energi Pemkab Langkat, Drs. M. Iskandarsyah mengatakan pihaknya telah berulangkali melakukan sosialisasi kepada masyarakat Kec. Padangtualang, agar tidak mengeksploitasi minyak secara ilegal, namun masyarakat tetap membandel. (a03/a01)

Tiga Ruko Di Stabat Terbakar STABAT (Waspada): Tiga ruko di Jalan Perniagaan Stabat Kab. Langkat terbakar, Selasa (27/12) sore. Tidak ada korban jiwa dalam kejadian, namun kerugian ditaksir pemiliknya puluhan juta rupiah karena ketiganya berdagang oli kendaraan bermotor, barang elektronik dan berjualan suku cadang mobil. Petugas pemadam Pemkab Langkat yang mengerahkan tiga mobil berhasil memadamkan api satu jam kemudian setelah dibantu masyarakat yang mendobrak pintu salah satu Ruko yang ditinggal pemiliknya. Ketiga korban, Awek, Ling-ling dan Heri, kini mengamankan sejumlah harta benda yang selamat. Menurut salah seorang korban, saat kejadian, listrik PLN kembali normal dan dia kemudian mematikan genset. Entah bagaimana terjadi korsleting arus listrik hingga menimbulkan percikan api. Kapolsek Stabat Iptu Zulkarnaen mengatakan masih menyelidiki penyebab kebakaran. ‘’Dugaan sementara akibat hubungan arus pendek listrik,’’ katanya. (a03/a01)

Kontras Catat ... sipil dan hak ekosob (ekonomi sosial dan budaya), 23 persen merupakan bentuk tidak profesional serta 22 persen merupakan kriminalitas. Untuk tertinggi tingkat kekerasan, tambah Muhrizal, paling banyak terjadi di Medan

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Bg4+, Rh8. 2. Bf1f6, d3. 3. Bf6xh6+mat.

Jawaban TTS: TTS Topik


Kesehatan, Kode Etik




Jawaban Sudoku:

1 8 7 5 6 9 2 3 4

4 5 3 2 7 8 9 1 6

9 6 2 4 1 3 7 5 8

3 4 6 7 9 5 1 8 2

5 7 9 8 2 1 4 6 3

8 2 1 3 4 6 5 7 9

7 3 4 6 5 2 8 9 1

6 1 5 9 8 4 3 2 7

2 9 8 1 3 7 6 4 5

disusul Deliserdang. “Kasus tertinggi terjadi di Medan 36 kasus, Deliserdang 19 kasus, dan Langkat 13 kasus, disusul kab/ kota lainnya masih berkisar 1 hingga 7 kasus,” bebernya. Muhrizal melanjutkan, beberapa kasus kekerasan dan pelanggaran yang perlu mendapat sorotan yaitu kriminalisasi terhadap 7 orang petani di Desa Dagang Kerawan, Tanjung Morawa, Deliserdang. Kemudian kriminalisasi anggota kelompok tani MBK dan kelompok tani Disodadi di Desa Merbau Selatan, Labura; Bentrokan masyarakat dengan Brimob di Kampung Sei Jernih; Kasus pelanggaran HAM dalam konflik masyarakat lokal Mandailing Natal dengan PT SMM; Dan kasus penggusuran lahan seluas 7,5 hektar di Jalan Jati. Muhrizal mengganggap banyak oknum polisi di lapangan yang tidak mengindahkan peraturan maupun Undang-undang yang telah dibuat pemerintah maupun Kapolri. “Ada UU No. 2 tahun 2002 tentang Polri, Perkap Kapolri No 8 tahun 2009. Keduanya mengatur tentang sikap demokratis, penghargaan, penegakan serta penghormatan HAM. Namun, prakteknya dilapangan nyaris tidak pernah diaplikasikan,” sesalnya sembari menerangkan dari 107 kasus yang dilaporkan hanya 7 kasus yang diproses di P3D. Itupun, tambahnya lagi, hanya sebatas sidang profesi, tidak diteruskan kepidananya. Karenanya, Kontras berharap agar Kapolda Sumut, Irjen Pol Wisjnu Amat Sastro agar dicopot dari jabatannya. “Kami menilai semenjak kepemimpinan beliau, Polisi di Sumut cenderung militeristik,” akunya. (m38)

Ada-ada Saja ... atas nama Muhamad Prawirodirjoyo,” kata Hakim Iva Sudewi, Selasa (27/12). Mendengar putusan tersebut Siti atau kini sering disapa Joy sempat menunduk dan berkali-kali mengusap airmata yang sempat menetes. “Saya sangat bersyukur akhirnya saya resmi menjadi laki-laki. Saya berharap di ulang tahun pertama saya sebagai laki-laki . (vvn)

MEDAN (Waspada): Sat Narkoba Polresta Medan beserta Polsek jajaran mengamankan sedikitnya 1.106 tersangka narkoba dengan mengungkap 875 kasus dan penyelesaian kasus mencapai 903 selama Januari hingga 25 Desember 2011. “Dari para tersangka polisi menyita barang bukti 709 kg ganja, 3.366.522 gram sabu, putaw 1,5 gram, ekstasi 16.780,5 butir, Erimin 41,5 butir, pil Evidrin 1.000 butir, pil Lorazepam 2 butir dan tepung ekstasi 23 gram,” jelas Kapolresta Medan Kombes Tagam Sinaga melalui Kasat Narkoba Kompol Juli Agung Pramono, SH, SIK, M.Hum, Selasa (27/12) petang. Dijelaskan Juli Agung, para tersangka yang diamankan ini paling banyak berstatus wiraswasta mencapai 525 orang, kemudian pengangguran 184 orang, pegawai swasta 176

orang, buruh 175 orang, anggota Polri 10 orang, pelajar 10 orang, mahasiswa 10 orang, PNS 6 orang, petani 7 orang dan anggota TNI 3 orang. “Rata-rata pendidikan para tersangka yang ditangkap jajaran Narkoba Polresta Medan Sekolah Menengah Atas (SMA) mencapai 681 orang. SMP 284 orang, SD 101 orang dan Perguruan Tinggi 40 orang. Sedangkan umur para tersangka lanjutnya, didominasi umur produktif yakni 18-30 tahun,” kata Juli Agung. Kalau dibandingkan tahun sebelumnya, untuk barang bukti ganja mengalami kenaikan. Tahun 2010 sita barang bukti 525,8 kg tahun ini 709 kg. “Jadi naik 183,2 kg,” jelasnya. Kemudian untuk narkoba jenis Putaw, 2010 disita barang bukti 0,4 gram, tahun ini disita 1,5 gram. “Untuk sabu-sabu, 2010 disita 2.132,58 gram. Tahun ini 3.366,522 gram. Naik

1.233,942 gram,” kata Juli Agung Pramono. Sedangkan ekstasi lanjutnya, 2010 disita barang bukti 4.753 butir. 2011 disita 16.780,5 butir. Naik 12.027 butir. Pil Erimin 5 (Happy Five), 2010 disita 248 butir. 2011 disita 41,5 butir. Turun 206,5 butir. Pil Evidrin, 2010 kosong. 2011 disita barang bukti 1.000 butir. Pil Lorazepam, 2010 kosong. 2011 disita barang bukti 2 butir. Tepung ekstasi, 2010 kosong, 2011 disita barang bukti 23 gram. Tepung Cafein, 2010 disita barang bukti 1,6 kg. 2011 kosong dan Subutex, 2010 disita barang bukti 1 butir, 2011 kosong. Waspadai Juli Agung Pramono juga meminta kepada warga masyarakat untuk mewaspadai bahaya narkoba di lingkungan masing-masing karena untuk kota Medan, bahaya narkoba ini sudah lampu merah. “Kita

harus mewaspadai bahaya narkoba ini mulai dari lingkungan keluarga,” jelasnya. Ketika ditanya apakah narkoba jenis sabu-sabu ini semuanya berasal dari Malaysia, Juli Agung menegaskan, sabu yang masuk ke Indonesia khususnya MedanberasaldariMalaysia.“Sabu yang kita amankan semuanya berasal dari negeri tetangga Malaysia dan masuk ke Medan melalui pelabuhan kecil di Tg. Balai atau perairan Aceh yang tidak dijaga petugas,” katanya. Untuk mengantisipasi peredaran dan bahaya narkoba ini pihaknya melakukan penyuluhan dan sosialisasi ke sekolahsekolah dan perguruan tinggi. “Harapan kita dengan sedini mungkin para pelajar mengetahui bahaya narkoba, mereka bisa menjauhi narkoba yang bisa merusak generasi muda, terutama generasi bangsa,” jelas Juli Agung Pramono. (m39)

Presiden: Agama, Landasan Moral Membangun Bangsa JAKARTA (Waspada): Presiden Susilo Bambang Yudhoyono pada peringatan Natal Bersama 2011 di Jakarta Convention Centre, Jakarta, Selasa (27/12) malam mengatakan, agama adalah landasan moral bagi membangun bangsa menjadi lebih maju. “Agama menjadi landasan moral dan etika untuk membangun bangsa yang lebih maju, mari kita songsong tahun depan penuh harapan. Kita cetak kondisi politik stabil, ekonomi baik dan kehidupan sosial yang lebih baik,” katanya. Dia meminta peristiwa yang tidak patut dalam kehidupan bernegara dan bermasyarakat pada 2011 tidak lagi terulang pada tahun mendatang. “Kesalahan dan ketidakpatutan dalam kehidupan bernegara dan bermasyarakat tahun ini jangan terjadi lagi tahun depan, dengan iman, pengharapan dan kasih, bangun Indonesia lebih sejahtera, adil dan damai,” katanya. Presiden juga meminta semua umat beragama, khususnya umat Nasrani yang tengah merayakan Natal, untuk terus meningkatkan toleransi dan kebersamaan dalam menyelesaikan

berbagai masalah. “Saat ini kita berada pada proses pembangunan yang bergerak maju, kita memerlukan kebersamaan di antara komponen bangsa apapun identitasnya, Islam, Kristen, Khong Hu Chu, Budha, Hindu memiliki tanggung jawab yang sama,” kata Presiden. Presiden menyebutkan kebersamaan, toleransi dan saling memahami adalah salah satu kunci keberhasilan pembangunan. Dia mengajak masyarakat dan umat kristiani untuk mensyukuri kondisi bangsa yang baik dari sektor ekonomi, politik dan kehidupan masyarakat sehingga terbangun harmoni. “Jadikan Natal sebagai jiwa terang, optimis, pikiran positif dan keyakinan,” kata Presiden. Di akhir pidatonya,Yudhyono menyampaikan salam dari Ibu Negara Ani Yudhoyono yang tidak bisa hadir karena sakit dan kini tengah dirawat di rumah sakit Hingga pukul 21:00 WIB belum ada konfirmasi resmi dari pihak Istana Presiden perihal sakitnya Ani Yudhoyono. Dirawat Di RSPAD Ibu Negara Ani Yudhoyono saat ini sedang sakit dan dira-


Medan dan Sumatera Utara dipantau dari pergolakan cuaca di Laut China Selatan. “Setidaknya di kawasan Sumut akan meningkat curah hujan dalam dua hari ini,” kata Hartanto, Kepala Data dan informasi (Datin) pada Badan Meteorologi, Klimatologi dan Geofisika (BMKG) wilayah I stasiun Bandara Polonia Medan. Dengan demikian, kata Hartanto, masyarakat diminta agar meningkatkan kewaspadaan bahaya banjir bahkan ancaman longsor, terutama di pesisir

Selain angin yang cukup kencang, menurut dia, awan di sekitar Bandara Silangit juga terlalu rendah sehingga menutupi pandangan menuju landasan pacu (runway). “Jadi, gagal mendarat karena cuaca buruk,” katanya. Pesawat jet pribadi yang ditumpangi Hatta Rajasa itu dialihkan ke Palembang, Sumatera Selatan, ujar Siburian. Gangguan Cuaca Di Laut Gangguan cuaca di kawasan

Wanita Dibunuh ... Setelah satu jam berada di dalam kamar, pria itu tampak keluar tergesa-gesa dan langsung pergi meninggalkan hotel. Bambang sempat melihat pria tersebut pergi tergesa-gesa. Setelah melihat pintu kamar terbuka, Bambang pun mengecek ke dalam kamar. Dia terkejut mendapati korban tergeletak bersimbah darah di lantai kamar. Bambang kemudian menyampaikan kepada pihak hotel tentang peristiwa di kamar No. 17 itu sebelum melaporkannya kepada Polsekta Delitua. Setelah tim Polresta Medan tiba di lokasi kejadian untuk melakukan identifikasi, jenazah

Daftar Tunggu ... Kepala Kantor Kementerian Agama Wilayah Provinsi Sumatera Utara, Drs Abd Rahim M.Hum mengatakan, pelaksanaan ibadah haji sangat diperhatikan oleh pemerintah, hal ini sesuai dengan UndangUndang Nomor 13 Tahun 2008 tentang penyelenggaraan ibadah haji, seperti yang tertuang pada pasal 6 yakni pemerintah berkewajiban melakukan pembinaan,pelayanan dan perlindungan dengan menyediakan laya-

wat di Rumah Sakit Pusat Angkatan Darat (RSPAD), Jakarta. Ibu Ani tiba di RSPAD pada Selasa (27/12) sore. Demikian menurut Juru Bicara Kepresidenan Julian Aldrin Pasha. Ia mengatakan, tim dokter kepresidenan menangani langsung perawatan Ibu Negara.

Julian enggan memberikan keterangan terkait dengan penyakit yang diderita Ibu Negara. “Nanti Ketua Tim Dokter Kepresidenan saja yang menjelaskan,” kata Julian Selasa malam. Julian pun meminta doa agar kesehatan Ibu Negara cepat pulih. (ant/kps)

Hatta Rajasa ...


Selain ditandai turunnya hujan, panitia juga dinilai tidak profesional. Seperti terlihat pada saat penyambutan kedatangan Plt. Gubsu Gatot Pujo Nugroho bersama Dirjen Nilai Budaya, Seni dan Film Kementerian Pariwisata, Ukus Kuswara, unsur Muspida Sumut, Bupati Simalungun JR Saragih. Pihak panitia terpaksa‘puntangpanting’ mengangkat karpet merah dan para penari pun lari lintang pukang menyambut tamu yang datang dari arah berlainan dari yang telah ditetapkan semula. Sebelumnya, penyambutan dilakukan di gerbang open stage, tapi ternyata para tamu terhormat datang dari tangga

korban dievakuasi ke RS H Adam Malik sekira pukul 17:00. Kapolsek Delitua Kompol SP Sinulingga didampingi Kanit Reskrim AKP Semion Sembiring yang turun ke tempat kejadian perkara saat dikonfrimasi wartawan membenarkan peristiwa tersebut. Menurut Kanit Reskrim, tewasnya wanita tersebut diduga dibunuh dengan benda tajam. Ketika disinggung mengenai identitas korban, Kanit mengatakan belum dapat mengungkapnya karena masih dalam penyidikan. Hingga malam pihaknya masih mengumpulkan keterangan beberapa saksi dari pihak hotel dan mengamankan sejumlah barang bukti. (m40)

timur Sumatera Utara, baik di kawasan Deliserdang, Medan, Langkat dan Asahan. Imbas dari gangguan cuaca di Laut China Selatan menyebabkan terjadi hujan intensitas tinggi bahkan hujan lokal terutama di pesisir timur Sumut. Sementara di pantai barat seperti di Mandailing Natal (Madina), Sibolga dan Tapteng terjadi hujan-hujan ringan, sedang dan merata disana. Potensi peluang banjir masih cukup besar, terutama banjir kiriman pada malam hari jika intensitas curah hujan di kawasan pegunungan semakin tinggi. “Ke depan , Sungai Babura, Sungai Deli, Sungai Batuan dan SungaiWampu di Langkat masih berpeluang terjadi banjir,” ujar Hartanto. Bahkan menurutnya, pengalaman tahun-tahun sebelumnya, imbas meningkatnya curah hujan di kawasan pegunungan, banjir kiriman akan dirasakan masyarakat yang bertempat tinggal sepanjang aliran sungai. “Peluang banjir masih ada, mengingat curah hujan hingga awal Januari 2012 di kawasan pesisir timur Sumut masih tinggi,” ujarnya. (Ant/m32)

nan administrasi, bimbingan ibadah haji, akomodasi, transportasi,pelayanan kesehatan, keamanan dan lainnya yang diperlukan oleh jamaah haji. “Setiap tahun saat penyelenggaraan ibadah haji, pemerintah terus melakukan perbaikan-perbaikan terhadap halhal yang dianggap kurang memberikan kenyamanan kepada jamaah, saat keberangkatan, saat di Arab Saudi maupun setelah kembali. Untuk memudahkan pemerintah mendapatkan masukan tentang pelak-

sanaan haji, dilakukan juga evaluasi guna mendapatkan berbagai pemikiran yang digunakan untuk pelaksanaan tahun berikutnya,” kata Rahim. Ka.KUA Medan Tembung Drs H Sutan Syahrir menyebutkan, untuk memberikan pelayanan dan kemudahan bagi calon jamaah haji di kecamatan, juga dilaksanakan bimbingan manasik haji selama beberapa bulan. “Sebelum musim haji dilaksanakan bimbingan terhadap jamaah selama beberapa bulan,”kata Syahrir. (m37)

Al Bayan ... Karena selalu di jalan benar, mereka mendapat petunjuk Allah dan memeliharanya dari segala yang buruk. Allah ridha kepada mereka dan mereka ridha kepada Allah SWT. Mereka selamat di dunia dan selamat pula di akhirat kelak. Tempat kembali mereka adalah surga yang abadi sebagaimana firman Allah, “Dan orangorang yang saleh berada di dalam taman-taman surga. Mereka memperoleh apa yang mereka kehendaki di sisi Tuhan mereka. Yang demikian itu adalah karunia yang besar” (QS. Asy-Syuura:22). Orang saleh termasuk dalam kelompok manusia yang beriman yang disebut Allah dalam Alquran sebagai khalifah di bumi (QS. an-Nur:55) tetap menyembah Allah, tidak menyekutukanNya dengan apapun. Allah juga berjanji kepada mereka kebahagiaan di dunia dan di akhirat. Sebagai manusia yang masih diberi kesempatan hidup, kita punya peluang untuk menjadi orang-orang yang saleh. Kita harus menempuh beberapa syarat berikut. Pertama, melaksanakan perintah-perintah Allah SWT yang telah diwajibkan kepada kita, seperti shalat lima waktu, menge-

luarkan zakat, memberi infaq dan sedekah, tidak riya dalam beribadah, tidak kikir, tidak zalim. Kedua, kita harus berusaha menjauhkan diri dari segala perbuatan dosa. Jangankan turut terlibat, simpatipun tidak, sebab maksiat itu larangan Allah. Dengan memelihara diri dari berbagai jenis maksiat, InsyaAllah anda akan dimasukkan Allah dalam kelompok salihin (orang-orang saleh). Orang saleh itu tidak akan merugi hidup di dunia (QS. al-Ashr:2), mendapat rezeki yang mudah, lepas dari kesusahan (QS. at-Thalaq: 2 - 3), merasa aman dan tenteram, bahagia sepanjang hari, tidak bersedih hati (QS. al-A’raf:35), berani berkata benar, tidak akan terjangkit penyakit hati, cerdas dan berwawasan luas. Dan masih banyak sifat-sifat utama lainnya. Mereka (orang-orang saleh) sangat berbeda dengan orang jahil dan bakhil. Kalau orang jahil dan bakhil memperturutkan hawa nafsunya di dunia, beribadah bukan karena Allah, bersifat munafik, cepat marah, hatinya penuh dengan rasa dengki, dendam, takabbur, riya dan sebagainya. Semoga kita menjadi orang-orang yang saleh.

Ikon Nasional Plt. Gubsu Gatot Pujo Nugroho membuka PDT 2011 mewakili Menko Perekonomian Hatta Rajasa. Pada kesempatan itu, Gatot menyampaikan permohonan maaf Menteri yang tidak dapat mendarat di Bandara Silangit akibat kondisi cuaca buruk. “Sebenarnya tadi, pak menteri sudah berada di bandara Silangit, karena cuaca yang tidak menguntungkan akhirnya pilot mengurungkan niat untuk mendarat,” jelas Plt. Gubsu. Gatot juga menyampaikan pesan-pesan Menko Perekonomian, antara lain menyangkut komitmen tentang kelanjutan penghijauan Danau Toba. Kemudian menyangkut pembangunan kawasan DanauToba agar dibangun sebagai simbol keberagaman masyarakat Sumatera Utara. Kemudian, Plt. Gubsu juga menyampaikan ide Menko Perekonomian, agar Danau Toba dapat dijadikan ikon pariwisata nasional, serta menggagas Danau Toba menjadi strategi kawasan ekonomi khusus kepariwisataan. Menyangkut infrastruktur, Gatot berjanji memperjuangkan terlaksananya pembangunan jalan tol Medan, Kualanamu dan Tebingtinggi. Menurutnya, saat ini sedang berlangsung proses pembebasan lahan dan tahapannya sudah mencapai 54 persen. “Mari kita bangun Danau Toba dengan pendekatankomprehensif, sebagai ciptaan Tuhan bagi masyarakat,” kata Gatot sembari menambahkan, pada pelaksanaan PDT mendatang agar ditingkatkan lagi, serta penyesuaian jadwal sesuai keinginan masyarakat di saat hari libur. “Kepanitiaan juga diserahkan kepada kepala daerah yang menjadi tuan rumah PDT.” (a29)


Rabu 28 Desember 2011

Road To Dakwah Waspada Di Islamic Center Lhokseumawe Kamis LHOKSEUMAWE (Waspada) : Road to Dakwah Waspada ke-2 di Aceh akan dipusatkan di Masjid Islamic Center Lhokseumawe. Kegiatan dakwan menyambut Hari Ulang Tahun ke-65 Harian Waspada akan disampaikan dai kondang Tgk H Jamaluddin, Kamis (29/12) pukul 13:30. Acara tidak lepas dari dukungan Pemkab Aceh Utara dan Kota Lhokseumawe, seperti bantuan materil berupa tempat pelaksanaan di Masjid Islamic Center yang merupakan masjid kebanggaan masyarakat dua kabupaten kota itu. “Saya sebagai Kepala Perwakilan Waspada Lhokseumawe membawahi Aceh Tamiang, Aceh Timur, Langsa, Aceh Utara, Bireuen, Aceh Tengah, Bener Meriah, Pidie Jaya dan Pidie mengucapkan terima kasih kepada Pj Bupati Aceh Utara M Alibasyah dan Wali Kota Lhokseumawe Munir Usman serta Pemkab Bireuen atas dukungannya,” ucap Bustami Saleh. Acara Road To Dakwah menyambut 65 tahun Waspada yang diperingati setiap 11 Januari di Lhokseumawe merupakan acara yang kedua yang dilaksanakan di Provinsi Aceh. Selama ini telah berlangsung di 9 kabupaten/kota di Sumatera Utara, dan terakhir 17 Desember lalu di Peureulak Barat, Aceh Timur. Bustami membuka pintu bagi masyarakat di bawah kabupaten/kota perwakilannya untuk datang pada acara itu. Karena selain acara puncak dakwah juga diselingi penyampaian apresiasi khusus yang dikemas sedemikian rupa kepada masyarakat Aceh. Selama ini sudah menjadikan media Harian Umum Nasional Waspada sebagai pusat pemberitaan yang melekat di hati. Kegiatan ini, kata Bustami yang didampingi Mustapa Kamal selaku Bendahara Panitia mengatakan, selain menyambut HUT Waspada, juga bagian dari menyemarakkan Tahun Baru Islam 1433 H. (cmk)

501 WNI Di LN Terlibat Narkoba 284 Divonis Hukuman Mati JAKARTA (Antara): 284Warga negara Indonesia (WNI) yang terlibat kasus narkoba di luar negeri divonis hukuman mati, kata Kepala Badan Narkotika Nasional (BNN), Gories Mere di saat konferensi pers akhir tahun di Jakarta, Selasa (28/12). 284 Orang divonis mati itu dengan rincian 271 orang di Malaysia dan 13 orang di RRC, ujarnya. Sementara jumlah WNI yang ditahan di luar negeri karena terlibat dalam jaringan sindikat narkoba internasional adalah 501 orang, ucap Gories. WNI yang menjalani penegakan hukum di luar negeri terdapat di Malaysia sebanyak 390 orang, China 35 orang, Hong Kong 10 orang, Arab Saudi sembilan orang dan Filipina delapan orang. Sedangkan di Australia dan Peru masing-masing lima orang, di Pakistan empat orang, Amerika Serikat, India dan Thailand masing-masing tiga orang. Di Brazil, Ekuador dan Iran masing-masing dua orang. Di Argentina, Chili, Kamboja, Kanada, Kolombia, Srilanka dan Timor Leste masing-masing satu orang.

“Sebagian besar WNI tersebut terlibat kasus narkoba dengan peran sebagai kurir narkoba antar negara,” papar Gories. Mayoritas dari mereka adalah wanita, direkrut dengan cara ditawari pekerjaan di luar negeri, dijadikan teman dekat, diajak kerja sama di luar negeri, diajak berwisata ataupun menikah di luar negeri, ujarnya, menjelaskan. Namun, kemudian para wanita tersebut dititipi koper atau tas yang berisi narkoba, tanpa sepengetahuannya. “Modus operandi lainnya adalah para TKW/TKI yang dipecat dari pekerjaannya di luar negeri, kemudian ditawari untuk membawa narkoba atau membawa tas yang tidak diketahui isinya ke negara lain dengan membawa imbalan uang,” tukas Gories. Untuk masalah ektradisi bagi WNI di luar negeri yang terlibat kasus narkoba, hal tersebut tergantung dari hukum yang berlaku di masing-masing negara, katanya. “Ekstradisi tergantung di negara masing, di negara kita untuk kasus narkoba tidak ada ekstradisi bagi warga asing,” kata Gories.

Seorang Buron Pemerkosaan Di Angkot Ditangkap Di Medan JAKARTA (Waspada):Tim Jatantras Polda Metro Jaya berhasil membekuk seorang lagi pelaku pemerkosaan dan perampokan di dalam mikrolet M26 yakni MSD. Dengan adanya penangkapan ini, berarti seluruh tersangka kasus perampokan dan pemerkosaan terhadap R ,35, berhasil dibekuk. Sebelumnya, Polres Kota Depok telah membekuk DR,18, YBR ,18, dan AI,19. Sumber kepolisian mengatakan MSD baru saja ditangkap pada Selasa (27/12) di Medan, Sumatera Utara. “Iya betul, sudah kami amankan satu lagi. Ini kami masih di Medan,” ujarnya. Adapun, tiga pelaku yakni DR,18, YBR,18, dan AI,19,sudah diamankan aparat kepolisian terkasit kasus pemerkosaan dan perampokan terhadap RS yang terjadi di dalam mikrolet M26 jurusan Kampung Melayu-Bekasi

pada 14 Desember 2011. YBR berperan mengancam korban dengan golok dan memerkosa korban. Sedangkan DR merupakan sopir tembak angkot itu dan AI yang merupakan kekasih YBR mengetahui peristiwa itu dan duduk di samping sopir. Sementara, MSD yang baru ditangkap hari ini memiliki peran melecehkan secara seksual korban. Seluruh pelaku kemudian merampas uang tunai Rp 500.000 milik korban. Setelah dirampok dan diperkosa, R ditinggalkan begitu saja di kawasan Cibubur, Jakarta Timur. Menurut Kapolres Kota Depok, Komisaris Besar Mulyadi Kaharni, tiga pelaku yakni DR, AI, dan YBR kemudian melarikan diri ke Bekasi, Cirebon, Padalarang, sampai akhirnya ditangkap di Bandung, Jawa Barat. Sedangkan MSD akhirnya diringkus di Medan, Sumatera Utara. (kps)

Info Sumut

WASPADA Rabu 28 Desember 2011

Kolom Amir Syarifuddin

Pengamanan Natal PEMERINTAH Provinsi Sumatera Utara sangat peduli pada kenyamanan masyarakat merayakan Natal dan Tahun Baru 2012. Bahkan untuk melihat langsung proses pengamanan ibadah masyarakat nasrani pada malam Natal, Sabtu malam, 24 Desember lalu, Plt Gubsu H Gatot Pujo Nugroho, ST bersama Kapolda Irjen Pol Drs Wisjnu Amat Sastro, Pangdam I BB Mayjen TNI Lodewijk F Paulus, mengunjungi sejumlah gereja di Medan. Gereja pertama yang dikunjungi Plt Gubsu dan sejumlah pejabat Sumut itu adalah Gereja GKPI di Jalan Sriwijaya. Setelah itu rombongan Plt Gubsu meninjau Gereja HKBP di Jalan Uskup Agung, GKPS di Jalan Cik DiTiro, GBIP di Jalan Diponegoro dan GKI di Jalan Zainul Arifin. Dalam kunjungan tersebut Plt Gubsu menyempatkan diri berdialog dengan sejumlah jemaat gereja. Ketika berbicara di depan jemaat GKI Jalan Zainul Arifin, Plt Gubsu mengimbau agar momentum Natal dijadikan sebagai awal perubahan menujuke arah yang lebih baik. Untuk mendukung kenyamanan warga melakukan perjalanan ke luar kota lewat jalur darat misalnya, Pemprov Sumut dalam hal ini Dinas Bina Marga menyiapkan 13 Posko di beberapa titik yang dianggap rawan. Posko ini dilengkapi alat berat untuk mengantisipasi berbagai kemungkinan yang terjadi di daerah rawan longsor. Ketersediaan Sembako dalam kategori cukup, harga relatif stabil dan pendistribusian lancar untuk dua bulan ke depan. Ketersediaan Sembako delapan bulan ke depan telah tercapai, operasi pasar terus dilakukan dan penyaluran raskin (beras miskin) telah mencapai target 99,57 %. Cadangan Pembangkit mencapai 50 Megawatt dinilai cukup untuk menerangi150.000 rumah. Pertamina telah membentuk Satgas dan Posko pemantauan distribusi BBM, pengaturan jadwal operator terkait pelayanan BBM di SPBU. Permintaan SPBU akan terus dilayani dan dapat dilakukan dengan mekanisme “pakai dulu”. Ini untuk menghindari terjadi kelangkaan BBM. Secara umum masalah keamanan dan ketertiban di Sumut cukup kondusif. Dalam Operasi Lilin yang dilaksanakan Polda, 929 lokasi Gereja dan 74 lokasi untuk perayaan tahun baru 2012 menjadi prioritas diawasi. Selain itu telah dibentuk 130 Pos terdiri dari 112 Pos Pengamanan dan18 Pos Pelayanan. Tidak kurang 11. 988 personil (AU, AL, Satpol PP dan Ormas kemasyarakatan dan kepemudaan) ikut ambil bagian dalam pengamanan. Keterlibatan berbagai organisasi masyarakat dan kepemudaan dalam pengamanan perayaan Natal dan Tahun Baru 2012, kata Plt Gubsu, merupakan wujud kerukunan dan keharmonisan masyarakat Sumut danmerupakan modal sosial yang sangat berharga dan perlu terus kita pelihara bersama. Tidak mengherankan bila Gatot menyatakan puas dengan kesiagaan para personil dan keterlibatan ormas dalam mengamankan jalannya ibadah Natal. “Saya melihat langsung, bagaimana elemen mahasiswa dan organisasi masyarakat yang personilnya berbeda agama, tapi ikut mengamankan saudara-saudara mereka yang beragama nasrani menjalankan ibadah pada malam Natal,” kata Gatot. Semoga suasana kondusif Sumut ini terus tetap terjaga. Sehingga masyarakat nyaman melakukan aktivitas, termasuk menjalankan ibadah sesuai dengan agama dan kepercayaan masing-masing.

Bersama Mengurangi Emisi Gas Rumah Kaca KETUA Tim Pembina PKK Provsu Hj Sutias Handayani Gatot Pujo Nugroho akhir bulan lalu, menjadi salah seorang delegasi resmi Pemerintah RI bersama Kepala Badan Lingkungan Hidup Dr Hidayati, menghadiri Conference of the Parties (COP) 17 to the United Nations Framework Convention on Climate Change (UNFCCC) di Durbin, Afrika Selatan. Konfrensi di antaranya membahas komitmen periode II Protokol Kyoto sebagai tanggung jawab negara mengurangi emisi gas rumah kaca untuk penanggulangan perubahan iklim. Kehadiran delegasi asal Sumut ini menghasilkan banyak manfaat, di antaranya pembelajaran pengayaan informasi tentang pengelolaan lingkungan hidup dibanyak negara melalui pameran yg digelar. Di samping itu, delegasi Sumut juga berkesempatan berdialog langsung dengan para pakar, praktisi dan pembuat kebijakan terkait pengurangan emisi Gas Rumah Kacar (GRK). Sumatera Utara ternyata memiliki peranan dan aktif dalam upaya pengurangan emisi gas rumah kaca sebagai upaya penanggulangan perubahan iklim yang tertuang dalam Protokol Kyoto tersebut. Untuk mendukung target Pemerintah Indonesia mengurangi 26% emisi GRK sebagaimana janji Presiden RI pada Conference of ther Parties (COP) ke 16 United Nations Framework Convention on Climate Change (UNFCCC) di Copenhagen, Sumut melakukan berbagai program. Di antaranya, inventory GRK di sektor sampah kerjasama dengan JICA, meminimalisir pencemaran dari pabrik kelapa sawit dalam proyek Cleaner Production bantuan Menteri Lingkungan Hidup Jepang, aktif melakukan monitoring pabrik-pabrik untuk penuhi baku mutu, sosialisasi kebijakan dan undang-undang tertkait lingkungan hidup dan penerbitan Perda Pengendalian Pencemaran Udara. Kepala Badan Lingkungan Hidup Provsu, DR Hidayati


Para wanita petugas kebersihan lingkungan di Afrika Selatan merangkul dan berfoto bersama Ketua TP PKK Provsu Hj Sutias Handayani (tengah) di dampingi Kepala Badan Lingkungan Hidup Provsu, Dr Hidayati saat berada di Durbin, Afrika Selatan saat menghadiri Conference of the Parties (COP) 17 to the United Nations Framework Convention on Climate Change (UNFCCC). menjelaskan pihaknya pada tahun 2012 ini, akan melakukan

kajian Baseline Potensi CO2 di Sumut secara global di antara-

ra bermitra dengan PT Patra Niaga yang merupakan member of Pertamina. Walau usia kemitraan yang dibina terbilang

muda, di tahun 2012 PT Cahaya Andhika Tamara dipercayakan handling pengisian BBM kereta api se-Sumatera dan Jawa. “PT

nya dari sektor kehutanan, transportasi, energi listrik dan

domestik. Dengan adanya baseline tersebut, maka dapat di-


AKTIVIS LINGKUNGAN: Aktivis lingkungan di Afrika Selatan yang tergabung dalam Organisasi Pemerhati Pelayaraan Internasional mengkampanyekan perilaku ramah lingkungan dengan membagikan brosur kepada Hj Sutias Handayani Gatot Pujo Nugroho didampingi Dr Hidayati, beberapa waktu lalu di Durbin, Afrika Selatan dalam rangka menghadiri dewan nasional perubahan iklim antar negara.

CAT Handling Pengisian BBM Kereta Api MEDAN ( Waspada): Di ujung tahun 2011, PT Cahaya Andhika Tamara (CAT) melaksanakan pemasaran perdana bahan bakar minyak (BBM) solar dan mfo untuk industri dan pertambangan sebanyak 180.000 liter di wilayah Sumatera Utara. Acara pelepasan armada tanki BBM perdana dilaksanakan, Selasa (27/12), di pelataran parkir kantor PT Cahaya Andhika Tamara Jalan Setia Budi Medan dihadiri komisaris, direksi dan karyawan/ti PT Cahaya Andhika Tamara Group serta mitra kerja. “Kami targetkan untuk tahun 2012, PT Cahaya Andhika Tamara akan menyalurkan 500.000 liter BBM solar dan mfo per bulan pada semester I, target akan ditingkatkan menjadi 1.000.000 liter per bulan pada semester II, target itu khusus untuk wilayah Sumut,” kata Presiden Direktur PT Cahaya Andhika Tamara Group Drs Hendrik Sitompul, MM di sela-sela acara itu. Menurut Hendrik, pemasaran BBM solar dan mfo di wilayah Sumut ini, akan dioperasikan dengan 25 armada. “Jumlah armada itu akan bertambah sesuai dengan kebutuhan,” kata Hendrik. Dalam menjalankan bisnisnya, PT Cahaya Andhika Tama-


Cahaya Andhika Tamara sudah melakukan langkah untuk proyek tersebut, ini tinggal masalah waktu,” tambah Hendrik.


PRESIDEN Direktur PT Cahaya Andhika Tamara (CAT) Drs Hendrik Sitompul, MM saat melepas pemasaran perdana BBM jenis solar dan mfo, Selasa (27/12)

Hendrik yang juga Sekretaris Biro Ekonomi Makro & Keuangan Dewan Pimpinan Pusat (DPP) Partai Demokrat (PD), juga mengakui kalau Sumut memiliki potensi besar untuk pemasaran BBM. “Sumut ini kita jadikan pasar baru untuk pemasaran BBM jenis solar dan mfo,” kata Hendrik optimis. PT Cahaya Andhika Tamara group yang baru 2 (dua) tahun menggeluti bisnis pemasaran dan handling pengisian BBM, sudah memiliki kantor di sejumlah daerah di Indonesia di antaranya Sumatera di Kota Medan, Palembang dan Lampung. Jawa Barat di Bandung dan Tasikmalaya. Jawa Tengah di Maos dan Tegal. Juga di Balikpapan, Samarinda, Manado, Banjarmasin dan Pontianak. “Sebelum di Sumut, di daerah lain sudah kita salurkan BBM ke sejumlah perusahaan industri dan per-tambangan, tahun depan PT Cahaya Andhika Tamara optimis akan menambah daerah pemasaran ke wilayah Indonesia Timur,” tegas Hendrik. Selain jeli melihat pasar sasaran, motivasi lain datang ke Sumut tentu untuk membangun dan memberi peluang kepada putra-putri di kampung halaman Sumatera Utara. “Walau kesibukan bisnis dan penyaluran BBM lebih banyak di luar Sumut, namun saya ingin membuka peluang bisnis dan lapangan pekerjaan di Sumut, artinya saya tidak lupa kampung halaman walau aktivitas bisnis dan organisasi lebih banyak di luar Sumut,” tambah Hendrik. Melalui PT Cahaya Andhika Tamara Group, yang berkantor pusat di Jakarta dengan jumlah karyawan 600 orang lebih, Hendrik Sitompul juga menjalankan bisnis advertising. Bahkan, bisnis advertising berhasil bersaing di Jakarta dan mendapat kontrak kerja khusus iklan PTTelkom Tbk khusus di areal Bandara Soekarno Hatta Cengkareng. Sementara untuk menjalankan bisnis cargo eksport/import. pengusaha muda Drs Hendrik Sitompul, MM menggunakan PT Geo Dermaga Mandiri. Walau masih bergerak di luar Sumut, Hendrik tetap optimis akan mengembangkan sayap ke Sumut. “Kita berharap potensi bisnis di Sumut menjadi primadona di luar pulau Jawa,” harap Hendrik. (m08 )


DIRJEN KEMENTERIAN: Dr Hidayati dan Hj Sutias Handayani Gatot Pujo Nugroho bersama Dirjen Kementrian Perhubungan RI, membahas polusi udara yang dikeluarkan kenderaan, saat berada di Stand Indonesia yang berada di Durbin, Afrika Selatan dalam rangka menghadiri dewan nasional perubahan iklim antar Negara.

ketahui posisi kondisi GRK di Sumut, sehingga jumlah penurunan GRK dapat diketahui sebagai kontribusi daerah ini menurunkan 26 persen GRK nasional. Kabar yang menggembirakan adalah, Sumut juga mendapat dukungan lembaga internasional asal Jerman untuk pembangunan yang berkelanjutan, GIZ yang berkomitmen memberikan dana hibah untuk inventory GRK pada sektor transportasi. Sumut secara nasional cukup diperhitungkan, karena menjadi penghasil gas polutan jenis methan terbesar di Pulau Sumatera yang dihasilkan kendaraan bermotor. Perlu disyukuri bahwa Pemrov Sumut cukup peduli dalam pengendalian perubahan iklim. Dalam sebuah wawancara belum lama ini, DR Hidayati mengungkapkan Sumut ternyata satu-satunya provinsi di tanah air yang telah menerbitkan Perda Pengendalian Pencemaran Udara dan membentuk Dewan Perubahan Iklim. Di sela-sela konfrensi, Hj Sutias Handayani, DR Hidayati dan Kementerian Perhubungan membicarakan tentang kontribusi Gas rumah Kaca dalam sektor transportasi yang tertuang dalam Perda Pengendalian Pencemaran Udara Provsu. Hasilnya, sosialisasi Perda nantinya akan melibatkan PKK, sehingga diharapkan melalui kader-kadernya informasi dapat disampaikan hingga ke level rumah tanggga. “Ibu gubernur setuju melibatkan PKK dalam sosialisasi perda nanti, melalui kader yang menjangkau hingga level rumah tangga, kita yakin penyampaian informasi lebih efektif,” jelas Hidayati. Inisiatif Sumut dalam upaya penurunan Gas Rumah Kaca ini mendapat apresiasi dari Kementerian Perhubungan sehingga mendaulat Kepala Badan Lingkungan Hidup, DR Hidayati menjadi salah satu narasumber Pada Rakernas di Jakarta 22 Desember silam. (m28)


Medan Metropolitan

WASPADA Rabu 28 Desember 2011

Umat Islam Diimbau Tidak Ikut Zikir Malam Tahun Baru MEDAN (Waspada): Ketua Forum Umat Islam Sumatera Utara Al-Ustad Indra Suheri, Selasa (27/12), mengimbau umat Islam untuk tidak mengikuti kegiatan malam zikir dilaksanakan tepat malam pergantian tahun 2012. Menurut Suheri, umat Islam sudah mempunyai kalender Hijriyah yang sudah ditetapkan oleh Khulafaurrasidin sebagai kalender penanggalan Islam. Karena itu tidak disyaratkan lagi untuk mengikuti kalender tahun Masehi. “FUI menghimbau umat Islam agar tidak ikut serta melaksanakan kegiatan keagamaan pada malam pergantian tahun baru Masehi. Sebab, tahun itu mempunyai hubungan yang erat dengan nilai-nilai historis pada agama Nasrani. Allah SWT telah mengingatkan umat Islam bahwa bagiku agamaku dan bagimu agamamu. Maka jalankan agama kita biarkan orang lain menjalankan agamanya,” katanya. Dia berharap agar upaya untuk membangkitkan semangat dan kemauan umat Islam untuk mencintai dan mengutamakan adanya kalender Tahun Hijriyah, jangan sampai terkikis dengan keasyikan atau menggemakan kemeriahan Tahun Baru Masehi, karena upaya untuk menggalakkan Tahun Baru Hijriyah sudah

dimulai kembali dengan berbagai kegiatan bahkan pengadaan kalender Hijriyah. Kata Suheri, meski penetapan hukum dalam mengikuti kegiatan seperti ini berada di tangan MUI sebagai lembaga pemutus fatwa, namun secara individu perlu ditekankan kepada masyarakat ataupun generasi muda Islam bahwa menghindarkan diri untuk tidak hadir pada kegiatan itu salah satu upaya penyelamatan aqidah. “Ini menyangkut aqidah, sebaiknya kita hindari,” ujarnya. Sementara itu, Al Ustadz Azhar Sitompul menyebutkan, pelaksanaan zikir itu tergantung kepada niat seseorang. “Tergantung niatnya, tapi secara umum tidak ada masalah, sebab melaksanakan zikir boleh kapan saja,” katanya. Hal yang sama disampaikan Al-Ustad Nizar Syarif yang menyebutkan, setuju dengan kegiatan itu dalam rangka mengalihkan perhatian umat Islam untuk tidak terlibat dengan kegiatan hura-hura. “Banyak yang memanfaatkan malam itu dengan kegiatan mubazir, utamanya anak muda yang begadang sampai pagi, jika dimanfaatkan untuk kebaikan tentu tidak ada masalah bahkan lebih baik daripada melakukan hal yang merusak diri sendiri,” sebutnya. (m37)

DPRD Tidak Serius Tuntaskan Masalah Harapan Square

Warga Dan Pedagang Ancam Bertindak Anarkis MEDAN (Waspada): Puluhan orang yang tergabung dalam Pedagang Warkop Medan (PWM) dan warga Jln. Samanhudi menyayangkan sikap anggota DPRD yang terkesan tidak serius menuntaskan kasus Harapan Square. Buktinya, rencana pertemuan antara warga, pedagang, Pemko dan DPRD yang dijadwalkan Selasa (27/12), terpaksa dibatalkan. Sebab, tidak ada anggota dewan baik dari Komisi C maupun Komisi D yang hadir untuk membahas masalah Harapan Square.

Sebelumnya, pihak DPRD meminta agar Pemko Medan menghentikan (stanvas) pembangunan Harapan Square. Kenyataannya, pembangunan pusat jajanan tersebut terus berlanjut. Akibatnya, sejumlah warga dan pedagang mengancam akan melakukan tindakan anarkis. “Dalam hal ini kita terus menghadiri setiap undangan yang dilayangkan anggota dewan. Bahkan, kita terus mengikuti setiap perkembangannya. Namun hingga sekarang tidak ada keputusan yang dikeluarkan anggota dewan,” ujar Lintong diwakili Fredy, warga Jln. Samanhudi di Gedung DPRD Medan ketika menunggu dilaksanakannyapertemuanmembahas Harapan Square, Selasa (27/12).

Padahal, lanjutnya, warga Jln. Samanhudi dan sejumlah pedagang warkop sudah berada di gedungDPRDMedansejakpukul 10:30 hingga pukul 14:30. Mereka menanti keputusan yang dikeluarkan DPRD Medan tersebut. “Namun yang terjadi, kita melihat di gedung tersebut tidak ada anggota dewan dari komisi C dan Komisi D yang datang. Akibatnya, rapat untuk membahas masalah Harapan Square tidak bisa dilaksanakan,” ujarnya. Jika hal ini dibiarkan berlarut-larut, akan menimbulkan preseden buruk terhadap anggota legislatif yang selama ini menjadi wakil rakyat. Sebaliknya, anggota DPRD Medan terkesan lepas tangan dan tidak berpihak kepada rakyat. Sementara itu, Ketua Peda-

gang Warkop Medan Dohot Simanjuntak menegaskan, jika anggota dewan tidak segera menuntaskan kasus Harapan Square tersebut, maka secara otomatis warga dan pedagang akan melakukan tindakan anarkis dengan membongkar bangunan stan Harapan Square. “Jikaterjadibentrokantarwarga, maka hal ini merupakan kesalahan anggota dewan kare-na tidak serius menanggapi keluhan warga dan pedagang,” ujarnya. Bayangkan, lanjut Simanjuntak, sekitar 40 orang terdiri dari warga Jln. Samanhudi dan Pedagang Warkop Medan telah meluangkan waktu ke gedung DPRD Medan hanya untuk menunggu keputusan tentang Harapan Square, ternyata tidak ada satupun anggota Komisi C

dan Komisi D yang hadir. “Kita mendengar pada Selasa (27/12) akan ada rapat di DPRD Medan untuk memutuskan masalah Harapan Square. Namun setelah kita datang, ternyata tidak ada satu pun anggota dewan yang hadir,” ujarnya. Parahnya lagi, lanjut Simanjuntak, Pemko Medan tidak menghormati anggota dewan yang meminta pembangunan Harapan Square dihentikan sementara sambil menunggu keputusan. “Melihat sikap anggota dewan yang tidak serius, maka kami akan memasang spanduk penolakan terhadap Harapan Square. Jika tidak dihiraukan juga, maka kami akan melakukan pembongkaran terhadap stan HarapanSquare,”tegasnya.(m38)

40 Persen PNS Badan PP Dan KB Absen BKD: Terancam Sanksi Penundaan Kenaikan Gaji MEDAN (Waspada): Sekitar 40 persen Pegawai Negeri Sipil (PNS) di jajaran Badan PP dan KB Kota Medan tidak masuk kerja tanpa keterangan (absen). Berdasarkan temuan tersebut, Badan Kepegawaian Daerah (BKD) Kota Medan akan memberikan sanksi berupa teguran dan penundaan kenaikan gaji berkala. “Ada tujuh tim yang kita sebar melakukan pengawasan terhadap disiplin PNS di masingmasing SKPD. Kita menemukan 40 persen pegawai di Badan PP dan KB Medan tidak hadir tanpa keterangan,” kata Kepala BKD Kota Medan Parluhutan Hasibuan kepada wartawan, Selasa (27/12). Dari seluruh jajaran SKPD Pemko Medan yang diawasi,

lanjut Parluhutan, Badan PP dan KB merupakan SKPD yang paling rendah tingkat kehadiran pegawainya yakni 60 persen. Sedangkan 40 persen tidak hadir tanpa keterangan. “Pegawai ini terlena dengan waktu libur panjang Natal sejak Sabtu (24/12) dan Senin (26/12). Jadi, kita langsung melakukan pengawasan disiplin pegawai setelah masuk kerja di hari pertama ini, Selasa (27/12). Kita mencatat jumlah pegawai di Badan PP dan KB sebanyak 66 orang dan hanya 60 persen yang hadir,” ujarnya. Dari hasil pengawasan keseluruhan, tercatat tingkat kehadiran mencapai 92,31 persen. Jumlah itu dinilai sudah cukup besar, walau masih ditemukan PNS tidak masuk kerja tanpa

keterangan. “Secara keseluruhan tingkat kehadiran pegawai sebesar 92,31 persen dari jumlah PNS Pemko Medan sekitar 8000-an pegawai. Namun, dari jumlah 8.000 pegawai itu, sedikitnya 1.000 pegawai merupakan guru di sekolah-sekolah negeri. Guru memang sedang libur sekolah. Jadi, pegawai pemerintahannya sekitar 92,31 persen dari 7000-an pegawai non guru yang hadir,” jelasnya. Sebagai tindak lanjut dari temuan tersebut, BKD Medan akan menyurati seluruh pimpinan SKPD bersangkutan. Dalam surat tersebut, BKD meminta pada pimpinan SKPD masing-masing untuk memberikan sanksi pada pegawainya yang tidak hadir. “Kita serahkan dulu masa-

lah ini kepada pimpinan SKPD. Biar pimpinan SKPD yang memberikan sanksi kepada pegawainya baik teguran atau sanksi lain. Namun, BKD Medan juga akan melakukan pemeriksaan terhadap database PNS. Mungkin saja, ada pegawai yang berulangkali absen,” ujarnya. Sebelumnya, ada tujuh tim yang melakukan pengawasan terhadap disiplin pegawai terdiri dari Tim I dipimpin Kepala BKD Medan Parluhutan Hasibuan, Tim II dipimpin Asisten Kesos Mussadad, Tim III dipimpin Asisten Umum Cheko Wakhda Ritonga, Tim IV dipimpin Kaban Pemberdayaan Masyarakat Damikrot Harahap, Tim V dipimpin Asisten Pemerintahan Daudta P Sinurat, TimVI dipimpin Kabalitbang Medan Lahum

dan Tim VII dipimpin Kepala Inspektorat Medan FaridWajedi. Tujuh tim tersebut melakukan pengawasan di Dinas TRTB Medan, Dinas Pendapatan Daerah (Dispenda) Medan, Dinas Bina Marga, Dinas Pertamanan, Dinas Koperasi dan UKM dan Dinas Perkim. Hasilnya, jajaran SKPD tersebut memiliki tingkat kehadiran yang tinggi dibanding Badan PP dan KB Kota Medan. Sekretaris Daerah (Sekda) Kota Medan Ir Syaiful Bahri Lubis menegaskan dari tujuh tim yang melakukan pengawasan itu akan langsung diputuskan sanksi kepada pegawai yang tidak hadir. Selain itu, sanksi juga diserahkan kepada pimpinan SKPD masing-masing agar dilakukan pembinaan terhadap pegawai di jajarannya. (m50)

Dispenda Optimalisasi Sadar Pajak Melalui Penyuluhan MEDAN (Waspada): Dinas Pendapatan Provinsi Sumut mengoptimalisasikan kesadaran pajak di kalangan masyarakat melalui penyuluhan. Dengan ini diprediksi sadar pajak akan semakin baik yang bermuara kepada optimalisasi pendapatan Provinsi Sumut. Kepala Dinas Pendapatan Provinsi Sumut H Sjafaruddin

SH, MM menjawab wartawan, Sabtu (24/12) mengatakan, sistem dan metoda penyuluhan tersebut akan terus dilakukan sehingga sadar pajak akan tumbuh secara konkrit dan riel. Penyuluhan pajak provinsi, menurut Sjafaruddin, bernilai strategis dan optimistis. Penyuluhan dimaksud adalah aktivitas atau proses mensosialisasikan

segala kebijakan pemerintah provinsi di bidang pajak provinsi, guna mendorong peningkatan kesadaran masyarakat (wajib pajak) akan hak dan tanggungjawabnya dalam proses pembangunan di Sumatera Utara. Dia mengakui banyak sistem atau metoda untuk meningkatkan sadar pajak, namun

Waspada/Amir Syarifuddin

KEPALA Dinas Pendapatan Sumut H Sjafaruddin melakukan inspeksi mendadak (Sidak) ke sejumlah Kantor Samsat di Medan.

pihaknya telah melakukan beberapa metode penyuluhan yakni metode langsung (direct communication/ face to face communication). Metode langsung ini dilakukan dengan cara tatap muka langsung dengan wajib pajak, baik secara perorangan maupun kelompok. Selanjutnya metode tidak langsung (indirect communication) yang dilakukan melalui perantaraan media cetak maupun elektronika termasuk melalui brosur, leaflet, spanduk, stiker, baliho, dan sejenisnya. Materi penyuluhan yang disampaikan, lanjutnya, yakni secara langsung meliputi Undang Undang Nomor 28 Tahun 2009 tentang Pajak Daerah dan Retribusi Daerah. Juga Undang Undang Nomor 22 Tahun 2009 tentang Lalu Lintas dan Angkutan Jalan. Materi tersebut juga meliputi Peraturan Daerah Provinsi Sumut Nomor 1 Tahun 2011 tentang Pajak Daerah Provinsi Sumatera Utara, Peraturan Menteri Keuangan Nomor 36/ PMK 010/2008 tentang Besar Santunan dan Sumbangan Wajib Dana Kecelakaan Lalu Lintas Jalan serta Peraturan Menteri Keuangan Nomor 37/PMK 010/ 2008 tentang Besar Santunan dan Iuran Wajib Dana Pertanggungan Wajib Kecelakaan Penumpang Alat Angkutan Penumpang Umum di Darat, Sungai/Danau, Ferry/Penyeberangan Laut dan Udara. Dekatkan pelayanan Sjafaruddin juga mengemukakan seluruh unit jaringan Unit Pelaksana Teknis (UPT) Dinas Pendapatan Provinsi Sumut (Dispendasu) yang tersebar di

seluruh kabupaten dan kota seSumut, dikenal sebagai Kantor Samsat termasuk jejaring Samsat Corner, Samsat Gerai, Samsat Drive Thrue, Bus Samsat Keliling (Samkel) dan Samkel Drive Thrue, terus komit mendekatkan pelayanan kepada masyarakat wajib pajak. Sjafaruddin pada setiap sidak berdialog langsung dengan masyarakat yang menyatakan penyebaran kantor Samsat termasuk layanan corner, gerak, dan drive thrue, dirasakan sangat membantu masyarakat karena semuanya lebih dekat dengan tempat tinggal mereka, pelayanan cepat hanya hitungan menit dan tidak ada biaya tambahan (pungli) maupun calo. “Sangat senang lho. Kita tidak perlu lagi repot-repot harus ke Kantor Samsat Medan Utara untuk bayar pajak kendaraan, cukup di Marelan ini saja. Urusannya gampang, cepat dan tidak ada pungli,” ujar Yu Yen Ti, wajib pajak di Samsat Gerai Marelan Medan, yang menempati ruko di bawah kendali Samsat Medan Utara yang dipimpin H Bahar Siagian MSi. Wajib pajak lainnya diantaranya Nurmalasari, Fitrie, Iyan dan Haris mengemukakan Samsat Gerai sangat efektif yang diibaratkan gedungnya kecil namun manfaatnya besar dan nyaman. Mereka menyarankan layanan seperti Samsat Corner yang ada di Sun Plaza maupun Plaza Medan Fair serta Samsat Gerai dan Drive Thrue yang ada di Jalan Imam Bonjol maupun Bus Samsat Keliling, perlu ditambah di beberapa lokasi strategis misalnya di Belawan dan kawasan Tembung.(m28)

Waspada/Ismanto Ismail

KAPOLSEK Medan Baru AKP Dony Alexander SH, SIK, M.Hum mengatur arus lalulintas dan dua mahasiswa melakukan teaterikal di bundaran Majestik Jln. Gatot Subroto Medan, Selasa (27/12).

Dua Gelombang Unjuk Rasa Di Bundaran Majestik

MEDAN (Waspada): Dua gelombang unjuk rasa terjadi di Bundaran Majestik Jln. Gatot Subroto Medan, Selasa (27/12). Unjuk rasa digelar Forum Mahasiswa Anti Penindasan (Formadas) Medan dan disusul Serikat Mahasiswa Indonesia (SMI). Pantauan Waspada di lapangan, massa Formades dalam melakukan aksi membentang beberapa spanduk dan poster bertuliskan antara lain, hentikan & usut tuntas segala bentuk tindak kekerasan oleh TNI-Polri terhadap rakyat, usut tuntas penembakan & pembantaian yang terjadi di Mesuji (Lampung). Selain itu melakukan teaterikal dan orasi. Dalam orasinya mereka menyebutkan, keterpurukan yang terjadi di tengah-tengah bangsa bisa dilihat dari susahnya untuk mendapat pekerjaan, mahalnya harga kebutuhan pokok, biaya pendidikan, banyaknya perampasan tanah petani, murahnya upah buruh. Hal tersebut merupakan beberapa contoh ketidak mampuan pemimpin ataupun pemerintah untuk menyelesaikannya. Pengunjuk rasa juga menyatakan penyataan sikapnya di antaranya, mengusut tuntas penembakan sehingga menelan korban jiwa oleh pihak kepolisian di Bina Nusa Tenggara Barat, usut tuntas penembakan dan pembantaian yang terjadi Mesuji Lampung, hentikan segala bentuk kekerasan yang terjadi terhadap rakyat (buruh, petani, mahasiswa, KMK), kembalikan tanah rakyat yang dirampas pengusaha, dan negara harus bertanggungjawab

atas tindak kekerasan yang dilakukan oleh TNI/ Polri. Usai melakukan orasi, para pengunjuk rasa membakar dua ban bekas di badan jalan tersebut, namun pihak kepolisian segera memadamkannya. Setelah pengunjuk rasa dari Formadas Medan membubarkan diri, tak berselang lama datang lagi gelombang unjuk rasa yang dilakukan Serikat Mahasiswa Indonesia (SMI) di lokasi bundaran Majestik tersebut. Pengunjuk rasa SMI dengan tertib membentang spanduk dan poster, serta melakukan orasi. Dalam orasinya mereka mengatakan, krisis kapitalisme di negara-negara benua Eropa dan Amerika dengan menemukan berbagai cara dalam penyelamatannya. Salah satu penyelamatan kapitalisme yang menciptakan regulasi-regulasi di negara berkembang (Indonesia) melalui legalisasi rezim berkuasa SBY-Budiono yang tunduk terhadap kepentingan modal sehingga yang menjadi korbannya adalah rakyat (petani) yang tanahnya dirampas, ketika UU pegadaan tanah diterapkan. Represifitas aparat terhadap rakyat yang terjadi di Bima (NTB) adalah bentuk arogansi negara kepada rakyatnya, dan tidakpedulian rezim SBY-Budiono pada kesejahteraan rakyat. Mereka menyerukan menolak perusahaan-perusahaan tambang yang anti rakyat di seluruh Indonesia, cabut UU pengadaan tanah, batalkan SK Bupati Bima No. 188.45/357/004/2010, copot seluruh jajaran aparatur negara terutama Kapolri dan Kapolda NTB yang bertanggungjawab atas kasus sape Bima. (m36)

Bangunan Ruko Roboh Timpa 5 Sepedamotor MEDAN (Waspada): Satu bangunan rumah toko (ruko) berlantai III roboh menimpa 5 unit sepedamotor dan kanopi milik Apotik Bintang Surya di Jalan AR Hakim, Kelurahan Te-gal Sari I, Kecamatan Medan Area, Selasa (27/12) sekira pukul 16:45. Tidak ada korban jiwa, namun kerugian diperkirakan mencapai Rp100 juta. Informasi yang diperoleh di lokasi kejadian, robohnya bangunan yang sedang direnovasi itu diduga karena tidak kuatnya fondasi bangunan di bagian atas, tepatnya di lantai II dan III, apalagi saat itu bangunan dalam kondisi basah karena diguyur hujan deras. Meski hujan deras, sejumlah buruh tetap bekerja sebagaimana biasanya. Tiba-tiba saja, bagian depan dinding bangunan roboh dan menimpa kanopi yang persis berada di samping bangunan ruko tersebut. Akibatnya, selain menimpa kanopi, reruntuhan bangunan juga menimpa 5 unit sepedamotor yang berada di depan apotik tersebut. Kelima sepedamotor yang tertimpa bangunan roboh itu masingmasing BK 2194 II, BK 5494 AAG, BK 6155 FG, BK 3679 ABY, dan Revo BK 4451 ABQ. Pemilik apotik bernama A Ling mengatakan, robohnya bangunan tersebut memang tak diduga, namun pihaknya akan tetap meminta pertanggungjawaban dari pemborong bangunan bernama A Kiet. “Kano-

pi saya hancur dan lima sepeda-motor yang berada di depan apotik saya turut mengalami kerusakan. Aku rugi Rp100 juta lho,” ujarnya. Sementara itu, Kanit Reskrim Polsek Medan Area AKP J Banjarnahor yang dikonfirmasi di TKP menyebutkan, pihaknya telah memboyong lima buruh bangunan yang sedang bekerja saat kejadian itu. Pemborong bangunan belum ditemukan karena tidak berada di lokasi bangunan saat peristiwa terjadi. “Pemborong bangunan bernama A Kiet akan segera dicari untuk meminta pertanggungjawabannya, sedangkan lima buruh bangunan masih dimintai keterangannya,” sebutnya. Menurut Banjarnahor, robohnya bangunan diduga kon-struksi bangunan tidak sesuai dengan bestek, apalagi ada beberapa bagian bangunan yang sedang direnovasi itu tidak dirobohkan, artinya beberapa fondasi lama tidak bongkar dan tetap digunakan. A Lung, seorang warga mengatakan, saat bangunan roboh memang sedang sepi dari lalulalang warga karena hujan turun deras. “Biasanya, pengunjung apotik cukup banyak. Untung saja, hari sedang hujan dan pengunjung apotik sepi,” katanya. Robohnya bangunan depan ruko tersebut membuat arus lalulintas sempat macat karena sejumlah warga dan pengendara sepedamotor berhenti untuk melihat peristiwa itu. (h04)

PWI Pusat Uji Kompetensi Anggota Di Sumut MEDAN (Waspada): Pengurus Persatuan Wartawan Indonesia (PWI) Pusat melakukan uji kompetensi wartawan (UKW) terhadap 42 anggota PWI Sumut di Hotel Garuda Plaza Medan, Selasa (27/12). Acara ini berlangsung hingga Rabu (28/12). Ketua PWI Cabang Sumut Drs. Muhammad Syahrir didampingi Sekretaris Edward Thahir, S.Sos dan unsur pengurus lainnya selaku panitia lokal di Gedung PWI Sumut, menjelaskan, UKW yang dilaksanakan PWI Pusat ini merupakan pertama kali di Sumut. Dari 42 peserta yang tersaring sebagai angkatan pertama, kata Syahrir, terdiri dari tiga tingkatan yakni Muda, Madya, dan Utama. Tingkat Muda untuk reporter diikuti 18 orang, Madya untuk Asisten Redaktur/Redaktur Pelaksana 14 orang, dan Utama untuk Redaktur Eksekutif/Wakil Pemimpin Redaksi/Pemimpin Redaksi sebanyak 10 orang. UKW bagi anggota PWI ini, lanjut Syahrir, merupakan tindaklanjut dari ditetapkannya PWI sebagai Lembaga Penguji Standar Kompetensi Wartawan (SKW) berdasarkan SK Dewan Pers No.14/SK-DP/VII/2011 tanggal 25 Juli 2011. “ UKW ini menjadi alat ukur apakah seorang wartawan itu kompeten atau tidak sebagaimana digariskan dalam Peraturan Dewan Pers Nomor 1 tanggal 2 Februari 2010 tentang SKW,” tegasnya.

