Page 1

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

RABU, Kliwon, 27 Februari 2013/16 Rabiul Akhir 1434 H

No: 24147 Tahun Ke-67

Terbit 24 Halaman (A1-12, B1-12)

Besok, Gatot Dilantik Di Jakarta

Kampanye Akbar Di Lap. Merdeka Medan

SBY Perintahkan Kader Demokrat Dukung Amri RE

MEDAN (Waspada): Hampir dapat dipastikan Gatot Pujo Nugroho akan dilantik menjadi Gubsu periode 2008-2013, besok (Kamis 28/2). Pelantikan berlangsung di Jakarta. Badan Musyawarah (Banmus) DPRD Sumut Selasa (26/2) mengadakan rapat. Salah satu agendanya adalah jadwal pelantikan Gatot Pujo Nugroho menjadi Gubsu sampai akhir periode 2013. Waspada memperoleh informasi, jalannya rapat Banmus tidak lagi hangat. Berbeda dengan pelaksanaan rapat 21 Februari 2013. Waktu itu terjadi tarik menarik pendapat tentang tanggal pelantikan Gatot. Sebagian anggota Banmus menolak jadwal yang telah dibuat oleh pimpinan dewan sebelumnya, yakni 25 Februari 2013. Padahal tanggal itu dipilih merupakan hasil rapat pimpinan dewan dengan pimpinan fraksi-fraksi. Juga kabarnya tanggal itu sudah pula dikonsultasikan kepada Kemendagri. Oleh sebagian anggota Banmus waktu itu, menolak tanggal pelantikan Gatot dengan alasan yang sangat bernuansa politis. Mereka khawatir gaung pelantikan tersebut akan menaikkan popularitas Gatot pada pelaksanaan Pilgubsu 7 Maret 2013. Berbagai alasanpun disampaikan anggota Banmus untuk menggagalkan

Lanjut ke hal A2 kol. 7

Harga Eceran: Rp2.500,-

Waspada/Muhammad Thariq

KETUA DPR RI Marzuki Alie bersama Menteri Koperasi dan UKM Syarief Hasan, Plt Ketua Partai Demokrat Medan Sutan Bhatoegana, Ketua DPD Partai Demokrat Sumut HT Milwan berkampanye untuk Amri RE di Lapangan Merdeka Medan, Selasa (26/2).

MEDAN (Waspada): Ketua Dewan Pembina Partai Demokrat Susilo Bambang Yudhoyono (SBY) memerintahkan kepada kader partai untuk membantu memenangkan pasangan nomor urut 4 Drs Haji Amri Tambunan dan RE Nainggolan dalam Pilgubsu 7 Maret 2013. “ Pesan Pak SBY kepada kader Partai Demokrat untuk memberikan dukungan kepada Amri RE. Kami sebagai kader Demokrat datang ke Sumatera Utara atas instruksi beliau (SBY-red) untuk memberikan dukungan kepada Amri RE untuk memperbaiki Sumatera Utara,” kata Ketua DPR RI Marzuki Alie didampingi Menteri Koperasi dan UKM Syarief Hasan, Wakil Ketua DPP Partai Demokrat Johnny Alen Marbun bersama Sutan Bhatoegana anggota DPR RI dari Partai Demokrat di hadapan ribuan masyarakat yang memberikan dukungan kepada Amri RE pada kampanye akbar nomor urut 4 di Lapangan Merdeka Medan, Selasa (26/2). Marzuki Alie yang juga wakil ketua Dewan Pembina Demokrat menegaskan, Menteri

Lanjut ke hal A2 kol. 6

Ketua MK: Negara Ini Mau Ambruk Koruptor Sikat Saja Siapapun Dia CISARUA (Waspada): Ketua Mahkamah Konstitusi (MK) Mahfud MD sempat mengunjungi kediaman Anas Urbaningrum di Jalan Teluk Langsa, Duren Sawit, Jakarta Timur. Mahfud yang juga ketua presidium KAHMI ini bersimpati atas kasus yang menimpa Anas. Tapi, Mahfud membantah bila dirinya akan melindungi Anas. “Anas itu adik saya, junior saya. Sebab itu saya berempati dan bersimpati. Dan saya melakukan hal yang sama kepada Bachtiar Chamsah

Waspada/Surya Efendi

GATOT Pujo Nugroho dan Tengku Erry Nuradi menyapa 55 ribu pendukung dari Asahan, Tanjungbalai, Labura, Batubara dalam kampanye akbar di Lapangan Parasamya, Kota Kisaran, Kab. Asahan, Selasa (26/2).

Kampanye GanTeng Di Kisaran

Peningkatan Daya Saing Untuk Pengembangan Potensi Wilayah KISARAN (Waspada): Kebangkitan Provinsi Sumatera Utara dengan melanjutkan program pembangunan yang telah dilakukan harus ditopang peningkatan daya saing melalui perbaikan sumber daya manusia, infrastruktur, sumber energi dan ketersediaan pangan. “ Program pembangunan Provinsi Sumatera Utara di Kab. Asahan, Batubara, Kota

Tanjungbalai dan wilayah Labuhanbatu yang kaya berbagai potensi harus dilanjutkan secara terpadu dan memenuhi kebutuhan masyarakat. Saya, Gatot Pujo Nugroho dan Tengku Erry Nuradi siap melayani rakyat untuk bersama membangun Sumatera Utara lima tahun ke depan,” kata Gatot Pujo Nugroho dalam orasi politik di kampanye akbar GanTeng, di lapangan Parasamya,

Al Bayan

Golongan Beruntung Oleh Tgk. H. Ameer Hamzah IMAM Ahmad dan Imam Turmidzi Radhiallahu anhuma meriwayatkan sebuah hadis dari Rasulullah SAW: Sesungguhnya dunia ini milik empat golongan, yaitu; Pertama orang yang diberikan harta dan ilmu. Kedua; diberikan ilmu tanpa harta. Ketiga; diberikan harta tanpa ilmu, keempat; tidak diberikan harta dan ilmu. Golongan pertama, hamba yang dianugerahi harta dan ilmu oleh Allah. Dia bertakwa kepada Allah Azza wajalla karena harta dan ilmunya, ia menyambung tali persaudaraan (silaturrahim) dan mengetahui hak Allah (zakat, infak dan shadaqah di jalan Allah). Ini adalah kedudukan yang paling baik. Syaikhul Islam Ibnu Taimiyah mengatakan: Golongan pertama ini dipelopori oleh Nabi Ibrahim, Nabi Sulaiman, Nabi Musa, dan di kalangan sahabat Nabi Muhammad adalah Abubakar Shiddiq, Abdurrahman bin Auf, Utsman

Lanjut ke hal A2 kol. 3

Kisaran, Selasa (26/2). Kampanye dihadiri puluhan ribu massa dari Asahan, Batubara, Tanjungbalai dan Labuhanbatu. Kehadiran pasangan GanTeng diiringi Reog Ponorogo, para ketua partai pengusung GanTeng, relawan, dan pagar betis massa Pemuda Pancasila. Pasangan GanTeng dieluelukan massa pendukungnya

Lanjut ke hal A2 kol. 3

ketika di penjara,” kata Mahfud di Cisarua, Jawa Barat, Selasa (26/2).

Lanjut ke hal A2 kol. 3

Berkas 5 Kasus Korupsi Besar Di Aceh Lengkap SEULAWAH, Aceh Besar (Waspada): Polda Aceh menetapkan tersangka lima kasus dugaan korupsi di daerah itu. Berkas kasus itu sudah dinyatakan P21 atau lengkap dan diserahkan kepada Kejati Aceh. Kasus yang telah dinyatakan lengkap, diantaranya, tindak pidana korupsi pada pengadaan bibit kakao di Aceh Selatan tahun 2009 dengan nilai kontrak sebesar Rp2.617.995.325, bersumber dari dana otonomi khusus (otsus) Kab. Aceh Selatan dengan tersangka Mwd dan kawan-kawan. Tindak pidana korupsi penggunaan dana Otsus APBA T.A 2009 dan 2010 pada kegiatan pekerjaan pembangunan

objek wisata Ie Seuum Kab, Aceh Besar dengan kerugian negara sebesar Rp 230.951.188, dengan tersangka Drs RMA dan kawan-kawan. Tindak pidana korupsi pembangunan peningkatan free intake Lueng III Cot Gud T.A 2010 dengan nilai kontrak Rp3.220.010.000, bersumber dari dana Otsus Dinas Pengairan Kab. Nagan Raya dengan tersangka TNP dan kawankawan. Bersamaan dengan itu Polda menangani kasus tindak pidana dugaan korupsi pada pekerjaan pengamanan tebing inteke Lueng III Cot Gud T.A. 2010 dengan nilai kontrak

Lanjut ke hal A2 kol. 3

Truk PT. TPL Dibakar, 31 Warga Ditangkap DOLOKSANGGUL (Waspada): Pembakaran truk Colt Diesel BK 6390 CC milik PT. Toba Pulp Lestari (PT. TPL), berbuntut pan-

jang. Selain 31 warga ditangkap, juga memicu demo 500an massa. Masyarakat Desa Pandumaan Sipituhuta, Kec. Pollung,

Waspada/Parlindungan Hutasoit

SEKIRA 500 warga Desa Pandumaan Sipituhuta, Kec. Pollung, mendatangi Mapolres Humbang Hasundutan menuntut 31 rekan mereka dibebaskan.

Kab. Humbang Hasundutan (Humbahas) bergerak ke Polres Humbahas, Selasa (26/2), meminta rekan mereka yang ditangkap dibebaskan. Kapolres Humbahas, AKBP. Heri Sulesmono Sik mengamankan 31 warga yang diduga terlibat pembakaran truk milik PT TPL, berikut menyita 15 senjata tajam berupa golok milik warga Desa Pandumaan Sipituhuta, Kec. Pollung. Di tengah derasnya hujan, 500-an warga menuntut Polres melepaskan ke31 orang rekan mereka. Sebelum menyampaikan tuntutannya warga melakukan kebaktian, sebagai lambang ketulusan tuntutan mereka. Lanjut ke hal A2 kol. 1

Waspada/Armin Nasution

GUS Irawan Pasaribu dan Soekirman berorasi di hadapan masyarakat Siborong-borong untuk menyampaikan janji politiknya kemarin.

Kampanye Di Siborong-borong

GusMan Berjanji Perbaiki Semua Jalan Rusak SIBORONG-BORONG (Waspada): Kejenuhan masyarakat Tapanuli Utara terhadap kondisi jalan lintas Sumatera di Taput yang sangat buruk terus menjadi keluhan masyarakat. Hal ini berkali-kali disuarakan masyarakat saat menghadiri kampanye pasangan cagub-cawagub Sumut nomor urut 1 Gus Irawan PasaribuSoekirman di Lapangan Pacuan Kuda Siborong-borong,

Selasa (26/2). “ Dan kami siap memperbaiki semua jalan rusak terutama jalan provinsi. Kalau jalan nasional dan jalan kabupaten kota akan kami sampaikan melalui cara yang sudah ditentukan. Misalnya dengan melobi pusat dan tentu saja berangkulan dengan semua kepala daerah se-Sumut untuk berkoordinasi,” jelas Gus Irawan Pasaribu. Di hadapan ribuan masa

pendukung, Gus Irawan dan Soekirman (GusMan) dalam orasi kesejahteraannya menegaskan komitmen pasangan ini untuk memberikan pelayanan terbaik untuk Sumut. Salah satu pelayanan terbaik yang menjadi prioritas itu berupa pembangunan infrastruktur jalan yang memberikan keamanan dan kenyamanan untuk masyarakat.

Lanjut ke hal A2 kol. 6

Ada-ada Saja Bersiul, Ke Penjara PERCAYA atau tidak, bersiul bisa diganjar hukuman penjara. Setidaknya itulah yang dialami pria ini. Robert Smith, yang juga dikenal sebagai Tukang Siul di kota Portland, Amerika Serikat terpaksa mendekam dipenjara karena siulannya dianggap

Lanjut ke hal A2 kol. 2

Serampang - Halaman kedua masih kosong? - He...he...he...

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

RABU, Pahing, 27 Februari 2013/16 Rabiul Akhir 1434 H

Lanjut ke hal A2 kol 2

Terbit 24 Halaman (A1-12, B1-12)  z Harga Eceran: Rp 2.500,-


Kapolda: Polisi Jangan Suka Minta-minta SEULAWAH, Aceh Besar(Waspada): Kapolda Aceh Irjen Pol Herman Effendi mengimbau kepada seluruh personil di jajaran Polda Aceh agar tidak menjadi polisi yang suka meminta-minta. “Bila masuk polisi nya pakai uang, sudah pasti kalau sudah jadi akan suka meminta-minta. Kebiasaan seperti ini yang harus dihapuskan dalam perekrutan polisi,” kata Kapolda, usai upacara pengambilan sumpah brigadir Polri gelombang II T.A 2012-2013 di SPN Seulawah Aceh Besar, Selasa (26/2). Di hadapan para bintara yang baru lulus dan orang tua, Kapolda mengingatkan untuk tidak melakukan hal-hal yang dilarang undang-undang. Seperti halnya meminta-minta uang yang bukan hak dan pada jalurnya. Sebab, penerimaan brigadir Polri ini dilakukan secara gratis, maka tidak ada istilah lagi untuk berusaha mengembalikan uang yang dikeluarkan untuk bisa masuk anggota Polri. ‘’Jika ditemukan akan ditindak tegas,’’ kata Kapolda. Untuk memastikan para orang tua para

z No: 24147 * Tahun Ke-67

Ketua MK: Anas Korupsi, Sikat Saja


KETURUNAN Raja Nagan Raya, Kabupaten Nagan Raya, Aceh, Zulkarnain (dua kiri) didampingi keturunan Raja Meureuhom Daya, Lamno, Kabupaten Aceh Jaya, T Syaiful (dua kanan) memberikan penjelasan dalam forum yang dihadiri keturunan raja-raja Aceh di Banda Aceh, Selasa (26/2). Sembilan keturunan raja Aceh (pewaris raja) mengadakan pertemuan untuk membentuk forum bersama guna melestarikan nilai-nilai adat yang pernah berjaya pada masa kerajaan tempo dulu dan kenekagaraman budaya Aceh. --Berita dan foto lain di halaman B10

BOGOR (Waspada): Ketua Mahkamah Konstitusi Mahfud MD tak melihat ada politisasi dalam proses hukum terhadap mantan Ketua Umum DPP Partai Demokrat Anas Urbaningrum, seperti dalam bocornya draf surat perintah penyidikan (sprindik). Mahfud berharap agar bocornya draf sprindik itu tidak mengabaikan dugaan tindak pidana korupsi yang dilakukan Anas. “Masalah sprindik itu mari kita persoalkan. Tapi, jangan menganggap kalau sprindik betul (dibocorkan), korupsinya lalu (dianggap) bersih. Korupsinya harus disikat. Oleh sebab itu, saya katakan enggak ada urusan politik,” kata Mahfud sesuai menghadiri peresmian Pusat Pendidikan Pancasila dan Konstitusi Mahkamah Konstitusi, di Desa Tugu Selatan, Cisarua, Bogor, Jawa Barat, Selasa (26/2). Mahfud mengaku hanya memberikan simpati ketika menemui Anas di Duren Sawit, Jakarta Timur, setelah Anas terjerat dalam perkara dugaan korupsi proyek Hambalang. Mahfud menganggap Anas sebagai adik. Menurutnya, hal sama selalu Lanjut ke hal A2 kol 1

5 Kasus Korupsi Besar Di Aceh P21 SEULAWAH, Aceh Besar (Waspada): Polda Aceh menetapkan tersangka lima kasus dugaan korupsi di daerah itu.Berkas kasus itu sudah dinyatakan P21 atau lengkap dan diserahkan kepada Kejati Aceh. Kasus yang telah dinyatakan lengkap, diantaranya, tindak pidana korupsi pada pengadaan bibit kakao di Aceh Selatan tahun 2009 dengan nilai kontrak sebesar Rp 2.617.995.325, bersumber dari

dana otonomi khusus (otsus) Kab. Aceh Selatan dengan tersangka Mwd dan kawankawan. Tindak pidana korupsi Lanjut ke hal A2 kol 3

Di Siborong-borong Waspada/Parlindungan Hutasoit

SEKIRA 500 warga Desa Pandumaan Sipituhuta, Kec. Pollung, mendatangi Mapolres Humbang Hasundutan menuntut 31 rekan mereka dibebaskan.

Truk PT. TPL Dibakar, 31 Warga Ditangkap DOLOKSANGGUL (Waspada): Pembakaran truk Colt Diesel BK 6390 CC milik PT. Toba Pulp Lestari (PT. TPL), berbuntut panjang. Selain 31 warga ditangkap, juga memicu demo 500-an massa. Masyarakat Desa Pandumaan Sipituhuta, Kec. Pollung, Kab. Humbang Hasundutan (Humbahas) bergerak ke Polres Humbahas, Selasa (26/2),

meminta rekan mereka yang ditangkap dibebaskan. Ka p o l re s Hu m b a h a s , AKBP. Heri Sulesmono Sik mengamankan 31 warga yang diduga terlibat pembakaran truk milik PT TPL, berikut menyita 15 senjata tajam berupa golok milik warga Desa Pandumaan Sipituhuta, Kec. Pollung. Di tengah derasnya hujan,

500-an warga menuntut Polres melepaskan ke-31 orang rekan mereka.Sebelum menyampaikan tuntutannya warga melukan kebaktian, sebagai lambang ketulusan tuntutan mereka. Dalam orasinya, massa mengancam akan melakukan aksi menginap jika ke-31 rekan

GusMan Siap Perbaiki Semua Jalan Rusak SIBORONG-BORONG (Waspada): Kejenuhan masyarakat Tapanuli Utara terhadap kondisi jalan lintas Sumatera di Taput yang sangat buruk terus menjadi keluhan masyarakat, hal ini berkali-kali disuarakan masyarakat saat menghadiri kampanye pasangan cagub-cawagub sumut nomor urut 1 Gus Irawan Pasaribu-Soekirman di La-

pangan pacuan kuda Siborong-borong, Selasa (26/2). “Dan kami siap memperbaiki semua jalan rusak terutama jalan provinsi. Kalau jalan nasional dan jalan kabupaten kota akan kami sampaikan melalui cara yang sudah ditentukan. Misalnya dengan melobi pusat dan Lanjut ke hal A2 kol 6

Lanjut ke hal A2 kol 3

Daya Saing Untuk Pengembangan Potensi Wilayah diaan pangan. “ Program pembangunan Provinsi Sumatera Utara di Kab. Asahan, Batubara, Kota Tanjungbalai dan wilayah Labuhanbatu yang kaya berbagai potensi harus dilanjutkan secara terpadu dan memenuhi kebutuhan masyara-

kat. Saya, Gatot Pujo Nugroho dan Tengku Erry Nuradi siap melayani rakyat untuk bersama membangun Sumatera Utara lima tahun ke depan,” kata Gatot Pujo Nugroho dalam orasi politik di kampanye Lanjut ke hal A2 kol 1


GUS Irawan Pasaribu dan Soekirman berorasi di hadapan masyarakat Siborong-borong untuk menyampaikan janji politiknya kemarin.

SBY Perintahkan Kader Demokrat Dukung Amri RE Perbaiki Sumut MEDAN (Waspada): Ketua Dewan Pembina Partai Demokra t Susilo Bambang Yudhoyono yang juga Presiden RI memerintahkan kepada

kader Demokrat untuk membantu memenangkan pasangan nomor urut 4 Drs Haji Amr i Ta m b u n a n d a n R E Nainggolan dalam Pilgubsu 7

MEDAN (Waspada): Hampir dapat dipastikan, Gatot Pujo Nugroho, akan dilantik menjadi Gubsu periode 20082013, besok (Kamis 28/2). Pelantikan berlangsung di Jakarta. Selasa, (26/2), Badan Musyawarah (Banmus) DPRD Sumut mengadakan rapat. Salah satu agendanya adalah jadwal pelantikan Gatot Pujo

Nugroho, menjadi Gubsu sampai akhir periode 2013. Waspada memperoleh informasi, jalannya rapat Banmus hari itu tidak lagi hangat. Berbeda dengan pelaksanaan rapat 21 Februari 2013. Waktu itu terjadi tar ik menar ik pendapat tentang tanggal Lanjut ke hal A2 kol 1

Maret nanti. “Pesan Pak SBY kepada kader Demokrat untuk memberikan dukungan kepada Amri RE. Kami sebagai kader Demokrat datang ke Sumatera Utara atas instruksi beliau (SBY-red) untuk memberikan dukungan kepada Amri RE untuk memperbaiki Sumatera Utara. Dengan demikian kami hadir mendampingi Amri RE dalam kampanye ini,” kata Ketua DPR RI Marzuki Alie didampingi Menteri Koperasi dan UKM Syarief Hasan, Wakil Ketua DPP Partai Demokrat Johnny Alen Marbun bersama Lanjut ke hal A2 kol 3

Ada-ada Saja

Al Bayan

Dihukum Penjara Karena Bersiul

Golongan Beruntung Oleh: H Ameer Hamzah IMAM Ahmad dan Imam Turmidzi Radhiallahu anhuma meriwayatkan sebuah hadis dari Rasulullah SAW: Sesungguhnya dunia ini milik empat golongan, yaitu; Pertama orang yang diberikan harta dan ilmu. Kedua; diberikan ilmu tanpa harta. Ketiga; diberikan harta tanpa ilmu, keempat; tidak diberikan harta dan ilmu. Golongan pertama, hamba yang dianugerahi harta dan ilmu oleh Allah. Dia bertakwa kepada Allah Azza wajalla karena harta dan ilmunya, ia menyambung tali persaudaraan (silaturrahim) dan mengetahui hak Allah (zakat, infak dan shadaqah di jalan Allah). Ini adalah kedudukan yang paling baik. Syaikhul Islam Ibnu Taimiyah mengatakan: Golongan pertama ini dipelopori oleh Nabi Ibrahim, Nabi Sulaiman, Nabi Musa, dan di kalangan sahabat Nabi Muhammad adalah Abubakar Shiddiq, Abdurrahman bin Auf, Utsman bin Affan dan Abu Dadah. Mereka kaya raya dan punya Lanjut ke hal A2 kol 2

Kampanye Akbar Di Lap. Merdeka Medan

Besok, Gatot Dilantik Di Jakarta

Ganteng Di Kisaran KISARAN (Waspada): Kebangkitan Provinsi Sumatera Utara dengan melanjutkan program pembangunan yang telah dilakukan harus ditopang peningkatan daya saing melalui perbaikan sumber daya manusia, infrastruktur, sumber energi dan keterse-

Waspada/Muhammad Thariq

KETUA DPR RI Marzuki Alie bersama Menteri Koperasi dan UKM Syarif Hasan, Plt Ketua Partai Demokrat Medan Sutan Bhatoegana, Ketua DPD Partai Demokrat HT Milwan berkampanye untuk Amri RE di Lapangan Merdeka Medan, Selasa (26/2).

PERCAYA a t a u t i d a k , bersiul bisa diganjar hukuman penjara. Setidaknya itulah yang dialami pria ini. Robert Smith, yang juga dikenal sebagai Tukang Siul di kota Portland, Amerika Serikat terpaksa mendekam dipenjara

Lanjut ke hal A2 kol 5

Serampang Waspada/Surya Efendi

SAPA 55 RIBU PENDUKUNG: Gatot Pujo Nugroho dan Tengku Erry Nuradi menyapa 55 ribu pendukung dari Asahan, Tanjungbalai, Labura, Batubara dalam kampanye akbar di Lapangan Parasamya, Kota Kisaran, Kab. Asahan, Selasa (26/2).

- Suka memberi baru paten - He.... he....he....

Berita Utama

A2 Daya Saing ....

akbar Ganteng, di lapangan Parasamya, Kisaran, Selasa (26/2). Kampanye dihadiri puluhan ribu massa dari Asahan, Batubara, Tanjungbalai dan Labuhanbatu. Kehadiran pasangan Ganteng diiringi Reog Ponorogo, para ketua partai pengusung Ganteng, relawan, dan pagar betis massa Pemuda Pancasila.Pasangan Ganteng dieluelukan massa pendukungnya saat menuju pentas, setelah dihantar Bupati Asahan Drs. H.Taufan Gama Simatupang, Wakil Bupati H.Surya BSc, Bupati Labura Khairuddinsyah. Sebelum Gatot Pujo Nugroho dan Tengku Erry Nuradi menyampaikan orasi politik, para ketua partai pengusung

Ketua MK ....

dilakukannya ketika ada kerabat lain yang tersangkut pidana. Meski berempati, Mahfud menegaskan bahwa perkara Anas harus tetap berjalan. “Saya termasuk orang yang keras. Pokoknya kalau sudah korupsi jangan diampuni, siapa pun dia, apakah Anas atau bukan. Kalau korupsi sikat saja. Negara ini mau ambruk. Jangan kalau teman korupsi kemudian ditutupi, enggak boleh,” kata dia. Mahfud menilai wajar jika Anas membantah terlibat korupsi Hambalang. Hal itu biasa dilakukan oleh mereka yang terjerat. Hanya, kata dia, mereka tidak bisa menghindar ketika KPK membeberkan bukti yang dimiliki. “Kita akan terus

Besok, Gatot ....

pelantikan Gatot. Sebagian anggota Banmus menolak jadwal yang telah dibuat oleh pimpinan dewan sebelumnya, yakni 25 Februari 2013. Padahal tanggal itu dipilih merupakan hasil rapat pimpinan dewan dengan pimpinan fraksi-fraksi. Juga kabarnya tanggal itu sudah pula dikonsultasikan kepada Kemendagri. Oleh sebagian anggota Banmus waktu itu, menolak tanggal pelantikan Gatot, dengan alas an yang sangat bernuansa politis. Mereka khawatir gaung pelantikan tersebut akan menaikkan popularitas Gatot pada pelaksanaan Pilgubsu 7 Maret 2013. Berbagai alasanpun disampaikan anggota Banmus untuk menggagalkan pelantikan pada 25 Februari. Hasilnya, acara pelantikan di tanggal itu gagal dilaksanakan. Namun, pada lanjutan rapat Banmus pada 26 Februari, hampir seluruh anggota Banmus ‘mencair’. Tidak ada lagi yang ngotot, meminta tanggal pelantikan di atas 7 Maret, seperti yang disuarakan sebelumnya. Pada rapat itu, umumnya anggota Banmus, mengatakan menyerahkan seluruhnya masalah ini pada yang melantik (Mendagri) dan yang akan dilantik (Gatot Pujo Nugroho). Anggota Banmus mengatakan setuju saja. Mendengar pernyataan ini, pimpinan rapat Banmus, yakni Wakil Ketua DPRD Sumut Chaidir Ritonga, segera menutup rapat. Selanjutnya dia melakukan koordinasi

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Md8+, Rxh7. 2. Me7+, Mf7+. 3. MxM+, Rh8. 4. Mg7+mat. Jawaban TTS: TTS Topik


Ganteng menyampaikan imbauan kepada massa untuk terus melakukan kampanye di tengah masyarakat dalam memenangkan pasangan Ganteng di Pilgubsu 7 Maret 2013. Di antaranya dari PKS H.Ansori Siregar LC (anggota DPR RI), Ketua DPC Partai Hanura Asahan Warisno, Ketua Partai Nasdem Asahan Anas Fauzi Lubis, Ketua Pujakesuma Asahan Endang Ngadiman, Ketua MPC Pemuda Pancasila Asahan DR Donald Panjaitan, dari Batubara dan Labura. Ansori Siregar mengingatkan sebagai ummat beragama sudah selayaknya mencegah perbuatan saling nista atau tidak melakukan fitnah kepada sesamanya. (26/2). (a10/a15) memantau,” pungkasnya. Seperti diberitakan, KPK menyangka Anas melanggar Pasal 12 Huruf a atau Huruf b atau Pasal 11 Undang-Undang Nomor 31 Tahun 1999 sebagaimana diubah menjadi UU No 20/2001 tentang Pemberantasan Tindak Pidana Korupsi. Nama Anas pertama kali disebut terlibat dalam kasus ini oleh mantan Bendahara Umum Partai Demokrat Muhammad Nazaruddin. Dalam penyelidikan KPK terkait kasus Hambalang, Anas diduga diberi mobil mewah Toyota Harrier oleh Nazaruddin pada 2009. KPK memperoleh bukti berupa cek pembelian mobil tersebut sejak pertengahan tahun lalu. Cek pembelian ini sempat tidak diketahui keberadaannya.(kcm) dengan berbagai pihak. Tidak ada hambatan Kepada Waspada, Chaidir Ritonga, mengatakan optimis Gatot Pujo Nugroho, dapat dilantik pada 28 Februari 2013. Alasannya, hampir tidak ada lagi hambatan yang menghalangi pelantikan itu. ‘’Kecuali yang besangkutan (Gatot) tidak mau dilantik,’’ katanya. Te n t a n g w a k t u y a n g sangat mepet? Menurut Chaidir Ritonga, sudah dikomunikasikan dengan pihak Kementerian Dalam Negeri (Kemendagri). Katanya, usai memimpin rapat Banmus, dia terus melakukan komunikasi dengan Dirjen Otonomi Daerah (Otda) Kemendagri Djohermansyah Djohan. Dalam pembicaraan itu, katanya Dirjen Otda, mengatakan kalau Mendagri hanya punya waktu pada 28 Februari. Karenanya Djohan, menyarankan agar pelantikan dilaksanakan pada tanggal itu di Jakarta. Menyangkut status Gatot, yang saat ini sedang berada pada masa cuti, kata Chaidir Ritonga, juga dibicarakan. Jawaban Dirjen Otda, bisa direvisi, dengan catatan surat permohonan revisinya diajukan Gatot, sebelum acara pelantikan. ‘’Jadi, sudah tidak ada masalah. Satu-satunya masalah adalah bila Gatot, tidak bersedia dilantik. Sampai saat ini (Selasa pukul 17:30, saya belum berhasil menghubungi Gatot,’’ kata Chaidir Ritonga. (m12)

Kapolda: Polisi ....

personil bintara Polri yang baru tidak melakukan sogokmenyogok, Kapolda melakukan inspeksi kepada orang tua di SPN saat mengunjungi anaknya di SPN, dengan menjumpainya satu persatu dan mempertanyakan bagaimana proses masuk anaknya menjadi anggota Polri. Sejumlah orang tua yang dijumpai Kapolda mengaku tidak ada mengeluarkan uang sedikitpun untuk memproses anaknya bisa menjadi anggota Polri. Bahkan para orag tua sangat senang, karena anakanak mereka bisa dengan murni lulus menjadi anggota Polri. Di hadapan orang tua, Kapolda menyampaikan janjinya untuk hadiah kepada masyarakat yang berhasil menangkap anggota Polri yang menjadi calo dalam penerimaan calon brigadir Polri tahun 2013. (cb01)

Albayan ....

Jawaban Sudoku:

3 6 8 4 7 1 5 9 2

5 2 4 6 8 9 7 1 3

9 7 1 3 2 5 4 6 8

1 4 6 5 3 2 9 8 7

2 5 9 7 6 8 1 3 4

8 3 7 1 9 4 2 5 6

6 1 5 8 4 7 3 2 9

7 8 2 9 1 3 6 4 5

4 9 3 2 5 6 8 7 1

ilmu yang luas. Harta dan ilmu mengantarkan mereka kepada derajat yang mulia menjadi kekasih Allah dan mendapat surga di akhirat kelak. Ummul Mukminin Khadijah binti Khuwailid termasuk golongan ini. Kekayaan yang mereka peroleh dari usaha mereka sendiri secara halal. Mereka bekerja mencari karunia Allah di dunia ini. Dalam berusaha tidak pernah menzalimi orang lain. Jangankan yang haram, syubahat saja ditolak. Abubakar Siddiq pernah memuntahkan makanan haram yang telanjur ditelannya. Golongan kedua adalah hamba hamba yang dilimpahi ilmu, namun tidak dilimpahi harta. Dia adalah orang yang niatnya lurus. Dia berkata,

Serikat Pekerja Pilih CH-Fadly

MEDAN (Waspada): Konfederasi Serikat Pekerja Seluruh Indonesia (KSPSI) berkomitmen memilih dan memenangkan pasangan Chairuman-Fadly pada Pilgubsu 7 Maret 2013. “Ini sudah ketetapan kita, dan kita tegaskan sejak musyawarah kemarin, pilihan K.SPSI adalah wajib memilih dan menangkan pasangan Ch-Fadly,” kata Ketua K.SPSI Sumatera Utara Sugianto Situmeang pada temu ramah serikat pekerja dengan Cagubsu Chairuman Harahap, Senin (25/2) di Hotel Antares. Sebelumnya, pasangan nomor urut 3 ini mendapat dukungan dan komiten memi-

lih dari berbagai elemen masyarakat lainnya. Sementara, Chairuman menyambut hal tersebut dengan mengucap syukur dan berharap dukungan yang be-sar itu akan menuai positif khususnya pada 7 Maret 2013. Dikatakan pria kelahiran Gunung Tua ini, pandangan yang positif bagi masa depan pekerja yang lebih menjanjikan dan terampil menjadi bagian dari programnya. “Inilah yang menjadi salah satu harapan yang kita perjuangkan, terhadap nasib pekerja, bagaimana memberikan ruang yang lebih banyak untuk menyatukan pekerja serta

menyiapkan tenaga-tenaga terampil.Ini menjadi program kita,”kata anggota Komisi 6 DPR RI itu di depan perwakilan K.SPSI se Sumatera Utara. Diakui Chairuman, program tersebut harus menjadi perhatiannya bila memenangi pemilihan nanti. Karena merupakan kehendak politik yang berkeinginan memajukan kehidupan berbangsa, sebab pekerja juga dinilai memiliki hak yang sama. Untuk mendorong itu, ujar Chairuman, Sumatera Utara harus menarik investasi untuk membuka lapangan kerja dan kesempatan bekerja bagi tenaga terampil asal daerah ini. (m07/rel)

SBY Perintahkan ....

Tidak hanya itu, hadir memberikan dukungan para pengusaha-pengusaha termasuk etnis Tionghoa yang merasa nyaman dan mudah dalam pengurusan izin di Deliserdang di bawah kepemimpinan Amri Tambunan. Marzuki di atas tribun Lapangan Merdeka didampingi kandidat gubernur Drs Haji Amri Tambunan-RE Nainggolan bersama istri dan tim kampanye terdiri dari Ketua dan Sekretaris Tim Pemenangan Syarial Ams dan Bahdin Nur Tanjung, tokoh-tokoh agama/ etnis, Ketua DPD Partai Demokrat Sumut menyambut dukungan masyarakat yang hadir dengan meneriakkan Amri RE dijawab massa menang, Amri RE dijawab massa menang, Amri RE dijawab massa jadi gubernur. Kemudian, Marzuki Alie menanyakan kepada massa apakah masyarakat Sumatera Utara ingin perubahan? Apakah masyarakat Sumatera Utara ingin perbaikan? Massa menjawab Sumut harus diperbaiki dari ketertinggalan. Atas jawaban masyarakat itu, Marzuki menjawabnya solusinya pilih nomor 4 Drs Haji Amri Tambunan dan RE Nainggolan. Ada empat alasan mengapa Amri dipilih, kata Marzuki Ali, pertama, Amri RE di mata SBY cukup dikenal di masyarakat karena pengalaman di pemerintahan. Kedua, kinerja

Amri RE sudah terbukti luar biasa di pemerintahan mulai dari lurah, camat, Sekda Medan hingga bupati Deliserdang dua periode hingga pencalonan dirinya sebagai kandidat gubernur periode 2013-2018. Ketiga, Amri RE didukung mayoritas komponen masyarakat Sumut yang pluralis dan multietnis/agama dan keempat, Amri RE adalah pasangan yang menunjukkan kebhinekaan. Keduanya menjadi teman dari muda sampai sekarang dari lulusan sekolah ilmu pemerintahan. “Untuk itu kalau ingin Sumut lebih baik, jangan lupa pilih nomor 4,” katanya disambut massa dengan mengacungkan empat jari dan meneriakkan Amri RE harus menang untuk perubahan dan perbaikan Sumut 5 tahun ke depan. Kemudian, Menteri Koperasi dan UKM Syarief Hasan yang juga Sekretaris Majelis Tinggi Demokrat mengajak kader Demokrat dan masyarakat Sumatera Utara untuk memilih Amri RE karena sudah teruji integritas dan kapabilitasnya yang tinggi untuk kepentingan masyarakat Sumut. Amri RE pilihan rakyat Sumut. Untuk itu jika ingin melihat pertumbuhan ekonomi Sumut tertinggi lima tahun di provinsi di Indonesia, pilih pemimpin terbaik Amri RE. (m13)

2010 dengan nilai kontrak sebesar Rp1.200.378.000, bersumber dari dana Otsus Dinas Pengairan Kab. Nagan Raya diduga dilakukan HS dan kawan-kawan. Kasus lainnya yakni, pekerjaan peningkatan saluran/ bangunan dari intake Cot Gud s/d BBP1 T.A 2010 dengan nilai kontrak sebesar Rp 1.234.490.000, bersumber dari dana Otsus Dinas Pengairan Nagan Raya diduga dilakukan Ms TA dan kawan-kawan. Pajak Bireuen Dilimpahkan Ke DJP Sementara kasus Pajak Bireuen,saat ini dalam penyidikan Polda Aceh. Kasus korupsi atau pencucian uang pada penggunaan uang negara hasil pemotongan Pajak Penghas-

ilan (PPh) dan Pajak Pertambahan Nilai (PPN) Pemkab Bireuen dari tahun 2007 s/d 2010 sebesar Rp.36.888.478.811, dilakukan MS, S.Sos. “Kasus pajak Bireuen sudah dua kali P-19 (pengembalian berkas perkara untuk dilengkapi-red), dan sekarang telah dilimpahkan ke Kanwil DJP Aceh,” terang Kapolda Aceh Irjen Pol Herman Effendi didampingi Kabid Humas Kombes Gustav Leo, usai penutupan pendidikan brigadir polisi di SPN Seulawah, Aceh Besar, Selasa (26/2). Kapolda menyatakan, ada sejumlah kasus korupsi lagi yang dalam tahap penyidikan.Namun, Kapolda enggan menyebutnya karena masih pemeriksaan (cb01)

mereka tidak dibebaskan. seorang pendemo. Kapolres Humbahas, AKBP Heri Sulesmono Sik, Selasa ( 26 / 2 ) mengatakan, masalah di Kec. Pollung sudah terjadi sejak tahun 2009. Dikhawatirkan kejadian tersebut ditunggangi oknum tidak bertanggungjawab.Namun, Kapolres tidak menjelaskan, siapa oknum tidak bertanggungjawab tersebut. “Kita sudah minta bantuan pengamanan pasukan Brimob Pematangsiantar, satu SSK (100 personil ) dibantu anggota Polres Humbahas,” katanya. Sementara itu, Senin (25/2) warga Desa Pandumaan Sipihuta melakukan sweeping bagi setiap kendaraan yang akan melintas atau masuk ke daerah mereka. Tindakan itu dilakukan menurut beberapa warga , untuk mengantisipasi berbagai tindakan yang tidak diinginkan warga. “Kami akan tetap mempertahankan hak kami,” ujar warga. Informasi diperoleh , ada

16 warga dari Desa Pandumaan Sipitu Huta , ditangkap pihak kepolisian dari perladangan Haminjon (Kemenyan), Tombak (Hutan) Sitangi dan Dolok Ginjang, Kec. Pollung. Penangkapan itu membuat ratusan warga Kec. Pollung melakukan sweeping terhadap angkutan subkontraktor PT. TPL Porsea Tbk yang melintas di jalan lintas Sumatera kawasan Simpangtiga, Desa Marade, Kec. Pollung, Kab. Humbang Hasundutan (Humbahas), Senin (25/2). Warga yang sedang tersulut emosi, diduga membakar sebuah truk Colt Diesel BK 8390 CC milik PT TPL (Toba Pulp Lestari) . Selain itu, masyarakat Simpang Desa Marade juga menghadang serta mensweeping setiap kendaraan yang lewat. Menurut informasi, Kapolres Humbahas AKBP Heri Sulismono beserta 60-an anggota kepolisian dari Polres Humbahas dan Polres Samosir, masih berada di sekitar

lokasi. Kakan Kesbang Tibum Humbahas MPR Simanullang SH kepada wartawan membenarkan, telah terjadi aksi pembakaran dan pengerusakan truk oleh 150 warga masyar a k a t D e s a Pa n d u m a a n Sipituhuta Kec. Pollung, yang terjadi Pasar IV PT TPL Sektor Tele sekitar pukul 13.15, Senin (25/2). (a21)

‘Andaikan aku mempunyai harta, tentu bisa beramal seperti yang diamalkan fulan’. Dia dengan niatnya itu, maka kedua-duanya memperoleh pahala yang sama. Sejumlah Rasul dan para sahabat Nabi masuk dalam golongan kedua ini, antara lain Nabi Nuh, Nabi Shaleh, Nabi Yunus, Nabi Ya’kub, sahabat Ali bin Abi Thalib, Abu Dzar AlGhifari, Abu Hurairah, Ammar bin Yassir, Imam Syafi’i dan lain-lain. Sayyidah Fathimah masuk dalam kelompok ini. Semua mereka orang-orang shaleh yang yang dianugerahi ilmu dan tidak disibukkan oleh harta. Meski kekurangan harta, mereka selalu dalam kecukupan. Dari syarahan hadits di atas tentu kita sangat ingin menjadi manusia golongan

pertama yang dianugerahi harta dan ilmu, sebab apabila keduanya bersatu manusia tersebut akan menikmati kebahagian yang tiada taranya. Mereka itulah yang disebut orang-orang sukses di dunia dan di akhirat. Menjadi golongan kedua, juga baik, sebab dianugerahi ilmu membuat orang tersebut bisa mencari penghidupan yang layak meski tidak banyak harta. Dengan ilmu yang ada padanya hamba ini sapat mengabdi kepada Allah SWT. Ka d a n g - k a d a n g d e n g a n ilmunya ia akan memperoleh harta. Ibnu Munzir mengatakan: Golongan kedua lebih saya sukai dari golongan pertama. Harta yang banyak melelahkan, ilmu yang banyak menyenangkan.

Sutan Bhatoegana anggota DPR RI dari Partai Demokrat di hadapan puluhan ribu masyarakat yang memberikan dukungan kepada Amri RE pada kampanye akbar nomor urut 4 itu di Lapangan Merdeka Medan, Selasa (26/2). Marzuki Alie yang juga wakil ketua Dewan Pembinan Demokrat menegaskan, Menteri Koperasi Syarif Hasan yang hadir di masyarakat pendukung Amri RE bukan kapasitasnya sebagai menteri tetapi sebagai kader Partai Demokrat yang juga diperintahkan SBY untuk turun ke Medan memberi dukungan kepada Amri RE yang diusung oleh Partai Demokrat. Marzuki Alie bersama Syarif Hasan, Johnny Alen Marbun dan Sutan Bhatoegana tidak menyangka melihat massa yang hadir memadati Lapangan Merdeka, tampak benar-benar mereka hadir untuk memilih Amri Tambunan. Massa yang hadir dari kelompok nelayan sampai petani, dari pedagang sampai penarik becak, dari penyapu jalan sampai buruh, dari yang muda sampai yang nenek-kakek memberikan dukungan kepada Pak Amri RE. Mereka tidak sungkan memasang kaos tanda gambar Amri RE nomor 4 dan memasang ikat kepala bertuliskan Amri RE terhibur dan merasa dekat Amri RE.

5 Kasus Korupsi ....

penggunaan dana Otsus APBA T.A 2009 dan 2010 pada kegiatan pekerjaan pembangunan objek wisata Ie Seuum Kab, Aceh Besar dengan kerugian negara sebesar Rp 230.951.188, dengan tersangka Drs RMA dan kawan-kawan. Tindak pidana korupsi pembangunan peningkatan free intake Lueng III Cot Gud T.A 2010 dengan nilai kontrak Rp3.220.010.000, bersumber dari dana Otsus Dinas Pengairan Kab. Nagan Raya dengan tersangka TNP dan kawankawan. Bersamaan dengan itu Polda menangani kasus tindak pidana dugaan korupsi pada pekerjaan pengamanan tebing inteke Lueng III Cot Gud T.A.

Truk PT TPL ....

Ada-ada Saja ....

karena siulannya dianggap mengganggu ketenangan.”Tuhan menunjukkan kepada saya bahwa bersiul itu OKE,” ujar Smith yang dilansir AP, Selasa (26/2). Pria berusia 32 tahun ini mengaku banyak orang tertawa jika mendengar ia bersiul. Kebiasaan bersiul pria 32 tahun ini awalnya dilakukan secara tidak sengaja. Kala itu, Robert gemar menghabiskan waktu dengan berjalan sambil mendengarkan musik melalui headphone. Kemudian ia pun mulai bersiul tanpa sadar. Sayangnya, tak semua suka dengan kebiasaannya bersiul. Sejumlah pengelola pertokoan di kota Portland mengajukan keluhan tentang perilaku si Tukang Siul, hingga ia diseret ke pengadilan dan akhirnya dijebloskan ke penjara. Jaksa penuntut mengatakan said bunyi siulan Smith begitu keras hingga suaranya terdengar meski dari jauh. Namun, bukan si Tukan Siul namanya, kalau menyerah pada ancaman polisi. Robert pun menantang polisi dengan mengatakan, “Anda bisa menangkap saya seribu kali, namun setelah saya keluar dari penjara, saya akan tetap bersiul.” Akhinya, pihak pengadilan akhirnya mengeluarkan peraturan yang membolehkan Smith untuk melakukan hobinya bersiul, asalkan ia melakukan hal itu sambil berjalan dengan alasan agar tidak mengganggu orang lain. (net/rzl)

WASPADA Rabu 27 Februari 2013

Kubu GanTeng Dan Gusman Saling Intip MEDAN (Waspada): Pasar bursa SCWA (Siapa Cagubsu-Wagubsu Anda) semakin ramai. Hari ini hitungan kupon yang masuk puluhan ribu. Terbanyak dari penduk u n g G a n Te n g diikuti pendukung GusMan. Sepertinya kedua kubu pendukung kandidat ini saling intip kekuatan masingmasing. Kemarin pendukung GusMan yang terbanyak mencatatkan kupon tetapi hari ini d i t i m p a o l e h p e n d u k u n g G a n Te n g . Selengkapnya posisi bursa SCWA hari ini sbb:

GanTeng 51%, GusMan 37%, Amri-RE 12%, CH-Fadly 0%, ESJA 0%. Harian Waspada mengedarkan kupon SCWA dalam rangka untuk mencari tahu siapa pilihan pembaca pada Pilgubsu 7 Maret 2013 mendatang. Pendukung Cagubsu-Wagubsu yang ingin berpartisipasi lewat bursa SCWA dapat mengisi kupon yang tersedia di halaman Pentas Pilkada sesuai petunjuk yang ada. Panitia hanya menghitung fisik kupon yang dikirim dan membuat persentasenya. (tim)

Kawal Suara Effendi-Jumiran, Kampung Esja Siapkan 1000 Relawan MEDAN (Waspada): Komunitas Anak Muda Pendukung Effendi Simbolon - Jumiran Abdi (Kampung Esja) terus melakukan gerakan sos i a l i s a s i d a n rekr utmen relawan untuk memenangkan pasangan nomor urut 2 pada Pilkada Gubernur Sumut 7 Maret 2013. Kampung ESJA menargetkan 1000 orang lebih relawan yang akan menjadi garda terdepan memenangkan pasangan Effendi - Jumiran satu putaran. Demikian disampaikan Ketua Tim Kampung Esja Taufik Abdillah, didampingi sekretaris Ebiet Prayugo Radityo usai melakukan sosialisasi dan pembekalan relawan Kec. Medan Johor, Medan Sunggal, Medan Denai, Medan Area dan Medan Tembung, Selasa (26/2). “ Saat ini Kampung ESJA sudah bekerja maksimal untuk mencapai tujuan agar pasangan Effendi Simbolon – Jumiran Abdi menang dan menjadi Gubernur – Wakil Gubernur Sumatera Utara 2013 – 2018,” kata Taufik. Sementara, Sekretaris Kampung Esja Ebiet menambahkan jika hasil yang ditargetkan nanti tercapai, terus bekerja maksimal sampai hari terakhir. “Kita optimis Esja menang

GusMan Siap ....

tentu saja berangkulan dengan semua kepala daerah seSumut untuk berkoordinasi,” jelas Gus Irawan Pasaribu. Di hadapan ribuan masa pendukung Gus Irawan dan Soekirman dalam orasi kesejahteraannya menegaskan komitmen pasangan ini untuk member i k a n p e l a y a n a n terbaik untuk Sumut. Kata dia, salah satu pelayanan terbaik yang menjadi prioritas itu berupa pembangunan infrastruktur jalan yang memberikan keamanan dan kenyamanan untuk masyarakat. “Secara tegas kami mengatakan siap menjawab pertanyaan masyarakat sumut selama ini kenapa jalan-jalan di sumbar. Aceh dan provinsi tetangga lainnya jauh lebih baik dari sumut, kami akan jawab itu dengan menyiapkan pembangunan skala besar untuk transportasi Sumut, dan ini merupakan komitmen pertama jika nanti masyarakat Sumut menjatuhkan pilihannya kepada kami, “ tegas peraih direktur terbaik bank BUMD tingkat nasional ini. Gus menilai bila saat ini

Komunitas Anak Muda Pendukung ESJA.


pada satu putaran.Relawan Kampung Esja yang diterjunkan di lapangan sampai hari H pemilihan selain bekerja menjaga suara untuk pasangan Effendi – Jumiran, juga diberi tugas untuk memantau dan mengamankan jalannya proses Pilgubsu 2013 yang aman, tertib dan lancar sehingga proses demokrasi Sumatera Utara berjalan kondusif,” kata Ebiet. Mewakili tim relawan dari kecamayan. Darwinsyah yang juga ketua Koordinator Medan Jo h o r m e n g u n g k a p k a n , mereka akan terus melakukan penggalangan di tengahtengah masyarakat untuk mensosialisasikan serta mengajak semua elemen agar menjadi bagian dalam melakukan perbaikan di Sumatera Utara.