Ujian Anggota Muda Sementara itu, Sekretaris PWI Sumut Edward Thahir, S.Sos menjelaskan, pada Kamis (29/12), mulai pukul 08:30 di Ruang Cenderawasih Hotel Garuda Plaza Medan, PWI Sumut juga melaksanakan Pembekalan dan Ujian Seleksi Calon Anggota Muda untuk gelombang kedua tahun 2011. Tampil sebagai narasumber pada pembekalan yang diikuti sekitar 50 peserta ini Direktur Utama PDAM Tirtanadi Provinsi Sumatera Utara Ir. Azzam Rizal, M.Eng dengan topik “Kiprah PDAM Tirtanadi Dan Tantangan Ke Depan”. Sedangkan narasumber lainnya dari unsur Pengurus PWI Cabang Sumut. Agenda yang juga sudah terjadwal dan harus dilaksanakan, kata Edward Thahir, turnamen futsal memperebutkan Piala Ketua PWI Sumut yang dibuka pada 30 Desember 2011 di Kisaran, Kabupaten Asahan. “Turnamen yang digelar PWI Perwakilan Asahan ini merupakan pelaksanaan turnamen futsal tahun ke-2 setelah yang pertama digelar Agustus 2010,” jelasnya. Sebelumnya, di penghujung tahun 2011 ini, PWI Sumut bekerjasama dengan Fakultas Ilmu Budaya (FIB)UniversitasSumateraUtara(USU)melaksanakan diskusi jurnalistik dengan topik ”Membedah Ragam Bahasa Pers Dari Sudut Pandang Kaidah Bahasa Indonesia dan Media”. Diskusi yang diikuti 160 lebih peserta terdiri dari dosen, guru, wartawan dan mahasiswaitudigelardiruangserbagunaProf.T.Amin Ridwan, FIB USU, Kamis (22/12).(m08)

WASPADA Rabu 28 Desember 2011

Medan Metropolitan


Akhir Tahun Banyak Warga Medan Ke LN MEDAN (Waspada): Arus penumpang dari Medan tujuan luar negeri seperti Kuala Lumpur, Penang,danSingapuramulaibergerak.Akhirtahun banyak warga Medan berlibur ke luar negeri (LN). Petugas keamanan di terminal keberangkatan luar negeri Bandara Polonia Medan Herven, Senin (26/12) mengatakan, animo masyarakat Medan dan Sumut cukup tinggi bertolak ke luar negeri menjelang Tahun Baru 2012. Dia memprediksikan, arus penumpang ke LN akan semakin meningkat dua hari kedepan karena orang-orang Medan, sudah membuat rencana akhir tahun berlibur bersama keluarga. “Pengalaman dari tahun sebelumnya, menjelang tutup tahun orang-orang Medan ramairamai melancong ke luar negeri,” ujar Herven. Hal senada juga diungkapkan staf penerbangan Air Asia Diah Handayani. Menurutnya, masyarakat Medan yang booking seat ke luar negeri semakin ramai baik tujuan Kuala Lumpur, Penang, bahkan Bangkok. “Kalau operator penerbangan lain menyatakan kurang arus

penumpang, malah Air Asia rata-rata seat pesawat jenis Airbus 320 terisi,” ujarnya. Dikatakan Diah, hingga awal Januari 2012, arus penumpang Air Asia meningkat pada rute dari Medan tujuan luar negeri. Kebanyakan warga Medan membooking seat dan membuat rencana perjalanan lebih awal. Sementara itu, Suryanto, penduduk Tanjung Morawa, menyatakan kegembiraannya dapat berlibur bersama keluarga ke Kuala Lumpur hingga awal Januari 2012. “Kami berangkat ke sana sambil chek up untuk berobat disalah satu rumah sakit di Kuala Lumpur,” ujarnya saat akData penumpang tujuan luar negeri Senin antara lain Air Asia QZ-8050 mengangkut 156 penumpang, Sriwijaya Air SJ-102 tujuan Penang 140 penumpang, Air Asia AK-1351 mengangkut 153 penumpang, Malaysia Airlines System (MAS) MH-861, 138 penumpang, Silk Air MI-233 tujuan Singapura 135 penumpang, Air Asia QZ-5076 tujuan Penang 169 penumpang dan Lion Air JT-1282 tujuan Penang 68 penumpang. (m32)

BELAWAN (Waspada): Sekolah Tinggi Teknologi (STT) Sinar Husni mewisuda 74 sarjana teknik, di Aula Kampus Sinar Husni 3 Jalan Veteran Gang Utama, Desa Helvetia, Kec. Labuhan Deli, Deliserdang, Sabtu (24/12). Wisuda angkatan ke-V sekolah tinggi itu terdiri dari 44 Sarjana Teknik Informatika, 12 Teknik Mesin dan 18 Teknik Elektro. Wilda Rina Hasibuan, ST terpilih sebagai wisudawan terbaik dengan indeks prestasi (IP) 3,70 dari jurusan Teknik Informatika. Ketua STT Sinar Husni Ir H Agus Husni MPD mengatakan, rata- rata ke-74 mahasiswa itu menimbah ilmu selama 4 tahun dengan nilai yang baik. Diharapkan seluruh wisudawan dapat melanjutkan pendidikannya ke tingkat lebih tinggi, sehingga ilmu yang diperoleh bermanfaat di masyarakat. Dijelaskannya, sesuai dengan motto “Ung-

gul, Profesional dan Terpercaya” STT Sinar Husni menekankan pengembangan sumber daya manusia (SDM) mahasiswanya untuk memiliki kekuatan etika, moral, dan spiritual, disamping kemampuan intelektual yang tangguh dan handal. Untuk mendukung hal itu, Sinar Husni konsistenmelakukanpembenahansaranadanprasarana serta kualitas dosen dengan program pendidikan bagi dosen ke jenjang strata-2 dan strata- 3.“Syukur Alhamdulillah, tahun ini dosen kita telah menyelesaikan pendidikan strata-2 sebanyak tiga orang yakni Suhendra ST.M.Kom, Zulham Sitorus ST.M.Kom, dan Rahmaniar ST,MT,” katanya. Hadir pada acara wisuda tersebut, Ketua STT Sinar Husni Ir H Agus Husni M.Pd, Ketua Yayasan Sinar Husni Drs H Arif Husni M.Pd, PembinaYayasan Sinar Husni dr H Syoufi Rizal Husni MARS, KopertisWilayah I Aceh-Sumut, orangtua wisudawan, dan undangan lainnya. (h03)

STT Sinar Husni Wisuda 74 Sarjana


KEPALA Badan Pengawas Obat dan Makanan (BPPOM) Medan Drs. Agus Prabowo didampingi sejumlah pedagang memusnahkan barang bukti berupa produk bermasalah di kantor BBPOM Jln. William Iskandar Medan, Selasa (26/12).

BBPOM Musnahkan Produk Bermasalah MEDAN (Waspada): Balai Besar Pengawas Obat dan Makanan (BBPOM) Medan memusnahkan ribuan produk bermasalah karena tidak memiliki izin edar dan mengandung bahan kimia berbahaya, Selasa (27/12). Produk senilai Rp. 448.042.000 ini, merupakan hasil razia BBPOM sepanjang 2011.

Kepala BBPOM Medan Drs. Agus Prabowo, Apt, MS mengatakan, ada empat jenis produk yang dimusnahkan yakni 3.550 obat keras senilai Rp28.167.000 dan 4.756 obat tradisional senilai

Laporkan Perusahaan Yang Tidak Bayar THR \MEDAN (Waspada): Seluruh pekerja di Medan diimbau agar melapor ke Dinas Sosial dan Tenaga Kerja Medan jika ada perusahaan yang belum membayar Tunjangan Hari Raya (THR) Keagamaan. “Dinas Sosial dan Tenaga Kerja Medan membuka posko pengaduan selama 24 jam di kantor Jln. Wahid Hasyim untuk menerima keluhan-keluhan dari pekerja yang belum menerima THR keagamaan,” kata Plt. Kepala Dinas Sosial dan Tenaga Kerja Medan Marah Husin Lubis, SH (foto) kepada Waspada, Selasa (27/12). Posko pengaduan dibuka pada Rabu (7/12), sejak surat pelaksanaan pembayaran THR keagamaan disebar ke perusahaan-perusahaan yang ada di Medan. “Saat ini kita belum menerima pengaduan dari pekerja atau buruh yang ada di Medan,” tuturnya. Tidak adanya laporan ini, karena Dinas Sosial dan Tenaga Kerja Medan sering melakukan

pembinaan terhadap perusahaan tentang hak-hak karyawan. “Kalau perusahaan sudah tahu akan hak-hak karyawannya, pasti tidak ada unjukrasa lagi. Pada tahun 2011, unjukrasa buruhdiMedanmenurundibandingtahunsebelumnya,”ujarnya. Marah Husin mengakui, banyak surat PHK yang diterima Dinas Sosial dan Tenaga Kerja, namun dapat diselesaikan. “Kita memediasi kedua pihak sehing-

ga masalah antara pekerja dan perusahaan dapat diselesaikan,” jelasnya. Mengenai ketentuan pembayaran THR keagamaan, lanjut Marah Husin, hal ini berdasarkan peraturan Menteri Tenaga Kerja RI No. Per-04/MEN/1994 tentang THR keagamaan bagi pekerja di perusahaan. “Dalam hal ini pengusaha wajib memberikan THR kepada pekerja yang telah mempunyai masa kerja tiga bulan secara terus menerus atau lebih,” terangnya. THR ini wajib dibayar pengusaha selambat-lambatnya tujuh hari sebelum hari besar keagamaan. “Bagi pengusaha yang melanggar ketentuan ini, diancam dengan hukuman sesuai dengan peraturan yang berlaku,” katanya. Namun, Marah Husin berharap seluruh perusahaan di Medan tetap menaati peraturan tersebut. “Kasihan mereka para pekerja, mereka ingin merayakanharibesarkeagamaandengan keluarganya,” ujarnya. (h02)

Gus Irawan Ajak Majelis Taklim Bersatu MEDAN (Waspada): Pembina Majelis Taklim Forum Silaturrahmi Sumatera Utara H Gus Irawan Pasaribu mengajak seluruh majelis taklim di berbagai daerah di Sumatera Utara, saling bergandengan tangan memperkokoh persatuan dan kesatuan agar menjadi sebuah kekuatan luar biasa dalam mensejahterakan umat. “Semakin banyak majelis taklim, semakin bagus saja. Mari kita bergandengan tangan untuk fastabiqul khairat, berlomba-lomba berbuat kebajikan,” ujar Gus Irawan dalam acara pengajian akbar merayakan 10 Muharram 1433 H sekaligus menyantuni yatim piatu yang diselenggarakan Forum Silaturahmi Majelis Taklim Labuhanbatu Selatan di Kotapinang, Sabtu (17/11). Pengajian akbar tersebut dihadiri ratusan kaum ibu dari berbagai majelis taklim (kelom-

pok pengajian) kaum ibu di Labuhanbatu Selatan. Hadir pada acara itu Ketua Forum SilaturahmiMajelisTaklimSumateraUtara Hj Hikmatul Fadhila SH, MM. Gus Irawan yang juga Ketua Masyarakat Ekonomi Syariah (MES) Sumatera Utara dan Direktur Utama Bank Sumut pada kesempatan tersebut menyatakan, Forum Silaturrahmi Majelis Taklim di berbagai kabupaten/ kota diharapkan tidak hanya memperluas silaturrahmi antar majelis taklim, tapi juga lebih giat menjalankan program-program nyata yang fokus pada pemberdayaan kaum duafa sehingga dapat berperan serta meningkatkan perekonomian umat. “Apa yang sudah dilakukan Forum Silaturahmi Majelis Taklim Sumatera Utara selama ini dengan menyelenggarakan kegiatan syiar Islam dan kegiatan social, sudah sangat baik dan perlu terus ditingkatkan dan di-

kembangkan ke berbagai daerah,” ujar Gus Irawan. Ketua Forum Silaturrahmi Majelis Taklim Sumatera Utara Hj Hikmatul Fadhilah mengatakan, forum majelis taklim tersebut baru-baru ini telah merangkul berbagai majelis taklim untuk bersama-sama menyelenggarakan nikah massal bagi masyarakat tidak mampu sebanyak 250 pasang di Tembung, Kabupaten Deliserdang. “Insyallah kita akan kembali menyelenggarakan nikah massal secara gratis untuk 500 pasang pada bulan Maret 2012,” sebutnya. Acara pengajian akbar tersebut selain diisi dengan ceramah oleh Ustadz Mawardi Lubis juga dimeriahkan dengan penyerahan hadiah bagi pemenang lomba marhaban dan pemenang lomba memandikan mayit, sekaligus memberikan santunan kepada 127 anak yatim piatu.(m28)


DIRUT Bank Sumut Gus Irawan Pasaribu bersama Forum Silaturrahmi Majelis Taklim Labuhanbatu Selatan, usai pengajian akbar dan menyantuni yatim piatu.

Rp 9.100.000. Kemudian, 15.307 produk kosmetik senilai Rp 372.790.000 dan 7.697 produk pangan senilai Rp37.985.000. Obat keras tersebut dimusnahkan karena pendistribusiannya tanpa hak dan kewenangan. Kemudian, pemusnahan produk kosmetik karena tidak memiliki izin edar dan obat tradisional mengandung bahan kimia obat. Sepanjang 2011 ini, kata Agus, BBPOM telah mengamankan produk bermasalah senilai Rp2 miliar terdiri dari jenis obat, kosmetik, obat tradisonal dan makanan. Namun, masih ada barang-barang berisiko yang beredar di pasaran. “Namun kami terus memperkecil peredaran produk bermasalah. Ini juga diperlukan peran serta masyarakat terutama pedagang agar tidak menjual produk pangan dan kosmetik yang mengandung bahan berbahaya,” kata Agus seraya menambahkan, sudah lima orang yang dijadikan tersangka dan berkasnya diserahkan ke Kejaksaan. Masih Ada Terkait makanan ber-peng

awet yang dikonsumsi anakanak perkotaan, Kasi Sertifikasi dan Layanan Informasi Kon sumen BBPOM Medan Sacra mento mengakui masih ada 12 bahan makanan yang meng andung formalin seperti mi dan bakso dari sejumlah sekolah maupun pasar. “Namun dibanding tahun 2010, temuan tersebut sudah jauh menurun. Kendati demikian, setiap bulan dilakukan pengawasan secara rutin melibatkan tim monitoring dan pembinaan dengan leading sector Badan Ketahanan Pangan (BKP),” ujarnya. Dalam jangka pendek, menurut Sacramento, formalin menyebabkan gangguan pencernaan dan iritasi lambung. Dalam jangka panjang, menyebabkan mutasi gen yang berhubungan dengan kanker. “Jadi, tidak boleh ada bahan formalin pada makanan, tapi secara alami terkadang ada, namun tidak terlalu dikhawatirkan. Contohnya pada buah Pear. Itu adalah alami, bukan bahan kimia yang dimasukkan ke situ,” terangnya. (h02)

PD Medan Resmikan Kantor Baru MEDAN (Waspada): Dewan Pimpinan Cabang Partai Demokrat (DPC PD) Kota Medan meresmikan kantor baru di Jl. Padang Golf Komplek CBD Polonia Blok G No.87 Medan, Senin (26/12). Kantor baru sumbangan kader Partai Demokrat Rahudman Harahap tersebut diresmikan salah seorang pendiri partai tersebut H Sutan Batoegana yang merupakan Pjs Ketua DPC PD Kota Medan. Peresmian tersebut, diisi dengan kegiatan pengguntingan pita, pemotongan nasi tumpeng, dan pemberian santunan kepada anak yatim dan piatu sebanyak 50 orang terdiri dari muslim dan nonmuslim. Sebelumnya pada hari yang sama, DPC PD Kota Medan juga menggelar kegiatan pasar murah di Kelurahan Sei Putih Tengah, Kecamatan Medan Petisah. Turut hadir dalam acara tersebut, Wali Kota Medan Rahudman Harahap, Sekretaris Eksekutif DPD PD Sumut Borkat Hasibuan, Ketua DPRD Medan Drs H Amiruddin, Sekretaris DPC PD Medan Ir Bangun Tampubolon, Ketua Fraksi Demokrat Medan Drs Heri Zulkarnaen selaku ketua panitia dalam acara tersebut, humas Ir Yahya Payungan Lubis, para kader PD Kota Medan dan para undangan lainnya. Sutan Batoegana menyebutkan, dengan

diresmikannya kantor baru tersebut harus segera dimanfaatkan untuk membangun kepentingan partai dan paling utama demi kepentingan masyarakat banyak. “Kantor ini tidak akan bermanfaat jika tidak diisi dengan kegiatan yang bermanfaat pula. Partai ini juga tidak akan bisa besar kalau di dalamnya ada saling gesek, gosok dan gasak, tetapi harus bersatu dan bekerjasama untuk membesar-kannya,” ujarnya. Sementara itu, DPD PD Sumut yang diwakili Sekretaris Eksekutif Borkat Hasibuan menyambut baik peresmian kantor baru tersebut. “Kantor baru tersebut harus dijadikan pusat pergerakan organisasi dalam membangun Demokrat di Kota Medan. Ini langkah baru menuju ke depan, dengan kerendahan dan ketulusan hati, Demokrat di masa datang akan semakin jaya,” sebutnya. Pada kesempatan itu, Wali Kota Medan Rahudman Harahap memberikan apresiasi yang besar kepada DPC Partai Demokrat yang peduli kepada masyarakat dengan menggelar pasar murah, sehingga dapat bermanfaat bagi masyarakat dalam mengatasi gejolak harga pada perayaan Natal dan Tahun Baru. Semoga apa yang dilakukan DPC Partai Demokrat Kota Medan khususnya Medan Petisah dapat diikuti DPC PD lainnya. (cwan)

PKK Medan Labuhan Lakukan Pembenahan BELAWAN ( Waspada): Guna memaksimalkan pemberdayaan kadernya, Tim Penggerak Pemberdayaan Kesejahteraan Keluarga (TP PKK) Kecamatan Medan Labuhan, melakukan pembenahan terhadap pengurus dan anggotanya. Usai dilantik menjadi Ketua TP PKK Kecamatan Medan Labuhan priode 2011- 2016, Ummy Zain Noval S.STP, Jumat (23/12) mengatakan, selama ini banyak pengurus PKK bergabung juga di sejumlah organisasi sejenis, sehingga ketika ada kegiatan maka peserta yang hadir orangnya itu-itu saja. “Kita ingin merubah kondisi itu agar fungsi kader bisa maksimal dan tidak seperti apa yang terjadi selama ini,” katanya. Menurutnya, sebagai gerak yang dikelola dengan prinsip dari oleh dan untuk masyarakat, PKK sudah dilaksanakan di seluruh Indonesia, karena bermanfaat bagi masyarakat dan keluarga di seluruh pelosok tanah air. Sebagai salah satu ujung

tombak pembangunan bangsa, PKK tidak terlepas dari partisipasi kader yang umumnya perempuan. Bahkan generasi yang cerdas akan dicapai apabila para perempuan berani melakukan perubahan yang diawali dari masing- masing keluarga. “Perempuan salah satu kunci kesuksesan sebuah keluarga, jadi fungsinya sebagai ibu rumah tangga harus dimaksimalkan,” ujar Ummy. Sejumlah pimpinan atau perwakilan Muspika Medan Labuhan, hadir dalam acara pelantikan yang dilakukan di Aula Kelurahan Besar itu, di antaranya Camat Medan Labuhan Zain Noval dan Kapolsek Medan Labuhan Kompol Sugeng Riyadi. Ummy Zain Noval S.STP terpilih sebagai Ketua TP PKK Medan Labuhan priode 20112016, dibantu sekretaris Khai riah Rambe dan bendahara Latifah. Ketua Pokja I Suyanti, Pokja II Elli Safrida, Pokja III Rifal Nur, dan Pokja IV Siti Nuraisyah. (h03)

DPD Krida Wanita Swadiri Kunjungi Waspada MEDAN (Waspada): DPD Krida Wanita Swadiri Indonesia Sumut, sebagai organisasi sosial ingin mewujudkan kemampuan dalam pendidikan anakanak serta berbagai keterampilan bagi anggota Krida yang dapat menyentuh dan berguna ditengah-tengah masyarakat. Demikian dikatakan Ketua DPD Krida Wanita Swadiri Indonesia Sumut Mardelia Desfrida SE, MSi, didampingi sekretaris Dra Masithah, Farhati, Cut Siti Salbiah, Leny Yos Santi SKM, Hj Nur Intan Pane, dalam audiensinya ke kantor Redaksi HarianWaspada, Kamis (22/12). Rombongan tersebut diterima Kepala Humas Waspada Drs H Erwan Effendi. Kata Mardelia, organisasi yang baru dilantik 2 Desember 2011 lalu, oleh Ketum DPP Hj Oetoyo Oesman ingin mengajak

kerjasama dengan mass media khususnya Waspada yang sering menyajikan berita tentang kreatifitas organisasi wanita. Kunjungan ke Waspada untuk memberitahukan tentang program kerja DPD Krida Wanita Swadiri Indonesia Sumut dalam jangka pendek dan panjang. Antara lain akan memberikan berbagai keterampilan bagi anggota dan masyarakat seperti pelatihan salon. Kemudian memberikan pendidikan bagi anak-anak yang terganggu mentalnya (down syndrome). Kepala Humas Waspada Erwan Effendi sangat mengapresiasi para ibu-ibu yang tergabung dalam DPD Krida Wanita Swadiri Indonesia Sumut, memiliki potensi agar punya kreatifitas yang bisa menghasilkan terutama untuk membantu rumah tangga. (m24)

Waspada/Irwandi Hrp

PJS Ketua DPC Partai Demokrat Kota Medan Sutan Batoegana didampingi para pengurus PD lainnya foto bersama anak yatim piatu usai pemberian bingkisan dalam acara peresmian kantor baru DPC PD Kota Medan di Jl. Padang Golf Komplek CBD Polonia Medan, Senin (26/12).

Universal Communication Gelar Pelatihan IT MEDAN (Waspada): Lembaga Komunikasi Massa (LKM) Universal Communication menggelar Pelatihan Informasi Teknologi dan Design Grafis Tingkat Pelajar Sumut Berbasis Media Online bertempat di Gedung International Leaguage Program (ILP) Jln. Sisingamangaraja Medan, baru-baru ini. Ketua LKM Universal Communication Drs. Dailami di dampingi Direktur Eksekutif A. Khair Lubis, SH dalam siaran persnya, Minggu (25/ 12), menjelaskan, pelatihan ini mengikutsertakan pelajar tingkat SMA dari Medan dan beberapa kabupaten/kota di Sumatera Utara. Kegiatan tahap awal dibuka Kepala Bappeda Sumut, Ir Riadil Akhir Lubis, M.Si dengan jumlah peserta sebanyak 50 pelajar dari SMAN 6 Medan, SMAN 8 Medan, SMA UISU Medan dan SMA An-Nizam Medan. Materi pelatihan diberikan kepada peserta meliputi pengetahuan tentang Informasi Teknologi, Design Grafis, Dasar-Dasar Jurnalistik dan Bahasa Jurnalistik. Harapan dari pelatihan ini, para pelajar mampu memahami serta menguasai materi yang diberikan sekaligus sebagai upaya meningkatkan Sumber Daya

Manusia (SDM) pelajar dalam menjawab tantangan era globalisasi informasi. Sementara itu, Kepala Bappeda Sumut, Ir Riadil Akhir Lubis, M.Si mengatakan, kegiatan yang digelar LKM Universal Communication ini merupakan wujud dari visi misi Gubsu dan Wagubsu tentang Rakyat Tidak Bodoh. “Melalui pelatihan ini, kita harapkan para pelajar mampu meningkatkan SDM mereka terkait dengan informasi teknologi, design grafis dan tak terkecuali tentang jurnalistik terutama media online”, kata Riadil. Diharapkan, LKM Universal Communication terus berpartisipasi dalam berbagai pelatihan. “Jika memungkinkan lebih banyak mengikusertakan mahasiswa, wartawan, pemuda dan masyarakat umum,” tambahnya. Setelah melaksanakan Pelatihan Informasi Teknologi dan Design Grafis Tingkat Pelajar Sumut Berbasis Media Online tahap pertama 22-23 Desember 2011, kegiatan kembali digelar pada 29-30 Desember 2011 dengan mengundang 50 pelajar dari SMAN 1 Binjai, SMAN 1 Berastagi, SMAN 1 Pancurbatu, SMAN 1 Percut Seituan dan SMAN 1 Perbaungan.(m25)


KEPALA Bappeda Sumut, Ir Riadil Akhir Lubis, MSi didampingi Ketua Lembaga Komunikasi Massa Universal Communication Drs Dailami diabadikan bersama instruktur, narasumber dan peserta Pelatihan Informasi Teknologi dan Design Grafis Tingkat Pelajar Sumut Berbasis Media Online, Kamis (22/12).

Medan Metropolitan A6 Pemko Diminta Kurangi Angkutan

WASPADA Rabu 28 Desember 2011

Poldasu Periksa Kacab PLN Medan

MEDAN (Waspada): Kasat Lantas Polresta Medan Kompol I Made Ary Pradana mengatakan, angkutan massal merupakan solusi yang bagus mengatasi kemacatan di kota Medan, tapi harus ada tindakan yang berani dari Pemko Medan untuk mengurangi angkutan yang ada sekarang. “Kalau pengurangan angkutan yang ada tidak diberlakukan, bukannya menambah kelancaran tapi justru menambah kemacatan,” sebut I Made Ary Pradana, Selasa (27/12). Menurut Made, angkutan massal solusi yang bagus tapi juga lihat dimensi angkutan massalnya. “Kita lihat kondisi jalan di Medan ini. Kalau seperti di Jakarta angkutan massal pakai bus besar kapasitas 40 penumpang. Di Medan kapasitas yang bagaimana untuk bisa layak dengan kondisi jalan seperti ini,” katanya. Jangan sampai nanti angkutan massal malah menghabiskan semua badan jalan yang ada. Sebagai contoh jalan lintas yang kecil yang hanya bisa dilintasi oleh kendaraan kecil, kalau angkutan massal masuk akan menjadi masalah. “Kita lihat kondisi perpakiran saat ini, kiri kanan mobil parkir banyak, ini kan mengganggu. Contoh di Jalan Zainul Arifin, kalau ini dilintasi angkutan massal harus dibarengi dengan penataan sistem perpakiran karena ini berkaitan,” ujar Made. Made menjelaskan, penyebab kemacatan juga karena ada perlintasan kereta api. Beberapa kondisi rel saat ini menghambat percepatan kendaraan belum

lagi kapasitas atau frekwensi perlintasan KA sudah sangat tinggi . “Ini harus ada solusi konkrit dari KA bekerja sama dengan Pemko Medan,” katanya. Kata Made, kalau tidak salah ada 14 perlintasan KA dan ratarata melintasi jalur utama di inti Kota Medan. Contohnya, Jalan Pandu-Hj Ani Idrus menuju Waspada. “Sudah frekwensi pengendara menunggu, posisi rel lebih tinggi dari kultur jalannya, sehingga mengakibatkan perlambatan,” ujarnya. Belum lagi yang di Jalan Stasiun Kereta Api, langsir KA itu membutuhkan beberapa menit di badan jalan sehigga membuat antrian panjang pengendara. “Satlantas sudah pernah berkordinasi dengan pihak KA untuk sistem pengaturanya. Namun ini harus ada kordinasi yang efektif dan ada kegiatan yang sifatnya aflikatif antara PT KAI dengan Pemko Medan,” kata Made. Apalagi nanti akan direncanakan Kuala Namu operasional dengan jalur KA. Frekwensi yang ada sekarang saja tanpa ada kegiatan di Kuala Namu sudah sangat mengganggu frekwensi perlintas KA, apalagi Bandara Kualanamu sudah jadi. “Berapa dalam sehari KA itu akan melintas mengantarkan penumpang menuju Bandara Kualanamu dari kota Medan. Ini pasti sangat mengganggu dan harus dipikirkan sejak awal,” sebutnya. Dalam rancangan angkutan kota, hal seperti ini harus direncanakan bagaimana sistem angkutannya. Kalau ini nanti akan menggunakan rel yang sudah ada untuk dipergunakan atau disambungkan dengan Bandara Kuala Namu harus dipikirkan. “Yang memikirkan PT KAI dan pemerintah. Kami dari kepolisian hanya bisa mengusulkan melalui kordinasi,

Brimobdasu Sterilisasi Lokasi Natal Oikumene MEDAN (Waspada): Puluhan personel penjinak bom (Jibom) Brimobda Sumut, Selasa (27/12) “menyeser” setiap sudut Lapangan StadionTeladan Medan, menggunakan metal detector guna mengantisipasi adanya bahan peledak yang dapat merusak perayaan Natal Oikumene (bersama) yang dilaksanakan hari ini, Rabu (28/12). Sterilisasi lokasi dilakukan hampir tiga jam, dan mendapat perhatian warga sekitar, karena Brimobdasu menyertakan dua unit mobil barakuda anti peluru dan satu mobil khusus untuk meledakkan bom. Usai melakukan sterilisasi sekira pukul 11:00, keseluruhan personel Jibom bergerak balik ke Mako Brimobdasu Jln. Wahid Hasyim Medan. Kapolresta Medan Kombes Pol. Tagam Sinaga yang memantau sterilisasi itu kepada wartawan mengatakan, sterilisasi dilakukan untuk mengantisipasi kemungkinan teror bom. “Ini merupakan prosedur tetap, meski tidak ditemukan benda-benda mencurigakan,” katanya. Tagam menyebutkan, untuk pengamanan saat acara, ditempatkan 411 personel gabungan, terdiri dari Polsekta Medan Kota, Polresta Medan, dan Polda Sumut. Personel nantinya disebar sesuai dengan satuan masing-masing. “Sistem pengamanannya dibuat tiga ring menggunakan metal detektor,” sebutnya. Selain mengantisipasi teror bom, petugas juga mewaspadai adanya pencurian kendaraan bermotor (curanmor) dan penganiayaan. Sedangkan perubahan arus lalu lintas dilakukan jika kepadatan di sekitar Stadion Teladan tidak memungkinkan lagi. “Untuk perubahan arus lalu lintas, kita lihat kondisinya. Jika padat akan ditutup dan dialihkan ke jalan lain, atau sistem buka tutup dilakukan,” ujar Tagam.(m27)

Aparat Kelurahan Gerebek Kamar Kos MEDAN (Waspada): Aparat Kelurahan Teladan Barat dan sejumlah kepala lingkungan (kepling), Kecamatan Medan Kota, menggerebek kamar kos di kawasan Jalan Air Bersih, Minggu (25/ 12) dinihari. Dalam penggerebekan itu, ditemukan sepasang insan berlainan jenis yang bukan pasangan suami-istri mengaku mahasiswa, namun tidak dapat memperlihatkan kartu tanda mahasiswa (KTM) nya. Salah seorang kepling mengatakan, penggerebekan yang mereka lakukan berdasarkan laporan keresahan warga. Selanjutnya pasangan tersebut diboyong ke Kantor Kelurahan Teladan Barat. Pasangan bukan suami istri itu sempat melontarkan katakata ancaman terhadap aparat kelurahan, akan tetapi tidak dilayani. Akhirnya, si pria berinisialYR, penduduk Jalan BajakV, Kelurahan Harjosari II Medan, membuat surat pernyataan tidak akan mengulangi perbuatannya bermalam di rumah kos tersebut. Sementara wanita berinisial T yang menempati kamar kos tersebut berasal dari kawasan Medan Marelan. (m34)

namun secara pelaksanaannya tetap Pemko Medan, PT KAI atau instansi terkait,” tuturnya. Terkait macat Medan, Polresta dan Pemko sudah membentuk forum lalulintas dibawa kendali pejabat Pemko Medan, karena permasalahan lalulintas bukan masalah polisi saja tetapi masalah instansi terkait. KA akui kemacatan Sementara itu, Manajemen Kereta Api tidak membantah kemacatan arus lalulintas di beberapa titik jalan akibat lambatnya perjalanan kereta api saat akan masuk dan keluar stasiun besar Medan. “Namun kondisi tersebut hanya semata-mata memberikan kenyamanan dan keamanan kepada para pengguna jasa kereta api di Sumatera Utara, terutama untuk keselamatan penumpang,” sebut Humas Kereta Api (KA) Divre I Sumatera Utara Asri. Kata Asri, saat kereta api akan memasuki dan keluar dari stasiun besar Medan, kecepatannya maksimum 5 km/jam, berarti tergolong lambat sehingga imbasnya lama terjadi kema-

catan arus lalulintas di Jalan Pandu, SM Raja, dan Jalan Haryono MT. Masalahnya, lanjutnya, kalau kecepatan kereta api terlalu kencang saat akan masuk ke stasiun besar di Medan, dikhawatirkan akan terpengaruh kepada ratusan penumpang didalamnya, setidaknya keselematannya. Apalagi ditambah dari Jalan Pandu ke arah Jln. SM Raja ada tekongan patah, menyebabkan kereta api tidak bisa melanju kencang dan sudah diatur lebih kurang 5 km/jam. “Kalau dipaksakan menjadi ancaman bagi penumpang,” ujarnya. Begitupun, pihak manajemen kereta api berupaya mencari solusi agar ke depan pada rute tersebut perjalananannya agak sedikit kencang dari saat ini, sekaligus tidak mengabaikan keselamatan penumpang. Masterplan tak sesuai Terkait hal tersebut, advokat M Sa’i Rangkuty SH,MH mengatakan, masterplan Kota Medan yang tidak sesuai dengan aturan harus segera ditindaklanjuti, seperti banyaknya bangunan

ruko tidak sesuai dengan roilen sehingga menjadi salah satu penyebab terjadi kemacatan arus lalulintas. Menurut Rangkuty, Pemko harus tegas kalau tetap mengganggu sebaiknya bangunan tersebut dirubuhkan. Akibat dari tidak sesuai dengan roilen maka terjadilah tempat yang sempit, sehingga pemilik bangunan pun tidak lagi memiliki parkir. Dia mengatakan, selain itu salah satu penyebab terjadi kemacatan arus lalulintas yakni parkir mobil berlapis. Sedangkan Direrktur LBH KAI Sumatera Utara Zulham Efendi Mukhtar SH menuturkan, untuk mengatasi kemacatan, Wali Kota Medan melalui dana APBD harus membuat atau menciptakan lahan khusus tempat parkir. “Saya yakin Rahudman Harahap sudah memikirkan tentang parkir yang masih semrawut tersebut, namun tidak merealisasikannya. APBD itu uang rakyat maka DPR sebagai wakil rakyat harus menyetujui untuk pendanaan pembuatan parkir khusus,” kata Zulham. (m39/m38/m24)

PKS Sumut Luncurkan Rumah Keluarga Indonesia MEDAN (Waspada): DPW Partai Keadilan Sejahtera (PKS) meluncurkan Rumah Keluarga Indonesia (RKI) sebagai wadah untuk membina keluarga Indonesia menjadi keluarga yang memiliki jiwa dan tidak sekadar simbol. “Selama ini kerap terjadi keluarga yang hanya dijadikan simbol dan tidak memiliki jiwa. Sehingga, anggota keluarganya mencari kompensasi keluar. Ibu mencari kompensasi ke luar, begitu juga dengan anak dan ayah. Sebab, rumah tangga hanya dijadikan transit (persinggahan). Untuk itulah, merupakan satu komitmen dan program dari DPP PKS untuk mendirikan RKI di seluruh provinsi di Indonesia, sebagai wadah untuk membina keluarga Indonesia,” ujar Ketua Bidang Perempuan DPP PKS Anis Byarwati saat berlangsungnya Talkshow Gebyar Hari Ibu, di Asrama Haji, Selasa (27/12). Hadir anggota DPR RI Idris Lutfi Rambe, Ketua Biro Pemberdayaan Perempuan Provsu Iis Faizah Hanum, dan Ketua DPW PKS Sumut Mohamad Hafes. Kegiatan sekaligus

pelantikan pengurus RKI yakni, Ketua Rina Afrida, Sekretaris Ummi Khairiyah, Bendahara Ratna Oktina Kusumastuti, Departemen Penyuluhan-kesehatan Olivia Rizkana Rosyada, Departemen Konseling Siti Khadijah, Yenni Marito, Nila Anggreiny, dan Departemen Sanggar Kreativitas Anak dan Remaja Rina Ariani. Anis menjelaskan, seharusnya rumah tangga betul-betul dapat menjalankan fungsinya, sebagai fungsi pendidikan, rekreasi dan lainnya. Tidak sekadar simbol yang hanya menampung istri, suami, juga anak. “Jika keluarga dapat menjalankan fungsinya, maka seluruh anggota keluarga itu akan merasa nyaman, sehingga dia dapat memberikan kebahagiaan untuk masyarakatnya. Untuk itulah kita memiliki komitmen keluarga Indonesia harus bida menjadi keluarga yang utuh,” katanya. Dia menyebutkan, hingga saat ini terdapat sebanyak 105 RKI di Indonesia. RKI ini dibangun untuk membangun keluarga yang lintas agama juga

lintas suku. Sehingga siapapun yang memiliki masalah keluarga dan ingin utuh rumah tangganya bisa datang ke RKI yang memiliki berbagai program, mulai dari pembekalan untuk ayah dan ibu. Sebab selama ini, sekolah untuk ayah dan ibu itu tidak ada. Menurut Anis, RKI ini merupakan kontribusi yang riil dan komitmen DPP PKS untuk membangun rumah tangga yang utuh. “Kita inginkan ke depan semua keluarga Indonesia memiliki jiwa dan tidak kosong, dan rumah tidak lagi menjadi terminal atau hanya tempat singgah dari anggota keluarga,” ujarnya sembari menyebutkan RKI ini juga ada di kabupaten/kota. Ketua Panitia kegiatan Eli Gustiawati menyebutkan, kegiatan ini juga dirangkaikan dengan talkshow Gebyar Hari Ibu dengan tema Ibu cerdas, keluarga tangkas, dan Sumut berkualitas. Sedangkan Ketua DPW PKS Sumut Mohamad Hafes mengatakan, RKI ini harus menjadi solusi bagi persamalahan keluarga yang ada di Sumut. (m37)

Sehari Terjadi 23 Laka Lantas, 5 Tewas MEDAN (Waspada): Hanya dalam waktu sehari, sebanyak 23 kasus kecelakaan lalu lintas (Laka Lntas) terjadi di wilayah Sumatera Utara. “Laka Lantas dominan dialami pengendara kendaraan bermotor, dikarenakan berbagai faktor, seperti kerusakan jalan, kelalaian pengemudi, dan tidak baiknya kondisi kendaraan.” Kasubid Pengelola Informasi dan Data (PID) Humas Polda SumutAKBPMPNainggolanmengatakan itu kepada wartawan, di Mapolda Sumut, Selasa (27/12). Diamenjelaskan,akibat23peristiwa Laka lantas itu sebanyak 5 korban meninggal dunia, 17 luka berat, dan 21 korban luka ringan. Dengan peristiwa satu hari itu, maka total sementara korban jiwa akibat kecelakaan lalulintas selama Operasi Lilin Toba 2011 sebanyak 15 orang. Karena sebelumnya, data Laka Lantas selama tiga hari sejak gelaran Ops Lilin Toba pada 23 Desem-

ber hingga 26 Desember, 10 korban jiwa melayang di jalan raya. Untuk sementara ini, kata Nainggolan, kasus Laka Lantas pada Ops Lilin Toba, terjadi 521 pelanggaran dengan tindakan langsung (tilang) 254 dan teguran 267. Kerugian materi yang ditimbulkan akibat Laka Lantas mencapai Rp45.600.000. Sedangkan tindak kriminal yang terjadi di seluruh jajaran sebanyak 10 kasus, terdiri dua kasus pencurian dengan pemberatan (curat), satu pencurian kendaraan bermotor (curanmor), satu kasus judi, tiga kasus penganiayaan berat (anirat), satu kasus narko-ba, satu pembakaran dan satu kasus pengrusakan. “Kendaraan yang mengalami kecelakan lalulintas saat ini diamankan di Polres masing-masing dan masih dalam pendataan,” kata Nainggolan. Demo Kapolda NTB Sementara itu, Selasa (27/ 12) siang, seratusan massa dari

Ikatan Mahasiswa Muhammadiyah (IMM) unjukrasa di Mapoldasu, menuntut Kapolda NTB dan Kapolres Bima diberhentikan secara tidak hormat terkait kasus Mesuji. Mereka datang ke Polda dengan sejumlah angkutan umum dan kendaraan bermotor, melakukan aksinya di depan Gedung Sentra Pelayanan Kepolisian Terpadu (SPKT) membawa berbagai spanduk kecaman terhadap kinerja aparat di NTB, karena dianggap tidak berpihak kepada rakyat. Koordinator aksi Fahrur Rizky dalam orasinya membacakan tuntutan, yaitu, menghentikan perizinan lahan penambangan PT Sumber Mineral Nusantara (SMN) di Bima, pecat Bupati Bima, dan pecat Gubernur Lampung. Setelah menyampaikan aspirasi dan diterima perwakilan dari Polda, akhirnya mereka membubarkan diri.(m27)

MEDAN (Waspada): Kepala Cabang (Kacab) PT PLN MedanWahyu Bintoro menjalani pemeriksaan di ruang penyidik Direktorat Reserse Kriminal Umum Polda Sumut, Selasa (27/12). Wahyu diperiksa sebagai terlapor atas pengaduan manajemen Hotel Griya. Wahyu yang mengenakan kemeja putih dipadu celana jeans coklat, terlihat serius menjawab sejumlah pertanyaan juru periksa (juper) yang menangani kasusnya. Didampingi pengacaranya, Wahyu diperiksa mulai pukul 11:00 hingga pukul 15:30. Usai menjalani pemeriksaan, Wahyu bersama pengacaranya langsung pergi meninggalkan Mapoldasu dengan mobil Toyota Kijang warna silver BK 1006 KK. Saat hendak dikonfirmasi wartawan, dia yang pernah dijemur masyarakat Tanjung Pinang karena kasus pemadaman listrik di daerah itu, enggan memberikan keterangan. “Nanti saja ya,” katanya bergegas menaiki mobil. Sementara kuasa hukum Griya Hotel Azhar AR, SH dan Mahmud, SH dari Diraja Co Law Office Jakarta, kepada wartawan mengatakan, selain laporan ke Polda Sumut dengan bukti lapor No.TBL/973/XII/2011/SPKT II, pihaknya juga melaporkan permasalahan tersebut kepada anggota DPR RI dan Mabes Pori, termasuk kepada menteri. Azhar juga menyayangkan sikap Kacab PLN Medan yang menyebutkan Hotel Griya merupakan konsumen antara dalam permasalahan tersebut. “Kita telah melaporkan kasus ini kepada Komisi III dan Komisi VII DPR RI, kemudian Mabes Polri dan menteri yang berkompenten. Hotel Griya bukan konsumen antara, tetapi konsumen akhir dari PLN. Kan tidak mungkin hotel sebagai pelanggan menjual listrik kepada penyewa kamar. Tak mungkinlah orang yang menyewa kamar dibiarkan gelap seperti di kuburan, hotel menyewa kamar bukan menyewa listrik,” katanya. Dia mengatakan, PLN bukan seperti Perta-

Waspada/gito ap

KACAB PLN Medan Wahyu Bintoro (belakang) dan pengacaranya saat berada di Mapoldasu, Selasa (27/12). Dia diperiksa terkait pemadaman listrik di Hotel Griya. mina, dimana barang yang di distribusikan kepada agen-agen penyaluran boleh diperjualbelikan kembali. “PLN itu bukan Pertamina, kalau Pertamina ya bisa saja menyalurkan minyak atau gas kepada agen, lalu agen menjual kembali kepada masyarakat. Dalam hal ini agen merupakan konsumen antara dan masyarakat pengguna itu konsumen akhir. Kalau di PLN tidak ada yang namanya agen listrik, mana boleh kita jual listrik kepada orang lain, bisa kena hukum kita,” sebut Azhar.(m27)

Ruangan Pasien Rawat Inap RSPM Sepi MEDAN (Waspada): Ruangan pasien rawat inap RSU Dr Pirngadi Medan (RSPM) terlihat sepi pada perayaan Natal 2011. Ini tidak seperti dari hari-hari biasanya karena setiap satu ruangan masing-masing hanya diisi oleh satu pasien,namunpadahari-haribiasabisamencapai tiga sampai empat pasien dalam satu ruangan. Pantauan Waspada di Lantai 8 RSPM, 19 ruangan di lantai tersebut sepi dari aktifitas. Sebagian ruangan hanya diisi satu orang pasien dari semulanya empat pasien yang menjalani rawat inap.“Inikan hari Natal, maka banyak pasien yang Nasrani meminta pulang. Tapi mereka pulang atas izin dokter, jika penyakitnya parah tidak diizinkan dokter pulang,” kata seorang perawat, Minggu (25/12), menanggapi sepinya pasien rawat inap. Sedangkan salah seorang keluarga pasien Yani, 42, menuturkan, seorang pasien asal Aceh, yang sebelumnya dirawat di kamar 817 karena

sakit stroke meminta pulang karena merasa takut. “Pasien itu bilang sama saya dia takut sendirian di ruangan. Menurut ceritanya, dia didatangi makhluk halus Karena sunyi, makanya dia minta pulang,” sebutnya. Menurut Humas RSUD dr Pirngadi Medan Edison Peranging-angin, dalam perayaan Natal ini tidak ada persiapan khusus karena bertepatan dengan hari libur. Dokter jaga tetap standby seperti hari biasa dan pelayanan kesehatan juga tidak mengalami hambatan. “Nggak ada persiapan khusus. Karena memang bertepatan hari Minggu. Jadi dokter fungsional juga masuk seperti biasa. Kita nggak ada buat jadwal seperti perayaan lebaran kemarin. Jadi dokter spesialis dan dokter jaga bekerja seperti biasa. Biasa itu, kalau hari seperti ini IGD atau ruangan lainnya juga sunyi. Karena mereka juga mau berliburan,” ujarnya. (h02)

Warga Protes Proyek Air Limbah Jln. Amaliun MEDAN (Waspada): Warga kawasan Jalan Amaliun, Kec. Medan Area, memperotes pekerjaan proyek air limbah karena sudah tiga bulan lebih tidak kunjung selesai. Siti Maryam, penjual pisang goreng di depan Gg Hasan Basri, Senin (26/12) mengatakan, akibat proyek yang tak kunjung selesai itu penjualannya terganggu. “Pembeli kurang berminat akibat proyek tak kunjung selesai. Akibat lainnya jalan macat dan saat hari panas berdebu, sedangkan kalau hujan permukaan jalan berlumpur,” ujarnya. Dia mengatakan, akibat proyek itu pernah seorang wanita lanjut usia terjatuh saat hendak pergi shalat di mushalla. “Kami meminta agar pemborong atau pemerintah segera mempercepat selesainya proyek tersebut agar tidak mengganggu aktivitas warga,” sebutnya. Ungkapan serupa juga disampaikan Agam, pemilik Wanet. Dia menceritakan kaca wanetnya pecah akibat terkena serpihan batu proyek ketika sedang dilakukan pengorekan. “Saya

cuma diberi ganti Rp250 ribu, padahal harga kacanya Rp500 ribu. Kami sungguh terganggu akibat proyek yang tak kunjung selesai ini,” ujarnya. Salah seorang tokoh masyarakat Jalan Amaliun HM Tahjuddin Nur SK mengungkapkan, pekerjaan proyek air limbah tersebut menyengsarakan masyarakat. “Pasalnya proyek itu terkesan tidak memiliki perencanaan matang atau tidak profesional. Rakyat tetap mendukung pembangunan, namun kalau dikerjakan secara tidak profesional alias asal-asalan maka masyarakat yang dirugikan,” katanya. Tahjuddin yang juga Ketua DPW Lasykar Ampera Arief Rachman Hakim Angkatan 66 Sumut ini, meminta aparat Pemko Medan dan Pemrovsu turun ke lapangan melihat langsung dampak proyek yang sudah memberikan efek negatif. Jika tidak dituntaskan, tambahnya, maka masyarakat bisa saja mengambil langkahlangkah tegas dan bila perlu akan dilaporkan pada aparat penegak hukum.(m34)

Banyak Penegak Hukum Jauh Dari Tuhan MEDAN (Waspada): Perhimpunan Advokat Indonesia (Peradi) Sumatera Utara, menilai masih banyak majelis penegak hukum didalam memeriksa dan mengadili masyarakat jauh dari demi Ketuhanan Yang Maha Esa. “Hal ini dari banyaknya pengaduan yang kita terima dari masyarakat dan untuk itu kita berharap majelis penegak hukum kembali ke hati nurani karena sangat dekat dengan Ketuhanan Yang Maha Esa,” ujar Ketua DPC Peradi Sumut Sofwan Tambunan didampingi Ketua Dewan Kehormatan Peradi Sumut OK Iskandar, dan anggota dewan kehormatan Langsir Ginting, usai rapat dewan kehormatan di Medan, Senin (26/12). Menurut Tambunan, dalam rapat tersebut, dewan kehormatan menerima 12 kasus pengaduan dari masyarakat terhadap 1.500 anggotanya. “Pada intinya kita mengawasi kode etik advokat yang menjadi anggota Peradi, dimana dari 1.500 an anggota Peradi sudah terdapat 12 kasus dan tiga diputuskan,” ujarnya.

OK Iskandar menambahkan, bahwa putusan tersebut adalah pemberhentian bagi advokat yang telah berkecimpung di pegawai negeri sipil (PNS), pemberhentian sementara dan surat peringatan terhadap mereka yang meninggalkan kliennya. “Si pengadu merasa dirinya ditinggalkan advokatnya ketika proses persidangan masih berlangsung atau merasa ditelantarkan dan ini sekitar 60 persen dari tingkat pengaduan,” sebutnya. Dikatakannya, untuk itu, dewan kehormatan mengimbau kepada seluruh advokat untuk benar-benar menjaga profesi yang officium nobile (terhormat) dengan menjalankan profesinya sesuai dengan undang-undang. “Sesama penegak hukum agar meningkatkan kinerjanya untuk menjaga kode etik agar dapat berjalan dengan baik proes hukum sehingga dapat meminimalisir tindak kejahatan,” ujarnya. Peradi juga berharap agar masyarakat tertib hukum dan tidak melanggar norma-norma agama dan hukum yang berlaku di Indonesia. (m38)


WASPADA Rabu 28 Desember 2011


PDIP Desak Pilkada Langsung Ditinjau

Waspada/Gito Rolies

DEWAN Pimpinan Daerah Ikatan Mahasiswa Muhammadiyah Provinsi Aceh, Selasa (27/12), melakukan aksi di pintu masuk Mapolda Aceh. Aksi berlangsung di Jalan, T Nyak Arief Lingke Kota Banda Aceh sehingga mengganggu pengguna jalan.

IMM Desak Kapolri Mundur Dari Jabatan BANDA ACEH (Waspada): Puluhan mahasiswa Ikatan Mahasiswa Muhammadiah (IMM) Aceh berunjuk rasa menuntut Kapolri Timur Pradopo mrngundurkan diri dari jabatannya. IMM juga mendesak agar Kapolda NTB dan Kapolres Bima dicopot dari jabatannya atas kasus penembakan warga di Bima, Nusa Tenggara Barat. Unjuk rasa yang berlangsung Selasa (27/12) sekira pukul 11.30 sempat memacetkan arus lalu lintas di depan Mapolda Aceh akibat pengunjuk rasa melakukan aksi di badan jalan. Di samping berorasi, para pengunjuk rasa juga mendesak aparat kepolisian mengizinkan mereka masuk ke halaman Mapolda Aceh untuk bertemu Kapolda Irjen Iskandar Hasan. Para pengunjuk rasa menilai, Kapolri telah gagal mereformasi institusinya karena hingga saat ini polisi masih arogan terhadap masyarakat. “Kasus penembakan warga di Bima, Nusa Tenggara Barat dan Mesuji adalah salah satu contoh kegagalan Kapolri dalam mereformasi institusinya. Karena itu, Kapolri harus segera melepaskan jabatannya,” kata koordinator aksi Arif Pribadi. Dalam aksi unjuk rasa yang berlangsung hingga menjelang

salat dzuhur itu, para mahasiswa meminta kepolisian mengevaluasi diri secara total, karena sikap dan perilaku aparat kepolisian selama ini jauh dari yang diharapkan. Polisi dinilai lebih membela pemodal daripada melindungi dan mengayomi masyarakat. Di Aceh Besar pada hari yang sama, sejumlah elemen pemuda dan mahasiswa Aceh Besar menggelar aksi unjuk rasa di Bundaran Lambaro sebagai wujud kekecewaan masyarakat terhadap pemerintah setempat yang memberi izin kepada perusahaan pertambangan beroperasi di daerah itu. Sebagai contoh, kata koordinator aksi Al Mudassir kepada Waspada, kasus penambangan di Lampanah Leungah. Meski telah diprotes masyarakat namun proses izin tetap terus berjalan. Selain itu izin terhadap PT LSM di Kecamatan Lhoong yang hingga kini tidak memberi kontribusi yang mampu memakmurkan masyarakat di kecamatan itu. Al Midassir dari Gerakan Masyarakat Menggugat mengatakan, aksi unjuk rasa juga diikuti Masyarakat Mukim Lampanah Lengah, Lhoong,

Lhoknga, Fokus Gempar (Forum Komunikasi Generasi Muda Aceh Rayeuk), PII (Pelajar Islam Indonesia), Kaukus Pemuda Aceh Besar, KKP (Koalisi Kebijakan Partisipatif), PB IPAR (Ikatan Pemuda Aceh Besar). Selain itu, Presma Serambi Mekkah, IKAMAB USM, MAPANCAS (Mahasiswa Pancasila, KML (Komite Masyarakat Lhoong), BKPRMI Aceh Besar, Forbes PG (Forum Bersama Peduli Gampong), Rabithah Thaliban Aceh Besar, PPMI, HMI dan HIMAB. AL Mudassir yang juga juru bicara Kaukus Pemuda Aceh Besar itu menambahkan, Pemerintah Kabupaten Aceh Besar terus melakukan upaya untuk peningkatan PAD melalui izin pertambangan. “Tapi PAD pertambangan entah kemana, rakyat harus menderita karena alam sudah mulai menjerit. Upaya pencitraan pemerintah telah overdosis, terlalu bangga akan kebijakan yang pro rakyat ternyata semua adalah untuk kemakmurandirisemata,”sebutnya. Pantauan Waspada selama aksi unjuk rasa, para pengunjuk rasa sempat mengusung foto Bupati Aceh Besar Bukhari Daud dan Wakil Bupati Anwar Ahmad yang pada bagian mulutnya ditempeli uang

pecahan Rp1.000 serta poster bertuliskan: Rezim Gagal, Menyakiti Bumi dan Hati Kami, Stop Pertambangan. Selain itu, elemen mahasiswa yang tergabung dalam Gerakan Rakyat Menggugat juga mendesak KPK untuk mengusut kasus dugaan gratifikasi yang dilakukan Pemerintah Kabupaten Aceh Besar terkait studi banding yang dilakukan oleh PT LCI beberapa waktu yang lalu. Begitu juga dengan aktivitas penambangan di Lhoong harus segera dilakukan reklamasi karena kegiatan itu telah memberikan dampak dan bencana terhadap masyarakat setempat. “Kesejahteraan yang diperoleh masyarakat tidak sebanding dengan apa yang diambil pengusaha tambang di kecamatan itu. Karenanya pemerintah harus menghentikan kegiatan tambang dan segera melakukan reklamasi bekas galian tambang itu,” sebutnya. Hal lain yang menjadi perhatian para pengunjuk rasa adalah pengembalian hak tanah masyarakat Lhoknga. Mereka menyayangkan sikap pemerintah kabupaten yang telah mengklaim tanah masyarakat sebagai tanah negara. namun hal itu tidak bisa dibuktikan secara sah. (b05)

JAK ARTA ( Waspada): Politisi PDI Perjuangan H Irmadi Lubis mendesak pemerintah dan DPR RI untuk segera meninjau ulang mekanisme pemilihan kepala daerah secara langsung sebagaimana diatur dalam UU No 32 Tahun 2004 tentang Sistem Pemerintahan Daerah. Jika mekanisme Pilkada ini tidak diamandemen, maka seluruh pasangan kepala daerah dan wakil kepala daerah tidak akan harmonis dan cenderung akan saling sikut. Pengunduruan diri Prijanto sebagai wakil gubernur DKI Jakarta merupakan bukti kepala daerah dan wakilnya tidak dapat harmonis setelah terpilih melalui pemilihan langsung. “Kepala daerah dan wakil kepala daerah yang dipilih langsung, justru pecah kongsi setelah mendapatkan mandat dari rakyat, dan ini menjadi pendidikan demokrasi yang buruk bagi rakyat,”

ujar Irmadi Lubis kepada Waspada di Jakarta, Selasa (27/12). Menurutnya, persaingan antara kepala daerah dan wakilnya setelah terpilih sangat rentan, sebab bisa jadi pencalonan kepala daerah dan wakilnya dimajukan partai politik berbeda. Dengan perbedaan partai politik, akibatnya setelah terpilih ada kepentingan partai politik. Fenomena pecah kongsi, jelas akan mengganggu jalannya roda pemerintahan, ujarnya. Disamping itu, fenomena pemilihan secara langsung di tingkat daerah menimbulkan praktik kapitalisme dan liberalisme dalam perpolitikan nasional dan daerah. Sementara, kapabilitas dan integritas calon dikesampingkan. Pilkada secara langsung, pun juga dinilai menyebabkan pemborosan uang negara dan masyarakat. Irmadi berpendapat, jika Pilkada langsung tidak semuanya diubah maka dia menyarankan Pilkada langsung

hanya diterapkan untuk kepala daerah saja, sedangkan untuk wakilnya lebih baik dipilih dari pejabat karir. Dia berargumentasi, jika kepala daerah dipilih langsung oleh rakyat dan wakilnya dipilih dari pejabat karir, maka konflik kepentingan tidak akan terjadi antara kepala daerah dan wakilnya. “Kepala daerah tidak mungkin memecat wakilnya yang pejabat karir, demikian juga wakilnya yang pejabat karir tidak mungkin punya kepentingan untuk menjatuhkan kepala daerah,” tegasnya. Agar kita melahirkan kepemimpinan efektif dan tidak lagi terjadi pecah kongsi antara kepala daetah dan wakilnya setelah dipilih rakyat, maka sangat mendesak bagi pemerintah maupun DPR untuk merevisi UU No 32 Tahun 2004 tentang Sistem Pemerintahan Daerah, tukas Irmadi Lubis. Sementara data dilansir Kementerian Dalam Negeri

Irmadi Lubis menunjukkan, sekira 91 persen kepala daerah dan wakil kepala daerah telah pecah kongsi sebelum masa jabatanya berakhir dan hanya sembilan persen yang kepemimpinan gubernur dan wakil gubernur, bupati dan wakil bupati yang langgeng sampai akhir jabatannya. (aya)

Kualitas Pelayanan JPK Tidak Akan Turun JAKARTA (Waspada): Jamsostek menjamin tidak akan ada penurunan kualitas pelayanan jaminan pelayanan ( JPK) kesehatan menyusul rencana migrasi program tersebut ke Badan Penyelenggara Jaminan SOsial Kesehatan (PT Askes) pada 2014 sebagaimana amanat UU BPJS. Dirut PT Jamsostek Hotbonar Sinaga di Jakarta, Selasa (27)12), mengatakan pihaknya akan terus meningkatkan kualitas pelayanan JPK. “Selama saya masih di sini, orientasi program akan tetap pada peningkatan kualitas dan kuantitas pelayanan kepada peserta,” kata Hotbonar. Ketika diingatkan tentang rencana migrasi program JPK ke BPJS Kesehatan, dosen Fa-

kultas Ekonomi Universitas Indonesia itu yakin kualitas pelayanan tidak akan menurun. PT Jamsostek mulai 1 Desember 2011 menjamin layanan cuci darah (hemodialisa), operasi jantung, pengobatan kanker dan pengobatan HIV/AIDS kepada pesertanya. Direktur Pelayanan PT Jamsostek Djoko Sungkono mengatakan pihaknya juga memberikan layanan pemeriksaan kesehatan (medical check up) kepada peserta Jamsostek yang berusia 40 tahun. Peningkatan manfaat Jaminan Pelayanan Kesehatan (JPK) tersebut didasarkan pada Keputusan Direksi No.Kep/ 310/102011 yang bertanggal 31 Oktober 2011 tentang Pemberian Manfaat Tambahan bagi

Peserta Program Jamsostek. Peningkatan manfaat tersebut diberikan setelah manajemen BUMN tersebut mengkaji kemungkinan peningkatan manfaat tersebut. Dengan sistem bilangan besar, kata Djoko, peningkatan kualitas dan kuantitas layanan bisa terus ditingkat sesuai dengan kinerja investasi dan perluasan kepesertaan. Pekerja Khawatir Sementara kalangan pekerja mengkhawatirkan migrasi program JPK akan menurunkan kualitas pelayanan JPK. Ketum Konfederasi Serikat Pekerja Seluruh Indonesia (KSPSI) Sjukur Sarto mengatakan migrasi program ke BPJS Kesehatan (PT Askes) tidak akan mudah.

Alasannya, pemindahan tersebut tidak sekadar pemindahan peserta baru, tetapi juga peserta lama yang menyangkut data, penginputan, sistem, jaringan kerja, sistem komunikasi dan sebagainya. Tidak hanya itu, migrasi JPK juga akan menurunkan kualitas pelayanan karena standar pelayanan mungkin akan disesuaikan dengan standar pelayanan bantuan sosial atau jaminan kesehatan masyarakat (Jamkesmas). ”Pekerja selama ini membayar iuran untuk mendapatkan JPK standar Jamsostek,” kata Sjukur dan menambahkan jika kualitas pelayanan sama, maka akan mendorong pekerja mendaftarkan diri sebagai penduduk miskin. (j04)

Catatan Peristiwa 2011 KECELAKAAN penerbangan sejak Januari sampai November 2011 meningkat 28,5 persen dibanding periode yang sama tahun lalu. Data KNKT (Komisi Nasional Keselamatan Transportasi) menyebutkan tahun 2011 ini terjadi 36 kasus, sementara pada 2010 terjadi 28 kecelakaan. Tren peningkatan kecelakaan penerbangan itu mencerminkan masih banyak lubang-lubang dalam mekanisme penegakan keselamatan penerbangan kendati pemerintah sudah menetapkan keamanan dan keselamatan penerbangan sebagai prioritas program. Pada periode 2007-2010 saja berdasarkan data KNKT, terjadi 81 kecelakaan pesawat di Indonesia, dengan komposisi faktor penyebab human error sebesar 52 persen dan faktor teknis sebesar 42 persen, selain 6 persen karena faktor lingkungan. Diantara peristiwa kecelakaan pesawat yang terjadi di Indonesia selama 2011 termasuk jatuhnya Casa 212-200 PK-TLF di hutan Gunung Gulus Kelam, Bohorok, Kabupaten Langkat. Berikut ini adalah catatan beberapa kecelakaan pesawat tersebut:


PARA korban jatuhnya pesawat Casa 212200 PK-TLF di hutan Gunung Gulus Kelam, Kab. Langkat. 18 Penumpang dalam pesawat tersebut semuanya tewas.

Kecelakaan Pesawat Meningkat 7 Mei 2011 Pesawat Merpati MA 60 MZ8968 dengan hentakan keras, mendarat di perairan Kaimana, Papua Barat. Cuaca buruk, membuat pilot tak dapat mendarat di bandara. Pesawat buatan China tahun 2010 itu pecah, lalu tenggelam di lautan. Tragisnya, lokasi tenggelamnya pesawat hanya berjarak 500 meter dari landasan pacu bandara. Sebanyak 25 penumpang terdiri dari 17 laki-laki, enam perempuan, dan dua anak dinyatakantewas.Awakpesawat adalah Kapten Purwadi Wahyu (pilot), Paul Nap (kopilot), Sumaryani (pramugari), Indriana Puspasari (pramugari), Joko (mekanik), dan Yonas Ihalau (mekanik).

Pesawat itu berangkat dari Sorong pukul 12:50 WIT dan dijadwalkan tiba di Kaimana pukul 14:00 WIT. 9 September 2011 Pesawat Susi Air 2011 milik operator Susi Air mengalami kecelakaan di kawasan Pasema, Yahukimo. Pesawat berjenis Cessna 208 B Grand Caravan 2011 terbang untuk mengangkut empat drum solar dan bahan pokok. Pesawat lepas landas dari Bandar Udara Wamena, pukul 12:15 WIT. Pesawat kehilangan kontak dengan Pengatur Lalu Lintas Udara 12:30 WIT dan kemudian dilaporkan jatuh. Seluruh kru dilaporkan tewas, yaitu Dave Cootes (pi-

Lokasi jatuhnya pesawat Casa 212-200 PK-TLF di hutan Gunung Gulus Kelam, Kab. Langkat.

lot), warga negara Australia dan Thomas Munk (ko-pilot), warga negara Slowakia. 29 September 2011 Pesawat Casa 212-200 PKTLF, pukul 07:28 lepas landas dengan mulus dari Bandara Polonia menuju Bandar Udara Alas Leuser Kutacane, Kabupaten Aceh Tenggara. Namun pesawat milik maskapai PT Nusantara Buana Air ini tak kunjung mendarat hinggga pukul 08:03. Tak lama kemudian sekitar pukul 09:30 dipastikan pesawat jatuh di hutan Gunung Gulus Kelam, Kabupaten Langkat. Ada 18 orang di dalam pesawat tersebut, 14 penumpang dan 4 kru. Semuanya Tewas. Seluruh korban tewas dalam posisi duduk di kursi masing-masing. Posisi pesawat condong ke belakang dengan bagian depan hancur akibat menabrak tebing. Sementara sayap pesawat ditopang pepohonan, dan bagian bawah badan pesawat ditembus batang pohon. Hal inilah yang diduga menyebabkan pesawat tidak sampai ke tanah. Kondisi awak pesawat, bertumpuk di bagian depan, tepat di belakang kabin pilot. Hal ini kemungkinan lantaran benturan keras yang menyebabkan penumpang terhempas ke bagian depan hingga menumpuk bersama bangkunya masing-masing yang terlepas dari badan pesawat. Evakuasi jenazah baru berhasil dilakukan pada Minggu (2/10) atau empat hari setelah pesawat nahas tersebut jatuh. Tim diturunkan ke lokasi menggunakan helikopter TNI AD. Evakuasi seluruh korban dilakukan dengan helikopter. Tim SAR mengakui, penyelamatan korban sangat sulit karena lokasi berada di kemiringan gunung yang terjal di samping cuaca saat evakuasi juga terlalu ekstrem. Akibat peristiwa itu Kemenhub Selasa (4/10) membekukan Aircraft Operator Certificate (AOC) maskapai Nusantara Buana Air (NBA). Kekosongan penerbangan yang sebelumnya diterbangi NBA ditawarkan pada maskapai lain. Adapun korban yang meninggal dunia dalam peristiwa tragis itu adalah: kru


PERHATIKAN PESAWAT: Sejumlah anak memperhatikan pesawat Sriwijaya Air SJ 230 rute penerbangan Jakarta-Yogyakarta yang tergelincir di Bandara Adisucipto, Yogyakarta, Rabu (21/12). Pesawat yang belum ditarik dari tempatnya tergelincir itu menjadi perhatian masyarakat. pesawat empat orang: 1. Captain: Famal Ishak 2. Co Pilot: Budiono 3. Enginer: Nico Matulessy 4. FOO: B Soetopo. Penumpang 14 orang: 1. Aisyah (P) 2. Astuti (P) 3. Suriadi (L) 4. Tia Apriliani (anak). *Suriadi, Astuti, dan Tia adalah ayah, ibu, dan anak 5. dr Suhelman (L) 6. dr Juli Dhaliana (P) *Suhelman adalah anggota DPRD Kabupaten Aceh Tenggara. Adapun Juli Dhaliana adalah istri Suhelman. 7. Siwa Sanbungan (L) 8. Jefridin (L) 9. Tirnau Karsau (L) 10. Andi Raylan Bangko (L) 11. Ahmad Arief (bayi). *Andi Raylan dan Ahmad Arif adalah bapak-anak 12. Samsidar Yusni (P) 13. Hamimatul Janah (anak) 14. Hanif Abdilah (bayi). 16 November 2011 Pesawat Cessna milik Nusa Flying School jatuh di kawasan Gunung Ciremai dan baru ditemukan pada 28 November. Tiga penumpang di dalamnya tewast yakni dua siswa penerbangan Agung Febrian, 30 dan Muhammad Fikriansyah, 18, serta seorang instruktur Kapten Partogi Sianipar, 25. 12 Desember 2011 Pesawat CASA 212 jatuh di Tanjung Berakit, Kabupaten Bintan Kepulauan Riau, saat mengadakan tes penerbangan.