“Semua kaum muda, pemilih pemula dan pendukung pasangan Esja antusias untuk menjadi relawan.Mereka murni didasari rasa simpatik terhadap pasangan nomor urut 2 yang jujur, berani dan melayani,’’ kata Darwinsyah dan menambahkan,Kampung Esja juga melakukan rekrutmen para relawan dari kalangan mahasiswa dan pelajar, dikoordinir oleh Sakti Lubis dan Rozi Sinaga. Menyahuti semangat pelajar dan mahasiswa, Koordinator Media Center Esja Rion Aritonang memberikan apresiasi positif dan menyampaikan terimakasih telah ikut berpartisipasi untuk pasangan Esja pada Pilgubsu 7 Maret 2013. (rel/m09)

kondisi jalan banyak dikeluhkan masyarakat Sumut, menurut dia itu terjadi karena paradigma pembangunan saat ini tidak jelas. Kemudian pemerintah disibukkan gejolak politik yang membuat fokus pembangunan semakin buyar. “Itulah yang kami siapkan, memastikan kami tidak akan mengorbankan masyarakat sumut, provinsi tempat kamai dilahirkan dan dibesarkan ini dengan kepentingan politik, karena fokus kami adalah membangun ekononmi dan mewujudkan kesejahteraan di Sumut,” terangnya. Kata dia, paradigma pembangunan yang diusung GusMan adalah pembangunan dengan semangat keberpihakan kepada rakyat. Bila saat ini banyak pembangunan infrastruktur jalan Sumut asal jadi, itu terjadi karena pembangunan dianggap sebagai sebuah pengeluaran, bukan investasi. “Paradigma ini yang akan kami ubah, sejalan dengan reformasi birokrasi yang melayani, kami akan menyiapkan infrastruktur jalan terbaik untuk sumut, sehingga

provinsi yang dikenal sebagai provinsi terkaya SDA nya ketiga di indonesia kembali kepada posisi terbaiknya. Provinsi nomor satu di Indonesia,” tegasnya. Sementara itu cawagub Soekirman, menyampaikan orasi kesejahteraanya menggunakan bahasa batak toba dengan fasih. Secara tegas soekirman menyatakan dirinya dan Gus Irawan mewujudkan pemerataan pembangunan yang selama ini masih menjadi persolan di Sumut. “Dimana-mana kita mendengar ketimpangan pembangunan antara wilayah barat dan timur Sumatera Utara, karena itu kami pastikan bila nanti rakyat beri kesempatan kepada kami, maka keluhan itu akan kami tuntaskan dengan mewujudkan keadilan dan pemerataan pembangunan di Sumut,” ujar mantan dosen Fakultas Pertanian USU ini disambut tepuk tangan masa pendukung yang tetap antusias memberikan dukungan walaupun di tengah guyuran hujan. (m06)

Berita Utama


Penembak Bidan Ditangkap, Diduga Libatkan Aparat MEDAN (Waspada): Polisi akhirnya menangkap tersangka pelaku penembakan yang menewaskan Nurmala Dewi Tinambunan, 30, bidan Puskesmas Teladan. Informasi di kepolisian, tersangka ditangkap di Kota Padang, Selasa (26/2). Kini polisi masih terus melakukan pengembangan kasus tersebut. “Ada tiga tersangka yang ditangkap di Kota Padang, seorang di antaranya wanita. Saat ini tim yang ditugaskan masih berada di Padang melakukan pengembangan, karena masih ada tersangka lain yang diburon,” ka-

ta sumber. Menurut sumber, dua oknum aparat diduga terlibat dalam kasus itu. Salah seorang berpangkat Brigadir diduga berperan sebagai pencari eksekutor yang diketahui bernama Gop. Untuk menjalankan aksi penembakan itu, Gop disebutkan dibantu oleh seorang oknum berpangkat Bripda. Keduanya kemudian berangkat ke Medan melakukan penembakan terhadap Nurmala. Tetapi saat di Medan, disepakati hanya Gop yang melakukan eksekusi. Korban ditembak di bagian bawah rusuk kiri hing-

ga tembus ke rusuk sebelah kanan. Di duga senjata api yang dipakai Gop diperoleh dari seseorang bernama S yang hingga saat ini masih diburon. Kasat Reskrim Polresta Medan Kompol M Yoris Marzuki ditanya penangkapan itu belum bersedia menjelaskan. Dia hanya mengatakan masih terus melakukan pengembangan. “Masih kita kembangkan dulu ya,” ujarnya singkat. Hingga berita ini diturunkan tidak satu pun perwira di Mapolresta Medan ataupun di Mapoldasu yang memberikan keterangan resmi terkait penem-

bakan bidan Nurmala Dewi Tinambunan. Keterangan hanya diperoleh dari sumber yang memang layak dipercaya, yang menegaskan bahwa kasus itu masih dalam proses pengembangan. Itu pula yang menjadi alasan polisi belum bersedia memberi keterangan resmi. Seperti diberitakan, bidan Puskesmas Teladan Nurmala Dewi Tinambunan tewas ditembak seorang tak dikenal di depan kediamannya Jl. Pertahanan, Lorong Indah, Dusun IV, Patumbak, Deliserdang, Kamis (7/2). Saat itu korban baru saja turun dari angkutan kota, hendak pu-

lang ke rumah setelah berdinas. Pelaku seorang diri mengendarai sepeda motorYamaha Mio, berjaket kulit, melepaskan tembakan kemudian kabur. Dari keterangan keluarga korban, penembakan itu kemungkinan berlatarbelakang asmara karena sebelumnya korban beberapakali diteror seorang wanita mengaku warga Batam, yang terganggu karena kekasihnya direbut korban. Tetapi motif ini masih dugaan sementara, karena penyidik kepolisian belum memberikan keterangan terkait motif kasus itu. (m27/m36)

Serikat Pekerja Pilih CH-Fadly Kawal Suara Effendi-Jumiran, Kampung ESJA Siapkan 1000 Relawan

M E D A N ( Wa s pada): Konfederasi Serikat Pekerja Seluruh Indonesia (KSPSI) berkomitmen memilih dan memenangkan pasangan Chairuman-Fadly pada Pilgubsu 7 Maret 2013. “Ini sudah ketetapan kita, dan kita tegaskan sejak musyawarah kemarin, pilihan K.SPSI adalah wajib memilih Waspada/Ist. dan menangkan paKANDIDAT kuat Gubernur Sumut sangan Ch-Fadly,” kata Chairuman Harahap di depan perKetua K.SPSI Sumate- wakilan Konfederasi Serikat Pekerja ra Utara Sugianto Situ- Seluruh Indonesia (K.SPSI) se Sumatemeang pada temu ra- ra Utara, dalam suatu pertemuan di mah serikat pekerja Hotel Antares Medan, Senin (25/2). dengan Cagubsu Chairuman Harahap, Senin (25/2) di Hotel Antares. Sebelumnya, pasangan nomor urut 3 ini mendapat dukungan dan komiten memilih dari berbagai elemen masyarakat lainnya. Sementara, Chairuman menyambut hal tersebut dengan mengucap syukur dan berharap dukungan yang besar itu akan menuai positif khususnya pada 7 Maret 2013. Dikatakan pria kelahiran Gunung Tua ini, pandangan yang positif bagi masa depan pekerja yang lebih menjanjikan dan terampil menjadi bagian dari programnya. “Inilah yang menjadi salah satu harapan yang kita perjuangkan, terhadap nasib pekerja, bagaimana memberikan ruang yang lebih banyak untuk menyatukan pekerja serta menyiapkan tenaga-tenaga terampil. Ini menjadi program kita,”kata anggota Komisi VI DPR RI itu di depan perwakilan K.SPSI se Sumatera Utara. (m07/rel)

Demo Di KPK JAKARTA (Waspada): Puluhan massa mengaku aktivis Himpunan Mahasiswa Islam (HMI) mendesak Komisi Pemberantasan Korupsi (KPK) untuk tidak melakukan tebang pilih menangani kasus korupsi, termasuk jika ada dari kalangan dari istana yang terlibat. Massa yang menggelar demo di depan kantor KPK, Jl. Rasunan Said, Selasa (26/2) menyebut dugaan keterlibatan dari kalangan istana muncul dalam berita acara pemeriksaan (BAP) Mindo Rosalina Manulang dan keterangan Nazaruddin. “Kami pertanyakan konsistensi KPK agar segera menjeruji AAM (Andi Alvian Mallarangeng) yang jelas telah ditetapkan sebagai tersangka,” kata koordinator lapangan (Korlap) Andika Febriandanu dalam orasinya. Kecurigaan para pendemo terhadap eksistensi KPK, dimana banyak kasus yang menyeret orang tertentu, tapi KPK seolah tidak punya nyali. Disamping itu, aksi demo aktivis yang membawa atribut dan bendera HMI juga mendesak KPK untuk segera menuntaskan kasus BLBI dan bailout Century. Para pendemo mengatakan bila KPK tidak segera mengusut kasus-kasus tersebut, mereka akan kembali berdemo.(j02)

Truk PT. TPL Dibakar, ... Dalam orasinya, massa mengancam akan melakukan aksi menginap jika ke-31 rekan mereka tidak dibebaskan. Kapolres Humbahas, AKBP Heri Sulesmono Sik, Selasa ( 26 / 2 ) mengatakan, masalah di Kec. Pollung sudah terjadi sejak tahun 2009. Dikhawatirkan kejadian tersebut ditungga-ngi oknum tidak bertanggungjawab.Namun, Kapolres tidak menjelaskan, siapa oknum tidak bertanggungjawab tersebut. “Kita sudah minta bantuan pengamanan pasukan Brimob Pematangsiantar, satu SSK (100 personil ) dibantu anggota Polres Humbahas,” katanya. Sementara itu, Senin (25/2) warga Desa Pandumaan Sipihuta melakukan sweeping bagi setiap kendaraan yang akan melintas atau masuk ke daerah mereka. Tindakan itu dilakukan menurut beberapa warga , untuk mengantisipasi berbagai tindakan yang tidak diinginkan warga. “Kami akan tetap mempertahankan hak kami,” ujar warga. Informasi diperoleh, ada 16 warga dari Desa Pandumaan Sipituhuta , ditangkap pihak kepolisian dari perladangan Haminjon (Kemenyan),Tombak (Hutan) Sitangi dan Dolok Ginjang, Kec. Pollung. Penangkapan itu membuat ratusan warga Kec. Pollung meJawaban Problem Catur, lakukan sweeping terhadap angkutan subkontraktor PT. TPL TTS Dan Sudoku Porsea Tbk yang melintas di jalan lintas Sumatera kawasan SimDari Halaman Sport. pangtiga, Desa Marade, Kec. Pollung, Kab. Humbang Hasundutan (Humbahas), Senin (25/2). Jawaban Problem Catur: Warga yang sedang tersulut emosi, diduga membakar sebu1. Md8+, Rxh7. ah truk Colt Diesel BK 8390 CC milik PT TPL (Toba Pulp Lestari). 2. Me7+, Mf7+. Selain itu, masyarakat Simpang Desa Marade juga menghadang 3. MxM+, Rh8. serta mensweeping kendaraan yang lewat. Menurut informasi, 4. Mg7+mat. Kapolres Humbahas AKBP Heri Sulismono beserta 60-an anggota kepolisian dari Polres Humbahas dan Polres Samosir, Jawaban TTS: masih berada di sekitar lokasi. Kakan Kesbang Tibum TTS Topik Kesehatan Humbahas MPR Simanullang SH kepada wartawan membenarkan, telah terjadi aksi pembakaran dan pengerusakan truk oleh 150 warga masyarakat Desa Pandumaan Sipituhuta Kec. Pollung, yang terjadi Pasar IV PT TPL Sektor Tele sekitar pukul 13:15, Senin (25/2). (a21)

Ada-ada Saja ...

Jawaban Sudoku:

3 6 8 4 7 1 5 9 2

5 2 4 6 8 9 7 1 3

9 7 1 3 2 5 4 6 8

1 4 6 5 3 2 9 8 7

2 5 9 7 6 8 1 3 4

8 3 7 1 9 4 2 5 6

6 1 5 8 4 7 3 2 9

7 8 2 9 1 3 6 4 5

4 9 3 2 5 6 8 7 1

mengganggu ketenangan. ”Tuhan menunjukkan kepada saya bahwa bersiul itu OKE,” ujar Smith yang dilansir AP, Selasa (26/2). Pria berusia 32 tahun ini mengaku banyak orang tertawa jika mendengar ia bersiul. Kebiasaan bersiul pria 32 tahun ini awalnya dilakukan secara tidak sengaja. Kala itu, Robert gemar menghabiskan waktu dengan berjalan sambil mendengarkan musik melalui headphone. Kemudian ia pun mulai bersiul tanpa sadar. Sayangnya, tak semua suka dengan kebiasaannya bersiul. Sejumlah pengelola pertokoan di kota Portland mengajukan keluhan tentang perilaku siTu-kang Siul,hinggaiadiseretkepengadilan dan akhirnya dijebloskan ke penjara. Jaksa penuntut mengatakan said bunyi siulan Smith begitu keras hingga suaranya terdengar meski dari jauh. (net/rzl)

MEDAN (Waspada): Komunitas Anak Muda Pendukung Effendi Simbolon - Jumiran Abdi (Kampung ESJA) terus melakukan gerakan sosialisasi dan rekrutmen relawan untuk memenangkan pasangan nomor urut 2 pada Pilkada Gubernur Sumut 7 Maret 2013. Kampung ESJA menargetkan 1000 orang lebih relawan yang akan menjadi garda terdepan memenangkan pasangan Effendi - Jumiran satu putaran. Demikian disampaikan Ketua Tim Kampung ESJA Taufik Abdillah, didampingi sekretaris Ebiet Prayugo Radityo usai melakukan sosialisasi dan pembekalan relawan Kec. Medan Johor, Medan Sunggal, Medan Denai, Medan Area dan Medan Tembung, Selasa (26/2). “ Saat ini Kampung ESJA sudah bekerja maksimal untuk mencapai tujuan agar pasangan Effendi Simbolon – Jumiran Abdi menang dan menjadi Gubernur – Wakil Gubernur Sumatera Utara 2013 – 2018,” kata Taufik. Sementara, Sekretaris Kampung ESJA Ebiet menam-

Peningkatan Daya ... saat menuju pentas, setelah diantar Bupati Asahan Drs.H.Taufan Gama Simatupang,Wakil Bupati H.Surya BSc, Bupati Labura Khairuddinsyah. Sentra Sapi Sebelum Gatot Pujo Nugroho dan Tengku Erry Nuradi menyampaikan orasi politik, para ketua partai pengusung GanTeng menyampaikan imbauan kepada massa untuk terus melakukan kampanye di tengah masyarakat dalam memenangkan pasangan GanTeng di Pilgubsu 7 Maret 2013. Di antaranya dari PKS H.Ansori Siregar LC (anggota DPR RI), Ketua DPC Partai Hanura Asahan Warisno, Ketua Partai Nasdem Asahan Anas Fauzi Lubis, Ketua Pujakesuma Asahan Endang Ngadiman, Ketua MPC Pemuda Pancasila Asahan DR Donald Panjaitan, dari Batubara dan Labura. “ Siapa bilang PKS tidak diterima lagi di Indonesia? Beberapa hari lalu PKS berhasil menghantarkan kadernya memenangkan pemilihan Gubernur Jawa Barat. Ini menandakan kader PKS sangat dipercaya masyarakat, apalagi dalam Pilgubsu ini kader PKS didampingi Bupati

Ketua MK: Negara ... Lebih lanjut, Mahfud mendukung penuh upaya penegakan hukum yang dilakukan KPK dalam mengungkap kasus ko-

Berkas 5 Kasus ... sebesar Rp1.200.378.000, bersumber dari dana Otsus Dinas Pengairan Kab. Nagan Raya diduga dilakukan HS dan kawan-kawan. Kasus lainnya yakni, pekerjaanpeningkatansaluran/bangunan dari intake Cot Gud s/d BBP1 T.A 2010 dengan nilai kontrak sebesar Rp1.234.490.000, bersumber dari dana Otsus Dinas PengairanNaganRayadidugadilakukan MsTA dan kawan-kawan. Sementara kasus Pajak Bireuen,saat ini dalam penyidikan Polda Aceh. Kasus korupsi atau pencucian uang pada penggunaan uang negara hasil pemotongan Pajak Penghasilan (PPh) dan Pajak Pertambahan Nilai (PPN)PemkabBireuendaritahun 2007 s/d 2010 sebesar Rp.36.888.478.811, dilakukan MS, S.Sos. “Kasus pajak Bireuen sudah dua kali P-19 (pengembalian berkas perkara untuk dilengkapi-red), dan sekarang telah dilimpahkan ke Kanwil DJP Aceh,” terang Kapolda Aceh Irjen Pol Herman Effendi didampingi Kabid Humas Kombes Gustav Leo, usai penutupan pendidikan brigadir polisi di SPN Seulawah, Aceh Besar, Selasa (26/2). (cb01)

Komunitas Anak Muda Pendukung ESJA.


bahkan jika hasil yang ditargetkan nanti tercapai, terus bekerja maksimal sampai hari terakhir. “Kita optimis ESJA menang pada satu putaran.Relawan Kampung ESJA yang diterjunkan di lapangan sampai hari H pemilihan selain bekerja menjaga suara untuk pasangan Effendi – Jumiran, juga diberi tugas untuk memantau dan mengamankan jalannya proses Pilgubsu 2013 yang aman, tertib dan

lancar sehingga proses demokrasi Sumatera Utara berjalan kondusif,” kata Ebiet. Mewakili tim relawan dari kecamatan.Darwinsyahyangjuga ketua Koordinator Medan Johor mengungkapkan, mereka akan terus melakukan penggalangan di tengah-tengah masyarakat untuk mensosialisasikan serta mengajak semua elemen agar menjadi bagian dalam melakukanperbaikandiSumut. (rel/m09)

Sergai dua priode T.Erry Nuradi, kita harus yakin dan mendoakan pasangan Ganteng melanjutkan pembangunan Provinsi Sumatera Utara,” ujar Ansori Siregar disambut massa dengan pekikan Hidup GanTeng. Ansori Siregar mengingatkan sebagai umat beragama sudah selayaknya mencegah perbuatan saling nista atau tidak melakukan fitnah kepada sesamanya. “Pasangan GanTeng akan melanjutkan berbagai perbaikan di provinsi Sumatera Utara,”tandasnya. Gatot Pujo Nugroho menyatakan infrastruktur yang sudah dibangun selama dia menjabat Plt Gubsu akan dilanjutkan bersama perbaikan berbagai sektor, termasuk perbaikan sumber daya manusia sebagai kata kunci untuk menempatkan provinsi ini lebih baik dari provinsi lain dalam meningkatkan kesejahteraan rakyat serta mampu bersaing dengan negara tetangga. “Wilayah ini salah satu andalan pengembangan potensi Sumatera Utara untuk kesejahteraan rakyat di atas kepentingan segalanya,” tutur Gatot. Sedangkan, T.Erry Nuradi dalam orasinya menyampaikan salut dan kagum dengan Pemkab Asahan yang telah bekerja

keras mewujudkan Kab. Asahan sebagai sentra peternakan sapi menuju swasembada daging sekaligus meningkatkan pendapatan petani peternak. “Program Pemkab Asahan dalam sentra peternakan sapi ditopang oleh Pemerintah Provinsi Sumatera Utara di bawah kepemimpinan Gatot Pujo Nugroho. Program ini akan kita lanjutkan jika kami memimpin Sumatera Utara lima tahun ke depan,”tukas Erry. Di sela orasi T.Erry Nuradi, dari atas pentas Gatot Pujo Nugroho melayani permintaan salam massa di bawah pentas, terutamakaumibu,memberitopi pet yang ditandatangani Gatot serta memberikan peci yang dipakainya saat seorang tua meminta dari Gatot. Seorang warga Kab. Batubara memberikan tasbih kepada Gatot, setelah Gatot menyalami pemberi tasbih, Gatot menggunakan tasbih berzikir. T.Erry Nuradi berorasi, bibir Gatot komat kamit berzikir dan tangannya cekatan mengurai anak tasbih. Pengawalan ekstra ketat dilakukan bagian pengamanan PKS dan polisi, karena massa antusias ingin bersalaman dengan pasangan GanTeng. (a10/a15)

rupsi di Indonesia. “Saya tegaskan, urusan hukum Anas itu tetap harus jalan. Saya termasuk orang yang keras. Pokoknya kalau sudah korupsi jangan diampuni. Siapapun dia. Apakah Anas atau bukan. Kalau korupsi sikat saja. Saya mengatakan begitu. Negara ini mauambruk,jangankalauteman korupsi kemudian ditutupi, itu tidak boleh,” ucap Mahfud. Mahfud juga akan memantau perkembangan kasus Anas baik di pengadilan maupun setelah vonis yang dijatuhkan kepada Anas. “Saya akan memantau. Jadi juga pendampingan hukum bukan mendampingi korupsinya,tapimaumeluruskan biar KPK juga tegas. Kalau korupsi sikat saja,” pungkas Mahfud. Karena Terima Hadiah Mobil Komisi Pemberantasan Korupsi menyatakan konteks penetapan Anas Urbaningrum sebagai tersangka kasus dugaan korupsi proyek Hambalang terkait hadiah mobil. “Konstruksinya, Anas diduga menerima pemberian atau janji terkait Hambalang sehubungan dengan tugasnya sebagai penyelenggara negara. Salah satu hal (pemberian) yang disangkakan itu di antaranya adalah mobil,” kata Juru Bicara KPK Johan Budi SP di kantor KPK, Selasa (26/2). Menurut Johan, kemungkinan ada materi yang lain yang diperoleh Anas selain mobil.

“Bisa uang atau barang, bisa juga janji,” kata dia. Meski demikian, Johan menolak untuk merinci jenis dan merek mobil yang diterima Anas itu. Johan pun tak menjawab saat ditanya apakah mobil gratifikasi itu bermerek Toyota Harrier yang selama ini disebut Nazaruddin merupakan pemberiannya. “Jangan main tebaktebakan,” kata Johan. KPK baru memeriksa saksi untuk tersangka Deddy Kusdinar dan Andi Mallarangeng terkait kasus Hambalang. Sementara pemeriksaan saksi untuk tersangka Anas Urbaningrum rencananya akan dijadwalkan pekan ini. Johan mengatakan, pemeriksaan saksi untuk Anas belum dilakukan karena KPK belum melakukan proses penyelidikan atau penyidikan di luar pembangunan infrastruktur fasilitas olahraga Hambalang. “Nanti kita lihat sejauh mana temuan penyidik,” kata dia. Anas Urbaningrum sendiri melalui pengacaranya, Firman Wijaya,menyatakanmobilToyota Harrier milik Anas bukan didapat atas pemberian Nazaruddin, melainkan dibeli Anas dari Nazaruddin dengan cara dicicil dan melalui transaksi yang sah. “Kepemilikan mobil Harrier oleh Anas merupakan transaksi jual-beli biasa. Sebagai pembeli, Anas menunjukkan itikad baik dengan membayar uang muka dan angsuran sesuai kesepakatan,” kata Firman. (okz/vvn)

Al Bayan ... bin Affan dan Abu Dadah. Mereka kaya raya dan punya ilmu yang luas. Harta dan ilmu mengantarkan mereka kepada derajat yang mulia menjadi kekasih Allah dan mendapat surga di akhirat kelak. Ummul Mukminin Khadijah binti Khuwailid termasuk golongan ini. Kekayaan yang mereka peroleh dari usaha mereka sendiri secara halal. Mereka bekerja mencari karunia Allah di dunia ini. Dalam berusaha tidak pernah menzalimi orang lain. Jangankan yang haram, syubahat saja ditolak. Abubakar Siddiq pernah memuntahkan makanan haram yang telanjur ditelannya. Golongan kedua adalah hamba hamba yang dilimpahi ilmu, namun tidak dilimpahi harta. Dia adalah orang yang niatnya lurus. Dia berkata, ‘Andaikan aku mempunyai harta, tentu bisa beramal seperti yang diamalkan fulan’. Dia dengan niatnya itu, maka kedua-duanya memperoleh pahala yang sama. Sejumlah Rasul dan para sahabat Nabi masuk dalam golongan kedua ini, antara lain Nabi

Nuh, Nabi Shaleh, Nabi Yunus, Nabi Ya’kub, sahabat Ali bin Abi Thalib, Abu Dzar Al-Ghifari, Abu Hurairah, Ammar bin Yassir, Imam Syafi’i dan lain-lain. Sayyidah Fathimah masuk dalam kelompok ini. Semua mereka orang-orang shaleh yang yang dianugerahi ilmu dan tidak disibukkan oleh harta. Meski kekurangan harta, mereka selalu dalam kecukupan. Dari syarahan hadits di atas tentu kita sangat ingin menjadi manusia golongan pertama yang dianugerahi harta dan ilmu, sebab apabila keduanya bersatu manusia tersebut akan menikmati kebahagian yang tiada taranya. Mereka itulah yang disebut orang-orang sukses di dunia dan di akhirat. Menjadigolongankedua,jugabaik,sebabdianugerahi ilmu membuat orang tersebut bisa mencari penghidupan yang layak meski tidak banyak harta. Dengan ilmu yang ada padanya hamba ini dapat mengabdi kepada Allah SWT. Kadang-kadang dengan ilmunya ia akan memperoleh harta. Ibnu Munzir mengatakan: Golongan kedua lebih saya sukai dari golongan pertama. Harta yang banyak melelahkan, ilmu yang banyak menyenangkan.