Kelima awak pesawat tewas. Menurut Kepala Kelompok Keselamatan Penerbangan Bandara Hang Nadim Batam Elfi Amir, pesawat lepas landas dari Bandara Hang Nadim Batam pukul 13:18 WIB. Pukul 13.40 WIB, pesawat kehilangan kontak dengan radar Air Traffic Control (Pengatur Lalu Lintas Udara) Tanjung Pinang. Beberapa saat kemudian diketahui pesawat Casa jatuh di Bintan. Semua awak pesawat ditemukan tewas. Mereka adalah Fadlul Kharim (pilot), Reza Bukalo (kopilot), dan tiga teknisi, yakni Syahrul, Suroso, serta Sutanto. 17 Desember 2011 Pesawat milik Associated Mission Aviation (AMA) jenis Cessna dengan nomor penerbangan PK-RCD tergelincir menjelang landas hingga terjatuh ke dalam jurang sebelum akhirnya terbakar di Papua Barat. Pilot pesawat Kapten Arnold Burung dan Ratih tewas dalam kecelakaan tersebut. Sementara tiga korban lain masih dalam perawatan medis di Rumah Sakit Dian Harapan 19 Desember 2011 Pesawat Cessna 172 milik Wing Flying School jatuh di tepi Pantai Bungko Lor, Kecamatan

Kapetakan, Cirebon. Penyebab kecelakaan akibat cuaca buruk. Pesawat Cessna yang naas itu saat ditemukan dalam posisi terbalik. Untuk menjangkau lokasi, tim terpaksa melalui jalan sungai. Warga sekitar, menambatkan pesawat agar tidak hanyut saat air pasang. Dolly dan Faran mengalami cidera ringan, Sedangkan pesawat Cessna berjenis 172 mengalami rusak parah. 20 Desember 2011 Pesawat Sriwijaya Air tergelincir di Bandara Adisucipto, sekitar pukul 17:10. Seratus tiga puluh satu penumpang termasuk kru pesawat selamat. Peristiwa kecelakaan pesawat Sriwijaya Air, yang terbang dari Jakarta ke Yogyakarta dengan nomor penerbangan SJ 230 PKCKN, segera saja mengingatkan semua pihak akan risiko, kerawanan, dan urgensi pengawasan keselamatan penerbangan di Tanah Air. Tidak ada korban jiwa dalam insiden itu tidak lantas berarti bahwa pengawasan keselamatan penerbangan bukan suatu urgensi. Media massa mengabarkan dugaan bahwa pesawat tersebut tergelincir karena hujan deras mengguyur Kota Gudeg sejak sore. (berbagai sumber/m05)

Luar Negeri


WASPADA Rabu 28 Desember 2011

Al-Qaida Di Irak Mengakui Pengeboman Di Baghdad BAGHDAD, Irak (AP): Satu kelompok depan al Qaida di Irak Selasa (27/12) menyatakan bertanggungjawab atas serangkaian pengeboman yang merobek sejumlah pasar, kafe dan gedung pemerintahdiBaghdaddalamsatuharipekanlalu,yangmenewaskan 69 orang dan meningkatkan kecemasan tentang situasi mendatang di negeri itu. Serangan yang terkoordinasi itu mengenai selusin kawasan yang sebagian besar dihuni kelompok masyarakat Syiah Kamis lalu itu dalam pertumpahan darah besar pertama sejak pasukan AS menyelesaikan penarikan dirinya bulan ini setelah mengobarkan perang hampir sembilan tahun. Mereka juga menghubungkannya dengan krisis pemerintahan yang telah mempertegang hubungan antara Sunni dan kaum Syiah Irak sampai ke titik tertingginya. Pernyataanbertanggungjawabitudikeluarkantanpamenjelaskan tentang kaitannya dengan penarikan pasukan AS. Sedikitnyatujuhorangtewasketikapengebombunuhdirimenyerang Kementerian Dalam Negeri Irak, Senin, dalam kekerasan terakhir sejak krisis meletus sepekan lalu antara pemerintah yang dipimpin orang Syiah dan para pemimpin Sunni. PM Nuri al-Maliki, seorang pemimpin Syiah, dalam sepekan ini mengupayakan penangkapanWakil Presiden Tareq al-Hashemi atas tuduhan terorisme dan berusaha memecat Deputi PM Saleh al-Mutlak. Keduanya adalah pemimpin Sunni. Ledakan terjadi ketika penyerang bom bunuhdiri menabrakkan kendaraannya ke penjagaan keamanan di luar kementerian dalam negeri di Baghdad Pusat, yang mengkibatkan korban-korban berjatuhan dan sejumlah kendaraan terbakar, kata polisi. Satu sumber senior kepolisian mengatakan, pihak berwenang yakin sasaran serangan itu adalah kementerian dalam negeri karena mengumumkan surat perintah penangkapan terhadap Hashemi atas tuduhan memiliki pasukan pembunuh. “Ini adalah pesan langsung bagi kami karena kami adalah pihak yang menangkap jaringan Tareq al-Hashemi dan kami juga pihak yang menjaga keamanan di negara ini,” kata Ali al-Quraishi, seorang letnan polisi yang mengawasi pos pemeriksaan di sekitar Baghdad.(m10)

Gadis Jerman Terkubur Jatuhan Batu BERLIN, Jerman (AP): Regu pertolongan Jerman terus melakukan pencarian seorang gadis 10 tahun yang terkubur jatuhan batu pada saat dia melakukan gerak jalan bersama keluarganuya di satu kawasan pantai indah. Carina Schmidt, wanita jurubicara untuk pihak berwenang regional, mengatakan cuaca badai membuat usaha pencarian gadis sulit, kata laporan kantor berita DAPD Selasa (27/12). Gadistersebut,yangtidakdisebutkanjatidirinya,sedangmelakukan gerak jalan dengan keluarganya Senin sore di sepanjang pantai Pulau Ruegen, Laut Baltik, ketika satu kumpulan batu dan tanah patah dari tebing di atas dan tiba-tiba menimpa keluarga itu. Ibu gadis itu dan kakak perempuannya terluka. Dua mercu suar yang berada di atas tebingkapurArconaCape,yangmembuatpulauitudanpantaiberpasir bawahnya menjadi tujuan populer bagi para wisatawan. (m10)

Harian Chili Bayar Pembaca Karena Resep Makanan SANTIAGO, Chili (AP): Pengadilan Tinggi Chili memerintahkan satu suratkabar untuk membayar AS$125.000 kepada 13 orang yang menderita luka bakar karena mencoba resep churros – adonan makanan ringan Amerika Latin yang digoreng dengan minyak panas - yang dimuat di suratkabar itu. SuratkabarLaTerceraharusmembayargantirugikepada11wanita danduapriamulaidariAS$279sampaiAS$48.000untukseorangwanita yang menderita luka bakar paling parah. Keputusan pengadilan tinggi itu diumumkan Senin (26/12), tujuh tahun setelah para pembaca itu menderita luka bakar ketika mencoba resep tersebut. Hakim mengatakan, suratkabar tersebut tidak mencoba terlebih dahulu resep tersebut sebelum menerbitkannya, sehingga ketika para pembaca mengikuti resep tersebut sesuai dengan yang dimuat, churros tersebut akan meledak ketika minyak mencapai suhu yang dianjurkan. Grupo Copesa, yang menerbitkan suratkabar itu, mengatakan pihaknya akan mematuhi keputusan pengadilan. Beberapa hari setelah resep itu dimuat di majalah Woman pada tahun 2004, sejumlah rumahsakit di wilayah itu menerima beberapa wanita yang menderita luka bakar ketika adonan yang digoreng dalam minyak tersebut tiba-tiba meloncat keluar dari tempat penggorengan.(m23/rzl)

Korban Tewas Akibat Banjir Filipina Bertambah 200 Orang CAGAYAN DE ORO, Filipina (Antara/AFP): Jumlah korban banjir di Filipina bertambah lebih dari 200 orang, Selasa (27/12) lebih dari sepekan setelah bencana alam itu dan para pejabat memperkirakan akan ditemukan lagi mayat. Data resmi jumlah korban tewas 1.450 orang, naik dari 1.236 orang pada hari sebelumnya ketika para personil angkatan laut dan kapal-kapal penjaga pantai menemukan lagi mayat di perairan pulau Mindanao, Filipina Selatan, kata kantor pertahanan sipil. Bau busuk akibat mayat tercium di daerah itu, satu tanda banyak mayat masih belum ditemukan di darat, kata Ana Caneda, kepala pertahanan sipil daerah itu. Badai tropisWashi yang menimbulkan hujan lebat, menyebabkan air sungai-sungai meluap dan menimbulkan banjir bandang di Fipilina Selatan 16 sampai 18 Desember, menghantam seluruh desa. “Sejumlah daerah yang kami pantau masih tercium bau busuk mayat. Kami tidak tahu berapa jumlah orang yang terkubur dibawah lumpur,” kata Caneda kepada AFP dan menambahkan jumlah korban tewas bisa mencapai 2.000 orang. “Banyak mayat ditemukan mengapung di teluk-teluk. Jika tidak di teluk pulau-pulau kecil, mereka mungkin sudah berada di Samudra Pasifik,”katanya.Untukmencarimayat-mayatterhambatakibatkelelahan para pekerja pertolongan yang telah bekerja tanpa henti sejak badai itu, tambah Caneda. Mereka yang selamat yang berada di tumpukan pasir kota Cagayan de Oro, berusaha menyelamatkan harta benda mereka dari lumpur, bukannya mencari mayat-mayat tiga tetangga mereka, kata pemerintah kota itu.

Seputar ASEAN Polisi Thailand Bunuh Enam Rekannya Sesama Petugas BANGKOK, Thailand (Antara/AFP): Seorang polisi di Thailand Selatan menembak mati enam rekannya sesama petugas sebelum menembak dirinya sendiri setelah minum di kantin polisi, yang berubah jadi berantakan, kata polisi setempat Selasa (27/12). Insiden, yang juga mengakibatkan seorang polisi terluka parah, terjadi pada Senin malam di satu kamp patroli polisi perbatasan di Provinsi Phatthalung, sekitar 840 kilometer (520 mil) di selatan ibukotaBangkok.“Tujuhpriaditemukantewas,termasukpenembak dan seorang cedera kritis,” kata penyidik polisi Phatthalung Letkol Prasit Singhapol kepada AFP melalui telefon. Prasitmengatakan,motifnyamasihbelumdiketahuitetapidelapan orang minum bersama di kantin di mana enam mayat ditemukan. “Pada tahap ini kita berpendapat itu konflik pribadi,” katanya. Tubuh penembak itu ditemukan sekitar 200 meter (meter) dari lokasi setelah dia bunuhdiri dengan senapan serbu yang sama digunakannya untuk menembak rekan-rekannya, kata Prasit. Polisi tidak dapat mengkonfirmasi laporan media lokal bahwa kelompok itu sedang merayakan promosi jabatan beberapa pria.

Palestina Bersikeras Ke PBB Reuters

MEMBAKAR PATUNG. Para aktivis dari Vishwa Hindu Parishad (VHP), satu kelompok garis keras Hindu, membakar satu patung sambil meneriakkan slogan dalam satu protes di New Delhi, India, Selasa (27/12). Unjukrasa itu juga bertujuan memprotes usul pemerintah untuk memberikan peluang kerja bagi para penganut agama lainnya.

Syria Tarik Tank Dari Jalanan Di Kota Homs BEIRUT, Lebanon (AP): Setelah beberapa hari melakukan serangan sebagai hukuman, tentara Syria mulai menarik tank-tank dari jalanan kota bergolak Homs Selasa (27/12) hanya setelah satu tim peninjau Liga Arab berada dalam perjalanannya ke pusat kota, demikian menurut sejumlah aktivis dan pejabat Arab. Aktivis oposisi Mohammed Saleh mengatakan pengeboman beratatasHomsdihentikanSelasa pagi dan tank terlihat menarik diri dari jalanan. Para aktivis lainnya yang berpangkalan di Homs mengatakan dia melihat kendaraan bersenjata meninggalkan posisinya di jalanan kota Selasa dinihari di satu jalanraya utama ke kota Palmyra ke timur. Dia memintatidakdisebutkannamanya. Selama beberapa hari, pasukan militer menggempur Homs dengan artileri meski menyetujui satu rencana Liga Arab untuk menghentikan pertumpahan darah. Misi pemantau Arab dimaksudkanuntukmemastikanpemerintahsesuaidengankesepakatan untukmenghentikanpenindasan sembilan bulan atas para pem-

yang murka sehubungan dengan melonjaknya angka pengangguran dan korupsi menjungkalkan Presiden Zine El Abdine Ben Ali setelah selama 23 tahun menjalankan kekuasaannya dengan tangan besi. 25 Januari : Dalam pidato kenegaraannya, Presiden Barack Obama membeberkan beberapa usul untuk ‘memenangkan masa depan.’ 25 Januari : Di Mesir, ribuan pemrotes anti-pemerintah bentrok dengan polisi dalam unjukrasa yang diilhami pergolakan di Tunisia guna menuntut diakhirinya kekuasaan Presiden Hosni Mubarak. 27 Januari : Puluhan ribu warga Yaman menuntut agar presiden mereka mengundurkan diri. Mengambil ilham dari revolusi di Tunisia, mereka bertekad untuk melanjutkan perjuangannya sampai pemerintah mereka yang didukung AS jatuh. 28 Januari : Kekacauan meletus di Mesir ketika para pemrotes menguasai jalanan Kairo, memerangi polisi, membakari markasbesar partai berkuasa

orang tewas dalam 24 jam di dan sekitar satu jalan utama kota itu. Ketua misi Liga Arab, Jend. Mustafaal-Dabisebelumnyamengatakan dia sedang dalam perjalanan ke kota itu dan pihak berwenang sejauh ini memberikan segala bantuan yang diperlukan. “Saya akan ke Homs. Sampai sekarang mereka sangat membantu,” kata Dabi kepada AFP. Tentara Syria menarik kendaraan lapis baja berat dari lokasi Baba Amro kota itu, lokasi sebagian aksi kekerasan, menjelang kedatangan para pemantau itu, kata satu kelompok pengawas hak asasi manusia. Sebelas tank ditarik pada pukul 07:00 waktu setempat (12:00 WIB), kata Rami Abdel Rahman, ketua Observatorium Hak Asasi Manusia Srha kepada AFP. Misi pemantau itu adalah bagian dari rencana Arab yang disetujui Suriah pada 2 November yang menyerukan penarikan pasukan keamanandarikota-kotadandistrik permukiman, penghentian aksi kekerasanterhadapwargasipildan pembebasanparatahanan.(m10)

Pewaris Kim Jong-il Jalani Ujian, Temui Delegasi Tak Resmi Korsel PYONGYANG, Korea Utara (AP): Pemimpin mendatang Korea Utara menguji keterampilan diplomatiknya di saat kematian ayahnya, ketika dia menyambut satudelegasipelayattakresmiKorea Selatanpadasaatdiamemperkuat posisinyapadastrukturpalingatas kekuasaan di negeri itu. Kim Jong-un dengan cepat memperoleh posisi terkemuka sejak kematian ayahnya Kim Jong-il pada 17 Desember lalu dan pertemuan singkatnya Senin dengan satu kelompok yang dipimpin oleh mantan ibunegara Korea Selatan dan seorang pemimpinbisnisterkemukamenunjukkan pada Seoul bahwa dia meyakinkanpadaperanbarunya. Para delegasi Korea Selatan telah pulang Selasa (27/12). Tampaknya jelas sekarang bahwa Kim Jong-un, yang masih

KILAS BALIK PERISTIWA DUNIA 2011 TAHUN BARU 2011 dibuka dengan satu gempa bumi keras berkekuatan 7,1 skala Richter yang melanda Chile , puluhan ribu warganya cemas akan terulangnya tsunami yang terjadi di Sumatera Utara beberapa tahun sebelumnya. Gempa tersebut membuat puluhan ribu orang mencari tempat yang lebih tinggi. 2 Januari : Gempa bumi berkekuatan 7,1 skala Richter mengguncang selatan Chile, puluhan ribu orang bergegas mencari tempat yang lebih tinggi. 6 Januari :Menhan AS Robert Gates mengumumkan dia akan memangkas AS$78 miliar dari anggaran Departemen Pertahanan selama lima tahun mendatang, dalam usaha untuk merampingkan defisit yang makin membengkak. 8 Januari :Anggota parlemen AS Gabrielle Giffords termasuk di antara 12 orang yang cedera dalam drama penembakan di Tucson,Arizona, yang menewaskan enam orang. 14 Januari: Dalam satu pergolakan populer yang tak terduga, para demonstran Tunisia

bangkang. Namun para oposisi dari Presiden Bashar Assad meragukan Liga Arab dapat menggerakkan pemimpin otoriter itu. Pemimpin senior oposisi Syria Burhan Ghalioun menyerukan Minggu agar Liga menyertakan dalam usaha itu. PBB mengatakan lebih dari 5.000 orang tewas sejak Maret dalam kekerasan politik. Di Kairo, seorang pejabat di ruang operasi Liga Arab mengatakan kepala misi ke Syria yang berasal Jend. Mohamed Ahmed Mustafa al-Dabi, memimpin satu tim yang terdiri dari 12 peninjau berada dalam perjalanannya ke Homs Selasa. Pejabat tersebut, yang berbicara tanpa ingin disebutkan namanya karena dia tidak berwenang untuk berbicara ke-

pada para wartawan, tidak memberikan rincian lebih lanjut. Homs, kota ketiga terbesar di Syria, berpenduduk 800.000 orang dan merupakan pusat dari revolusi menentang Assad, berlokasi kira-kira 160 km di utara ibukota,Damaskus.Banyakwarga Syria menganggap Homs sebagai “ibukotaRevolusi.”Senin,pasukan keamanan tewas sekurang-kurangnya 42 orang, sebagian besar di Homs. “Hari ini tenang, tidak seperti sebelumnya,” kata Saleh Selasa. “Penembakan yang berlangsung beberapa hari, namun sekarang tidak terjadi penembakan. Berembuk dengan gubernur Para pemantau Arab bertemu dengan gubernur provinsi Homs, Suriah, Selasa pada awal misinya untuk menghentikan pertumpahan darah sembilan bulan di negara itu. Delegas pemantau Liga Arab itu mulai berembuk dengan Gubernur Homs GhassanAbdelAl,katatelevisiSyria, Dunia. Perundingan itu dilakukan setelahparaaktivismelaporkan34

dan menolak jam malam yang diumumkan militer. FEBRUARY 1 Februari : Presiden Mesir Hosni Mubarak mengatakan dia tidak akan ikut dalam pemilu mendatang pada September namun menolak untuk segera mengundurkan diri, seperempat juta pemrotes menuntut dia agar mundur. 3 Februari : Di Yaman, pengunjukrasa berpawai di beberapa kota menentang kekuasaan otoriter presiden. 6 Februari : Wapres Mesir bertemu dengan Persaudaraan Muslim (IM) dan kelompok oposisi lainnya dan menawarkan konsesi luas, termasuk pemberian kebebasan pers dan menarik kembali kekuasaan polisi dalam usaha terakhir pemerintah untuk mengakhiri pergolakan dua minggu. 7 Februari : Sudan Selatan dijadwalkan untuk menjadi negara terbaru di dunia. Hasil referendumakhirmenunjukkan98,8 persen memberikan suara memisahkan diri dari Sudan Utara. 8 Februari : Seorang eksekutif

berusia di akhir 20an tahun, saat ini berada di posisi untuk mempercayakan kendali keluarga Kim atas negara berpenduduk 24 juta jiwaitukepadagenerasiketiganya. Kakeknya Kim Il-sung, seorang tokoh yang dihormati, yang mendirikanKoreaUtarapada1948dan digantikan oleh Kim Jong-il, yang memerintah selama 17 tahun. Suratkabar terkemuka RodongSinmunSeninmenganggap Kim muda sebagai kepala Komite Sentral Partai Pekerja — satu jabatan yang tampaknya akan membuat dia menjadi pejabat tingkat atas di dalam tubuh partai berkuasa.Sebelumnya,KoreaUtara menyebutdia sebagai‘pemimpin tertinggi’ dari pasukan angkatan bersenjata yang berkekuatan 1,2 jutatentaraitudanparapemimpin tertinggimilitertelahmenyatakan janji setianta kepada Kim muda. Senin malam, Pyongyang menyebut Kim seorang‘pemim-

pin cerdas’ dan ‘kamerad penyayang’ saat dia kembali memberi hormat kepada ayahnya, yang tubuhnyaterbaringdiIstanaKumsusan Memorial. Media pemerintah menjulukinya sebagai ‘pengganti besar’ dan‘pemimpin yang luar biasa.’ Selasa, kedua pemimpin delegasi Korea Selatan itu menemui Kim Yong-nam, presiden dari PresidiumParlemenKoreaUtara, yang selalu mewakili negara dan dianggap seorang kepala negara nominal, menurut tayangan APTN. Delegasi itu telah sampai kembali di Korea Selatan setelah melayat kematian pemimpin Korea Utara Kim Jong-il. Didukung China Putra sulung almarhum pemimpin Korea Utara Kim Jongil tiba di Beijing ketika Pyongyang mempersiapkanpemakamankenegaraan bagi ayahnya, kata kantor berita Korea Selatan Yonhap,

Senin. Yonhap mengutip sumber yang mengetahui kegiatan Kim Jong-nam yang mengatakan, dia tiba di Beijing dari Macau beberapa hari lalu dan “berada dalam perlindungan China”. Badan Intelijen Nasional Korea Selatan (Korsel)menyatakantidakmemiliki keterangan mengenai laporan itu dan tidak ada konfirmasi lain. Tidak jelas apakah putra Kim Jong-il itu akan menghadiri pemakaman ayahnya Rabu di Pyongyang, kata Yonhap. Kim Jong-nam, 40, tinggal di luar negeri—terutamadiwilayahMacau, China — selama beberapa tahun ini,setelahtampaknyatidakmendapat dukungan ayahnya karena berusaha memasuki Jepang dengan paspor palsu pada 2001. Kim Jong-il akhirnya mendukung putra bungsunya dari pernikahan lain sebagai penguasa mendatang.(m10)

Google yang membantu memicu pergolakan di Mesir memberikan tenaga baru para pemrotes setelah dibebaskab dari tahanan. “Kami tidak akan menyerah,” katanya menjanjikan di Lapangan Tahrir Kairo. 11 Februar : Warga Mesir meluapkan kegembiraannya setelah pemrotes pro-demokrasi menjatuhkan Mubarak dengan satu pawai ke istananya dan televisi pemerintah. Mubarak mengundurkan diri dan menyerahkan kekuasaan kepada militer. 13 Februari : Para pemimpin militer Mesir membubarkan parlemen, membekukan konstitusi dan menjanjikan pemilihan dalam serangkaian langkah yang disambuit hati-hati oleh para pemrotes. 14 Februari : Para pemrotes turun ke jalan-jalan Iran, Bahrain dan Yaman. 15 Februari : PM Italia Silvio Berlusconi menghadapi peradilan atas berbagai tuduhan tentang dia membayar seorang gadis remaja berusia 17 tahun dari Maroko untuk melakukan hubungan seks dan kemudian dia

menggunakan pengaruhnya untuk menutupi itu. 20 Februari : Di Libya, militer Moammar Khadafi melepaskan tembakan senjata berat ketika ribuan orang berpawai di satu kota sebelah timur yang berusaha lakuan pemberontakan. Mereka menembaki para pelayat yang berusaha memakamkan para korban serangkaian penembakan sebelumnya yang berjumlah lebih dari 200 orang. 26 Februari : Presiden AS Barack Obama mengatakan Khadhafi telah kehilangan kekuasaannya dan mendesak pemimpin Libya itu meletakkan jabatan. MARET 4 Maret : Penangkapan, pembunuhan dan kehilangan menjaditerordiTripoliketikaKhadafi melakukan penumpasan ataspergolakanyangtimbul,para pejuangpemberontakmenguasai setengah bagian Libya Timur. 9 Maret : Pesawat angkasa luar bolak-balik Discovery mengakhiri karirnya sebagai pesawat angkasa luar AS yang paling banyakmelakukanpenerbangan,

kembali dari untuk terakhir kalinya. 11 Maret : Gempa bumi berkekuatan 9,0 skala Richter mengguncang pantai timurlaut Jepang dan menimbulkan tsunami, yang menewaskan hampir 20.000 orang dan menyebabkan kerusakan berat atas stasiun listrik tenaga nuklir Fukushima Dai-ichi, kecelakaan nuklir terbesar setelah Chernobyl. 12 Maret : Liga Arab meminta Dewan Keamanan PBB untuk mengenakan zona larangan terbang untuk melindungi pemberontak Libya ketika pasukan Libya maju menuju posisi pemberontak yang memiliki persenjataan buruk. 14 Maret : Terjadi kebocoran radiasi dari pembangkit listrik tenaga nuklir Fukushima di Jepang setelah satu reaktor ketiga retak akibat ledakan dan reaktor keempat terbakar. 18 Maret : Pada satu unjukrasa massal terhadap pemerintah Yaman, penembak jitu menembaki para pemrotes dari atas atap bangunan, yang menewaskan 46 orang, termasuk anak-

RAMALLAH,Tepi Barat (Waspada): Para petinggi dan juga fraksi diPalestinasudahsepakatuntukmenekanDewanKeamananPerserikatan Bangsa-Bangsa(PBB)demimendapatkankeanggotaanpenuhdiPBB. Salah seorang pejabat Fatah, Bassam Al Sahli menga-takan, pejabat Otoritas Palestina dan beberapa fraksi di Palestina akan menuntut agar voting DK PBB untuk keanggotaan Palestina dilaksanakan. “Meski kami gagal mendapatkan keanggotaan lewat voting DK PBB, kami tetap akan mendesak PBB agar kami menjadi anggota penuhnya,” ujar Bassam, seperti dikutip Gulf News, Selasa (27/ 12). Hingga saat ini, Palestina tampaknya tidak akan mendapatkan sembilan dukungan di DK PBB untuk meraih keanggotaan penuh di organisasi tersebut. Palestina sebelumnya sudah berhasil mengamankan sembilan suara, namun Amerika Serikat (AS) berhasil membujuk Bosnia agar tidak mendukung Palestina. Sikap abstain yang dicetuskan oleh Inggris dan Prancis juga semakin memperumit keanggotaan Palestina di PBB. “Dengan tegas, kami menolak tekanan AS dalam proposal keanggotaan Palestina di PBB. Kami menilai, proposal keanggotaan itu adalah hal yang tak dapat diubah. Kami tidak akan tunduk dalam segala bentuk ancaman dan tekanan, meski demikian kami akan selalu menggunakan jalur diplomasi,” tambahnya.(ok)

PM Guinea Bissau:

Usaha Kudeta Digagalkan BISSAU, Guinea Bissau (Antara/AFP): Serangan terhadap sarana tentara di Guinea Bissau adalah upaya kudeta, yang gagal, kata PM Carlos Gomes Junior dan jurubicara pemerintah. PM dan jurubicara Adiatou Djalo Nandigna memakai istilah ‘percobaan kudeta’ dan menyambut kegagalannya dalam tanggapan terbuka pertama mereka tentang serangan itu setelah pertemuan dengan parlemen. “Pada pagi ini, tentara menyerang markas (angkatanbersenjata)danmencurisenjata.Banyaktelahditangkap,termasuk pemimpin usaha kudeta itu,” kata Nandigna Senin (26/12), tanpa menyebutkan jumlah yang ditangkap atau tempat mereka ditahan. Gomes mengatakan, “Saya tidak tahu apakah politisi terlibat dalam percobaan kudeta itu. Penyelidikan akan memberitahu kita.” Saat menyambut keadaan kembali tenang, perdana menteri itu menyatakan ada gangguan pada pagi itu, tapi semuanya jelas sekarang. “Kami akan terus bekerja,” katanya. Panglima tentara Guinea Bissau sebelumnya menyatakan pasukannya menggagalkan percobaan kudeta pada Senin pagi di negara miskin Afrika Barat itu dan menangkap pemimpinangkatan laut, menuduhnya mendalangi serangan tersebut. Kepala Staf Angkatan Darat Jend. Antonio Indjai menyatakan pasukannya mengalahkan tentara pemberontak di markas tentara, yang terjadi saat Presiden Malam Bacai Sanha menjalani perawatan di Prancis. Kepresidenan pada awal bulan ini membantah kabar bahwa presiden berusia 64 tahun itu, yang menghabiskan sebagian besar masa jabatannya keluar-masuk negara bermasalah tersebut dengan alasan kesehatan, meninggal di rumah sakit di Paris.

Orang China Yang Stress Melawan ... Lewat Bantal! SHANGHAI, China (Antara/Reuters): Gelombang bantal yang bertuliskan nama bos dan guru memenuhi udara saat ratusan orang China berkumpul di Shanghai untuk mengumbar stress mereka, dan melancarkan perang bantal besar-besaran. Acara tahunan tersebut menandai tahun kelimanya dengan lonjakan minat yang sangat besar dari pekerja muda kantoran dan mahasiswa sehingga penyelenggara menggelar dua malam acara “perang bantal” sebelum Hari Natal dan merencanakan satu acara lagi pada 30 Desember. “Sekarang banyak pekerja kantoran dan mahasiswa yang menghadapi tekanan sangat berat di tempat kerja dan sekolah, jadi kami berharap bisa memberi mereka penyaluran untuk meringankan tekanan mereka sebelum akhir tahun,” kata Eleven Wang, pendiri dan otak di balik acara “perang bantal”. “Kadang-kala kita menghadapi tekanan dari bos, guru dan ujian kita, jadi hari ini kita jadi gila. Setiap orang ingin menulis di bantalnamamatapelajaranujian,gurudanbosmereka,danmenikmati serta menyalurkan stress mereka sampai sepuasnya,” dia menambahkan sebagaimana dikutip Reuters Selasa (27/12). “Setelah menyalurkan stress, kita kembali dapat menghadapi hidup sehari-hari kita dengan penuh kenikmatan,” katanya. Bantal dibagikan di pintu saat peserta memasuki ruangan, lalu emosi disulut oleh konser musik rock, dan banyak orang di ruang acara itu bergoyang dan mengayunkan bantal mereka mengikuti irama musik. Lalu saatnya “pertempuran”. Bantal memenuhi udara dan banyak‘petempur’ memilih untuk melemparkan dan bukan menggunakan bantal mereka untuk menggebuk lawan, Beberapa peserta yang tak beruntung menerima pukulan bantal bertubi-tubi di kepala mereka, tapi kebanyakan peserta malah dengan suka-rela terjun ke dalam ‘kekacauan.’ anak. 19 Maret : AS menembakkan misil penjelajah dari laut, sementara jet tempur Prancis menembaki pasukan Khadafi, sebagai awal dari usaha internasional mendukung pergolakan di Libya yang tampaknya hampir kalah melawan pasukan Khadafi. 21 Maret :Warga Syria meneriakkan ‘Jangan Takut’ melakukan pawai setelah satu penumpasan maut yang dilakukan pemerintah gagal untuk menghentikan protes besar tiga hari di kota Deraa, Syria Selatan. 23 Maret : Aktris pemenang Oscar dan aktivis penelitian AIDS, Elizabeth Taylor meninggal dunia dalam usia 79 tahun. 25 Maret : Krisis nuklir di pembangkit listrik tenaga nuklir Fukushima mencatat perkembangan baru bahwa kontaminasi nuklir kemungkinan lebih buruk dari yang diperkirakan. 6 April : Portugal menjadi negara ketiga Eropa yang dililit krisis keuangan dan membutuhkan talangan, menyusul Irlandia dan Yunani. 13 April : Mubarak, presiden

terguling Mesir, dan dua putranya ditahan untuk menjalani penyelidikan kasus korupsi, penyalahgunaan kekuasaan dan pembunuhan atas pemrotes. 15 April : NASA menyiarkan data dari misi pemetaan angkasa luar, yang memungkinkan siapapun dengan akses internet untuk membaca dengan teliti jutaan galaksi, bintang, asteroid. 21 April : Jepang menerapkan larangan masuk ke satu kawasan luas di sekitar pembangkit listrik tenaga nuklir Fukushima guna mencegah puluhanribu penduduk agar tidak kembali ke rumahmerekasetelahdievakuasi. 22 April : Pasukan keamanan Syria melepaskan tembakan ke arah para pemrotes, yang menewaskan sekurang-kurangnya 75 orang di berbagai kota di negeri itu. 23 April : Presiden Yaman setuju untuk mengundurkan diri dan menyerahkan kekuasaan pada deputinya. 29 April : PangeranWilliam dari Inggris dan Kate Middleton menikah di Westminster Abbey, London. (bersambung)


WASPADA Rabu 28 Desember 2011


China Ujicoba Kereta Api Super Cepat CHINA melakukan ujicoba kereta api super cepat yang mampu menempuh perjalanan 500 km per jam Senin (26/12). Negara panda tersebut terus melaju dalam mewujudkan ambisi perkeretaapian tercanggih meski masih menghadapi masalah serius pada jaringan kereta api cepatnya. Kereta api yang dibuat perusahaan CSR Corp Ltd, perusahaan pembuat kereta api terbesar China, dirancang untuk menyerupai pedang kuno China, demikian laporan kantor berita China Xinhua. “Kereta api ini akan me-

menuhi referensi bagi operasi kereta api berkecepatan tinggi saat ini,” kata pakar kereta api Shen Zhiyun. Tapi sebenarnya kereta api masa depan China tidak perlu memiliki kecepatan seperti itu, kata Kepala CSR Zhao Xiaogang

kepada Beijing Morning News. “Kami hanya bertujuan untuk memastikan keamanan dan keselamatan kereta api yang beroperasi,” katanya. Industri kereta api China tahun ini menghadapi masa yang berat setelah terjadi tabrakan antara dua kereta api cepat pada Juli lalu yang menewaskan sedikitnya 40 orang. Akibatnya, pembangunan kereta api cepat di China hampir dihentikan. Februari lalu, menteri urusan kereta api, Liu Zhijun, seorang tokoh penting di belakang sektor perindustrian kereta api cepat, dipecat karena tuduhan korupsi. Tokoh ini belum juga disidangkan di pengadilan. Syafri/CNN

Milioner India Bingung Mau Investasi Di Mana TIDAK berlebihan bila dikatakan Ajay Piramal duduk di atas tumpukan uang. Dia adalah salah seorang milyuner India yang memiliki sejumlah perusahaan - Vodafone Essar (di bidang telekomunikasi), Piramal Capital dan IndiaReit (di bidang real estate). Begitupun, saat ini dia tengah bingung kekayaannya mau dibuat apa. “Masalahnya bukan kesempatan,” kata Ajay. “Masalahnya ini India. Setiap investasi besar, maka di sana tidak akan ada transparansi,” cetusnya. Dilema yang dihadapinya merupakan sinyal yang mengkhawatirkan bagi India. Di negara yang digerogoti korupsi, birokrasi yang rumit dan kebijakan pemerintah yang tidak jelas serta berubah-ubah, orang-orang yang tumbuh menjadi milyuner mulai berpikir “ini saatnya meninggalkan India karena lebih mudah berbisnis di tempat lain.” Mei tahun lalu, bisnis kesehatan Ajay berhasil menjual obat generik ke perusahaan farmasi terbesar AS, Abbot Laboratories, dengan nilai 3,8 miliar dolar. Melihat potensi yang besar tersebut, Ajay berniat memperluas pabrik kimianya, namun birokrasi mengatakan untuk itu perlu waktu lima tahun. “Perusahaan yang sama bisa didirikan di China hanya dalam waktu dua tahun,” katanya. “Saya cinta India, tapi saya juga tidak mau mengecewakan langganan saya,” ujarnya. Kantor Ajay terletak di satu kawasan luas milik keluarganya di Mumbai. Bangunan di sekitarnya bercat putih dengan kaca biru yang memantulkan sinar matahari menyandang namanya dengan huruf besar: Piramal Towers. Investasi terbesar Piramal Group adalah pembangunan kawasan yang di sana juga berdiri perusahaan telekom raksasa Inggeris, Vodafone Plc. September lalu, setelah mereka mendapatkan pembayaran dari Abbott, berbagai tawaran mulai berdatangan kepada me-

PARA pengunjung menaiki kereta api peluru super cepat pada upacara peluncurannya di Qingdao, Provinsi Shandong.

Jembatan Daur Ulang Terpanjang Di Dunia AJAY PIRAMAL ketika diwawancara AP. reka. “Karena orang tahu kami punya uang, banyak orang yang mendekati kami untuk pembangunan proyek infrastruktur,” katanya. “Bukan saya tidak mau dan tidak ingin membangun jalan, tapi orang-orang ini tidak punya pengalaman dan pengetahuan dalam bisnis ini. Walau mereka datang dengan memperlihatkan surat ijin dan berbagai surat jaminan, kami tetap tidak percaya,” jelas Ajay tentang pengalaman yang dihadapinya. Setiap hari mereka berparade ke kantornya, seperti para bankir, pedagang batu-bara, para petambang, para pengeluar ijin dan para penyandang dana. “Mereka semua menyebutkan nama-nama para politikus pendukung mereka. Tapi saya tetap tidak percaya karena saya lihat banyak proyek yang kualitasnya tidak bagus,” jelas Ajay. Apalagi saat ini, perusahaan infrastruktur India dikenal sebagai penghancur kekayaan terbesar. “Penanaman modal di bidang infrastruktur tidak bisa disentuh, sehingga itu sama dengan membiarkan uang kita hilang begitu saja,” kata Jagannadham Thunuguntla, Kepala Penelitian Di SMC Global Securities. Dia mengatakan, empat perusahaan infrastruktur teratas India – GMR Infrastructure, GVK Power and Infrastructure, Lanco Infratech and Punj Lloyd

– telah kehilangan 80 persen kekayaan mereka. Korupsi Merajalela India sebenarnya termasuk negara di mana pertumbuhan ekonomi relatif cepat, dan seharusnya menjadi magnet bagi masuknya modal. Namun, sebaliknya sejak awal tahun 2010, jumlah warga India yang menanamkan modal di luar negeri jauh melebihi jumlah orang asing berinvestasi di India, demikian data bank sentral. Rasa frustasi yang dirasakan para elit bisnis India terhadap korupsi yang merajalela, lumpuhnya perpolitikan, peraturan yang tumpang tindih, serta terbatasnya akses untuk mendapatkan sumber daya alam – sudah mencapai puncaknya dan hal ini mungkin tidak didengar kalangan berkuasa yang mulai meliberalisasiperekonomiannya. “Jika Anda seorang pengusaha yang jujur di India, maka akan sulit untuk memulai sesuatu,” kata Jamshyd Godrej, Kepala Pabrik Godrej & Boyce. “Perusahaan akan beroperasi di mana perusahaan tersebut melihat peluang terbaik dan efisiensi bagi modal mereka.” Ajay masih menyimpan keinginanannya untuk mengelola perusahaan farmasi dan menjadi perusahaan pertama di India yang menemukan obat kelas dunia.Syafri/AP

TERHAMPAR di atas air tenang Sungai Tweed di Peeblesshire, Skotlandia, jembatan Dawyck Estate telah memecahkan record. Dengan panjang 30 meter dan terbuat seluruhnya dari produk limbah plastik, bangunan yang baru selesai dibangun itu merupakan jembatan terpanjang dan jembatan daur ulang paling kokoh di dunia. Terdiri dari campuran materi plastik super kuat - yang diciptakan sejumlah peneliti di Universitas Rutgers dari bendabenda berupa botol plastik dan limbah plastik rumah tangga jembatan tersebut bisa dilalui para pejalan kaki, mobil dan kenderaan berat. Jembatan tersebut merupakan satu di antara lima bangunan semacam yang sekarang ada di atas muka bumi, meski pun empat bangunan lainnya lebih kecil dan terdapat di Amerika Serikat, dan bisa menopang kenderaan seberat 44 ton. Menurut Vertech Composites, perusahaan Inggeris yang merancang proyek tersebut, jembatan itu merupakan contoh yang memiliki potensi untuk memenuhi persyaratan bagi jalan berkualitas dan jembatan di masa depan yang bersahabat dengan alam. “Saat ini dibutuhkan banyak jembatan atau alat untuk menyeberangi sungai di kawasan pedesaan. Dan jumlah itu akan bertambah pada masa-masa mendatang,” kataWilliam Mainwaring, Pejabat Eksekutif Vertech Composite. Dengan cara ini, William ingin memperlihatkan bahwa plastik-plastik usang masih bisa

Eskalator Raksasa Untuk Kawasan Kumuh PEMERINTAH kota Medellin di Kolombia meresmikan pemakaian eskalator raksasa yang dibangun di luar ruangan untuk warga di kawasan kumuh kota itu. Warga yang hidup di distrik Comuna 13, yang lokasinya menggantung di sisi bukit terjal, sebelumnya harus naik turun bukit dengan tangga yang terdiri dari ratusan anak tangga untuk bepergian ke mana-mana. Kini tangga jalan bersejarah itu akan memudahkan mereka beraktivitas karena dibuat dalam bentuk potongan enam bidang dan mencapai ketinggian sekitar 384m. Wali Kota Medellin mengklaim proyek pembangunan tangga berjalan untuk membantu warga naik-turun bukit sekitar tempat tinggal mereka di kawasan miskin ini adalah untuk yang pertama kalinya di dunia. Tahun 1980an Medellin dikenal sebagai kota yang penuh kekerasan dan sering terjadi tindak pembunuhan. Kota ini di kenal sebagai pusat kegiatan jual-beli obat bius, bahkan nama kota itu menjadi salah satu nama kartel narkotika paling menakutkan di dunia. Tetapi beberapa tahun terakhir reputasi itu sudah mulai berubah. Lima Menit Proyek pembangunan eskalator bernilai US$7 juta atau sekira Rp63,5 miliar ini merupakan salah satu upaya terakhir pemerintah setempat untuk mengubah citra kota itu. Sejauh ini Medellin sudah punya sistem kereta api dalam kota yang modern, sementara kawasan di sisi lain bukit juga sudah dilayani kereta kabel. Sekira 12.000 warga distrik Comuna 13 akan diuntungkan oleh proyek eskalator ini, yang bisa dimanfaatkan tanpa dipungut biaya dan memangkas waktu perjalanan dengan berjalan kaki dari, setengah jam menjadi hanya lima menit. Sebelumnya untuk mendaki atau menuruni tangga, warga harus berjalan kira-kira mengitari bangunan setinggi 30 lantai kalau hendak pergi atau kembali dari rumah menuju pusat kota dan sebaliknya. Comuna 13 sampai kini tetap merupakan kawasan paling miskin dan rawan di Medellin. Namun pembangunan tangga jalan ini, dikombinasikan dengan berbagai proyek lain, akan membantu perbaikan kehidupan warga setempat dan menarik mereka ke arah kesempatan ekonomi yang lebih luas. (bbc/rzl)

dipergunakan daripada dibakar atau dibuang ke tempat-tempat sampah dan keuntungan utama bagi lingkungan adalah dihasilkannya jembatan itu. Dia juga menambahkan bahwa campuran plastik daur ulang itu menjadi benda alternatif yang bersifat lebih berkesinambungan dibanding bangunan jembatan yang ada saat ini dan kemungkinan tidak berdegradasi seperti baja, kayu dan semen. “Teknologi ini menciptakan kesolidan dan kekuatan yang cocok untuk bangunan seperti jembatan,” kata William. “Bila jembatan tersebut

habis masa gunanya, maka plastik ini bisa didaur ulang kembali dan digunakan untuk keperluan lain, yang artinya benda ini tidak akan pernah memenuhi tempat sampah,” tambahnya. Begitupun, terwujudnya semakin banyak orang melintasi jalan atau jembatan yang terbuat dari plastik masih membutuhkan waktu cukup lama. “Jembatan di Peeblesshire dibangun di atas lahan pribadi, sehingga menghindari regulasi keamanan dari departemen transportasi Inggeris,” kata Profesor Bob Lark, Ketua Sekolah Teknologi di Universitas Cardiff,

yang terlibat dalam membantu merancang aspek struktur dari proyek Dawyck Estate. Profesor Bob meyakini menghindari rintangan aturan legislatif masih perlu dilakukan di saat standar bangunan saat ini disusun berdasarkan materi yang ada dan tidak menyinggung benda yang baru dikembangkan. Begitupun, teknologi ini memiliki potensi untuk digunakan pada sektor konstruksi lainnya. Kesempatan seperti itu tidak luput dari perhatianVertech Composite, yang sangat perhatian pada usaha menemukan dan menciptakan cara baru da-

lam menggunakan teknologi plastik. “Kami melihat potensi itu bagi plastik yang didaurulang dengan cara yang sama untuk digunakan bagi pembuatan jalan, sebagai ganti kayu di bangunan-bangunan dan pertanian, yang saat ini masih menggunakan kayu untuk kandang ternak,” kata William. “Materi-materi seperti kayu pada umumnya lebih cepat mumuk dibanding plastik, sehingga ada peluang untuk meningkatkan efisiensi dan memberi dampak positif bagi lingkungan,” tambahnya. Syafri/CNN

JEMBATAN terbuat dari plastik daur ulang ini dirancang untuk bisa menopang mobil dan kenderaan besar dengan berat maksimal 44 ton. /CNN

Perceraian Termahal Dalam Sejarah BILA menikah lagi, tampaknya Mel Gibson bakal berpikir ulang untuk bercerai. Sebab, dalam perceraiannya kali ini, aktor sekaligus produser dan sutradara itu harus memberikan gonogini sekira US$425 juta atau sekira Rp 3,8 triliun kepada mantan istrinya. Uang itu lebih banyak dari biaya pembuatan ‘Avatar’ (US$ 400 juta atau setara Rp 3,6 triliun) yang disebut sebagai film termahal saat ini. Mel Gibson resmi menyandang status duda setelah Pengadilan Los Angeles memutus sidang cerainya pada Jumat pekan lalu. Namun, perceraian dari Robyn “perempuan yang dinikahinya selama 30 tahun terakhir” itu harus dibayar mahal. People pun menyebut gana-gini perceraian Gibson tersebut sebagai yang termahal dalam sejarah Hollywood. Karena tak mempunyai perjanjian pranikah, mantan istrinya yang berusia 55 tahun itu berhak atas separuh total harta Gibson yang diperkirakan US$ 850 juta (Rp 7,6 triliun). Total harta pria 55 tahun itu merupakan perkiraan Los Angeles Business Journal pada 2006. Namun, tidak disebutkan pemegang hak asuh tujuh anak pasangan tersebut. Salah satu aset Gibson adalah pendapatan dari film laris ‘The Passion of the Christ’ sebanyak US$ 600 juta (Rp 5,4 triliun). Aset investasi dan propertinya sebanyak US$ 100 juta (Rp 900 miliar). Di antaranya, pulau di Fiji yang dibeli US$ 15 juta (Rp 135 miliar) pada 2005. Ada juga US$ 75 juta (Rp 678 miliar) dari sejumlah proyek film dan TV yang diproduseri bintang yang berulang tahun tiap 3 Januari tersebut. People melansir, sejumlah harta sudah dipindahtangankan kepada Robyn. Di antaranya, dua rumah mewah di Malibu seharga US$ 22,5 juta (Rp 203 miliar). Bahkan, Robyn bakal menerima separo pendapatan Gibson sampai akhir hayatnya. Keretakan pernikahan pasangan tersebut tercium sejak akhir 2009. Gibson menjalin hubungan dengan musisi perempuan Rusia Oksana Grigorieva. Dalam sebuah pengakuan yang direkam Grigorieva, Gibson menjelaskan alasan dirinya tak bisa bersama Robyn. “Aku meninggalkan istriku karena kami tak mempunyai kesamaan jiwa. Tak punya lagi visi spiritual yang sama,” tutur Gibson. Pada pertengahan 2010 juga terjadi konflik antara Grigorieva dan Gibson. Grigorieva menuntut Gibson di pengadilan dengan laporan kekerasan. Namun, Robyn membela Gibson. Dalam pernyataan dibawah sumpah pada Juli 2010, kesaksian Robyn


MEL GIBSON dan pasangan terakhirnya Oksana Grigorieva. menguntungkan Gibson. “Mel adalah figur ayah yang baik dan penuh kasih. Mel tak pernah menganiaya atau melakukan kekerasan terhadap saya maupun anak-anak,” tutur Robyn. Meski begitu, rumah tangga Gibson-Robyn tak bisa dipertahankan. Mereka pun resmi bercerai dua hari sebelum Natal. Gibson kali pertama bertemu Robyn pada akhir 1970-an. Ketika itu Robyn adalah perawat dokter gigi dan Gibson tengah syuting salah satu film hitsnya, Mad Max. (net/rzl)



Mancini Masih Yakin Kampiun





Optimis Terus Tekan Citizens

LONDON (Waspada): Manajer Manchester City Roberto Mancini, masih yakin pasukannya bakal menjadi kampiun Liga Premier musim ini.


MANCHESTER (Waspada): Gelandang Manchester United (MU) Park Ji-Sung, percaya kemenangan 5-0 dua kali berturut-turut yang mereka torehkan atas Fulham (20/12) danWigan (26/12), berdampak ganda menatap sisa laga musim ini, Pertama, memulihkan keyakinan Setan Merah setelah sempat anjlok akibat dipermalukan Manchester City dalam derbi di Old Trafford, Oktober lalu. Kedua, meningkatkan tekanan terhadap City, yang masih memimpin di puncak klasemen Liga Premier hanya dengan keunggulan selisih gol dari United. “Tujuan kami adalah berada di depan. Kami selalu mencoba menampilkannya pada periode ini, kami hanya mencoba untuk membuat kinerja kami semakin tinggi,” papar Park kepada, Selasa (27/12). “Kami masih setengah jalan melalui musim, dan kami akan terus menekan City,” tambah gelandang senior MU asal Korea Selatan tersebut. Mengenai problem cedera yang melanda beberapa pemain Setan Merah, Park yakin, manajer Sir Alex Ferguson punya solusi jitu untuk mengantisipasinya. “Susunan pemain kami berubah (melawan Wigan) dibandingkan dengan laga terakhir kami lawan Fulham,” ungkapnya. “Tapi, kami masih terus mengeluarkan penampilan yang sama seperti lawan Fulham. Ini baik untuk tim dan ini membuktikan bahwa skuad kami cukup kuat,” tambah Park. Masalah cedera MU malah bisa dikatakan mencapai titik kritis di lini bawah dengan tumbangnya bek Jonny Evans, melengkapi derita Phil Jones, Chris Smalling, dan Rio Ferdinand. Di lini tengah dan depan, The Red Devils juga belum bisa memainkan Tom Cleverley, Anderson, Ashley Young dan Michael Owen. Menurut Sir Fergie, itu memang konsekuensi dari musim kompetisi yang panjang. Dia punya pengalaman untuk mengatasinya, terbukti MU kini sudah menyamai nilai Citizens di puncak klasemen, setelah sempat tertinggal lima angka pada awal Desember lalu. “Seperti yang sudah sering saya katakan,


satu musim dalam sepakbola itu panjang. Jika kami bisa di puncak klasemen pada tahun baru, saya akan senang,” beber Sir Fergie. (m15/afp/mf)

Minta Merah Lebih Percaya


LONDON (Waspada): Pelatih Liverpool Kenny Dalglish (foto) mengaku, timnya perlu lebih percaya diri untuk meraih hasil positif dan konsisten pada sisa musim ini di Liga Premier. “Kami hanya perlu sedikit lebih percaya pada diri sendiri. Itu yang paling penting, setelah kami mengalami mimpi buruk (di awal musim),” jelas Dalglish, seperti diberitakan AFP, Selasa (27/12). Kesimpulan itu dia keluarkan setelah Si Merah hanya mencetak empat gol dari lima laga terakhir di liga. Teraktual, The Kop ditahan tim papan bawah Blackburn Rovers 1-1 pada laga bertajuk Boxing Day 26 Desember di Anfield Stadium, sehingga kehilangan peluang untuk

menembus zona Liga Champions. Sebelumnya, Merah juga telah ditahan 0-0 oleh tim semenjana Wigan Athletic di DW Stadium, 20 Desember lalu. “Setelah beberapa pertandingan mengecewakan, saya katakana kami memiliki lebih dari cukup kesempatan untuk memenangi laga. Kinerja (tim) mungkin telah lebih baik, tetapi tidak ada komplain mengenai jumlah peluang yang kami ciptakan,” tukas Dalglish. “Hal terpenting bagi kami adalah sikap. Kami masih mengalami kebuntuan sampai menit terakhir, di mana kami tetap berjuang untuk kemenangan,” tambah mantan striker fenomenal The Reds tersebut. Kabar baiknya, duel lawan The Rovers menjadi penampilan perdana Steven Gerrard, setelah sang kapten absen sejak 22 Oktober karena infeksi pergelangan kaki. Gerrard sudah tidak merumput pada 10 pertandingan liga dan piala. Dia diturunkan Dalglish menit 69 menggantikan Charlie Adams, sehingga diprediksi akan menjadi starter saat melawan Newcastle United, Jumat mendatang. “Steven melakukan latihan dengan sangat baik. Dia kelihatannya sangat sehat, tetapi dia butuh waktu di lapangan untuk mendapatkan kebugaran total,” pungkas Dalglish. (m15/ant/afp)

Mourinho Tekankan Kejeniusan LONDON (Waspada): Entrenador Real Jose Mourinho menekankan pentingnya kejeniusan pemain untuk menggapai sukses tim. “Saya kira kejeniusan akan membuat segala sesuatunya berbeda. Kejeniusan menurut saya menyangkut para pemain hebat dan yang dapat bekerjasama dalam satu organisasi,” ujarnya kepada BBC, yang dikutip Selasa (27/12). Kejeniusan pemain itu pula, menurutnya, menjadi kunci suksesnya meraih prestasi saat membesut Inter Milan, Chelsea dan FC Porto. Mourinho menukangi Madrid sejak 2010 dan merebut gelar Copa Del Rey pada musim pertamanya. Di paruh musim keduanya saat ini, pelatih kontroversial asal Portugal itu mampu membawa Los Blancos memimpin di puncak


PELATIH Madrid Jose Mourinho (kiri) ibarat ayah sekaligus guru bagi Mesut Ozil.

klasemen La Liga Primera dan lolos ke babak 16 besar Liga Champions. “Kejeniusan dalam membina juga harus ada. Sepakbola bagi saya merupakan ilmu kemanusiaan, ini menyangkut pengetahuan tentang orang atau manusia,” tuturnya. “Saya bisa mempersiapkan para pemain sebaik yang saya inginkan, tapi pada akhirnya mereka akan memutuskan segala sesuatu di lapangan pada momen yang paling tepat. Mereka membuat segala sesuatunya menjadi berbeda,” tambah Mourinho. Di Turki, gelandang Madrid Mesut Ozil dalam wawancara dengan NTVSpor menyebutkan, Mourinho sebagai figur ayah sekaligus guru dalam karier sepakbolanya. “Mourinho seperti ayah bagi saya. Dia guru yang hebat, berkarakter kuat dan pelatih yang sangat peduli kepada semua pemainnya,” sanjung bintang Jerman berdarah Turki tersebut. Pria berusia 23 tahun itu juga mengaku masih sangat kecewa, karena El Real kalah telak 13 dalam laga El Clasico melawan Barcelona di Santiago Bernabeu, 10 Desember lalu. Tapi setelah itu Madrid mampu bangkit dengan menggebuk Sevilla 6-2, sehingga tetap bertahta di puncak klasemen. “Hasil buruk itu terjadi karena kami bermain buruk. Tapi kini kami masih memimpin La Liga dengan keunggulan tiga poin (atas Barca). Saya ingin mengangkat trofi bersama Jerman dan Real Madrid pada 2012,” tekad Ozil. (m15/bbc/dpa)

PSSI Resmi Depak La Nyalla Cs JAKARTA (Waspada): PSSI akhirnya membuat keputusan penting terkait empat anggota Komite Eksekutif (Exco) PSSI, yakni La Nyalla Mattalitti, Erwin Dwi Budiawan, Roberto Rouw, dan Tony Apriliani. Melalui Surat Keputusan (SK) yang diterbitkan Majelis Etik PSSI berisikan pemberhentian permanen terhadap empat anggota Exco yang dinilai telah melakukan pelanggaran etika organisasi, pemecatan diumumkan juru bicara PSSI, Eddi Elison, di kantor PSSI, Selasa (27/12). Menurut Eddi, sanksi semula diberikan kepada La Nyalla cs berdasarkan SK No 001/ PTS/M-KE-PSSI/XII/2011 tertanggal 19 Desember 2011 yang meminta keempatnya meminta maaf karena melakukan pelanggaran etika. Dalam SK tersebut, keempatnya telah diminta berjanji menghentikan tindakan pelanggaran etika dan tidak mengulangi pelanggaran etika dalam segala bentuk dan jenisnya di PSSI.

WASPADA Rabu 28 Desember 2011

“Pelaksanaan sanksi ini harus diterima Ketua Umum PSSI dan Komite Eksekutif PSSI serta AFC dan FIFA dalam waktu 2x24 jam sejak selesai dibacakan putusan ini,” kata Eddi. Ditambahkan, apabila setelah batas waktu yang ditentukan di atas sanksi tersebut tidak dilaksanakan seluruhnya, keempat anggota Exco tersebut dijatuhkan sanksi pemberhentian permanen dari Komite Eksekutif PSSI maupun kegiatan persepakbolaan di tanah air. “Karena sudah melewati batas waktu tersebut, keempat anggota Exco itu langsung diberhentikan secara permanen dari aktivitas sepakbola di lingkungan PSSI,” tegas Eddi lagi. Karena tidak melaksanakan putusan Komite Etik, imbuh Eddi, keempatnya diberhentikan dari keanggotaan Exco dan kepengurusan lain yang melekat secara permanen. “Ini sesuai dengan SK bernomor 002/PTS/ M-KE-PSSI/XII/2011 tertanggal 26 Desember 2011,” pungkasnya. (yuslan)

“Saya tetap percaya pada akhirnya kami bisa melakukan pekerjaan bagus. Ini penting untuk bertahan dengan peluang meraih gelar juara di akhir,” ucapnya, seperti dilansir Reuters, Selasa (27/12). Syarat utamanya, menurut pelatih asal Italia itu, Mario Balotelli dan kawan-kawan mesti mampu menaklukkan rival sekota Manchester United. Kedua tim Kota Manchester itu kini memimpin bersama di puncak klasemen dengan 45 poin dari 18 pertandingan. “Jika ingin memenangkan gelar, kami harus bermain baik melawan United. United memiliki tim tangguh, tetapi kami cukup kuat untuk mewujudkannya,” klaim Mancini. The City sempat unggul lima poin di atas MU. Pasukan Mancini bahkan telah mempermalukan The Red Devils 6-1 pada jumpa pertama musim ini di Stadion Old Trafford, Oktober lalu. Tetapi jarak terpangkas kemudian menjadi sama pada bulan Desember, setelah Manchester Biru dipecundangi Chelsea 2-1 di Stamford Bridge (12/12), lantas ditahan West Bromwich 0-0 pada laga bertajuk Boxing Day (26/12). Di periode yang sama, United malah sukses membantai Wolves 4-1 dan Wigan 5-0. “Laga lawan West Brom membuat frustrasi, karena kami tidak bisa mencetak gol. Jika Anda tidak mencetak gol dalam permainan seperti ini, maka jelas sulit untuk menang,” dalih Mancini. “Kami sebenarnya memiliki dua atau tiga peluang untuk

Klasemen Liga Premier Man City Man United Tottenham Chelsea Arsenal Liverpool Newcastle Stoke City West Brom Everton Norwich Aston Villa Fulham Sunderland Swansea QPR Wolves Wigan Bolton Blackburn

18 14 3 18 14 3 16 11 2 18 10 4 17 10 2 18 8 7 18 8 6 18 7 4 18 6 4 17 6 3 17 5 6 18 4 8 18 4 7 18 4 6 17 4 6 17 4 4 17 4 3 18 3 5 18 4 0 18 2 5

1 53-15 1 47-14 3 32-19 4 36-21 5 33-25 3 21-14 4 25-22 7 18-28 8 19-26 8 18-20 6 27-31 6 19-23 7 19-24 8 22-22 7 16-21 9 17-31 10 19-32 10 15-35 14 22-41 11 25-39

45 45 35 34 32 31 30 25 22 21 21 20 19 18 18 16 15 14 12 11

*Belum termasuk hasil laga Selasa (27/12).

mencetak gol di babak pertama. Tapi tidak ada yang berbuah gol, sehingga sulit bagi para pemain untuk mencari solusi yang bagus,” tambah mantan pelatih Lazio dan Inter Milan itu. Akhir pekan nanti, agenda laga sepertinya juga belum berpihak kepada The Eastlands. Pasukan Mancini menyambangi markas Sunderland pada 1 Januari 2012, sehari sebelumnya United justru hanya menjamu Blackburn Rovers. “Kami tahu persaingan akan menjadi ketat, tidak ada keraguan tentang hal itu. Kami hanya harus memetik poin yang mesti kami ambil. Paruh kedua musim ini akan menarik,” kata kapten Vincent Kompany dalam Mirror Football. Bek sentral Citizens asal Belgia itu juga menyesalkan performa rekan-rekannya, yang ba-


STRIKER City Mario Balotelli (kiri) gagal memenuhi tuntutan gol dari manajer Roberto Mancini di The Hawthorns Stadium. nyak membuang peluang saat menjajal West Brom di The Hawthorns Stadium. Eastlands menurut Kompany, kurang punya naluri membunuh hingga terganjal hasil tanpa gol. “Kami memiliki peluang untuk mencetak gol, tapi kami ti-

dak memiliki naluri membunuh. Akhirnya ini menjadi laga sulit bagi kami. Tentu akan menjadi sempurna jika kami mencetak gol di awal, itulah yang sebenarnya ingin kami lakukan,” ujarnya lagi. “Kami mungkin kehilangan

ketajaman kali ini, padahal itu sesuatu yang bagus dari kami musim ini. Namun saya pikir masih ada beberapa sisi positif dari laga ini, saya tidak berpikir ini kinerja buruk kami,” tambah Kompany. (m15/rtr/espn/sky)

Mimpi Buruk MU

Pilih Risiko Tetap Lazio PARIS (Antara/AFP): Penyerang Prancis Djibril Cisse membatalkan pembicaraan mengenai kembalinya dia ke bekas klubnya AJ Auxerre. Seperti dikutip dalam akun twitter miliknya, Selasa (27/12), bomber eksentrik itu menegaskan keinginannya untuk tetap bermain di klubnya saat ini, SS Lazio. “Hai teman-teman, saya mendengar banyak hal mengenai saya. Oleh karena itu saya ingin menjelaskan situasinya, saya akan tetap bermain di Lazio dan menunjukkan siapa diri saya sebenarnya,” tulis Cisse. “Saya bukan orang yang gampang menyerah, saya seorang pejuang dan saya akan menyampaikan kepada kalian semua terima kasih saya lagi atas dukungan dan saya tengah menantikan untuk mulai bermain lagi,” tambah bomber berumur 30 tahun itu. Cisse hingga kini menjalani musim yang sulit, sehingga penuh risiko jika tetap bersama I Biancoceleste di Roma. Mantan penyerang Liverpool itu kalah bersaing dengan kapten Tomasso Rocchi dan striker Jerman Miroslav Klose. Pekan lalu, Presiden Auxerre Gerard Bourgoin mengkonfirmasi bahwa klubnya tertarik untuk memboyong Cisse ke tempat dia mengawali karier.


Cisse sudah mencetak 70 gol liga dalam empat musim bersama Auxerre dan menjadi pencetak gol terbanyak di Ligue 1 Prancis pada tahun 2002 dan 2004, sebelum pindah ke Liverpool. Bomber dengan banyak tato itu juga pernah bermain di Marseille, Sunderland serta klub raksasa Yunani, Panathinaikos, sebelum pindah ke Italia dengan Lazio pada musim panas lalu.

LONDON (Antara/AFP): Manajer Manchester United Sir Alex Ferguson mengakuk, timnya mengalami mimpi buruk dengan cederanya bek Jonny Evans (foto), saat sang juara bertahan menggunduli Wigan Athletic 5-0 di Old Trafford. “Jonny keluar lapangan dengan cedera. Dia mengalami cedera betis dan akan absen selama dua pekan. Kami sudah mengalami mimpi buruk dalam beberapa hari terakhir,” beber Sir Fergie melalui Live Live Radio BBC, Selasa (27/12). Evans satu-satunya bek sentral United yang fit jelang AP laga melawan Wigan, namun pemain nasional Irlandia Utara tidak bisa muncul lagi pada babak kedua. Menurut Ferguson, Evans dipastikan absen pada partai malam Tahun Baru 2012 menghadapi Blackburn Rovers pada matchday 19 Liga Premier. “ Phil Jones dan Chris Smalling keduanya sakit. Rio Ferdinand batal tampil kemarin, karena cedera punggung dan Jonny Evans keluar lapangan saat jeda pertandingan. Ini membuat kami berada dalam tekanan,” ratap Ferguson. Sebelumnya, bek tangguh Serbia Nemanja Vidic sudah dipastikan tak bisa tampil sepanjang sisa musim ini. Sir Fergie kini berharap, Jones dan Smalling bisa pulih lebih cepat dari perkiraan semula.

Messi Pelihara Mimpi Juara Dunia


BUENOS AIRES (Waspada): Bintang Barcelona Lionel Messi (foto), masih memelihara mimpi untuk mengangkat tropi Piala Dunia bersama Timnas Argentina. “Saya masih memiliki mimpi, dan itu adalah menjadi juara dunia, juga mengangkat Copa America bersama tim nasional. Saya tahu akan melakukannya, saya yakin akan melakukannya,” tegas Messi, seperti dikutip dari AP, Selasa (27/12). Keyakinan demikian diungkapkan bomber mungil itu dalam wawancaranya dengan Asosiasi Sepakbola Argentina (AFA), yang dipublikasikan dari Buenos Aires. Messi telah memenangi banyak penghargaan bersama El Barca, tetapi dia belum pernah mendapatkan tropi apapun dengan Albiceleste, yang sudah puasa gelar sejak 1993. Teraktual, Tim Tango gagal menjuarai Copa America di negeri sendiri pada Juli 2011. Dampaknya, berbagai pertanyaan miring pun mengarah pada penampilan Messi, yang sepertinya ‘menggila’ setiap kali membela Barca. “Saya tidak harus mendemonstrasikan apapun kepada siapapun,” dalih bomber berumur 24 tahun itu. “Saya akan senang untuk memenangi gelar bersama tim nasional.

Tetapi saya hanyalah salah seorang (anggota) di kelompok ini yang ingin melakukan yang terbaik untuk sepakbola Argentina, tidak lebih,” tambah Messi. Namun menurutnya, Argentina dan Barcelona sangat berbeda. Sukses El Catalan menjadi tim terbaik di dunia, tutur Messi, mutlak sebagai hasil kerja keras bertahun-tahun dengan rekan setim yang sama. “Semakin sulit dengan tim nasional, karena kami telah melalui beberapa pemangkasan (anggota) dan pergantian pelatih dalam beberapa tahun belakangan. Tapi kami terus tumbuh dan saya tahu kami dapat memenangi banyak hal,” pungkas Messi. Bersama Tango, Messi sejauh ini baru mengoleksi gelar juara Piala Dunia U-20 pada 2005 dan emas Olimpiade 2008. Di Barca, semua gelar di Spanyol dan Eropa, telah direbut pemuda kelahiran Rosario tersebut. Pelatih anyar Argentina Alejandro Sabella, yakin Messi akan menularkan sukses di klubnya kepada timnas. Karenanya, dia meminta publik jangan lagi menghakimi sang bintang. “Kita harus tinggalkan dia sendiri, suatu hari nanti dia tidak akan datang lagi. Dia seseorang yang bisa menolong kita,” papar Sabella. “Jadi kita perlu melakukan apapun. Jika kita bisa membantu Messi, maka dia akan membantu kita,” tambah suksesor Sergio Batista tersebut. (m15/ap/afp)

Bakal Reuni Bersama Ancelotti PARIS (Waspada): Carlo Ancelotti tinggal menunggu waktu untuk diumumkan sebagai pelatih anyar Paris Saint Germain (PSG), yang kini memimpin sendirian di puncak klasemen Ligue 1 Prancis. Menurut The Sun, Selasa (27/12), kehadiran Ancelotti bahkan bakalan dibarengi dengan kedatangan bintang Inggris David Beckham, lantas menyusul Ricardo Kaka. Pasalnya, Ancelotti punya hasrat menduetkan lagi Beckham dengan Kaka, mengulangi kisah kejayaan AC Milan pada musim 2007/2008 silam. Saat itu Kaka merupakan ikon Rossoneri, sedangkan Beckham didatangkan dengan status pinjaman selama setengah musim

dari LA Galaxy. Real Madrid kemudian membeli Kaka dari Milan senilai £60 juta pada 2009. Namun serangkaian cedera membuat bintang Brazil itu gagal bersinar terutama pada era entrenador Jose Mourinho, sehingga besar kemungkinan dilepas Los Blancos. Tawaran £30 juta akan dilayangkan PSG untuk Pemain Terbaik Dunia FIFA 2007 itu. Sedangkan Beckham hampir pasti gabung, setelah kontraknya tidak dia perpanjang lagi bersama Los Angeles Galaxy. Sebelumnya, klub raksasa dari ibukota Prancis itu telah mentransfer £43 juta Javier Pastore dari Palermo. Maka kedatangan Beckham dan Kaka akan

membuat serangan PSG semakin bervariasi. Juga membuat klub itu semakin cosmopolitan pasca dikuasai Qatar Sports Investments, konsorsium asal Uni Emirat pimpinan Sheikh Mansour. Posisi Kaka kini kalah mengkilap dibanding Angel Di Maria atau Mesut Ozil. Gelandang serang berusia 29 tahun itu bisa makin terpuruk, karena Nuri Sahin juga telah pulih dari cedera. Karenanya Daily Mail melansir, Mourinho sedang menunggu penawaran terbaik untuk Kaka. Selain PSG, peminatnya adalah Milan serta Chelsea dan Arsenal. “Kaka selalu menarik minat klub lain. Mourinho telah me-


DUO mantan Milan, David Beckham dan Ricardo Kaka (kanan), kemungkinan reuni dengan Carlo Ancelotti di Paris. miliki opsi terbaik di lini tengah, maka hal terbaik adalah melego Kaka,” ungkap sumber dalam tim Madrid. “Sejauh ini belum ada

penawaran konkret. Tetapi Madrid tampaknya akan melepas Kaka jika ada penawaran £22 juta,” tambah sumber dimaksud. (m15/vvn/sun/dm)


WASPADA Rabu 28 Desember 2011


IPSI DS Juara Pencak Silat Festival Sukan Kombat MEDAN (Waspada): Pengcab IPSI Deliserdang pimpinan Ir H Marapinta Harahap mencatat prestasi juara umum pada Kejuaraan Pencak Silat Pesta Pulau Penang (Festival Sukan Kombat) di Pulang Penang, Malaysia, 20-24 Desember lalu. Tim IPSI Deliserdang berkekuatan delapan atlet dipimpin Helmawati Saragih dan duet pelatih, JumonoTarigan dan Hariki, tampil sebagai juara umum dengan merebut dua medali emas, tiga perak, dan tiga perunggu. Dua medali emas masingmasing dipersembahkan Rini Purba (kelas A putri 45-50 kg)

dan Mawar Sari (B putri 50-55 kg), sedangkan tiga perak disumbangkan M Farisy Akbar (A putra 45-50 kg), Dani Pradana (D putra 60-65 kg), dan Afriansyah (F putra 70-75 kg). Tiga perunggu diraih Dewi Ratih (C putri 55-60 kg), Musthofa Akbar (B putra 50-55 kg), dan Achsan Maulana Siagian (C putra 55-

60 kg). Ketua Umum Pengcab IPSI Deliserdang, Ir H Marapinta Harahap, mengaku bersyukur dan gembira, apalagi event ini berskala internasional. Marapinta juga memuji semangat dan kemauan bertanding anak didiknya yang begitu membanggakan. Dikatakan, Rini Purba cs tidak sedikit pun gentar sehingga berhasil meraih gelar juara umum untuk kedua kalinya, setelah 2006 lalu. “Deliserdang sudah empat kali mengikuti event ini dan dua kali tampil menjadi juara umum. Prestasi ini kami rasa

cukup baik,” ujar Marapinta di Medan, Selasa (27/12). Dijelaskan, Festival Sukan Kombat yang dilaksanakan Feskom (IPSI Pulau Penang), diikuti seratusan pesilat dari Singapura, Thailand,Vietnam, Indonesia (diwakili Pengcab IPSI Deliserdang), dan Malaysia. Marapinta juga menjelaskan enam pesilat Deliserdang dipastikan memperkuat Sumut di PON XVIII/2012 di Riau nanti. Mereka adalah Dinda Ayu Permatasari SH, Zumida Oktina, Andi Zulkarnaen ST, M Ihwa Taufik Nasution (TGR), dan M Saleh Irawan Lubis (TGR). (m18)

Lanal TBA Terbaik Perahu Naga, Hias Festival Dragon Boat Race 2011 TANJUNGBALAI (Waspada): Komandan Pangkalan TNIAL, Letkol Laut (P) Retiono Kunto, didampingi Wali Kota Tanjungbalai Thamrin Munthe membuka Festival Dragon Boat Race 2011 di Water Front Pantai Amor Sungai Asahan, Selasa (27/12). Festival dalam rangka menyambut HUT Kota Tanjung-

balai ke-391 ini merupakan event wisata dan olahraga tahunan Podsi Cabang Kota Tanjungbalai bekerjasama dengan pemerintah kota setempat. Tujuannya sebagai salah satu daya tarik wisata Kota Tanjungbalai yang dikenal sebagai Mutiara Selat Malaka di Hilir Danau Toba. Festival ini diikuti 54 tim

dengan rincian perahu naga (18 tim), perahu tradisional (26), perahu hias (3), dan perahu dayung udang (7). Lomba dayung udang dijuarai Putra Indah disusul Uluna, Pantang Menyerah, dan Si Cantik Manis. Perahu hias dimenangi tim Pangkalan TNI-AL Tanjungbalai Asahan yang mengungguli tim Regen dan Dispora Tanjung-

Waspada/Hotma Darwis Pasaribu

KETUA KONI Sumut Gus Irawan Pasaribu dan Ketua KONI DS H Erwin NP foto bersama seusai pelantiikan Koordinator Olahraga Kecamatan se Kabupaten Deliserdang di Balairung Pemkab Deliserdang, Selasa (27/12).

Tingkatkan Olahraga Di Kecamatan Koordinator Olahraga Kecamatan DS Dilantik LUBUK PAKAM (Waspada): Bupati Deliserdang, Drs H Amri Tambunan, meminta Koordinator Olahraga Kecamatan seKabupaten Deliserdang meningkatkan pembinaan di daerahnya masing-masing. “Minimnya prestasi harus dijadikan motivasi untuk bangkit, bahu membahu membangun dunia olahraga dengan mencari bibit-bibit atlet sejak usia dini,” ujarnya dalam sambutan tertulisnya yang dibacakan Staf Ahli Bupati, Parlaungan Lubis, pada pelantikan Koordinator Olahraga Kecamatan

se-Kabupaten Deliserdang (22 Kecamatan) masa bhakti 20122015 di Balairung Pemkab Deliserdang di Lubuk Pakam, Selasa (27/12). Dikatakan, untuk mencapai sasaran dimaksud, Koordinator Olahraga Kecamatan harus menjadi bagian penting dari upaya pembinaan serta peningkatan prestasi atlet di setiap kecamatan. Acara pelantikan dilakukan Ketua KONI Kabupaten Deliserdang, Drs H Erwin Nurdin Pelos, dan dirangkai penyerahan tali kasih atlet berprestasi,

yakni Basuki Nogroho (medali emas SEA Games)Wilma Sinaga, Setia Wati, dan Ayu Rahayu (emas, perak, dan pe-runggu Asean Para Games 2011). Ketua KONI Sumut, H Gus Irawan Pasaribu, meminta Koordinator Olahraga Kecamatan se-Deliserdang yang baru dilantik segera menyusun program kerja sekaligus melaksanakannya dengan penuh tanggungjawab. Gus yakin, dengan potensi yang dimiliki, ke depan prestasi olahraga Deliserdang dapat lebih maju. (a06/a07)

balai. Sementara itu, perahu naga dijuarai Hiu Pangkalan TNI-AL, Kumbang Perkasa, Bahari Jaya, dan Sikumbang Jantan. Untuk lomba perahu tradisional, juara diraih Dewa Samudra bersama Kiay Pamungkas, Singa Kota Kerang, dan Calicap Mandi. Selaku Pembina Podsi Tanjungbalai, Danlanal mengatakan selain menyambut hari jadi Kota Tanjungbalai ke-391 dan mewujudkan Tanjungbalai sebagai kota wisata, festival ini targetnya mencari bibit andal untuk dibina sebagai pedayung profesional. Dijelaskan Danlanal, beberapa tahun terakhir ini, prestasi atlet dayungTanjungbalai cukup disegani di tingkat propinsi maupun nasional. Buktinya, pada festival Dragon Boat 2011 tingkat Sumut di Prapat, Tanjungbalai tampil sebagai juara I dan runner-up di Kabupaten Simeulue, Aceh. (a14)

Waspada/Dedi Riono

SEJUMLAH pemain peserta Festival Sepakbola ASSBI Sumut foto bersama Ketua KONI Sumut dan segenap Pengurus ASSBI Sumut usai acara pembukaan festival, Selasa (27/12).

Agas Binjai, Patriot Medan Melaju Gus Buka Turnamen ASSBI Sumut MEDAN (Waspada): SSB Agas Binjai dan Patriot Medan melaju ke babak 32 Besar Festival Sepakbola Asosiasi Sekolah Sepakbola Indonesia (ASSBI) Sumut di Lapangan Paskhas Polonia Medan, Selasa (27/12). Tampil di kelompok U-12, Agas memastikan tiket dengan mengemas empat poin hasil menaklukkan SSB Portis 2-1 dan bermain imbang 0-0 saat bertemu SSB Bintang Marelan. Sukses Agas diikuti SSB Patriot Medan U-12. Bahkan tim binaan Drs Hendra DS dan pelatih Syahril WP itu mengantongi poin sempurna (enam poin). Dua kemenangan itu diraih dengan mengungguli SSB Tumpas 2-0 dan menumbangkan Kurnia 1-0. Hasil memuaskan juga diraih tim SSB Patriot U-14 ikut melaju hasil menaklukkan Bintang Raya 1-0 dan imbang 0-0 dengan SSB Bintang Muda Leuser. Festival ASSBI Sumut yang diikuti 94 tim itu dibuka resmi Ketua KONI Sumut, Gus Irawan Pasaribu. Dalam sambutannya, Gus berharap ASSBI Sumut dapat menggelar event secara rutin sehingga pembinaan sepakbola usia muda dapat berjalan dengan baik. “Semakin banyak event digelar, maka akan semakin banyak kesempatan bagi pesepak-

IOF, Monstrac Asahan Bantu Pos Ops Lilin KISARAN (Waspada): Pengurus Kabupaten Indonesia Offroad Federation (IOF) dan Monster Trail Asahan Community (Monstrac) memberikan bantuan logistik kepada sejumlah Pos Operasi Lilin Toba 2011, Senin (26/12), sebagai langkah membina hubungan masyarakat dengan petugas keamanan, dan bentuk solidaritas. Demikian dikatakan Sekretaris IOF Kabupaten Asahan, Bembeng TS. Menurutnya, bantuan berbentuk makanan karena Pos Ops Lilin selain tempat penjagaan merupakan tempat istirahat bagi pengguna jalan yang kelelahan, sehingga bantuan ini bisa dimanfaatkan untuk membantu petugas dan masyarakat. Kepala Pos Ops Lilil Seidadap, Iptu Dahron Harahap, berterima kasih atas bantuan yang bisa dimanfaatkan bagi petugas dan masyarakat. Menurut Dahron, penjagaan ini akan terus dilakukan sampai perayaan tahun baru 2012. (a15)

Indonesia Juara, Gede Siman Raih Bonus Terbanyak Kilas Balik Olahraga Nasional 2011 KANCAH olahraga nasional pada tahun 2011 kembali menorehkan sejarah baru, yakni berhasil kembali juara umum pesta olahraga terbesar SEA Games XXVI yang digelar di Palembang dan Jakarta, 11-22 November, setelah menunggu 14 tahun lamanya. Indonesia berada di puncak dengan perolehan 182 emas, 151 perak dan 142 perunggu. Disusul Thailand di posisi runner-up dengan 109 emas, 100 perak, dan 120 perunggu. Urutan ketiga ditempati Vietnam (96-92-100). Di cabang sepakbola, Indonesia belum berhasil menyempurnakan keberhasilan juara umum, setelah merebut medali perak pascakalah penalti atas Malaysia 4-5. Dalam penyelenggaraan ASEAN Para Games (multievent olahraga cacat) di Solo, 15-20 Desember lalu, kon-

tingen Indonesia hanya menduduki posisi runner-up di bawah Thailand dengan 123 emas, 96 perak, dan 73 perunggu. Kontingen tuan rumah sendiri hanya mengantongi 113 emas, 108 perak, dan 89 perunggu. Pembukaan dan penutupan acara seremonial SEA Games dan ASEAN Para Games parhelatan negara-negara Asia Tenggara cukup meriah, namun ditandai turunnya hujan dan menjadikan sejumlah acara urung dilaksanakan. Sebelum pembukaan SEA Games XXVI, Presiden RI Susilo Bambang Yudhoyono turut meresmikan Jakabaring Sport City (JSC) dengan luas sekira 400 hektar. “Saya berharap ke depan Jakabaring Sport City dapat dipertanggungjawabkan,” kata SBY saat peresmian dan pembukaan SEA Games XXVI di Stadion Gelora Sriwijaya, 11 November lalu.

Problem Catur


Putih melangkah, mematikan lawannya tiga langkah.

Jawaban di halaman A2 8







1 A





10 Peraih Bonus Terbanyak di SEA Games XXVI Biaya seremonial pembukaan SEA Games XXVI cukup fantastis mencapai Rp150 miliar, sama dengan biaya pemberian bonus kepada atlet Indonesia. Perinciannya, Rp200 juta untuk peraih emas, Rp50 juta (perak), dan Rp30 juta (perunggu), Untuk pelatih medali emas Rp 50juta, Rp30 juta (perak), dan Rp15 juta (perunggu). Pembukaan ASEAN Para Games dilakukanWakil Presiden Boediono pada 15 Desember lalu. Saat itu, Boediono mengatakan ASEAN Para Games bukan hanya bertanding bersama tetapi juga merayakan nilai-nilai kemanusiaan yang sangat mulia. “Nilai kemanusiaan pertama adalah persaudaraan di mana kekerabatan yang terjalin di antara bangsa-bangsa serumpun di Asia Tenggara ini telah terjalin sejak 44 tahun silam. Nilai kemanusiaan kedua adalah semangat hidup dan tekad kuat mengingat atlet yang bertanding adalah




I Gede Siman Sudartawa (renang) Rp800 juta Uyun Muzizah (balap sepeda) Rp650 juta Triyaningsih (atletik) Rp600 juta Cherry Bonaria (paralayang) Rp600 juta Prima Simpatiaji (tenis) Rp600 juta Indra Gunawan (renang) Rp480 juta Franklin Ramses Buruni (atletik) Rp400 juta Eka Octarorianus (dayung) Rp400 juta Agus Prayogo (atletik) Rp400 juta Anwar Tarra (dayung) Rp400 juta kalangan difabel yang pantang menyerah dalam berbagai keadaan,” kata Budiono. Bonus atlet ASEAN Para Games adalah Rp50 juta (emas), Rp20 juta (perak), dan Rp10 juta (perunggu). Para pelatih juga mendapat bonus Rp10 juta untuk emas, Rp5 juta (perak), dan Rp2,5 juta (perunggu). Emas Terbanyak I Gede Siman Sudartawa adalah peraih medali emas terbanyak di SEA Games XXVI dari cabang renang. Siman berhasil mengantongi empat


emas dengan memenangi nomor 100 meter gaya punggung, 200 m gaya punggung, 50 m gaya punggung, dan 4×100 m estafet gaya ganti beregu putra. Dengan demikian, Siman meraih bonus terbesar di antara atlet Indonesia lainnya, Rp800 juta. Pelari Triyaningsih berhasil meraup bonus Rp 600 juta setelah mencetak hatrik dengan raihan tiga medali emas. Triyaningsih meraih emas dari nomor 10.000 meter, 5000 m, dan lari maraton. *Setia Budi Siregar


1. Singkatan Kode Etik Kedokteran Indonesia. (Dokter bersumpah mentaati dan mengamalkannya). 3. Singkatan Majelis Kehormatan Etik Kedokteran. (Majelis menangani pengaduan pasien). 5. Singkatan Ikatan Dokter Indonesia. 7. Ahli kedokteran kuno asal Yunani. (Namanya disebut dalam mukadimah kode etik diatas). 8. Dokter ahli. (Dokter wajib merujuk pasien kepada dokter yang ahli di bidang penyakit pasien tsb). 12. Sifat-sifat yang layak terhadap manusia, suka menolong, bertimbang rasa. (Menjadi alasan dokter melakukan pertolongan darurat). 14.Menyuntik mati pasien untuk meringankan penderitaannya. (Kode etik melarangnya). 16.Sakratul _____; Ajal. (Dokter tidak dapat mencegahnya tapi harus berusaha mempertahankan hidup pasiennya, menurut kode etik). 18.Kawan: ____ sejawat. (Hubungan baik sesama dokter mesti dijaga, sesuai lafal sumpah dokter). 20.Sesuatu yang disembunyikan agar tidak diketahui orang lain. (Dokter wajib menyembunyikannya, menurut kode etik). 22.Tuntut. (Dokter yang membuka rahasia pasien dapat diseret ke pengadilan jika pasien menuntut,

bola muda meningkatkan kemampuannya. Sebaliknya, minimnya kompetisi akan menghambat laju pembinaan,” ucap Gus. Ketua ASSBI Sumut, H Sumantraji, menyatakan komitmenya untuk berupaya mem-

bantu meningkatkan pembinaan Sekolah Sepakbola (SSB) di Sumut. Terlebih lahirnya ASSBI tidak lain untuk membangun pondasi sepakbola nasional yang lebih baik yang dimulai dari pembenahan pembinaan di SSB.

Event mempertandingkan dua kelompok umur U-12 dan U-14 itu sesuai rencana akan berakhir, Rabu (28/12) ini. Namun tidak tertutup kemungkinan waktu pertandingan bertambah jika cuaca tidak mendukung. (m42)

15 Tim Sepak Takraw Bersaing Turnamen PSTI Asahan KISARAN (Waspada): Sejumlah 15 tim bersaing pada Turnamen Sepak Takraw Pelajar se-Kabupaten Asahan di Gedung Serga Guna Rambate Rata Raya. Kisaran, 27-28 Desember 2011. Turnamen diadakan Pengurus Cabang Persatuan Sepak Takraw Indonesia (PSTI) Asahan dan dibuka resmi oleh Ketua Pengcab PSTI Asahan, Mislian. Dalam sambutannya, Mislian mengatakan turnamen tersebut digelar dalam rangka meningkatkan pembinaan atlet. “Dari turnamen ini, kami juga ingin menjaring bibit pemain sepak takraw berbakat untuk selanjutnya dilakukan pembinaan intensif sehingga ke depan bisa membela Kabupaten Asahan pada event tingkat provinsi maupun

nasional,” ucap Mislia. Ketua Panpel Turnamen, Maraden Sitepu, mengatakan 15 tim peserta dibagi dalam empat grup. Untuk Grup A dihuni SMAN 2 Kisaran, SMA Asahan B, SMK Muhammadiyah, dan SMPN 5 A Kisaran. Grup B terdiri atas SMKN 2 Kisaran, SMA Daerah, SMAN 1 Kisaran, dan SMAN 4 A Kisaran. Grup C ditempati SMA Asahan A, SMAN 4 B, MAN Kisaran, dan Al Wasliyah, sedangkan SMPN 2, SMPN 6, dan SMPN 5 B bersaing di Grup D. Sementara itu, pertandingan hari pertama ditandai sukses delapan tim lolos ke babak 8 Besar, yakni SMAN 2 Kisaran, SMK Muhammaddiyah, SMKN 2 Kisaran, SMAN 4 Kisaran, SMA Asahan, MAN Kisaran, SMPN 2, dan SMPN 5. (a31)

Putra Sumut Target Semifinal Kejurnas Voli Junior 2012 MEDAN (Waspada): Pengprov PBVSI Sumatera Utara menargetkan minimal lolos ke semifinal putra pada KejurnasVoli Junior diYogyakarta, 7-15 Januari 2012. “Kami menargetkan semifinal, jadi saya berharap agar tim pelatih benar-benar selektif dalam memilih atletnya,” ucap Elvian, Kabid Binpres PBVSI Sumut. “Dengan itu akan terbentuk tim yang benarbenar solid dan dapat kembali mengibarkan panji Sumatera Utara pada kejuaraan voli berskala nasional,” tambah Elvian kepada Waspada, Selasa (27/12). Menurutnya, pemusatan latihan 150 persen untuk kejuaraan kali ini sudah berlangsung sejak hari 26 Desember lalu di Lubuk Pakam. Regu voli junior putra Sumut akan ditangani trio pelatih yang sudah memiliki prestasi baik di kejuaraankejuaraan nasional, yakni Ramino, Avitdiansyah, dan Dedy. “Atlet yang mengikuti pemusatan latihan adalah yang terbaik dari seluruh kabupaten/ kota yang ada di Sumut, sebagian besar terpantau dari kejuaraan junior daerah yang dilaksanakan September lalu di Lubuk Pakam,” papar Elvian. Setelah melalui seleksi dan persaingan ketat, dia mengharapkan akhir Desember nanti sudah

terbentuk tim inti supaya pelatih dapat menerapkan strategi yang akan dipakai pada sesi latihan berikutnya. “Jika tahapan itu terpenuhi, para atlet nantinya sudah mahir dalam menjalankan taktik dan strategi yang akan diterapkan pada pertandingan sesungguhnya di Yogyakarta,” lanjutnya. Pelatih Ramino mengaku siap memenuhi tahapan dimaksud beserta target yang ditetapkan PBVSI Sumut. “Saya selaku pelatih berharap agar para atlet bisa menunjukkan kemampuan maksimalnya pada setiap latihan yang dilaksanakan, sehingga kami tidak akan salah memilih pemain untuk dibawa,” ujarnya. Ramino cs juga sangat mengharapkan dukungan publik terutama komunitas pencinta olahraga voli supaya anak asuhnya mampu meraih prestasi terbaik di Yogyakarta. Sedangkan Elvian mengklaim voli Sumut mulai diperhitungkan lagi di kancah nasional dengan mampunya tim putra menembus babak final pada Pekan Olahraga Pelajar Nasional (Popnas) 2011 lalu di Riau. “Juga atas sukses tim voli Bank Sumut menjadi finalis Kejurnas Antarklub Divisi I di Tangerang sekaligus promosi ke Divisi Utama Livoli tahun depan,” pungkas Elvian. (m15)

SMP Muhammadiyah Juara Umum Kejuaraan Pencak Silat Pelajar MEDAN (Waspada): 7 Pesilat binaan SMP Muhammadiyah 1 Medan baru-baru ini meraih juara umum pada turnamen pencak silat pelajar se Kota Medan yang diselenggarakan Dinas Pendidikan Olahraga (Dispora). “Prestasi ini harus kita lanjuti lagi, Dalam artian akan terus kita tingkatkan lagi untuk mencari bibit-bibit baru,” tekad pelatih silat Tapak Suci Putra Muhammadiyah, Paiman SPd, di Medan, Selasa (27/12). Ketujuh pesilat yang meraih sukses adalah Dinda (kelas A Waspada/dede putri), Rujanto (B putra), Fauzial TUJUH pesilat SMP Muhammadiyah foto bersama usai meraih Qodiah (E putri) dengan meraih juara umum pada turnamen pencak silat pelajar se Kota Medan juara I, dan Hafni Sitepu (C putri) baru-baru ini. juara II. Agung (F putra), Surya (D putra), dan Arifin Harahap (C putra) menjadi terus dilaksanakan. “Ke depan diharapkan siswa juara III. kami dapat mengukir prestasi di tingkat provinsi Keberhasilan itu, menurut Paiman, tidak dan nasional,” tambah Paimin. terlepas dari pembinaan dan latihan rutin yang (m43) sesuai KUHP Pasal 322 ayat b). 23.Singkatan Ilmu Pengetahuan & Teknologi Kedokteran/ Kesehatan. (Dokter harus senantiasa mengikuti beritanya).

MENURUN (Lain-lain)

2. Serat berbulu putih, kawannya jarum suntik. 4. Kerdil; Pertumbuhan badan terhenti sehingga tetap kecil. 6. Upah sebagai pembalas jasa. (Disesuaikan dengan kemampuan pasien, menurut kode etik). 7. Tekanan darah atau denyut jantung yang lebih tinggi daripada normal. 9. Penyakit kekurangan butir darah merah. 10.Singkatan Spesialis Urologi. 11. Pusing karena darah naik ke kepala. 12.Ilmu pengetahuan tentang gejala dan kegiatan jiwa. 13.Slang karet yang dimasukkan ke dalam saluran kandung kemih. 15.Kehilangan daya ingat, terutama tentang masa lalu karena cedera pada otak. 17.Tanaman sayur berwarna merah, berkhasiat membantu pembentukan glycogen pada liver. 19.Bagian muka di bawah mulut; Mentum. 21.Rumus molekul air.

Sudoku Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tidak ada keterlibatan matematika, hanya membutuhkan pertimbangan dan logika. Tingkat kesulitan: sedang (***), bisa diselesaikan dalam waktu kurang dari sepuluh menit. Jawabannya lihat di halaman A2 kolom 1.

3 5 5 7 3 2 4 7 8 6 3 5 1 2 9 7 1 2 3


1 4 5 8 3 6 3 6 2 8 3 6 2 9 ***412



WASPADA Rabu 28 Desember 2011

Arsenal Frustrasi LONDON (Waspada): Meski unggul jumlah pemain, Arsenal gagal mengalahkan Wolverhampton Wanderers dalam lanjutan Liga Premier di Emirates Stadium, Selasa (27/12). Alhasil, skuad besutan Arsene Wenger harus puas bermain imbang 1-1. Main di kandangnya sendiri, The Gunners langsung mengambil inisiatif serangan. Tak butuh waktu lama bagi tuan rumah menyarangkan gol pertama. Menit kedelapan, skuad Meriam London sudah mampu merobek jala Wolves. Berawal dari umpan terobosanYossi Benayoun, Gervinho lolos dari jebakan offside dan mudah menaklukkan kiper Wolves, Wayne Hennessey, dengan mudah. Menit 15, Robin

van Persie nyaris menambah koleksi golnya. Menerima umpan dari Gervinho, sepakan pemain Belanda itu masih melebar. Peluang pertama tim tamu datang di menit 26. Sepakan kaki kiri Stephen Hunt ternyata masih tinggi di atas gawang Arsenal yang dikawalWojciech Szczesny. Tak lama kemudian, Van Persie kembali mengancam namun tendangan kaki kirinya masih mampu ditepis Hennessey.

Menit 33, giliran free kick Mikel Arteta ditangkap Hennessey. Wolvers akhirnya mampu menyamakan kedudukan di menit 38. Tendangan jarak jauh Hunt berbelok arah setelah mengenai kepala Steven Fletcher. Szczesny pun tak mampu menghalau bola karena salah antisipasi. Skor 1-1 bertahan hingga babak pertama usai. Di babak kedua, Arsenal tidak mengendurkan tekanannya. Namun, justru Wolves yang mampu menciptakan peluang pertama melalui tendangan spekulasi Nenad Milijas. Acungan jempol patut diberikan kepada Hennessey di paruh kedua karena sukses menepis tendangan van Persie, tandukan

Per Mertasecker plus sepakan Thomas Vermaelen yang nyaris berbuah gol. Bahkan, sepanjang pertandingan Hennessey mencatat 10 penyelamatan bagi timnya yang kerap membuat van Persie cs frustrasi akibat sulit mencetak gol kemenangan. Padahal, Gunners sudah mendapat keuntungan saat Milijas terkena kartu merah karena tekel kerasnya kepada Arteta di menit 75. Kendati begitu, Arsenal tetap gagal memetik poin penuh. Dengan hasil ini, Arsenal berada di peringkat kelima dengan 33 poin dan Wolves bercokol di peringkat 16 dengan koleksi 16 angka. (m33/global)

Awal Buruk Lakers


LAGA panas antara Wolverhampton Wanderers dan Arsenal dalam lanjutan Liga Premier ditandai tekel keras Nenad Milijas (bawah) terhadap Mikel Arteta yang berbuah kartu merah di Emirates Stadium, London, Selasa (27/12) malam.

Permainan Nadal Mudah Ditebak MADRID (Waspada): Rafael Nadal (foto) sempat kehilangan gairah dalam bermain sepanjang tahun 2011. Nadal juga menyebutkan permainannya terlalu mudah ditebak oleh lawanlawannya. “Sepanjang tahun, Anda kehilangan sedikit intensitas. Intensitas dalam diri Anda, konsentrasi, mencoba untuk berpikir positif, dan percaya semua akan berjalan dengan baik. Semua itu harus ada di pikiran anda,” jelas Nadal, Selasa (27/12). Sepanjang tahun 2011, Nadal hanya mampu membawa pulang satu gelar juara grand slam di Prancis Terbuka. Sisanya, Nadal tidak mampu membendung keperkasaan Novak Djokovic (Serbia), sehingga titel sebagai petenis nomor satupun ikut melayang. “Pikiran saya cukup bagus pada pertengahan tahun pertama, memang tidak sempurna, karena saya harus lebih baik saat menghadapi Djokovic. Kini, saya harus mulai bekerja lagi,” Nadal menambahkan. “Tapi, saya memang tidak menampilkan permainan tenis terbaik. Ketika memilikinya, maka Anda akan merespons semua dengan baik. Saya harus bermain sedikit tidak terduga,” kata petenis kidal berusia 25 tahun itu. “Permainan saya terlalu mudah diprediksi sepanjang musim ini. Hal itu yang harus saya perbaiki untuk menghadapi musim mendatang,” tandas penggemar setia Real Madrid itu.


Musim Depan Kebangkitan Hamilton WOKING, Inggris (Waspada): Mantan pebalap Alex Zanardi percaya Lewis Hamilton

sudah mendapatkan pelajaran yang berarti dari kegagalan di Formula One (F1) 2011. Musim


PEBALAP McLaren, Lewis Hamilton (kanan), diprediksi bangkit dan bakal menjadi pesaing berat SebastianVettel dalam perebutan gelar musim depan.

Pasang Iklan

Telp. 4528431 HP. 081370328259 Email:

depan, Zanardi percaya Hamilton akan lebih tangguh lagi. Pebalap McLaren asal Inggris itu memang mengalami musim terburuk di F1. Hamilton hanya mampu finish di peringkat kelima klasemen akhir. Bahkan, juara dunia 2008 itu terlibat beberapa insiden di lintasan dan begitu juga masalah pribadinya. Zanardi, pebalap F1 pada era 1990-an, merasa Hamilton akan melupakan kegagalan itu dan akan tampil sesuai standarnya pada musim depan. “Apa yang terjadi padanya tahun ini, berarti Hamilton hanya manusia biasa. Bahkan, seorang Lewis Hamilton mudah diserang. Tapi Hamilton sangat bijaksana. Saya pernah mewawancarai dia sekali dan saya

mendeskripsikan dia seorang yang sangat dewasa untuk seusianya,” kata Zanardi, Selasa (27/12). Dengan berbagai masalah yang dihadapi Hamilton, Zanardi yakin Hamilton akan memperlihatkan penampilan terbaiknya pada F1 2012. Bahkan, pendamping Jenson Button di tim McLaren-Mercedes itu akan tampil lebih tangguh dan kompetetif. “Namun, saya sangat yakin sekali, Hamilton mendapatkan sebuah pelajaran yang berarti. Hamilton akan memperlihatkan penampilan terbaik, kendati mendapatkan tekanan sangat besar,” tandas mantan pebalap Jordan, Minardi, Lotus, dan Williams ini. (m33/auto)

LOS ANGELES, AS (Waspada): Juara NBA 2009 dan 2010, Los Angeles Lakers, langsung menuai dua kekalahan beruntun dalam awal musim ini. Terakhir, Kobe Bryant cs menyerah dari tuan rumah Sacramento Kings 91-100 da-lam lanjutan kompetisi NBA, Selasa (27/12). “Ini bukan rivalitas. Kami selalu mengalahkan mereka setiap tahun, jadi saya sungguh tak peduli jika mereka kali ini mengalahkan kami,” kilah Kobe Bryant, bintang Lakers. Bintang kemenangan King tak lain adalah Maurice Thornton yang membukukan 27 angka. Selain Thornton, kekalahan Lakers juga ditentukan oleh bantuan Tyreke Evans dan John Salmons. Jika Evan menambah 20 poin, maka Salmons memberi kontribusi 13 poin bagi Kings. Pada laga ini, Kobe mengemas 29 poin didukung Metta World Peace dan Paul Gasol yang masing-masing menyumbang 19 dan 15 angka. Tapi, torehan itu tak cukup untuk menghindarkan Lakers. Sorotan pun mengarah kepada pelatih anyar Lakers, Mike Brown. “Ini baru awal musim, jadi tidak ada yang perlu dirisaukan. Kalah di dua laga perdana bukan berarti sudah tertutup peluang kami untuk berbicara banyak musim ini,” kilah Brown kepada ESPN. Jagoan Wilayah Timur, Chicago Bulls, juga harus tumbang

dari Golden State Warriors 9199. Kecemerlangan guard Stephen Curry mem-berikan kemenangan bagiWarriors dengan mencetak 21 poin 10 assist. Curry pun menga-lahkan bintang Bulls, Derrick Rose, yang hanya mendulang 13 angka. “Ia benar-benar membuat tim menang sendirian. Permainan menyerang Curry menjadikannya guard terbaik di NBA saat ini,” puji pelatih Golden State, Mark Jackson. Keterpurukan juga tengah melanda juara bertahan NBA, Dallas Mavericks. Bahkan Dirk Nowitzki cs tidak terlihat seperti tim yang me-ngangkat trofi pada Juni silam, setelah kalah kedua kali. Di laga pembuka, Dallas tumbang dari Miami Heat dan kali ini menyerah di tangan Denver Nuggets. Nugget menghancurkan Mavericks 115-93 dengan dipimpin Ty Lawson yang menoreh 27 poin bersama Andre Miller dan Al Harrington yang sama-sama memberi 18 angka. Semen-tara itu, Orlando Magic bangkit dengan berhasil meraih kemenangan 104-95 atas Houston Rockets. Oklahoma City Thunder meraih kemenangan kedua dengan menaklukkan Minnesota Timberwolves 104-100. Hasil tersebut sekaligus menghapus asa pemain muda asal Spanyol, Ricky Rubio, meraih kemenangan pada debut NBA-nya. (m33/ap)


GUARD Sacramento Kings, Tyreke Evans (tengah), berhasil melepaskan diri dari kawalan duet LA Lakers, Derek Fisher dan Kobe Bryant (kanan), dalam lanjutan kompetisi NBA di Sacramento, Selasa (27/12).

Hasil Selasa (27/12) Toronto Raptors vs Cleveland Cavaliers Indiana Pacers vs Detroit Pistons New Jersey Nets vs Washington Wizards Orlando Magics vs Houston Rockets Charlotte Bobcats vs Milwaukee Bucks Oklahoma City vs Minnesota T’wolves San Antonio Spurs vs Memphis Grizzlies Denver Nuggets vs Dallas Mavericks New Orleans Hornet vs Phoenix Suns Portland T’blazers vs Philadelphia 76rs Golden State Warriors vs Chicago Bulls

104-96 91-79 90-84 104-95 96-95 104-100 95-82 115-93 85-84 107-103 99-91

Sumatera Utara

WASPADA Rabu 28 Desember 2011

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:28 12:41 12:28 12:36 12:35 12:32 12:28 12:24 12:31 12:30

‘Ashar 15:51 16:03 15:52 15:58 15:58 15:57 15:52 15:48 15:55 15:54

Magrib 18:26 18:36 18:27 18:31 18:31 18:34 18:27 18:23 18:29 18:27



Shubuh Syuruq


19:40 19:50 19:41 19:45 19:45 19:48 19:41 19:37 19:43 19:41

04:57 05:14 04:58 05:08 04:06 04:57 04:57 04:53 05:00 04:01

05:07 05:24 05:08 05:18 05:16 05:07 05:07 05:03 05:10 05:11

L.Seumawe 12:34 L. Pakam 12:27 Sei Rampah12:26 Meulaboh 12:38 P.Sidimpuan12:25 P. Siantar 12:26 Balige 12:26 R. Prapat 12:23 Sabang 12:41 Pandan 12:27

06:28 06:45 06:29 06:39 06:37 06:28 06:28 06:23 06:31 06:32

Zhuhur ‘Ashar 15:56 15:51 15:50 16:01 15:50 15:50 15:51 15:48 16:03 15:52





Shubuh Syuruq


Zhuhur ‘Ashar




Shubuh Syuruq


18:29 18:25 18:24 18:35 18:27 18:25 18:26 18:24 18:35 18:29

19:43 19:39 19:38 19:49 19:41 19:39 19:41 19:38 20:49 19:43

05:06 04:56 04:56 05:08 04:51 04:55 04:53 04:50 05:14 04:54

05:16 05:06 05:06 05:18 05:01 05:05 05:03 05:00 05:24 05:04

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:27 12:29 12:38 12:31 12:28 12:35 12:23 12:34 12:27 12:26

18:28 18:28 18:33 18:32 18:26 18:31 18:23 18:32 18:27 18:24

19:43 19:42 19:48 19:46 19:40 19:46 19:37 19:46 19:42 19:38

04:53 04:57 05:11 04:58 04:58 05:06 04:52 05:03 04:53 04:55

05:03 05:07 05:21 05:08 05:08 05:16 05:02 05:13 05:03 05:05

Panyabungan 12:24 Teluk Dalam12:31 Salak 12:29 Limapuluh 12:25 Parapat 12:27 GunungTua 12:24 Sibuhuan 12:23 Lhoksukon 12:33 D.Sanggul 12:27 Kotapinang 12:22 AekKanopan 12:24

06:37 06:27 06:27 06:39 06:22 06:25 06:24 06:21 06:45 06:24

15:52 15:53 16:01 15:56 15:52 15:58 15:47 15:58 15:51 15:50

06:24 06:28 06:42 06:29 06:29 06:37 06:23 06:33 06:24 06:26

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

Zhuhur ‘Ashar 15:49 15:56 15:53 15:49 15:51 15:49 15:49 15:56 15:52 15:47 15:48




Shubuh Syuruq

18:27 18:34 18:29 18:23 18:26 18:26 18:26 18:29 18:28 18:23 18:24

19:41 19:49 19:43 19:37 19:40 19:40 19:40 19:43 19:42 19:37 19:38

04:49 04:55 04:57 04:54 04:55 04:50 04:48 05:05 04:54 04:48 04:51

04:59 05:05 05:07 05:04 05:05 05:00 04:58 05:15 05:04 04:58 05:01

06:20 06:26 06:28 06:24 06:25 06:21 06:19 06:36 06:25 06:19 06:22

Kebijakan PT. KAI Resahkan Pedagang PERBAUNGAN (Waspada): Kebijakan PT. Kereta Api Indonesia (KAI) Wilayah Sumatera Utara yang melarang pedagang asongan berjualan di atas kereta api, kecuali memiliki karcis resmi (berlaku) yang mulai diberlakukan 1 Januari mendatang, menuai keresahan ratusan pedagang asongan Kab. Serdang Bedagai (Sergai), Selasa (27/12) sore.

Waspada/Abdul Hakim

SEPEKAN sebelum pergantian tahun, penjual terompet sudah menjamur di Stabat, salah satunya di Jalan KHZ. Arifin Stabat.

Penjual Terompet Mulai Menjamur Di Stabat STABAT (Waspada): Menjelang pergantian tahun, penjual terompet di Stabat mulai menjamur. Di beberapa ruas jalan terlihat terompet dijual. Menurut pedagang, harga terompet dipasarkan mulai Rp5.000 hingga Rp20.000. Pedagang berharap pada malam pergantian tahun nanti cuaca cerah, sehingga penjualan tinggi. “Tahun lalu terjual lebih 100 terompet, mudah-mudahan tahun ini bertambah,” kata Ibu Ana, penjual terompet di Jalan KHZ. Arifin Stabat, Senin (26/12). Sepekan sebelum pergantian tahun, menurut Ibu Ana terompet belum ada peminatnya. (a03)

Kebijakan Pemerintah Perlu Dievaluasi BINJAI (Waspada): Ketua FSU Sumut Ir Suseno Arto WP mengemukakan masalah kemiskinan meningkat, akibat pola ketatanegaraan kurang tepat. Hal itu dikemukakannya, Senin (26/12)dirumahaspirasiumat,CakrukPakTengkuJln.Hasanuddin 12-A Binjai saat acara, “Evaluasi Pembangunan di Akhir Tahun Anggaran 2011”. Menurur Suseno banyak anggaran belanja negara untuk percepatan pembangunan tidak terselesaikan dengan baik. Akibatnya pembangunan tertunda dan rakyat makin sengsara. Untuk mengentaskan kemiskinan, Suseno berharap perlu ditingkatkan kinerja yang lebih baik dengan membuat rencana pembangunan yang terukur, melakukan analisa yang tajam. Sebab Indonesia negara kaya tetapi pengelolaan kekayaan itu tidak dilaksanakan dengan sempurna. “Agar rakyat tidak miskin dan negeri jangan lebih terpuruk, pemerintah harus membuat kebijaksanaan harus pro rakyat dan menyentuh tingkat paling bawah,” kata Suseno. Ketua FSU Sumut Suseno mengungkapkan, pembangunan di Sumatera Utara harus dibenahi. Jika ingin berhasil, maka semua komponen yang ada harus diberdayakan.(a04)

Dua Sepeda Motor Hilang BINJAI (Waspada): Dalam satu hari dua sepeda motor hilang disikat maling di Binjai, masing-masing milik Amelia Simamora, 47, warga Danau Jumpang Lk I Kelurahan Tunggorono, Kec. BinjaiTimur, dan Kanna Murti, 33, warga Jalan Kartini, Kel. Kartini, Kec. Binjai Kota. Sepeda motor BK 5532 RAA milik Amelia, hilang ketika diparkir di depan warnet SRY jalan TA Hamzah, Kel. Pahlawan, Kec. Binjai Utara, sehingga korban mengalami kerugian Rp21 juta. Sementara sepeda motor milik Kanna Murti, hilang ketika diparkir di depan rumahnya, sehingga korban mengalami kerugian Rp20 juta.KeduakasuspencuriantersebutsudahdilaporkankeMapolres Binjai. Sementara Kapolres Binjai AKBP Musa Tampubolon, SH, S.Ik, M.Hum ketika dikonfirmasi melalui Kasat Roni Bonic, S.Ik, Selasa (27/12), membenarkan kejadian itu.(a05)

Tunggakan Listrik Pelanggan PLN Binjai Rp6,7 Miliar BINJAI(Waspada):PLNCabangBinjaiakanmenagihtunggakan listrik konsumen Rp6,7 miliar, sesuai target dari PLN Wilayah Sumut. Humas PLN Binjai Safwan Wajdi menjelaskan, Selasa (27/ 12), PLN Binjai punya 14 unit pelayanan yang harus kerja keras dalam empat hari mengejar target tersebut. Safwan mengemukakan, PLN Binjai berharap pelanggan listrik bisa melunasi tunggakan menghindari pemutusan. “Tindakan pemutusan terpaksa dilakukan,” ujarnya. Sebab tunggakan sangat besar. Omset penjualan Rp55 miliar per bulan, sampai saat ini PLN Binjai menunggak rekening Rp14 miliar. 14 Unit pelayanan yang terdapat di Binjai Kota, Binjai Barat, Binjai Timur, Kuala, Stabat, Tanjung Pura, Gebang, P. Brandan, P. Susu, Berastagi, Kebanjahe,Tiga Binanga, Sidikalang dan Pakpak Bharat diharap mampu memenuhi target yang ditetapkan PLN Wilayah Sumatera Utara. Mencapai target itu, PLN Binjai akan melakukan pemutusan aliran listrik secara besar-besaran bagi pelanggan yang masih menunggak.(a04)

Barang Bukti Lenyap Dari Polsek Patumbak PATUMBAK (Waspada): Barang bukti sepedamotor BK 3072 AAD, hasil tangkapan personil Polsek Patumbak beberapa waktu lalu lenyap dari tempat penyimpanan barang bukti. Sepedamotor itu disita sebagai barang bukti dari AK, 25, warga Kelurahan Timbang Deli, yang mencuri sepedamotor jenis matic, warna hitam, BK 3072 AAD di Simpang Marindal, Brigif VII, Medan Amplas, Senin (28/11) sekira pukul 19:00 lalu. Pantauan Waspada, Senin (19/12) hingga Kamis (22/12), sepedamotor hasil curian itu sudah tidak kelihatan di tempat penyimpanan barang bukti. Sedangkan tersangka AK masih mendekam di sel Polsek Patumbak. Selain itu, mobil Daihatsu Xenia Nopol F 1869 CT yang disita dariSualiasAsiong,30,wargaKec.Polonia,hampirsetiapharidigunakan personil Polsek Patumbak tugas luar, disinyalir seizin Kapolsek. Mobil itu diamankan, Selasa (6/12) sekira pukul 16:00, di depan Mapoldasu, sebab Su alias Asiong tertangkap tangan membawa satu paket sabu yang disimpan di dalam charger Hp untuk diserahkan kepada De, salah satu tahanan Mapoldasu. Kapolsek Patumbak Kompol Sonny W Siregar saat akan dikonfirmasi sejak Senin (19/12) hingga Kamis (22/12), tidak berada di kantor.(c02)

Keresahan seratusan pedagang itu diutarakan langsung kepadaWakil Bupati Sergai, Ir. H. Soekirman yang juga Ketua DPD PAN Sergai, didampingi Ketua Fraksi PAN Sergai, H.Syahlan Siregar, Pengurus DPD PAN, Kaswasi ST, Sekretaris Camat Perbaungan, Suparmin, di Masjid Al Huda, LingkunganTempel,Kel.Simpang Tiga Pekan, Kec. Perbaungan. Pembina pedagang asongan Perbaungan, Masa Khairul alias Lolom, 44, mengatakan seluruh pedagang asongan lebih dari 300 orang yang puluhan tahun berjualandikeretaapimenjadisangat resah,terancamtidakbisaberusaha lagi karena kebijakan manajemen PT. KAI yang diberlakukan mulai1Januarimendatang.Kalau pun berjualan diwajibkan membeli karcis resmi layaknya penumpang umum, paparnya. “Jika PT. KAI membebankan tiket wajib kepada pedagang asongan, setiap harinya harus membeli 6 tiket dengan harga seluruhnya Rp84 ribu, sedangkan penghasilan pedagang asongan per hari maksimal Rp50 ribu. Karena selama ini 90 persen dari

jumlah pedagang asongan hanya sebagaisales(penjual)yangmembeli dagangan dari pengusaha (pengepul), disebabkan keterbatasan modal,” ungkap bapak 7 anak itu. Menurut Lolom, jika ini tetap diberlakukan dipastikan seribuan anak, istri serta suami akan terlantar berhubung tidak adannya pekerjaan lagi. “Kami berharap kepada Wakil Bupati untuk memperjuangkan nasib pedagang asongan.” SementaraWakil Bupati Sergai, H. Soekirman kepada Waspada disela-sela pertemuan seratusan pedagang asongan, mengatakan, dengan adanya kebijakanPT.KAI,kitamenangkap ada keresahan sosial, sehingga kita berupaya menjembatani, memediasi antara masyarakat dengan PT. KAI, mencari langkah terbaik dimana pedagang bisa tetap berjualan dan PT. KAI dapat berjalan dengan baik. “Intinya mencarijalanterbaik,”kataWabup H. Soekirman. Langkah yang akan ditempuh, lanjut H. Soekirman, akan mempelajari kebijakan terlebih

dahulu, apakah kebijakan itu peraturan, undang-undang pemerintah pusat atau kebijakan lokal. “Tadi kita sudah mencoba menghubungi anggota DPRD Sumut, saudara Zulkifli Husein dari Komisi E dan Fraksi PAN. Beliau menyiapkan diri untuk menjadi mediator aspirasi pedagang asongan Perbaungan dengan PT. KAI Sumut,” imbuh H. Soekirman. Sementara itu Ketua Fraksi PAN Sergai, H. Syahlan Siregar menambahkan, dimohon agar Direksi PT. KAI Sumut meninjau ulang kebijakan atau menunda peraturan yang mulai diberlakukan 1 Januari tersebut. “Karena kibijakan itu menyangkut hajat hidup orang banyak, di satu sisi sektor riil perekonomian harus ditingkatkan. Namun sebaliknya PT. KAI berupaya membumihanguskan pedagang asongan yang juga bagian dari pelaku sektor riil itu,” kata H. Syahlan. Jika ini tetap diberlakukan, tambah H. Syahlan, pedagang asongan dan Fraksi PAN Sergai akan turun menemui Direksi PT. KAI Sumut, di Medan. Sementara Kepala Stasiun Kereta Api Perbaungan, SMT Manulang membenarkan peraturan yang akan diberlakukan 1 Janurai itu terkait pelarangan pedagang asongan berjualan di dalam kereta api kecuali memiliki tiket resmi, merupakan kebijakan dari atas. Pihaknya sebatas pelaksana.(c03)

Pelatihan Pemantapan Nilai-nilai Kebangsaan Ditutup SIBOLANGIT (Waspada): SeminardanPelatihanPemantapan Nilai-nilai kebangsaan dalam mempertahankan NKRI bagi generasi muda Sumatera Utara, yang diselenggarakan Forum Komunikasi Lintas Generasi Muda Bangsa (FKLGMB) Provinsi Sumatera Utara di Taman Dewi Sibolangit, 22 s/d 24 Desember 2011 diharapkan dapat memperkuat kemampuan dan peningkatan kualitas generasi muda. Demikian disampaikan Ka. Kesbang Pollinmas Sumut, Drs. Bukit Tambunan diwakili Drs. Mual Harahap, saat menutup seminar dan pelatihan. “Pembangunan bangsa guna terciptanya kehidupan nasional yang ber-

martabat,” katanya. Acara yang dihadiri Ketua Panitia Imelda Pandiangan, Oda Kinanta, Sjarijal Akino, Ocah Harahap, Ketua FKLGM Sumut BernardSibagariangdiikuti60 peserta dari seluruh elemen masyarakat. “Dari kegiatan ini diharap dapat meningkatkanpemantapandalam mempertahankanNKRI,menuju masyarakatyangkokoh,penuhnilai Pancasila,” terangnya. Dikatakan, saat ini banyak fakta yang terjadi di masyarakat Indonesia,dimanaakhlaq,mental dan agama para pemuda makin merosot. “Meski Ideologi negara adalah Pancasila, namun ideologi masyarakat Indonesia mulai luntur,” ujarnya.

Pemprovsu berharap acaraacara kebangsaan seperti ini mampu meningkatkan pemantapan untuk mempertahankan NKRI. “Semoga menjadi sarana untuk menyamakan persepsi dalam NKRI, Bhinneka Tunggal Ika, dan mampu memantapkan dalam membela NKRI,” katanya. Sementara itu, Ketua Panitia ImeldaPandianganmenjelaskan, tujuan penyelenggaraan untuk meningkatkan hubungan kelembagaan di semua pihak, guna mengidentifikasi segala permasalahan kebangsaan saat ini. Seminar dan pelatihan kebangsaan menghadirkan pembicara lokal dari KNPI Sumut, Dispora Provsu dan Paskhas TNI AU.(m21)

LPGM Sumut Selenggarakan Pelatihan Bela Negara SIBOLANGIT(Waspada):Keberadaan generasi muda memiliki peranan strategis sebagai garda terdepan dalam mengkomunikasikan serta memperjuangkanaspirasidankepentingan rakyat, sehingga harus diawaki kader-kader pemimpin yang visioner,berkarakterdanmemiliki kesadaran moral kebangsaan. Hal tersebut disampaikan KepalaKesbangPollinmasProvsu DrsBukitTambunanyangdiwakili KabidIVThomsonSimanungkalit SH ketika membuka Seminar dan Pelatihan Peran Dan Fungsi Serta Kedudukan Generasi Muda Sebagai Komponen Cadangan Pertahanan RI yang diselenggarakan Lembaga Pengembangan Dan Pemberdayaan Generasi Muda Sumatera Utara (LPGM)

di The Hill Hotel & Resort Sibolangit, Sabtu (24/12). Hadir pada acara ini Ketua LPGM Sumut Rotua Sibagaring SST, Ketua Panitia Rifki Ramadhan, Gorby Hutabarat, Berliano Bako. Pada kesempatan itu Kepala Kesbang Pollinmas Provsu mengharapkan, dari kepelatihan ini akan lahir kader pembina kesadaran bela negara yang memilikidedikasitinggi.Pasalnya, pemuda sebagai bagian dari civil society yang berperan sebagai penyeimbangpemerintah,memiliki tugas dan tanggungjawab yang sama dalam melaksanakan pembinaankesadaranbelanegarakepada warga negara lainnya “Kesadaran belanegaramerupakansalahsatu elemen mendasar dalam menentukan eksistensi negara dan

bangsa Indonesia,” katanya. Dikatakan, saat ini generasi muda memiliki potensi besar dan dapat mengambil inisiatif sehingga tidak terjebak pada nilai budaya konsumtif, materialisme, hedonismedankorupsi.Generasi muda hendaknya terpanggil untuk lebih bersikap arif dan membangun kenegarawanan karena saat ini telah terjadi disorientasi di kalangan kepemimpinan nasional. Ketua LPGM Rotua Sibagariang SST mengakui, pemuda memilikipotensiyangbesardalam menyelesaikan persoalan bangsa terutama menyangkut pertahanan negara, meski tak dipungkiri bahwa persoalan dalam diri pemuda juga banyak. (m41)

Waspada/Edi Saputra

PULUHAN pedagang asongan Perbaungan bersama Wakil Bupati Sergai, H. Soekirman, Ketua Fraksi PAN Sergai, H. Syahlan Siregar, Sekcam Perbaungan, Suparmin, Kepala Stasiun Kereta Api Perbaungan, SMT Manulang, Pembina Pedagang Asongan, Lolom.

Iringan Kapoldasu Terhambat Bus KUPJ SEIBAMBAN (Waspada): Iringan kendaraan rombongan Kapoldasu, Irjen Pol.Wisjnu Amat Sastro sempat mengalami hambatan beberapa saat ketika melintas di jalan lintas Sumatera (Jalinsum) Km 58-59, kota Sei Rampah, Senin (26/12) sekitar pukul 16:00. Informasi dihimpun Waspada, rombongan orang nomor satu di jajaran Poldasu itu melintas dari arah Medan menuju Tebingtinggi dengan pengawalan mobil voredes dan sepeda motor. Di saat bersamaan searah dengan rombongan Kapoldasu,

Ketua PD Muhammadiyah Sergai, H. Zubir Hamzah didampingi Ketua Ranting Muhamma-

diyah Desa Pon, Muis Kuswari mengatakan, khitan massal ini merupakan bentuk kepedulian

Waspada/Edi Saputra

Wakil Bupati Sergai, H. Soekirman didampingi Ketua PD Muhammadiyah Sergai, H. Zubir Hamzah dan Ketua Panitia kegiatan, Muis Kuswari tampak meninjau peserta khitan massal di gedung SMP dan SMA Muhammadiyah Desa Pon.

Serda FJD Ngl yang bertugas di Silog Sekkau Jakarta Timur. Oknum yang terkesan arogan itu akhirnya dijemput petugas POM TNI AU Medan. SaatmenunggupetugasPOM TNI AU, oknum tersebut sempat mengatakan sedang cuti tahun baru. “Saya sedang cuti, karena tidaktegabapakyangbawamobil, maka saya gantikan,” ujarnya. PantauanWaspada, oknum tersebut dijemput Kasubsi Plintib Lalin, Letda POM, Herdi M. Ramadhan untuk dibawa ke Medan berikut bus KUPJ yang dikendarainya. (c03)

PC NU DS Bahas Tanah Terlantar LUBUK PAKAM (Waspada): Pimpinan Cabang Nahdlatul Ulama Kabupaten Deliserdang bekerjasama dengan PW NU Sumut serta PW LBM NU Sumut melaksanakan Bahtsul Masail ke3 membahas masalah tanah mati (tanah terlantar-red), di Aula Cadika Pramuka Lubuk Pakam, Minggu (25/12). Kegiatandiikutiratusanpeserta turut dihadiri pengurus NU Kab. Deliserdang, Langkat, Binjai, SerdangBedagai,Tebingtinggidan Medangunamembahasmasalah proses penggarapan tanah mati. Katib Suriyah PWNU Sumut Drs. H. Musaddad Lubis meminta kepada seluruh pengurus NU agar memanfaatkan tanah mati atau tanah yang kosong/terlantar dengan berpedoman pada hukum dan peraturan berlaku. Dalam membahas hukum Islam terkait dengan masalah tanah

atau dalam bahasa fikih artinya “ul mawat” menyangkut dan menghidupkan tanah-tanah terlantar diharapkan peran NU harusmengertitentangtanahdan bagaimana filosofi tanah dalam agama, kata H. Musaddad seraya mengajak warga NU bagaimana memanfaatkan tanah menurut aturan-aturan syariat Islam. H. Musaddad mengatakan kita sepakat tanah yang kosong danterlantarituharusdihidupkan dan dimanfaatkan kepada umat dan warga masyarakat sehingga diharapkan memberi motivasi kepada pengurus NU dan warga NU juga umat pada umumnya untuk memiliki tanah dengan cara yang baik sesuai dengan syariat Islam dan peraturan hukum berlaku. Menurut Musaddad, pemerintah harus mendorong bagaimanacaraagartanahyangbelum

dimanfaatkan segera dimanfaatkan dengan sebaik-baiknya agar tujuanuntukmemakmurkandan mensejahterakan rakyat secara umum dapat dilaksanakan dan tercapai sebagaimana mestinya. Ketua PC NU Deliserdang Gustur Husein Siregar SH, MAP menjelaskan masih banyak permasalahan tanah di Deliserdang yang belum sinkron. Bahkan bisa kita lihat sendiri masih banyak tanah mati yang tidak dipakai dan tidakterawatsebagaimanamestiya. “Kita harapkan melalui Bahtsul Masail ke 3 ini mudahmudahan sebagai pengurus dan warga NU dapat mengambil hikmah dalam pencerahan yang disampaikanparaulamaNU.Mari manfaatkan tanah mati sesuai aturan-aturan syariat Islam serta hukum dan peraturan berlaku,” ajak Ketua PC NU Deliserdang Gustur Husein Siregar.(a06)

Kasus Dugaan Korupsi Di PD Pembangunan Binjai Dipetieskan MEDAN (Waspada): Asumsi negatif masyarakat terkait penegakan hukum kiranya cukup beralasan, seperti halnya kasus dugaan korupsi di PD Pembangunan Binjai melibatkan direktur sebelumnya, yang terkesan dipetieskan Polresta Binjai. Kasus yang merugikan keuangan negara miliaran rupiah itu semakin tidak jelas perkembangannya, sehingga mendapat reaksi keras dari Lumbung Informasi Rakyat (LIRA) yang mendesak Kapolresta Binjai meng-

Muhammadiyah Sergai Gelar Berbagai Kegiatan SEIBAMBAN (Waspada): Dalam kaitan memperingati tahun baru Islam, 1433 Hijriyah danulangtahun(Milad)Muhammadiyahke-102,PimpinanDaerah Muhammadiyah Kab. Serdang Bedagai melaksanakan berbagai kegiatan, Minggu (25/12). Kegiatan itu di antarannya khitan (sunat) massal dengan 125 orang peserta, dua diantarannya muallaf di gedung SMP dan SMA Muhammadiyah Desa Pon, Kec. Sei Bamban, pemutaran film “Sang Pencerah” dan “Laskar Pelangi” serta tablig akbar diisi Ketua PW Muhammadiyah Sumut, Prof. Dr. H. Asmuni dan Drs. H. Armansyah. KemudianperesmianKantor Pimpinan Ranting Muhammadiyah Desa Pon di kompleks Masjid Taqwa Desa Pon, serta pembagian sekitar 600 tabungan (celengan) kepada warga Muhammadiyah untuk pembangunan gedung Dakwah Muhammadiyah Sergai yang akan dikutip per triwulan.

bus KUPJ BK 7917 DM yang berada di depan tampak enggan menepi, walau telah terdengar sirene maupun pemberitahuan petugasPatwalyangadadidepan. Setelah berhasil dihentikan, smpat terjadi adu mulut antara sopir KUPJ dan petugas. Insiden ini mengakibatkan rombongan sempat terhenti beberapa saat, kemudian melanjutkan perjalanan ke arah Tebingtinggi. Sedangkan bus KUPJ akhirnya diamankan ke Pos Pengamanan Desa Pon, Kec. Sei Bamban. Belakangan diketahui, sopir bus KUPJ adalah oknumTNI AU,

Muhammadiyah kepada masyarakat, khususnya yang kurang mampu se Sergai dalam rangka perayaan tahun baru Islam dan Milad Muhammadiyah ke 102, terang pria yang juga Ketua Ranting Muhammadiyah Desa Pon. “Awalnya khitanan massal direncanakan hanya 60 orang, namun karena antusiasnya masyarakat bertambah menjadi 142orang,2diantarannyamuallaf yakni Rahmat Sembiring, 17, warga Sei Rampah dan Ronal Butarbutar, 18, warga Desa Pon Kec. Sei Bamban, terima kasih kepada semua pihak yang telah mendukungkegiatanini,”tambah Kuswari. Wakil Bupati Sergai, Ir. H. Soekirman mengimbau semua pihak untuk dapat meningkatkan kepekaan khusunya terhadap kaum duafa, seperti yang telah dilakukan Muhammadiyah yang melaksanakan khitan massal dihari libur,” ujarnya kepada Waspada seusai meninjau acara khitan massal itu. (c03)

ungkapdanmeringkustersangka. Hal itu ditegaskan Sekretaris Daerah LIRA Sumut, Oskar Siagian, Skm dalam pertemuan terbatas terkait perkembangan sejumlah kasus korupsi di Binjai, Sabtu (17/12). “Kami sangat kecewa dengan kinerja Polresta Binjai yang terkesan mempetieskan kasus tersebut,” ujar Oskar. Lanjutnya, tidak ada alasan buat Polresta Binjai mengabaikan puluhan karyawan PD Pembangunanyangmelaporkanoknum mantan direkturnya, terkait

dugaan korupsi di perusahaan daerah yang dipimpinnya. Dalan laporan itu terlapor diduga memalsukan identitas jumlahkaryawanyangmenerima perumahan, yang tidak sesuai dengan jumlah dan data daftar karyawan sebenarnya. Selain itu juga dilaporkan gaji mereka tidak dibayar enam bulan terakhir, bahkan tidak sedikit di antara mereka diwajibkan membayar sejumlah uang kepada pelapor agar dapat bekerja di perusahan daerah tersebut.(m14)

Sumatera Utara


Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: Edward Thahir. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Armin R. Nasution. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Sinur Manik (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi). Wartawan Kota Medan: Umum: Zulkifli Harahap, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa, Maini Anggita, Silfa Humaira. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Dedek Juliadi, Hajrul Azhari Ritonga. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebing Tinggi: Muhammad Idris, Abdul Khalik. Pematang Siantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Pakpak Bharat: Arlius Tumanggor. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanafiah, Hasanul Hidayat. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Bustanuddin, Wintoni. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan Waspada dilengkapi dengan kartu pers. Tidak dibenarkan menerima uang dalam bentuk apapun. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988

Ratusan Ball Press Pakaian Bekas Diamankan TANJUNGBALAI (Waspada): Pangkalan TNIAL Tanjungbalai Asahan, menggagalkan penyelundupan ratusan ball press pakaian bekas asal Malaysia di perairan Tanjung Tiram, Senin (26/12). Pakaian bekas itu, diangkut KM Sa I. Dan, saat penangkapan, dua awak kapal yakni KKM dan ABK menceburkan diri ke laut menghindari tangkapan petugas. Sementara, nakhoda kapal, Sal, warga Kota Tanjungbalai dan 1 ABK berhasil diringkus dan diamankan bersama barang bukti di Posal Tanjung Tiram. Komandan Pangkalan TNAL Tanjungbalai Asahan Letkol (P) Retiono Kunto H melalui Pasi

OpsKaptenLaut(P)Bayu,didampingi Pasi Intel Kapten Marinir Irfan Hilmi mengatakan, kapal dan muatannya ditangkap saat berlayardiperairanTanjungTiram menuju daratan.“Pakaian bekas itu dibawa dari Malaysia menuju Batubara, dan rencananya akan dikirim ke Medan melalui jalur darat,” ungkap Bayu. Dijarah Massa Lebih lanjut dikatakan Bayu, kendati barang bukti ratusan ball

press pakaian bekas di kapal, sempat dijarah massa. Kendati situasi berhasil dikendalikan, namunkapalpengangkutpakaian bekas itu nyaris karam. “Ball press basah semua, karena kapal nyaris karam. Penyebabnya, saat itu pasang surut sehinggakapalmiringdanmuatannya punterendamairlaut,”jelasBayu. Oleh sebab itu, lanjut Bayu, Lanal TBAkinisedangberupayamenarik kapal dan muatannya untuk dibawa ke Kota Tanjungbalai. “Masihtahappemeriksaandan penyelidikan.Setelahitu,rencananya barang bukti akan kita serahkan ke Bea Cukai Teluknibung guna kepentingan pemeriksaan lebih lanjut,” ujar Bayu. (a14)

Pemkab Labusel Bentuk Tim Ukur Ulang HGU Perkebunan KOTAPINANG (Waspada): Untuk memastikan luas lahan perkebunan di Kabupaten Labuhanbatu Selatan (Labusel), Pemkab Labusel membentuk tim untukmelaksanakanpengukuran ulang Hak Guna Usaha (HGU) ataslahanperkebunanswastadan BUMN yang berada di Labusel. Kepala Bagian Hukum Pemkab Labusel, Khairil mengatakan, tim pengukuran ulang HGU yang dibentuk Pemkab itu akan memulai pengecekan secara langsung ke lahan perkebunan pada tahun 2012 mendatang. Menurutnya, langkah itu penting dilakukan guna memastikan luasan tanah yang diklaim warga memiliki hak atas tanah maupun pihak perusahaan perkebunan yang jumlahnya men-

capai sekira 30-an perusahaan yang tersebar di Labusel. Menurutnya, keberadaan HGU perusahaan perkebunan di Labusel diyakini banyak yang tidak seseuai ketentuan, bahkan melebihi jumlah luas sesuai HGU yang sebenarnya dimiliki perusahaan. Karena itu, untuk menertibkannya, akan dilakukan pengukuran ulang oleh tim yang dibentuk Pemkab setempat. “Tim pengukuran ulang HGU itu terdiri dari lintas SKPD (Satuan Kerja Perangkat Daerah). Jadi semuanya nanti bisa diteliti baik itu HGU, perizinan, limbah perusahaan maupun menyangkut tenaga kerjanya,” kata Khairil. Selain untuk dapat memastikan luasan lahan, pengukuran ulang HGU itu juga dinilai dapat

meminimalisasi konflik antara warga dengan perusahaan perkebunan yang bersengketa, sehingga, perlu dilakukan inventarisirperkebunanmanayang diperkirakankelebihanHGUuntuk dilaksanakan pengukuran ulang. Sementara Kepala Bagian Pemerintahan, Irsan Arini mengatakan, di dalam tim pengukuran HGU tersebut, pihaknya juga dilibatkan untuk meneliti persoalan perizinan perusahaan perkebunan untuk diketahui apakah masih berlaku atau perlu diperpanjang. Dia menambahkan, untuk lahan perkebunan yang diketahui berlebih dari hasil pengukuran ulang tersebut akan dibahas oleh tim Pemkab yang menanganimasalahtersebutsesuai ketentuan yang berlaku. (c18)

Pembangunan MIS Desa Sidua-dua Terlantar AEKKANOPAN (Waspada): Pembangunan gedung sekolah Madrasyah Ibtidaiyah Swasta (MIS) Desa Sidua-dua, Kec. Kualuhselatan, Kab. Labuhanbatu Utara (Labura), yang merupakan bantuandanahibahdaripropinsi, diterlantarkan rekanan pemborong bangunan tersebut. Gedung sekolah yang berjumlah lima lokal itu mendapat bantuan sebanyak tiga lokal, namun belum selesai dikerjakan. Rekanan pemborong yang disebut sebut warga Rantau Prapat telah meninggalkan sekolah itu danmentelantarkannyabegitusaja, sehingga proses belajar di sekolah tersebut menjadi terganggu. Kepala Sekolah MIS Desa Sidua dua, Siti Hajar saat dikonfirmasi Waspada, Selasa (27/12) tidak berada ditempat. Namun para guru yang saat itu berada

di sekolah mengaku sangat terganggu proses belajar mengajar di sekolah tersebut. “Kita sangat terganggu pak, karena tiga kelas digabungmenjadisatukelas,”ujar salah seorang guru. Dikatakannya, sejak gedung sekolah itu direhab, 76 murid sekolahitumenjaditidaknyaman belajar, sebab katanya lima lokal ruangkelasyangadasebelumnya, hanya dua lokal yang bisa dipergunakan. “Kita hanya bisa pakai dua lokal saja.Yang tiga lokal lagi bapaklihatsendirisajakondisinya masihberantakan,sehinggakami menggabungkan murid kelas I hingga kelasVI menjadi dua lokal saja. Otomatis proses belajar pun menjadi terganggu,” katanya, yang dibenarkan guru guru lain. Sementara Ketua Alwasliyah DesaSiduadua,H.Suheri,kepada Waspada mengaku tidak terlibat

proses pembanguna gedung sekolah tersebut. Dia mengaku pihak rekanan tidak ada melibatkan dirinya masalah pembangunan sekolah itu. “Masalah pembangunan sekolah itu tanya saja langsung sama kepala sekolahnya, karena rekanan yang mengerjakan sekolah itu langsung berkoordinasi sama kepala sekolah,” katanya saat ditemui diacara sunat masal di Puskesmas Sidua dua. Pantauan Waspada di lokasi, Selasa (27/12), tiga ruang kelas yangdikerjakankondisinyamasih berantakan, satu di antara ruang kelastersebutterlihatbelumdipasang atap sengnya. Para pekerja yang selama ini mengerjakan sekolahtelahmeninggalkanlokasi itu, sehingga bahan bangunan yang ada di sekolah itu banyak yang hilang. (c08)

Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan: hitam-putih Rp. 33.000,-, berwarna Rp. 90.000,Ukuran kolom: 40,5 mm. E-mail Iklan: Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Waspada/Syahri Ilham Siahaan

GEDUNG Sekolah MIS Desa Sidua dua, Kec. Kualuhselatan terlihat masih belum selesai dikerjakan.