WASPADA Rabu 27 Februari 2013

Kubu GanTeng Dan Gusman Saling Intip MEDAN (Waspada): Pasar bursa SCWA (Siapa Cagubsu-Wagubsu Anda) semakin ramai. Hari ini hitungan kupon yang masuk puluhan ribu. Terbanyak dari pendukung GanTeng diikuti pendukung GusMan. Sepertinya kedua kubu pendukung kandidat ini saling intip kekuatan masing-masing. Kemarin pendukung GusMan yang terbanyak mencatatkan kupon tetapi hari ini ditimpa oleh pendukung GanTeng. Selengkapnya posisi bursa SCWA hari ini sbb: GanTeng

SBY Perintahkan ... Koperasi Syarief Hasan yang hadir di tengah masyarakat pendukung Amri RE bukan kapasitasnya sebagai menteri tetapi sebagai kader Partai Demokrat yang juga diperintahkan SBY untuk turun ke Medan memberi dukungan kepada Amri RE yang diusung oleh Partai Demokrat. Marzuki Alie bersama Syarief Hasan, Johnny Alen Marbun dan Sutan Bhatoegana tidak menyangka melihat massa yang hadir memadati Lapangan Merdeka.Mereka hadir sebagai pendukung dan simpatisan Amri Tambunan. Massa yang hadir dari berbagai elemen memberikan dukungan untuk kemenangan Amri RE. Tidak hanya itu, hadir juga memberikan dukungan para pengusaha termasuk etnis Tionghoa yang merasa nyaman dan mudah dalam pengurusan izin di Deliserdang di bawah kepemimpinan Amri Tambunan selaku bupati. Marzuki di atas tribun Lapangan Merdeka didampingi Drs Haji Amri Tambunan-RE Nainggolan bersama istri dan tim kampanye terdiri dari Ketua dan Sekretaris Tim Pemenangan

GusMan Berjanji ... Bila saat ini kondisi jalan banyak dikeluhkan masyarakat Sumut, menurut Gus, itu terjadi karena paradigma pembangunan saat ini tidak jelas. Kemudian pemerintah disibukkan gejolak politik yang membuat fokus pembangunan semakin buyar. “Itulah yang kami siapkan, memastikan kami tidak akan mengorbankan masyarakat Sumut, provinsi tempat kami dilahirkan dan dibesarkan. Fokus kami adalah membangun ekonomi dan mewujudkan kesejahteraan di Sumut,” terang Gus, dan menambahkan, paradigma pembangunan yang diusung GusMan adalah pembangunan dengan semangat keberpihakan kepada rakyat. ‘’ Bila saat ini banyak pembangunan infrastruktur jalan Sumut asal jadi, itu karena pembangunan dianggap sebagai sebuah pengeluaran, bukan investasi,’’ kata Gus. Sementara itu, cawagub Soekirman, menyampaikan orasi kesejahteraannya dengan menggunakan bahasa Batak Toba dengan fasih. Secara tegas Soekirman menyatakan, dia dan Gus Irawan mewujudkan pemerataan pembangunan yang selama ini masih menjadi persolan di Sumut. “Dimana-mana kita mendengar ketimpangan pembangunan antara wilayah barat dan timur Sumatera Utara, karena itu kami pastikan bila nanti rakyat memberi kesempatan kepada kami, keluhan itu akan kami tuntaskan dengan mewujudkan keadilan dan pemerataan pembangunan di Sumut,” ujar mantan dosen Fakultas Pertanian USU ini, yang disambut tepuk tangan masa pendukung. Salah seorang warga yang sengaja naik ke atas panggung

51%, GusMan 37%, Amri-RE 12%, CH-Fadly 0%, ESJA 0%. Harian Waspada mengedarkan kupon SCWA dalam rangka untuk mencari tahu siapa pilihan pembaca pada Pilgubsu 7 Maret 2013 mendatang. Pendukung Cagubsu-Wagubsu yang ingin berpartisipasi lewat bursa SCWA dapat mengisi kupon yang tersedia di halaman Pentas Pilkada sesuai petunjuk yang ada. Panitia hanya menghitung fisik kupon yang dikirim dan membuat persentasenya. (tim)

Syahrial Ams dan Bahdin Nur Tanjung, tokoh-tokoh agama/ etnis, Ketua DPD Partai Demokrat Sumut menyambut dukungan masyarakat dengan meneriakkan Amri RE, yang dijawab massa dengan ‘’Menang..’’. Marzuki Alie menanyakan kepada massa, apakah masyarakat Sumatera Utara ingin perubahan? Massa menjawab Sumut harus diperbaiki dari ketertinggalan. Atas jawaban masyarakat itu, Marzuki menjawab solusinya pilih nomor 4 Drs Haji Amri Tambunan dan RE Nainggolan. Ada empat alasan mengapa Amri dipilih, kata Marzuki Alie, pertama, Amri RE di mata SBY cukup dikenal di masyarakat karena pengalaman di pemerintahan. Kedua, kinerja Amri RE sudah terbukti luar biasa di pemerintahan mulai dari lurah, camat, Sekda Medan hingga bupati Deliserdang dua periode hingga pencalonan dirinya sebagai kandidat gubernur periode 20132018. Ketiga, Amri RE didukung mayoritas komponen masyarakat Sumut yang pluralis dan multietnis, agama dan keempat, Amri RE adalah pasangan yang menunjukkan kebhinekaan. Bahkan, Amri RE adalah te-

man dari muda sampai sekarang dari lulusan sekolah ilmu pemerintahan.Sehingga tidak diragukan lagi dalam melakukan pembangunan. Sedangkan, Menteri Koperasi dan UKM Syarief Hasan yang juga Sekretaris Majelis Tinggi Demokrat mengajak kader Demokrat dan masyarakat Sumatera Utara untuk memilih Amri RE karena sudah teruji integritas dan kapabilitasnya yang tinggi untuk kepentingan masyarakat Sumut. Wakil Ketua DPR Partai Demokrat Johnny Alen Marbun dalam orasinya mengatakan, ini jarangterjadidalamsuksesikepala daerah. Tokoh nasional seperti Marzuki Alie, Menteri Koperasi dan UKM serta ketua DPR RI ikut dalamkampanye.Iniartinya,kata Johnny Alen Marbun, pembangunanSumutmenjadiperhatian tokoh-tokoh nasional agar dapat maju dan berkembang meninggal ketertinggalannya. Sementara Amri RE di hadapan masyarakat pendukung mengatakan,diabersamaREakan membangun Sumut bukan denganjanji-janjitetapidenganbukti. “Mari kita lawan ketertinggalan Sumut dengan perbaikan bersama kami,” ujarnya. (m13)

M Sagala memberikan testimoni dukungannya terhadap pasangan GusMan. Secara sukarela M Sagala menyampaikan aspirasinya dan mengajak seluruh masyarakat Sumatera Utara untuk memilih GusMan Menyusul salah seorang pelaku usaha binaan Gus Irawan Pasaribu saat menjabat Dirut Bank Sumut , Br Simorangkir yang memberikan pengakuannya betapa program yang dijalankan Gus saat menjabat Dirut Bank Sumut benar-benar membantu masyarakat kecil. Sekretaris tim pemenangan GusMan Taput Jasa Sitompul,

yang juga anggota DPRD Taput dalam orasinya mengimbau masyarakat Taput khususnya dan Sumut umumnya untuk bersama-sama menjadi bagian perubahan menuju Sumut sejahtera. Acara kampanye dimeriahkan dengan penyanyi senior asal Sumut Edy Silitonga, yang ikut memberikan dukungan kepada pasangan GusMan. Di akhir acara Gus Irawan Pasaribu dan Soekirman didampingi Edy Silitonga menyanyikan lagu Mama dan Tano Batak diikuti ribuan massa pendukung. (m06)

Besok, Gatot Dilantik ... pelantikan pada 25 Februari. Hasilnya, acara pelantikan di tanggal itu gagal dilaksanakan. Namun, pada lanjutan rapat Banmus pada 26 Februari, hampir seluruh anggota Banmus ‘mencair’. Tidak ada lagi yang ngotot, meminta tanggal pelantikan di atas 7 Maret, seperti yang disuarakan sebelumnya. Pada rapat itu, umumnya anggota Banmus, mengatakan menyerahkan seluruhnya masalah ini pada yang melantik (Mendagri) dan yang akan dilantik (Gatot Pujo Nugroho). Anggota Banmus mengatakan setuju saja. Mendengar pernyataan ini, pimpinan rapat Banmus, yakni Wakil Ketua DPRD Sumut Chaidir Ritonga segera menutup rapat. Selanjutnya dia melakukan koordinasi dengan berbagai pihak. Tidak ada hambatan Kepada Waspada, Chaidir Ritonga mengatakan optimis Gatot Pujo Nugroho dapat dilantik pada 28 Februari 2013. Alasannya, hampir tidak ada lagi hambatan yang menghalangi pelantikan itu. ‘’Kecuali yang besangkutan (Gatot) tidak mau dilantik,’’ katanya. Tentang waktu yang sangat mepet? Menurut Chaidir Ritonga, sudah dikomunikasikan dengan pihak Kementerian Dalam Negeri (Kemendagri). Katanya, usai memimpin rapat Banmus, dia terus melakukan komunikasi dengan Dirjen Otonomi Daerah (Otda) Kemendagri Djohermansyah Djohan. Dalam pembicaraan itu katanya, Dirjen Otda mengatakan kalau Mendagri hanya punya waktu pada 28 Februari. Karenanya Djohan menyarankan agar pelantikan dilaksanakan pada tanggal itu di Jakarta. Menyangkut status Gatot, yang saat ini sedang berada pada masa cuti, kata Chaidir Ritonga, juga dibicarakan. Jawaban Dirjen Otda, bisa direvisi, dengan catatan surat permohonan revisinya diajukan Gatot, sebelum acara pelantikan. ‘’Jadi, sudah tidak ada masalah. Satu-satunya masalah adalah bila Gatot tidak bersedia dilantik. Sampai saat ini (Selasa pukul 17:30 saya belum berhasil menghubungi Gatot,’’ kata Chaidir Ritonga. (m12)

Info Sumut

WASPADA Rabu 27 Februari 2013


Bukti GanTeng Makmurkan Desa Waspada/Surya Effendi

KEPALA desa menerima bantuan pemberdayaan desa dari Gatot Pujo Nugroho pada Mei 2012. Program bantuan ini merupakan terobosan Gatot Pujo Nugroho untuk lebih memajukan desa sebagai ujung tombak pelayanan masyarakat.

DALAM setiap kesempatan Gatot- Tengku Erry selalu menekankan, mereka tidak mengumbar janji tapi sudah memberikan bukti. Saat kandidat lain masih berjanji akan mensejahterakan desa, Gatot-Tengku Erry justru sudah melakukannya. Dua tahun terakhir, Gatot giat memakmurkan desa di Sumatera Utara. Gatot Pujo Nugroho sebagai Plt Gubernur Sumatera Utara misalnya, sejak tahun 2012 sudah menggulirkan program bantuan untuk desadesa di Sumatera Utara. Ada 1.000 d e s a

tertinggal mendapat bantuan Rp 50 juta yang dianggarkan lewat APBD. Program ini kembali diteruskan di tahun 2013, jumlah desa penerima bahkan meningkat menjadi 1.800 desa dan mendapatkan bantuan senilai Rp 50 juta. Tengku Erry Nuradi juga tak kalah berprestasi. Lewat Gerbang Swara, Bupati Serdangbedagai itu menggerakkan masyarakat bersama-sama membangun daerahnya. Ada juga program Pelayanan Administrasi Terpadu Kecamatan (PATEN) yang berhasil memangkas rantai birokrasi. Puncaknya, Serdangbedagai lewat program pertanian yang tertata berhasil dihantarkan adik kandung mantan Gubernur

Waspada/Surya Effendi

KELUARGA petani melakukan kegiatan pelatihan dan keterampilan bersama Gatot Pujo Nugroho. Pembangunan desa dan pertanian yang kontinyu akan membuat desa menjadi sentra pertumbuhan ekonomi di masa mendatang.

Program GanTeng untuk Rakyat - Melanjutkan pemberian asuransi jiwa untuk keluarga nelayan. - Meneruskan pendidikan gratis berkualitas tingkat SDSMA di seluruh Sumatera Utara. - Melanjutkan program kesehatan murah berkualitas untuk rakyat. - Melanjutkan program bantuan Rp 50 juta untuk tiap desa - Menyelesaikan target 95 persen jalan mulus dan mantap di Sumut. - Tekan pengangguran lewat 2 juta lapangan kerja melalui proyek MP3EI dan Sei Mangkei. - Melanjutkan penyaluran bantuan operasional dan kesejahteraan guru tepat waktu. - Melanjutkan penyaluran beasiswa S1 dan S2 untuk guru. - Melanjutkan kondisi aman, tertib, dan kondusif di Sumut. - Mewujudkan keluarga Sumut sejahtera, harmonis dan beriman. - Melanjutkan pertumbuhan ekonomi yang stabil dan di atas rata-rata nasional. - Meningkatkan program beasiswa untuk siswa cerdas tapi kurang mampu. - Melanjutkan program cetak sawah baru dan swasembada beras. - Melanjutkan program perlindungan bagi petani lokal lewat optimalisasi produk pertanian Sumut. - Mewujudkan perlindungan dan penguatan pasar tradisional agar punya daya saing.

(24/2), menyasar lingkungan RW Binaan Daihatsu di wilayah Kelurahan Sungai Bambu. Bertempat di RW 04 dan RW 08 Kelurahan Sungai Bambu, aktivitas kerja bakti ADM meliputi pembersihan saluran air, pengangkatan lumpur, pengecatan canstin, dan merapikan ruang terbuka umum. Selain dihadiri oleh manajemen

di Sumatera Utara. Program ini merupakan salah satu upaya membantu desa untuk mandiri di tengah berbagai kendala yang ada,” ujar Tengku Erry memuji terobosan Gatot Pujo Nugroho. Tengku Erry juga mengingatkan, dalam kepemimpinannya Gatot Pujo Nugroho juga berani melakukan terobosan meluncurkan program Asuransi Jiwa Gratis untuk nelayan. Program tersebut merupakan apresiasi kepada nelayan tradisional yang tersebar di pesisir pantai timur dan barat Sumut. “Pasangan GanTeng berani melakukan terobosan. Untuk itu, mari kita lanjutkan agar sejumlah program strategis yang sudah dijalankan, tidak putus di tengah jalan,” ajak Erry. Gatot Pujo Nugroho memang dalam dua tahun terakhir agresif memberdayakan desa. Dalam visinya, kemajuan desa jelas tak hanya mengurangi laju urbanisasi, tapi juga turut

memacu pertumbuhan ekonomi lebih cepat. Tak heran jika, dalam kebijakannya Gatot selalu menyertakan pembangunan desa dalam daftar prioritas. Selain bantuan desa, mantan dosen Politeknik Negeri Medan itu juga menggulirkan program cetak sawah baru, mendirikan posko-posko pertanian di tiap kecamatan, dan memperbaiki jalan desa serta irigasi pertanian. “Desa yang tertata dengan baik akan menjadi salah satu kekuatan Sumatera Utara. Karenanya, ke depan desa akan menjadi titik pertumbuhan sosial dan ekonomi yang penting bagi kita,” tegas Gatot beberapa waktu lalu. Bantuan Desa Meningkat Tajam Gatot Pujo Nugroho menjelaskan pada Tahun Anggaran 2013 pih a k n y a mengalokasikan dana Rp 90 miliar untuk

1.800 desa di 25 Kabupaten dan 1 kota di Sumut. Ada peningkatan sekitar 80 persen dari anggaran tahun 2012. “Pada tahap pertama yaitu tahun 2012 lalu ada 1.000 desa yang menerima bantuan. Dan tahap kedua, tahun ini kami mengalokasikan jumlah yang sama bagi 1.800 desa agar ke depan desa semakin berdaya,” ujarnya. Melalui dana bantuan senilai Rp 50 juta per desa yang diberikan kepada desa tertinggal, diharapkan dapat menjadi stimulus pembangunan pedesaan bersama dengan alokasi dana desa (ADD) kabupaten masing-masing. Di Sumatera Utara saat ini terdapat 5.889 desa dan kelurahan, dimana 2.2876 diantaranya adalah desa tertinggal dan 2.352 desa berkembang. (m28)

Waspada/Surya Effendi

SEJUMLAH petani menanam padi bersama Gatot Pujo Nugroho. Sektor pertanian dan pedesaan menjadi prioritas Gatot sebagai titik kebangkitan Sumatera Utara 5 tahun ke depan.

Kerja Bakti Dan Kepedulian Bersama ADM JAKARTA (Waspada): PT Astra Daihatsu Motor (ADM) dalam salah satu program Corporate Social Responsibilitynya (CSR) melaksanakan kegiatan bersih – bersih lingkungan, yang sejalan dengan nilai Pilar Sehat Bersama Daihatsu. Kegiatan bersih – bersih lingkungan (Kerja bakti) yang dilaksanakan pada hari Minggu

Sumut Tengku Rizal Nurdin menjadi lumbung beras Sumatera Utara. Saat berkampanye di Padangsidimpuan, Tengku Erry mengajak warga Sumatera Utara bersama-sama Gatot-Tengku Erry melanjutkan sejumlah pro-gram yang sudah berjalan selama ini. GanTeng terbukti mempunyai program pro rakyat, menjadi terobosan baru, cerdas, strategis dan belum pernah dilakukan provinsi lain. Kepada sekitar 15 massa pendukung, dalam orasi politiknya, Tengku Erry menyebutkan, program pembiayaan Rp 50 juta untuk tiap desa di seluruh Sumut merupakan program cerdas dalam membantu kemandirian desa. “Program ini pertama kali dibuat di Indonesia. Hanya ada

ADM, Erlan Krisnaring Cahyono, Executive Officer Purchasing ADM, Dikky Burhan, Division Head Production Sunter Assembly Plant ADM, turut hadir pula Wakil Walikota Jakarta Utara Tri Kurniadi, Camat Tanjung Priok, Supriyono dan Kasudin Kebersihan Jakarta Utara H. Zainuri guna membuka kegiatan kerja bakti.


ERLAN K. Cahyono, Executive Officer Purchasing PT Astra Daihatsu Motor (ADM) (ketiga dari kanan) menyerahkan secara simbolik bantuan alat kebersihan kepada Wakil Wali Kota Jakarta Utara Tri Kurniadi (paling kanan).

Kerja bakti yang melibatkan 100 personel Artileri Pertahanan Udara (ARHANUD), juga diperbantukan oleh tidak kurang dari 300 orang dari Kel. Sungai Bambu, personil Security ADM dan juga warga dari RW 04 dan RW 08 Kelurahan Sungai Bambu. Dalam kesempatan ini pula, ADM mendonasikan 500 buah alat kebersihan seperti sapu lidi, cangkul, sekop, dan tempat sampah, serta 800 karung plastik sebagai wadah pengangkut lumpur dan kotoran. Kebersihan lingkungan merupakan cerminan, dari sehatnya lingkungan. Dan hal inilah yang mendorong pelaksanaan kerja bakti yang diprakarsai oleh ADM beserta warga sekitar. Selain itu kegiatan bersih – bersih lingkungan ini pun dilakukan guna meraih penghargaan ADIPURA wilayah Jakarta Utara. “Kegiatan ini merupakan bentuk kepedulian kami, untuk turut menjaga kebersihan lingkungan sekitar pabrik. Semua usaha yang kami lakukan, semata demi kepentingan warga yang tinggal disekitar wilayah ADM, dan hal ini sejalan dengan Pilar Sehat dan Pilar Hijau Bersama Daihatsu. Kegiatan yang kami lakukan bersama warga, melibatkan RW – RW yang selama ini telah kami bina,” ujar Erlan Krisnaring Cahyono.(m07/rel)

Medan Metropolitan

WASPADA Rabu 27 Februari 2013

Pemko Medan Keliru Tempatkan Lapak Pedagang Buku Bekas Di Jln. Pegadaian MEDAN (Waspada): Ketua Komisi D DPRD Medan menilai kebijakan Pemko Medan sangat keliru karena menempatkan lapak pedagang buku bekas di Jln. Pegadaian.

Ketua Komisi D DPRD Medan Muslim Maksum Yusuf, Lc, Selasa (26/2), mengatakan, lapak baru tempat pedagang bu-

ku bekas di Jln. Pegadaian sangat tidak layak, karena lokasi itu merupakan jalur hijau. Sebab, rel itu masih aktif dan akan menjadi jalur rel kereta api internasional karena membawa penumpang ke Kuala Namu Internasional Airport. “Lokasi itu tidak layak. Itu merupakan jalur hijau dan lintasan kereta api internasional maupun reguler,” kata Muslim. Muslim menjelaskan, persoalan baru akan muncul begitu lokasi itu dioperasikan. Sebab, lahan itu milik PT KAI, bukan milik Pemko Medan. Artinya, lahan dan kios pedagang merupakan aset yang terpisahkan. “Apakah lahan itu sudah diserahkan ke Pemko Medan. Kalau belum, berarti

kios dan lahan aset terpisahkan. Bagaimana nanti ke depannya. Bila tidak cocok sewa dan sebagainya. Pedagang tidak nyaman berjualan karena tidak ada jaminan lapak tersebut bisa ditempati secara permanen,” ungkapnya. Dia menambahkan, DPRD Medan telah mempertanyakan anggaran untuk membangun kios tersebut. Sebab, dalam APBD Kota Medan tidak tercantum. Sampai saat ini, Komisi D DPRD Medan belum mendapat jawaban langsung dari Pemko Medan terkait sumber pembiayaan pembangunan 180 lebih kios tersebut. “Kami juga nanti akan pertanyakan pengerjaan kios-kios tersebut. Sampai saat ini kami

tidak tahu apakah pakai dana pribadi, bantuan pihak ketiga atau di pos bantuan,” tambahnya. Menurut Muslim, kios-kios tersebut yang sebagian besar sudah berdiri tanpa Izin Mendirikan Bangunan (IMB). Bangunan tersebut untuk komersil, bukan bangunan sosial. Seharusnya Pemko Medan memperhatikan aturan-aturan yang mereka buat sendiri. Pemko terkesan diskriminasi dalam menerapkan aturan. “Dinas TRTB diharapkan bisa melihat aturan dan menerapkannya untuk bangunan yang dibangun Pemko Medan. Jangan terkesan tebang pilih. Aturan itu diterapkan untuk semua pihak,” tegasnya. (m30)

Truk Masuk Kota Tabrak Tujuh Mobil

Sat Lantas Akui Kecolongan Waspada/Arianda Tanjung

SEJUMLAH pedagang buku bekas sudah menempati kios baru di Jln. Pegadaian, Medan, Selasa (26/2).

Wanita Miliki 5 Kg Ganja Dituntut Delapan Tahun Penjara MEDAN (Waspada): Terdakwa Sulastri alias Tri, 52, warga Aceh Tenggara, yang ditangkap karena memiliki 5 Kg ganja kering siap edar, dituntut delapan tahun penjara, dalam persidangan agenda pembacaan tuntutan yang digelar di ruang Cakra III Pengadilan Negeri (PN) Medan, Selasa (26/2). “Setelah menjalani proses persidangan, maka kami jaksa penuntut umum sampai kepada pembacaan tuntutan. Terdakwa terbukti secara sah dan meyakinkan melanggar Pasal 114 ayat (2) UU RI No35 Tahun 2009 tentang narkotika. Menuntut terdakwa selama 8 tahun penjara,” kata Jaksa Penuntut Umum (JPU) Rivai dalam tuntutannya di hadapan majelis hakim yang diketuai Kawit Rianto. Selain dibebani hukuman kurungan badan, terdakwa yang sehari-harinya bekerja sebagai buruh cuci itu, diwajibkan membayar denda sebesar Rp1 miliar subsider tiga bulan penjara.

Usai mendengarkan pembacaan tuntutannya, terdakwa langsung memohon kepada hakim untuk mengurangi masa hukumannya ketika sidang putusan tiba.”Saya mohon pak hakim, agar pak hakim bisa meringankan hukuman saya,” ujar terdakwa memelas. “Nanti akan kami pertimbangkan,” kata hakim. Selanjutnya majelis hakim menunda sidang hingga pekan depan dengan agenda pembacaan putusan. Sebagaimana dalam dakwaan JPU sebelumnya disebutkan, terdakwa ditangkap 28 September 2012 di Jln. Jamin Ginting tepatnya Simpang Pos Medan. Dari Aceh, terdakwa sempat transit di Kabanjahe. Dari Kabanjahe, terdakwa menumpangi bus Sutra menuju Medan. Menurut Jaksa, ganja seberat 5 Kg tersebut dibawa terdakwa atas perintah Win, warga Aceh, yang akan diberikan kepada seseorang yang disebutnya bermarga Siregar. (m38)

MEDAN (Waspada): Kasat Lantas Polresta Medan Kompol Risya Mustario mengakui pihaknya kecolongan karena adanya truk pengangkut semen masuk inti kota hingga terjadi tabrakan b e r u n t u n d i J l n . Si s i n g amangaraja, Medan. “Kita akui kecolongan dengan adanya truk masuk kota, sehingga terjadi kecelakaan lalulintas,” kata Risya Mustario, disela-sela pengamanan kampanye di Lapangan Merdeka Medan, Selasa (26/2). Didampingi Kanit Laka AKP Eko Hartanto, Risya menjelaskan, kecolongan ini disebabkan personel Sat Lantas melakukan pengamanan kampanye di Lapangan Gajah Mada Jln. Krakatau. “Anggota ketika itu melakukan pengamanan kampanye, sehingga tidak mengetahui ada truk bermuatan semen yang masuk inti kota,” kata dia. Risya juga menegaskan, untuk ke depan pihaknya kembali melakukan razia terhadap truk melebihi tonase yang masuk inti kota Medan. “Setelah

masa kampanye ini berakhir, kita akan kembali melakukan razia,” tegasnya. Mengenai truk semen tersebut, Kanit Laka AKP Eko mengatakan, kasus itu ditangani Unit Lantas Polsek Patumbak. “Yang menangani kasusnya Unit Lantas Polsek Patumbak, kita hanya mendapat laporan dari Kanit Lantasnya,” kata dia. Tidak ditahan Di tempat terpisah, Kapolsek Patumbak Kompol Triyadi mengatakan, pihaknya masih memproses kasus tabrakan beruntun itu. “Kasusnya masih kita proses. Sedangkan truk masih diamankan sebagai barang bukti. Tetapi sopir truk tidak ditahan, setelah diperiksa dipulangkan dengan syarat wajib lapor,” kata dia. Mengenai proses penyidikan,Triyadi mempersilakan menanyakan kepada Kanit Lantas AKP Imam. Kepada Waspada, Imam juga mengaku masih memproses kasus itu. Kata dia, semua pemilik kendaraan yang

mengalami tabrakan sudah diperiksa. “Untuk truk pengangkut semen ditahan, tetapi pengemudinya tidak ditahan,” ujarnya. Alasan tidak ditahan, kata Imam, karena pengemudi truk melanggar pasal 310 (1) Yo 229 (2) UURI No. 22/2009 tentang LLAJ dengan pidana penjara paling lama 6 bulan dan sesuai pasal 21 KUHAP, yang dapat ditahan yakni ancaman hukumannya di atas lima tahun. Diberitakan sebelumnya, tabrakan beruntun terjadi Senin (25/2) siang di Jln. Sisingamangaraja depan Kampus Univa. Tabrakan terjadi akibat truk bermuatan semen BK 9309 DE mengalami rem blong. Truk menghantam angkot yang sedang menunggu penumpang, kemudian menghantam enam mobil dan satu sepedamotor yang ada di depannya. Tidak ada korban jiwa, tetapi pengendara sepedamotor mengalami luka-luka dan dirawat di RSU Estomihi, Medan.(m27/m39)

Aliansi Ormas Islam Dan Forum Umat Islam Minta Ketua MUI Medan Mundur MEDAN (Waspada): Aliansi Ormas Islam Sumatera Utara Pembela Masjid dan Forum Umat Islam Sumatera Utara menyatakan kekecewaannya setelah membaca pernyataan Ketua Majelis Ulama Indonesia (MUI) Kota Medan Prof. H.M. Hatta di Harian Waspada, Sabtu (23/2) halaman B-2. Pasalnya, menurut mereka, Hatta dan Komisi Fatwa serta jajaran MUI Kota Medan terlibat dalam pengeluaran fatwa dan rekomendasi untuk pemindahan/penghancuran sejumlah masjid di Kota Medan. Karena itu, Hatta diminta segera mengundurkan diri dari kepengurusan MUI Kota Medan. “Selain mengimbau agar segera mengundurkan diri dari kepengurusan MUI Kota Medan, Aliansi Ormas Islam juga mengimbau para pengurus MUI Kecamatan se-Kota Medan segera menggelar musyawarah luar biasa guna mengganti Prof H.M. Hatta dan pengurus lainnya mengembalikan nama baik MUI Kota Medan,” tegas Ketua Umum Aliansi Ormas Islam Sumatera Utara Pembela Masjid Drs. Leo Imsar Adnans didampingi Ketua Umum Forum Umat Islam Sumatera Utara Ustadz Sudirman Timsar Zubil kepada Waspada, Minggu (23/2). Menurut Leo Imsar, pernyataan Ketua MUI Kota Medan Prof H. M. Hatta yang menyebutkan dirinya/MUI Kota Medan tidak terlibat dalam penghancuran sejumlah masjid, hanya merupakan pembelaan diri. Seolah-olah tindakan Hatta/MUI Kota Medan sudah benar sehingga umat Islam terkecoh dan mempercayai pernyataannya. Dalam pernyataannya di Harian Waspada, Sabtu (23/2), Hatta mengatakan, pihaknya tidak pernah terlibat dalam perubuhan masjid. Bahkan, selalu tegas menentang perubuhan masjid dan tidak pernah bertemu dengan pihak pengembang. Pernyataan ini, menurut Leo Imsar, tidak benar. “Fakta di lapangan, MUI Medan terlibat dengan mengeluarkan rekomendasi atau fatwa pemindahan/peruntuhan sejumlah masjid di Medan,” ujarnya. Leo Imsar menjelaskan, MUI Medan memang tidak mengeluarkan fatwa atau rekomendasi secara vulgar terkait pemindahan/penghancuran

masjid. Tetapi fatwa dan rekomendasi yang dikeluarkan MUI Medan yakni: Pada kasus Masjid At Thayyibah di Jl.Multatuli, “dengan menyatakan pemindahan/ istibdal Masjid At-Thayyibah sudah sesuai dengan syar’i (sementara dasar-dasar ayat dan hadist yang digunakan sehingga keluarnya fatwa tersebut tidak relevan. Apalagi data-data di lapangan juga tidak sesuai dengan apa yang dikemukakan). Pada kasus Masjid Raudhatul Islam, lagi-lagi dengan mengutip ayat dan hadist serta pendapat ulama yang tidak relevan, lalu MUI Medan menyimpulkan dan mengeluarkan rekomendasi: “Pemindahan masjid/ tanah wakaf dibolehkan oleh para fukaha”. “Pemindahan masjid diperbolehkan, dengan alasan seperti jarak yang jauh dari tempat tinggal atau karena kesulitan memasukinya karena tanah sekeliling sudah menjadi milik orang lain,” dan sebagainya. “Mengapa MUI Medan tidak mempedomani UndangUndang TentangWakaf dan Fatwa MUI Sumut mengenai Masjid,” kata Leo Imsar. Selain itu, lanjut Leo Imsar, pada kasus penghancuran Masjid Al Ikhlas di Jln. Timor Medan, jelas-jelas oknum MUI Medan memobilisasi dan mengundang ormas-ormas Islam untuk menyetujui pemindahan/penghancuran masjid tersebut. Parahnya lagi, oknum MUI Medan berkonspirasi dengan pihak-pihak tertentu guna ‘menyulap’ daftar hadir ormas Islam menjadi pernyataan persetujuan pemindahan/penghancuran Masjid Al Ikhlas di Jln. Timor Medan dengan mendapat imbalan Rp700 juta. Uang ini dibagi-bagikan di Masjid AlAmin Jln. Prof. H.M. Yamin, SH dan banyak orang yang mengetahuinya. Karena keterlibatan Hatta/ MUI Medan dalam kasus perubuhan sejumlah masjid, lanjut Leo Imsar, Aliansi Ormas Islam melakukan unjukrasa di Kantor MUI Medan, beberapa bulan lalu. Dalam pertemuan saat itu, menyangkut kasus Masjid AtThayyibah, Hatta/MUI Medan mengakui kekekeliruannya. Tetapi dia menyatakan, fatwa yang sudah dikeluarkan tidak dapat dicabut atau dibatalkan.