Batubara Berpacu Kejar Ketertinggalan BANYAK orang memanfaatkan waktu libur beristirahat atau setidaknya refresing bersama keluarga ke tempat obyek wisata maupun tempat permainan lain yang layak dikunjungi sebagai langkah menghilangkan kejenuhan sehari-hari. Berbeda dengan sosok H OK Arya Zulkarnain, SH, MM nota benenya Bupati Batubara memanfaatkan hari libur pada cuti bersama, Senin (26/12) bersepedamotor sendirian mengitari pelosok desa/kampung dan kelurahan merupakan hal biasa dilakukannya. ‘’Lihat tu, Pak OK bersepedamotor masuk kampung sendirian. Meskipun waktu cuti libur bersama tetap punya perhatianterhadapdaerah,’’tukas Adek dan Udin Some masyarakat Kelurahan Labuhan Ruku, Kec. Talawi, kepada Waspada. Bupati mengenderai sepeda motor jenis Yamaha RX King, tanpa didampingi pejabat, dan itu merupakan hal biasa dilakukannya. Sedangkan ajudan mengikuti dari belakang dengan sepeda motor lain.

Dia datang dari arah Lima Puluh menyusuri jalanan lalu sampai Simpang Geho Labuhan Ruku dan terus kedalam Kampung Kedah/Kampung Jawa. Setelah itu, kembali keluar dan masuk lagi ke arah Puskesmas Rawat Inap. Selanjutnya menuju keTanjungtiram.Begitujugapada hari kerja OK Arya gelar Datuk Setia Amanah kerap melakukan Sidak ke SKPD tanpa diketahui maupun meninjau pembangunan di lapangan. Meskipun diakui, sebagian pejabat (eselon II dan III) jarang menetap di Batubara terutama hariliburbiasaSabtudanMinggu, karena hari terakhir kerja mereka sudah pada pulang ke tempat tinggal masing-masing baik ke Asahan, Sergai dan Medan. Sedangkan yang menetap tinggal di Batubara umumnya berasal dari anakdaerahatauyangberkeluarga perlu mendapat perhatian. “Realitanya ini terjadi di Batubara, sebagian pejabat pada balik kampung sehingga menjadi kendala jika memerlukan koordinasi,” ujar warga lainnya. Bupati Batubara berkomit-

WASPADA Rabu 28 Desember 2011

men dalam memberdayakan anak daerah, didukung kualitas dan kemampuan maupun prestasi kerja yang dimiliki guna menempati suatu jabatan. Sampai kepada domisili daerahnya pun turut dipikirkan demi menjaga keseimbangan agar dirinya tidak condong kepada kecamatan (daerah) tertentu. “Sampai sejauh ini saya pikirkan demi menjaga keseimbangan menempati posisi jabatan,”ujarOKAryasembarimengaku akan melakukan pembena-

han secara berlahan di tubuh Pemkab Batubara. Terkait master plan pembangunan ke depan lebih terarah dari Labuhan Ruku - Tanjungtiram, Kuala Tanjung dan Medang Deras membangun rumah potonghewan.Selainrencanamembangun jembatan penghubung dari Kampung Kedah dengan Kampung Alai (Talawi-Tanjungtiram), juga membenahi ruas jalan sampai membuka terminal bus dan jalan lingkar. Di samping melakukan pembenahan terhadap riol yang rusak atau tumpat diseputaran Pasar Inpres dan Simpang Bogak Jalan Merdeka Tanjungtiram. Sampai arah pengembangan Pelabuhan Kuala Tanjung dalam mendukung program pembangunanpemerintahpusatmelalui Master Plan Percepatan PembangunanEkonomiIndonesia(MP3EI)danKawasanIndustriSeiMangkei (KISM) berbasis kelapa sawit. Tahap awal kini sedang berjalan pembangunan jalur Kereta Api (KA) dari Kuala TanjungStasiun Bandar Tinggi. Sehingga nanti membuka peluang bagi

investor menanamkan modal baik mendirikan usaha industri dikawasanpesisirmaupunusaha market dari hasil Inalum, membukapeluangkerjabarubagi anak daerah. “Ini kita tanamkan kepada setiap investor membuka usaha di Batubara untuk mengutamakan anak daerah dalam merekrut tenagakerjadibutuhkan,”ujarnya. Apalagieksekutifdanlegislatif telah menandatangani bersama berita acara pengesahan APBD Batubara Tahun 2012 yang mengalami kenaikan mencapai Rp 633,7 miliar. Sebelumnya Tahun 2011 hanya Rp 559 miliar. Sebelumnya Bupati Asahan, Drs. H. Taufan Gama Simatupang MAP memberikan apresiasi terhadap kinerja OK Arya karena ketertinggalan Batubara secara berlahan dapat terkejar dan membuahkan prestasi membanggakan setelah dimekarkan. ‘’Awal dimekarkan APBD Batubara hanya berkisar Rp200 miliar, namun kini sudah hampir menyerupai Asahan,” ujarTaufan akrab dipanggil Buya. * Iwan Has

Waspada/Iwan Has

KAFILAH Nasyid Batubara (putra/i) yang mengikuti festival ke XIX Provsu Tahun 2011 ketika audiensi kepada Bupati Batubara H OK Arya Zulkarnain, SH,MM, Selasa (27/12).

Bupati Terima Audiensi Kafilah Nasyid Batubara LIMAPULUH (Waspada): Setiap karya/seni yang diraih didukung dari kemauan diri sendiri maupun membenahi, agar bisa lebih baik sehingga prestasidapatdipertahankanmaupunditingkatkan. ‘’Mudah-mudahan ini masukan bagi putra/ i kita setiap mengikuti even atau perlombaan agar mendapat prestasi gemilang bagi daerah,’’ tukas Bupati H OK Arya Zulkarnain, SH,MM, Selasa (27/12). Dia mengatakan itu ketika menerima audiensi kafilah nasyid daerahnya dalam festival ke XIX Provsu Tahun 2011 lalu Batubara juara empat. Prestasiini,katanya,patutdibanggakan,karena Batubara bisa tampil juara dan tidak ketertinggalan dengan daerah lain. Sedangkan anak daerah dapat mempertahankan dan meningkatkan karyanya, sejalan mempersiapkan bekal mendukung

pengembangan pembangunan ekonomi. ‘’Mari kita siapkan diri untuk bekal ke depan menampung bidang pekerjaan,’‘ujarnya, sembari mengatakan Batubara indikator pengembangan ekonomi di Indonesia oleh Pemerintah Pusat melalui Program MP3EI di Kuala Tanjung. Kafilah Nasyid Batubara melakukan audiensi terdiri Kabag Kesos (Ketua), Drs Sofyansyah, H Taufik Hidayat, Safri, SH, Fitriana, M Januar, M Irwan (official), Syahlan Efendi, Heldawati, SPd (pelatih), M Sadikin, Yaumil Qodri, Erwanto, M Hafiz, M Fachorur Rozi, M Fahmi, Nst, M Agung Perdana, Rendi, Dian Afrizal, M Efan Ali Syaputra, Basri, M Said, Yunita Sara, Nur Halimah, Nurul Azni, Youhana Maulida, Siti Aisyah, Alika Putri, Siti Haranti, Kak NiaWahab, Sri Ariati, Lilis Suryani, Almira Dewi, Rahma Yani (peserta). (a13)

Warga Sei Merbau Tewas Di Kolong Jembatan Sei Silau TANJUNGBALAI (Waspada) : Seorang warga Akhirnya, lanjut Diah, setelah hampir 6 jam Kel.Seimerbau, Kec.Teluknibung, ditemukan tewas di Instalasi Jenazah, datang seorang pria mengaku di kolong jembatan sungai Silau, Kec.Tanjungbalai bernama Ruslan. Dan, pengakuan Ruslan, jasad Utara,KotaTanjungbalaiSelasa(27/12)sekirapukul yang terbujur kaku itu abang kandungnya. 05.00 Jenazah Sofyan Aritonang, 55, pertama kali “Keluarga masih mengurus pemulangan jasad ditemukan warga, dan selanjutnya dilaporkan ke korban,” tambah Diah. Sementara, Kapolres PolsekTanjungbalaiUtara.Saatditemukan,posisinya Tanjungbalai AKBP Edward P Sirait melalui terlentang dan miring ke kiri. KasubbagHumasAKPYaniSinulinggadidampingi Menindaklanjutilaporanwarga,petugasPolsek Kapolsek Tanjungbalai Utara AKP S Nainggolan Tanjungbalai Utara lantas turun ke lokasi kejadian membenarkan kejadian itu. (a14) dan mengamankan sejumlah barang berharga milik korban. Barang berharga itu antara lain dompet berisi KTP atas nama Lokot,wargaJalanGaruda,jam tangan, mancis, ponsel dan uang puluhan ribu rupiah. Dari lokasi kejadian, jasad korban selanjutnya dibawa ke RSUD Tanjungbalai untuk kepentinganvisum.“Tidakada tanda-tanda kekerasan di tubuh korban,” kata Direktur RSUD KotaTanjungbalai Diah Retno di dampingi petugas Instalasi Jenazah Ilham. Dijelaskannya, semula korban tidak diketahui identitasnya. “Korban memegang KTP atas nama Waspada/Rahmad F Siregar Lokot, dan ternyata setelah PETUGAS medis RSUD Tanjungbalai, memeriksa jenazah dicek, rupanya KTP itu bukan Sofyan Aritonang di ruangan instalasi jenazah. milik korban,” jelas Diah.

PMI Labuhanbatu Simulasi Penanggulangan Bencana RANTAUPRAPAT (Waspada): Palang Merah Indonesia (PMI) Labuhanbatu mengadakan simulasi penanganan korban bencana yang diadakan Minggu (25/12), yang sempat membuat masyarakat heboh dan berduyun-duyun menyaksikan kebolehan para calon relawan PMI yang sedang mengikuti pelatihan Korps Sukarela (KSR) PMI. Warga yang melintas dijembatan Sungai Bilah di Jl.WR Supratman, sempat heboh karena adanya aktivitas penyelamatan korban yang menggunakan perahu karet milik Pemkab Labuhanbatu. Warga mengira ada korban yang terseret arus sungai yang memang saat ini terlihat debit airnya sedang tinggi. Setelahmengetahuikejadianyangsebenarnya, warga spontan memberi aplus terhadap program kerja PMI Labuhanbatu. “Kami kira tadi memang benar ada yang hanyut terseret arus, rupanya simulasi PMI, tapi program itu baik kok,”

ungkap warga bermarga Hasibuan yang turut menyaksikan simulasi itu. Ketua PMI Labuhanbatu dr Alwi Mujahit Hasibuan M.Kes melalui Sekretaris PMI M Rusli mengatakan, bahwa kegiatan ini menjadi agenda rutin PMI untuk melakukan rekrutmen relawan yangakanditerjunkankelokasi-lokasibencana.Para relawan berasal dari berbagai eleman pemuda dan mahasiswa.“Pelatihankaliinimelibatkanpararelawan sebanyak 35 orang,” terangnnya. Ditambahkan Rusli, untuk menambah ilmu dankemampuanpararelawandibimbinglangsung tenaga ahli dari provinsi, sehingga pemahaman para relawan untuk tanggap di lokasi bencana akan teruji dikarenakan pemahaman itu langsung di lokasi praktek, di samping pembelajaran teori sudah dilakukan 19 sampai 24 Desember. “Rangkaian kegiatan ini akan ditutup bersamaan peringatan hari Relawan PMI,” ujarnya. (c07)

Mayat Mr X Membusuk Dalam Semak SEIBALAI, Batubara (Waspada): Mayat pria Dankinikitamasihmenghimpundataoranghilang, tanpa identitas ditemukan warga warga mulai karena jasad tersebut tidak beridentitas. Untuk membusuk dalam semak sekitar satu meter dari sementara,jasadtersebutmasihdisimpandikamat Jalinsum Asahan, tepatnya di Desa, Perkebunan mayat RSDU Kisaran” ujar Berutu. Seibalai, Kec. Seibalai, Kab. Batubara, Selasa (27/ Disinggung dengan korban pembunuhan 12), sekitar pukul 09:00. atau laka lantas, Berutu, belum bisa pastikan hal Informasi dihimpun Waspada, mayat itu itu, karena masih menunggu hasil visum. Dilihat ditemukandalamkondisitelentangdidalamsemak dari kondisi tubuhnya, korban telah tewas sekitar dengan memakai kemeja berwarna putih, dan 4-5hari.Sehinggasulituntukmengenalinyakarena celana jeans biru. “Saya berencana membeli lem ke kedai, tapi sewaktu saya lewat mencium aroma tubuhnya mulai membusuk. “Namun demikian, kita akan mengumpulkan menyengatdalamsemak,danketikansayalihatternyatamayatseorangpria,”ujarwargayangmenemu- data dari mayat tersebut, sehingga bisa diketahui kan mayat tersebut, S Sitinjak, ditemui waspada. dari mana asalnya dan apa penyebab tewasnya Akibatnya, Sitinjak langsung melaporkanya pria tersebut,” ujar Berutu. (a15) ke pihak yang berwajib, dan langsung menarik perhatian warga untuk menyaksikan mayat tersebut. Namun untuk pe-nyelidikan, jasad tersebut dibawa ke RSUD Kisaran untuk keperluan visum. Kapolres Asahan, AKBP Marzuki MM, dikonfirmasi Waspada melalui Kasubag Humas AKP R Berutu, didampingi Kanit Reskrim Iptu A Siringoringo SH, mengatakan hinggasaatinimasihdilakukan penyidikan, terhadap penemuan mayat tersebut, sehingWaspada/Sapriadi ga belum diketahui dengan JASAD seorang pria ditemukan warga dalam semak dalam pasti motifnya. “Kita masih menunggu kondisi mulai membusuk, Desa, Perkebunan Seibalai, Kec. Seibalai, hasilvisumdariRSUDKisaran. Kab. Batubara, Selasa (27/12).

Sumatera Utara

WASPADA Rabu 28 Desember 2011


Menteri Pariwisata: Jalan Ke Berastagi Tak Seindah Alamnya BERASTAGI (Waspada): Menteri Pariwisata dan Ekonomi Kreatif, Mari Elka Pangestu mengungkapkan, kondisi infrastruktur jalan menuju kota wisata Berastagi tidak seindah alamnya. Dia juga menyesalkan kondisi jalan menuju Taman Simalem Resort (TSR) Kec. Merek, Tongging, Danau Toba, Kab. Simalungun dan Dairi, Kab. Dairi. “Jika dari kesuburan tanaman, sayur-mayur, buah buahan Kabupaten Karo sangat subur,danbisadiandalkan.Begitu juga penginapan eksotis dengan pemandangan pegunungan. Namun, kita sangat menyesalkan kondisi jalan menuju kota wisata

Tanah Karo tidak seindah alamnya,” terang Mari EIka Pangestu di kantor Bupati Tanah Karo, Selasa (27/12). Dikatakanya, melihat kondisi jalan yang sangat memprihatinkan terutama dari ibukota Provinsi Sumut menuju ke Berastagi,

Mayat Tak Dikenal Ditemukan Di Sumur Pancur Batu (Waspada): Sosok mayat lelaki tak dikenal, ditemukan masyarakat Desa Dusun Tengah Pancur Batu, Kab Deliserdang dalam sumur milik penduduk. Penemuan sosok mayat yang ditaksir berusia 30 tahun menimbukan kegegeran warga dusun dan segera melaporkan ke perangkat desa dan selanjutnya bersama pihak kepolisian mengevakuasi korban ke rumah sakit. Informasi dikumpulkan wartawan dari masyarakat setempat, Selasa (27/12), penemuan mayat berawal dari adanya warga bernama E br Tarigan yang merasa mencium bau busuk di sekitarnya, Senin pagi. Semula ia merasa bau busuk berasal dari bangkai ayam atau bebek yang mati. Karena merasa penasaran dengan bau busuk yang muncul di sekitar rumahnya, Evi mengajak keluarganya untuk mencari sumber bau busuk. Di saat melakukan pencarian ternyata aroma busuk berasal dari dalam sebuah sumur. Penemuan sumber aroma yang busuk berasal dari sumur segera dilaporkannya ke perangkat desa Dusun Tengah, Julistra Tarigan dan bersama sama meninjau ke TKP dan melihat adanya sosok mayat dengan posisi telungkup di dalam sumur. Penemuan mayat segera dilaporkan kepada Kepala Desa Ebenneser Pelawi dan selanjutnya melaporkan kepada pihak kepolisian. PihakkepolisiandipimpinIptuGunawanyangmendapatinformasi segera terjun ke TKP bersama anggotanya dibantu tim forensik Poldasu melakukan evakuasi jenazah korban dari dalam sumur dan selanjutnya dilarikan ke RSU di Medan. Kepala Desa Dusun Tengah Ebeneser Pelawi melalui perangkat desanya Julitra Tarigan dihubungi wartawan membenarkan adanya peristiwa ini. Menurutnya, korban yang belum diketahui identitasnya bukan penduduk setempat, karena hingga sore harinya belum ada yang melaporkan kehilangan keluarga. “Diduga korban berasal dari desa lain,” kata Tarigan . (a36)

seharusnya hanya menempuh jarak bekisar dua jam, dengan menggunakan kendaraan roda empat. Tapi, dengan keadaan jalan yang rusak membuat laju kendaraan harus ekstra hati -hati, dan memakan waktu bekisar tiga atau empat jam. Belum lagi terkendala dengan kemacetan di jalan, bisa mencapai lima hingga enam jam. “Maka kita sangat mengharapkan dari sembilan kabupaten, dua kota, ikut ambil andil demi memperlancar infrastruktur jalan ke kota wisata, agar tetap menjadi tujuanpelancongbaiklokal,maupun mancanegara,” terangnya. Amatan Waspada, kedatangan Menteri Pariwisata dan Ekonomi Kreatif keT. Karo sangat membuat kejutan, baik di kala-

ngan Pemkab dan masyarakat sekitar. Dengan menggunakan mobil warna hitam BK 9 LG, Mari ElkaPangestulangsungmeninjau pasar buah Berastagi, dengan ditemaniBupatiKaro,KaroJambi, Wakil Bupati, Terkelin Berahmana, Kadis Dinas Pariwisata Karo, Dinasti Sitepu, serta kalangan Pemkab. Bermalam Di TSR Kedatangan Menteri Pariwisata dan Ekonomi Kreatif, Mari EIka Pangestu, sebelum bertamu ke kantor Bupati, dan meninjau Pasar Buah Berastagi, Kab. Tanah Karo, Selasa (27/12) sebelumnya menyempatkan diri melakukan penanaman pohon cemara serta menginap di Taman Semalam Resort (TSR), Kec. Merek. “Mari EIka Pangestu me-

nyempatkan diri berkunjung ke TSR, dan menanam tiga bibit pohon cemara di areal lahan TSR sore sekira jam 16:00, serta akan bermalam menikmati pemandanganalampegunungandisini,” terang pengusaha TSR, Tamin Sukardi kepada Waspada. Dikatakan pemilik Hotel Sibayak, Tamin Sukardi, atas dukungan Menteri Pariwisata terhadapeksotispenginapanyang ditawarkan TSR, dia sangat berharap pada wisatawan, baik lokal maupun mancanegara agar dapat berlama – lama di kota wisata yang terkenal dengan kesejukan udara alam pegunungan, danpemandanganindahdaridua gunung aktif, Sinabung, dan Sibayak. (c19)

Pemkab Simalungun Tolak Konversi Sopir Bus ALS Ditodong Pistol Tanaman Teh Menjadi Sawit SIMALUNGUN (Waspada): Pemkab Simalungun akhirnya bersikap tegas, menolak konversi tanaman teh ke tanaman kelapa sawit yang dimohonkan PTP Nusantara IV (Persero). Penegasan itu dikemukakan Kepala Kantor Pelayanan Izin Terpadu (PIT) PemkabSimalungun,Sudiahman Saragih, di ruang kerjanya, kemarin. Dijelaskannya, sikap ditempuh Pemkab Simalungun yang menolak konversi tanaman teh ke tanaman kelapa sawit tersebut, selain berpedoman pada peraturan perundang-undangan berlaku juga menyikapi perkembangan situasi dan aspirasi masyarakat yang saat ini tengah bergejolak. “Keputusan Pemkab menolak konversi tanaman teh ke tanaman sawit berdasarkan pemikiran dan pertimbangan serta aspirasi masyarakat yang juga menolak,” tegas Sudiahman. Permohonan itu berkaitan dengan surat Direksi PTP Nusantara IV (Persero) Nomor 04.03/X/108/X/2011 Perihal Permohonan persetujuan konversi teh menjadi kelapa sawit dengan luas 1.647,25 ha di Kabupaten Simalungun. Lebih lanjut dikatakanSudiahman,berbagaielemen menyuarakan aspirasi dan tuntutan penolakan konversi tanaman teh menjadi kelapa sawit masing-

masing dari Ketua DPRD Simalungun, Ketua Komisi II DPRD Kabupaten Simalungun, Ketua Fraksi Golkar Bersatu DPRD Simalungun,KetuaDPCHimapsi Kabupaten Simalungun, Ketua Earth Society Of Danau Toba, Forum Aliansi Bersama Sidamanik, Forum Pemerhati Lingkungan Sidamanik, Lembaga Penyalur Aspirasi Rakyat, Ketua HKTI Kecamatan Sidamanik, Ketua Gapoktan Sarimatondang,Warga Masyarakat Kecamatan Sidamanik, Angkatan Muda Indonesia Bersatu (AMIB) Kabupaten Simalungun serta dialog public Plus Minus Konversi Perkebunan Teh ke Sawit. Selain itu, rencana konversi itu juga dinilai telah menyalahi tata ruang yang telah direncanakan yakni kedua kebun tersebut diperuntukkan buat lokasi eco touris (wisataalam)yangberhawa dingin. Dampak negatif lainnya terjadinya perubahan ekosistem flora dan fauna. Di samping itu dampak lain yang muncul adalah bertambahnya pengangguran karena perkebunan kelapa sawit lebih sedikit menyerap tenaga kerja dan bakal menghilangkan trend mark agrowisata yang selama ini dikenal dan diminati di Simalungun. Yang dikhawatirkan masyarakat akibat konversi teh ke tanaman sawit, lanjut dia, daya serap

tanah terhadap air berkurang yangdapatmengakibatkanbanjir, erosi dan longsor. Kekhawatiran ini tidak berlebihan karena akibat dari konversi tanaman yang telah terlebih dahulu dilakukan yakni banjir, erosi dan longsor itu bisa dirasakanmasyarakatdiKecamatanPaneidanJorlangHataranyang baru –baru ini terkena banjir. “Dariberbagaipertimbangan itulah kita minta pihak PTP Nusantara IV perlu mengkaji ulang secara mendalam atas rencana konversidimaksud,sehinggamasyarakat dan perusahaan perkebunan itu dapat berdampingan dengan baik,” ujar Sudiahman. Berdasarkan pantauan di lapangan, kemarin, pihak PTPN IV Kebun Bah Butong sudah melakukan replanting tanaman teh. Bahkan seluas sekitar 5 hektar persisdibelakangpabriktehkebun BahButong,Sidamaniksudahada yang ditanami kelapa sawit. Sedangkandisepanjangjalan protokol menuju Kecamatan Sidamanik terpampang spanduk berukuran besar yang isinya menolak rencana konversi teh ketanaman sawit. Salah seorang warga, Azis Damanik, kepadaWaspada juga menyatakan keberatannya atas rencana konversi tersebut. “Kami berharap pihak PTPN IV tetap bertahanpadatanamanteh,”kata Damanik.(a29)

Tubruk Mobil Barang, Satu Tewas Tiga Luka Waspada/Ist

DANDIM 0208/Asahan yang baru Letkol Inf Muhamad Ali menerima tanda jabatan saat sertijab Dandim 0208/Asahan di aula Makorem 022/PT, Kamis (22/12).

Letkol Inf Muhamad Ali Jabat Dandim 0208/Asahan PEMATANGSIANTAR (Waspada): Danrem 022/PT Kolonel Inf Karsiyanto menerima laporan korps raport serah terima jabatan (sertijab) Dandim 0208/Asahan dari pejabat lama Letkol Inf Handoko N kepada pejabat baru Letkol Inf Muhamad Ali. Kepenrem 022/PT Mayor Caj Drs. Prinaldi, Sabtu (24/12) menyebutkan sertijab Dandim itu dilaksanakan di Makorem 022/ PT, Kamis (22/12), karena sesuai aturan baru, untuk sertijab para Dandim dilaksanakan di Makorem. Kecuali, sertijab Danyon dilaksanakandiMakoBatalyon,dimanaDanyonmempunyaipasukan pemukul dan bukan mempunyai wilayah. Menurut Danrem 022/PT saat menerima alih tugas, wewenang dan tanggung jawab jabatan, lazim dalam kehidupan organisasi di lingkungan militer, dengan tujuan sebagai upaya untuk menambah wawasan dan pengalaman dalam penugasan serta meningkatkan kesegaran dan kinerja satuan. “Dengan pengalihan itu, diharapkan satuan maupun yang bersangkutan akan semakin baik dan semakin berprestasi dalam malaksanakan tugasnya. Kami mengucapkan terima kasih kepada Letkol Inf Handoko N atas pengabdian yang sudah dilaksanakan selama menjabat sebagai Dandim 0208/Asahan, Korem 022/PT,” ucap Danrem. Kepada Letkol Inf Muhamad Ali yang mendapat kepercayaan dan kehormatan dari pimpinan TNI-AD menjabat sebagai Dandim 0208/Asahan, Danrem mengucapkan selamat datang dan selamat bertugas. Kapenrem 022/PT menambahkan pejabat lama Letkol Inf Handoko Nurseta selanjutnya akan menjabat sebagai Kasrem 031/ WB, Kodam I/BB, sedang pejabat baru Letkol Inf Muhamad Ali sebelumnya menjabat Komandan Secaba Rindam IM. Sementara, sertijab Ketua Persit KCK Cabang XXXV dari Ny. Handoko kepada Ny. Muhamad Ali dilaksanakan pada Sabtu (24/ 12) di kantor Persit KCK Koorcab Rem 022 PD I/BB. (a30)

Majelis Tabligh PD Muhammadiyah Gelar Pelatihan Fardukifayah Di LP PEMATANGSIANTAR (Waspada): Majelis Tabligh PD Muhammadiyah Kota Pematangsiantar menggelar pelatihan fardukifayah atau bilal mayit di Lembaga Pemasyarakatan (LP) Pematangsiantar sebagai salah satu upaya peningkatan dan pengamalan ajaran agama Islam. “Sebagai umat Islam, kapan saja dan dimanapun berada, kita diwajibkan belajar. Sebagai seorang Muslim, kita harus mempunyai ilmu atau pengetahuan, dipahami, diamalkan dan dihayati serta tau bersyukur hingga jiwa kita menjadi lega dan tenteram,” sebut Ketua PD Muhammadiyah Pematangsiantar melalui Ketua Majelis Tabligh,TarjihdanTajdidAhmadFitrianto,SAgsaatpelatihanfardukifayah itu di LP Pematangsiantar, Jalan Asahan, Kamis (22/12). Ketua Bagian Kerohanian dan PHBI Ikhwansyah, SH, MSi didampingi Ketua Majelis Informasi PD Muhammmadiyah Pematangsiantar, Zulhanif Al, Sabtu (24/12) menyebutkan pelatihan fardukifayah yang diikuti 60 orang warga binaan laki-laki dan perempuan LP, sebagai upaya peningkatan dan pengamalan ajaran agama Islam yang dianut. Selain itu, warga binaan LP mengikuti pengajian tentang ibadah, akidah dan syariah setiap Rabu dan Kamis pembacaan ayat suci Al-Qur’an secara bergiliran. Pelatihan fardukifayah itu dibimbing Ustad H. Nurhalim, Drs. Marisan dan Fakhrudin Sagala, S.PdI mulai dari mempersiapkan peralatannya berupa air, kain dan lainnya, memandikan, mengkafani, menyolatkan dan menguburkannya dengan alat peraga berupa boneka. (a30)

Waspada/Dede Basri Hasibuan

MENTERI Pariwisata dan Ekonomi Kreatif, Mari EIka Pangestu didampingi Bupati Tanah Karo, Karo Jambi, memegang buah markisa dari tanaman masyarakat saat berkunjung ke pasar buah Berastagi, Kab. Tanah Karo. Menteri menjadi pusat perhatian pedagang dan para wisatawan.

PEMATANGSIANTAR (Waspada): Akibat menubruk mobil barangdaribelakang,pengemudi mobil penumpang pribadi tewas, sedangkan tiga keluarganya mengalami luka berat. Kecelakaan lalu lintas (lakalantas) itu terjadi di jalan umum km22-23,jurusanPematangsiantar-Parapat, Desa Dolok Parmonangan, Kec. Siantar, Kab. Simalungun, Selasa (27/12) sekira pukul 05:00. Korban tewas, Pontas JH Butarbutar, 65, pensiunan pegawai BUMN, korban luka berat terdiri Dicky JA Butarbutar, 33, swasta, Bonur Junita Butarbutar, 38, ibu rumah tangga dan Cindy Tampubolon, 7, pelajar, semuanya warga Jakarta. Lakalantas itu terjadi ketika mobilpenumpangpribadiToyota Kijang Super BM 1171 RC dike-

mudikan Pontas menubruk dari belakang satu mobil barang jenis tronton BK 3365WA yang belum diketahui identitas pengemudinya. Mobil Toyota Kijang Super menubruk mobil barang dari belakangketikasedangmelajudari arah Parapat menuju arah Pematangsiantar. Pontas diduga tidak memperhatikanmobilbarangyang sedang berhenti, karena rusak di badan jalan di sebelah kiri jurusan mobil Toyota Kijang Super. Benturan keras membuat bagiandepanmobilToyotaKijang remuk dan Pontas terhempas menghantam kaca depan dan kemudi mobil hingga mengalami lukaberatpadabagiankepaladan dadanya. Tiga penumpang mobil turut terhempas ke depan dan menghantam kaca depan dan sandaran mobil hingga mengala-

untuk menambah terus saldo dan melakukan transaksi melalui BNI e-Banking dan belanja dengan kartu Debit sebanyakbanyaknya, untuk poin dihitung berdasarkan saldo rata-rata bulanan tiga bulan terakhir sebab semakin besar saldo maka semakin besar kesempatan rezeki. Dijelaskan,hingggaakhir2011 BNI Taplus yang ada di seluruh

“Kutembak kau nanti,” bentak pria tersebut. Dan Siregar, sopir ALS menantang ancaman tersebut dengan cepat melompat dari belakang kemudinya menghadapi sang pria. Sebagian penumpang termasuk koresponden Waspada yang berada dalam bus ALS cepat bereaksi, ikut memberikan dukungan untuk melakukan perlawanan kepada pria tersebut. Beberapa orang di antaranya sempat ikut melompat keluar bus mendekati mobil warna hitam tersebut karena semua berpikir kejadian itu adalah tindakan perampokan. Melihat reaksi dari sopir dan penumpang bus ALS yang tidak menyerah diancam dengan senjata itu, akhirnya pria bersenjata pistol tersebut kelihatankecutdandengancepatnaikkemobilnya bergerak meninggalkan lokasi, sementara penumpangnya yang terlihat beberapa laki-laki bertubuh tegap, tidak sempat turun membantu. “Dia pikir aku takut diancam begitu,” sebut Siregar, sopir ALS kepada Waspada. Dia mengakui sering menghadapi tindakan brutal seperti itu selama menjalankan tugasnya membawa bus ALS di lintas barat Sumatera, terutama di daerah-daerah rawan kejahatan mulai Bengkulu sampai ke Sumbar. (c16)

Lintas Barat Sumatera Rawan Longsor PADANG(Waspada):Para pemakaijalandarat jalur barat Sumatera dalam masa mudik tahun baru saat ini diminta untuk lebih waspada dalam menghadapi tanah longsor yang setiap saat mengancam dan bisa saja terjadi. Koresponden Waspada yang melakukan perjalanan darat dari Jakarta menuju kota Medan, mencatat paling tidak ada lima belas daerah terjadinya longsor pada jalur lintas barat Sumatera itu, Senin (26/12). Daerah-daerah itu terjadi di daerah pebukitan

mi luka berat. Wargayangmendengarsuara benturan keras di pagi itu segera keluardarirumahmasing-masing dan berupaya memberikan pertolongan dengan membawa semua korban ke RS Tentara, Kota Pematangsiantar.Namun,Pontas tidak tertolong dan meninggal ketika tiba di rumah sakit. SatLantasPolresSimalungun yangmenerimainformasitentang kejadian itu segera tiba di tempat kejadian dan melakukan penyelidikan serta mengamankan mobil ToyotaKijangSuperdanmobilbarangtrontonkemarkasSatLantas. Kapolres Simalungun AKBP M. Agus Fajar H, S.Ik saat dikonfirmasi menyebutkan laka lantas itu masih dalam penyelidikan dan pengemudi mobil barangjenistrontonmasihdalam pencarian. (a30)

Nasabah BNI Kabanjahe Dapat Mobil Mewah KABANJAHE (Waspada): Nasabah BNI Cabang Kabanjahe memperoleh satu unit mobil mewah jenis Fortuner setelah namanya keluar sebagai pemenang Rezeki BNI Taplus periode Oktober 2011. Undian kepada nasabah dilakukan setiap bulan hinggga akhir Desember 2011. Nasabah yang beruntung ini, Rela Tarigan warga JalanVeteran Gang Arihta, Kec. Kabanjahe. Kepada Waspada, kemarin, dia mengaku tidak menduga sebagai pemenang Rezeki BNI Taplus. “Apa benar saya sebagai pemenangnya,” ucap bapak tiga anak yang keseharianya berjualan peralatan pertanian seperti cangkul, parang dan arit. Dia mengaku pada 2008 usaha miliknya sempat jatuh karena lokasi tempatnya berjualan terbakar namun dia segera bangkit untuk memulaikembalidantidakgoyah dengan musibah tersebut, hingga akhirnya sampai sekarang usaha yang dilakoninya bersama BNI terusberlanjuthinggasaatinisejak dirinya menabung pada 1993. Kepala Cabang BNI Kabanjahe H. Bahtiar, SE kepada Waspada mengaku sangat bangga mendengar nasabahnya ditetapkan sebagai pemenang undian BNI Taplus yang diundi setiap bulan yang pengundian dilakukan di kota Makasar. Bahtiar juga menyampaikan kepada seluruh nasabahnya

JAMBI (Waspada): Sopir bus angkutan umum PT. ALS bernomor 356, BK 7851 DI, Berena Siregar, 46, yang sedang mengemudikan kenderaannya melintas di jalur lintas Sumatera bagian barat, dari Jakarta tujuan Medan, tepatnya di daerah Tanjung Enim, Kab. Enim, Sumsel, Senin (26/12), nyaris menjadi korban keberutalan seorang pria bertubuh tegap, pendek yang tidak diketahui identitasnya, sempat menodongkan senjata api genggam, jenis pistol ke kepala sopir bus itu. Kejadian itu begitu singkat, kedua mobil yang berlawanan arah berpapasan di satu tikungan di daerah yang sepi penghuni itu. Pengemudi mobilTerios warna hitam tersebut dengan sengaja menghadangkan mobilnya tepat di depan bus ALS. Dan pria yang mengemudikan mobil Terios mengeluarkan kata-kata kasar dan secepatnya keluardarimobilnyasambilmenodongkansenjata api jenis pistol ke arah sopir bus ALS yang ketika itu masih diam di belakang kemudi. Penumpang bus ALS sendiri yang dalam keadaan lelah tidak menyangka kalau kejadiannya yang cepat itu serius. Dan setelah sang pria tegap tersebut memukul pintu bus di samping sopir ALS dengan kuat, baru penumpang sadar kalau kejadian itu peristiwa itu serius.

dan kejadian longsor, bukan saja terjadi di atas jalan perbukitan yang menutupi badan jalan. Longsor juga kerap terjadi pada badan jalan yang tanahnya turun longsor ke dalam jurang. Untuk ituparapengemudidimintalebihwaspada,karena tidak ada yang mengetahuinya kapan longsor itu terjadi. Para pengemudi diimbau untuk menghentikan perjalanannya pada saat hujan turun, terutama di kawasan yang berbukit-bukit termasuk di kawasan jalan darat di Sumut. (c16)

Waspada/Mulia Siregar

BENCANA longsor yang terjadi di daerah pebukitan di jalur lintas barat Sumatera beberapa hari belakangan ini membuat pengemudi dan pemakai jalur jalan was-was, seperti tampak dalam foto yang diambil, Senin (26/12), longsor menutupi badan jalan di daerah Sumatera barat.

Indonesia telah memberikan berbagai jenis hadiah yang dapat dimenangkan para nasabah BNI berupa delapan unit Mercedes Bens E300 Elegance, 88 Toyota Fortuner 2.5G diesel, 888 sepedamotor Honda Scoopy, 8888 Gadget dan 888888 voucher. yang keseluruhanyadiserahkankepada nasabah pemenang BNI taplus hinggaakhirDesember2011.(c10)

Waspada/Micky Maliki

KEPALA Cabang BNI Kabanjahe H. Bahtiar, SE secara simbolis memberikan kunci satu unit mobil Toyota Fortuner kepada pemenang undian BNI Taplus periode Oktober 2011 di Kabanjahe.

Wujudkan Good Governance Perlu Kerja Keras PEMATANGSIANTAR (Waspada): Wali Kota Hulman Sitorus, SE menyatakan dalam mewujudkan penyelenggaraan pemerintahan yang baik (good governance)danbebasKKNsesuai tuntutan masyarakat, diperlukan berbagai upaya dan kerja keras dari semua jajaran Pemko Pematangsiantar terutama dalam memperbaiki dan meningkatkan kinerja secara profesional. Wali Kota menyatakan itu saat membuka rapat pemutakhiran data tindak lanjut hasil pemeriksaan Inspektorat tingkat Kota Pematangsiantar tahun 2011 di ruang data Pemko, Selasa (20/12), sebut Kabag Humas dan Protokoler Pemko Drs. Daniel H Siregar, Kamis (22/12). Menurut Wali Kota, kerja keras Pemko tidak hanya dilakukan untuk meningkatkan intesitas, kualitas dan efektifitas pemeriksaan semata, namun sejauh mana temuan hasil pemeriksaan dapat ditindaklanjuti. “Karena itu, sesuai kebijakan di bidang pengawasan, kegiatan semacam ini merupakan agenda tetap yang dilakukan secara berjenjang mulai dari tingkat kabupaten/kota, provinsi, maupun tingkat regional/nasional,” katanya. Menyikapi perkembangan serta berbagai bentuk penyimpangan yang semakin rapi dan sistematik,Wali Kota mengharapkan Inspektorat dalam langkah ke depan harus mawas diri, profesional dan peka terhadap perubahan serta tuntutanaspirasimasyarakatyangterusmeningkat. “Instansi ini harus menjadi garda terdepan dalam menegakkan aturan serta berani mengungkap penyimpangan sesuai dengan fakta yang ada secara benar, cermat, tepat serta mampu mengembangkan fungsi dialogis dengan pihak yang diperiksa.”

“Pada sisi lain, para pejabat, baik pimpinan unit serta pimpinan kegiatan, pemegang kas, dan pegawai yang berkaitan langsung dengan tindak lanjut hasil pemeriksaan agar dapat mengikuti kegiatan ini dengan sungguh-sungguh agar permasalahan yang sulit dibahas dan diselesaikan tindak lanjutnya hingga Pematangsiantar tahun 2012 dinilai wajar tanpa pengecualian dan terwujudnya Pematangsiantar yang mantap, maju dan jaya,” harap Wali Kota. Kepala Inspektorat Drs. Pardamean Silaen, MSi menyebutkan maksud dan tujuan kegiatan itu untuk meneliti, mengevaluasi, menilai kinerja dan kondisi akhir pelaksanaan tindak lanjut hasil pemeriksaan Inspektorat tahun anggaran 2011 dan peserta rapat pemutakhiran data tindak lanjut pemeriksaan Inspektorat tingkat Pematangsiantar tahun 2011 terdiri seluruh pimpinan SKPD di lingkungan Pemko seperti Kadis, Kakan, Kaban, Kabag, Camat, Lurah serta kepala SD, SMP dan SMA seluruh Pematangsiantar. Silaen mengungkapkan hasil pemeriksaan tahun anggaran 2011 dan objek pemeriksaan sebanyak 71 objek, realisasi pemeriksaan sampai Desember 2011 sebanyak 71 objek dan laporan hasil pemeriksaan (LPH) terbit sebanyak 46 LPH sertadari46LPHyangterbit,terdapattemuandalam hasilpemeriksaanselamatahunanggaran2011antara lain jumlah temuan sebanyak 76 dan rekomendasi 85sertatindaklanjutrekomendasiatastemuanhasil pemeriksaan sudah selesai (S) sebanyak 21, masih dalam proses (D) empat dan Belum (B) 60. “Karena itu, kami seluruh petugas pemeriksa dari Inspektorat akan bekerja dengan sungguhsungguh hingga terwujud Pematangsiantar yang mantap, maju dan jaya,” tandas Silaen. (a30)

Sumatera Utara


WASPADA Rabu 28 Desember 2011

Warga Tolak Madina Square PANYABUNGAN (Waspada): Ketua Parsadaan Pomparan Sutan Kumala Yang Dipertuan Kotasiantar melalui Patuan Dilaut mengatakan, sangat menyesalkan dan menolak dengan tanpa kompromi pembangunan Madina Square di atas tanah eks Pasar Lama Panyabungan oleh pihak ketiga diduga difasilitasi Pemkab Madina. “Pada prinsipnya tanah eks Pasar Lama Panyabungan adalah tanah adat/waris ulayat milik kerajaan Hutasiantar di mana pada masa itu tanah tersebut adalah tempat jual beli penduduk yang bernama Pasar Syarikat,” katanya kepada Waspada, Senin (26/12). Ia mengungkapkan, awal berdirinya Pasar Panyabungan merupakan Pasar Syarikat tempat jual-beli penduduk dari

beberapa kekuriaan seperti Kuria Kotasiantar, Pidoli, Gunungtua, Panyabungan Tonga dan PanyabunganJuluyangpengelolaannya bersifat periodik antara Raja Panusunan Kotasiantar dengan Raja Panusunan Panyabungan Tonga dan setelah Negara Kesatuan Republik Indonesia (NKRI) merdeka, perkembangan Pasar Panyabungan semakin pesat dan oleh pemerintah

LMP Dukung Pembangunan Paluta GUNUNGTUA (Waspada): DPD Laskar Merah Putih (LMP) Kabupaten Padanglawas Utara (Paluta) menyatakan pihaknya siap mendukung, mengawal dan berperan aktif dalam pelaksanaan program pembangunan yang dicanangkan Bupati Paluta, Drs. H. Bachrum Harahap. “Kami pengurus dan kader DPD LMP Paluta siap mendukung, mengawal dan berperan aktif dalam setiap program pembangunan yang dicanangkan Bupati dan Wakil Bupati Paluta. Sebab, itu salah satu tugas dan fungsi Laskar Merah Putih sebagai salah satu elemen pemuda di Paluta,” kata Ketua LMP Paluta, Henryfai H.s didampingi Sekretaris, Asrin Harahap dan sejumlah pengurus lainnya, kepada Waspada, Senin (26/12). Menurut Henryfai, LMP ini merupakan salah satu organisasi kepemudaan yang baru di Kabupaten Paluta. “Untuk itu, ke depan LMP akan menunjukkan program kerjanya yang menyentuh langsung ke masyarakat serta terlibat langsung dalam setiap kegiatan pembangunan yang dilakukan di Paluta. Ini bukan tugas yang ringan, namun kami akan berusaha berbuat yang terbaik untuk mewujudkannya,” tuturnya. Ia menambahkan, secara internal LMP Paluta akan terus berbenah diri dengan membentuk kepengurusan cabang di seluruh kecamatan yang ada, supaya eksistensi LMP bisa terus dipupuk dan ditingkatkan. (a35)

Pelanggan PLN P. Sidimpuan Menunggak Rp4.6 M P. SIDIMPUAN (Waspada): Akhir 2011, PT PLN (Persero) Cabang Padangsidimpuanakanmelaksanakanpemutusanaliranlistrikterhadap pelanggan yang menunggak antara satu hingga tiga bulan akibat kerugian mencapai Rp4.6 miliar. Demikian dikatakan Manager Cabang PT PLN Cabang Padangsidimpuan, Ir Sudirman MT didamping Humas, M. Lutfi Lubis SH kepada Waspada, Selasa (27/12). Program pemutusan ini merupakan program pimpinan wilayah agar tidak memberatkan beban PT PLN dalam memberikan pelayanan maksimal kepada pelanggan yang lain. Selain itu katanya, dari 42 ribu pelanggan itu total tunggakan yang belum dibayarkan kepada PLN sebesar Rp4.6 milliar dan didalamnya sudah termasuk utang Lampu Penerangan Jalan Umum (LPJU) Pemkab Madina selama sebulan atau untuk November tahun ini sebesar Rp365 juta. ‘’Sedangkan Tahun 2011 ini pendapatan PT PLN Cabang Padangsidimpuan sebesar Rp12 milliar dengan jumlah pelanggan 212 ribu pelanggan yang mencakup rayon P. Sidimpuan, Ranting Panyabungan, Ranting Natal, Ranting Kotanopan, Ranting Sibuhuan, ranting Gunung Tua dan Ranting Sipirok,’’ ujar Lutfi. Lanjutnya, rincian tunggakan per rayon yakni untuk rayon Padangsidimpuan Rp995.836.004, Panyabungan Rp966.373.320, Kotanopan Rp103.405.991, Sibuhuan Rp1.417.917.205, Gunung Tua Rp835.752.730,NatalRp143.445.031danSipiroksebesarRp219.928.134. Bagi pelanggan yang menunggak satu bulan katanya akan diputuskan sementara hingga tunggakannya dilunasi sedangkan untuk pelanggan yang menunggak selama tiga bulan akan dibongkar tuntas dan akan dikenakan biaya pemasangan baru jika ingin menyambung lagi dan tunggakannya itu harus juga dilunaskan terlebih dahulu. “Harapan kami kepada seluruh pelanggan yang belum melunasi pembayaran rekening listriknya agar segera membayar jangan sampai petugas kami disalahkan di lapangan untuk memutus aliran listrik,” imbau keduanya.(c13)

PAN Madina - Perdami Kerjasama Operasi Katarak PANYABUNGAN (Waspada): DPC Partai Amanat Nasional (PAN) Kab. Mandailing Natal (Madina) bekerjasama dengan Persatuan Dokter Ahli Mata Indonesia (PERDAMI) dan RSUD Panyabungan mengadakan operasi katarak untuk 50 mata. Demikian disampaikan Ketua Panitia Operasi Katarak, Zulfikar didampingi Sekretaris, Hasan kepada Waspada, kemarin di Kantor DPC PAN Madina Jalan Lintas Sumatera, Kelurahan Dalan LidangPanyabungan. Operasi katarak ini dilaksanakan beberapa waktu lalu. Dijelaskan,penjaringanpesertaoperasikataraklangsungdilakukan kader PAN di kecamatan. Operasi katarak juga telah dilakukan di wilayah Pantai Barat tepatnya di Kecamatan Natal untuk operasi 25 mata. Ketua DPC PAN, H. Nis’at Sidiq Nasution melalui Wakil Ketua, H. Syahminan Rangkuty mengatakan, operasi itu bentuk kepedulian PAN terhadap masyarakat atau orangtua ekonomi lemah, yang selama ini penglihatan terganggu karena tidak ada biaya. Harapan PAN, operasi katarak dapat memberi manfaat bagi penderita mata katarak supaya kedepan lebih bisa dan bebas berkarya serta menikmati hidup sebagaimana biasanya. Syahminan menambahkan, PAN Madina akan terus melakukan kegiatan bersifat sosial untuk mencapai dua digit instruksi DPW PAN, sekaligus untuk meraih kembali kejayaan PAN di Madina masa kepemimpinan H. Abdul Rahman Nasution alias Ompung. “Saya yakin matahari akan terus terbit bersinar menepati janjinya menerangi dunia untuk kehidupan, di bawah naungan awan biru yang menyejukkan,” ucap Syahminan. Ia juga yakin di kepemimpinan Nis’at Sidiq, PAN Madina akan berkembang kuat dalam mengakomodir kepentingan semua elemen masyarakat menuju sejahtera di alam sadar berdemokrasi. Untuk mengantarkan Hatta Radjasa menuju RI 1, PAN Madina semakin gencar mengadakan konsolidasi internal dan eksternal partai mulai dari tingkat kabupaten, kecamatan, hingga kelurahan/desa seKabupataen Madina. (c14)

Waspada/Sarmin Harahap

PESERTA operasi katarak saat foto bersama dengan pengurus DPD PAN Madina, Selasa (13/12) di RSUD Panyabungan.

dibangun pasar yang lebih modern di atas tanah di mana sifatnya pinjam pakai. “Kami atas nama keluarga besar Parsadaan Pomparan Sutan Kumala Yang Dipertuan Kotasiantar meminta kepada Bupati HM Hidayat Batubara dan DPRD Madina sebagai perwakilan masyarakat segera menyelesaikan permasalahan ini secara arif dan bijaksana serta sesuai dengan ketentuan peraturan perundang-undangan berlaku,” tandasnya. Diminta Selesaikan Melalui kuasa hukumnya, Hasanuddin Nasution untuk atas nama dan kepentingan ahli waris almarhum M. Sutan Nasution

gelar Patuan Kumala Alamsyah NasutionberalamatdiJalanLarya Gang Ampera No 15 Medan, meminta Komisi I DPRD Kabupaten MandailingNataldapatmenyelesaikan masalah tanah yang terletak di JalanWillem Iskandar yakni Pasar Lama Panyabungan yang hingga saat ini tersendatsendat, bahkan di atas tanah tersebut sekarang ini telah berdiri bangunan ruko (rumah toko). Permintaanpenyelesaiantersebutsudahduakalidisampaikan Law Office A. Hakim Siagian, SH. M.Hum dan Patners ke Komisi I DPRD Madina di perbukitan Payaloting Panyabungan. Surat pertama dilayangkan 26 Juli 2011 dan kedua 14 September 2011,

yang ditandatangani M. Afdhal Lubis, SH. Pihak kuasa hukum Hasanuddin mengharapkan pihak DPRD dapat membantu sebagai mediasinya agar masalah ini dapat diselesaikan dengan baik. Sekretaris Komisi I DPRD Madina Iskandar Hasibuan membenarkan adanya surat dari Law Office A. Hakim Siagian, SH. M,Hum dan Partners itu. Dikatakan, kuasa hukum Hasanuddin Nasution selaku ahli waris almarhum M. Sutan Nasution gelar Patuan Kumala Alamsyah Nasution berharap sekali agar DPRD Madina bisa menjadi mediasi agar permasalahan itu bisa diselesaikan dengan baik. (a28)

HUT Ibu Di P. Sidimpuan Mengharukan, Anak Pedagang Sayur Jadi Dokter P. SIDIMPUAN (Waspada): Peringatan Hari Ulang Tahun (HUT) Ibu ke-83 di Kota Padangsidimpuan menjadi momen mengharukan.Seorangibupedagang sayur di kakilima mendapat penghargaan, karena kegigihannya sukses mengantarkan anak-

nya menjadi dokter. Nurhayati Harahap, 47, warga Kota Padangsidimpuan, seorang wanita telah menjanda sejak1987,taksurutniatnyauntuk menyekolahkan anaknya dari tingkat SD sampai meraih gelar dokter spesialis.

Waspada/Ahmad Cerem Meha

SEBAGAI pedagang sayur di kaki lima dan petani, Nurhayati Harahap berhasil menyekolahkan anaknya sampai perguruan tinggi, yang salah satu di antaranya menjadi dokter spesialis. Nurhayati didampingi Wakil Ketua DPRD Kota P.Sidimpuan Tati Ariyani Tambunan (kanan).

Peringatan Hari Ibu ini dimeriahkan aksi ribuan ibu berjalan kakikelilingkotadilepasWaliKota, Drs Zulkarnain Nasution MM bersama ibu Wali Kota Meliani Lubis Zulkaranain Nasution dan Muspida, Minggu (25/12). Acarainidihadiriribuankaum ibudiantaranyadaripengajianAkbar Al-Ikhlas, Persatuan Istri anggota DPRD,PersatuanIstriDenpom1/ 2-3,IbuPKKPemko,PersatuanIstri Kejaksaan Negeri Padangsidimpuan dan lainnya. Ketua Panitia, Sri Juniar Ningsih Mujoko SE, istri Dansub Denpom 1/2-3, memaparkan, agar para ibu rumahtangga menopangtugassuamididalamrumah tangga agar tercapai keluarga sejahteradanberahlakulkarimah. Wakil ketua DPRD Kota Padangsidimpuan, Tati Ariyani Tambunan mengatakan hal senada. ‘’Kita sebagai wanita telah ikut menyukseskan kesetaraan gender, sehingga ke depan tugas wanita semakin ditingkatkan untuk kemajuan kaum ibu,” ujarnya. (c13)

Pemerintah Harus Gerak Cepat Antisipasi Longsor Nabundong Chairuman Harahap Khawatirkan Jalan Amblas MEDAN (Waspada): Pemerintah daerah dan pemerintah provinsi diwanti-wanti agar bergerak cepat melakukan antisipasi di lapangan pasca longsor Hutan Nabundong, Kec. Hulusihapas, Kab. Padanglawas Utara, karena kondisinya dinilai sangat rentan mengundang bahaya. Anggota DPR RI Chairuman Harahap, SH, MH melihat langsungkondisijalanlintasSumatera Gunungtua-P.Sidimpuan pasca longsor, saat wakil rakyat dari Komisi III ini dalam perjalanan melalui jalur darat dari Gunungtua menuju Aek Godang. Upaya antisipasi untuk alternatif darurat justru belum dilihatnya dilakukan secara efektif. “Kebetulan, saya sedang dalamperjalanandariGunungtua menujuAekGodang.Sayamelihat kondisi ini sangat berbahaya, se-

dangkan upaya antisipasi darurat belum dilakukan. Hanya sebatas dibuat tanda,” ujar Chairuman kepada Waspada via telefon, Senin (26/12). Dijelaskannya, di kawasan ini ada jalan seperti bertingkat. Menurut dia, yang sangat rentan mengundangbahayaadalahjalan yang berada di atas yang diperkirakan jika dilewati truk dalam tonasetinggiakanmengakibatkan getaran. “Kita khawatir jalan ini amblasdanmengakibatkankerugian besar. Karena itu, saya pikir harus dilakukan kajian dan seterusnya mengambil kebijakan dengan gerak cepat,” ujarnya. Chairuman mengungkapkan, longsor memang peristiwa alam, tapi musibah ini harus ditangani secara objektif dengan melibatkan pemerintah daerah dan pemerintah provinsi. “Kalau

pemerintah kabupaten merasa perlu dibantu Pemerintah Provinsi, tentu saja tinggal dikoordinasikan.Yang penting, kondisi ini dapat ditangani secara maksimal,” ujarnya. Diakuinya, dalam perjalanan itu, dia justru tidak menemukan petugas yang siaga di lapangan. Seharusnya, menurut dia, tidak saja petugas, tapi alat berat juga harus disiagakan di lokasi. ���Jalanan memang hanya bisa dilalui satu arah. Sangat tidak mungkin dilewati dua arah,” katanya lagi. Informasi diperoleh, kondisi jalur lintas Sumatera GunungtuaPadangsidimpuan masih terus mengancam.Batugunungmalah kerap berjatuhan, sehingga pengendara yang melintas harus ekstra hati-hati. Separuh badan jalanlongsoryangsetiapsaatdapat menjadi petaka.(m41)

Waspada/Alpin Lubis

KAPOLRES Madina AKBP. Ahmad Fauzi Dalimunte (tengah) di dampingi Kapolsek otanopan AKP. Huayan Harahap, SH saat hendak meninjau ruangan BKPM dan FKPM.

Kapolres Madina:

Polisi Menggalakkan Kemitraan Dengan Masyarakat PANYABUNGAN(Waspada): Polisi saat ini sedang giat-giatnya menggalakkan kemitraan dengan masyarakat. Kemitraan ini dianggap sangat urgen untuk menyelesaikan permasalahan yang muncul di tengah masyarakat. Hal itu dikatakan Kapolres Madina AKBP Ahmad Fauzi DalimunthesaatmeninjauPilotProjek desa percontohan Siskamling BKPM,FKPMdiDesaAekMarian, Kec. Lembah Sorik Marapi Kab. Madina, belum lama ini. Dikatakannya, kita berharap permasalahan yang muncul di tengah-tengah masyarakat dapat diselesaikan terlebih dahulu di tingkat desa. Sebab tidak semua permasalahan itu harus diselesaikan melalui pengadilan, bisa saja suatu masalah diselesaikan dengan asas musyawarah dan kekeluargaan. Makanya kita bentukBalaiKemitraanPolisidan

Masyarakat (BKPM) dan Forum Kemitraan Polisi dan Masyarakat (FKPM)ini.Jadimarikitafungsikan balai dan forum ini dengan sebaik-baiknya. “Kita juga meminta tokohtokoh masyarakat untuk berperanaktifmenjagakekondusifan daerah. Walaupun menurut laporan, di bawah jajaraan Polsek Kotanopaninitergolongkondusif, tapi perlu kehati-hatian kita semua. Mari kita bergandeng tangan untuk mencari solusi suatu permasalahan. Begitu juga saya meminta kepada semua Kapolsek yang ada di bawah jajaran Polres Madina untuk membentuk BKPM dan FKPM ini di wilayah hukumnya masingmasing,” kata Kapolres Kapolsek Kotanopan AKP Huayan Harahap, SH dalam sambutannya mengatakan, saat ini Polsek Kotanopan menaungi limakecamatan,yaituKecamatan

Kotanopan, Ulu Pungkut, Lembah Sorik Marapi, Puncak Sorik Marapi dan Tambangan. Kasus yang terjadi dalam setahun ini di daerah ini berjumlah 24 kasus dan rata-rata sudah diteruskan ke pengadilan. Kita berharap kehadiran BKPM dan FKPM ini berguna dan dapat mengatasi permasalahan yang muncul di tengah-masyarakat Hadir dalam acara tersebut Camat Kotanopan, Ulu Pungkut, Tambangan,PuncaksorikMerapi dan Lembah Sorik Merapi, Ketua MUI Lembah Sorik Merapi, Kepala Desa, tokoh adat, tokoh masyarakat dan alim ulama. Usai memberi kata sambutan, Kapolres memberikan bantuan alatalat olah raga kepada pengurus BKPM dan FKPM dan juga kepada Naposo Nauli Bulung. Setelah itu, baru meninjau ruangan BKPM dan FKPM di daerah ini. (c15)


Salah satu ruas jalan yang kupak kapik, persimpangan jalan negara ke Jalan A. H.Nasution.

Uang Rakyat Digelontorkan Rp1,5 M, Jalan Di P. Sidimpuan Tetap Kupak-kapik PADANGSIDIMPUAN (Waspada): Kendati uang rakyat digelontorkan Rp1,5 miliar bersumber dari APBD 2011, tapi sejumlah jalan di Padangsidimpuan justru tetap kupak-kapik. Informasi dihimpun Waspada di lapangan, Senin (26/12), dana pemeliharaan ruas jalan di Kota Padangsidimpuan ini bagaikan tidak berbekas, karena kondisi jalan dari hari ke hari justru bertambah parah, padahal tahun anggaran hampir berahir. Hampir seluruh ruas jalan jalan di Kota Padangsidimpuan ditemui lubang, sehingga mengurangikelancaranlalulintas danmengurangi kenyamanan pengendara. Saat musim hujan seperti ini, bukan tidak jarang pejalan kaki memaki pengendara, karena kena percikan air. Proyek tersebut tidak jelas titik titik yang akan dikerjakan,karenapapanproyeksebagaipedoman masyarakat untuk pengawasan tidak pernah kelihatan, sehingga terkesan pelaksaan pekerjaan tertutup bagi umum. Pengamatan di lapangan, ada beberapa ruas jalanyangsudahdikerjakan, dengantambalsulam, seperti jalan Imam Bonjol, namun pekerjaan jauh di bawah standar yang diharapkan. Permukaan badan jalan yang disisip tidak rata dengan permukaan jalan lama, sehingga tidak menyatu.

Begitu hujan turun mudah terkelupas, akibatnya kembali bermunculan lubang-lubang. Sementara ruas jalan negara menuju kebun Pijor Koling Padangsidimpuan Tenggara, begitu Dinas PU mengumumkan pemenang lelang beberapa bulan lalu, ruas jalan yang rusak sudah dikorek, sehingga kesannya termasuk dalam volume pekerjaan. Tapi sampai sekarang ruas jalan tersebut tidak dikerjakan. Karena kecewa, warga menimbunnya dengan tanah. Di Jalan Baru 1 Padangsidimpuan, lubanglubang yang ada ditimbun dengan sirtu, sehingga tidak layak sebagai jalan di pusat kota, sementara Jalan Baru 2 sirtu masih menumpuk di pinggir jalan, sehingga mengganggu lalu lintas. Berpedoman kepada kondisi tersebut paket proyek berbiaya Rp1,5 miliar tersebut hingga penghujung Desember ini belum selesai, namun warga menduga akan terjadi KKN antara pemberi kerja dengan yang mengerjakan, sehingga dibuat berita acara selesai. KepalaDinasPUKotaPadangsidimpuanyang berulang ulang mau dikonfirmasi ke kantornya tentang pelaksaan proyek itu tidak pernah bertemu. Salah seorang staf yang dihubungi mengatakan, “Jangankan wartawan, kami aja stafnya jarang ketemu,” ujarnya. (a26)

Pemkab Madina Diminta Tinjau Ulang Izin PT. BME PANYABUNGAN(Waspada): Pemkab Madina diminta segera meninjau ulang izin pertambangan PT. Bahana Multi Energi (PT. BME) yang akan beroperasimenambangtimahhitamdihulusungai Aek Latong Desa Lumban Dolok, Kec. Siabu, Kab. Mandailing Natal, karena dinilai telah mengadudomba masyarakat sekitarnya. Hal itu disampaikan anggota DPRD Madina H. Bahri Efendi Hasibuan kepada Waspada di Panyabungan, Minggu (25/12). “Untuk mencapai tujuan, mereka melakukan penambangan di perbukitan Desa Lumban Dolok, kita menilai perusahaan telah mengadudomba masyarakat di Kecamatan Siabu dan Bukit Malintang dengan cara bergerilya mengumpulkan tanda tangan masyarakat dengan imbalan Rp100 ribu per tandatangan,” ucapnya. Sesuai informasi diterima dari masyarakat, kata Bahri Efendi, perusahaan kurun waktu beberapa minggu terakhir telah bergerilya mengumpulkan tanda tangan untuk mendukung mereka melakukan penambangan di daerah itu. “Pengumpulan tanda tangan itu dilakukan mulai dari Kel. Simangambat, Kec Siabu hingga ke sejumlah desa di Kec. Bukit Malintang. Ini kan sudah jelas praktik adu domba terhadap masyarakat di kedua kecamatan. Artinya, sebagian masyarakatdiajakmemberikandukungandengan imbalan Rp100 ribu, sementara masyarakat lainnya menolak. Bahri juga mensinyalir izin tambang PT. BME kurang jelas keabsahannya, karena rencana kehadiran perusahaan ini tidak pernah disosialisasikan kepada masyarakat sekitar, khususnya titik lokasi yang akan dijadikan usaha pertambangan yang merupakan hulu sungai yang dipergunakan masyarakat di Kecamatan Siabu. “Kami berkeyakinan apabila PT. BME tetap melaksanakanusahapertambangandihulusungai Aek Latong itu, akan berdampak kepada warga yang menggunakan sungai untuk mandi dan mencuci pakaian setiap harinya dan sangat

dikhawatirkan masyarakat di wilayah Kec. Siabu terancam bencana banjir,” ungkapnya. Di tempat terpisah salah seorang warga Desa Lumban Dolok Ridwan Hasan Lubis menyatakan menolak kehadiran PT. BME di daerah itu. “Kita tidak setuju perusahan pertambangan itu beroperasi di Kec. Siabu, karena selain lokasinya berada di hulu sungai yang dipergunakan banyak orang, lahan yang akan diusahai untuk mendapatkan bahan tambang nantinya diperkirakan masuk dalam kawasan hutan lindung,” jelasnya. Mantan Ketua HMI Madina itu mengaku sangatkesalmelihatsikapperusahaanyangsengaja mencari dukungan dari masyarakat sekitarnya dengan imbalan sejumlah uang. Praktik seperti itu, lanjutnya, jelas-jelas berbau KKN (Kolusi, Korupsi dan Nepotisme) untuk mendapatkan persetujuan dari masyarakat sekitar lokasi tambang. “Kita menilai perusahaan tidak berani secara terang-terangan melakukan pendekatan maupun sosialisasi kepada masyarakat. Artinya, sejak awal perusahaan sudah melakukan kesalahan bagaimana di belakang hari. Kita meminta kepada PT.BMEuntukmengurungkanniatnyamelakukan penambangan di hulu sungai itu, karena masyarakat akan menolaknya,” paparnya. Kalimat penolakan juga disampaikan M. Pulungan dari Desa Huraba atau desa berdampingan dengan Desa Bonak Dolok, Kec. Siabu. Dengantegas,diamenyampaikanrasakeberatannya jika PT. BME melakukan aktivitas di kawasan hulu sungaiAekLatong,karenaakanberdampakkepada kehidupan masyarakat yang berada di hilirnya. “Kita tidak membiarkan sungai yang digunakan masyarakat untuk mandi, mencuci dan mengairi areal persawahan tercemar akibat kegiatan pertambangan timah hitam itu. Yang sangatdikhawatirkan,apabilaPT.BMEmelakukan aktivitas, tidak tertutup kemungkinan ekosistem di hulu sungai rusak dan menimbulkan bencana banjir ke desa-desa di sekitarnya,” terangnya.(a28)

Batalyon Infanteri 123/RW Gelar Penyuluhan Dan Konseling KB P.SIDIMPUAN(Waspada):Untukmendukung program Badan Kesejahteraan Keluarga Berencana Nasional (BKKBN) pusat, Batalyon Infanteri 123/ RW menggelar penyuluhan dan konseling Keluarga Berencana (KB) di aula Markas Komando (Mako) Batalyon 123/RW Kota Padangsidimpuan, Rabu (21/12). Acara dihadiri Pabandya Bhakti Aster Komando Daerah Militer (Kodam) I Bukit Barisan Letkol Inf Joko Suparyanto, Kepala Badan BKKBN Prov Sumut diwakili Juang Kencana Drs Fahmi Lubis, Danyonif 123/RW Letkol Inf AT Chrisharjdoko, Kepala Badan Keluarga Berencana, Pemberdayaan Perempuan dan Perlindungan Anak (BKBP3A) Kota Padangsidimpuan Amiruddin LM,CamatPadangsidimpuanSelatanParuhuman Harahap S.Sos, para Lurah se-Kecamatan Padangsidimpuan Selatan, Persit KCKYonif 123/ RW, Pelajar SMAN 3 dan SMAN 8 Padangsidimpuan, Mahasiswa UMTS dan STAIN serta masyarakat Danyonif 123/RW Letkol Inf AT Chrisharjdoko sesusai acara mengatakan , kegiatan penyuluhan dankonselingKBinidilaksanakanuntukmembantu pemerintah daerah melakukan pelayanan KB dankesehatankepadamasyarakatdanjugasebagai pelaksanaan program BKKBN pusat bekerjasama dengan Markas Besar (Mabes) TNI AD. BKKBN Provsu, Juang Kencana, Drs Fahmi Lubis mengatakan, tujuan program KB ini untuk

mengendalikan laju pertumbuhan penduduk sekaligus sebagai upaya kita untuk membangun ketahanan keluarga, karena dengan demikianlah keluargaakanmemilikikemampuandalamrangka pemberdayaan keluarga itu sendiri termasuk di dalamnya bagaimana supaya keluarga itu mampu menyekolahkan anaknya, sebut Fahmi. Kalau anak banyak, bagaimana keluarga itu akan menyekolahkannya, bagaimana memenuhi gizi untuk pertumbuhan anaknya dan lain sebagainya tanggungjawab keluarga untuk mewujudkan keluarga yang sehat dan sejahtera, sementara di satu sisi, sekarang ini pendidikan sangatlah menentukan masa depan bagi anakanak kita, ungkapnya. Pasi Intel Batalyon 123/RW Kapten Inf Edi Tri menyampaikan, penyuluhan KB tersebut dilaksanakan berdasarkan Surat Telegram (STR) dari Kodam I Bukit Barisan, kemudian Batalyon 123/RW bekerjasama dengan BKBP3A Kota Padangsidimpuan untuk melakukan pembinaan teritorial bagi TNI AD dalam rangka mendukung program BKKBN pusat tersebut, ujar Edi Tri. ‘’Kegiatan pos pelayanan KB Yonif 123/RW telah melayani masyarakat yang ikut KB sebanyak 70 orang dengan rincian alat KB digunakan yaitu, IUD 6 orang, Iplan 20 orang, Suntik 21 orang, Pil 16 orang dan alat kontrasepsi 7 orang,’’ ungkapnya. (c13)

Ekonomi & Bisnis

WASPADA Rabu 28 Desember 2011


2012, Bank Enggan Turunkan Bunga JAKARTA (Waspada): Perbankan ditaksir tidak akan terlalu besar turunkan tingkat suku bunga dasar kreditnya (SBDK) pada 2012 mendatang. Hal ini diungkapkan Peneliti Center for Information and Development Studies (Cides) Umar Juano dalam diskusi mengenai Proyeksi Pertumbuhan Ekonomi Indonesia 2012 di Hotel Ambhara, Blok M, Jakarta, Selasa (27/12/2011). “SBDK di tahun depan tidak akan turun terlalu banyak. Karena (tergantung) bagaimana BI (Bank Indonesia) mempersuasi bank untuk menurunkan suku bunga agar meningkatkan ekonomi domestik,” katanya. Menurut Umar, hal ini disebabkan karena kekhawatiran bank jika pihaknya menurunkan tingkat SBDK-nya, bank lain justru melakukan sebaliknya yaitu menaikkan suku bunga deposito sehingga nasabah pindah.

“Jadi kesepakatan antar bank saya kira perlu untuk melakukannya (penurunan SBDK) bersama-sama. Meskipun persuasi BI penting dilakukan ke bank-bank, mereka (bank) juga tidak ingin BI terlalu ikut campur tangan. Bank-bank itu kan juga harus untung,” lanjut dia. Umar menambahkan, bank sentral di tahun depan juga akan tetap menahan BI rate di angka enam persen untuk menahan krisis global. Meskipun pihaknya telah melihat adanya perlambatan ekonomi karena krisis ini, ekonomi Indonesia masih tumbuh 6,2 persen. “E konomi kita masih sebagian besar didukung oleh ekonomi domestik, karena ekspor hanya adalah berkontribusi ke pertumbuhan sekira 28

persen,” lanjutnya. Meskipun pertumbuhan ekonomi Indonesia ini relatif tinggi, Umar berpendapat hanya masyarakat kelas menengah ke atas yang dapat menikmatinya. Hal ini terlihat di pertumbuhan kredit yang tinggi hanya di beberapa sektor seperti perdagangan dan telekomunikasi. “Pertumbuhan industri manufaktur hanya sekira enam persen tahun ini, tahun depan diprediksi lebih rendah (pertumbuhannya). Hal ini karena pertumbuhan manufaktur yang menyerap tenaga kerja masih terganjal banyak hal terkait infrastruktur seperti jalan dan listrik,” tandasnya. Harga emas Sementara itu harga emas turun hingga 15 dolar AS lantaran pelaku pasar masih wait and see atas perkembangan krisis utang di Eropa menjelang tutup tahun ini. US Commodity Futures Trading Commision menuturkan,

aksi spekulasi yang terjadi di perak dan emas memang sudah tidak membuat harga dua komoditas ini menguat, bahkan dalam tiga pekan terakhir ini harganya cenderung melemah. Harga perak sendiri disebut sudah turun hingga setengahnya. Bank sentral Eropa akan meluncurkan program baru jika perekonomian berubah. Tapi kebijakan atas penanganan krisis ini harus berhadapan dengan deflasi yang terjadi di Eropa sekarang ini. Di sisi lain, China merupakan produsen emas terbesar kembali memasarkan produksi emasnya sebanyak 31,75 ton pada Oktober lalu. Dan membuat penjualan emasnya sebanyak 290.752 ton selama 10 bulan pertama di 2011, naik 4,96 persen dari tahun lalu. Seperti dikutip dari Reuters, Selasa (27/12) pagi, harga emas sekarang ini bergerak turun 0,1 persen menjadi 1.603,29 dolar AS. Sementara harga emas AS ada di 1.605,2 dolar AS. (okz)

Inggeris Lebih Bahagia Tanpa Euro LONDON (Waspada): Sudah satu dasawarsa mata uang euro digunakan di kawasan Eropa, namun Inggeris masih bertahan menggunakan mata uangnya. Bahkan, negara monarki ini bangga bisa menggunakan mata uang poundsterling (pound). Lebih dari itu, Inggeris bahkan menyatakan permusuhannya terhadap mata uang yang saat ini sedang berjuang untuk bertahan hidup. Sehingga negara dipimpin Ratu Elizabeth ini tidak dapat menyembunyikan kepuasan mereka terhadap pound. Seperti dilansir dari Straits Times, Selasa (27/12), pada kenyataannya, keadaan zona Eropa saat ini sedang terimbas sentimen negatif dan sedang berjuang, ekonomi Inggris tetaplah tidak menunjukkan kinerja yang baik. Menurut sebuah jajak pendapat, yang dibuat Perdana Menteri Inggeris David Came-

ron pada pertemuan puncak krisis Uni Eropa, 65 persen warga Inggeris mengatakan mereka percaya euro akan hancur dan hanya satu dari lima responden berpikir akan bertahan hidup. Meskipun ada permusuhan terhadap mata uang euro, manfaat nyata dari keputusan Inggris untuk tetap keluar dari mata uang tunggal Eropa tampaknya merupakan keputusan yang tepat. Angka yang dilaporkan Komisi Eropa menunjukkan defisit publik Inggeris pada 2011 akan lebih besar daripada Yunani dengan utang yang kirakira akan sama dengan Prancis, meskipun belum pernah terjadi sebelumnya langkah-langkah penghematan. Yuan tertinggi Sedangkan mata uang China, yuan menguat tertinggi atas dolar Amerika Serikat (AS) seiring dengan langkah bank

sentral China, People Bank of China (PBOC) dan pertumbuhan ekonomi yang ditaksir melewati empat persen. Yuan diperkirakan akan tetap stabil, atau paling tidak naik sedikit pada minggu terakhir tahun 2011 ini dan akan berada di kisaran 6,30 versus dolar, hal ini sejalan dengan ekspektasi pasar. Mata uang tersebut kemungkinan akan terus memperhitungkan kondisi tahun depan seperti China yang terus mencatatkan surplus perdagangan yang besar meskipun terjadi perlambatan ekspor. Selain itu, China juga ada di tengah tekanan dari Amerika Serikat untuk membiarkan yuan naik untuk menyeimbangkan perdagangan bilateral. Ta p i a p r e s i a s i y u a n kemungkinan akan melambat menjadi hanya sekira tiga persen pada tahun 2012, seiring banyak kejadian luar biasa sehingga nilainya akan diperta-

hankan kestabilannya. Ini juga dilakukan untuk mengantisipasi dampak krisis Eropa. “PBOC baru-bar u ini mengambil langkah yang kuat dengan menyuntik dolar ke pasar melalui bank-bank negara. Ini memberikan pasar sinyal jelas bahwa pemerintah tidak akan membiarkan depresiasi yuan,” kata seorang pedagang di sebuah bank besar China seperti dikutip dari Reuters, Selasa (27/12). Nilai yuan di pasar spot ditutup pada 6,3198 terhadap dolar, naik dari penutupan Jumat akhir pekan lalu dari 6,3364, setelah mencapai tertinggi sepanjang waktu 6,3160. Puncak sebelumnya adalah 6,3294 hit pada 16 Desember. PBOC mengatur nilai yuan di titik tengah 6,3167 pada hari Senin, lebih kuat dari 6,3209 pada Jumat lalu serta rekor tertinggi 6,3165 pada 4 November. (okz)

Uni Eropa Setarakan Indonesia JAKARTA (Antara): Uni Eropa mengubah kebijakan bantuannya kepada Indonesia menyusul meningkatnya pendapatan per kapita Indonesia sehingga naik peringkat dari negara miskin menjadi negara berpendapatan menengah, demikian keterangan tertulis Kementerian Perencanaan Pembangunan Nasional/Badan Perencanaan Pembangunan Nasional (Kementerian PPN/ Bappenas), Selasa (27/12). Kementerian itu mengungkapkan, Duta Besar/Ketua Delegasi UE untuk Indonesia Julian Wilson telah menemui Menteri PPN/Kepala Bappenas Armida S Alisjahbana untuk menjelaskan perubahan

kebijakan bantua Eropa ke Indonesia. MenurutWilson, hubungan dengan negara-negara yang meningkat pendapatan per kapitanya berubah menjadi hubungan lebih setara antara negara-negara berpendapatan tinggi dengan negara-negara berpendapatan menengah. Pada kondisi seperti itu hubungan baru perlu diikuti oleh instrumen-instrumen baru dalam penyaluran bantuan. Jika misalnya tadinya bantuan lebih banyak menyangkut upaya mengentaskan kemiskinan, maka kini lebih banyak menyangkut upaya meningkatkan proses produksi dengan teknologi lebih tinggi, misalnya

melalui kerja sama pembuatan pesawat terbang, sebagaimana yang baru terjalin antara Airbus dengan industri pesawat terbang Indonesia. Kebijakan UE baru ini akan mulai berlaku untuk periode 2014-2020, sementara sebelum berlaku, usul perubahan kebijakan ini masih akan dibahas selama kurang lebih 18 tahun. Sedangkan komitmen UE sebesar 200 juta euro untuk kegiatan yang sudah masih dapat terus diselesaikan. Armida sendiri mengatakan sejak reformasi bergulir Indonesia sebenarnya telah menggunakan bantuan luar negeri secara sangat selektif, misalnya

J A K A RTA ( Wa s p a d a ) : Direktorat Jendral Pajak (DJP) Kementerian Keuangan (Kemenkeu) menerbitkan fasilitas pengangsuran atau penundaan pembayaran Pajak Bumi dan Bangunan (PBB) atas Wajib Pajak. Direktur Jenderal (Ditjen) Pajak Fuad Rahmany, atas permohonan Wajib Pajak, dapat memberikan pengangsuran atau penundaan pembayaran utang Pajak Bumi dan Bangunan (PBB) sebagaimana tercantum dalam Surat Pemberitahuan Pajak Terutang (SPPT), Surat Ketetapan Pajak PBB (SKP PBB)

atau Surat Tagihan Pajak PBB (STP PBB). “Ketentuan mengenai hal ini tercantum dalam Peraturan Ditjen Pajak Nomor PER-38/PJ/ 2011 tentang Tata Cara Pengangsuran dan Penundaan Pembayaran PBB, yang diterbitkan 21 Desember 2011,” ungkap Direktur Penyuluhan Pelayanan dan Humas DJP Dedi Rudaedi lewat keterangan tertulisnya di Jakarta, Selasa (27/12). Dedi melanjutkan, permohonan dimaksud dapat diajukan oleh Wajib Pajak yang mengalami kesulitan likuiditas, kesulitan keuangan, atau me-

ngalami keadaan di luar kekuasaannya. Sehingga, Wajib Pajak tidak akan mampu memenuhi kewajiban pajak tepat pada waktunya. Jangka waktu pengangsuran atau penundaan, ditetapkan dalam jangka waktu paling lama 12 bulan sejak diterbitkannya surat keputusan pengangsuran atau penundaan. Menurutnya, bagi Wajib Pajak yang ingin memanfaatkan fasilitas ini, permohonan pengangsuran atau penundaan diajukan paling lambat Sembilan hari kerja sebelum jatuh tempo pembayaran, kecuali

untuk membangun kapasitas kelembagaan dan kerjasama berbagai teknologi produksi di mana kedua belah pihak memperoleh manfaat. Armida tidak terlalu memasalahkan langkah EU yang kini melaksanakan kebijakan kesetaraan antara donor dengan penerima donor terhadap Indonesia. Badan Pembangunan Perserikatan Bangsa Bangsa (UNDP) mencatat pendapatan per kapita Indonesia terus meningkat hingga melewati 3.000 dolar AS sejak 2007. Tahun 2011, pendapatan per kapita Indonesia telah mencapai 3.716 dolar AS.

Bayar Pajak Kini Dapat Diangsur Wajib Pajak atau kuasanya dapat menunjukkan bahwa batas waktu pengajuan tersebut tidak dapat dipenuhi karena keadaan di luar kekuasaannya. Selain itu, Wajib Pajak juga harus tidak memiliki tunggakan PBB tahun-tahun sebelumnya. Setelah meneliti dan mempertimbangkan permohonan Wajib Pajak, maka Kepala Kantor Pelayanan Pajak Pratama atas nama Direktur Jenderal Pajak memberikan keputusan dalam jangka waktu paling lambat tujuh hari sejak tanggal diterimanya surat permohonan. (okz) Waspada/ist

Rabu lalu bertempat di PT Mitra Rajawali Banjaran, Bandung. PT Sidomuncul menerima penghargaan atas komitmen dan kepeduliannya dalam penanggulangan Aids di Provinsi Jawa Barat. Penghargaan yang diberikan kepada perusahaan-perusahaan nasional maupun lokal ini dihadiri juga Gubernur Jawa Barat Ahmad Heryawan dan Perwakilan DPR Pusat Nafsiah Mboy. Tampak pada gambar perwakilan PT Sidomuncul Nanik R unarso menerima piagam penghargaan yang diserahkan langsung gubernur.



Seorang pedagang cabai merah tampak menimbang cabai di Pasar Sukaramai Medan, Selasa (27/12). Menjelang Tahun Baru 2012 harga cabai terus alami peningkatan harga ke level Rp.45.000 hingga Rp 46.000 perkilogram, sebelumnya Rp.35000 hingga Rp 36.000 perkilogramnya.

Harga Cabai Merah Melambung BLANGKEJEREN ( Waspada): Karena stok menipis, harga cabai merah melambung di pasar-pasar Blangkejeren menembus angka Rp30.000 per kilogram. Ditambah lagi, cuaca buruk sudah berlangsung sejak akhir pekan lalu menyebabkan tanaman cabai masyarakat terkena penyakit. “Hasil panen petani cabai akhir pekan ini memang agak menipis, apalagi musim hujan

sangat rentan kena penyakit, sehingga tak perlu kaget kalau cabai hibrida merah itu melambung,” kata Samsul, salah satu petani cabai Blangkejeren, Selasa (27/12). Selain harga cabai merah melambung dari Rp10.000 per kilogram menjadi Rp 30.000 per kilogram, stok cabai hijau juga sudah sangat sulit dipasaran. Sedangkan cabai rawit masih dengan harga bertahan Rp25.

000 per kilogram di tingkat eceran. Sedangkan stok bawang merah masih tersedia, yakni bawang merah dengan harga per bambu Rp15.000 hingga mencapai Rp18.000. dan tomat dari Rp4.000 menjadi Rp6.000 per kg. Salah seorang penampung cabai, Amin, mengatakan, menjelang Tahun Baru 2012 harga bumbu dapur khususnya cabai dan bahan lainnya mera-

ngkak naik. Saat ini saja, stok bumbu dapur tersebut terbatas, sedangkan permintaan tinggi. Menurutnya, bumbu dapur akan terus mengalami kenaikan pada hari puncak Tahun Baru, karena pasokan dari Gayo Lues belum bisa diandalkan. Sementara pasokan dari luar daerah seperti Tanah Karo kemungkinan menipis soalnya mereka merayakan Natal sekaligus Tahun Baru. (cjs)

Menjanjikan, Kopi Luwak Diburu Pengusaha TAKENGEN (Waspada): Karena tingginya permintaan pasar (konsumen), kopi luwak arabika gayo kini paling diburu pengusaha di Aceh Tengah. Sementara diperkirakan akibat masih minimnya bahan baku, menyebabkan jenis kopi ‘special’ini mencapai harga Rp 1,5 juta/kg. “Bila masih berbentuk original (gabah kopi luwak yang belum diolah), kami membeli kopi hasil permentasi luwak itu dari kolektor hanya berkisar Rp300 ribu-Rp400 ribu per kg, tergatung kualitas biji. Namun setelah digonseng (roasting) dan siap pakai nilai jualnya mencapai Rp1,5 juta per kg,” ungkap Rosyi Sentana, owner (pengusaha) kopi berasal dari Lhokseumawe, menjawab Waspada Selasa (27/12) pagi di Takengen. Menurutnya, selama ini

meningkatnya harga kopi luwak (musang-red), karena pada umumnya konsumen telah mengetahui beda kopi biasa (non luwak) dengan kopi asli dari permentasi hewan pemakan biji-bijian ini. “Kopi jenis luwak lebih diminati karena selain rendah kafein juga bila rutin dikonsumsi dapat menetralisir berbagai penyakit, diantaranya seperti penyakit asma dan asam lampung. Artinya kopi jenis satu ini kerap diburu karna bermanfaat bagi kesehatan,” jelasnya. Dikatakan, kopi luwak asal Aceh Tengah ini memiliki dua jenis berbeda yakni kopi luwak liar (jenis biji didapat petani dari seputar perkebunan dan lebih alami) dan kopi luwak penangkaran (jenis biji dihasilkan musang tanpa bahan baku biji pilihan).

“Kopi luwak liar lebih mahal harga belinya dari kolektor karena biasanya hasil permentasi lebih alami, musang dapat mengkonsumsi buah merah kopi pilihan dan berkualitas. Sementara biji penangkaran hasilnya kurang original, disebabkan biji dikonsumsi hewan tersebut telah diberi buah asalan dari para penangkarnya,” jelas Rosyi. Memenuhi permintaan pasar dan menjaga kualitas, katanya, para pengusaha berburu kopi luwak di Aceh Tengah telah memiliki tehnis tersendiri untuk mengurangi adanya percampuran biji kopi biasa dengan jenis luwak. “Untuk mengenal perbedaan gabah (biji) kopi arabika biasa dan luwak, dapat dikenali beberapa perbedaan mencolok secara kasat mata seperti;

aroma, warna, dan tekstur biji. Selain itu mayoritas kopi luwak bila disentuh biji terasa kasat ditangan, sementara kopi non luwak lebih lembut,” terangnya. Dalam satu bulan katanya kebutuhan akan kopi luwak di pasaran domestic menimal 100 kg-200 kg. Namun karena masih terbatasnya daya tampung ditingkat kolektor, setiap pengusaha yang berburu luwak hanya mampu menyediakan maksimal 30 kg per bulan. “Permintaan akan kopi luwak semakin meningkat setiap bulannya. Dari itu hendaknya petani di dataran tinggi Gayo ini dapat melihat peluang yang ada. Artinya selain petani merupakan pelaku transaksi jual beli kopi arabika seperti lazimnya, juga memanfaatkan kopi hasil permentasi musang ini sebagai tambahan ekonomis,” pungkas Rosyi.(cb09)

Nelayan Luar Jarah Ikan Perairan Aceh MEUREUDU (Waspada) : Puluhan boat nelayan asal luar daerah seperti dari Sumatera Utara (Sumut), dilaporkan hingga kini masih saja menjarah/ merambah ikan di laut perairan Aceh, hal itu seperti terjadi di Kabupaten Pidie dan Pidie Jaya. Aksi yang dinilai brutal dilakukan nelayan Sumut itu sangat meresahkan nelayan tradisional Aceh. Para nelayan kita sangat mengharapkan agar instansi terkait bersama Pol Air (Polisi Air) Polda Aceh segera mengatasi masalah tersebut. Menurut sejumlah nelayan tradisional di Kabupaten Pidie Jaya dan Pidie kepada Waspada, Selasa (27/12), setiap waktu melihat boat asal Sumut itu selama ini muncul di perairan

pantai Kabupaten Pidie Jaya dan Kabupaten Pidie. Bahkan, lebih parahnya lagi terkadang nelayan asing berbendera Thailand juga sering merambah isi perut laut Aceh itu. Informasi Waspada peroleh lebih parahnya lagi terjadi di sepanjang perairan laut Pantai Barat dan Selatan, Aceh. Seperti diungkapkan Koordinator Panglima Laot Barat-Selatan Aceh T Risman kepada pers. Berdasarkan laporan diperoleh dari para nelayan setiap waktu melihat boat asal Thailand muncul di perairan Pantai Barat dan Selatan. “Laporan diterima, kapal penghalau dari aparat keamanan sudah sering mengejar nelayan asing yang mengeruk

hasil perut laut Aceh itu. Karenanya, para nelayan Aceh berharap agar nelayan asing itu tidak hanya sekedar dihalau atau dikejar, tapi juga perlu ditangkap, sebab menguras ikan di wilayah Aceh, “jelasnya. Ne l a y a n a s i n g h a n y a sebentar menghilang ketika ada patroli dari aparat keamanan, tapi selang beberapa jam setelah itu kapal nelayan asing kembali menjarah ikan di perairan Aceh. Meskipun demikian, kepada nelayan di Aceh dihimbau bersabar dan tidak melakukan hal-hal yang dapat merugikan diri sendiri, kata Risman. “Ko m u n i t a s Ne l a y a n Tradisional (Kontan) menyatakan boat asal Thailand yang kerap berkeliaran di laut

perairan Aceh sudah sering dikeluhkan para nelayan tradisional setempat,” ujarnya. Menurut mantan Panglima Laot Kabupaten Pidie itu, boat yang biasa digunakan nelayan luar itu itu mencapai 60 GT dan menguras ikan dalam jumlah besar. Kalau masih berkeliaran di perairan Aceh, diharapkan agar nelayan asing itu segera ditangkap, kata anggota DPRK Pidie Jaya Muhammad Bentara. Sejumlah nelayan di Kabupaten Pidie Jaya menyebutkan, selama nelayan luar itu masih beroperasi di perairan Aceh telah membuat nelayan tradisional setempat terus merugi, karena berkurangnya hasil tangkapan ikan.(b09)

Permintaan Terompet Naik Hingga 60 Persen TRADISI pergantian tahun baru identik dengan membunyikan terompet. Semarak bunyi terompet akan menghiasi penutupan 2011 ini. Tiupannya berdengung saling menyambut tak henti-henti menjelang dan memasuki pk.00.00. Kebiasaan itu, rupanya membawa rezeki bagi mereka yang kreatif memanfaatkannya untuk mengais rezeki. Seperti Rusli, 58, seorang pengrajin terompet di Medan. Dia sengaja memproduksi terompet lebih banyak dari tahun lalu karena tahun baru ini pemesanan terompet naik 60 persen.

“Tahun ini pasti lebih meriah dan kami lebih untung,” ungkapnya kepada Waspada Jumat, (27/11). Dia tidak kesusahan dalam menerima pesanan sebanyak apapun, karena dia dibantu tujuh karyawan. Hingga saat ini pesanan yang diproduksi sudah mencapai 20.000 terompet, pesanan langganan mereka dari Kutacane, Lhoksumawe, Tapsel, Nias, Pematang Siantar, Asahan, Tebing dan Kota Medan. Hal ini disebabkan pedagang terompet tahun ini makin banyak. Rusli memanfaatkan karton bekas yang berasal dari perkantoran dan percetakan, untuk dijadikan berbagai macam bentuk terompet. Dengan mengolah bahan dasar karton bekas dia kemudian mengkreasikan bahan tersebut. Hasilnya, berbagai jenis terompet tercipta, seperti naga, gajah, harimau,

dan sek sopon. Terompet itu kemudian ia jual antara Rp5.000 hingga Rp70.000, tergantung bentuk dan tingkat kesulitan. Menjelang pergantian tahun seperti sekarang, dia mengaku mampu meraih omset hingga puluhan juta rupiah. Sementara itu Bonar, 22, pedagang terompet eceran mengungkapkan menjadi pedagang terompet di akhir tahun sungguh menguntungkan dengan modal Rp1 juta, dalam seminggu dia bisa meraup keuntungan hingga Rp500.000, tentu itu akan sangat menguntungkan. “Semua kalangan mencari dan ingin membelinya unruk memeriahkan suasana tahun baru. Terompet yang paling digemari karena unik dan mewah adalah, terompet berbentuk naga, ular, harimau, dan yang

terbaru terompet panah asmara, gitar, angka delapan dan biola dengan harga berkisar Rp20.000 hingga Rp25.000, sementara terompet biasa Rp5.000 hingga Rp10.000 tergantung ukuran, sementara itu terompet yang paling langka karena bentuknya yang besar adalah sek sopon Rp50.000 hingga Rp75.000,” katanya kepada Waspada. Dia menambahkan pembeli akan membludak di malam tahun baru, dan di detikdetik terakhir pergantian tahun pk. 00.00 di akhir Desember. Pantauan Waspada menjelang tahun baru ini sudah terlihat aneka terompet dijual di pinggir jalan, supermarket, dan mal. Pembeli juga sudah tertarik dan membelinya untuk anak-anak mereka karena tahun baru sudah di depan mata. (csf)

B6 1 CM 2 CM


Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000


AUTOMOTIVE Informasi Pembaca


Bursa Automotive

: Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower


: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

5 CM 6 CM

Rp. 65.000 Rp. 78.000

NISSAN Grand Livina 1.5 XV A/T Th. 2008. W. Htm, sgt mulus, original, jok kulit, spt baru, mesin sehat, sgt irit BBM. Hrg. 155jt/ Nego. Hub. 0813 7618 8118

TOYOTA Kijang Thn. 90. Mobil simpanan. Hijau, ban + Velg Baru. CD, AC, Hub. 0813 6101 2299

MERCY E230 ‘96 Hijau Met, Km Low, Mulus, BK Mdn, Int. Original, Sprt baru, Sound system, VCD Multi, DVD, MP3, RT, DP 36,5 Jt Angs. 4,2 Jt x 23 Hub. (061) 7670.0979


SUZUKI Carry Thn. 2004 Real Van Dijual. AC, Warna biru metalik. Harga damai. Hub. 0812 6334 091

All New Xenia, Terios, Luxio, Sirion, Grand Max Pick Up - Minibus, Cash Kredit - Tukar tambah - Proses cepat Hub. Dika 0852.7074.7744 - (061) 7744.3877 KHUSUS PENGGEMAR JEEP CEPER

D-Taft GT (4x4) Thn. 90. W.Hitam, P. Window, AC, Ban Velg Import, body kaleng2. Mobil bener sudah di modif (tdk kecewa). HP. 0812 6025 8795 (D. Setia Budi)

HONDA ACCORD 86 DIJUAL Kondisi ok. Central lock, alarm, BK Medan. Harga 23 Jt. Minat Hub. 0852 9618 4559 HONDA PROMO AKHIR TAHUN

Beli Honda CRV/Freed Hadiah langsung sepeda motor tanpa diundi. CRV DP 60 Jt-an, Freed DP 40 Jt-an Hub. Johan 0813 9619 6265

ISUZU Panther Hi Grade. 94. Nama langsung. BU cepat 54,5. Hub. 0853 6077 9299


Grand Touring Type J, LS, LV, Pick Up Panther, Turbo Diesel, Kuat, Hemat, Dijamin untung, Terima tukar tambah semua merk, Info: Astra, Isuzu: (061) 68444.8554 / 0813.7591.5420 NEW RIO/ALL NEW PICANTO KIA ALL DP 20% Angsuran Rendah/Bunga Ringan

kaca Film Lumarr + Discount Tambahan. Mobil Free Hub. 0852 7691 0079 / IRFAN

MITSUBISHI L300-Box Thn. 93. Hrg: 45,3Jt (Net). Hub. 0853 7077 7707 MERCY C180 ‘94 Silver Met, Jok klt, VR 16”, ABS, Airbag, PW, PS, Alarm, BK 333, DP 25 Jt, Angs: 2,76 Jt x 23 Hub. 0852.7507.6512 / Kanda

Rp. 91.000 Rp. 104.000

TOYOTA Corolla SE Salon, Thn. 86 Dijual. W. Hitam, Hub. HP. 0812 65 7735. (061) 8460027


Terios Sirion, Luxio, Pick Up, atw ingin Bw plg “All New Xenia !!” DP & Angs. Ringan. Proses Cpt. Data dijemput. Hub. ZOEL: 0852 7542 2777 - 0819 833 506

7 CM 8 CM

MITSUBISHI Pajero Sport 4x2, Eceed ‘10, AT/ Tiptronic, Turbo Diesel, Jok klt asli, Htm, Ban bsr, MP3, CD, Subwoofer, TOT, DP 75Jt, Angs: 7,7 Jt Hub. 0852.7690.3900

SUZUKI Real van Thn. 95, hijau metalik, lengkap, AC, Tape, ban baru, mulus, Rp. 43Jt/nego. Hub. 0812 6344 5757 TP SUZUKI Baleno merah maron, pemakaian Th. 99, sgt orisinil, mulus dan terawat, mesin sehat, Hrg. 68Jt.Nego. Hub. 0821 6312 2295 SUZUKI sedan Forsa GLX, Thn. 88, BK Mdn asli, warna merah maron, AC, Tape, PW, CL, VR, BR, Kondisi sangat bagus. Harga Rp. 23Jt. (damai). Hub. IWAN Jl. Perdamaian/Taduan No. 113. HP. 0852 7630 4256

TOYOTA Yaris Type E Th. 2008/BU. W. Htm, AC, Tape, VR, BR, BK Asli Mdn. Sehat, sgt mulus, original, jarang pakai. Hrg. 155Jt/damai. Hub. 0853 6018 2414

TOYOTA Kijang 1.8 LX ‘00 Model LSX, Biru Dongker, AC dgn, Tp, CD, PS, VR, BR, DP 17 Jt, Angs. 2,85 Jt Hub. 0852.7507.6512/ Kanda

TOYOTA BARU Pemesanan All New Avanza - Cash & Kredit. Hub. 0812 6048 1001 TOYOTA SE Saloon ‘87/W. Merah, AC, Velg Standart, BK Panjang Rp. 29Jt (nego). Hub. 0853 7373 2155 - 77870870 TOYOTA Kijang Super Thn. 88 SOHC, 5 pintu AC, Tape, Jok kulit, warna abu2. Mobil terawat. Harga Rp. 34Jt. Hub. 0813 6126 5117

DO RE MI JOK MOBIL KHUSUS AVANZA/INNOVA Rp. 1.350.000,Jok (model press) + Alas

TOYOTA Avanza G Th. 10, Wrn hitam, balik DP Rp. 48Jt. sdh bayar 9 kali, model baru, per bln Rp. 3.995.000. Pelunasan Rp. 102.306.000. Kembar Ponsel Jl. SM. Raja No. 200. (Dpn UISU). 0821 6767 7000 / 7851402

TOYOTA Kijang Grand Extra Dijual. Thn. 96. 1,8. Warna abu-abu. BK Medan asli. Hub. 061-76329538

TOYOTA Avanza Th. 2006 warna hitam metalik. Hub. 0812 6075 923/ 0812 6038 274 BURSA BUTUH DANA BUTUH DANA Jaminan Apa Saja. Sertifikat Tanah Mobil & Sp. Motor. Segala tahun. Hub. 061.8222 774 HP. 0853.6199.1500-0816 314 1807





SEDAN Rp. 600.000 Rp. 900.000 Rp. 1.000.000 Rp. 1.400.000

MINI BUS Rp. 700.000 Rp. 1.000.000 Rp. 1.100.000 Rp. 1.600.000



JL. S. PARMAN BLOK DD No. 3-4 PETIDAH - MEDAN (DEPAN SEKOLAH ST. THOMAS 2 MEDAN) Telp. 061-4522123, 77602123 JL. MAKMUR No. 10 A, MEDAN (MASUK DARI JL. ADAM MALIK / JL. KARYA) TELP. 061-6639123, 76501123



ELEKTRONIK REPARASI AC, KULKAS, MESIN CUCI Kompor Gas, Dispenser H & C TV, M. Pompa Air Sanyo

Hub. SURYA TEKNIK SERVICE Telp.66482216 - 0813 7589 8757- 082163120894 Siap Ketempat

11 CM Rp. 165.000 12 CM Rp. 180.000

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000


Pelanggan Yang Terhormat

HA TI-HA TI terhadap penipuan yang HATI-HA TI-HATI mengatas namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk membeli produk anda, TI apabila anda ingin TI-HA dan HA HATI-HA TI-HATI melakukan transaksi jual beli melalui transfer. Segala akibat yang terjadi diluar tanggungjawab PT. Harian WASPADA. Apabila anda mencurigai sesuatu, silahkan hubungi kami di 061-4576602. Terimakasih

Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput


PERABOT TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 7653.2188


Spring Bed 6 kaki 2 lapis Rp. 1.150.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun

Hub Telp. (061) 661.8116 - (061) 661.6802 - 7653.2188

Anda Butuh Perabot Jepara Asli?


Hubungi: Jl. Bilal No. 90 P. Brayan Medan Telephone Toko : 661.6285 Rumah : 661.1540 Fax : 661.6285 (061) Jl. K.L. Yos Sudarso depan SMA Negeri 1 Tebing Tinggi Telp. (0621) 24243






821 9951

Jl. Setia Budi No. 2 TUMPAT/ SEDOT


0813 6147 0812

Jl. Gatot Subroto Medan Ada Garansi

Ingin Promosikan Produk Anda

TOYOTA Twincam 1.6 Hitam met Th. 90, BK Medan baru perpanjang, VR16, BR, PS, PW, CL, RMT, DVD, AC Dingin. Hrg. 45Jt. Nego. Hub. 0812 6477 7088

TOYOTA Fortuner Bensin Th. 06, Bln 7, matic, wrn hitam metalik, mulus, 1 tangan dari baru Rp. 249Jt. Kembar Ponsel Jl. SM. Raja No. 200 (dpn UISU). 0811 613107 / (061) 7851402

9 CM Rp. 126.000 10 CM Rp. 140.000

Rabu, 28 Desember 2011




Hub. Jl. Nibung II No. 114 Medan (Samping Medan Plaza) Telp. (061) 4566884 (Hunting) dekat Carrefour.

Media yang Tepat untuk Iklan Anda BURSA



Berbagai Model dan Warna Jl. Prof. H.M. Yamin SH. No. 344/Jl. Serdang Depan Gg. Sado Medan, HARI MINGGU TETAP BUKA



Ingin Promosikan Produk Anda Harian


Media yang Tepat untuk Iklan Anda FD CD



Keterangan lebih lengkap silahkan hubungi:

TELPON : 061 - 4576602 FAX : 061 - 4561347 * Format: JPG - TIFF (Photoshop)


WASPADA Rabu 28 Desember 2011

07.00SiDoelAnakSekolah 08.00 Dahsyat 11:00 Infotainment INTENS 12:00 Seputar Indonesia Siang 12:30 Film Indonesia 14.30 Cek & Ricek 15.30 Give 5 16.00 Silet 17.00 Seputar Indonesia 17.30 Dewa 19.00 Mega Sinetron : Binar Bening Berlian 21.00 Mega Sinetron : Anugerah 22.30 D’Journey 23.00 BOM : Little Big Soldier 01.30 Seputar Indonesia Malam


07.00 Inbox 09:00 Halo Selebriti 10:00 SCTV FTV Pagi 11:00 SL Liputan 6 Terkini 12:00 SL Liputan 6 Siang 12:30 SCTV FTV 14.30 Status Selebriti 15.00 Uya Emang Kuya 16.03 Jebakan Betmen 17.00 Liputan 6 Petang 17.30 Laskar Pelangi 19.00 SCTV Sinetron Aliya 20.30 Dia Atau Diriku 22.30 Liputan 6 Terkini 22.33 SCTV FTV Utama Spesial Tahun Baru

07.00 Disney Club 07.30 Disney Club 08.00 Layar Pagi 10.30 Diantara Kita 11:00 Sidik 11:30 Lintas Siang 12:00 Layar Kemilau 13.30 Cerita Siang 15.00 Starlite 15.30 Lintas Petang 16.00 Aksi Juara 18.00 Animasi Spesial 19.00 Sampeyan Muslim 20.00 Senggo Senggol Asmara 21.00 Bulan Di Atas Mentari 22.00 MNCTV Festival 00:00 Lintas Malam

06:30 Hati Ke Hati Bersama Mamah Dedeh 07:30 Wooow…! 08:00 Friends 09:00 Resep Warisan 09:30 Segeeerr Beneerrr 10:30 Catatan Sang Dai 11:30 Topik Siang (Live) 12:00 Klik ! 13:00 Sinema Siang 15:00 Mantap (Live) 16:00 Topik Petang (Live) 16:30 Fenomania 17:00 Anak Jin 18:00 Pesbukers (Live) 19:00TawaSutraCoooyyy… 20:00 Klik! Award (Live) 23:00 Most Incredible Moments 00:00 XYZ 00:30 Topik Malam (Live) 01:00 Lensa Olah Raga Malam (Live)

07:00 - KISS Pagi 07:30 - FTV Pagi 09:30 - Hitzteria 11:30 - Patroli 12:00 - Drama Asia (Korea) 13:30 - Drama Asia (Korea) 15:00 - KISS Sore 16:00 - Fokus 16:30 - Drama Asia (Korea): 18:30 - Drama Asia (Mandarin): Monkey King 19:00 - Satria 20:00 - Tutur Tinular 22:00 – Mega Asia

07.05 Editorial Media Indonesia 08.05 Eleven Show 09.05 Headline News 10.05 Eleven Show 11.05 MDG’s Insight 13.30 Jakarta Jakarta 14.30 Metro Sore 15.30 Public Corner 16.05 Discover Indonesia 16.30 Sentilan Sentilun 17.05 Metro Hari Ini 18.05 Metro Hari Ini 19.05 Suara Anda 20.05 Suara Anda 20.30 Journalist On Duty 21.05 Top Nine News 22.05 Mata Najwa 23.00 Metro Sports


07:30 Ranking 1 08:30 Derings 10:00 Ngulik 10:30 IBU 11:00 Insert 12:00 Reportase Siang 12:30 Jelang Siang 13:00 Bingkai Berita 13:30 Ceriwis 14:30 86 15:00 Keluarga Minus 15:30 Sketsa 16:00 Happy Family 17:00 Reportase Sore 17:30 Insert Sore 18:00 Jika Aku Menjadi 19:00 Comedy Project 20:00 Derings 21:00 Bioskop TransTV 23:00 Kakek-Kakek Narsis 00:00 Bioskop TransTV : 01.0 Reportase Malam

06:30 Apa Kabar Indonesia 09:30 Live News Kabar Pasar Pagi 10:00 Coffee Break Live 11:30 Mutumanikam 12:00 Live News Kabar Siang 13:30 Ketemu Pepeng 14:30 Live News Kabar Pasar 15:00 Mutumanikam 15:30 Manusia Indonesia 16:30 Sport File 17:00 Live News Kabar Petang 19:30 ApaKabarIndonesia Malam 21.00 Live News Kabar Malam 22.00 Live News Kabar Arena 23.00 Radio Show

08.00 Fairly Odd Parents 08.30 MEnggapai Bintang 09.00 Super Hero Kocak 10.00 Obsesi 11.00 Top Banget 11.30 Hot Spot 12.00 Awas Ada Sule 13.00 Main Kata 13.30 Global Siang 14.00 Petualangan Panji 14.30DenyManusiaIkan 15.00 Hand Made 15.30 Berita Global 16.00 Top Banget 16.30 Fokus Selebriti 17.30 Penguin Of The Madagascar 18.00 Spongebob 19.00 Awas Ada Sule 20.00 Big Movies 22.30 Big Movies

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

Inovasi Musik Tiada Henti Nidji MENYADARI kenyataan – mempertahankan eksistensi dan popularitas jauh lebih berat ketibang pertama meraihnya, Nidjibandpuntakhenti-hentinya melakukaninovasidaneksplorasi dalam bermusik. Mengiringi peluncuran album keempat bertajuk Liberty produksi Musica Studio’s - band dipunggawai Giring[vokal],Rama dan Ariel [guitar], Adri [drum], Andro [bass] dan Run-D [keyboard] ini, melaku-kan perubahankaraktersoundhingga berbeda dengan yang selama ini terekam di album Breakthru (2006), Top Up (2007) dan Let’s Play (2009). ”Berkat peran duo produser musik baru Gio Wibowo dan Nabil Hussein, memudahkan Nidji untuk terus melakukan inovasi dan eksplorasi tiada henti dalam bermusik. Alhasil, album Liberty ini banyak mencuatkan energi baru yang progresif dan lebarbagimusikalitasNidji,”papar Giring kepada Waspada di JCC Sena-yan Jakarta, baru-baru ini. Berkat konsep aransmen ringan yang lebar plus petikan gitar Ariel – mengantar singel andalan bertajuk Jangan Takut benar-benar nyaman untuk

didengar. Lagu tersebut tercipta setelah saya dan istri sedikit terlibat cekcok karena isu kepercayaan saat menjalani karan-tina di Cisarua – Bogor, tutur Giring. Disebutkannya, berangkat dari kekesalan pula, ia mencoba membuat nada berdasarkan progresi chord diberikan lima personel Nidji lainnya. Dan katakata pertama yang keluar adalah ’Jangan-jangan takut lagi, janganjangan takut aku. Ku bukan dia yang tak setia. Hingga akhirnya tercipta lirik dan nada lagu secara utuh dan lengkap, terang Giring seraya menutur-kan, pemilihan lagu Jangat Takut sebagai singel pembuka album Liberty bukan sesuatu yang mereka perkirakan. ”Tradisi selama ini, lagu kesukaan atau favorit mayoritas personel Nidji tidak pernah menjadi jagoan album. Mudah mudahan lagu JanganTakut akan menjadi awal yang baik untuk album terbaru kami,” harap pria bernama lengkap Giring Ganesha. Gitaris Rama menegaskan, single Jangan Takut merupakan cermin kembalinya energi musik Nidji yang sempat hilang. ”Kini, formulasi lagu simple dengan medium beat, notasi plus lirik


Ingin Promosikan Produk Anda Harian



Gaji tetap, komisi, bonus Hubungi: Bpk. Akbar: 0821.6388.6438


Playgroup, SMU/ D3/ S1 syarat Kreatif, datang langsung: Jl. Karyawisata No. 23A Johor Tp. 786.1690 Medan

WASPADA Media yang Tepat untuk Iklan Anda

LOWONGAN KERJA RESMI KE MALAYSIA Anda ingin bekerja secara legal ke Malaysia???? Disini jawabannya:

Perusahaan Elektronik Terkemuka di Selangor, membutuhkan Tenaga kerja wanita untuk dipekerjakan di kilang:

WESTERN DIGITAL M SDN BHD, DI SELANGOR A. SYARAT PENDAFTARAN: 1. Wanita umur 18 s/d 30 tahun 2. Pendidikan minimal SMP/ SLTA sederajat 3. Membawa foto copy Ijazah, KTP, Kartu keluarga (asli dibawa sewaktu interview) 4. Membawa pas photo warna 3x4: 6 lbr 5. Bisa eks. Malaysia 6. Bisa yang telah menikah B. GAJI - Gaji kasar sebulan RM 1.286 (untuk bagian Cleanroom) - Gaji kasar sebulan RM 1.150 (untuk bagian Non Cleanroom) - Bonus tahunan C. FASILITAS - Levy subsidy 109% - Asrama tiket pulang kemudahan kesehatan, asuransi, berangkat naik pesawat terbang - Biaya proses pemberangkatan dapat dicicil setelah TKI bekerja di Malaysia D. JADWAL PENDAFTARAN/ JADWAL SELEKSI: - Pendaftaran: Setiap hari kerja - Seleksi: Jumat Tanggal 13 Januari 2012 Segera daftarkan diri anda sekarang juga ke:

PT. MUTIARA KARYA MITRA (Group Rumah Sakit Sari Mutiara) SIUP NO: 629/MEN/2006 JL. KAPTEN MUSLIM NO. 89C MEDAN TELP. (061) 845.2956 - 847.1840 - 846.8759 (dekat ke RSU Sari Mutiara & Millenium Plaza) Contact Person: Mega 0812.6408.0074 0813.6220.2213 Ibu Veronika 0852.6135.3442

DIBUTUHKAN SEGERA Sebuah Restoran membutuhkan: A. TUKANG MASAK B. TUKANG POTONG C. WAITRESS Bagi anda yang memiliki komitmen dan loyalitas yang tinggi, silahkan bergabung dengankamibagiyangtinggal diluar kota atau tidak memiliki kendaraan, disediakan tempat tinggal gratis

yang mudah diingat dan umum khasNidji,telahkembali,”ujarnya Dari segi aransemen, inovasi baru album keempat Nidji begitu kentalterasapadaunsurkeyboard yang lebih dominan dengan sound-sound baru ga-rapan Randy (Run-D). Indikasi-nya,



Informasi Pembaca Bursa Property

G R : Garasi LB KM : Kamar Mandi LT KP : Kamar Pembantu RM KT : Kamar Tidur RT SHM: Sertifikat Hak Milik

: Luas Bangunan : Luas Tanah : Ruang Makan : Ruang Tamu


LT. 305,5m² Bangunan 7x13m, 3 KT, 2 KM, R. Tamu, R. Kel, Lokasi Jl. Benteng Hilir/ TT. Sewa Ledtsu, Harga 200 Jt-an/ Nego Pem. hub. 0821.6020.0068 Yetno Pem.


Uk. Tanah 10x43m, Jl. Bromo/ Raya Cangkuk III No. 8 depan Ktr Camat Mdn Denai


Tnh Dijual Uk. 5x20m, SK Camat Jl. Makmur Psr. VII Tembung

Hub. 0852.7601.2770 - 0852.6113.0111


Jl. Marelan Raya Gg. Persatuan No. 23 Tanah 600m, SHM, LT. 16x23m, 15x13m², 4 KT, RT, RK, R. Sholat, Lt. keramik, RM, Garasi, 5 KM, PLN, Telp Hub. 0813.9763.0664

Hadiah Diidamkan Justin Bieber

bagian Lead lagu yang sebelumnya banyak diisi Gitar, kini digantikan keyboard Run-D. Simak saja, komposisi Save Me tampil indah dengan pendekatan musik yang menjadi khas musik Nidji. Suara keyboard menerawang dan sisipan gitar





Penerbangan Via Singapore * Khusus bagi jama’ah dari luar kota nginap di Hotel Madani Gratis * Seluruh Jamaah Tertanggung ASURANSI

DAFTAR SEGERA Kantor Pusat: Gedung Gelora Plaza Lt. 1 Jl. S.M. Raja No. 4 / 18 Medan Telp. 061-7326981, 0813 7503 1889, 0852 6213 3488


Uk. 10,4x18,3m SHM Jl. Beringin Psr. VII Tembung Gg. Bacang No. 8 (50m dari Jln besar) Hub. 0853.7375.5731

Media yang Tepat untuk Iklan Anda





Berpengalaman professional


1. Umroh Reguler 9Hr, dan 2 Minggu/ 13hari 2. Umroh dan Arbain di Madinah 3. Umroh Plus Mesir 4. Umroh Plus Turkey 5. Umroh Plus Jordan Aqsha 6. Umroh Plus India Kashmir 7. Umroh Plus Dubai PEMBUKAAN MANASIK HAJI DILAKSANAKAN PADA FEBRUARI 2012 DAFTARKAN SEGERA KE:




KANTOR PUSAT MULTAZAM MEDAN JL. TITI PAPAN/ PERTAHANAN NO. 10 SEI SIKAMBING TELP. (061) 457.6116 - 7731.3385 HP. 0812.6495.8456 - 0813.6137.2321 - 0812.6481.828




My Residence in Medan

Jl. Sisingamangaraja No. 82 Medan Telp. (061) 734.2106






8,5x29,5m, SHM, Lokasi Strategis, Lokasi Jl. Karya Baru, Pondok Surya Baru, T. Perantara Hub. 0813.9763.0664

Keterangan lebih lengkap silahkan hubungi:

TAHUN 2012?

Untuk Alumni, SMA/ SMK/ MA Tahun ajaran 2011 dan 2012


Tanah Kaplingan di Mariendal Jl. Mekatani/ Anggaran III (Kav. 6), Luas Tanah 15x28m

T ELPON : 061 - 4576602 F AX : 061 - 4561347


Hub. 0813.7405.3722 0852.6121.4179

* Format: JPG - TIFF (Photoshop)

Mulai Belajar: Senin, 16 Januari 2012 s/d Pelaksanaan SNMPTN 2012


Dapatkan tanah kavling Uk. 6x16,5m² beli pasti untung !! dengan 2 akses jalan masuk bisa dari Komp. Johor Mencirim Sunggal dan bisa dari Jalan Pala Sei Mencirim Sunggal, Khusus menyambut Tahun Baru !! Pesan sekarang dapat diskon Rp. 2 Jt untuk 8 Kavling saja !! Telepon sekarang di: 0813.6112.2791 0811.653.755 - 0853.7176.5677

ibu.” ungkap Bieber seperti dikutip dari



Justin Bieber/

dandang dan panci, mengecewakan. Saya pikir akan kuberikan saja pada



Daftarkan sekarang juga di lokasi belajar MEDICA Jl. Bantam No. 12 Medan Telp. (061) 457.8058 Jl. Iskandar Muda No. 19B Medan Telp. (061) 415.9280 Atau hubungi/ SMS ke: - Jonris M, S.Pd (0852.7955.6481) - Basri Ginting, ST (0812.639.6209) - Ir. Tagor Silalahi (0812.6493.252) Pendaftaran sudah dibuka...!!! Jam belajar boleh pilih pagi atau sore hari: Pagi : Les 1 Pukul 08.00 Sore : Les 1 Pukul 13.00/ 14.55





MEDAN: Jl. Serdang Gg. Sado 43B, Tempuling Medan, Sumatera Utara Telp. (061) 6634.2201


Dengan H. TEJA SAEFUL Cucu Asli Mak Erot Bersama


Jl. Ring Road (Simp. Jl. Bunga Asoka) Medan TELP. 0813.6210.5778


* (AgusT)

Izin Usaha: 503/1099.SK.HO/SL/NT/08



Nidji yang manis di sela vokal Giring yang meneriakan reffrain Save Me menjadi ciri unik dan merupakan salah satu elemen kuat perubahan terkini musikalitas Nidji.

Mungkin Justin Bieber harus mengirim surat ke Sinterklas setelah ia mendapatkan dan-dang dan panci sebagai hadiah natal, bukan Game Boy seperti yang dia inginkan. Bieber mengatakan hadiah yang ia dapat ternyata tergan-tung pada kocokan dadu. Hadiah diputuskan dalam sebuah permainan di hari natal saat masingmasing anggota keluarga membelikan hadiah untuk anak-anak. Ia menjelaskan, kita mengo-cok dadu dan jika memperoleh angka kembar, aku bisa mengambil sebuah hadiah, jika tidak, itu berarti giliran orang selanjutnya dan ketika giliran kita kembali lalu mendapatkan dadu kembar , kita harus memilih hadiah orang lain dan bertukar hadiah.” “Pernah saya menginginkan game boy tetapi saya malah mendapatkan


Antar surat lamaran anda ke:

Ingin Promosikan Produk Anda

07:30 Selebrita Pagi 08:00 Strike 08:30 Hitam Putih 09:30 Ups Salah 10:00 Spotlite 11:00 Warna 11:30 Redaksi Siang 12:00 Selebrita Siang 12:30 Si Bolang 13:00 Laptop Si Unyil 13:30 Cita-citaku 14:00 Dunia Air 14:30 Koki Cilik 15:00 Ayo Menyanyi 15:30 Asal Usul Fauna 16:00 Jejak Petualang 16:30 Redaksi Sore 17:00 Jejak Petualang: Sur. 17:30 Orang Pinggiran 18:00 Hitam Putih 19:00 On The Spot 20:00 Opera Van Java 22:00 Bukan Empat Mata **m31/G


BILA anda ingin perkasa ingat jangan sampai salah masuk carilah yang benar-benar pewaris ilmu Mak Erot Sejati, karena keahlian H. Teja Saeful sudah tidak diragukan lagi dalam menangani keluhan seputar alat vital bahkan pengobatan H. Teja Saeful, sudah terkenal Indonesia dan kota-kota besar di Indonesia, sudah ribuan pasien tertolong dipengobatan Mak Erot ini yang aman tanpa efek samping, bahkan dimanca negara sekalipun pengobatan Mak ERot sudah tidak diragukan lagi keberhasilannya. INGAT untuk Kaum Pria jangan sampai Anda terhina Kaum wanita karena kondisi alat vital yang kurang sempurna Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041 KONSULTASI UMUM: KHUSUS PRIA: - Buka Aura - Ejakulasi dini - Cari Jodoh - Impotensi - Sesama jenis - Memperbesar “Alvit” - Pelaris - Memperpanjang “Alvit” - Memikat lawan jenis - Keras dan tahan lama dll - Besar PYDR KHUSUS WANITA: - Ingin punya keturunan - Memperkencang & memperbesar payudara - Mengobati keputihan dll

DIJAMIN 100% Hanya Tempat Kami Klinik Mak Erot Jl. Laksana No. 55J masuk dari Jl. Amaliun Yuki Simpang Raya Medan (Praktek Tetap) H P. 0 8 1 2 . 4 0 3 8 . 3 3 3



Setelah sukses di propinsi di Papua, kini hadir di kota Medan, pengobatan nyata luar biasa, bila anda ingin perkasa, ingat jangan salah informasi disini yang pasi ±30 menit kami akan buktikan alat vital menjadi besar dan perkasa. Dengan metode pengurutan disekitar alat vital melalui totok urat-urat kejantanan. Kami tidak mengumbar janji belaka. Tdk ada efek samping, bebas utk semua agama. Bukan janji tapi bukti ditempat Penanganan khusus pria: - Memperbesar, panjang, keras, kuat dan tahan lama - Kencing manis, diabetes, L. syahwat - Ejakulasi dini/ impotensi Khusus Wanita: - Memperbesar/ kencang payudara - Ingin punya keturunan/ gurah vagina - Ingin kembali perawan/ keputihan Konsultasi umum - Ajian semar mesem/ buka aura - Penglaris/ penghasihan/ cari jodoh - Pasang susuk, karir/ jabatan

DIJAMIN 100% Alamat Jl. Halat / Masuk Jl. Senam No. 19C. Belakang Makam Pahlawan H P. 0 8 2 1 . 6 6 5 5 . 1 2 2 2



Pedagang Tradisional Wajib Dibina, Bukan Dibinasakan


ksi demo pedagang ikan Pasar Simpanglimun, Medan, menggelar jualan mereka di badan Jalan SM Raja membuat macet arus lalulintas di lokasi itu. Untung hanya kurang lebih satu jam kemacetannya, setelah itu para pedagang bersedia mundur ke dalam setelah melalui musyawarah dengan pejabat Pemko Medan dan Muspika plus. Aksi serupa juga pernah mereka lakukan sebelumnya di jalan yang sama dengan cara memblokir jalan. Ratusan pedagang pasar tradisional itu melakukan aksi protes terhadap PT Inatex yang mengutip distribusi ikan yang tidak sesuai dengan perjanjian. Pedagang pun keberatan dengan penembokan oleh PT Inatex, apalagi setiap tahunnya PT.Inatex melakukan pengutipan sebesar Rp 6 juta hingga Rp 7 juta untuk pembayaran sewa tempat. Pedagang yang mengatasnamakan dirinya, Persatuan Pedagang Pasat Tradisional (P3T) Simpanglimun sempat memacetkan lalu lintas selama kurang lebih satu jam. Syukurnya, aksi mereka beberapa waktu lalu berlangsung damai dan ratusan pedagang ini kemudian bergerak ke kantor Walikota dan DPRD Medan mengadukan nasibnya, mencari keadilan agar tetap bisa berusaha untuk mencari makan menghidupi keluarga anak-istri. Sayangnya, protes para pedagang itu tidak mampu diselesaikan Pemko Medan dan juga DPRD Medan, prosesnya berlarut-larut, sehingga muncul aksi jualan ikan di tengah badan jalan protokol kemarin. Terkait protes pedagang tradisional Simpanglimun atas PT Inatex kiranya Pemko Medan, terlebih Dinas Pasar dan Tata Ruang, juga wakil rakyat perlu mencari tahu keabsahan perusahaan itu. Dari masalah luas sebenarnya areal kapling hingga izin usaha dan peruntukannya. Juga dilihat sejarah berdirinya pasar tradisional sehingga masyarakat tidak dirugikan. Kasihan para pedagang tradisional di sana karena tidak tenang berjualan. Kehidupan keluarganya terancam, dapur bisa tidak berasap kalau terus-menerus digusur. Seharusnya Pemko dan DPRD Medan membela hak-hak para pedagang kecil dari tindak semena-mena pengusaha besar. Jangan sampai kepada pedagang dibebankan biaya sewa kelewat tinggi sehingga pedagang kecil Intisari di sana tidak bisa lagi berusaha dan akan diganti pedagang berduit. Hemat kita, keberadaan pedagang dan Lakukan musyawarah pasar tradisional secara umum semakin dan berpihaklah pada terjepit, sudah banyak yang berganti pasar modern yang hanya bisa dinikmati orangpedagang kecil di pasar orang berduit saja. Pada akhirnya pedagang tradisional dari pihak- lemah pindah di emperan toko atau jalan-jalan Sebagai pedagang kecil atau pepihak yang ingin membi- tertentu. dagang kaki lima mereka menjadi target nasakan hak hidup wong sasaran dinas penertiban. Kucing-kucingan pun terjadi. Padahal, kalau para pedagang kecil cilik di trotoar atau kaki lima diberdayakan, mereka bisa tumbuh dan berkembang, dan meningkatkan pendapatan asli daerah, seperti di sejumlah daerah (Yogyakarta dll). Justru itu, keberadaan pedagang kecil di pasar tradisional jangan sampai tergusur, dimatikan dengan berbagai trik jahat oknum pejabat dan pengusaha berduit lewat penggusuran maupun lewat renovasi pasar dan menaikkan sewa setinggi langit. Begitu juga pedagang kaki lima di jalan-jalan. Pemko lewat dinas terkait punya kewajiban membantu mereka yang kecil dengan bantuan dana maupun ketrampilan sehingga keberadaan mereka menjadi terorganisir, tidak memacetkan arus lalu lintas dan tidak membuang sampah sembarangan. Pemerintah pusat dan daerah jangan menganggap pedagang kecil dan kakilima sebagai musuh. Apalagi mereka berjuang untuk bertahan hidup. Bukan mengejar menjadi orang kaya. Andai saja lapangan kerja terbuka tentunya mereka lebih senang bekerja di kantor-kantor pemerintahan dan swasta maupun pabrik dan industri. Tapi, lapangan kerja yang sempit membuat mereka mencari alternatif bekerja di sektor non-formal dengan berjualan seadanya di tengah kota.Yang penting bisa menghasilkan uang untuk menyambung kehidupan, bayar kontrak, dan membayar uang sekolah anak. Tak pelak lagi, aksi demo pedagang tradisional Simpanglimun perlu ditanggapi positif dan segera. Jangan diundur-undur terus karena dikhawatirkan menciptakan ‘’bom waktu’’ yang dapat merusak iklim kondusif di Sumut. Lakukan musyawarah antara pedagang dengan pihak PT Inatex lewat mediasi DPRD Medan. Cari tahu akar permasalahannya dengan mengundang Dinas Tata Ruang dan Tata Bangunan (TRTB), Dinas Bina Marga, Dinas Perindustrian dan Perdagangan, Dinas Pertamanan, dan Satpol PP Kota Medan guna meneliti seluruh perizinan PT Inatex dan aturan sepihak yang dijalankannya hingga saat ini. Jangan sampai aksi murni para pedagang malah ditunggangi pihak ketiga (provokator) lewat pengerahan massa dalam jumlah besar dan akhirnya menimbulkan kerugian besar dan menjadi masalah baru, sementara masalah lama belum selesai. Yang pasti, kita mendukung perjuangan para pedagang kecil di pasar tradisional. Keberadaan mereka wajib mendapat perlindungan dan pembinaan dari pemerintah pusat dan daerah. Semua elemen bangsa harusnya berpihak pada wong cilik dengan cara melawan upaya oknum dan pengusaha besar yang ingin membinasakan pedagang tradisional yang kondisinya semakin memprihatinkan belakangan ini.+


Faks 061 4510025


+6282267150890 Ustadz Arifin Siregar adalah mujaddidnya Waspada,..ana dukung dgn ide2 beliau yg bagus dalam membuang semua bidah,syirik demi kemajuan umat islam. +6281362224356 Semopa pak dr.arifin sehat dan selalu memberikan tausiah .yg mau saya tanyakan sama bapak masalah pembagian waris dalam Islam. Saya menunggu tulisan bapak. +6287867350304 Kpd yth Bapak Bupati Deli Serdang, mohon dan tolong diperbaiki jalan Tj. Selamat dan Tj. Anom yg rusak parah disebabkan muatan dump truk milik alam jaya yg melebihi kapasitas dan supirnya yg ugal2an. Apa enggak bisa ditertibkan pak. +6283194126095 PESAN UTK UKTI. Wahai saudaraku, apa yg kau cari diluar? “jika rumah tidak menjanjikan ketenangan/kasih sayang, pendidikan bahkan penghasilan”. Ukti terpaksa keluar, menuntut ilmu, mencari nafkah atau ketenangan dll. Semua harus dicari sebagai ikhtiar dalam kehidupan. Tapi sadarkah kita, hidup tak lepas dari godaan? Bahwa manusia yg tdk bertanggung jawab hadir disekitar kita, yg mencuri, menganiaya, memprkosa bahkan membunuh. “Jaga lah diri baik2saudaraku, karena tak ada tempat utk minta pertolongan dg cepat kecuali pada Allah. Tutuplah aurat, jangan mengundang sahwat.Hindarkan tempat2 sepi jika ingn melakukan perjalanan, sebaiknya jgn jalan sendirian&hindari keluar ditengah malam. Hanya kita yg bisa menjaga diri&keluarga +6283197577808 Pada menjelang Tahun baru ini,semoga para koruptor pada tobat.... +6285370492466 Pak Mendikbud yth kok daerah Kab Mandailing Natal tidak dicaikan uang sertifikasi satu tahun. Kemanalagi kamimengadu pak MUHAMmad NUh APAKAh SUDAH DIDEPO SITO didaerah atau udah di korupsi daerah jadi. kami jam tugas 24 jam jungkir balik kerja, imbalan tidak cair tolong pak bantu GURU yg tanpa tandajasa ini.GURU SMP Negeri 1 Kecamatan Siabu. Jadi kami GURU DIMANDAiling NATAL MOHON uang sertifikasi dibayar langsung dari pusat biar jangan dipotong didaerah ,potongan pun Rp 150 ribu per GURU guru sgt keberatan didaerah, langsung aja di transfer dari pusat kedaerah trims pak dekdikbud. +6285371087167 Sebagai koran ummat, Waspada selayaknya tidak memuat karikatur si Gumarapus yang tampilannya terlalu vulgar (berpelukan) apalagi pada dua edisi hari Jum’at, Selamat menyambut hari ultah 11 Januari, moga jaya terus. Saya punya usul bagaimana kalau sms terbaik diberi hadiah ONH (walau tidak penuh, misalnya hanya biaya untuk dapat porsi keberangkatan) karena kalau terpilih tentu saya sangat gembira, sebab sebagai pembaca setia Waspada yang selalu memuat info haji, saya sangat ingin pergi haji ke Mekkah.