“Namun Hatta/MUI Medan menjanjikan akan mengeluarkan fatwa baru untuk memperbaiki fatwa terkait penghancuran Masjid At-Thayyibah. Tetapi sampai sekarang, fatwa baru ini tidak juga dikeluarkan MUI Medan,” sebut Leo Imsar. Jadi, kata Leo Imsar, secara gamblang bahwa Hatta/MUI Medan dengan fatwa dan rekomendasi yang dikeluarkannya, jelas terlibat dalam konspirasi pemindahan/penghancuran sejumlah masjid di Kota Medan. “Karena itu, Hatta tidak usah mencari alasan untuk pembelaan diri. Lebih baik bertobat sebelum terlambat,” kata Leo Imsar seraya menambahkan, tindakan Hatta/MUI Medan ini telah menodai nama baik ulama dan menzalimi umat Islam. Berpihak Ke Pengembang Sementara itu, Ketua Umum Forum Umat Islam Sumatera Utara Ustadz Sudirman Timsar Zubil menilai, pernyataan Hatta sangat keliru jika yang dipersoalkan adalah prosedur formal bahwa fatwa dan rekomendasi merupakan permintaan atau pertanyaan nazir dan masyarakat. Kemudian, MUI Kota Medan tidak pernah berhubungan dengan pihak pengembang. “Padahal, bukan itu substansi persoalannya. Tetapi isi fatwa dan rekomendasi yang dikeluarkan MUI Kota Medan, serta kaitannya dengan Mesjid At-Thayyibah dan Raudhatul Islam,” tegasnya. Ustadz Timsar Zubil membeberkan isi fatwa MUI Kota Medan terkait istibdal Masjid At-Thayyibah: Pertama: “Bahwa pembangunan Mesjid At-Thayyibah baru yang terletak di Jln. Multatuli, Kel. Hamdan, Kec. Medan Maimun dipandang telah memenuhi ketentuan istibdal wakaf sesuai syariat Islam”. Kedua: “Bahwa pertapakan dan bangunan Masjid At-Thayyibah baru tersebut dipahami telah memadai sebagai pengganti dari pertapakan dan bangunan Masjid At-Thayyibah lama yang telah ada sebelumnya”. Ketiga: “Bahwa aktivitas Masjid At-Thayyibah baru dapat dijalankan sebagaimana layaknya kegiatan masjid pada umumnya”. Keempat: “Bahwa fatwa ini dapat dijadikan pedoman sejak

tanggal ditetapkan”. “Dari keempat butir Fatwa MUI Kota Medan tersebut, sangat jelas substansinya berhubungan erat dan bahkan memihak kepada pengembang PT. MIL,” kata Timsar Zubil. Mengenai keberpihakan kepada pengembang PT. MIL, Timsar Zubil mengungkapkan sejumlah bukti. Pertama, adanya manipulasi data yang dijadikan pertimbangan oleh MUI Kota Medan dalam mengeluarkan fatwa.Yakni, pendataan keinginan masyarakat Lingkungan I s/d IV, Kelurahan Hamdan, Kecamatan Medan Maimun oleh Lurah Kelurahan Hamdan, tidak akurat. Hal ini terbukti dari adanya 410 warga dan jamaah yang menggugat Direktur PT. MIL di Pengadilan Tata Usaha Negara Medan (PTUN Medan) dan di Pengadialn Negeri Medan (PN Medan) yang sampai sekarang belum mempunyai kekuatan hukum tetap. Kedua: dalam“pasal” Menginggat No. 9 (sembilan) disebutkan, “telah ada kata sepakat antara masyarakat dan BKM Masjid At-Thayyibah”. Keterangan ini merupakan pemutarbalikkan fakta. Karena pada pertemuan antara warga/jamaah dengan pihak Muspika yang dihadiri: (a) Sekretaris Camat Medan Maimun, Syaifuddin; (b) KUA Kecamatan Medan Maimun, Drs. Hermanto Joko; (c). Lurah Kel. Hamdan, Achiyaruddin, S.Sos; (d) Sekretaris Lurah Kel. Hamdan, Andi Syahputra; (e) Ketua LPM Kel. Hamdan, Moh. Masnal; (f ) Nazir Masjid At-Thayyibah, Sabarudin; (g)Wakapolsek Medan Kota, Mayang Sari; (h) Pengurus FPI DPD SUMUT, H. Husin Ali; (i) Kepala Lingkungan I, Kasno, keputusan musyawarah itu adalah: Masjid At-Thayyibah yang berada di Lingkungan I, Kel. Hamdan tidak boleh dipindahkan. “Bagaimana bisa MUI Kota Medan menyatakan telah ada kata sepakat antara masyarakat dengan BKM Masjid At-Thayyibah? Sungguh aneh sikap MUI Kota Medan yang mengambil pendapat 22 warga yang setuju pemindahan masjid, bukan pendapat ratusan warga yang mempertahankan keberadaan Mesjid At-Thayyibah sebagaimana hasil keputusan dan musyawarah pada tanggal 10 Maret 2006 di Kantor Camat Medan

Maimun,” jelas Timsar Zubil. Ketiga, kata Ustadz Timsar, dalam pertemuan di kantor MUI Kota Medan tanggal 23 April 2007, Ustadz Nizar Syarif, Ketua Komisi Fatwa MUI Kota Medan menyatakan, “Agar Mesjid At-Thayyibah jangan dulu dirubuhkan, dan masjid baru pengganti jangan diresmikan sampai ada putusan kasasi oleh Mahkamah Agung RI”. Pernyataan Ketua Komisi Fatwa MUI itu tentu didasarkan pada pengetahuan dan kesadaran beliau bahwa pembongkaran Masjid At-Thayyibah dan peresmian masjid baru pengganti adalah perbuatan melanggar hukum jika dilakukan ketika proses hukum belum Berkekuatan Hukum Tetap (BHT). Akan tetapi anehnya Fatwa MUI Kota Medan No: 192/ Kep/MUI/Medan/2007 tertanggal 26 April 2007 (hanya berselang empat hari sejak beliau menyampaikan pernyataan tersebut), beliau juga turut menandatangani. Keempat: Fatwa MUI Kota Medan tersebut telah dijadikan alasan pembenaran PT. MIL untuk menghancurkan Masjid AtThayyibah pada tanggal 10 Mei 2007. “Bagaimana bisa Hatta menyatakan tidak memihak pengembang? Padahal dalam pertemuan di Kantor MUI Kota Medan tanggal 23 April 2007 wakil-wakil masyarakat/jamaah telah menjelaskan perihal gugatan mereka terhadap PT. MIL. Hal itu terbukti dari pernyataan Ketua Komisi Fatwa MUI Kota Medan. Lalu kenapa masih dikeluarkan Fatwa MUI Kota Medan tentang Istibdal Mesjid AtThayyibah No: 192/Kep/MUI/ Medan/2007 tanggal 26 April 2007. Apakah itu bukan memihak kepada pengembang? Karena MUI Kota Medan telah mengetahui adanya sengketa antara warga/jamaah dengan pihak pengembang,” ujar Timsar Zubil. Mesjid Radhatul Islam Terkait masalah Masjid Raudhatul Islam, seperti dikatakan oleh Wakil Sekjen MUI Pusat, KH. Tengku Zulkarnain dalam sidang gugatan perdata penghancuran Masjid At-Thayyibah di Pengadilan Negeri Medan bahwa antara alasan (dalil-dalil) Fatwa MUI Kota Medan dengan objek perkara tidak singkron, maka dalam rekomendasi untuk istibdal Mesjid Radhatul Is-

lam, sama juga halnya. Di mana tentang istibdal Masjid Raudhatul Islam, alasan “Kepentingan Umum” yang diambil dari Kompilasi Hukum Islam Indonesia (KHII) Pasal 225 ayat (2) b yang menyatakan istibdal boleh dilakukan karena kepentingan umum, sangat jelas tidak sesuai dengan kenyataan. Karena penggusuran dan pemindahan Mesjid Raudhatul Islam adalah untuk kepentingan pengembang PT. Jatimasindo. Menurut Timsar Zubil, Wali Kota Medan yang turut memberikan rekomendasi istibdal Masjid Radhatul Islam telah menyadari kekeliruannya. Wali Kota Medan secara jujur dan berani memperbaiki kekeliruan rekomendasi No: 451/17615 tanggal 30 Nopember 2009 dengan mencabut dan membatalkan rekomendasi tersebut pada ketetapan keenam SK Walikota Medan No: 451/091.K/ 2013 tanggal 8 Februari 2013. Dengan SK tersebut Wali Kota Medan menetapkan pembangunan kembali Masjid Radhatul Islam di tempat semula. Harus Mundur Berbeda dengan Wali Kota Medan yang secara jujur dan berani memperbaiki kekeliruannya, menurut Timsar Zubil, MUI Kota Medan hingga saat ini masih tetap merasa tidak bersalah. Padahal, fatwa dan rekomendasi yang dikeluarkannya telah mengakibatkan Rumah Allah dihancurkan oleh pihak pengembang PT. Jatimasindo. Karena itu, Prof. HM Hatta dan semua penandatangan fatwa serta rekomendasi yang mengakibatkan dihancurkannya Masjid At-Thayyibah dan Masjid Raudhatul Islam harus mengundurkan diri. Mereka sudah tidak layak lagi memimpin MUI Kota Medan. Mereka harus mundur karena mengeluarkan kebijakan yang salah dan berakibat fatal. Hal ini telah mengakibatkan umat Islam sangat kecewa dan marah hingga melakukan unjukrasa ke Kantor MUI Medan, beberapa bulan lalu. “Aksi unjukrasa ke MUI Kota Medan akan terulang kembali jika Hatta dan semua penandatangan fatwa/rekomendasi perubuhan sejumlah masjid di Medan tidak segera memundurkan diri. Jangan sampai Aliansi Ormas Islam yang memakzulkan mereka,” tegas Timsar Zubil.(h04)


UMA Gelar Gebyar Psikologi 2013 MEDAN (Waspada): Psikologi dituntut berperan dalam membangun karakter pendidikan bangsa. Peran psikologi itu diharapkan semakin menunjang peningkatan kualitas pendidikan yang bermoral dan berakhlak. “Karena itu peran psikologi sangat diharapkandalammembangun karakter pendidikan bangsa,” kata Rektor UMA Prof. Dr. H. A.Ya’kub Matondang, MA ketika membuka Gebyar Psikologi 2013 di halaman Fakultas Psikologi UMA Jln. Kolam, Medan Estate, Selasa (26/2). Turut hadirWakil Rektor Bidang Kemahasiswaan, Ir. H. Zulhery Noer, MP, Dekan Psikologi UMA, Prof. Dr. Abdul Munir, MPd, Ketua Panitia Ana W.Purba. Rektor UMA mengemukakan, melihat peran psikologi sangat penting dalam membangun karakter bangsa, maka psikologi harus diperkenalkan kepada masyarakat luas. Kegiatan Gebyar Psikologi ini salah satu cara memberikan pemahaman kepada masyarakat tentang manfaat psikologi dalam kehidupan manusia dan dunia pendidikan. Dekan Fakultas Psikologi UMA Prof Dr Abdul Munir, M.Pd mengatakan, Gebyar Psikologi UMA 2013 bertujuan agar masyarakat mengetahui dan memahami peran psikologi baik di dunia pendidikan maupun usaha/bisnis. Ketua Panitia, AnaW Purba mengatakan, tema Gebyar Psikologi 2013 adalah mengenalkan peran psikologi dalam dunia pendidikan dan dunia usaha. Kegiatan tersebut sudah menjadi agenda rutin setiap tahun. “Gebyar psikologi ini diisi dengan berbagai kegiatan di antaranya seminar, perlombaan, pertunjukan kreativitas remaja, tes minat dan bakat, konseling secara gratis serta pertandingan futsal antar SMA sederajat. (m49)

Pipa PDAM Dipotong Maling Distribusi Air Terputus MEDAN (Waspada): Pipa PDAM dipotong maling di Jln. STM/ Simpang Jln. Sukapura, Kel. Suka Maju, Medan Johor, akibatnya puluhan rumah warga tidak tersambung air bersih sejak Selasa (26/2) dinihari. Pipa PDAM yang tertanam di sisi kiri dalam riol Jln. Sukapura, dipotong maling diduga untuk mengambil besi kuning yang lengket di pipa tersebut. “Harga besi kuning sangat mahal, makanya pipa dipotong saat warga tertidur,” ujar sumber. Menurut sumber, diperkirakan pipa itu dipotong maling pada Selasa dinihari, sebab warga yang hendak mengambil air wudhu sholat Subuh, air dalam kran tidak mengalir. Setelah diselidiki, teryata pipa saluran air bersih ke ratusan rumah warga sudah terpotong. “Sejak subuh rumah kami tidak mengalir air, “ kata H Syaifuddin Zuhri dan ibu Munir, warga lingkungan Jln. Sukapura. Pantauan Waspada, pipa yang dipotong lebih kurang 15 Cm, sehingga air tumpah dan mengalir deras ke riol dan terus ke Sungai Batuan selama beberapa jam sejak Selasa dinihari hingga Selasa siang. Kepala Kantor Imigrasi (Kakanim) Polonia Medan Tani Rumapea yang rumahnya bersebelahan dengan TKP pemotongan pipa, sangat menyesalkan perbuatan maling tersebut. “Akibat ulah orang tidak bertanggungjawab, kepentingan hajad hidup orang banyak terhadap air bersih menjadi terganggu,” sebutnya. Dia menyatakan heran, ada beberapa petugas penjaga malam disekitar itu termasuk area penjaga malam komplek perumahan Imigrasi Medan, namun pipa air bersih sempat dipotong maling. Sementara itu, petugas PDAM bernama Eric saat diberitahukan masalah itu mengatakan, pihaknya segera turun ke lapangan bersama teknisi untuk menyambung kembali pipa yang terpotong itu. (m32)

Musyawarah, Gotong Royong Harus Digalakkan MEDAN (Waspada): Sekarang jarang lagi terlihat tradisi yang menunjukkan jati diri dari bangsa ini seperti musyawarah dan gotong royong. Padahal, musyawarah dan gotong royong salah satu alternatif yang bijaksana untuk menghadapi permasalahan seperti kesalahpahaman yang berujung kepada pertengkaran. Hal itu dikatakan Ketua DPP Gerakan Perempuan Ormas Musyawarah Kekeluargaan Gotong Royong (GePe Ormas MKGR) Pusat Dra Marlina Purnomo MSi, dalam acara pelantikan GePe Ormas MKGR Sumut, di Medan Club Jln. R A Kartini, Selasa (26/2). “Sudah seharusnya sejak dini musyawarah dan gotong royong digalakkan kembali agar gesekan-gesekan yang terjadi di seluruh lapisan masyarakat bisa diminimallisir dan untuk itulah salah satu alasan hadirnya GePe Ormas MKGR ditengah-tengah masyarakat,” ujar Marlina. Kata dia, dalam berorganisasi juga tidak dapat dilakukan secara individual, perlu musyawarah dan gotong royong.“Bagi kaum perempuanyangtergabungdalamorganisasiiniagardapatmenunjukkan kemampuannya, sehingga GePe MKGR nantinya mampu membantu masyarakat terutama kaum perempuan,” sebutnya. Ketua DPD GePe Ormas MKGR Sumut Dra Hj Ellyda Sukardi mengucapkan terimakasih atas amanah yang sudah diberikan dan akan terus berjuang di tengah-tengah masyarakat, terutama untuk memperjuangkan hak kaum wanita. “Kami juga akan bekerja secara proporsional, mandiri, dan amanah sehingga program yang akan kami jalankan dapat diterima masyarakat,” tuturnya. Sebanyak 80 pengurus DPD GePe Ormas MKGR Sumut dilantik, di antaranyaSekretarisDewanPembinaHjFatimahHabibi,KetuaDewan Penasehat Hj Ratna Chairuman Harahap, Ketua DPD Sumut Dra Hj Ellyda Sukardi, Ketua Harian Sri Rahayu SH, Sekretaris DPD Dra Hj ChristinaWinarsih, dan Bendahara DPD Hj Nazla Khairani. (cat)

Waspada/Arianda Tanjung

KETUA DPD GePe Ormas MKGR Sumut Dra Hj Ellyda Sukardi (kiri) menerima bendera pataka dari Ketua DPP GePe Ormas MKGR Pusat Dra Marlina Purnomo MSi (kanan), di Medan Club Jln. RA Kartini Medan, Selasa (26/2).

Medan Metropolitan

A6 Kepergok, Pencuri Tikam Mahasiswi Tujuh Liang MEDAN (Waspada): Kepergok hendak mencuri handphone, pria bertato berinisial ML, 28, warga Jln. Selamat Ketaren, Desa Medan Estate, Kec. Percut Seituan, nekat menikam korbannya seorang mahasiswi di Asrama Putri Universitas Amir Hamzah Jln. Williem Iskandar, Pasar IV, Desa Medan Estate, Selasa (26/2) sekira pukul 05:00. Akibatnya, korban MariaTari Sarumpaet, 21, warga asal Kec. Merbau, Labuhanbatu Utara, menderita luka tikam tujuh liang. Informasi yang diperoleh di

kepolisian, pagi itu korban sedang tertidur di kamar kosnya. Tiba-tiba saja, tersangka ML masuk ke dalam kamar kos korban melalui jendela dan mencoba mengambil handphone yang terletak di tempat tidur sebelah kepala korban. Namun, aksi tersangka kepergok korban yang terbangun dari tidurnya dan spontan teriak. Ternyata, teriakan korban membuat ML gugup. Diduga karena panik, tersangka menikamkan pisaunya ke paha kiri korban. Akibat tikaman bertubitubi itu korban menjerit kesakitan. Sejumlah penghuni kos

lainnya yang mendengar jeritan korban, berhamburan mendatangi kamar Mari Tari Sarumpaet. Tersangka ML yang mencoba kabur, berhasil ditangkap warga saat berada di areal persawahan tak jauh dari rumah kos korban. Kemudian massa menghajar tersangka. Polisi yang mendapat informasi datang ke lokasi mengamankan ML dari amuk massa dengan memboyongnya Polsek Percut Seituan.

Sementara itu, korban saat mengadu ke Polsek Percut Seituan mengatakan, dirinya sedang tidur dan tiba-tiba melihat pelaku berada di dalam kamar hendak mengambil Hp. Pelaku sempat masuk ke dalam kelambu. “Aku lagi tidur, pas terbangun kulihat pelaku sudah di dalam kelambu mau ambil Hp. Langsung aku berteriak,” ujar Mari Tari Sarumpaet yang mendapatkan 7 jahitan atas luka

robek tikaman pisau tersangka di paha kirinya. Terpisah, Kanit Reskrim Polsek Percut Seituan AKP Faidir Chan saat dikonfirmasi mengatakan, tersangka akan dikenakan pasal 365 dengan ancaman kurungan 7 tahun. “Pelaku telah kita amankan, dan kita kenakan pasal 365 dengan ancaman kurungan 7 tahun penjara. Saat ini pelaku masih dalam proses pemeriksaan,” tuturnya. (h04)

Jadwal Penerbangan Di Bandara Polonia No. Penerbangan Ke Flight


GARUDA INDONESIA 1 Jakarta GA-181 2 Jakarta GA-183 3 Jakarta GA-185 4 Jakarta GA-187 5 Jakarta GA-189 6 Jakarta GA-191 7 Jakarta GA-193 8 Jakarta GA-147 9 Jakarta GA-195 10 Banda Aceh GA-142 11 Banda Aceh GA-14.6 CITILINK 1 Jakarta 2 Jakarta 3 Jakarta 4 Batam 5 Batam

QG-831 QG-833 QG-835 QG-880 QG-882

Tiba Dari



05.20 08.45 10.30 11.55 14.10 15.55 17.55 18.45 19.55 09.45 14.50

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Banda Aceh Banda Aceh

GA-180 GA-182 GA-184 GA-186 GA-146 GA-188 GA-190 GA-192 GA-196 GA-143 GA-147

08.00 09.45 11.10 13.20 14.20 15.10 17.10 19.10 22.00 12.25 17.55

8.40 18.50 20.05 10.00 14.20

Jakarta Jakarta Jakarta Batam Batam

QG-830 QG-832 QG-834 QG -881 QG-883

08.05 09.05 09.35 13.15 17.55

AIR ASIA 1 Kuala Lumpur QZ-8050 06.05 2 Kuala Lumpur QZ- 8054 11.20 3 Kuala Lumpur AK- 1351 08.00 4 Kuala Lumpur AK-1355 17.25 5 Penang QZ-8072 10.40 6 Penang AK-5837 18.30 7 Kuala Lumpur AK-1357 21.25 8 Baangkook QZ-8084 17.00 9 Bandung QZ-7987 08.25 10 Surabaya QZ-7611 11.35 11 Bandung QZ-7981 17.10 12 Banda Aceh QZ-8022 11.00 13 Pekanbaru QZ-8028 07.00 Selasa, Kamis, Sabtu

Kuala Lumpur QZ-8051 Kuala Lumpur QZ-8055 Kuala Lumpur AK-1350 Kuala Lumpur AK-1354 Penang QZ-8073 Penang AK-5836 Kuala Lumpur AK-1356 Bangkok (2,4,6) QZ-8085 Bandung QZ-7986 Surabaya QZ-7610 Bandung QZ-7980 Banda Aceh QZ-8023 Pekanbaru QZ-8029 Selasa, Kamis, Sabtu

08.30 10.55 07.35 17.00 16.30 18.15 21.05 29.55 05.35 11.10 19.55 13.20 10.30

LION AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Jakarta 5 Jakarta 6 Jakarta 7 Jakarta 8. Jakarta 9 Jakarta 10 Jakarta 11 Jakarta 12 Jakarta 13 Jakarta 14 Penang 15 Penang 16 Jakarta 17 Jakarta 18 Jakarta 19 Jakarta 20 Jakarta 21 Surabaya 22 Surabaya 23 Banda Aceh 24 Jakarta

JT- 211 JT- 381 JT- 397 JT- 207 JT- 301 JT- 395 JT- 303 JT- 215 JT-201 JT- 387 JT-399 JT-383 JT-385 JT-1282 JT-1288 JT-205 JT-203 JT-219 JT-309 JT-209 JT-0970 JT-972 JT-396 JT-305

0545 06.45 07.50 08.40 10.00 11.00 11.50 12.25 12.50 13.50 15.20 15.50 17.00 08.05 13.35 2010 18.00 20.40 19.10 21.00 07.00 12.55 12.15 18.30

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Penang Penang Jakarta Jakarta Jakarta Jakarta Jakarta Surabaya Surabaya Banda Aceh Jakarta

JT-380 JT-300 JT-394 JT-302 JT-214 JT-200 JT-204 JT-398 JT-382 JT-384 JT-202 JT-212 JT-396 JT-1283 JT-1289 JT-206 JT-208 JT-386 JT-308 JT-218 JT-971 JT-973 JT-397 JT-210