WASPADA Rabu 28 Desember 2011

SejarahTahun Baru Dan Produktivitas Oleh Dr Drs H.Ramli Lubis, MM Perayaan tahun baru yang telah mengakar ke sejarah dan membudaya di masa sekarang mesti bisa bermakna produktiv bagi negeri ini.


alam beberapa hari ke depan kita akan menjumpai tahun 2012.Biasanyadalammomen pergantian tahun masehi ini, perayaantahunbaruadalahsuatubudaya. Warga, khususnya kaum muda-mudi berduyun-duyun meramaikan jalanan dengan berkonvoi sambil menunggu datangnya waktu pergantian tahun. Ada juga yang menjadwalkan bertahun baru ke luar kota, tempat wisata dan lain sebagainya. Maka tidak heran pada momen seperti ini hotel-hotel penuh dan tempat wisata ramai di mana-mana. Dalam Islam adaTahun Baru Hijriyah yang baru saja berlangsung. Ada substansi berpindah dari suatu kondisi yang kurang baik kepada yang baik, dan dari kondisi yang baik kepada kondisi yang lebih baik. Berpindah menjadi lebih baik ada pesan dalam tahun baru hijriyah setiap tahun. Perayaan tahun baru bagi bangsa Persia merujuk pada Kalender Persia yang didasarkan dari musim dan pergerakan matahari. Tahun baru bangsa Persia ini disebutNorouzyangmerupakanperayaan (hari pertama) musim semi dan awal Kalender Persia. Orang Persia punya Kata ”norouz” berasal dari bahasa Avesta yang berarti “hari baru”. Oleh bangsa Persia, hari ini dirayakan pada tanggal 21 Maret jika memakai Kalender Gregorian. Sejak Kekaisaran Dinasti Arsacid/ Parthian, yang memerintah Iran pada 248 SM-224 M, Norouz dijadikan hari libur. Mereka merayakannya dengan mempersembahkan hadiah telur sebagai lambang produktivitas. Perayaan ini dilakukan oleh orang-orang yang terpengaruh Zoroastirianisme yang tersebar di Iran, Iraq, Afganistan, Kazakhstan, Kyrgyzstan, Uzbekistan, Kurdistan, Pakistan, Kashmir, beberapa tempat di India, Syria, Kurdi, Turki, Armenia, Caucasus, Crimea, Georgia, Azerbaijan, Macedonia, Bosnia, Kosovo, dan Albania. Perayaan tahun baru masehi yang kita kenal sekarang ini didasarkan kalender tradisional sebagai acuan penanggalan bagi bangsa Romawi sudah ada sejak abad ke-7 SM—meski mengalami

beberapa kali revisi. Sistem kalendar ini dibuat berdasarkan pengamatan terhadap munculnya bulan dan matahari, dan menempatkan bulan Martius (Maret) sebagai awal tahunnya. Pada tahun 45 SM Kaisar Julius Caesar mengganti kalender tradisional ini dengan Kalender Julian . Urutan bulan menjadi: 1) Januarius, 2) Februarius, 3) Martius, 4) Aprilis, 5) Maius, 6) Iunius, 7) Quintilis, Sextilis, 9) September, 10) October, 11) November, 12) December. Di tahun 44 SM, Julius Caesar mengubah nama bulan “Quintilis” dengan namanya, yaitu“Julius” (Juli). Sementara pengganti Julius Caesar, yaitu Kaisar Augustus, mengganti nama bulan“Sextilis” dengan nama bulan “Agustus”. Sehingga setelah Junius, masuk Julius, kemudian Agustus. Kalender Julian ini kemudian digunakan secara resmi di seluruh Eropa hingga tahun 1582 M ketika muncul Kalender Gregorian. Januarius (Januari) dipilih sebagai bulan pertama, karena diambil dari nama dewa Romawi “Janus” yaitu dewa bermuka du—satu muka menghadap ke depan dan yang satu lagi menghadap ke belakang. Dewa Janus adalah dewa penjaga gerbang Olympus. Sehingga diartikan sebagai gerbang menuju tahun yang baru. Alasan kedua adalah karena 1 Januari jatuh pada puncak musim dingin. Di saat itu biasanya pemilihan consul diadakan, karena semua aktivitas umumnya libur dan semua senat dapat berkumpul untuk memilih Konsul. Di bulan Februari konsul yang terpilih dapat diberkati dalam upacara menyambut musim semi yang artinya menyambut hal yang baru. Sejak saat itu Tahun Baru orang Romawi tidak lagi dirayakan pada 1 Maret, tapi pada 1 Januari. Tahun Baru 1 Januari pertama kali dirayakan tanggal 1 Januari 45 SM. Orang Romawi merayakan tahun baru dengan cara saling memberikan hadiah potongan dahan pohon yang dianggap suci. Belakangan, mereka saling memberikan kacang atau koin lapis emas dengan gambar Dewa Janus.

Mereka juga mempersembahkan hadiah kepada kaisar. Selain perayaan tahun baru yang kita kenal sekarang, dalam sejarah bangsabangsa ada beberapa perayaan tahun baru dengan berbagai macam ragamnya. Sebut saja Tahun Baru China, Tahun Baru Yahudi dan sebagainya. Masingmasing memiliki falsafahnya sendirisendiri. Ragam perayaan tahun baru Bangsa China; Bagi bangsa China, tahun barunya disebut dengan Imlek. Dinegerinya, mereka biasa merayakan tahun baru mereka pada malam bulan baru pada musim dingin (antara akhir Januari hingga awal Februari) atau jika memakai kalender Gregorian tahun baru ini terletak antara 21 Januari hingga 20 Februari. Dalam penanggalan Tionghoa dan berakhir dengan Cap Go Meh di tanggal ke-15 (pada saat bulan purnama). Malam Tahun Baru Imlek dikenal sebagai Chúx? yang berarti “malam pergantian tahun”. Banyak ragam adat istiadat dalam merayakan tahun baru bagi bangsa China ini. Namun secara umum berisi perjamuan makan malam pada malam tahun baru dan membakar kembang api. Selama perayaan tahun baru, lampion merah digantung yang melambangkan makna keberuntungan. Tahun Baru Imlek dirayakan oleh orang Tionghoa di Daratan Tiongkok, Korea, Mongolia, Nepal, Bhutan, Vietnam, Jepang (sebelum 1873), Hong Kong, Macau, Taiwan, Singapura, Indonesia, Malaysia, Filipina, Thailand dan tempat-tempat lain. Bangsa Yahudi; Bagi bangsa Yahudi, merayakan Tahun Baru mereka tidak pada hari ke-1 bulan ke-1 Kalender Ibrani (bulan Nisan), tetapi pada hari ke-1 bulan ke-7 Kalendar Ibrani (bulan Tishrei). Mereka menyebut perayaan tahun baru dengan nama Rosh Hashanah, yang berarti “kepala tahun”. Biasanya mereka merayakannya dengan berdoa di sinagog, mendengar bunyi shofar (tanduk). Menyediakan makanan pesta berupa roti challah yang bundar dan apel yang dicelupkan ke dalam madu, juga kepala ikan dan buah delima. Buah-buahan baru disajikan pada malam kedua. Dalam masa perayaan tahun baru orangYauhdi menghentikan semua aktifitas kerjanya.

MenurutperhitunganKalenderIbrani, tanggal 1 bulanTishrei tahun ke-1 AM adalah ekuivalen dengan hari Senin, tanggal 7Oktobertahun 3761BCEdalamKalender Julian (Kalender Romawi Kuno). Ketika PanglimaPompeydariKekaisaranRomawi Kuno menguasaiYerusalem pada tahun 63 SM, orang-orangYahudi mulai mengikuti Kalender Julian (Kalender Bangsa Romawi yang menjajahnya). Dan setelah Israel berdiri pada tahun 1948 M, mulai tahun 1950an M Kalender Ibrani menurun penggunaannya dalam kehidupan bangsa Yahudi sekuler. Mereka lebih menyukai Kalender Gregorian untuk kehidupan pribadi dan kehidupan publik mereka. Kaum sekuler; Bagi kaum sekuler, perayaan tahun baru mengikuti budaya Romawipadatanggal1Januari.Tahun1752 Inggris dan koloni-koloninya di Amerika Serikat ikut menggunakan sistem penanggalan kalender Gregorian. Di Inggris, Untuk merayakan Tahun Baru para suami memberi uang kepada para istri mereka untuk membeli bros sederhana (pin). Banyak orang-orang koloni di New England, Amerika, merayakan tahun baru dengan menembakkan senapan ke udara dan teriak, sementara yang lain mengikuti pesta terbuka. Di Amerika serikat, Tahun Baru dijadikansebagaihariliburumumnasional untuk semua warga Amerika. Pada saat lonceng tengah malam berbunyi, sirene dibunyikan, kembang api diledakkan, orang-orangmeneriakkan“SelamatTahun Baru” dan menyanyikan Auld Lang Syne.. Produktivitas Adalah menjadi fenomena di abad modern akan momen tahun baru yang identik dengan pesta kembang api dan berlarut malam menunggu waktu pergantian tahun. Sebagai sebuah dinamika budaya, tentu ini tetap saja menimbulkan pro dan kontra. Tetapi perayaan tahun baru yang telah mengakar ke sejarah dan membudaya di masa sekarang mesti bisa bermakna produktivitas bagi negeri ini. Bangsa Indonesia sudah mesti bisa mengambil manfaat dari fenomena perayaan tahun baru ini. Momen ini harus menjadi waktu untuk mengevaluasi dan mengukur capaian dan kekurangan yang telah terjadi untuk menjadi menyusun rencanarencana produktif ke depan. Penulis adalah Mantan Wakil Wali Kota Medan.

Mitos Mayoritas Angka Muslim Oleh Nirwansyah Putra Panjaitan Hancurnya Masjid Al-Ikhlas di Jalan Timor Medan, merupakan contoh utama yang memperlihatkan analisis atas dasar sosial politik an sich tak berguna bila kekuatan ekonomi yang terus bergulat di kota Medan,dinisbikan.


untowijoyo boleh jadi sudah almarhumlebihenamtahunlalu. Namun, lebih dari 20 tahun lalu, di saat Soeharto sedang kuat-kuatnya, dia sudah menulis dengan goresan “pedih” soal kondisi umat Islam dalam bukunya “Paradigma Islam;Interpretasi untuk Aksi” (1991). Dia menyebut, walaupun politik Islam terus bertahan, tetapi nyatanya tidak pernah sukses; di masa lalu hal itu selalu saja bertemu dengan kekecewaan demi kekecewaan. “Ketika mengantar buku Herbeth Feith mengenai Pemilu 1955, H.J. Benda bahkan mencatat kesimpulan terpenting buku itu, bahwa Islam ternyata tak sebegitu kuat; dan bahwa kekuatan politik non-Islam ternyata berhasil memorakporandakan ‘mitos mayoritas angka’,” tulisnya. Hasil Pemilu 1955 menjadikan Partai Nasional Indonesia (PNI) sebagai pemenang, 57 kursi DPR dan 119 kursi Konstituante (22,3%). Masyumi 57 kursi DPR dan 112 kursi Konstituante (20,9%), NU 45 kursi DPR dan 91 kursi Konstituante (18,4%), PKI 39 kursi DPR dan 80 kursi Konstituante (16,4%), dan Partai Syarikat Islam Indonesia (2,89%). Dari 5 partai ini, maka partai yang berbasis Islam, Masyumi-NU-PSII, totalnya hanya 42,19%. Kalimat Kuntowijoyo selanjutnya makin “pedas”. Salah satu yang jawaban yang mungkin atas hal itu, menurut Kuntowijoyo, adalah “bahwa Indonesia, atau dalam hal ini Jawa, bukanlah masyarakat Muslim yang sebenarnya.” Kuntowijoyo bermaksud SARA? Tidak. Anda pasti ditertawakan kalau mengatakan itu pada sejarahwan Indonesia dan cendekiawan Muslim yang disegani itu. Dalam bukunya itu, Kuntowijoyo mencari jawab dari salah satu bidang ilmu yang menjadi spesialisasinya, sejarah. Kuntowijoyo menulis, “Saya ingin melacak sejarah alienasi dan oposisi umat, khususnya dalam sejarah Jawa, dengan harapan hal itu akan menjelaskan bagaimana umat telah melewati masa-masa yang sulit dan bagaimana mereka menanggulangi kondisi-kondisi politik dalam setiap periode.” Dia misalnya meminjam pendapat W.F.Wertheim soal ini seperti dituangkan Wertheim dalam bukunya Indonesian Society in Transition (1959). Dikatakan, gagasan persamaan dalam Islam merupakan daya pikat utama agama ini, karena konsep stratifikasi sosial Hindu tidak menarik buat pedagang dan pengrajin kecil yang sedang tumbuh di kota-kota pesisir. Islam melengkapi mereka dengan ideologi untuk melawan kelas atas Hindu. Didirikannya Demak sebagai kerajaan Islam pertama di Jawa pada akhir abad ke-15 merupakan kemenangan

kelas saudagar dan kemenangan jenis kerajaan maritim atas aristokrasi dan negara agraris Majapahit. Namun, kegiatan perdagangan saudagar Islam yang sedang muncul ini dihentikan oleh bangsa Portugis yang datang ke perairan Asia Tenggara. Demak melawan tapi gagal. Runtuhnya perdagangan internasional terbukti fatal untuk negara Islam yang baru saja didirikan itu, karena dalam waktu kurang dari seabad, muncul pulasebuahnegaraagraris,Mataram,yang akanmemerintahseluruhJawa.Dituliskan Kuntowijoyo, pada masa Mataram inilah muncul perpecahan antara agama dan politik, atau Islam dan negara. Pertarungan di ibukota Baiklah, mari kita longok Kota Medan sebagai ibukota provinsi Sumatera Utara. Kota ini merupakan satu rangkaian dari kota-kota di kawasan pesisir Timur. Bila kita merujuk pada Pilgubsu 2008 lalu, maka kemenangan Syamsul Arifin-Gatot Pudjo Nugroho, lebih banyak ditentukan oleh suara merekadipesisirTimur daripada kawasan Pantai Barat. Kombinasi Melayu-Jawa pada pasangan ini begitu kukuh memikat kawasan Pantai Timur yang mayoritas dihuni penduduk Muslim-Melayu/Jawa. Belumadapenelitianyangpasti apakah Muslim di kawasan ini termasuk kategori abangan atau santri. Pasangan ini kemudian menang di Kota Medan (40,39%), Binjai (38,58%), Langkat (66,28%), Sergei 30,88 (%), Tebing Tinggi (39,43%), Deliserdang (37,77%), Batubara (45,59%), Tanjung Balai (39,08%), dan Asahan (30,65%). Kota Medan yang merupakan sumbu utama kawasan ini menjadi barometer yang memainkan pengaruhnya dalam etalase sosial politik ekonomi kawasan Timur. Sebagai ibukota provinsi, kota ini pun menjadi lahan perebutan dominasi pengaruh kekuasaan, baik dari segi suku bangsa dan agama. Dua hal besar yang diperebutkan itu adalah kekuasaan politik, ekonomi dan budaya. Apa yang dilakukan oleh penguasa di kawasan ini memperlihatkan itu. Mantan Walikota Medan, Bahctiar Dja’far, pernah dengan sangat masif membangun kantor pemerintahan di seluruh kecamatan, kelurahan dan administrasi publik dalam ornamen Melayu. Alhasil, Kota Medan “menguning”, seperti warna dasar yang menjadikarakterdarisukubangsaMelayu. Melayu makin kuat ketika mantan Pangdam I Bukit Barisan, Mayjend. TNI H.T.

Rizal Nurdin (almarhum) duduk sebagai gubernur menggantikan Raja Inal Siregar. Suku bangsa Batak Toba tidak mau kalah. Patung Sisingamangaraja yang berdiri gagah di kawasan jalan SisingamarajaMedan,sebagaijalanutamadiKota Medan, adalah simbol untuk itu. Naiknya Rudolf M Pardede menggantikan HT Rizal Nurdin yang wafat dalam peristiwa kecelakaan pesawat Mandala nan tragis di Bandara Polonia, memperkukuh kembali posisi BatakToba di percaturan sosial politik Sumut.Terlepas dari pro dan kontra terhadapsosokini,asalmuasalRudolfyang seorang Batak Toba mempunyai posisi tersendiri. Dan kini, di sumbu kekuasaan di ibukota Provinsi, sosok Rahudman Harahap (seorangyangberasaldariTapanuliSelatan) sebagaiWalikota Medan dan Gatot Pudjo Nugroho yang seorang Jawa, membuat etalase sosial politik makin menarik. Patut digarisbawahi, posisi agama kedua penguasa ibukota itu adalah pemeluk Islam. Gatotsendiriberasaldaripartaiyangberbasis Islam yaitu Partai Keadilan Sejahtera. Namun rupanya, posisi agama ini rupanya tak signifikan ketika masyarakat melihat kontribusi keduanya dalam membela dan melindungi kepentingan umat Islam. Kasus hancurnya Masjid Al-Ikhlas di JalanTimor Medan, merupakan contoh utama yang memperlihatkan analisis atas dasar sosial politik an sich tak berguna bila kekuatan ekonomi yang terus bergulatdikotaMedan,dinisbikan. Seperti diketahui, posisi suku bangsa Tionghoa yang amatkuatdisektorperekonomian, ternyata berpengaruh luar biasa dalam memainkan kebijakan sosial politik ekonomi, plus kebudayaan. DitengahmegahnyatapakbangunankuilagamaBudhadanKelenteng yang notobene menjadi simbol agama dan budaya sebagian besar warga Tionghoa di Kota Medan, ternyata di sisi yang lainnya, rumah ibadah seperti masjid kondisinya berbanding terbalik. Masifnya pembangunan kawasan ekonomi yang dimiliki dan didesain serius oleh kelompok pemodal kuat–sayang memang, hingga kini tak pernah disebutkan dari mana asal investor yang bersangkutan dan akan membawa dampak sebesar apa bagi kesejahteraan umum di Kota Medan maupun Sumatera Utara secara keseluruhan–ternyata tak hanya membuat rumah ibadah umat Islam menjadi korban. Kawasan pemukiman warga yang berada di pinggir kota juga terkena getahnya. Pembelian aset dan properti besar-besaran suku bangsa Tionghoa di kawasan yang semula didominasi oleh suatu suku bangsa tertentu, begitu kentara. Bila dulu, wajah “pecinan” hanya tampak pada kawasan Mega Mas-Wahidin-Asia-Brayan, maka kini, telah menyeberang ke kawasan yang lebih pinggir seperti Medan Barat, Perjuangan, Tembung, Denai, Amplas, Patumbak, Selayang, Tuntungan dan Polonia. Alhasil,

warga asal yang semula dominan di kawasan Kota Medan, kini telah berpindah ke kawasan perbatasan dan di Kabupaten Deliserdang. Dus, jalinan pertarungan antara kekuasaan sosial budaya, kekuasaan politik dan kekuasaan ekonomi, di Kota Medan, begitu kuat auranya. Mitos dan alienasi Dalam hal politik Islam, maka fenomena ini bisa dikategorikan dalam kotak periferalisasi (peminggiran) dan alienasi (pengasingan) umat Islam dari pergulatan di ibukota provinsi. Jumlah mayoritas secara kuantitatif, tampak hanya sekedar “mitos statistik” bila dihadapkan dengan faktor penting seperti kekuatan, jalur dan jaringan ekonomi di sisi yang lainnya. Adalah hal wajar bila rentetan kekecewaan politik Islam, masih akan terus berlanjut dan akan semakin muram. Islam yang semula diminati karena asas keadilan dan persamaan tanpa memperlihatkan struktur kelas masyarakat, kini sedang terombang-ambing dalam struktur kelas baru stok lama: borjuis-proletar. Peminggiran dan keterasingan Islam dari umatnya sendiri, begitu kasat mata dalam kasus robohnya Masjid Al-Ikhlas JalanTimor itu; bagaimana mungkin masjid bisa hancur di tengah komposisi penduduk yang mayoritas Islam? Penulis adalah Dosen FISIP UMSU, Sekretaris Litbang PW Muhammadiyah Sumut.

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di Media manapun.Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * DKI, Kaltim dan Sumut banyak korupsi - Makanya kalau mau kaya ke Sumut, he...he...he * 2012 ekonomi Indonesia dipresiksi aman - Walaupun banyak kasus lahan * Kolusi pengusaha-penguasa korbankan masyarakat - Begitulah kalau banyak kepentingan


D Wak


WASPADA Rabu 28 Desember 2011


Merdeka Untuk Sumut? PSSI Pantang Mundur BOPI sebagai lembaga olahraga profesional telah menyurati Menhumham, Menakertrans dan Dirjen Imigrasi yang intinya warga negara asing yang bermain sepakbola profesional di Indonesia harus mendapat izin dari PSSI melalui LPIS, bila tidak berarti melanggar UndangUndang, ya urusannya aparat hukum. Kemudian menjadi polemik selama ini agar masyarakat tahu tentang statuta PSSI Pasal 23 yakni peserta kongres antara lain 18 peserta club-club Super Liga untuk Kongres Luar Biasa PSSI 9 Juli di Solo. Jadi bukan jumlah kompetisi sekali lagi bukan peserta atau jumlah kompetisi yang selama ini menjadi polemik.Karena itu PSSI merupakan organisasi jalan terus cari pemain timnas dari devisi 1 utama, devisi utama, devisi 1 dan 2 amatir serta Liga Pelajar Indonesia (LPI). Di sini banyak pemain potensial yang bisa masuk Timnas. Kemudian lucu suatu forum bisa mengajukan kongres, di dunia ini yang namanya forum hanya tukar informasi,ngomong-ngomong dan cakap-cakap,tapi tidak bisa mengambil kebijakan. Sebab forum bukan badan organisasi PSSI.Yang ini nggak usah dibahas sebab membuang energi dan tenaga, lebih baik fokus membenahi persepakbolaan tanah air agar berprestasi. Cocok kata UdinMulyonoKetuaHarianBontangFC(MetroTV,17/12/11)bahwaprovokatorPSSImengundurkan diri dari persepakbolaan Indonesia. Jangan fitnah kepada orang lain sebab fitnah lebih kejam daripada pembunuhan, jangan adadustadiantarakitasebabdustaakanmenghancurkandirikitasendiri.Lebihbaikkitamembenahi PSSI agar maju. Biarkanlah pengurus PSSI ini menjalankan programnya 4 tahun ke depan. Bila kita tidak setuju siap mengundurkan diri dari pengurus PSSI.Yang kongres 4 tahun yang akan datang ikut bertarung lagi merebut PSSI, berjiwa besar dan satria. Jangan merusui PSSI hasil KLB di Solo sebab yang rugi masyarakat sepakbola tanah air. Membangun persepakbolaan Indonesia dengan etika, moralitas, kejujuran dan legilitas sesuai dengan Undang-Undang dan statuta PSSI dan FIFA AFC. Karena itu bila BOPI telah memberikan sinyal kepada aparat hukum dan instansi terkait harus dijalankan seperti warga negara asing yang bermain sepakbola di Indonesia tidak terdaftar di dalam LPIS (PSSI) wajib dideportasi dari tanah air ini.Indonesia negara hukum,hukum adalah panglima dan kompetisi yang ilegal harus dihentikan oleh pemerintah Indonesia.Ini sesuai dengan perintah FIFA“merujuk Pasal 18 statuta FIFA PSSI harus mengontrol semua kompetisi dan mengambil tindakan terhadap kompetisi ilegal seperti ISL sebab yang diakui FIFA adalah kompetisi yang digulirkan PSSI yakni IPL” (Waspada 22-12-11 hal.A11). Komisi disiplin menjatuhkan hukuman yang ikut ISL dan Komite Etik PSSI menjatuhkan vonis terhadap 4 anggota exco divonis harus meminta maaf kepada PSSI, AFC dan FIFA dalam waktu 2 x 24 jam sejak 20-12-11.Tindakan yang dilakukan oleh badan-badan PSSI bukan kehendak PSSI tetapi perintah FIFA merujuk pasal 18 statuta FIFA. Sedangkan kompetisi ISL melalui PT.Indonesia menurut FIFA sebagai kompetisi ilegal,dalam surat FIFA kepada PSSI.Yang menjadi korban FIFA seharusnya FIFA yang digugat melalui Kongres Luarbiasa FIFA atau tidak mengakui FIFA sebagai badan persepakbolaan dunia. Jangan PSSI yang dirusuhi, sebab PSSI menjalankan perintah FIFA. Yang dibutuhkan dalam membangun persepakbolaan Indonesia yakni tegas, disiplin dan taat aturan sesuai dengan aturan FIFA. Karena itu jangan takut kepada provokator, lebih baik dimulai dari sekarang menegakkan disiplin sehingga nantinya akan melahirkan pemain-pemain timnas yang dibanggakan di Asia. Persepakbolaan merupakan salah satu perekat bangsa, di dadaku ada Garuda. Oleh karena itu PSSI menjalankan surat perintah FIFA tanggal 22 jam 23.00 yang ditujukan kepada PSSI ada 6 butir antara lain :mencabut Transfer Matching System (TMS) baik pemain lokal dan pemain negara lain yang ikut ISL bila tidak mematuhi surat FIFA tersebut. Oleh karena itu yang tidak sesuai dengan surat FIFA membubarkan diri atau bergabung dengan PSSI melalui IPL. PSSI hanya menjalankan statuta FIFA Pasal 18 butir 1 dan Pasal 16 butir 1.Semua pihak mengamankan surat FIFA dalam rangka menyelamatkan persepakbolaan Indonesia. (F.Nasti, pecinta sepakbola Indonesia).

Soal Tanah Eks PTPN Assalamu’alaikum.Wr.Wb. KepadaYth. Bapak Presiden SBY, Bapak Gubsu & para anggota DPR-RI serta pejabat terkait, dipinggiran kota Medan, 1.Sangat banyak tanah eks Perkebunan Negara (PTPN) yang sdh lama terlantar yang seakanakan tak jelas kepemilikannya, krn tanpa plank & pagar, 2.Jangan biarkan semua tanah eks perkebunan di Sumut mengambang kepemilikannya, apakah masih milik Negara atau memang mau dijual kepada warga negara Indonesia. 3.Pemerintah harus pastikan & tegas atas tanah eks perkebunan ini, karena sudah terlalu banyak keributan antar warga/kelompok penggarap pada tanah eks perkebunan ini & modus menggarapnya mirip seperti dizaman PKI. 4.Sudah banyak warga membangun rumah permanen dilahan eks perkebunan di Pasar 3 Jln. Datuk Kabu Tembung & Jl. Selambo Medan Amplas, dll. 5.Bapak Gubsu/DPR-RI/DPRD Tk.I SUMUT “JANGAN” abaikan kondisi seperti ini, pastikan segera tanah eks Perkebunan milik negara. 6.Janganterusdibiarkandigarapwargaseenaknyahalinidapatmerugikansertamembahayakan keamanan negara & Pemprovsu khususnya, 7.Menjadi “BOM WAKTU” bagi negara dan bila ada kekeliruan sedikit saja, bisa meledak dan dapat meluluh-lantahkan persatuan & kesatuan di Sumut. Wassalam. Ir.Zulkifli AM. +628566238659

Prof. Dr. Syahrin Harahap, MA

Tahun Baru Dan Produkt ifitas “Kehidupan terbaik adalah bila seseorang berumur panjang dan banyak karyanya. Sementara kehidupan terburuk adalah manakala seseorang berumur panjang tetapi sedikit karyanya. (al-Hadis).” Kalau filsafat ar-Razi tentang‘waktu mutlak’ (al-waqt al-muthlaq = al-dhr) dijadikan dasar dalam melihat makna waktu maka boleh jadi akan menjadi absurd makna khusus dari suatu pergantian tahun. Sebab menurut filsafat ini waktu mutlak berjalan terus tanpa adanya penggalan dalam bentuk bulan, tahun, dan abad. (Al-Razy: Rasâil al-Falsafiyah). Akan tetapi penggalan waktu sebagaimana juga pergantian tahun telah dijadikan manusia sebagai batas untuk mengevaluasi apa saja yang sudah dilakukannya di masa lalu dan merupakanstarting point dalam melakukan pekerjaan-pekerjaan baru yang lebih bermakna. Seiring dengan itu Rasulullah Saw., kemudian memberi sample terhadap pentingnya pergantian tahun tersebut dalam kalimat wisdom yang sangat menarik: “Siapa saja yang hidupnya hari ini lebih baik dari kemarin sungguh ia akan beruntung, dan siapa saja yang hidupnya hari ini sama saja dengan kemarin sungguh ia akan merugi, dan siapa saja yang keadaannya hari ini lebih buruk dari kemarin sungguh ia akan celaka.” (al-Hadis). Petunjuk dan wisdom di atas menjadi semakin krusial bagi kita untuk memaknai kegairahan masayarakat di berbagai tempat dalam menyambut tahun baru yang demikian beragam. Bahkan kelompok dan pemerintah tertentu ada yang menggunakan dana yang cukup besar bagi upacara dan acara pergantian tahun tersebut. Akantetapisampaidisinikitaperluberhentisejenakuntukmengritikdirisendiri.Sebabpenyambutan tahun baru di berbagai bagian dunia telah dihiasi dengan kegiatan pesta pora kembang api, nyanyian yang glamour dan seringkali tidak menyinggung makna waktu dan efektifitasnya. Jika bukannya ada yang mengisinya dengan mabuk, berjudi, dan pelanggaran nilai-nilai moral lain yang dapat menggannggu keharmonisan masyarakat. Pergeseran nilai tahun baru dari evaluasi kerja serta starting point untuk masa berikutnya perlu dianalisis dua hal. Pertama, tradisi penyambutan tahun baru terlanjur dianggap sebagai tradisi kelompok atau bagian dunia tertentu bukan urusan semua umat manusia. Kedua, penyambutan tahun baru telah menjadi sebuah pesta pora akibat menangnya pengaruh pragmatisme dari idealisme dalam mempengaruhi kehiduapn masyarakat di berbagai bagian dunia. Bahkan saat menyambut tahun baru enerasi muda sering kehilangan arah dan karakternya dengan menggunakan cara dan tradisi bukan bangsanya sendiri dalam merayakannya. Keadaan ini mengingatkan kita kepada hukum baja sejarah dalam hal pinjam meminjam budaya dari HAR Gibb, ahli budaya dan modernitas. Menurutnya: “Apabila suatu masyarakat sudah lebih banyak menggunakan budaya lain yang dipinjamnya daripada budayanya sendiri maka sesungguhnya masyarakat itu sudah tidak memiliki budaya lagi”. Berkenaan dngan itu, maka paling tidak ada tiga hal yang dapat dianalisis sehubungan dengan tradisi penyambutan tahun baru. Pertama, tradisi menyambut tahun baru perlu diinternalisasi sebagaikeperluanuniversalumatmanusia.Sebabpergantiantahundapatdimaknaisebagaimomentum mengevaluasi apa yang telah dilakukan dan merupakan starting point untuk merencanakan kegiatan dan karya yang lebih penting dimasa yang akan datang. Al-Qur’anul karim sendiri mengingatkan manusia bahwa “apabila kamu telah selesai melakukan suatu pekerjaan maka kerjakanlah dengan sungguh-sungguh dan lebih baik pekerjaan yang lain”. Kedua, tradisi penyambutan tahun baru diberbagi kalangan masyarakat perlu dijaga agar tetap menjadi momentum evaluasi dan starting point untuk memperbaharui tekad setiap orang atau kelompok untuk lebih baik di masa datang, tidak sebaliknya menjadi ajang pesta pora yang melacurkan karakter sendiri dan melakoni karakter bangsa lain yang belum tentu benar. Ketiga, kita tidak bisa hanya mengritik dan meratapi pergeseran nilai yang sangat dahsyat ini, melainkan menggunakan akal cerdas kita mencari alternatif cara lain penyambutan tahun baru yang lebih mengedepankan karakter dan nilai-nilai moral bangsa serta membangkitkan semangat untuk meningkatkan produktifitas dan kreatifitas anak-analk bangsa di masa depan. Sebab Allah telah bersumpah dengan krusial makna waktu bahwa setiap orang akan berada dalam kerugian kecuali mereka yang tetap menegakkan nilai-nilai keimanan dan kebenaran serta tetap sabar dan konsistren dalam jalan hidupnya. Wa Allâhu A’lamu bi al-Shawâb.

Oleh Warjio Selama setelah Orde Baru, hampir sama sekali tidak ada pembangunan berarti. Hampir tidak ada perhatian serius dari pemerintah pusat terhadap pembangunan di Sumut.


inggu lalu, tepatnya 17 Desember 2011, saya diminta sebagai moderator dalam satu acara Dialog Publik dengan tema: Konteks Ke Indonesiaan: Kenihilan Pembangunan Sumut (Sumatera utara). Acara yang dilaksanakan Panitia Pelantikan Ikatan Alumni Program Pascasarjana Universitas Medan Area (UMA). Bagi saya, dialog ini menarik karena beberapa alasan. Pertama, saya kira inilah baru pertama kalinya, sebuah diskusi publik yang secara kritis membahas kenihilan pembangunan di Sumut. Benar, memang banyak diskusi yang dibuat mengenai pembangunan di Sumatera Utara, tetapi yang benarbenar menilai kenihilan itu, saya belum menjumpainya. Panitia, acara ini jelas sangat berani. Kedua, narasumber yang dihadirkan dalam dialog ini, saya nilai memang sangat kompeten untuk memberikan analisis dan penilaian mengenai kenihilan pembangunan di Sumut. Mereka terdiri dari Dr. RE. Nainggolan, mantan Sekda Pemprovsu, seorang yang banyak pengalaman dalam bidang administrasi dan pemerintahan Sumut. Kemudian, Fadli Nurzal, SAg, anggota legislatif DPRD Sumut dan Ketua PPP Sumut. Fadli Nurzal , SAg adalah seorang legislator muda yang memiliki banyak pengalaman dan dianggap memiliki pengetahuan untuk menjelaskan peranan DPRD Sumut dalam persoalan pembangunan di Sumut. Ketiga, seorang analis dan pengamat ekonomi dari USU yang analisisnya banyak dijadikan rujukan dalam menilai ekonomi dan pembangunan di Sumut, Drs. Jhon Tafbu Ritonga, M.Ec. Keempat adalah, Prof. Dr. Zulkarnaen Lubis, MS, mantan Rektor UMA dan praktisi pendidikan. Barangkali, karena alasan narasumber yang berkompeten ini, saya diminta “ sebagai penengah” dan memberikan persfektif ekonomi politik dalam menilai kenihilan pembangunan di Sumut. Alasan ketiga, umumnya para peserta dialog adalah alumni Pascasarjana UMA yang banyak di antara mereka adalah para birokrat pemerintahan, swasta, elit maupun pimpinan partai politik, akademisi dan praktisi. Dengan anatomi peserta seperti itu, jelas penilaian mengenai kenihilan pembangunan Sumut bukan hanya akan diperdebatkan tetapi juga dapat dianalisis dari berbagai persefektif. Kenihilan Pembangunan Sumut Banyak sarjana yang berpendapat pembangunan sebagai sebuah dasar publik harus dilihat sebagai proses politik (Jonathan R. Pincus & Jeffrey A. Winter, 2004, Syamsul Hadi, 2005, Budi Winarno, 2003, Kumorotomo, 2008, B.S.Muljana, 1995). Kenyataan yang seperti itu, membahas pembangunan kita dihadapkan pada pertanyaan, siapa yang mendapat keuntungan dari proses pembangunan tersebut? Apa yang mereka dapatkan? Bagaimana mereka mendapatkan? Dalam konteks pembangunan Indonesia, pembangunan lebih diarahkan kepada pertumbuhan ekonomi (eco-

nomi growth), perawatan masyarakat (comunity care) dan pengembangan manusia (human development) (Edi Suharto, 2005). Kenyataan inilah yang menjadi titik kunci dalam dialog publik mengenai kenihilan pembangunan Sumut. Setidaknya, dari narasumber dalam dialog publik ini ada aliran pandangan yang dapat disimpulkan. Pertama, selama setelah Orde Baru, Sumut hampir sama sekali tidak ada pembangunan yang berarti. Penilai dan pendukung aliran ini adalah Dr. RE. Nainggolan, Drs. John Tafbu Rintonga, M. Ec. dan Fadli Nurzal, S.Ag. Menurut, Dr. RE Nainggolan, selama dia menjabat baik sebagai bupati ataupun ketika sebagai Sekda Pemprovsu, hampir tidak ada perhatian yang serius dari pemerintah pusat terhadap pembangunan di Sumut. Proyek-proyek besar infrastruktur yang selama ini diharapkan dan dirindukan oleh masyarakat Sumut, ”hanya menjadi barang mainan” pusat. Sebagai contoh misalnya, jalan Medan-Parapat sekarang ini adalah warisan zaman Belanda dulu dan tidak pernah ada perbaikan yang signifikan dari pemerintah pusat. Proyek Kuala Namu sekarang ini pun ”masih terlunta-lunta” karena kurang seriusnya pemerintah pusat. Sebagaimana diketahui, pelepasan lahan HGU dan eks HGU untuk akses jalan menuju bandara terkendala karena lambat terbitnya persetujuan dari pihak Kementerian BUMN. Sementara pembebasan lahan untuk jalan layang di Jl Djamin Ginting baru terealisasi untuk 60 kepala keluarga (KK) dari total 110 KK yang lahannya terkena proyek. Jika pun proyek ini berjalan, ini karena ada”tekanan” dari media dan masyarakat Sumut. Padahal, Sumut adalah provinsi yang memberikan pemasukan yang besar kepada pusat. Pemerintah pusat terkesan melakukan diskriminasi, atau menganaktirikan pembangunan di Sumut, dibandingkan dengan pembangunan di Jawa dan Kalimantan. Sekedar mengambil contoh perbandingan untuk anggaran jalan pada 2009, DKI Jakarta menyiapkan dana sebesar Rp1, 1 72 triliun untuk panjang jalan 142 km, sedangkan Sumut hanya 708 miliar untuk untuk 2. 249 km. Apa yang disampaikan Dr. RE Nainggolan menjadi perhatian kita. Sebab, jalanjalan di Sumut, sudah kalah jauh dengan jalan-jalan di provinsi Aceh, Pekan Baru ataupun Padang. Guyonan bagaimana mengetahui wilayah Sumut berbatasan dengan Aceh adalah dengan jalannya yang berlubang bukanlah sekedar guyonan tetapi adalah kenyataan. Di samping itu, persoalan lain yang menjadi ciri Sumut adalah persoalan pendidikannya. Sebagaimana disampaikan oleh Prof. Dr. Zulkarnaen Lubis, MS, keadaan ini diperburuk dengan persoalan pendidikan, dimana perhatianpPusat terhadap pendidikan Sumut kurang. menurtnya, pendidikan sebagai pilar pembangunan di Indonesia, seharusnya menjadi perhatian. Adalah wajar, jika Index SDM manusia Sumut rendah. hal ini dise-

babkan karena pendidikan dan fasilitas pendidikan yang tidak memadai. Sedangkan menurut Drs. Jhon Tafbu Ritonga, M. Ec. sesungguhnya ekonomi Sumut bisa bergerak tanpa perhatian dari pusat adalah karena kemampuan masyarakat Sumut khususnya mereka yang bergerak UMKM. Merekalah sesungguhnya yang jadi penampung bagi jalannya roda ekonomi Sumut. Ini mengindikasikan bahwa secara ekonomi pusat tidak memiliki peranan yang besar dalam membentuk ekonomi Sumut. Kebijakan strategis untuk Sumut seperti perlu adanya pabrik ban pesawat, masih didominasi kepentingan pusat. Padahal, Sumut adalah daerah penghasil karet yang besar. Atas alasan ini, Drs. John Tafbu menekankan sudah saatnya rakyat Sumut harus ”berani menggebrak pusat” dan meminta pertangungjawaban pusat dari apa yang telah Sumut berikan kepada pusat. Sebab, jika pusat tidak memberikan perhatiannya kepada Sumut, gelombang keinginan merdeka bisa terjadi. Kenyataan ini juga menjadi alasan bagi Fadli Nurzal, SAg untuk menyatakan sikapnya, bahwa pendekatan ”nurut pusat” harus diubah. Mewacanakan konflik di Sumut sebagai bagian dari cara menekan pusat adalah cara yang harus dilakukan. Ini bisa dilakukan dengan cara melakukan demonstrasi dengan menggalang tokoh-tokoh Sumut baik yang ada di daerah maupun yang ada di Jakarta. Sebab, model pendekatan dialog dan silaturahmi yang selama ini dilakukan oleh elit dari Sumut baik yang ada di Jakarta maupun yang ada di daerah sebagai bagian dari bergaining position dengan Pusat di jakarta tidak memberikan hasil yang nyata. Hilang di telan angin. Pusat masih memandang sebelah mata. Menurutnya, cara seperti itu manjur, sebab pengalaman dari Aceh, Papua, Sulawesi yang selalu ”ada konfliknya” mengakibatkan pusat lebih memperhatikan mereka. Masyarakat Sumut yang selalu diam dan tidak berkonflik, kurang diperhatikan oleh Pusat. Oleh karenanya, jangan sampai rakyat Sumut meminta untuk merdeka dari Pusat.

Merdeka untuk Sumut? Saya kira, apa yang disampaikan baik oleh RE Naingggolan, John Tafbu Ritonga, Zulkarnaen Lubis, dan Fadli Nurzal, menjadi catatan kritis dan satu keberaniaan untuk menilai secara jujur kondisi sebenar pembangunan di Sumut. Selama ini, pembangunan di Sumut menjadi ”alat legitimasi pusat” untuk tidak memberikan perhatiannya kepada Sumut dalam soal dukungan mereka terhadap pembangunan. Hal ini disebabkan oleh beberapa hal. Pertama, mewacanakan harmonisasi di Sumut menjadi idiom dan ciri seakan menjadi alasan Pusat untuk tidak memberikan perhatiannya. Orang Sumut dianggap” baik-baik” dan tidak akan berbuat seperti di Aceh, Sulawesi ataupun Papua. Kalau pun misalnya diberikan”kue kecil” pembangunan, Sumut tidak akan menuntut. Akan diam dan berterimakasih. Kedua, di satu sisi juga keadaan ini menjadi bagian strategi kampanye politik tentang keberhasilankepaladaerahdalam membangun masyarakatSumut.Adasatu kebanggaan kepala daerah, jika di daerahnya aman. Tetapi, bukan menjadi satu persoalan bagi mereka jika jalan hancur, infrastruktur berantakan. jalan kota macat, dan sebagainya. Para kepala daerah akan berlomba mengiklankan keberhasilan ini. Ketiga, persoalan korupsi yang menjeratkepaladaerahmaupunwakilnyaserta para elit birokrasinya melemahkan bergaining position dengan pusat. Dalam posisi ini,merekajaditersanderadantidakberani ”menekan pusat” atau pun meminta banyak dari pusat. Sebab mereka akan mencari perlindungan dari pusat. Jadi persoalannya, politik sandera menjadi salah satupenyebabmengapapusattidakmemberikan perhatiannya kepada Sumut. Tentu, kekawatiran merdeka untuk Sumut? harus disikapi oleh pusat dengan memberikan perhatian secara serius kepada Sumut. Saya kira, di luar persoalan yang mendera ataupun yang menjadi sandera politik, pusat harus memberikan perhatiannya kepada Sumut. Penulis adalahDosen Ilmu Politik FISIP USU; Mengajar Politik Lokal Dan Ekonomi Politik Di Magister Studi Pembangunan (MSP) USU.

Suplemen Makanan: Untuk Siapa? Oleh Albiner Siagian ...suplemen makanan haruslah dijadikan pelengkap, tetapi, faktanya, banyak orang yang menjadikan suplemen makanan sebagai pengganti makanan sehari-hari).


ibuan tahun lalu, Bapak Ilmu Kedokteran Modern, Hippocrates, berkata, “Let your food be your medicine and your medicine be your food”. Ungkapan ini kira-kira bermakna jadikanlah makanan sebagai obat untuk mencegah penyakit. Kalau sudah sakit, orang memerlukan obat. Lalu, makanan seperti apa yang bisa mencegah penyakit? Jawabannya adalah makanan yang pas takarannya sesuai dengan kebutuhan tubuh. Makanan itu juga harus seimbang, beraneka ragam, dan mengandung zat gizi yang lengkap. Pertanyaannya kemudian adalah“Di zamansekarangini,mungkinkahmanusia memiliki pola makan yang seimbang? Di era pada mana manusia sangat sibuk dan di kondisi lingkungan yang penuh dengan cemaran ini, dapatkah pola makan konvensial menunjang kesehatan yang optimal? Jawabannya bisa “ya’, bisa ‘tidak’. Kalau jawabannya adalah ‘ya’ keadaan inilah yang membutuhkan suplemen makanan. Suplemen makanan Suplemen makanan (food supplement atau dietary supplement) adalah makanan yang mengandung zat-zat gizi dan non gizi, bisa dalam bentuk

kapsul, kapsul lunak, tablet, bubuk, atau cairan, yang berfungsi sebagai pelengkap kekurangan zat gizi yang dibutuhkan untuk menjaga agar vitalitas tubuh tetap prima. Suplemen makanan juga diartikan sebagai produk kesehatan yang mengandung satu atau lebih zat yang bersifat gizi. Suplemen makanan dapat digolongkan menurut kandungan zat gizi dan komponen aktifnya, yaitu vitamin, antioksidan, produk hormon, asam amino dan protein, mineral, dan lemak makanan. Sementara itu, berdasarkan manfaatnya, suplemen makanan, antara lain, berperan sebagai anti-penuaan, penurun berat badan, pemelihara kesehatan tulang dan otot, anti-kanker, pemelihara kesehatan jantung dan pembuluh darah, pendorong fungsi kognitif dan kecerdasan, pemeliharan kesehatan saluran pencernaan, pemelihara daya tahan tubuh, penjaga kesehatan kulit, penundan kerusakan mata, dan pendorong vitalitas seksual. Selain itu, beberapa suplemen makanan diklaim dapat berperan sebagai obat (efek terapeutik). Siapa yang membutuhkannya? Pada dasarnya, sesuai dengan namanya, suplemen makanan haruslah dijadikan pelengkap bagi makanan

yang dikonsumsi sehari-hari. Kalau komposisi makanan yang dikonsumsi lengkap (beragam dan seimbang), suplemen makanan tidak dibutuhkan. Akan tetapi, faktanya, banyak orang yang menjadikan suplemen makanan sebagai pengganti makanan sehari-hari). Hal ini dilakukan karena berbagai alasan. Sebagai contoh, penderita obesitas lebih memilih suplemen makanan daripada mengurangi asupan makanan dan berolahraga karena stigma sosial negatif terhadap obesitas; manfaat kesehatan dari penurunan berat badan; keinginan untuk “magic bullet” untuk penurunan berat badan; membutuhkan persyaratan yang lebih ringan dibandingkan dengan perubahan gaya hidup, seperti olah raga dan diet ketat; frustasi terhadap usaha sebelumnya, misalnya olah raga atau diet yang tidak berhasil; tersedia tanpa perlu resep dokter, terpengaruh godaan iklan, atau tergoda pernyataan “alami”. Lalu, siapakah yang butuh suplemen makanan? Berbagai kelompok orang, baik karena alasan fisiologis, gaya hidup, dan perilaku makan membutuhkan suplemen makanan. Ibu hamil membutuhkan suplemen zat besi dan asam folat untuk mencegah bayi lahir dengan berat badan rendah, cacat lahir, atau komplikasi kehamian. Wanita yang memasuki masa menopause membutuhkan suplemen vitamin dan fitoestrogen. Vegetarian memerlukan suplemen multivitamin dan mineral. Bayi dan balita memerlukan suplemen vitamin A untuk memelihara kesehatan mata dan men-

dukung pertumbuhan. Sementara itu, anak-anak yang tidak menyukai sayur dan buah memerlukan suplemen vitamin dan mineral. Perokok membutuhkan suplemen vitamin (vitamin C dan E) dan mineral (selenium dan seng). Orang yang bekerja pada tekanan oksidatif yang tinggi, misalnya supir angkutan umum, petugas sampah, penyapu jalan, dan polisi lalu lintas membutuhkan suplemen multivitamin dan antioksidan. Akhirnya, peminum alkohol dan pengguna obatobatan jangka panjang memerlukan suplemen vitamin dan antioksidan. Gunakan dengan bijak Suplemen vitamin dibutuhkan hanya kalau benar-benar diperlukan tubuh. Anjuran utamanya adalah menyeimbangkan asupan makanan. Usahakan memenuhi kebutuhan tubuh akan zat gizi melalui makanan. Mengonsumsi suplemen harus dilakukan secara bijak dan tepat. Jangan berlebihan! Itu hanya membuang-buang uang. Kelebihan suplemen vitamin dan mineral, misalnya akan menjadikannya bersifat toksik di dalam tubuh. Hal itu akan membebani hati untuk menawarkannya. Untuk kelebihan zat gizi yang harus dibuang dari dalam tubuh, itu akan membebani ginjal. Konsumsi suplemen memerlukan saran dari dokter atau ahli gizi agar terhindar dari dampak negatifnya. Penulis adalah Guru Besar Tetap Ilmu Gizi FKM USU.



WASPADA Rabu 28 Desember 2011

Kapolres Aceh Utara Imbau Napi Kabur Serahkan Diri

Poltek Buka Pendidikan Vokasi Bagi Warga LHOKSEUMAWE (Waspada) : Politeknik Negeri Lhokseumawe bekerjasama dengan Dikti (Seamolec), Selasa (27/12) membuka program pendidikan vokasi berkelanjutan (PVB) secara gratis bagi warga yang tak mampu melanjutkan pendidikan ke perguruan tinggi. Vokasi adalah pendidikan tinggi yang diarahkan pada penguasaan keahlian terapan tertentu. Pembukaan kegiatan dihadiri unsur Muspida dari Lhokseumawe dan Aceh Utara. “Proses seleksinya akan dilakukan di empat SMK di Aceh Utara dan Lhokseumawe, kemudian mereka diajarkan keterampilan khusus, sehingga setelah selesai pendidikan mereka mampu bekerja langsung,” kata Direktur Politeknik Negeri Lhokseumawe Ridwan, kemarin. Menurutnya, warga yang menjadi mahasiswa dalam program tersebut tidak mengenal batas usia. Mereka akan diseleksi di SMK Tanah Luas, Dewantara, Lhoksukon, Aceh Utara dan SMK 4 Lhokseumawe. “Kita juga melibatkan 25 guru dari empat SK tersebut untuk menjadi asisten dosen dalam proses pengajaran,” katanya. Tujuan program ini selain untuk pengurangan angka pengangguran juga peningkatan Angka Partisipasi Kasar (APK), juga peningkatan devisa tenaga kerja terdidik. “Jika sudah selesai Diploma Satu (D-1) bisa melanjutkan ke D-II dan D-III,” katanya.(cmk)

Berantas Maksiat, Dinas Syariat Bangun Tiga Unit Pos Pengawas LHOKSEUMAWE (Waspada) : Menanggapi keresahan warga yang tidak terbendung lagi terkait maraknya kasus maksiat, Selasa (27/12), Dinas Syariat Islam Kota Lhokseumawe bakal membuka tiga unit pos pengawas di lokasi waduk raksasa di Desa Pusong, Kecamatan Banda Sakti. Hal itu diungkapkan Kepala Dinas Syariat Islam Diauddin menanggapi keluhan masyarakat yang resah dengan kondisi waduk yang gelap tanpa diterangi cahaya lampu menjadi objek pelaku maksiat. Diauddin mengaku dirinya sudah berulang kali menerima laporan masyarakat terkait banyaknya pasangan muda – mudi yang non muhrim berduaan di tempat gelap di kawasan jalan lingkar waduk setempat. Meski berulang kali telah melakukan operasi syariat dengan mengimbau secara lisan dan melakukan patroli, namun sayangnya hanya bertahan sementara saja. Akan tetapi begitu petugas pulang ke markas, aksi maksiat yang tadinya lerai lamban laun para pelaku maksiat kembali lagi ke lokasi gelap waduk. Oleh karena itu untuk memberantas maksiat, tegas Diauddin, pihaknya akan membangun tiga unit pos pengawas syariat di jalan lingkar waduk dan menempatkan petugas piket dariWilayatul Hisbah. Terkait mekanisme proses penjagaan di pos tersebut, pihak Dinas Syariat Islam akan melakukan koordinasi dengan berbagai pihak terutama kepolisian dan Satpol-PP. “Rencana membangun tiga unit pos pengawas ini sudah kita ajukan pada anggaran 2012, dan masih menunggu rekomendasi para legislatif setuju atau tidak,” papar Diauddin. Diauddin menjelaskan, selain pembangunan pos pengawas, juga akan dibangun pintu keluar masuk ke lokasi waduk yang nantinya bakal menjaring pasangan bukan muhrim yang hendak berbuat maksiat. (b16)

Warga Jadi Korban Lubang Maut Sepanjang Jalan ExxonMobil LHOKSEUMAWE (Waspada): Jalan ExxonMobil yang menghubungkan Kecamatan Syamtalira Aron, Matang Kuli dan Paya Bakong dipenuhi lubang maut. Sejumlah warga yang memanfaatkan jalan itu telah menjadi korban, dalam beberapa bulan terakhir tercatat dua meninggal dunia dan beberapa warga lainya mengalami luka serius. Warga Gampong Glok, Syamtalira Aron, Amiruddin Yunus,42, kepada Waspada, Senin (26/12) menjelaskan, korban terakhir Sulaiman,58, warga Keude Aron. Sepedamotor korban terjebak lubang di Gampong Glok. Sebelum jatuh, korban dihantam sepedamotor lain dari belakang sehingga mengalami luka parah. “Kejadiannya sekira pukul 07:30. Koban sekarang sedang kritis di rumah sakit,” jelasnya. Sementara itu, menurut kakak korban H Usman R, 60, ketika dilarikan ke rumah sakit, Sulaiman tidak sadarkan diri. “Sekarang sedang dirawat di Rumah Sakit Cut Mutia,” jelasnya. Imum Imum Aron, HMTayeb didampingi sejumlah warga lainnya juga menambahkan, pada Oktober 2011 dua remaja juga meninggal dunia akibat jatuh dalam lubang. Korban terperosok dalam lubang di depan bekas Rumah Sakit Paru milik perusahaan eksplorasi gas alam itu. Keduanya sempat ditolong warga, namun tidak sempat diselamatkan dan meninggal dunia. Pada pertengahan November lalu, Hasanah dari Keude Aron juga mengalami hal yang sama. Begitu juga dengan Arsyen juga terperosok lubang maut di kawasan Simpang Cluster-I. Imum Mukim dan warga mengharapkan jalan tersebut segera diperbaiki. Namun perusahaan, jangan hanya menutupi lubang dengan semen seperti dilakukan beberapa waktu lalu. Dengan cara itu tidak akan tahan lama. Sementara itu Humas Aceh Production and Operation (APO) ExxonMobil, Armia ketika menyerahkan bantuan untuk Masjid di Keude Aron, akhir November lalu mengakui jalan sudah pernah diperbaiki namun sekarang telah rusak kembali.(b15)

Pria Belawan Curi Motor Di Aceh Utara LHOKSUKON (Waspada) : MSH, 25, pria asal Jalan Sebelas, Gang II, Kecamatan Medan Belawan, Medan, ditangkap mencuri sepeda motor di Desa Rayeuk Kuta, Kecamatan Tanah Luas, Aceh Utara, Senin (26/12). Pemuda yang mengaku menetap sementara di Desa Matang Sijuek Timu, Kecamatan Baktiya Barat, Aceh Utara ini, mencuri sepeda motor merk Yungmin BL 3950 NG milik Samsul Bahri, 45, warga Desa Rayeuk Kuta. “MSH ditangkap warga. Sebelum diserahkan ke Mapolsek, dia sempat dihajar massa hingga mukanya bengkak dan sebagian jemarinya luka lecet,” kata Kapolres Aceh Utara AKBP Farid BE melalui Kapolsek Tanah Luas Ipda Teguh Yano Budi, Selasa (27/ 12). Kapolsek menambahkan, saat diperiksa petugas, MSH memberikan keterangan berbelit-belit. Namun polisi belum bisa memastikan apakah tersangka pura-pura gila atau memang menderita gangguan jiwa. Sementara, MSH, saat ditanya mengaku nekat mengambil sepeda motor itu saat diparkir di depan sebuah warung di Desa Rayeuk Kuta. “Saya terpaksa mengambilnya karena tak ada kendaraan pulang ke Desa Matang Sijuek Timu. Saya tak berniat menjualnya,” papar MSH. (b19)

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu) Garuda Indonesia

Berangkat (flight, tujuan, waktu)

GA 142 Jakarta/Medan GA 146 Jakarta/Medan

10:40 15:50

GA 143 Medan/Jakarta GA 147 Medan/Jakarta

11:25 16:45

Y6 555 Jakarta * Y6 537 Jakarta/Medan

19:05 12:30

Y6 556 Jakarta** Y6 538 Medan/Jakarta

07:05 12:30

JT 304 Jakarta JT 396 Jakarta/Medan

11:35 20:00

JT 397 Medan/Jakarta JT 307 Jakarta

06:40 12:15

SJ 010 Jakarta/Medan


SJ 011 Medan/Jakarta


Batavia Air Lion Air

Sriwijaya Air Air Asia

AK 305 Kuala Lumpur *** 12:20

AK 306 Kuala Lumpur*** 12:45

FY 3401 Penang ****

FY3400 Penang ****

Fire Fly


* Setiap Selasa, Kamis, Minggu. ** Setiap Senin, Rabu, Jumat. *** Setiap Senin, Rabu , Jumat dan Minggu. **** Setiap Selasa, Kamis dan Minggu.


Waspada/Zainal Abidin

MESKIPUN telah dibangun saluran pembuangan di sepanjang jalan di pusat Kota Lhokseumawe, namun tetap banjir melanda kawasan itu, Selasa (27/12).