08.20 09.20 10.20 11.10 11.40 12.10 13.10 14.40 15.10 16.20 17.20 17.50 19.45 10.25 15.55 9.20 18.25. 21.05 22.20 23.20 12.15 16.00 07.05 07.20

MALAYSIA 1 Kuala Lumpur 2 Kuala Lumpur

MH-861 MH-865

09.40 15.45

Kuala Lumpur Kuala Lumpur

MH-860 MH-864

08.50 15.00

SILK AIR 1 Singapura 2 Singapura

MI-233 MI-237

08.40 20.35

Singapura Singapura

MI-232 MI-238

07.50 19.50

VALUAIR 1 Singapura (2.4,7) VF-282 2 Singapura (1,3,6) VF-284

11.45 17.55

Singapura (2.4.7) VF-281 Singapura (1,3,6) VF-283

11.05 17.15

SRIWIJAYA AIR 1 Jakarta 2 Jakarta 3 Batam 4 Pekanbaru 5 Pekanbaru 6 Banda Aceh 7 Penang 8 Padang

SJ-015 SJ-011 SJ-035 SJ-043 SJ-041 SJ-010 SJ-102 SJ-021

13.25 15.55 16.50 10.20 17.20 12.50 07.20 16.00

Jakarta Jakarta Batam Pekanbaru Pekanbaru Banda Aceh Penang Padang

SJ-010 SJ-016 SJ-034 SJ-042 SJ-040 SJ-011 SJ-103 SJ-020

11.00 16.20 14.55 11.50 15.45 14.20 09.50 14.10

FIRE FLY 1 Subang 2 Penang 3. Penang

FY -3413 FY- 3403 FY- 3407

14.35 10.55 18.20

Subang Penang Penang

FY-3412 FY-3402 FY-3406

14.05 10.35 17.55

07.30 11.45 18.50

Singapura Jakarta Jakarta

RI-862 RI-093 RI-097

08.00 12.00 19.30

MANDALA AIRLINE 1 Jakarta RI-092 2 Singapura RI-861 3. Jakarta RI-096

Jadwal Perjalanan Kereta Api No KA

Nama KA

U.2 Sri Bilah U.4 Sri Bilah U.6 Sri Bilah U.8 Sri Bilah U.1 Sri Bilah U.3 Sri Bilah U.5 Sri Bilah U.7 Sri Bilah U.10 Sri Bilah U.12 Sri Bilah U.9 Sri Bilah U.11 Sri Bilah U.14 Putri Deli U.16 Putri Deli U.18 Putri Deli U.13 Putri Deli U.15 Putri Deli U.17 Putri Deli U.22 Siantar Ekspres U.21 Siantar Ekspres PLB 7000 Sri Lelawangsa PLB 7002 Sri Lelawangsa PLB 7004 Sri Lelawangsa PLB 7008 Sri Lelawangsa PLB 7010 Sri Lelawangsa PLB 7012 Sri Lelawangsa PLB 7001 Sri Lelawangsa PLB 7003 Sri Lelawangsa PLB 700 Sri Lelawangsa PLB 7009 Sri Lelawangsa PLB 7011 Sri Lelawangsa PLB 7012 Sri Lelawangsa


Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Bisnis Bisnis Bisnis Bisnis Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi



Berangkat Datang

Medan Medan Medan Medan Rantau Prapat Rantau Prapat Rantau Prapat Rantau Prapat Medan Medan Binjai Binjai Medan Medan Medan Tanjung Balai Tanjung Balai Tanjung Balai Medan Siantar Medan Medan Medan Medan Medan Medan Tebing Tinggi Binjai Binjai Binjai Binjai Binjai

Rantau Prapat Rantau Prapat Rantau Prapat Rantau Prapat Medan Medan Medan Medan Binjai Binjai Medan Medan Tanjung Balai Tanjung Balai Tanjung Balai Medan Medan Medan Siantar Medan Tebing Tinggi Binjai Binjai Binjai Binjai Binjai Medan Medan Medan Medan Medan Medan

08.00 10.30 15.00 22.50 08.05 14.35 16.55 23.25 04.50 20.15 09.20 21.40 06.50 12.50 17.10 07.15 11.55 19.25 11.25 07.00 18.00 07.30 05.00 09.50 12.15 14.40 05.20 08.55 06.30 11.00 13.30 15.50

13.16 15.31 20.18 03.34 13.12 19.49 21.50 04.21 05.42 21.07 10.12 22.32 11.17 17.27 22.15 11.54 16.28 22.47 14.50 10.45 20.04 08.22 05.52 10.42 13.07 15.32 07.22 09.47 07.22 11.52 14.22 16.42


WASPADA Rabu 27 Februari 2013

Sidang Lanjutan Kasus BNI SKM Medan

Surat Kuasa PT Atakana Sah MEDAN (Waspada): Saksi ahli dari BPN Abdul Rahim Lubis menyatakan, perjanjian pengikatan jual beli (PPJB) PT BDKL dan PT Atakana Company sah. Demikian juga surat kuasa PT Atakana kepada Boy Hermansyah sebagaimana ketentuan dalam KUHPerdata. Demikian fakta-fakta yang terungkap dalam persidangan Pengadilan Tipikor dihadapan majelis hakim yang diketuai Erwin Mangatas Malau, di Pengadilan Negeri Medan, Selasa (26/2). “PPJB PT BDKL dan PT Atakana Company sah dan dibolehkan. Namun proses selanjutnya yaitu AJB harus mendapat izin dari BPN. Demikian pula surat kuasa PT Atakana kepada Boy Hermansyah untuk menjual itu adalah sah sebagaimana ketentuan dalam KUHPerdata,” kata Abdul Rahim Lubis, yang pada tahun 2010 menjabat Kasi Hak Tanah BPN (Badan Pertanahan Nasional) Sumut. Abdul Rahim Lubis mengakui, saat menjabat sebagai Kasi Hak Tanah BPN Sumut mengetahui adaya surat kuasa dari M Aka selaku Dirut PT Atakana Company kepada Boy Hermansyah selaku Dirut PT BDKL (Bahari Dwi Kencana Lestari). “Ada surat kuasa dari M Aka kepada Boy Hermansyah khusus untuk penjualan SHGU No. 102 yang terletak di Aceh. Proses peralihan HGU harus diajukan permohonan kepada pejabat pemegang SK. Setelah ada izin, lalu dibuatlah akta peralihan haknya oleh PPAT, lalu dibaliknamakan di BPN Pusat. Setelah dilakukan akta perjanjian jual beli HGU, maka dilakukan izin peralihan, baru PPAT membuat akta jual beli,” sebutnya. Menurut saksi, untuk membuat akta peralihan Sertifikat Hak Guna Usaha (SHGU) harus ada izin dari BPN Pusat. Peralihan itu juga harus dibuktikan dengan akta dari PPAT (Pejabat Pembuat Akta Notaris) setempat. Begitupun, bila ada akta PPAT, namun tidak ada izin dari BPN Pusat,

maka peralihan SHGU itu tidak sah. “Jadi peralihan itu harus dibuktikan dengan akta PPAT. Ada akta PPAT tapi tidak ada izin BPN Pusat, berarti tidak bisa dialihkan. Begitupun pemegang hak yang terdaftar BPN lah yang menjadi subjek atau memberikan jaminan hak tanggungan. Untuk penerbitan akta pembenahan hak harus dibuat PPAT sesuai dengan daerah kerjanya,” ujar saksi. Saksi menjelaskan, dalam mengajukan peralihan SHGU itu, bisa melalui Kanwil BPN setempat lalu diteruskan ke BPN Pusat. Namun Kanwil harus memeriksa dokumen izin peralihannya. “Kalau misalnya ditolak di BPN Pusat, itu karena ada masalah teknis, misalnya ada sengketa. Sepanjang belum keluar izin peralihan, maka SHGU tetap terdaftar atas pemegang hak yang lama dalam hal ini PT Atakana Company,” tuturnya. Sekedar mengingatkan, dalam perkara ini, salah satu dari empat pemilik saham lama PT Atakana, yakniMuhammadAkaselakuDirekturUtama,secara sepihak (tanpa persetujuan pemegang saham yang lain), mencabut kuasa yang diberikan kepada Boy Hermansyah sebagaimana keputusan RUPS. Tidak hanya itu, Aka juga mengajukan pemblokiran atas SHGU No. 102 ke kantor Badan Pertanahan Nasional (BPN). Selanjutnya Aka mengadukan Boy Hermansyah ke Poldasu dan Kejatisu, dengan tuduhan penggelapan dokumen pemilikan kebun PT Atakana, sebagai jaminan pinjaman ke BNI SKM Medan. Bahwa aset SHGU No. 102 atas nama PT Atakana Company telah dipindahtangankan kepada pihak ketiga atas dasar persetujuan oleh para Pemegang Saham dalam Rapat Pemegang Saham Luar Biasa. Namun, M Aka melaporkan PT BDL ke Polda Aceh dan Polda Sumut, sehingga Polda Aceh menyita fisik SHGU No.102 dan dititip rawatkan kepada M Aka/PT Atakana. (m38)

Konferda Garda Banper Sei Padang Dinilai Ilegal Waspada/Andi Aria Tirtayasa

PETUGAS Reskrim Polsek Percut Seituan dipimpin AKP Faidir Chan menginterogasi tersangka ML (duduk tidak pakai baju), pelaku pencurian yang menikam korbannya bertubi-tubi di Asrama Putri Universitas Amir Hamzah.

Pesantren Raudhah Berbenah Sambut Santri MEDAN (Waspada): Menyambut tahun ajaran 2013/ 2014, Pesantren Ar-Raudlatul Hasanah (Raudhah) mulai berbenah untuk persiapan menyambut santri dan santriwati baru. Selain perbaikan gedung lama, pembangunan gedunggedung baru juga sedang berlangsung. Salah satunya pembangunan tahap pertama Rusunawa yang merupakan bantuan dari Kementerian Perumahan Rakyat (Kemenpera) untuk asrama santri dan santriwati Raudhah yang saat ini sedang berlangsung. Sebagaimana dilansir situs resmi Kemenpera RI, area Pesantren Ar-Raudlatul Hasanah Medan merupakan salah satu daerah yang telah masuk perencanaan pembangunan Rusunawa tahun 2013 dalam program pembagunan multiyears. Pembangunan tersebut direncanakan akan selesai akhir Juni 2013 dengan daya tampung sebanyak 350 santri. Sekretaris Pesantren Raudhah Ustad Mar’an Sabuqi Siregar, di ruang kerjanya, Selasa (26/2), menjelaskan tentang

rencana Raudhah ke depan. Selain pembangunan Rusunawa tersebut, Raudhah juga sedang merenovasi total gedung Mesir untuk dibangun secara permanen 4 lantai. Gedung tersebut ditahunajaranbaruakandipergunakan sebagai ruang perpustakaan,aulapertemuandanlaboratorium selain kelas-kelas santri. Begitu pula dengan Masjid Jami’ yang menjadi central kegiatan Pesantren. Jumlah santri yang semakin banyak dan kunjungan dari wali-wali santri menjadikan program pelebaran masjid masing-masing 6 meter di sisi kanan dan kiri, menjadi prioritas yang akan diselesaikan tahun ini juga. Untuk itu, santrisantri juga terkadang dilibatkan untuk bersama-sama bergotong-royong menaikkan batu dan bahan-bahan yang diperlukan. Di samping itu, pada tahun 2013/2014, Raudhah juga mencanangkan untuk membuka secara resmi pendaftaran santri/ santriwati baru Pesantren Cabang Ar-Raudlatul Hasanah yang berada di daerah Lumut, Sibolga, Tapanuli Tengah.

Perencanaan tersebut ditetapkan menyusul sambutan warga Lumut dalam peletakan batu pertama tahun 2011 yang lalu dan melihat kapasitas asrama serta gedung di pesantren pusat Medan, yang tidak lagi cukup untuk menampung lebih banyak santri di tahun ajaran baru nanti. Pesantren yang dalam tahap penyelesaian ruang kelas tersebut akan menjadi Pesantren Cabang Pertama dan satu-satunya Pesantren ArRaudlatul Hasanah Medan, sampai saat ini. “Pesantren Ar-Raudlatul Hasanah, sebagai lembaga pendidikan milik umat tentu akan terus berbenah dalam memberi pelayanan kepada masyarakat. Di Desa Simpang Pergendangan, Tiga Binanga, Tanah Karo, kita juga telah membangun Raudhatul Atfal (RA) dan Madrasah Ibtidaiyah (MI) yang atas doa dan sambutan masyarakat telah mendapat izin operasional pada tahun 2012 masing-masing dengan NSM 101212060018 untuk RA dan NSM 1112120600010 untuk MI,” kata Siregar. (cwan)

MEDAN (Waspada): Dewan Pimpinan Daerah (DPD) Garda Banper Sumut hasil Konferda Siantar, menyatakan Konferda Garda Banper Sumut yang diadakan Taufan Agung Ginting, pada 23 Januari 2013 di Sei Padang Medan, ilegal, karena bertentangan dengan AD/ART dan sarat dengan kepentingan politik. Ketua DPD Garda Banper SumutYusuf Tarigan mengatakan itu kepada wartawan, Selasa (26/2), menyikapi berita di sejumlahmedia terbitan Medan tentangpembekuanDPDGardaBanperolehTaufan Agung Ginting selaku pendiri ormas itu. Kata Yusuf, apa yang dilakukan Taufan sangat bertentangan dengan visi misi membangun kepemudaan. “Pernyataan Taufan mengindikasikan kegelisahan dirinya yang ditinggal para pendukungnya sebagai efek sikapnya yang kami anggap tidak bertanggungjawab terhadap organisasi,” ujarnya. Hal itu, sebutnya, karena oknum-oknum pengurus DPC yang menghadiri Konferda Sei Padang juga tidak dapat dianggap sebagai utusan yang sah, sebagaimana layaknya pelaksanaan konferensi sebuah organisasi. Misalnya, Saul Sihombing mewakili DPC Dairi sudah 15 tahun tidak aktif mengelola Garda Banper di Dairi. Begitu juga Boloni Tarigan dari Langkat, Gantino Barus dari Karo, Syahrudi Erwin dari Asahan yang katanya Plt Garda Banper Asahan. “Parahnya, Supratman Siahaan dari DPC Medan sebenarnya sudah bukan pengurus DPC Medan, karena pada 2010 sudah dibekukan dan diterbitkan SK Plt No. 07/DPD/GB/SU/SK/III/2010 tentang pelaksana tugas DPC Garda Banper Medan dan SK No. 012/DPD-GB/SU/SK/V/2010 tentang struktur komposisi dan personalia pengurus Garda Banper Kota Medan atas pimpinan Effendi Purba sebagai ketua dan Aquardes Janri Pakpahan sebagai sekretaris,” sebut Yusuf. Sekretaris Garda Banper Sumut Johnny Sarinthon menambahkan, Konferda dilaksanakan Taufan tersebut tidak organisatoris. “Mestinya

langkah-langkah organisasi melaksanakan sebuah konferensi harus sesuai aturan yang tertuang di AD/ART, bukan sesuai akte pendirian, karena DPD Garda Banper Sumut pimpinan Yusuf Tarigan merupakan hasil Konferda yang merupakan pilihan suara dari kabupaten/kota se-Sumatera Utara,” tutur dia. Sementara hasil Konferda di Siantar memutuskan, Garda Banper adalah sebuah organisasi yang independen, dan harus diketahui tidak ada satu rupiah pun uang dari PDIP dikeluarkan untuk membangun dan membesarkan Garda Banper, kecuali jika ada oknum-oknum yang meminta uang kepada PDIP tanpa diketahui organisasi. Menurutnya, pada kongres PDIP di Semarang, PDIP menolak Garda Banper sebagai ormas underbow PDIP. “Jadi kenapa Taufan sangat sibuk membawa dan mengatasnamakan Garda Banper untuk mendukung calon diusung PDIP saat pilkada. Tetapi setelah selesai pilkada Garda Banper pun ditinggalkan,” ujarnya. Kepada para pendiri Garda Banper agar menyikapi permasalahan itu dengan arif dan bijaksana, tidak terprovokasi oleh oknum diduga memiliki kepentingan pribadi dan politis. “Karena visi kepemudaan harus dibangun demi kepentingan bangsa dan negara,” kata Jhonny menyebutkan segera mempersiapkan konferensi sebagai forum tertinggi organisasi dalam menyelesaikan persoalan organisasi, termasuk pergantian kepengurusan. Sementara itu, tokoh masyarakat Marlon Purba menilai sikap diambil Taufan Ginting selaku salah seorang pendiri Garda Banper Sumut sangat tidak bijaksana dan menunjukkan yang bersangkutan tidak paham dalam berorganisasi. Dia mengatakan, menyelesaikan permasalahan terkait persoalan organisasi ada mekanismenya, karena pengurus Garda Banper Sumut dipilih melalui Konferda. “Saya berharap Taufan dapat lebih dewasa menyelesaikan persoalan terjadi saat ini,” kata Purba.(m27)

Rektor IAIN SU Mendatang Harus Punya Kapasitas Lakukan Perubahan MEDAN (Waspada): Sekjen Forum Pembauran Kebangsaan (FPK) Sumut DR Arifinsyah MAg mengatakan, perlu perubahanperubahan yang positif di IAIN Sumatera Utara. Satu di antaranya, diperlukan sosok Rektor yang punya kapasitas untuk melakukan perubahan-perubahan yang signifikan tersebut. “Sosok Rektor mendatang harus memiliki visi dan misi multikultural dalam berbagai bidang untuk membangun IAIN SU ke depan,” kata Dr Arifinsyah MAg, di Medan, barubaru ini, terkait akan dilaksanakan pemilihan Rektor IAIN SU Periode 2013-2017. Kata dia, di IAIN SU berkumpul beragam latarbelakang baik etnis, pendidikan, ormas dan sebagainya, tetapi dapat

bersinergi untuk membangun IAIN SU ke depan. Menurut Arifinsyah, dalam konteks ini di IAIN SU cukup banyak yang punya kriteria demikian, misalnya Prof DR NA Fadhil Lubis MA, Prof DR Asmuni, Prof DR Syahrin MA, Prof DR Ramli AbdulWahid MA, Prof DR Amiur Nuruddin MA. “Tidak kalah penting dan menarik sosok lainnya yakni Dekan Fakultas Syariah IAIN SU DR Saidurrahman MAg. Sosok ini adalah sosok yang unik bahkan punya peluang untuk menatap IAIN SU ke depan dengan ide-idenya yang plural dan semangat yang kuat untuk memajukan IAIN SU,” sebutnya. Selain itu, lanjut dia, Rektor yang diharapkan ke depan adalah yang mampu mening-

katkan kesejahteraan pegawai dan dosen. Hal ini dengan indikator penertiban administrasi, ketegasan dalam kebijakankebijakan dan penyelesaian persoalan internal maupun eksternal, dan juga ketegasan tidak hanya melihat benar dan salah tetapi juga nilai keadilan dan soliditas keluarga besar IAIN SU. Arifinsyah mengatakan, satu hal yang harus dipahami Rektor IAIN SU ke depan, bahwa potensi dosen IAIN SU cukup banyak dimanfaatkan lembaga-lembaga di luar IAIN SU, seyogianya Rektor harus mampu memberdayakan dan mensinergikan potensi-potensi yang strategis tersebut untuk membangun IAIN Sumut ke depan. (m49)

Brankas Labkes Dibobol Maling MEDAN (Waspada): Dua brankas milik Kantor Balai Laboratorium Kesehatan (Labkes) Medan di Jln. Williem Iskandar Pasar V Barat, Desa Medan Estate, Kec. Percut Seituan, dibobol maling, Minggu (24/2). Akibatnya, uang Rp5 juta milik para pegawai lenyap. Bendahara di Labkes Medan, Rahman, 52, dalam laporan pengaduannya di Polsek Percut Seituan, Senin (25/2) menyebutkan, akibat aksi maling itu, dua brankas rusak dan uang Rp5 juta merupakan uang arisan para pegawai Labkes di dalam brankas lenyap. “Yang hilang hanya uang arisan sebanyak Rp5 juta, sedangkan surat-surat penting lainnya tidak ada yang hilang,” sebutnya. Informasi yang diperoleh di kepolisian, pencurian tersebut pertama kali diketahui petugas kebersihan (cleaning service) yang pagi itu hendak bekerja

membersihkan setiap ruangan. Semua pintu ruangan terbuka dan suasana dalam ruangan acak-acakan. Petugas Polsek Percut Seituan dan Tim Identifikasi Polresta Medan yang turun ke TKP melakukan penyelidikan dan menemukan jerejak jendela yang terbuat dari besi di belakang kantor sudah rusak dan kacanya pecah. Diduga para pelaku masuk melewati jendela belakang kantor. Di lantai I, hampir seluruh pintu ruangan kerja terbuka serta pintunya rusak akibat dibuka secara paksa. Petugas menemukan dua brankas yang sudah terbuka dan gembok brankas dipotong dengan menggunakan alat pemotong besi. Petugas kepolisian juga menemukan jejak para tersangka yang diduga ada 4 sampai 5 orang dan setelah telusuri bagian tembok di belakang kantor, ternyata jejak tersangka menga-

rah ke belakang arena Valedrom balap sepeda. Selain itu, petugas juga menemukan sepasang sandal jepit yang diduga milik para kawanan maling. Petugas pun kemudian mengintrogasi penjaga malam kantor bernama Sudin Samsir Matondang, 45. Saat ditanya, Sudin Samsir Matondang mengaku tidak bertugas jaga malam saat itu karena dirinya lagi kurang sehat. “Aku tadi malam kurang sehat, aku tiduran di rumah yang tidak jauh dari kantor ini,” ujarnya. Kanit Reskrim Polsek Percut Seituan AKP Faidir Chaniago saat dikonfirmasi mengatakan, pihaknya sedang melakukan penyelidikan. “Polisi sedang melakukan penyelidikan lebih lanjut dan akan memeriksa penjaga malam untuk dijadikan saksi. Du a b r a n k a s s u d a h k i t a amankan untuk dijadikan barang bukti,” tuturnya. (h04)


WAKIL Ketua I Bidang Organisasi Dewan Pengurus Pusat (DPP) Serikat Pekerja Bank Sumut Tumpal Pangaribuan didampingi fungsionaris pusat dan pengurus cabang memberikan keterangan, di Kantor Pusat Bank Sumut.

Serikat Pekerja Bank Sumut Keberatan Pendiskreditan Gus Irawan MEDAN (Waspada): Serikat Pekerja PT Bank Sumut menyatakan keberatan atas pemberitaan yang mendiskreditkan mantan Direktur Utama (Dirut) Bank Sumut H Gus Irawan Pasaribu dengan mengatasnamakan pegawai Bank Sumut. “Pegawai Bank Sumut merupakan orangorang profesional yang tidak ikut terlibat langsung dalam kegiatan politik praktis. Jadi dengan tegas kami nyatakan, Serikat Pekerja Bank Sumut keberatan dan menyesalkan pemberitaan yang mengatasnamakan pegawai Bank Sumut untuk digiring pada kegiatan politik praktis,” kata Wakil Ketua I Bidang Organisasi Dewan Pengurus Pusat (DPP) Serikat Pekerja Bank Sumut Tumpal Pangaribuan kepada wartawan, di Kantor Pusat Bank Sumut Jln. Imam Bonjol Medan, Senin (25/2). Sikap ini mereka nyatakan sehubungan munculnya pemberitaan yang mengisyaratkan 50 persen pegawai Bank Sumut tidak suka kepada Gus Irawan Pasaribu. Berita dimaksud disebutkan berasal dari penjelasan dua oknum yang mengaku pegawai Bank Sumut. Didampingi Sekretaris Umum DPP Serikat Pekerja Bank Sumut M Rafles, Koordinator Bidang Nujuar, Ketua Dewan Pengurus Cabang (DPC) Serikat Pekerja Bank Sumut Syariah Medan Fahmi Ichwan Siregar, beserta sejumlah pengurus pusat dan pengurus cabang Serikat Pekerja Bank Sumut se-Sumatera Utaraut lainnya, Pangaribuan menegaskan pihaknya akan menginvestigasi dua oknum yang mengaku pegawai Bank Sumut dimaksud. “Kami akan investigasi identitas maupun keberadaan dua oknum tersebut siapakah dia, apakah benar pegawai Bank Sumut atau hanya mengaku-ngaku pegawai Bank Sumut kemudian menyebar berita menyesatkan,” ujar Pangaribuan yang mendapat dukungan dan aplaus dari para

pengurus dan Pimpinan Cabang Serikat Pekerja Bank Sumut yang hadir. Selain keberatan dan menyesalkan pemberitaan yang dilansir dua oknum tersebut, kata Pangaribuan, mereka juga keberatan atas pernyataan oknum tidak bertanggungjawab tersebut yang menuduh Gus Irawan menggunakan Bank Sumut sebagai kendaraan politik untuk menuju kursi Sumut 1. “Pernyataan sumber berita itu tidak bertanggungjawab yang mengklaim mewakili 50 persen pegawai Bank Sumut adalah kebohongan besar dan diindikasikan bermaksud memecah belah pegawai Bank Sumut,” sebutnya seraya berulang menyampaikan pernyataan dari dua oknum tersebut adalah bohong dan bertujuan mengadudomba pegawai Bank Sumut. Menurut dia, seluruh pegawai Bank Sumut tidak pernah mendapat tekanan dan intimidasi dalam menyalurkan hak politiknya sebagaiWarga Negara Indonesia dalam memilih calon Gubernur Sumatera Utara periode 2013–2018. “Kami selaku Serikat Pekerja PT Bank Sumut mensinyalir oknum tidak bertanggungjawab tersebut telah terlibat politik praktis sehingga menghalalkan berbagai cara untuk mendiskreditkan Gus Irawan selaku mantan Dirut Bank Sumut yang kini merupakan salah satu kandidat Gubernur Sumut periode 2013-2018,” tuturnya. Karena itu, lanjut Pangaribuan, bila dari investigasi terhadap kedua oknum tersebut ditemukan bukti-bukti kuat atas isu menyesatkan dan tidak bertanggungjawab dimaksud, pihaknya akan melaporkannya kepada manajemen Bank Sumut untuk dikenakan sanksi sesuai code of cundoct dan mengajukan pengaduan kepada pihak yang berwajib untuk dilakukan pengusutan sesuai ketentuan dan perundang-undangan yang berlaku.(cwan)

Luar Negeri Roket Palestina Hantam Israel WASPADA

Rabu 27 Februari 2013

JERUSALEM (AP): Roket yang ditembakkan dari Jalur Gaza menghantam Israel Selasa (26/2) yang membuat ketegangan makin meningkat kembali di kawasan itu beberapa minggu sebelum kunjungan Presiden AS Barack Obama. Jurubicara kepolisian Micky Rosenfeld mengatakan sisa-sisa roket tersebut ditemukan di selatankotaAshkelon,diselatanIsrael. Serangan itu menyebabkan terjadinya kerusakan di satu jalanan, namun tidak ada korban cedera, katanya. Roket tersebut merupakanseranganprojektilpertamadari wilayahPalestinauntukmenghantamIsraelsejakpermusuhanGaza dan Israel November lalu. Penembakan roket tersebut terjadi sehari setelah pasukan Israel melukai dua remaja Palestina dekat kota suci yang dekat ke

Bethlehem, ketika terjadi salah satu dari sekian banyak unjukrasa Palestina diTepi Barat selama beberapa hari terakhir ini. Serangan itu terjadi setelah dikeluarkannya pernyataan dari Kantor Presiden Palestina yang mengatakanPresidenMahmoud Abbas memerintahkan para pejabatkeamananPalestinaSenin malam untuk meningkatkan keamanan dan ketertiban di Tepi Barat, namun menuduh Israel telah memprovokasi warga Palestinauntukmenimbulkankekacauan dan kekerasan.’

“Ledakanterdengardiwilayah Ashkelon dan kami menemukan adanyaroketyangtersangkutmenimbulkan kerusakan di jalanan, namuntidakmelukaiwarga,”ujar jurubicara polisi Israel Micky Rosenfeld Selasa. Sejauhini,tidakadakelompok bersenjata di Gaza yang mengklaim bertanggung jawab atas serangan roket itu. Hal itupun menjadi serangan roket pertama yang terjadi setelah Israel dan Hamas menyepakati perjanjian gencatansenjatayangdimediasiMesir pada November 2012. Selama gencatan senjata berlangsung,perseteruanantaraIsrael dan warga Palestina masih kerap terjadi. Israel sempat menembak

parapetaniPalestinadanbeberapa orang demonstran Palestina. Belakangan ini, Israel dan Palestina juga kembali berseteru akibat kasus tewasnya tahanan Palestina di penjara Israel, Arafat Jaradat. Israel melaporkan, Jaradattewaskarenasakitnamunhasil otopsi Pemerintah Palestina menyebutkan, ada banyak luka memar di jenazah Jaradat yang menunjukan bahwa pria itu tewas karena dianiaya. Presiden Mahmoud Abbas khawatir akan munculnya perseteruan antara warganya dengan Israel. Abbas turut mengingatkan aparat keamanan Palestina agar tidak menyeret dirinya dalam konflik terbuka dengan Israel.

Sementaraitu,PresidenIsrael Shimon Peres langsung mengeluarkan komentarnya untuk menyikapi serangan roket di Kota Ashkelon. Peres menegaskan, Israel tidak pernah berdiam diri bila diserang dengan roket. “PemerintahIsraeltidakpernahdiam dalam menyikapi serangan roket. Hamastahu,bilamerekamenembakkan roketnya, mereka dihukum dan oleh karena itu mereka dituntutmenahandiri,”ujarPeres, seperti dikutip Ynet, Selasa. “Ini adalah peristiwa yang tidak umum, namun meski tidak umum, peristiwa ini harus segera ditindak,” tegas Peres. Seperti diketahui, roket kembali menyerang salah satu kota

di NegeriYahudi itu pada hari ini. Serangan roket itu merusak jalanan namun tidak menimbulkan korban jiwa. “Ledakan kembali terdengar diwilayahAshkelondankamimenemukan ada satu roket yang tersangkut menimbulkan kerusakandijalanan,namuntidakmelukai warga,” ujar juru bicara polisi Israel Micky Rosenfeld. Brigade Jihad Al-Aqsa yang merupakan sayap militer Fatah mengklaim bertanggung jawab dalam insiden serangan itu. Fatah mengatakan bahwa tembakan roket yang ditujukan ke Kota Ashkelon adalah serangan balasan atas kematian tahanan Palestina, Arafat Jaradat. (m10)

China Luncurkan Fregat Siluman

The Associated Press

SEORANG pria Palestina melemparkan batu ke arah tentara Israel setelah upacara pemakaman Arafat Jaradat di kota Hebron, Tepi Barat, Senin (25/2). Ribuan orang menghadiri prosesi pemakaman pemuda Palestina, 30, yang tewas dalam situasi yang menjadi masalah di tahanan Israel.

Aquino Peringatkan Sultan Sulu MANILA,Filipina(Waspada): Presiden Filipina Benigno Aquino memperingatkan seorang pemimpin kesultanan agar mengakhiriupayapendukungnyayang bersenjata untuk menduduki negara bagian Sabah, Malaysia. Dalam pidato di televisi, Presiden Aquino mengatakan Sultan Sulu, Jamalul Kiram III, akan menghadapi ‘kekuatan hukum penuh’ jika pendukungnya tidak meninggalkan Lahad Datu. Sekitar 180 orang mendarat di Lahad Datu Klik padaKlik pertengahanFebruaridengantujuan menguasai kawasan yang berdasarkan sejarah merupakan wilayah Kesultanan Sulu. “Jika Anda tidak memilih untuk bekerja sama, kekutan penuh

hukum negara akan digunakan untuk mencapai keadilan bagi semua orang yang berada dalam jalan yang berbahaya,” seperti dinyatakan Presiden Aquino. “Situasiinitidakbisabertahan. JikaAndamemangpemimpinyang sebenarnyadarirakyatAnda,Anda seharusnya bersama kami dalam memerintahkan pendukungmu untuk pulang dengan damai.” Aquino menambahkan bahwa penyelidikan juga akan digelar sehubungan dengan apakah ada undang-undang yang dilanggar dalam tindakan yang disebutnya ‘bodoh’. Para pendukung Sultan Jamalul Kiram III mendarat di negara bagian Sabah itu dengan menggunakanperahumotordan 30 di antaranya bersenjata.

Kepolisian Malaysia mengepungkemahyangmerekadirikan danmemintaagarparapendatang meninggalkan tempat itu namun ditolak. SeorangsaudaraSultan,Agbinuddin Kiram — yang ikut dalam kelompok pendatang tersebut — mengatakanmerekatidakmelanggarundang-undangapapunkarena SabahadalahmilikKesultananSulu. “Kamibukanmenyerangtempatinikaremamilikkami,”tuturnya kepadakantorberitaTheAssociated Press. “Jika polisi Malaysia menggunakansenjata,makakamiharus mempertahankan diri.” PemerintahMalaysiadanFilipina sudah sepakat untuk mengakhiri masalah ini dengan damai. Filipina mengirimkan kapal

AL yang membawa makanan dan pasokan obat serta pekerja sosial maupun pemimin Muslim untuk membujuk para pendukungSultanmeninggalkanLahad Datu. Negara bagian Sabah memiliki perbatasan laut dengan Filipina Selatan, yang memiliki sejumlah kelompok militan. Di masa lalu, Sabah merupakan bagian dari Kesultanan Sulu, yang menjangkau beberapa kawasan Filipina Selatan termasuk Borneo, sebelum diserahkan kepada Inggris pada tahun 1880an. Tahun 1963, Sabah menjadi bagian dari Malaysia, yang masih membayarsewatahunansebagai perlambang kepada Kesultanan Sulu. (bbc/m10)

Presiden Obama Didesak Dukung Perjanjian Perdagangan Senjata

The Associated Press

PARA petugas bantuan memeriksa lokasi jatuhnya satu balon udara di luar desa al-Dhabaa, sedikit di barat kota Luxor, 510 km selatan Kairo, Mesir, Selasa (26/2). Balon udara itu mengalami kecelakaan saat terbang di atas kota kuno Luxor ketika terjadi kebakaran dan jatuhdisatuperladangantebuSelasa,yangmenewaskan18wisatawan asing, demikian kata pejabat keamanan.

Gema Internasional

PBB, New York (Antara/ Reuters): 36 Kelompok pengawas senjata dan hak asasi menulis surat kepada Presiden Barack Obama menjelang perundingan di PBB mengenai perdagangan senjata pada bulan depan, mendesaknya mendukung kuat per=janjian internasional itu. Pejuang pengawasan senjata mengatakansetiapmenitseorang mati di dunia akibat kekerasan bersenjata dan konvensi diperlukan untuk mencegah arus pengiriman senjata gelap ke daerah konflikdanmeningkatkanperang dan kekejaman. Majelis Umum PBB Desembermemutuskanuntukmemulai perundingan pertengahan Maret tentang perjanjian internasional pertama untuk mengatur perdagangan senjata global senilai AS$70 miliar setelah satu konfe-

rensi Juli gagal mencapai kesepakatan karena Amerika Serikat dan negara-negaralainmenginginkan tambahan waktu. “AS sebagai pemasok senjata terkemuka dunia, memiliki tanggung jawab khusus untuk memberikan kepemimpinan yang diperlukanbagisatuATT(perjanjian perdagangan senjata) dengan standar setinggi mungkin bagi pengiriman senjata konvensional dan amunisi,” kata kelompok itu dalam surat mereka kepada Obama yang dikirim Jumat malam. “Perjanjian Perdagangan Senjata dapat menjadi satu alat penting untuk membantu mengurangkan penderitaan manusiayangdisebabkanolehtransfertransfersenjatainternasionalyang tidak bertanggung jawab. Kelompok 36 itu yang menulis surat itu termasuk Amnesty International

USA, Arms Control Association, Friends Committee on National Legislation, Oxfam America, National Association of Evangeliscals dankelompok-kelompoklainnya. Hal penting dari perjanjian itu adalah menetapkan standar transfer bagi semua transfer lintas perbatasandarisegalatipe senjata konvensional— ringan dan berat. Jugaakan menetapkanketentuan mengikat bagi sejumlah negara untuk meninjau semua kontrak senjata lintas perbatasan guna menjamin amunisi itu tidak akan digunakan dalam pelanggaran hak asasi manusia, tidak melanggar embargo dan tidak dialihkan secara tidak sah. JurubicaraWakil Dewan Keamanan Nasional AS Caitlin Hayden mengonfirmasikan surat itu dan mengatakan pihaknya“mengajukan sejumlah masalah pen-

ting.”DiamengatakanWashington akan mendukung satu perjanjian berdasarkan syarat-syarat tertentu. “Konferensi Perjanjian Perdagangan Senjata Maret 2013 itu akan mengusahakan satu Perjanjian Perdagangan Senjata yang akan membantu keamanan internasional,(dan)melindungihak kedaulatan negara-negara untuk melakukan perdagangan senjata yang sah,” katanya. Hayden mengatakan Washington tidak akan mendukung satu perjanjian yang melanggar hak konstitusional para warga AS untuk memiliki senjata- satu masalah politik yang peka di AS. Karena pemberlakuan satu perjanjian bulan depan akan membutuhkan konsensus,AS dan semuadelegasilainmemilikihakhak veto.

Demokrasi Mau,Yang Ambivalens Juga Oke SEMENJAK diperkenalkan ‘demokrasi’ sebagai sistem pemerintahannegarayangdikehendaki rakyatataubangsa,banyaknegara berpacumengejardanmengadopsi ‘demokrasi’atausecarasederhana dapatdisebutsebagai‘sistempemerintahan atau negara yang dikehendaki rakyat.’ Demokrasi menjadi primadona tujuan yang hendak dicapai. Namun sekarang timbulpertanyaanapakahsemua rakyat atau negara menghendaki demokrasi?Takperlususah-susah menjawab, memang ada rakyat yang tidak menghendaki demokrasiatauyangbersifatambivalens. Suatu survei di Libya yang dilaksanakan setelah kejatuhan Moammar Khadafi menampakkan bahwa rakyat di sini tidak tertarik dengan demokrasi. Padahal, Arab Spring yang dianggap sebagai penggerak kebebasan di dunia Arab oleh dunia Barat dirayakan sebagai perjuangan de-

mokrasi melawan kediktatoran. Hanya sekitar 15 persen yang menyatakan bahwa mereka menghendaki demokrasi dalam jangka satu tahun dibandingkan dengan 40 persen yang menyuarakan menginginkan a strong leader. Sedangkan sepertiga lagi penduduk yang disurvei menghendaki demokrasidalamwaktulimatahun ke depan. Menurut seorang akademisi yang terlibat dalam pelaksanaan survei bahwa rakyat Libya kurang pengetahuan mereka tentang pelaksanaandemokrasi.Mungkin sekali penyebabnya ialah Libya begitulamadibawahpenindasan pemimpin yang otoriter. Rakyat Libya mungkin sangat sedikit terterpademokrasi.Menarikuntuk dilihat pada respons peserta survei tentang demokrasi dilaksanakan beberapa tahun lalu di Asia Selatan terutama India dan Pakistan. Ke dua negara dianggap lebih

YANGON, Myanmar (Antara News): Dua peraih hadiah Nabel, Uskup Agung Desmond Tutu dan Aung San Suu Kyi, Selasa (26/ 2) bertemu diYangon, Myanmar.“Tutu bertemu dengan sejumlah tahanan politik pagi ini. Daw Suu (Aung San Suu Kyi) akan menemuinya di Yangon sore ini — dia (Suu Kyi) akan kembali dari Naypyidaw untuk bertemu dengannya,” kata sumber pada Liga Demokrasi Nasional (NLD) pimpinan Suu Kyi.Daw adalah panggilan kehormatan Myanmar. Seorang pejabat pemerintah Myanmar membenarkan kedatangan Tutu yang kabarnya akan juga melancongi sejumlah tujuan wisata, termasuk kuil Bagan dan danau Inle di negara bagian Shan, sebelum melintas ke India pada 1 Maret. Tutu yang memenangkan Nobel pada 1984 karena perannya dalam menentang apartheid di Afrika Selatan adalah penyokong utama perjuangan Suu Kyi dalam menegakkan demokrasi. September 2011, setahun setelah Suu Kyui dibebaskan, pria flamboyan berusia 81 tahun ini mencetuskan kalimat “I love you!” (Aku cinta padamu) kepada Suu Kyi lewat link video.

SHANGHAI, China (Waspada): Polisi China mulai menggelar penyelidikan terhadap sebuah perusahaan pakaian yang merancang seragam sekolah. Menurut laporan, seragam rancangan perusahaan itu terkontaminasi racun. Timpengawasdarikepolisianmengatakan,pewarnayangdigunakan perusahaan Shanghai Ouxia Clothing dalam merancang seragam, mengandung senyawa amina aromatik. Sekitar 24.600 bocah SD dan SMPdimintaberhentimenggunakanseragamyangdibuatperusahaan tersebut, demikian diberitakan BBC Selasa (26/2). Seperti diketahui, amina aromatik merupakan bahan dasar pembuat plastik dan juga pestisida. Senyawa itu dapat berubah menjadi racun bila dihirup atau dimasuk ke pori-pori kulit. BiroSupervisiTeknisdanKualitasShanghai(SQTSB)menemukan enam buah seragam sekolah buatan perusahaan itu yang dinilai tidak memenuhi standar. Sementara itu, lima seragam lainnya dikabarkan tidak layak digunakan.

BEIRUT, Lebanon (AP): Para aktivis anti-rezim mengatakan puluhan orang anggota pemberontak dan pasukan pemerintah tewas dalam pertempuran dekat satu akademi kepolisian dekat kota Aleppo, di Syria Utara. Observatorium HAM Syria mengatakan Selasa (26/2) bahwa korban tewas dalam pertempuran selama dua hari, termasuk sekurang-kurangnya 26 pemberontak, 40 tentara pemerintah dan lima milisi pro-pemerintah. Kelompok aktivis itu mengatakan kedua belah pihak telah saling menembak saat pemerintah melancarkan serangan udara. Akademi kepolisian itu terletak di timur Aleppo, kota terbesar Syria, di mana pemberontak berperang untuk menguasainya sejak Juli lalu. PBB mengatakan kira-kira 70.000 orang tewas sejak konflik Syria dimulai Maret 2011. Sebelumnya, Human RightsWatch (HRW) — badan pemantau HAM dunia — mengatakan Selasa, sekurang-kurangnya 141 orang, setengahnya anak-anak, tewas ketika militer Syria menembakkan sekurang-kurangnya empat misil ke Aleppo pekan lalu. KelompokpemantauHAMinternasionalitumengatakanserangan mengenaikawasanpadatpendudukdanmenyebutseranganitusebagai ‘satu peningkatan serangan terhadap warga sipil Syria.’ (m10)

LUXOR, Mesir (AP): Satu balon udara yang terbang di atas kota kuno Luxor di Mesir terbakar dan jatuh ke perladangan tebu Selasa (26/2), yang menewaskan sekurang-kurangnya 19 wisatawan asing, demikian menurut seorang pejabat keamanan. Peristiwa itu merupakan salah satu yang terburuk yang melibatkan wisatawan asing di Mesir dan tampaknya akan mendorong industri pariwisata ke kancah resesi yang lebih dalam. Para korban tewas di antaranya warga Prancis, Inggris, Belgia, Hongaria, Jepang dan sembilan wisatawan Hongkong, kata Gubernur Luxor Ezzat Saad kepada para wartawan. Tiga orang berhasil selamat dalam kejadian tersebut — dua wisatawan dan satu warga Mesir — telah dilarikan ke rumah sakit lokal. Menurut pejabat keamanan Mesir, balon udara tersebut dalam penerbangannya membawa sekurang-kurangnya 20 wisatawan terbang di atas Luxor ketika terbakar, yang kemudian memicu satu ledakan di tabung gasnya, kemudian jatuh dari ketinggian 300 meter dari udara. Balon tersebut jatuh ke perladangan tebu di luar desa al-Dhabaa, sedikit di barat Luxor, 510 km selatan Kairo, kata pejabat tersebut, yang tak ingin disebutkan namanya. Mayat para korban wisatawan itu bertaburan di perladangan tebu tersebut bersama puing-puing balon udara itu. Seorang wartawan The Associated Press di lokasi kejadian menghitung ada delapan mayat ketika jasad tersebut dimasukkan ke dalam kantungan mayat dan dibawa. Pejabat keamanan mengatakan seluruhnya tercatat 18 mayat yang telah ditemukan. (m10)

Suu Kyi Bertemu Tutu

Seragam Sekolah Siswa China Terkontaminasi Racun

Puluhan Orang Tewas Dalam Pertempuran Terakhir Di Syria

Balon Udara Meledak Dan Jatuh Di Mesir, 18 Tewas


berpengalamantentangdemokrasi ketimbang Libya. Survei di Asia Selatan memperlihatkan dukungan yang luas pada demokrasi, tapi juga memunculkanbeberapacelahdalam dukungantersebut.Umpamanya, 62 persen orang yang disurvei menyatakan lebih memilih demokrasi pada bentuk pemerintahan, sementara itu hanya 10 persen dengan tegas memilih pemimpin yang otoriter pada bidang pemerintahan tertentu. Namunbegitu,28persenresponden menyatakan tak persoalan apakah pemerintahan yang demokratis atau tidak. Hasil survey bahkan lebih penting–danrasakhawatirmunculdalamhaldukunganterhadap demokrasi – jika dibandingkan respons spesifik di India dan Pakistan. Dukungan terhadap demokrasi amat lemah di Pakistan dibandingkan dengan India.

Laporan survei ini menunjukkanbahwaketikasurveydilaksanakan Pakistan berada di bawahkepemimpinanmiliteryang otoriter. Tidak jelas memang, sejauh mana berpengaruhnya terhadapresponden.Ketikaresponden menjawabpertanyaanyangopenended tentang apa arti demokrasi bagi mereka, kebanyakan mereka yang menjawab baik di India maupundiPakistan,jawabannya sangat positif atas ide demokrasi. Hanya 7 persen responden India dan 8 persen responden Pakistan menggambarkan demokrasi dalam artian negatif. Ketika responden ditanyakan lebihmemilihpemerintahanyang demokratis ketimbang bentuk pemerintahanlain,hasilnyacukup berbeda.RespondenIndia70persen nyata memilih demokrasi, hanya 37% Pakistan yang memilih demokrasi. Sama halnya hanya 6 persen India mendukung kedik-

tatoran dibandingkan dengan 14 persen Pakistan. Pandangan respondenPakistanyang14persen tersebut bisa disebut sama dengan hasil respons Libya 10 persen memilih diktator. Jawaban yang ambivalens seperti halnya di Libya, di India danPakistanjawabanserupajuga muncul. Lihatlah cukup mengagetkan49persenpersenresponden Pakistan menyatakan bahwa mereka tak ambil pusing apakah pemerintahberbentukdemokratis atautidak.Danlebihmengherankanlagi21persenrespondenIndia juga menyatakan pemerintahan yang demokratis atau bersifat kediktatoran. Jawaban ambivalens ini di Asia Selatan digali lebih jauh oleh survei dengan proses eliminasi responden yang menyatakan mereka menerima demokrasi tetapi senangjugadenganpemerintahan yang otoriter pada beberapa

bidang pemerintahan. Mereka tidakmempersoalkanpulaapakah olehmiliter,strongleaderataupara teknokrat. Contoh survei yang saya kemukakan di sini seperti di Libya yang mewakili dunia Arab setelah gejolakrevolusiyangmenurunkan para penguasa yang otoriter,Libya sedang mencari bentuk atau sistem pemerintahan yang bagaimana sebaiknya setelah mereka didera dibawahpemerintahanMoammar Khadafipuluhantahun.Sedangkan di India dan Pakistan menjadi pembanding menarik dalam hal pemerintahandemokrasiyangmereka anut sampai sekarang. Kesimpulannya terlihat bahwa responden yang disurvey menyatakan mau demokrasi tapi bersifat ambivalens dalam hal pelaksanaan pemerintahan artinya mereka tidak begitu nyata menginginkan demokrasi penuh. (Kosky)

BEIJING, China (AP): China meluncurkan satu fregat siluman bermisil di tengah ketegangannya dengan para tetangga sehubungan dengan klaim Beijing atas beberapa wilayah maritim. AL Tentara Pembebasan Rakyat saat ini membangun sebanyak 20 fregat Type 056 Jiangdao untuk menggantikan sejumlah kapal model lama dan meningkatkan kemampuan untuk berpatroli dan mengawal kapal-kapal dan kapal selam di perairan yang diklaimnya di Laut China Selatan dan Timur. Kapal pertama untuk kelas 056 Jiangdao itu, kapal No.582 secara resmi diserahkan kepada AL Senin (25/2) di kota metropolis Shanghai yang menjadi pangkalan bagi armada timur China. Kapal-kapal itu menampilkan desain ramping untuk mengurangi kesemrawutan dan membuat mereka sulit terpantau radar dan dipersenjatai dengan rudal anti-kapal dan anti-pesawat. Kapal-kapal juga memerlukan awak hanya 60, dua pertiga lebih sedikitdarikapaltua.LaksamanaWuShenglimenegaskanpentingnya meningkatkanperangkatdankemampuanALChinaditengahbeberapa sengketa maritim. Pernyataan ini menjadi berita utama Harian PLA yang disiarkan Tentara Pembebasan Rakyat. Wu yang juga anggota Komisi Militer Pusat dari Partai Komunis ini menyerukan terus mening-katkan kemampuan tempur AL China, seperti diinginkan pemimpin China Xi Jinping. Januari lalu, militer China diperintahkan untuk meningkatkan kemampuan tempurnya pada 2013 dan fokus pada tujuan perang serta memenangkan pertempuran. Kapal baru ini disebut menyimbolkan mulainya transformasi kekuatan pertahanan laut China dan diharapkan lebih banyak lagi diproduksi, dengan tugas utama untuk pengawalan dan operasi antikapal selam. China bersengketa dengan Jepang di Laut China Timur, selain juga dengan sejumlah negara Asia Tenggara di Laut China Selatan. (m10)

Kedatangan Jamaah Umrah Meningkat Dramatis Ke Saudi JUMLAH para jamaah Umrah yang tiba di Kerajaan Arab Saudi selama tiga bulan terakhir telah mencapai lebih dari 1,6 juta jamaah, demikian diungkapkan oleh Menteri Urusan Haji Dr. Bandar Hajjar. “Kami mengharapkan rekor kedatangan jamaah Umrah akan terjadi selama Ramadhan,” kata menteri Saudi itu Minggu (24/ 2), yang menambahkan bahwa jumlah jamaah Umrah yang datang tahun ini akan melampaui 6 juta jamaah. Dia mengatakan semua departemen pemerintah bekerjasama untuk memberikan pelayanan penting yang lebih baik kepada para jamaah. “Kami berharap suatu peningkatan jumlah jamaah Umrah sampai 500.000 selama musim Umrah ini dibanding tahun lalu.” Dia mengatakan jumlah jamaah Umrah meningkat sampai 10 hingga 20 persen setiap tahunnya. Hajjar mengatakan kementeriannya telah mengatur serangkaian pertemuan dengan para wakil misi Haji dari lebih 70 negara untuk membuat persiapan awal bagi musim Haji mendatang. “Pertemuan-pertemuan bertujuan membantu misi-misi Haji mengatur para jamaahnya dengan mendidik mereka tentang ibadah Haji,” kata menteri Saudi itu. Mesir, Pakistan dan Aljazair diperkirakan akan mengirimkan jumlah jamaahnya jauh lebih tinggi dibanding tahun lalu, demikian menurut angka-angka yang dikeluarkan oleh misi Saudi di luar negeri.MenteriUrusanHajiDr.BandarHajjarmengatakanperluasan mataf (tempat bertawaf di sekitar Ka’abah) diharapkan tidak akan mempengaruhi jamaah ketika pihak berwenang Saudi harus membuat pengaturan untuk menjamin kenyamanan mereka. Hajjar mengatakan sistem pelacakan elektronik untuk Umrah telah bekerja dengan baik. “Para pejabat kami akan memeriksa pelayanan yang diberikan pada para jamaah melalui berbagai perusahaan dan akan menindak setiap operator yang lalai,” katanya menambahkan. Filipina kirim 8.000 jamaah Sebanyak 8.000 warga Filipina akan melakukan Haji tahun ini, kata Menteri Mehol K. Sadain dari Komisi Nasional Muslim Filipina (NCMF) baru-baru ini. “Kementerian Haji Saudi telah mengabulkan permintaan kami untuk 8.000 visa bagi jamaah haji kita. Tahun lalu, hanya 6.000 jamaah yang melakukan Haji dengan 2.000 visa lanjut setelah diminta, “ kata Sadain dari Jeddah. Dia menambahkan bahwa Filipina memiliki kuota 12.000 visa. SadainmemimpindelegasiberanggotalimaorangkeArabSaudi untuk membahas visa Haji tahun ini. Dia terpaksa pulang ke Filipina karena dia juga berpartisipasi dalam perundingan damai antara pemerintah Filipina dan Front Pembebasan Islam Moro (MILF). Tunisia kirim lebih 10.000 jamaah Sementara itu, dilaporkan sebanyak 10.374 jamaah Tunisia akan tiba di Arab Saudi untuk menunaikan ibadah Haji tahun ini. Hal itu diungkapkan Nourredine Khadmi, menteri urusan agama Tunisia setelah pertemuannya dengan Menteri Haji Saudi di Jeddah, Sabtu lalu. Khadmi, dalam sebuah pernyataan kepada Arab News, menyatakan penghargaan yang tinggi untuk upaya pemerintah Saudi melayaniparajamaahHajinya.Diajugamengatakanbahwatempattempat suci sedang menjalani perbaikan yang tentunya akan lebih bermanfaat bagi jamaah. Perbaikan seperti kereta ke tempattempat suci dan kereta diproyeksikan antara Dua Masjid Suci akan sangat membantu orang beribadah. Menteri Urusan Haji Saudi Dr Bandar Hajjar menyambut menteri Tunisia dan delegasi yang menyertainya. Hajjar terkesan pada menteri Tunisia karena para jamaahnya mengikuti program standar yang disiapkan oleh Kementerian Haji Saudi, seperti pendidikan para jamaah sebelum kedatangan mereka di Saudi dan jadwal pelemparan batu. (an/mujo)