Drainase Tak Berfungsi, Lhokseumawe Banjir LHOKSEUMAWE (Waspada): Hujan yang mengguyur Kota Lhokseumawe mengakibatkan banjir di sejumlah ruas jalan di pusat kota. Ironisnya, saluran drainase yang baru saja dibangun pemerintah daerah tidak mampu mengatasi banjir yang kerap melanda Kota Petro Dollar itu, Selasa (27/12). Meskipun curah hujan tidak terlalu deras, namun Jalan Perdagangan dan Jalan Sukaramai di pusat kota tetap tergenang. Air setinggi lutut orang dewasa mengganggu pemilik toko dan pengguna jalan. Apalagi kedua jalan itu ramai dilintasi warga, sehingga warga mengharapkan saluran pembuangan yang dibangun sepanjang jalan bisa difungsikan. “Aneh, sudah dibangun saluran, tapi airnya tidak mau mengalir,” kata salah seorang pemilik took emas di Jalan Perdagangan. Selain di pusat kota, banjir juga terjadi di Jalan Darussalam, Jalan Tgk Cik Di Tiro dan Jalan Samudera. Kondisi itu mengakibatkan sejumlah siswa dan pegawai kantor di sekitar lokasi banjir aktivitasnya juga terganggu. Punahkan Tanaman Padi Sementara itu, sekitar 2.665

hektare tanaman padi milik petani di sejumlah kecamatan di wilayah Kabupaten Bireuen punah akibat diterjang banjir yang terjadi dalam beberapa hari belakangan ini. Sehingga para petani setempat mengalami kerugian ratusan juta rupiah dan harus menanam kembali musim tanam ini. Tanaman padi yang rusak akibat diterjang banjir itu antara lain di Kecamatan Gandapura 130 hektare, Makmur 25 hektare, di Kutablang 434 hektare, Jangka 395 hektare, Peusangan 823 hektare, Peusangan Siblah Krueng 211 hektare, Kuala 161 hektare, Jeumpa 40 hektare, Peudada 204,96 hektare dan di Kec. Pandrah 242 hektare. Demikian Kepala Dinas Pertanian, Peternakan, Perkebunan dan Kehutanan Bireuen Azmi Abdullah melalui Kepala Bidang Pertanian, Tanaman Pangan dan Holtikultura Alie Basyah kepada wartawan, Selasa (27/ 12). Menurut Alie Basyah, pe-

milik tanaman padi yang mati akibat diterjang banjir umumnya harus menyemai dan menanam kembali tanaman padinya agar dalam musim tanam ini mereka dapat panen sebagaimana biasanya, meskipun panennya nanti akan bergeser waktunya. “Sebenarnya, total tanaman padi yang terendam banjir mencapai 3.073 hektare, namun 2.665 hektarnya tanaman padi baru berumur 15-20 hari dan umumnya mati, sehingga pemiliknya harus menanam kembali,” jelasnya. Namun, pihaknya sampai saat ini belum bisa menyebutkan angka pasti kerugian petani akibat padinya diterjang banjir. “Kita masih melakukan pendataan dan perhitungan di lapangan 20 persen dari 2.665 hektare tanaman padi yang sudah berumur 30 hari, sedangkan 80 persennya lagi benih padi yang baru disemai yang baru berumur 5-15 hari umumnya harus disemai kembali,” paparnya. (b15/cb02)

Waspadai Aksi Jambret Malam Hari BIREUEN (Waspada) : Aksi jambret tas atau dompet kaum ibu di Bireuen sekarang ini mulai kambuh, bahkan dalam dua pekan ini dua kasus terjadi dan yang terakhir dialami Hidayati, 23, warga Desa Karang Rejo, Kota Juang, Bireuen, Sabtu (24/12) malam saat dibonceng suaminya Heri Gunawan dengan sepedamotor Supra Fit BL 3652 ZK di kawasan Meuligoe. Dompetnya dijambret dua pria mengendarai Honda Supra X 125 setelah menarik tasnya lalu membawa lari ke kawasan Paya Kareung. Setelah menarik dompetnya, pelaku langsung tancap gas ke jalan arah RSD Fauziah, lalu membelok ke kawasan Simpang Adam Batre, lalu berputar ke arah timur. Kapolres Bireuen AKBP Yuri Karsono melalui Kapolsek Kota Juang Iptu Syamsul, Senin (26/12) membenarkan. (cb02)

Erosi Tebing Sungai Meluas Jembatan Peudada Bireuen Terancam Ambruk PEUDADA ( Waspada) : Erosi tebing Krueng Peudada di aliran sungai sebelah timur kawasan Desa Pulo, Kecamatan Peudada, Bireuen semakin meluas. Ratusan meter kebun penduduk amblas ke sungai. Tak hanya kebun penduduk, akibat meluasnya erosi tebing sungai hulu sebelah timur jembatan Jalinsum Peudada, salah satu jembatan terpanjang di Aceh itu terancam ambruk ke sungai. Mukhlis, warga Desa Pulo, Minggu (25/12) mengatakan, warga Pulo yang berdomisili di sepanjang aliran sungai resah akibat mengganasnya erosi tebing sungai. Pasalnya, warga Pulo sudah dua kali berturut tertimpa banjir bandang beberapa tahun lalu, meski tidak sempat merenggut korban jiwa, tetapi sempat menelan kerugian harta benda yang besar. Konon lagi di musim penghujan sekarang ini sedang dibalut kecemasan terhadap erosi tebing sungai yang semakin meluas. Dikatakan, erosi tebing sungai kawasan Desa Pulo sema-

Waspada/H AR Djuli

JEMBATAN Peudada Bireuen semakin terancam erosi tebing sungai di kawasa Desa Pulo. Foto direkam, Minggu (25/12). kin menerobos ke bagian hulu jembatan sebelah timur yang bersebelahan dengan Desa Pulo diharapkan dinas terkait Kabupaten Bireuen maupun Pemerintah Provinsi Aceh perlu segera mengatasi erosi tebing krueng Peudada untuk menyelamatkan areal kebun penduduk dan jem-

batan Jalinsum Peudada yang terancam ambruk ke sungai. Camat Peudada Munawar membenarkan, warga yang berdomisili di aliran sungai Krueng Peudada sudah menyampaikan keluhannya agar erosi tebing Krueng Peudada yang semakin meluas dapat segera diatasi. (b12)

LHOKSUKON (Waspada) : Kapolres Aceh Utara AKBP Farid BE mengimbau sebelas narapidana yang kabur dari Rumah Tahanan (Rutan) Lhoksukon, Aceh Utara, Senin (26/12) segera menyerahkan diri ke polisi atau Rutan Lhoksukon. “Jika dalam dua kali 24 jam imbauan ini tak diindahkan, kita terpaksa mengambil tindakan tegas. Bila perlu, kita keluarkan perintah tembak di tempat,” kata Kapolres Aceh Utara AKBP Farid Bachtiar Effendi, Selasa (27/12). Kapolres menambahkan, pasca kaburnya napi tersebut, pihaknya langsung menurunkan tim pemburu ke titik-titik yang dicurigai, termasuk desa asal para napi. Polisi juga menyebar foto para napi yang kabur ke semua Polsek di Aceh Utara untuk memudahkan proses pelacakan. “Harapan kita, pihak keluarga ikut membantu membujuk dan menyadarkan para napi agar segera menyerahkan diri ke pihak berwajib. Dengan demikian, para napi ini tidak sampai terancam tindakan tegas dari polisi,” tandas Kapolres. Seperti diberitakan sebelumnya, sebelas napi yang menghuni kamar C6, Rutan Lhoksukon, Aceh Utara membobol dinding kamar ter-

sebut dan berhasil kabur dengan menaiki pagar Rutan. Napi yang kabur, rata-rata tersangkut kasus narkoba, termasuk kurir ganja asal Bandar Lampung, Safri Maizal alias Ayi Lampung. Bekuk Bandar Togel Sementara itu, aparat Polsek Tanah Jambo Aye, Aceh Utara, menangkap seorang tersangka bandar judi toto gelap yang selama ini beroperasi di Pantonlabu, ibukota Kecamatan Tanah Jambo Aye. Tersangka berinisial RA alias Willi, 38, warga Dusun II, Pantonlabu. Pria beristri dua ini dibekuk petugas di rumah istri mudanya di Desa Biara Timu, Kecamatan Tanah Jambo Aye, Senin (26/12) sekitar pukul 22:00. “Bersama tersangka kita amankan uang hasil penjualan togel Rp650.000, HP Nokia berisi nomor togel dan selembar repas atau bon togel,” kata Kapolres Aceh Utara AKBP Farid BE melalui Kapolsek Tanah Jambo Aye Iptu Mukhtar, Selasa (27/12). Untuk proses pemeriksaan lebih lanjut, tersangka masih diamankan di Mapolsek Tanah Jambo Aye. Tersangka dijerat dengan Qanun Syariat Islam Nomor 13 tentang judi atau Maisir, dengan ancaman hukuman bisa mencapai 10 kali cambuk. (b19)

Anggota DPR Asal Aceh Kunjungi Unimus BIREUEN (Waspada) : Anggota Komisi X DPR yang membidangi pendidikan, pemuda dan olahraga asal Aceh, M Faisal Amin mengunjungi Universitas Almuslim (Unimus) Peusangan, Bireuen, Senin (26/12) sekaligus untuk menginput data tentang kendala yang dihadapi Unimus untuk perencanaan penegerian perguruan tinggi kebanggaan masyarakat Kota Sate Matang tersebut. Dia juga menyerahkan beasiswa bagi 23 murid SDN dari Kecamatan Makmur dan hibah untuk STEI Kebangsaan serta paket rehab berat kelas di SMPN 1 Jeumpa. Pertemuan yang dihadiri pimpinanYayasan Almuslim, unsur DPRK setempat dan anggota DPR Aceh dan sejumlah pejabat terkait lainnya dari Bireuen dan Provinsi Aceh berlangsung secara kekeluargaan. Rektor Unimus Almuslim Peusangan Amiruddin Idris dalam kesempatan itu menjelaskan, kunjungan Komisi X DPR ke Unimus untuk memperoleh berbagai informasi terkait dengan perkembangan dan kendala dihadapi Unimus dalam proses penegeriannya selama ini. Selain itu, juga membahas rencana akan dibukanya Fakultas Kedokteran dan Rumah Sakit Almuslim dalam waktu dekat. “Sekarang Unimus telah memiliki 16 ribu lebih mahasiswa, rasanya dengan banyaknya mahasiswa dan prodi Unimus sudah berat dikelola oleh yayasan. Usulan penegerian Unimus sudah sesuai dengan amanah rapat yayasan VII Juni 2010,” katanya. Jika tidak dinegerikan, kata Amiruddin, aturan pemerintah untuk universitas swasta semakin sulit, karena setiap fakultas harus memiliki tenaga pengajar, seorang profesor, dua dosen sudah S3, tiga dari S2, jika tidak dapat disediakan harus ditutup. “Kita berharap dengan keda-

Waspada/Abdul Mukthi Hasan

M FAISAL Amin, anggota Komisi X DPR (tengah) duduk bersama Rektor Unimus H Amiruddin Idris dan anggota DPRA Anwar Idris serta anggota DPRK Bireuen duduk mendengar masukan terkait kendala penegerian Unimus di kampus setempat, Senin (26/12). tangan M Faisal Amin dapat memfasilitasi rencana penegerian Unimus ini,” harap Amiruddin. Ketua Yayasan Almuslim H Yusri Abdullah menegaskan, rencana penegerian Unimus tidak menyerahkan atau tidak mengganggu asetnya yang telah ada selama ini, karena aset-aset itu tetap utuh. “Jadi rencana penegerian Unimus tanpa diganggu asetnya,” jelasnya. M Faisal mengatakan dirinya akan menindaklanjutinya, bahkan dia berpesan kepada rektor supaya tidak bosan-bosan menyampaikan hal tersebut ke Jakarta supaya hal itu cepat menjadi kenyataan. (cb02)

Pengabdian Guru Madrasah Di Tengah Keprihatinan Pelanggaran HAM M NUR, 53, menilai telah terjadi pergeseran moral yang signifikan antara siswa tempo dulu dengan sekarang. Sebagai seorang guru yang bertugas di berbagai sekolah di Aceh, pria asal Peureulak Barat, Aceh Timur ini selalu bermimpi, moral anak bangsa akan kembali seperti dulu. “Tapi mustahil, gurei (guru) sekarang takut melanggar HAM bila harus mendidik seperti gurei-gurei awai (dulu),” ungkap M Nur mengutarakan keprihatinan para pendidik sekarang. “Bayangkan, ada anak tidak menghargai gurunya lagi. Bahkan ada yang memusuhi guru yang mendidiknya,” kata Nur di ruang kerjanya, kantor Kepala Sekolah Madrasah Aliyah Negeri (MAN) Sumbok, Nibong, Aceh Utara, Sabtu (24/ 12). Sebelum menjabat Kepsek, dia telah bertugas mendidik anak bangsa mulai dari Aceh Timur, Sinabang, Simeulue, Kota Lhokseumawe dan Aceh Utara. Dia mengaku terpaksa mengabaikan HAM, bila moral anak didiknya bisa hancur karena hak asasi itu. “Saya terpaksa keras bila berbicara moral anak-anak,” tegasnya lagi. Apa yang dituturkan ayah 10 orang anak yang hanya mendapatkan pendidikan sampai Diploma-3 di IAIN Arraniri Banda Aceh ini, tak jauh berbeda dengan fakta di lapangan. Madrasah Aliyah Sumbok yang baru saja mendapat status negeri, masih terdapat banyak kekurangan. Di antaranya, sekolah hanya memiliki pintu gerbang, sedangkan pagar sekitar gedung belum ada. “Kami sampaikan kepada anak-anak, secara fisik pagar belum ada, namun siswa ke luar masuk sekolah harus melalui pintu gerbang,” jelas M Nur. Siapa yang berani melanggar, hukumannya cukup berat. Memberi hukuman kepada anak, sesuai dengan karakternya. Ada anak yang hanya cukup

Waspada/Zainal Abidin

M NUR, Kepsek Madrasah Aliyah Negeri (MAN) Sumbok,Nibong, Aceh Utara tampak akrab bersama para siswanya, Sabtu (24/12). ditegur dengan lembut, dibentak sampai terpaksa dipukul. Tetapi memukul siswa, bukan atas dasar kebencian. “Dalam agama sudah dijelaskan bagaimana cara menghukum anak di atas usia 10 tahun,” tambah pria yang mulai karirnya sebagai guru sejak 1986. Ketika seorang guru berpedoman pada agama ketika mendidik, M Nur mengaku terpaksa mengabaikan aturan lain yang menurut pihak tertentu melanggar HAM. Dengan caranya mendidik seperti itu, dia mengaku Insya Allah belum ada wali murid yang menegurnya. Apalagi diadukan kepolisi, seperti yang dialami sejumlah guru selama ini. Menurutnya, siswa dan orang tuanya pasti mengerti, perbedaan antara memukul karena benci dengan memukul sebagai peringatan. Sehingga selama dia mengabdi sebagai guru, setiap kali bertindak keras dalam membentuk moral kepada siswa selalu mendapat hasil positif. Zainal Abidin

Ulee Madon, Gampong Industri Bordir Tas Motif Aceh ULEE MADON adalah sebuah gampong di Kecamatan Muara Batu, Kabupaten Aceh Utara. Di gampong tersebut tumbuh dan berkembang secara alami industri bordir tas motif Aceh sejak 15 tahun lalu. Gampong ini juga pernah mendapatkan prestasi sebagai gampong industri bordir dari Pemerintah Provinsi Aceh. Hasil kajian Bank Indonesia, perajin tas motif Aceh di Ulee

Madon mampu menyerap 170 tenaga kerja. Secara menyeluruh, Kecamatan Muara Batu memiliki 27 UMKM perajin tas bordir dengan jumlah tenaga kerja mencapai 420 orang. Dengan nilai investasi tidak kurang dari Rp403.050.000, persediaan bahan baku sebesar Rp4.926. 739.000 dan nilai produksi per periode survei sebesar Rp7.096. 661.000. Berdasarkan hal itu, untuk mengembangkan potensi ekonomi, meningkatkan pemberdayaan pelaku usaha daerah dan mengoptimalisasi fungsi intermediasi perbankan untuk kontribusi pengembangan sektor rill dan UMKM, Bank Indo-

nesia Lhokseumawe bersama Pemkab Aceh Utara berkomitmen membentuk klaster guna melakukan pembinaan terpadu terhadap industri bordir Ulee Madon. Klaster industri ini diharapkan akan menciptakan mata rantai nilai saling ketergantungan dan saling melengkapi dalam pengembangan usaha bordir. Dari situ diharapkan dapat membuka lapangan kerja dan meningkatkan kesejahteraan masyarakat yang mempercepat pertumbuhan ekonomi daerah. “Pembentukan klaster kita yakini mampu memperkuat perekonomian lokal dan mampu memfasilitasi reorganisasi

industri serta klaster dapat meningkatkan net working antar UMKM. Selain itu, klaster juga mampu meningkatkan produktivitas dan efisiensi serta mampu mendorong dan mempermudah inovasi,” kata Zulfan Nukman, Pemimpin BI Lhokseumawe, Rabu (21/12) di Gampong Ulee Madon dalam acara peresmian industri bordir. Menurut Zulfan, semua daerah di Indonesia memiliki kerajinan khas masing-masing dengan keunikan dan keunggulannya. Itu artinya, ke depan, kerajinan yang dihasilkan industri Ulee Madon dihadapkan persaingan memperebutkan pasar. Karena itu, mulai saat ini,

jika ingin usahanya maju, produk yang dihasilkan harus bermutu. Pengusaha harus memiliki konsep yang jelas tentang produk, jalur distribusi yang efisien, promosi produk yang efektif serta menjalin hubungan dengan konsumen melalui komunikasi pemasaran. Agar produk kerajinan Ulee Madon berkualitas dan mampu merebut pasar, maka produk harus memiliki daya tahan yang mencerminkan umur ekonomis, karakteristik produk, desain, corak penampilan dan kesesuaian dan spesifikasi. “Untuk mempromosi tas motif Aceh Ulee Madon, BI mengikutsertakan anggota KUB Ingin Jaya

pada pameran Simposium Nasional Pengembangan UKM Inovatif melalui inkubator bisnis di Bogor dan yang membanggakan, hasil kerajinan Ulee Madon banyak penggemarnya,” kata Zulfan. HM Alibasyah, Pj Bupati Aceh Utara mengatakan, agar produk industri Ulee Madon dikenal dengan baik, maka produk hasil sering dipromosikan melalui acara pameran atau melalui iklan-iklan di media massa atau brosur. Produk berkualitas tidak akan diketahui orang tanpa diperkenalkan lewat promosi. “Saya mendukung kegiatan ini,” katanya. Maimun Asnawi


WASPADA Rabu 28 Desember 2011

B11 Putusan Sidang Praperadilan Kapolres Pidie Tak Sesuai Bukti Persidangan

Warga Lamlagang Gelar Wirid Yasin, Kenang Tujuh Tahun Tsunami BANDAACEH (Waspada) : Masyarakat Gampong Lamlagang, Kecamatan Banda Raya, Kota Banda Aceh, Senin (26/12) malam mengadakan wirid yasin dan doa bersama mengenang tujuh tahun musibah tsunami. Wirid yasin dan doa bersama dipusatkan di Masjid As-Sadaqah dan Masjid Al-Muhajirin desa setempat. Wirid yasin yang diikuti ratusan kaum laki-laki dan perempuan serta remaja itu dimulai sejak pukul 18:40, usai shalat Magrib hingga menjelang Isya. Warga terlihat larut dalam zikir dan doa yang dipimpin Ustadz Zoel. Tak sedikit yang meneteskan air mata mengenang dahsyatnya peristiwa tsunami 26 Desember 2004 lalu, yang meluluhlantakkan kawasan Provinsi Aceh. Usai wirid yasin dan doa, dilanjutkan shalat isya berjamaah. Usia shalat acara kembali dilanjutkan dengan tausiah dan zikir bersama dipimpin Ustadz Zoel. Saat mendengar tausiah, sebagian besar para jamaah tak sanggup membendung air mata dan terus bercucuran. Usai tausiah dan zikir serta pembacaan doa bersama itu, acara dilanjutkan makan malam bersama dengan lauk kuah daging sapi, yang merupakan swadaya masyarakat Dusun Satu Desa Lamlagang. Acara juga berlanjut di Masjid As-Sadaqah, warga kembali mengikuti tahlilan yang juga diikuti ratusan warga terutama kelurga dari korban musibah tsunami. (b09)

SIGLI (Waspada) : Putusan Majelis Hakim Pengadilan Negeri (PN) Sigli dalam kasus praperadilan Kapolres Pidie terkait meninggalnya tahanan Salaman Bin Hasyem, dinilai tidak sesuai bukti persidangan. Karena dalam amar putusan setebal 65 halaman yang dibacakan hakim tunggal Fadli, merujuk pada bukti persidangan yang menolak seluruhnya eksepsi termohon (Kapolres Pidie). Namun dalam pengambilan keputusan hakim malah merujuk pada eksepsi termohon. “Putusan tersebut sepenuhnya wewenang hakim, tetapi hasil putusan itu tidak mencerminkan keadilan, karena setelah eksepsi temohon ditolak, seharusnya hakim saat mengambil putusan tidak merujuk kepada eksepsi termohon, melainkan bukti-bukti dan saksi di persidangan,” jelas kuasa hukum pemohon dari keluarga Salman Bin Hasyem (alm), Wiwin Ibnuhajar didampingi Said Safwatullah, usai mendengar putusan hakim PN Sigli Fadli, Selasa (27/12). Wiwin juga memaparkan, dalam putusan, itu hakim juga tidak mengaitkan soal penganiayaan yang berujung tewasnya Salman bin Hasyem, tetapi hakim dalam putusannya merekomendasi masalah penganiayaan tersebut adalah pidana umum. “Oleh sebab itu, keluarga pemohon melalui kuasa hukum akan melakukan kasasi ke Mahkamah Agung karena tidak bisa menerima putusan pengadilan tersebut. Selain itu kami selaku kuasa hukum keluarga pemohon segera mela-

Dunia Pendidikan Memasuki Era Demokrasi BLANGKEJEREN (Waspada): Dewan Pendidikan lahir pada masa dimana dunia pendidikan memasuki era demokrasi yang sesungguhnya. Dengan keberadaannya, Dewan Pendidikan diharapkan menjadi jembatan yang mengakomodasi kepentingan masyarakat, pemerintah, dan praktisi pendidikan. Begitu disebutkan, Gunmas,SPd.MPd Ketua Majelis Pendidikan Daerah Kabupaten Gayo Lues, di sela acara sidang MPD tentang penyampaian rekomendasi terhadap Pemkab Gayo Lues, selasa (27/12). Acara dihadiri Bupati Gayo Lues, Staf Ahli Bupati Bidang Pendidikan dan anggota DPRK dari Fraksi PKS. Selain memahami peran dan fungsinya sebagaimana tercantum dalam Keputusan Menteri Pendidikan Nasional Nomor 044U/2002 tentang Dewan Pendidikan dan Komite Sekolah, serta memiliki paradigma yang mampu mengatasi segala permasalahan dengan kacamata yang lebih populis yang selalu berpihak kepada kepentingan masyarakat secara luas, mengingat subjek pendidikan adalah masyarakat. Usai acara itu, 12 murid terbaik di seluruh Gayo Lues yang masing-masing diambil dari sekolah mulai tingkat SD,SMP dan SMA diberikan bingkisan senilai Rp500 ribu per murid atas prestasi yang dicapai. (cjs)

Prof Hasnudi, Rektor Definitif UGL Kutacane KUTACANE (Waspada) : Bupati Aceh Tenggara Hasanuddin B di aula UGL, Selasa (27/12) melantik dan mengambil sumpah Prof Dr Hasnudi, MSi sebagai rektor definitif Universitas Gunung Leuser (UGL) Kutacane. Selain melantik dan mengambil sumpah Hasnudi sebagai rektor UGL periode 2011-2015 , Bupati Agara H Hasanuddin B sebagai Ketua Dewan Pembina juga melantik Rustam Efendi sebagai Dekan Fakultas Pertanian, Hataruddin sebagai Dekan Fakultas Ekonomi, Indra Utama sebagai Dekan FKIP dan Arbai’i sebagai Dekan Fakultas Teknik. Bupati Agara Hasanuddin B mengatakan, pelantikan dan pengambilan sumpah terhadap rektor dan 4 orang Dekan UGL diharapkan mempercepat penegakan disiplin demi peningkatan kuantitas dan kualitas kampus. Khusus bagi Fakultas Keguruan Ilmu Pendidikan, bupati berpesan agar secepatnya bisa menambah program studi seperti program matematika, kimia, teknik informasi, sosiologi dan jurusan Program Studi Geografi. Sedangkan untuk tahun 2012 di kampus UGL juga akan didirikan dua fakultas lagi yakni Fakultas Hukum dan Kehutanan. “Jelas ini bukan pekerjaan mudah bagi rektor dan para dekan yang baru dilantik untuk mendukung rencana tersebut Pemkab Agara sudah memberikan kesempatan bagi 10 dosen UGL guna mengambil pendidikan strata tiga,’’ demikian bupati. (b26)

IPPAT Salurkan Bantuan Untuk Korban Banjir Aceh Timur BANDA ACEH (Waspada) : Ikatan Pemuda Pelajar Aceh Timur (IPPAT) bersama sejumlah elemen mahasiswa dari Banda Aceh dan Langsa, Minggu (25/12) menyalurkan bantuan berupa pakaian, peralatan shalat dan sembako untuk 530 kepala keluarga korban banjir yang tersebar di Kecamatan Banda Alam, Alu Ie Mirah dan Bagok, Aceh Timur. Bantuan yang diangkut menggunakan dua truk merupakan sumbangan yang terkumpul dari masyarakat dan pengguna jalan selama empat hari sebesar Rp21 juta serta barang bantuan lainnya berupa sembako, pakaian, perangkat shalat dan perlengkapan bayi. Selain itu, bantuan juga diperoleh dari Biro Kesra Setda Aceh dan Ridwan Abubakar, anggota DPRA dari Partai Aceh. “Jika kita uangkan, semua bantuan ini jumlahnya kira-kira Rp60 juta lebih. Jika ditambah dengan uang sumbangan masyarakat pengguna jalan di kawasan Simpang Lima, Simpang Jam dan Simpang Surabaya sebesar Rp21 juta, jadi jumlah semua mencapai Rp81 juta lebih,” jelas Ketua Umum IPPAT, Aftahurriza, Selasa (27/12). Untuk menyalurkan bantuan itu, pihaknya menurunkan 75 mahasiswa ke lapangan, yang terdiri dari Ikatan Pemuda Pelajar Aceh Timur (IPPAT), Akademi Farmasi Banda Aceh, FKM Serambi Mekkah, Aliansi Mahasiswa Langsa (AMAL), STIKES Cut Nyak Dhien Langsa dan Akbid MUQ Langsa. “Alhamdulillah, saat ini kondisi masyarakat korban banjir sudah normal dan sudah mulai beraktivitas seperti biasa,” pungkas Aftahurriza. (b04)

Status RSIA Beureunuen Tak Jelas SIGLI (Waspada) : Berbagai elemen masyarakat peduli kesehatan di Kabupaten Pidie menilai Pemkab Pidie tidak becus mengurus keberadaan Rumah Sakit Ibu dan Anak (RSIA Beureunuen di Kecamatan Mutiara Timur. Buktinya, hingga sudah berkalang tahun usia RSIA, statusnya tetap saja belum jelas. Padahal peningkatan kualitas pelayanan kesehatan di rumah sakit besar setelah RSUD Sigli itu ditentukan dari peningkatan status secara jelas. Karena tidak jelasnya status menyebabkan RSIA Beureunuen, Mutiara Timur membuat pelayanan terhadap masyarakat amburadul menyusul kekurangan tenaga medis dan dokter, ungkap beberapa pegiat LSM, Selasa (27/12). “Selama dioperasikannya RSIA Beureunuen itu, pelayanan kesehatan jelek. Banyak warga yang mengeluhkan kondisi pelayanan di rumah sakit pemerintah daerah itu,” ungkap Asnawi Ali, Ketua LSM Yapmalsop Kabupaten Pidie. Hal sama dikatakan Tim Panitia Khusus (Pansus) XXIV DPRK Pidie. Berdasarkan hasil temuan di lapangan, RSIA Beureunuen itu sejak lama tidak jelas statusnya. Akibat kondisi demikian, Pansus DPRK itu menilai kinerja Pemkab Pidie buruk dalam mengurus kesehatan warganya. “Karena itu, Pansus DPRK Pidie meminta pemerintah daerah setempat segera memperjelas status dan keberadaan RSIA,” tegas Ketua Pansus XXIV DPRK Pidie, Mahfuddin Ismail A MA. “Jika statusnya belum jelas, Pemkab Pidie tidak dibenarkan memprioritaskan program-program tertentu terhadap RSIA, karena akan sulit dipertanggung jawabkan. Kita mau adanya kejelasan status rumah sakit pemerintah daerah itu,” katanya. Pansus DPRK itu meminta Bupati Pidie memperjelas keberadaan aset daerah seperti mobil, sepedamotor, toko dan tanah milik daerah. (b09)


SEORANG ibu membagikan nasi pulut (Bu Leukat) untuk anak-anak seusai doa bersama memperingati 7 tahun tsunami di Komplek Masjid Desa Kuala Simpang Ulim, Kecamatan Simpang Ulim, Aceh Timur, Senin (26/12). Doa bersama itu berlangsung khidmat, diikuti 150 orang dan dihadiri anggota Komisi X DPR-RI dari PD, Muslim dan anggota DPRK Aceh Timur dari PA, Fadhil Muhammad.

Sapi ‘Berkandang’ Dalam Kota, Bupati Pijay Meradang

Galian C Diduga Penyebab Amblas Jalan Lawe Sekerah Agara KUTACANE (Waspada) : Badan jalan nasional yang amblas sepanjang 50 meter di Desa Lawe Sekerah, Kecamatan Badar, Aceh Tenggara, ditengari akibat ulah perusahaan yang melakukan penambangan galian C di lokasi badan jalan yang amblas itu. Sebagaimana diberitakan sebelumnya, amblasnya badan jalan di Lawe Sekerah, jumat (23/12) lalu, terkesan akibat naiknya debit air. Hal ini dibantah Ir Supryianto, kepada Waspada Selasa

(27/12). Dia mengatakan, besar kemungkinan terjadinya amblas badan jalan sepanjang 50 meter yang memutuskan hubungan jalan tak bisa dilintasi mobil angkutan sembako dari Kutacane ke Gayo Lues itu, karena galian C yang tidak memenuhi standar di lokasi itu. Dikatakan, seharusnya arus aliran sungai yang meluap akibat derasnya guyuran hujan bukan menghantam badan jalan, namun karena terjadinya aksi liar galian C sehingga membelokan luapan sungai menghantam badan jalan, demikian sebut Supryianto. Jalan amblas ini sebelumnya telah ditinjau Bupati Agara H Hasanuddin,B bersama Ketua DPRK H Salim Fakhri, dan

MEUREUDU (Waspada): Bupati Pidie Jaya (Pijay) Drs HM Gade Salam meradang. Menyusul beberapa camat belum mampu menenertibkan hewan ternak sapi “berkandang “di dalam kota, dan sepanjang jalan negara MedanBanda Aceh. “ Ini terakhir kalinya kami ingatkan. Apabila masih ada hewan ternak masyarakat kedapatan masih berkandang di dalam kota, di jalan-jalan negara atau dalam perkarangan kantor pemerintahan. Camat –camat tersebut yang akan kami tertibkan. Karena sudah berkali-kali kami ingatkan kepada para camat, namun tidak juga digubris, makanya akan kami gubriskan” tegas Bupati Pijay Gade Salam, pada acara coffe morning digelar di Pendopo bupati setempat, Selasa (27/12). Sikap tegas itu disampaikan Bupati Gade Salam, karena selama ini sudah cukup banyak korban masyarakat di daerah itu yang meninggal dunia di jalan raya disebabkan ternak masyarakat yang berkeliaran sepanjang jalan negara, seperti di Luengputu, Kecamatan Bandar Baru, Trienggadeng, Uliem, Janka Buya, Meurah Dua, Kecamatan Panta Raja, Bandar Dua dan Kecamatan Meureudu yang merupakan ibu kota kabupaten Pijay. “ Lebih parah lagi di Meuredu yang merupakan ibu kota kabupaten. Itu sapi sampai masuk ke dalam perkarangan pendopo dan kantor bupati. Dan camat Meuredu sudah ratusan kali saya ingatkan untuk menertibkan sapi-sapiitu. Tetapi tidak digubris. Jadi ini yang terakhir kalinya saya ingatkan, apa bila tidak mau digubris juga makan aka anda akan kami gubriskan” demikian tegas Gade. Menurut Gade Salam, akibat banyak hewan ternak di dalam kota dan bermangkal di jalan raya. Kini daerah itu sudah ada kata-kata yang

Dandim Letkol R Andi Roediprijatna W. Arafik Beruh, Ketua LSM GakaG Agara menengarai amblasnya badan jalan nasional yang menyisakan lintasan jalan 1,5 meter sepanjang 50 meter, diduga kuat akibat ulah PT GTL yang selama ini melakukan pengambilan galian C di Lawe Sekerah yang berlokasi di belakang PT GT. Dikatakan, amblasnya jalan nasional tidak sepenuhnya terjadi karena faktor bencana tetapi akibat ulah pengusaha. Arafik meminta aparat hukum menurunkan tim teknis agar dapat diketahui amblasnya jalan nasional sepanjang 50 meter itu bukan akibat bencana. (b25)

Realisasi APBA Aceh Tahun 2012 Capai Target BANDA ACEH (Waspada): Hingga 26 Desember 2011, realisasi keuangan Anggaran Pendapatan dan Belanja Aceh (APBA) Tahun Anggaran 2011 telah mencapai 90 persen, sesuai dengan target 90 persen. Sementara realisasi fisik mencapai 99,5 persen dari target 100 persen. Demikian Ketua P2K dan Staf Ahli Gubernur Aceh Bidang Pembangunan dan Hubungan Luar Negeri, Dr Taqwallah, kepada Waspada, Senin (26/12). “Sisa tidak terserap keuangan diperkirakan sekitar 9 persen atau Rp684 miliar, yang terdiri dari belanja tidak langsung Rp256 miliar dan belanja langsung Rp428 miliar,” jelasnya. Dia merincikan, dari jumlah Rp428 miliar belanja langsung yang tidak terserap terdiri dari sisa lelang Rp220 miliar, sisa kontrak/kegiatan Rp205 miliar dan kegiatan tertunda sebesar Rp23 miliar. Adapun untuk kegiatan tertunda ini, ada 16

SKPA yang realisasinya lebih dari 95 persen, 18 SKPA 90-94 persen, 14 SKPA 85-90 persen dan 5 SKPA yang realisasinya di bawah 85 persen. Sementara mengenai realisasi fisik, Taqwallah menyebutkan, dari 4.110 paket strategis terdapat 198 paket dari 8 SKPA yang konstruksinya dalam penyelesaian (KDP) s.d 31 Desember 2011, terdiri dari BMCK 147 paket, Pengairan 14 paket, Dinas Pendidikan 15 paket, Dispora 6 paket, DPKKA 3 paket, Disnakemobduk 2 paket, dan Dishubkomintel sebanyak 2 paket. Kemudian yang terdeteksi putus kontrak sebanyak 28 paket yang terjadi di 7 SKPA, yakni Dishutbun 13 paket, Dinkes 6 paket, Diskeswannak 5 paket, Pengairan 1 paket, Disdik 1 paket, Sekwan 1 paket dan Distan 1 paket. Untuk itu, sebut Taqwallah, sesuai dengan arahan gubernur pada rapim 23 Desember lalu, tim P2K dan SKPA memantau

porkan delik pidana umum ini ke Polda Aceh,” ujar Wiwin. Amatan Waspada, Selasa (27/12) di PN Sigli, sidang praperadilan Kapolres Pidie yang dimulai sekira pukul 10:00 itu dengan agenda pembacaan amar putusan hanya dihadiri dua orang pihak kuasa hukum keluarga pemohon. Yaitu Wiwin Ibnuhajar dariYayasan Bantuan Hukum Indonesia (YBHI) Banda Aceh dan Said Safwatullah dari Pos Bantuan Hukum dan Hak Asasi Manusia (PB-HAM) Sigli. Sedangkan kuasa hukum termohon, turut hadir Kompol Asrizal, AKP Jatmiko, Iptu Jauhari. Selain itu turut dihadiri masyarakat Gampong Asan, Kecamatan Kota Sigli, tempat asal keluarga pemohon untuk memberi dukungan moral serta puluhan anggota Polres Pidie. Dalam amar putusannya, hakim tunggal Fadli menolak seluruhnya permohonan pemohon dan eksepsi termohon dan membenarkan penangkapan terhadap Salman bin Hasyem yang diduga melakukan percobaan pengancaman dan pemerasan terhadap Bank Pundi Cabang, Sigli pada 17 November 2011. Tetapi hakim dalam putusannya tidak merekomendasikan soal tindak penganiayaan yang diduga dilakukan anggota termohon, yang berujung meninggalnya Salman bin Hasyem. Karena masalah tersebut masuk dalam ranah pidana umum dan bukan ke dalam praperadilan. Sehingga hakim menolak seluruhnya permohonan pemohon. (b10)

bertuliskan berupa peringatan di media, untuk berhati-hati melintasi ruas jalan negara di Pidie Jaya kerena banyak binatang ternak liar berkeliaran sehingga memunculkan jumlah angka lakalantas sangat tinggi. Dalam sepekan terakhir ini saja kata Gade, korban orang meninggal dunia akibat ternak liar tersebut jumlahnya sangat banyak. “ Dan itu patut kita cermati dengan jernih oleh para camat. Meskipun kami tahu tugas camat bukan mengusir sapi. Tetapi kami targetkan tahun 2012 tak ada lagi ternak berada di jalan dan dalam perkantoran dan pusat ibu kota kecamatan, lebih-lebih dalam Kota Meureudu,’’ katanya. Menurut Gade, menyusul pihak kecamatan tidak menertibkan hewan ternak, Gade Salam selaku Bupati Pijay pernah beberapa kali mengusir sapi dan kambing yang masuk dalam perkarangan salah satu kantor camat saat dirinya melintas menuju Kota Banda Aceh. “ Coba saudara bayangkan. Saya ini seorang bupati tetapi karena melihat ada beberapa ekor sapi dan kambing di masuk dalam perkarangan kantor camat saya usir. Tidak hanya itu, saya juga menemukan ada beberapa kantor pemerintahan yang sudah pukul enam sore tidak menurunkan bendera,itu saya yang turunkan. Seorang bupati” ujar Gade Salam dengan nada kecewa. Acara refleksi akhir tahun yang dikemas dalam suasana coffe morning itu dilaksanakan Dinas Perhubungan, Komunikasi, Informatika, dan Parawisata (Dishubkominfopar) Pijay. Dalam acara itu, Bupati Pidie Jaya, Drs HM Gade Salam bertindak sebagai pembicara tunggal untuk memberikan arahan kepada 24 SKPD dalam jajaran pemerintahan yang dipimpinnya. (b10)

Rombongan RTM Malaysia Kunjungi Banda Aceh

paket-paket yang konstruksinya dalam penyelesaian (KDP). “Sambil menunggu penetapan APBA TA. 2012, tim P2K dan SKPA akan melakukan kunjungan selama 6 hari sejak 26 hingga 31 Desember ini,” imbuhnya Ditambahkan, dari pagu sebesar Rp8,3 miliar dalam DIPA tahun 2012, terdapat 4.296 paket strategis yang pengumuman lelangnya akan dilakukan secara kolektif mulai 20 Januari 2012, yang terdiri dari KPA Aceh 888 paket atau senilai Rp558 miliar dan KPA Kabupaten/Kota 2.903 paket atau senilai Rp2,2 triliun. “Untuk itu, seluruh Kepala SKPA diharap dapat memastikan seluruh SK Pengelola Anggaran dan unit layanan pengadaan sudah tuntas sebelum 10 Januari 2012, termasuk kabupaten/kota. Sebagian proses seleksi akan dilakukan dengan menggunakan e-program,” demikian Dr Taqwallah. (b04)

BANDA ACEH (Waspada) : Lembaga Penyiaran Publik (LPP) RRI di Provinsi Aceh selama ini dinilai cukup maksimal dalam merawat dan melestarikan budaya lokal yang merupakan bagian dari budaya nasional. Demikian Direktur Program dan Produksi LPP RRI Pusat, Masduki, pada acara malam seni yang diadakan RRI Banda Aceh-RTM Malaysia, Senin (26/12) malam di auditorium RRI Banda Aceh. Menurut Masduki, kondisi demikian suatu hal yang sangat membanggakan dan dengan maksimalnya dalam merawat dan melestarikan budaya lokal, pihaknya di pusat selama ini menaruh perhatian yang ekstra untuk pengembangan RRI di Provinsi Aceh. “Selama ini di Aceh RRI selain sudah ada tiga stasiun yaitu Banda Aceh, Lhokseumawe dan Meulaboh juga telah dibuka studio produksi di Sabang, Takengon dan Aceh Singkil serta puluhan pemancar relay,” ujar Masduki. Begitupun, diakuinya perhatian yang besar terhadap pengembagan RRI di Aceh juga tidak terlepas dari pertimbangan karena Provinsi Aceh adalah bagian yang tak terpisahkan dari

Indonesia. Pada kesempatan itu Masduki juga menyampaikan surprise terhadap perkembangan Kota Banda Aceh selama ini karena berkembang kalau dibandingkan dengan lima tahun lalu dirinya ke Banda aceh. Kepala LPP RRI Banda Aceh Muliono menjelaskan, kehadiran rombongan dari RTM Malaysia yang berjumlah 93 orang ke Aceh dipimpin Presiden Persatuan Penyiar Kebangsaan Malaysia H Keliwon bin Pajhar. Selama berada di Banda Aceh dari 25 hingga 28 Desember 2011, rombongan duta wisata dari negeri jiran tersebut selain menghadiri malam seni yang diadakan RRI Banda Aceh juga mengunjungi sejumlah situs tsunami di Banda Aceh dan sekitarnya. Pada malam seni yang menampilkan kesenian dan budaya dari kedua negara mengusung thema merajut budaya antar bangsa dan wadah jalinan muhibah persaudaraan IndonesiaMalaysia. Kegiatan malam seni RRI dan RTM Malaysia yang turut dihadiri Wakil Gubernur Aceh Muhammad Nazar dan Wali Kota Banda Aceh Mawardy Nurdin. (b04)

Sepucuk Surat Dedek Untuk Mamak UDARA di kawasan Cota Gapu, Kota Juang, Bireuen, Selasa (27/12) begitu tenang, hanya saja saat itu jalan nasional yang terlihat lalu lalang berbagai jenis kendaraan roda dua dan empat.

Namun, di sebuah lorong di Desa Geulanggang Baroe, terlihat seorang anak remaja, Dedek Syawalinda, 13, anak perempuan yang memiliki kekurangan di bagian wajahnya duduk seorang diri di bangku di depan sebuah kios sambil memegang selembar kertas sambil melihat ibunya Noer Halimah, 33, yang sedang menyapu di halaman rumah berlantai dua. Waspada yang kebetulan singgah ke tempat itu, menyapa gadis kecil yang bagian wajahnya kurang sempurna itu sembari menanyakan kertas di ta-

Waspada/Abdul Mukthi Hasan

DEDEK Syawalia, 13, anak dari Iskandar dan Noer Halimah, warga Desa Geulanggang Baroe, Kota Juang, Bireuen, memegang surat yang diserahkan kepada ibunya untuk mengucapkan selamat Hari Ibu. ngannya. Awalnya diam dan sambil senyum-senyum mengatakan ada isi sesuatu di kertas yang dipegangnya itu. “Ini surat Dedek (panggilan

akrabnya) untuk mamak, mamakkan, Kamis (22/12) memperingati Hari Ibu ke-83. Surat ini mau saya kasih kepadanya karena isinya ucapan selamat Hari Ibu, walaupun terlambat yang penting ada ucapkan selamat untuk mamak kita,” ujar gadis kecil tersebut. Ketika surat di tangannya Waspada minta lihat, anak kedua dari tiga bersaudara pasangan Iskandar-Noer Halimah, awalnya menolak. “Jangan om, ini surat Dedek, mau Dedek kasih untuk mamak, bukan untuk om, om tidak boleh membacanya,” katanya. Pembicaraan Waspada dengan Dedek, ketika itu didengar ibunya yang sedang menyapu, penasaran ibunya juga mendekat seraya menayakan surat apa di tangan anaknya yang sekarang duduk di kelas III SD 16 Kota Juang, Bireuen itu. “Kalau untuk mama mengapa belum dikasih,” tanya ibunya Noer Halimah sambil mendekat ke arah anaknya itu. Merasa sudah diminta, lalu

Dedek-pun menyerahkan surat itu kepada ibunya. Lalu Halimah dengan seksama membacanya, namun tiba-tiba satu air bening jatuh dari kelopak matanya dan dengan reflek mulutnya mengucapakan kata penuh haru sambil menatap ke arah anaknya itu. “Surat ini untuk mamak, Dek, ya? Makasih nak, walaupun kamu cacat wajah, namun kamu begitu perhatian kepada mamakmu ini, semoga kamu jadi anak yang baik ya nak,” katanya sambil mendekati anaknya lalu memeluk erat dan menciumnya penuh haru. Ketika itu juga suasana berubah ibaratnya anak dengan ibunya sedang melepaskan rindu. “Bagaimana kita tak terharu, isi suratnya mengucapkan terimakasih kepada saya yang telah melahirkannya dan mengucapkan selamat Hari Ibu, saya terharu sekali dan kali ini kali kedua dia mengharukan saya. Dulu saat dia rekaman lagu anak terbuang yang pernah beredar di pasaran juga seperti ini, walaupun anak saya cacat

wajah namun perhatian kepada orang tuanya sangat besar,” ucap Halimah sambil memperlihatkan surat itu. Setelah surat diserahkan, Waspada membacanya. Adapun isi surat itu yakni; Assalamualaikum Wr Wb; Selamat Hari Ibu, hari yang membalas jasa ibu, karena Ibulah yang telah mendidik saya sampai saya sebesar ini, ibu-pun tak pernah lelah mendidik saya, dan tak pernah letih mendidik kita, menjaga kita sampai dewasa dan ibupun segalanya bagi kita, ia yang telah mengandung sampai sembilan bulan, ia mengandung tanpa berkata lelah dan letih. Dan walaupun saya kekurangan seperti ini, tapi ibu saya sangat menyayangi saya, ibu engkaulah segalanya bagiku ibu. Lalu surat itu ditulis pantun berbahasa Aceh yang isinya tentang mengenai ibu mengandung. Kata pepatah ureung tuha (orang tua-tua), buluen keudua golom meutente, buleun yang

keulhe baroe nyata (bulan kedua ibu mengandung belum tentu, bula ketiga baru pasti). Buleun keupeut ramee ureueng tanyeong, buleun keulimoeng baroe nyata (bulan keempat banyak yang Tanya, bulan kelima nyata). Buleuen keunam saket lam tuboh, buleun keutujoh makanan gob ba (bulan keenam sakit badan, bulan ketujuh dibawa makanan oleh orang). Buleun keulapan saket lam tuleung, buleuen sikureung uloen lahe u donya (bulan kedelapan sakit dalam tulang, bulan kesembilan saya lahir ke dunia) Nyan keuh seudeh poma Tanya meungandoeng (Begitulah sedihnya ibu kita mengandung dan melahirkan kita). Setelah isi dengan pantun Aceh tentang ibu mengandung, lalu Dedek menutupnya dengan menulis lagi di sudut kiri bawah kertas, khusus buat ibuibu yang ada di seluruh dunia. Selamat Har i Ibu ke-88. Tertanda Dedek. Abdul Mukthi Hasan



‘Markas’ Pesta Ganja Diobrak-abrik, 3 Tersangka Setengah Teler Diringkus IDI (Waspada): Markas yang selama ini dijadikan lokasi pesta ganja di Gampong Aceh, Kecamatan Idi Rayeuk, Kabupaten Aceh Timur, diobrak-abrik aparat kepolisian Satuan Narkoba Polres Aceh Timur, Senin (26/12) malam. Dalam operasi yang dilancarkan anggota Opsnal Satuan Narkoba mengamankan tiga tersangka yakni, MI, 21, IL, 29, dan SAP, 28, ketiganya warga Gampong Aceh, Kecamatan Idi Rayeuk. Bersama tersangka yang setengah sadar itu petugas juga ikut mengamankan barang bukti (BB) berupa ganja sisa yang dihisapnya. Kapolres Aceh Timur AKBP Drs Ridwan Usman melalui Kasat Narkoba Iptu Agus Sunandar, S.Farm saat dikonfirmasi Waspada, Selasa (27/12) membenarkan. Agus Sunandar menambahkan, berdasarkan laporan warga, selanjutnya kepolisian dari Satuan Narkoba melakukan pengintaian di lokasi. Menjelang dinihari, polisi berhasil menangkap ketiga penghisap ganja yang kondisinya setengah sadar. Setelah diperiksa di lokasi dan polisi juga menemukan BB, selanjutnya ketiganya diamankan ke Polres guna pemeriksaan lebih lanjut. (b24)

Baitul Mal Salurkan ZIS Rp684 Juta PEUREULAK (Waspada): Setelah akhir Juli 2011, Badan Baitul Mal Kabupaten Aceh Timur, Provinsi Aceh, kembali menyalurkan Zakat Infak Sedaqah (ZIS) sebesar Rp684.000.000. Penyaluran tahap ketiga di tahun ini dipusatkan di Pendopo Peureulak, Selasa (27/12). Kepala Badan Baitul Mal Aceh Timur, Tgk. H. M. Iqbal, B.Th, MA kepada Waspada mengatakan, penyaluran ZIS kali ini akan dipusatkan di dua lokasi yakni di Pendopo Bupati di Peureulak Selasa (27/12) dan di Sekretariat Daerah Idi Rayeuk, Rabu (28/ 12) hari ini. “Di Idi, besok (hari ini—red) akan diundang yang berhak menerima sebanyak 12 kecamatan dan hari ini diundang 12 kecamatan,” katanya. Lebih lanjut Haji Iqbal merincikan, tahap ketiga penyaluran ZIS kali ini yakni meliputi senif Fakir 85 orang per Rp500.000, Miskin 196 orang per Rp500.000. selanjutnya senif Fisabilillah meliputi ZIS Guru Kolektif 330 orang per Rp300.000, ZIS Pesantren/Dayah 19 orang per Rp1.000.000, ZIS Masjid/Meunasah di 23 Kecamatan/ Rp1.000.000, ZIS Mesjid di 24 Kecamatan/Rp1.000.000, ZIZ Balai Pengajian/TPA sebanyak 78 unit/Rp750.000. Selanjutnya, sambung H Iqbal, senif Ibnu Sabil meliputi Beasiswa santri sebanyak 42 orang per Rp300.000, Beasiswa SD sebanyak 29 murid per Rp200.000, Beasiswa SMP sebanyak 28 siswa/Rp250.000, Beasiswa SMA sebanyak 57 siswa per Rp300.000, Beasiswa D-III sebanyak 16 mahasiswa per Rp400.000, Beasiswa S-1 di dalam daerah sebanyak 240 mahasiswa per Rp500.000 dan Beasiswa luar daerah sebanyak 10 mahasiswa per Rp1.000.000 dan Sekolah Penyetor ZIS sebanyak 16 sekolah per Rp1.000.000. Kemudian, sambung H Iqbal lagi, penyaluran juga terhadap sekolah di bawah Kementrian Agama (Kemenag) Aceh Timur yakni 64 sekolah per Rp1.000.000 dengan total Rp64.000.000. “Selain itu kita juga salurkan untuk senif Muallaf sebanyak 9 orang per Rp1 juta, dan hal amil infak sebanyak Rp42.600.000,” sebutnya se-raya menandaskan, seluruh ZIS yang disalurkan yakni Rp684.000.000. (b24)

Waspada/Muhammad H Ishak

KENDARAAN saat melintasi di jembatan negara di Desa Gampong Beusa, Kecamatan Peureulak, Kabupaten Aceh Timur, yang kondisinya rusak parah dan terancam ambruk.

Jembatan Di Jalinsum Peureulak Barat Terancam Ambruk PEUREULAK (Waspada) : Jembatan di kawasan Jalinsum Banda Aceh–Medan persisnya di Desa Gampong Beusa, Kecamatan Peureulak Barat, Kabupaten Aceh Timur, terancam ambruk. Pasalnya, konstruksi besi dan aspal pada sambungan jembatan rangka baja itu mulai hancur. Bahkan, ketika dilintasi kendaraan pengangkut alat berat mengakibatkan jembatan bergetar hingga ke seluruh badan jembatan. Pantauan Waspada, Selasa (27/12), titik yang menjadi sambungan jembatan itu makin kritis dan mengakibatkan lubang mengangga. Lubang tersebut mengancam keselamatan pengguna jalan. Kendaraan yang mengetahui jembatan rusak selalu melambatkan laju kendaraannya saat melintas pada sambungan jembatan. Dari panjang jembatan sekira 100 meter itu terdapat 4 titik sambungan jembatan yang kondisinya berlubang dan besinya hancur. Rosiana, 20, pengendara sepedamotor mengaku, jika tidak segera diperbaiki diperkirakan lubang di atas jembatan yang terdapat pada sambungannya mengancam pengguna jalan. “Bahkan lubang di atas ruas jembatan juga bertabur lubang,” katanya seraya menambahkan, pihak terkait sudah beberapa kali memperbaikinya dengan menempel lubang itu, tapi masih belum efektif dan terus terjadi kerusakan. Ketua Komite Nasional Pemuda Indonesia (KNPI) Aceh Timur Iskandar Usman Al Farlaky mendesak Dinas Bina Marga dan Cipta Karya (BMCK) melalui SUB Langsa melakukan perbaikan jembatan negara, sebab jembatan Peureulak itu adalah urat nadi warga dengan segala keperluan ke wilayah Sumatera Utara.(b24)

Rabu 28 Desember 2011

Perusahaan Diminta Bayar Upah Pekerja

Umat Diminta Doakan Ulama Aceh IDI (Waspada) : Umat muslim dan muslimah diminta senantiasa mendoakan kesembuhan sejumlah ulama kharismatik dan ulama besar Aceh yang kini sedang sakit. Selain itu juga agar diminta melaksanakan shalat ghaib (shalat jenazah jarak jauh— red) terhadap ulama-ulama yang meninggal dunia. Demikian dikatakan anggota Komite III DPD Tgk H Abdurrahman BTM, Selasa (27/12). Menurutnya, sangat wajar umat muslim di Aceh melakukan hal tersebut, sebab berdasarkan sebuah hadist Rasulullah SAW, ulama adalah pewaris segala ambiya (para nabi). H Abdurrahman BTM juga mengucapkan berduka yang sedalamnya-dalamnya atas kepergian Tgk Syeh H Adnan Mahmud Bakongan, Selasa (27/12) sekira pukul 01:00. Almarhum meninggal dunia di usia 108 tahun di kediamannya di Kecamatan Bakongan, Aceh Selatan. Semasa hidupnya, beliau banyak mendidik muridmuridnya di Aceh Selatan atau di seluruh Aceh hingga ke Sumatera Utara. Almarhum Syeh Adnan dikenal sosok ulama besar dan kharismatik Aceh. Selain memimpin pondok pesantren juga selama sehatnya sering diundang ke seluruh Aceh untuk berdakwah. “Usia beliau sudah sangat lanjut, bahkan sangat sedikit ulama Aceh yang usianya seperti beliau,” papar Abdurrahman. Untuk itu, dia meminta umat Islam se-Aceh agar mendoakan sejumlah ulama Aceh yang kini menderita sakit seperti Tgk H M Amin (Abu Tumin) dan Tgk H Ibrahim Bardan (Abu Panton). (b24)


UMP Aceh Rp1,4 Juta Per Bulan LANGSA (Waspada) : Pemerintah Aceh meminta seluruh pengusaha dan perusahaan yang bergerak di Aceh segera menyesuaikan dan membayar para pekerjanya dengan standar Upah Minimum Provinsi (UMP) Aceh yang mencapai Rp1,4 juta per bulan. “Kita harapkan perusahaan yang kondisi keuangannya sehat segera membayar UMP kepada para pekerjanya,” ujar Anwar TM Ali, Kepala Bagian Perindustrian dan Jamsos di Dinas Ketenagakerjaan dan Mobilitas Penduduk Aceh, di sela-sela penandatanganan Perjanjian Kerjasama (PKB) antara PTPN I Aceh dengan Serikat Pekerja Perkebunan (SPBUN) setempat, Selasa (27/12). Dikatakan, perusahaan yang tidak mampu membayar UMP segera melapor kepada pihak-

Waspada/Muhammad Hanafiah

RATUSAN tenaga kontrak Pertamina Rantau, Kabupaten Aceh Tamiang yang mengadu ke DPRK Aceh Tamiang, Selasa (27/12).

Pekerja Kontrak Pertamina Rantau Terancam Dipecat Mengadu Ke DPRK Aceh Tamiang KUALASIMPANG (Waspada): Ratusan tenaga kontrak ( Pekarya) Pertamina Rantau, Kabupaten Aceh Tamiang, Selasa (27/12) mendatangi DPRK Aceh Tamiang mengadukan nasib mereka yang terancam dipecat.

Mereka diduga telah diintimidasi Pertamina Rantau melalui vendor ( perusahaan pemasok tenaga kerja kontrak) di perusahaan penghasil minyak dan gas ( migas). Pantauan Waspada, kedatangan ratusan karyawan kontrak itu menggunakan sepedamotor erkumpul di halaman gedung wakil rakyat tersebut.Namun, tidak ada seorangpun pimpinan dewan yang menyambut kedatangan 275 orang tenaga kontrak itu. Menurut Ketua Komisi A DPRK Aceh Tamiang, Bukhari,SE kepada ratusan tenaga kontrak, Ketua DPRK Aceh Tamiang, Ir Rusman dan Wakil Ketua ,Drs H.Armand Muis sedang ada urusan tugas ke luar kota,sedangkan Wakil Ketua, Nora Idah Nita sedang sakit. Mereka disambut Ketua Komisi A, Bukhari dan Sekretaris Komisi A, Jafar Ketong di Ruang Banmus DPRK Aceh Tamiang dengan utusan perwakilan te-

naga kontrak yaitu Muhammad Zein B, Anjasmara, Syahruddin,Syamsuddin Halim, Adral, Nyakman, Muhammad Hatta, Ruslan, Darwin, Amir. Penuhi Panggilan Sidang Utusan tenaga kontrak itu mengungkapkan, ratusan tenaga kontrak Pertamina Rantau itu pada hari Jumat (23 Desember 2011) memenuhi panggilan sidang ke VIII agenda sidang menghadirkan saksi-saksi dari pihak tergugat ( PT Pertamina EP Field Rantau) di Pengadilan Negeri Hubungan Industrial ( PHI) di Banda Aceh untuk menyelesaikan perselisihan Hubungan Industrial Pekerja Kontrak PTPertamina EP Fiel Rantau dengan Perusahaan PT Pertamina EP Field Rantau, Kabupaten Aceh Tamiang. Masih menurut pengakuan dari delegasi, ketika mau berangkat ke Banda Aceh untuk menghadiri sidang, mereka telah membuat surat pemberitahuan ke PT Pertamina EP Field Rantau dan kepada masing-masing vendor ( baca: Perusahaan yang memasok mereka untuk bekerja) di Pertamina Rantau. “ Sebagai warga negara Indonesia yang mematuhi hukum, maka kami sebanyak 275 orang pergi ke Banda Aceh untuk memenuhi surat panggilan menghadiri sidang di Banda Aceh, “ terang delegasi. Namun, ungkap mereka, setelah mereka pulang dari

Banda Aceh , ternyata pada tanggal 24 Desember 2011 pihak PT Pertamina Rantau menerbitkan surat yang ditujukan kepada vendor yang isinya menyatakan kami semua telah mangkir massal dan semua diskorsing selama tiga hari serta ada ancaman intimidasi yang menyatakan surat tersebut merupakan surat peringgatan terakhir karena meninggalkan lokasi pekerjaan tanpa izin dari perusahaan. “ Hal ini namanya sengaja mencari-cari kesalahan pada kami, sebab sebelum berangkat kami sudah membuat surat pemberitahuan ,tetap kenapa kami ketika itu tidak dilarang berangkat ke Banda Aceh, namun kenapa begitu kami pulang dari Banda Aceh langsung diskorsing dan diintimidasi Pertamina dan vendor,” kecam tenaga kontrak itu kemarin. Karena itu mereka memohon kepada DPRK Aceh Tamiang untuk segera memanggil PT Pertamina Rantau .” Perusahaan sudah mengintimidasi dan berbuat sewenang-wenang kepada kami yang selama ini mengabdi untuk perusahaan itu, bahkan kami terancam mau dipecat ,” pinta mereka. Bukhari dan Jafar Ketong menyatakan nanti pihaknya akan berkoordinasi dengan pimpinan dewan dan Pemkab Aceh Tamiang untuk memanggil Pertamina Rantau dan vendor. (b23)

38 Guru Dari UPI Bandung Mengajar Di Pedalaman Aceh IDI (Waspada) : 38 Guru dengan berbagai disiplin ilmu yang lulus seleksi di Universitas Pendidikan Indonesia (UPI) Bandung akan ditempatkan di sejumlah daerah terpencil di Kabupaten Aceh Timur. Proses serah terima dipusatkan di Kantor Dinas Pendidikan Aceh Timur di Langsa, Selasa (27/12). Kepala Dinas Pendidikan Aceh Timur H Agussalim didampingi Kabid Dikmen Muhammad Yakob mengatakan, 38 tenaga pendidik dari luar Aceh itu akan ditempatkan di sejumlah sekolah di kawasan pedalaman seperti Lokop dan Peunarun dengan jarak 40-80 kilometer ke arah selatan jalan negara. Agussalim merincikan, dari 38 guru akan ditempatkan di Sekolah Dasar (SD) sebanyak

27 orang, sementara 11 lainnya ditempatkan di SMP. “Para guru ini dikontrak oleh Kementerian Pendidikan Nasional selama 1 tahun,” paparnya seraya mengatakan, setelah selesai kontrak akan dikembalikan ke UPI Bandung. Agussalim meminta seluruh komunitas sekolah agar mendukung program pemerintah itu dalam mencerdaskan bangsa ini hingga ke seluruh pelosok tanah air. “Kita masih kekurangan guru, jadi dengan program ini kita harap komunitas sekolah terutama wali siswa mendukung keberadaan para guru yang nantinya akan menjalankan tugas dan fungsinya sebagai tenaga pendidik,” kata Agussalim. Bupati Aceh Timur Muslim Hasballah didampingi Ketua

MPD Aceh Timur Abdullah Arya juga mendukung program Mendiknas yang mengalokasikan 38 guru untuk mencerdaskan putra putri Aceh Timur, khususnya di daerah tertinggal. “Ini kesempatan emas untuk Aceh Timur, karena tidak semua kabupaten/kota mendapatkan jatah dari Mendiknas,” katanya. Untuk itu, kata Muslim, diharapkan wali murid/wali siswa memanfaatkan kesempatan itu untuk mendukung proses pendidikan di kawasan pedalaman Aceh Timur. “Secara tidak langsung ini juga berkat kerja keras Dinas Pendidikan Aceh Timur yang menempatkan 38 guru yang dikontrak Mendiknas untuk ditempatkan di Aceh Timur,” tutur Muslim. (b24)

nya agar dicarikan jalan musyawarah, sehingga tercapai kesepakatan antara manajemen perusahaan dan para pekerja. Dikatakan, hendaknya laporan ketidaksanggupan telah dilakukan satu bulan sebelum jatuh tempo pelaksanaan UMP yang dilaksanakan 1 Januari 2012 mendatang. Sampai sejauh ini, menurutnya, baru dua perusahaan di Aceh yang sudah menyatakan kesanggupan melaksanakan UMP yaitu PTPN I Aceh serta PT SAI, perusahaan penghasil semen di Aceh Besar. Menanggapi isi PKB antara pihak PTPN I dan pekerja, menurutnya, sangat menarik karena banyak hal yang berkembang seperti soal bonus yang akan diberikan kepada para pekerja dari hasil laba perusahaan. (b22)

PTPN I Aceh Tandatangan PKB Dengan SPBUN LANGSA (Waspada) : Guna menjamin hak dan kewajiban manajemen perusahaan dan pekerja di lingkungan PT Perkebunan Nusantara I (PTPN I) Aceh, kemarin, kedua belah pihak melakukan penandatanganan Perjanjian Kerjasama (PKB). Kesepatan PKB untuk tahun 2012/2013 ditandatangani Direktur PTPNI I Erwin Nasution dan Ketua Serika Pekerja Perkebunan (SPBUN) Ramadhan Ismail di aula kantor direksi PTPN I di kawasan Kebun Baru, Waspada/Samsuar Kota Langsa, Selasa (27/12). DIREKTUR PTPN I Aceh Erwin Nasution bersama Ketua Serikat Ramadhan Ismail me- Pekerja Perkebunan (SPBUN) Ramadhan Ismail melakukan ngatakan, banyak hal yang penandatanganan Perjanjian Kerjasama (PKB) yang dilakukan dicapai dalam penyusunan di kantor direksi PTPN I Aceh, Selasa (27/12). PKB antara manajemen dan SPBUN, salah satunya soal pengupahan yang “Yang paling penting soal keadilan berkarir bagi untuk pertama sekali sejak 1998, pihak PTPN para pekerja, karena ini menyangkut masa I sanggup membayar UMP para pekerja. depan,” katanya. “Baru tahun ini pihak manajemen mampu Direktur PTPN I Erwin Nasution menyammembayar UMP bagi pekerja. Ini tidak terlepas but baik kesepakatan PKB itu yang menurutnya dari kondisi keuangan perusahaan yang sema- menjadi acuan bagi pihak manajemen dan kin sehat serta kerjasama antara pihak pekerja pekerja dalam melakukan berbagai hal. dan manajemen yang terjalin mesra selama “PKB merupakan landasan hukum bagi ini,” ujarnya. setiap akti-vitas pekerja dan pihak manajemen, Dia menekankan, ada dua poin keadilan dalam PKB semua hak dan kewajiban kedua yang dicapai dalam PKB tahun ini di antaranya belah pihak diatur, mudah-mudahan kita dapat soal perolehan pendapatan yang semakin baik melaksanakannya dengan baik,” ujarnya. (b22/ serta soal keadilan berkarir bagi seluruh pekerja. b21)

H Abdullah Rasyid Di Pengajian Ulama-Umara Aceh Timur

Anak Zina Tak Boleh Dikeluarkan Akte Kelahiran PEUREULAK (Waspada): Tgk H Abdullah Rasyid (Abu Lah) menegaskan, anak yang lahir di luar nikah tidak boleh dikeluarkan Akte Kelahiran. Sebab akan berdampak kepada harta warisan. Demikian Tgk H Abdullah Rasyid didampingi Tgk. H. Bukhari Hasan dalam Pengajian Ulama – Umara se Aceh Timur, Sabtu (24/12) di Balai Pengajian Ulama – Umara di Desa Alue Bu, Kecamatan Peureulak Barat, Aceh Timur. Menjawab pertanyaan salah seorang jamaah, H. Abdullah Rasyid menegaskan hal itu dan perlu disampaikan untuk seluruh umat Islam diseluruh pelosok. Dikatakan, anak yang lahir di luar nikah

akan berdampak banyak hal seperti harta warisan, “ karena anak zina (lahir di luar nikah— red) tidak bisa menerima harta warisan dari ayah zina,” katanya seraya menandaskan, jika Akte Kelahiran dikeluarkan oleh instansi pemerintahan maka bisa jadi nantinya anak zina itu bisa mendapatkan harta warisan. “Untuk itu, hal ini perlu ditegaskan dan perlu diketahui masyarakat luas. Apalagi sekarang sudah banyak orang yang membuat Akte Kelahiran,” kata H Abdullah Rasyid seraya mengingatkan instansi pemerintah juga harus hatihati dalam mengeluarkan Akte Kelahiran terhadap seseorang penduduk. (b24)

Ulama Kharismatik Aceh Syech H Adnan Mahmud Wafat TAPAKTUAN(Waspada):InnalillahiWainna Ilahi Rajiun. Aceh yang dikenal dengan negeri Serambi Makkah, kembali kehilangan ulama besarnya. Ulama kharismatik Syech H.Adnan Mahmud,97, berpulang ke rahmatullah, Selasa (27/12) sekira pukul 01:00, di kediamannya di Bakongan, Aceh Selatan. Wafatnya ulama karismatik, pimpinan Pesantreen Ashabul Yamin dan murid tertua Syech Muda Waly itu, cepat tersiar sejak Selasa pagi. Ribuan pelayat dari berbagai daerah dan dusun tampak membanjiri Kedai Bakongan, melayat ke rumah duka. sekitar 75 kilometer dari Tapaktuan ke jurusan Medan Menurut Syech H Marhaban, salah seorang putranya, meninggalnya Abu Adan, panggilan akrabnya karena penyakit tua. “Beliau memang sakit dan pernah berobat ke Penang, Malaysia, beberapa waktu lalu, tetapi telah sembuh,” ucapnya. Memang kata Marhaban yang sering dipanggil Waled Marhaban, kondisi kesehatan almarhum dalam beberapa hari kian memburuk. Almarhum meninggalkan tujuh putra dan dimakamkan di komplek Pesantren Ashabul Yamin, Tgk Chik Diribee Chik. “Kita kembali kehilangan ulama besar,”kata salah seorang

tokoh masyarakat yang melayat di rumah duka. Kilas Balik Syech H Adnan Mahmud, lahir di Suak Berambang Kecamatan Manggeng Aceh Selatan (kini Kecamatan Lembah Sabil, Abdya), tahun 1914, atau 97 tahun silam. Seusai menamatkan sekolah desa di desa kelahirannya, Suak Berambang, beliau belajar di Dayah Bustanuh Huda, Blangpidie, Aceh Barat Daya yang saat itu dipimpin Syech H Mahmud, lebih dikenal dengan nama Abu Syech Mud, bersama Syech H Muda Waly Alkhalidy. Selain di Bustanul Huda, Abu Adnan juga belajar di sejumlah dayah lainnya di dalam dan luar Aceh secara tidak menetap. Karena tekad beliau belajar agama tidak pernah mengenal usia,tempat dan waktu. Dalam mengemban misi syariat, sama persis dengan ajaran Syech Muda Waly Alkhalidy. Yaitu sama-sama menganut mazhab Syafi’ie dalam syariat, faham sunny (ahlussunnah) dalam aqidah dan tarekat Naqsyabandi dalam tasauf. Dalam bidang organisasi politik pun, ia praktis satu haluan dengan Muda Waly. Beliau pernah menjabat sebagai koordinator Partai Islam (PI) Perti Aceh Selatan (1950-1960) yang dipelopori Syech Muda Waly.(b30)

Mahasiswa Stikes Bina Bangsa Tuntut Puket I Dicopot KUALASIMPANG (Waspada): Ratusan mahasiswa Sekolah Tinggi Ilmu Kesehatan ( Stikes) Bina Bangsa Kualasimpang, Kabupaten Aceh Tamiang menggelar aksi demo menuntut dikeluarkannya Puket I, Ns Elka Halifah,S.Kep dari kampus itu karena telah melakukan berbagai dugaan kesalahan yang diterapkan di kampus itu. Menurut para pendemo, Selasa (27/12), Puket I Stikes Bina Bangsa,Ns Elka Halifah, S.Kep telah melakukan kesalahan pelaksanaan Perkenalan Program Studi Mahasiswa (PPSM). Para pendemo juga dalam pernyataan sikapnya mengungkapkan, Puket I menahan Surat Keputusan Badan Ekse-

kutif Mahasiswa tanpa alasan yang jelas, tidak mengakui adanya BEM di Kampus Stikes Bina Bangsa Kualasimpang, memaksa mahasiswa menandatangani surat non aktif kuliah, mengambil alih tugas dan tanggung jawab dari BEM, Ka. Prodi PSIK, Puket II dan Puket III tanpa sepengetahuan pihak terkait. Selanjutnya, ungkap pendemo, Puket I dengan sengaja menaikan biaya praktik 100 persen tanpa sepengetahuan pihak yayasan dan Puket I tidak pernah menjelaskan rincian biaya praktik ke mahasiswa. Para pendemo juga menuntut kepada Yayasan Getsampena untuk melengkapi fasilitas-fasilitas kampus.

Para mahasiswa juga meminta Yayasan Getsampena mengeluarkan Puket I dari kampus Stikes Bina Bangsa Kualasimpang, pihak Yayasan harus hadir untuk memenuhi tuntutan mahasiswa dalam jangka waktu 3 x 24 jam terhitung Selasa (27/12) Para mahasiswa juga menuntut Stikes Bina Bangsa Kualasimpang untuk membuat aturan kampus secara tertulis dan sosialisasikan kepada mahasiswa, memperbaiki manajemen kampus, memilih staf yang berkualitas dan professional untuk memajukan Stikes, menentukan jadwal kuliah/ roster secara tetap dan buat kalender akademik. Setelah menggelar orasi,

utusan mahasiswa yaitu Mustafa (Ketua BEM), Jualdi (Wakil Ketua BEM)dan M.Ilyas, Nurdin masing-masing sebagai anggota BEM serta Mariati, Opa Sari, Romaniah masing-masing mewakili mahasiswi kebidanan menggelar pertemuan dengan Ketua Stikes Bina Bangsa, Puket I Ns Elka Halifah,S.Kep dan pihak lainnya, namun belum membuahkan hasil keputusan. Ketua BEM Stikes Bina Bangsa, Mustafa seusai pertemuan menyatakan pihak Yayasan Getsampena Stikes Bina Bangsa Kualasimpang akan memutuskan tuntutan para mahasiswa itu pada hari Kamis (29/12) sore. “Karena itu kita tetap mogok kuliah sampai ada keputusan dari Yayasan dan pihak kampus ini,” tegas Mustafa. (b23)

Waspada/Muhammad Hanafiah

MAHASISWA Stikes Bina Bangsa Kualasimpang, Kabupaten Aceh Tamiang berorasi pada aksi demo di halaman kampus itu, Selasa (27/12).

Waspada, Rabu 28 Desember 2011