A8 1 CM 2 CM


Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000



: : : : :

Bursa Automotive

Air Condition Ban Radial Central Lock Nippon Denso Double Blower


: Power Stearing : Power Window : Radio Tape : Ve l g R a c i n g :Electric Window

5 CM 6 CM

Rp. 65.000 Rp. 78.000

ISUZU Panther Pick Up Thn. 2004, W. Hitam met, BK Mdn, mobil msh original, sehat, terawat & mulus sekali ( lempang / kaleng2). Bak lebar (3 way). PS, Jok kulit, siap pakai. Hrg. 73Jt Nego. Hub. 0852 1080 4566 (A Lai)

TOYOTA Avanza S Over Kredit Hitam met Th. 2006. Sgt orisinil dan mulus, sudah dibayar 21 x sisa 15x 4.210.000, Balik DP. 75Jt. Nego. Hub. 0852 7688 3371

Panther Pick Up Turbo..............DP 20 Jt-an Panther LM, LV, LS, Touring.......DP 50 Jt-an Hub. Suprapto 0813 7507 0088 /(061) 7786 0168


Hub. VIVI HP. 0813 1075 1237 / 061 9127 2565

DAIHATSU Taft GT 4x4 Thn. 96 Dijual Independent keadaan mulus. Luar dalam. Harga/damai. Hub. 0878 6719 1062 - 0853 5998 4488 PILIH UANG/ EMAS DI DAIHATSU

100% BARU !! DISKON SUKA SUKA, DP dan ANGSURAN NEGO, Xenia DP 15 Jt-an, Teios DP 20 Jt-an, Pick Up DP 13 Jt-an, Gran Max, Sirion dan Luxio Juga bisa, Data bisa dijemput dimana saja dan proses cepat Hub. Hidayat 0853 70733 999

DAIHATSU Astra Promo, Terios, Xenia, Luxio, Pick Up, Bunga Ringan, Proses cepat Hub. 0813 6237 8733, Virthon Sitorus DAIHATSU Xenia Th. 2009. W. Silver metalic, AC, Tape, VR, BR, PS, PW, CL, Body kaleng. Jamin mulus. H. Nego. Hub. 0852 7599 6758 DAIHATSU Grand Max Pick Up 1,3 Over Kredit Th. 2011. Sgt orisinil dan mulus, sudah dibayar 20 x Sisa 16 x 2,993.000. Hub. 0823 6635 9858

DAIHATSU Xenia Th. 2008, Li Family (1000cc) Hitam, BK Mdn. Hrg. Rp. 110Jt. HP. 0812 655 1009 DAIHATSU 100% BARU Xenia D Plus..........DP 28 Jt-an...Angs. 3,1Jt Terios....................DP 33 Jt-an Angs. 4 Jt-an Pick Up.................DP 12 Jt-an Angs. 2 Jt-an Hub. PT. Capella Medan / Josua 0812 6311 0820

DAIHATSU Taft GTS th. 89. W. Hitam, sangat mulus. Rp. 46 Juta Nego. Mitsubishi Jet Star, Th. 87. W. Hitam, siap pakai. Rp. 13 Jt. Nego. Hub. 0853 6172 0189

CHEVROLET Tavera Thn. 02/ 03. Hijau met, BK Mdn Rp. 85Juta. Hub. 77863981 ISUZU Panther Grand Royale Plus Thn. 1999. W. Biru met, BK Asli Mdn, Lkp: AC DB, TP, PS, PW, VR, BR, Jok kulit, mobil sehat, terawat, rapi & bersih. 90%. mulus skl. Siap pakai. Hrg. 79Jt. Nego. Hub. 081 2650 6623 (A Siong)

Rp. 91.000 Rp. 104.000

TOYOTA Avanza Thn 2008 akhir/ BK Des 2013, Tipe S, Warna Silver, Harga Rp. 130 Jt, TP Hub. 0852 7766 1180


DAIHATSU KREDIT TERMURAH Bunga 3,5%, Full Diskon, Xenia DP 20 Jt/Angs. 2,1Juta, Pick Up DP. 11 Jt/Angs. 86.000/Hari, Terios DP 23 Jt Terima Tkr. Tambah Data Dijemput

7 CM 8 CM


MITSUBISHI Kuda Diesel Super Exceed 2000 - 2001. BK Asli Medan, Tgn. I dan baru AC DB, BK Panjang, sangat terawat, tidak kecewa. Hub. 0812 6084 9696

MITSUBISHI Kuda GLS 2001 Dijual. Silver, mobil lengkap dan sangat mulus, Harga Rp. 77 Juta Nego. Hub. 0852 7759 5354 OPEL Blazer LT Injection Hitam met th. 96. Sgt orisinil dan mulus, mesin sehat, AC Dingin. Hrg. 45Jt. Nego. Hub. 0823 6261 5557

PROTON SAGA 1.3 M/T Thn. 2009. Hijau met. BK Mdn Rp. 88Jt. Hub. 0853 7089 9893 SUZUKI Baleno Thn. 2003 W. Silver metalik, AC, Tape, VR, BR, PS, PW, CL, BK Medan asli. Jok kulit, body kaleng. Mulus. H. Nego. Hub. 0823 6271 3587 PROMO SUZUKI BARU 2013 CARRY 1.5 P.U DP 15 Jtan atau Angs 2 Jtan MEGACARRY DP 20 Jtan atau Angs 2 Jtan APVARENA DP 33 Jtan atau Angs 3 Jtan ERTIGA DP 45 Jtan atau Angs 3 Jtan Hub. HENDRA 0821 6674 0003


Carry PU............DP 15 Jt-an / Angs. 2,9Jt-an Mega Carry......DP 21 Jt-an/Angs. 2,6Jt-an Ertiga................DP 40Jt-an/Angs. 3,7 Jt-an Hub. LIWAN 0852 6111 7724

SUZUKI Karimun Over Kredit Hitam met Th. 2003. sgt orisinil dan mulus, sudah dibayar 12 x Sisa 24 x 2.400.000. Hub. 0812 6063 7823


Carry M. Bus 1.5 Futura 2006, Pjk Hidup, Biru, AC, Tape, Mulus Hub. 0852 9758 2374 SUZUKI Sidekick Sudah model Escudo Th. 96. Hitam met, mulus, VR, BR, PS, PW, CL Rmt, Full sound, AC Dingin, Hrg. 0823 6156 7527

KARIMUN Thn. 2000 Biru met. BK Mdn Mobil kaleng2 mulus, full musik. HP. 0813 9692 4688 Buk Suhar. SUZUKI Carry Futura Real Fan Dijual. AC DB, Th. 03. BK Siantar, cantik, jarang pake. Hub. 0812 6343 235

SUZUKI Carry Th. 95/96 Adventura

1.3. W. Merah metalic. VR, BR, Sangat mulus, terawat. Hub.085277 86 8029

Ingin Promosikan Produk Anda Harian

WASPADA Media yang Tepat untuk Iklan Anda

TOYOTA Kijang Super Commando Thn. 89. W. Biru metalik, aC, Tape, VR, BR, Jok kulit, body lempang. Mulus. H. Nego. Hub. 0852 6129 5788


Avanza, Innova, Fortuner PURBA: 0813 9736 0333 -0878 6946 5276

TOYOTA Kijang Super G Th. ‘95. Bensin, warna abu2 tua metalik, BK Asli Medan, Velg Racing, Ban Baru, pakai AC, Rp. 64,5Jt. Depan Kampus UISU No. 200. 0815 337 33688 / 7851402

9 CM Rp. 126.000 10 CM Rp. 140.000

Pelanggan Yang Terhormat


Apabila anda mencurigai sesuatu, silahkan hubungi kami di 061-4576602


TOYOTA Avanza Thn. 2004 Warna silver metalic Type G. Harga Rp. 112juta Nego. Hubungi: 0812 6378 7364

TOYOTA Kijang LGX Th. 97. Bensin, W. Biru, Siap pakai. H. 93Jt/ Nego. Hub. 0852 6176 2517 TOYOTA Kijang Super Commando ‘92. Warna biru dongker, AC, VR, Tape, pakai power, BK Medan asli, atas nama sendiri, siap pakai/BU. Hub. HP. 0821 6405 7884

TOYOTA Avanza Tipe G Dijual. Thn. 2010. Warna hitam, mobil bagus, harga 142 Juta. Alamat Johor Indah Permai Blok R II. HP. 0812 650 9481






Menerima Siswa Baru, Instruktur Berpengalaman, Garansi Sampai Mahir, Ruang belajar Wi-Fi, Bonus Alat Kerja Hub. MB 1 Celullar Jl. Besar Delitua No. 1 (Depan Jl. Stasiun/Sekolah Istiqlal) Telp. (061) 703 2619HP. 0813 6113 9888







Syarat: a. Pendidikan min. SMA/sederajat b. Pengalaman kerja minimal 1 tahun c. Bisa berbahasa Inggris (3, 4) d. Kreatif dan aktif dalam bekerja e. Tanggung jawab dan jujur f. Pengalaman di restoran Franchise sebelumnya (3, 4) NB: Khusus Manager & Asisten Manager dapat training diluar negeri Surat lamaran dikirim ke email:

Atau diantar langsung ke: Jl. Ade Irma Suryani No. 4 Lamaran diterima selambat-lambatnya 7 hari setelah iklan ini terbit

Rp. 1.350.000,Jok (model press) + Alas








KHUSUS REPARASI /SERVICE Kulkas, M. Cuci, Sanyo Air, Dispenser, Bongkar Pasang AC Hub. PRATAMA ELECTRIC GARANSI Telp. 7343789




HP. 0813 7035 7291 Ada Garansi

TUMPAT/ SEDOT SETIA BUDI HP. 8442246 0812 631 6631 Ada Garansi


SEGERA DAFTARKAN KE KANTOR PUSAT MULTAZAM JL. T I T I PAPA N / P E R TAHAN A N N O. 10 SEI SIKAMBING D MEDAN TELP. (061) 457 6116 FAX. (061) 451 2319 HP: 0813 6137 2321 - 0812 6495 8456



Membuka kerja langsung diterima, siapapun anda Jl. Gatsu No. 181 HP: 0812 6099 2580 - 0812 6919 0557, Gaji UMR di Mdn

DIJUAL RUMAH Permanen bertingkat 2 di Jl. Denai Ujung Psr. 5 Tembung. Uk. 18x11. KT. 3, RT, Km2, SHM. PAM. Full keramik. Rp. 295Nego. Hub. 0813 9642 3289 - 0813 6213 9613

STUK BK 7384 DM. No. Uji Mdn 57724-A. A/n. KUPJ. Alamat Jl. SM. Raja S. Marindal No. 07 A Mdn Merk Isuzu.

1. ADMINISTRASI 2. SEKRETARIS DIBUTUHKAN SEGERA Lamaran antar langsung ke: Jl. Krakatau No. 2 D-E Telp. (061) 661 5210 Medan







Dibutuhkan segera, yg sudah pengalaman bekerja di panglong, mobil Carry Pick Up dan Grand Max Pick Up Hub. (061) 661 5210 Medan

Dalam pembukaan 10 kantor cabang baru di Tahun ini perusahaan kami membutuhkan tenaga potensial untuk diproyeksikan menduduki posisi: 1.Sekretaris 4.Inventory 2.Administrasi 5.Distributor 3.Pergudangan 6.Marchandiser Diberikan training/pelatihan ±3 bulan pada semua posisi. Bagi yang berprestasi diberikan menempati posisi: - Asisten Manager - Manager Cabang Selama training ada penghasilan Harian + Mingguan + Bulanan sesuai dengan standar pelatihan bagi yang berprestasi Syarat-syarat: 1. Min SMU sederajat 2. Foto copy KTP : 1 lembar 3. Foto copy Ijazah : 1 lembar 4. Pasphoto 3x4 : 2 lembar 5. Daftar Riwayat Hidup 6. Tidak sedang bekerja atau kuliah Surat lamaran diantar langsung ke: M A R S E X PA N D I N G Jl. Mandala By Pass 108D (Sebelah Bank BRI)




STUK BK 1253 EZ. No. Uji Medan 23282 - A. A/n. KPUM. Alamat Jl. Rupat No. 30 - 32 Medan. Merk Daihatsu.




Uk. 10x15m (SHM), B.U Jl. JErmal 14 No. 10, Harga Rp. 160 Jt Hub. 0853 7270 7717


TOYOTA Innova G Solar Th. ‘04/05. Manual. warna hitam metalik, Bln 12,l mobil mulus, Rp. 147Jt. Jl. SM. Raja No. 200. Hub. 0821 6767 7000 / 7851402

* MANUAL / TIPE G * HITAM METALIK * KM RENDAH * BK PANJANG Harga 125Jt/Nego Hub: 0852 0635 4200

1. Kasir 2. Bagian dapur 3. Manager 4. Asisten Manager 5. Administrasi Pembukuan

Cafe di Lhokseumawe Butuh KOKI Berpengalaman (Lelaki), Umur 22 - 27 Thn, Tempat tinggal ada, Bisa Western, Seafood, Indonesia Hub. 0821 6014 5017 - 0812 6964 1320


TOYOTA Kijang Kapsul LGX Solar Th. 2001. BK Medan. W. Biru met, Cat dan mesin mulus, siap pakai Hrg. Nego. HP. 0852 7650 6242



Kami Restoran Franchise ternama membutuhkan:

Jl. HM. Joni No. 56 Medan (Rumah Songket Palembang) Telp. (061) 735 4633

Spesialis Surat Rumah dan BPKB 5 Jam Cair, 3 Juta - 1M. Tanpa Usaha, Bergaransi Jaminan: SHM, SK Camat, HGB. BPKB Mobil, Spd. Mtr, Truk, mobil kredit / Bantu Pelunasan BPKB. Hub. FAMILY FINANCE 0813 7044 6668 , 0813 7044 6633 Sdr. Andre

Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput



JUAL VESPA PX 82 2 BUAH BK Hidup. Lengkap dengan Suku Cadang Griya Martubung Blok IV /98. HP. 0813 6174 4576

TOYOTA Avanza G Th. 2005 BK Medan. W. Silver met, cat dan mesin mulus, siap pakai. Hrg. Nego. HP. 0821 6021 0957




Jaminan apa saja Sertifikat Tanah mobil & Sp. Motor. Segala tahun. Hub. 061-8222774 HP. 0853 6199 1500

TOYOTA Kijang LSX Th. 2002. W. Biru met. Bensin 1.8cc cat dan mesin mulus, AC DB. Hrg. Nego Hub. 0811652506

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

HA TI-HA TI terhadap penipuan yang mengatas HATI-HA TI-HATI namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk TI-HA TI apabila membeli produk anda, dan HA HATI-HA TI-HATI anda ingin melakukan transaksi jual beli melalui transfer. Segala akibat yang terjadi diluar tanggungjawab

-Kijang LGX Biru Solar Thn. 2000. Plat BB Tapsel, lengkap AC DB, Tape, VR, BR, Remot, pajak panjang, BU. 99Jt/Nego. -Kijang Commando 91, Biru, long, 6 speed. 47Juta/Nego. Hub. 0811 645 684

TOYOTA Kijang Commando Long 6 Speed. W. Merah metalic, VR, BR, CD, AC, lengkap, sangat mulus. Hub. 0813 9642 3289

11 CM Rp. 165.000 12 CM Rp. 180.000

Rabu, 27 Februari 2013


Kami perusahaan yang sedang berkembang membutuhkan: 1. Kepala Koki 2. Koki 3. Steward 4. Bartender 5. Waiter/s Persyaratan: 1. Pria/ wanita 2. Pengalaman diutamakan 3. Bersedia kerja shift Fasilitas: Jamsostek dan tempat tinggal Antar lamaran lengkap langsung interview ke: Z & W Coffe Jl. Tempuling No. 146 Medan CP: 0852 7707 8119 Paling lama 2 minggu setelah iklan ini terbit

HADIRILAH !!! JOB FAIR & PAMERAN SMK NEG 8 MEDAN Jl. Dr. Mansyur/ Jl. SMTK Kamis, 28 Februari 2013 Alumni SMK/ SMA Dapat Membawa Lamaran Kerja



Informasi Pembaca Bursa Property

G R : Garasi LB KM : Kamar Mandi LT KP : Kamar Pembantu RM KT : Kamar Tidur RT SHM: Sertifikat Hak Milik

: Luas Bangunan : Luas Tanah : Ruang Makan : Ruang Tamu


Lantai keramik, Gipsum, PAM, 2 Kamar Tidur, Jl. Suasa Raya, Mabar Hilir Medan Hub. 0852 9690 1000


Type 70 (KT 3, KM 2), Carport, Komplex Lalang Green Lang II Hub. 0852 6119 3333

SEDANG DIBANGUN Perumahan Setia Jadi Type 45 (U. Tanah: 6x16m² Harga Rp. 169 Jt, Lokasi Strategis Jl. Benteng Hilir Ujung/ Titi Sewa Bandar Kaliphah (Dekat Unimed Pancing)

Peminat hub. Hendrik 0812 6074 1978 Ali 0812 7694 0050




PERABOT TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 7653.2188

SPRING BED DIJUAL MURAH Spring Bed 6 kaki 2 lapis Rp. 1.150.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun

Hub Telp. (061) 661.8116 - (061) 661.6802 - 7653.2188






Anda Butuh Perabot Jepara Asli?

JUAL KOMP. TASBIH I => (061) 7785 0222 -

Blok B 15x20 Rp. 1,5 M, Blok G15x20 Rp. 1,2 M Blok G 12x20 Perabot AC Rp. 1,3 M Blok VV 9x15, 1½ Tkt, AC, Rp. 680 Jt Blok CC 10x15 Rp. 580 Jt, Blok FF 7x15 Rp. 525 Jt

RUMAH MODEL VILLA DIJUAL Di Patumbak Dsn VI Dekat Amplas Medan, SHM, Uk. 14x19m, Keramik, KT 3, 2 KM, Rp. 275 Jt/nego Hub. 0812 6018 0279

MALIOBORO PERABOT Hubungi: Jl. Bilal No. 90 P. Brayan Medan Telephone Toko : 661.6285 Rumah : 661.1540 Fax : 661.6285 (061) Jl. K.L. Yos Sudarso depan SMA Negeri 1 Tebing Tinggi Telp. (0621) 24243


Komp. Johor Indah I BL XI/ 12, SHM LT. 601m (Lbr. 31,75 x Pjg 19), KT 5, KM 4 Hub. 0812 650 9089


Di Jalan Menteng VII Komplek Citra Menteng Blok Citra Menteng Blok D No. 5, SHM, Luas 147m, 4 KT, 4 KM, Garasi 2 mobil, Maaf TP, Harga bisa nego Hub. 0812 6024 9959 - 0812 6071 2666



Uk: 1750m², Lok. Jl. Sunggal (Dpn Graha Prima) Harga 1 Jt permeter, Surat SHM Cocok buat perumahan HUB. 0812 691 8833/ TANPA PERANTARA

TANAH/ LAHAN DIJUAL Luas 18,10 Ha, Cocok di Tanami Sawit/ Karet, Harga 25 Jt/ Ha Nego Minat hub. 0823 6557 3181 (061) 7511 3304


Tanah Uk. 44x100m, Jln Besar Sei Rampah samping Polsek Firdaus, Cocok U/SPBU, RS, Sekolah, Ruko, Harga 450.000/M, Nego, SHM Hub. 0811 645 684


Tanah & Bangunan (HOOK) daerah Jalan DR. Mansyur Hub. 0852 9716 9621 Tanpa perantara


TANAH & RUMAH SHM Jl. Besar Tg. Morawa LT = 1.400m² LB = 700m² Harga = 2,5 M (Nego) Ada komisi AGEN Hub: 0852 0635 4200 TERCECER TERCECER

STUK BK 9953 DU. No. Uji Mdn 30330 - A. A/n. KUSWINOTO. Alamat Jl. Tapanuli No. 21 Medan. Merk Mitsubishi.


Surat Ganti Rugi Tanah Kaplingan No. 22. Yang terletak di Dusun II Sidomulyo A. Kec. Biru-biru Kab. Deli Serdang Sumatera Utara. a/n. JASRIEL SE. Luas 315m2


Surat Tanah SK Bupati No. 2444 3 / A / IV/22 A/n. WIRO SUMITO. Yang terletak di Jl. Raya Menteng No. 298. Luas +/- 250m. Bagi yang menemukan Surat Tanah tersebut harap hubungi alamat Jl. Raya Menteng No. 298 atau hubungi HERMAN HP. 0813 6172 4943. MUCHLIS. 0813 7591 5241




WASPADA Rabu 27 Februari 2013


Priyo Tegaskan Timwas Century Tidak Panggil Anas JAKARTA (Antara): Wakil Ketua DPR RI Priyo Budi Santoso menegaskan Tim Pengawas Kasus Bank Century (Timas Century) DPR RI tidak ada rencana memanggil mantan Ketua Umum Partai Demokrat Anas Urbaningrum sebagai narasumber. “Timwas Century tidak pernah berencana memanggil Mas Anas. Apa urgensinya?” kata Priyo Budi Santoso di Gedung MPR/DPR/DPD RI, Jakarta,


PRESIDEN Susilo Bambang Yudhoyono bersama Ibu Negara Ani Yudhoyono didampingi Ketua Mahkamah Konstitusi Mahfud MD melihat maket bangunan saat meresmikan Pusat Pendidikan Pancasila dan Konstitusi MK di Desa Tugu Selatan, Cisarua, Bogor, Jabar, Selasa (26/2). Pusat pendididikan itu terdiri atas tujuh bangunan dan menelan biaya Rp 14,2 miliar dari APBN.

Presiden: Pancasila Jangan Disakralkan JAKARTA (Antara): Presiden Susilo BambangYudhoyono mengatakan Pancasila sebagai ideologi negara jangan disakralkan dan menjadi dogma yang kaku. “Pancasila tidak boleh kita sakralkan, kita dogmakan, mari kita tetap jaga sebagai `open` ideologi (ideologi terbuka),” kata Presiden saat memberi sambutan dalam peresmian gedung Pusat Pendidikan Pancasila dan Konstitusi Mahkamah Konstitusi (MK) yang terletak di Cisarua, Bogor, Jawa Barat, Selasa (26/2). Presiden mengatakan, Pancasila sebagai ideologi bangsa dan negara harus mampu tetap relevan seiring dengan perkembangan zaman.

Menurut Presiden, Pancasila merupakan jalan alternatif atas dua ideologi ekstrem yang saling berlawanan, Marxisme Komunisme dengan Kapitalisme Liberalisme. Presiden mengatakan, Marxisme Komunisme mengalami koreksi pasca perang dingin. Negara-negara Eropa Timur yang menerapkan ideologi ini mengalami perubahan fundamental. Sementara ideologi Kapitalisme Liberalisme juga mengalami koreksi seiring dengan krisis ekonomi dunia yang masih mendera saat ini. “Saya mengatakan kedua ideologi itu telah mengalami koreksi sejarah. Indonesia selamat, kita memilih jalan

berbeda, tidak masuk dalam kutub-kutub ideologi itu,” kata Presiden. Sementara itu, Ketua MK Mahfud MD mengatakan Pancasila sebagai ideologi yang terbuka merupakan fitrah bangsa Indonesai yang tidak bisa digantikan dengan ideologi lain. Menurut dia, Pancasila digali dari keluhuran budaya bangsa yang sudah berakar dan dipraktekan sejak lama oleh nenek moyang bangsa Indonesia. Namun demikian Pancasila harus diletakkan dalam kerangka ideologi terbuka yang selalu bisa ditafsirkan berdasarkan perkembangan masyarakat dalam berbagai kearifan lokal.

Martin Minta KPK Tidak Terpancing Konflik Demokrat J A K A RTA ( Wa s p a d a ) : Anggota Komisi III DPR RI dari Fraksi Gerindra, Martin Hutabarat meminta Komisi Pemberantasan Korupsi (KPK) tidak terpancing dengan konflik di internal Partai Demokrat. “Saya beranggapan bahwa KPK tidak perlu ikut-ikutan meramaikan kasus Anas ini,” kata Martin kepada Waspada di Gedung DPRRI Jakarta, Selasa (25/2) menanggapi pernyataan mantan Ketua Umum Demokrat Anas Urbaningrum yang disampaikan saat mengumumkan pengunduran dirinya akhir pekan lalu. Dalam pidatonya Anas

menyebut bahwa peningkatan statusnya sebagai tersangka karena adanya tekanan politik dan bukan murni kasus hukum. Majelis Tinggi Partai Demokrat pun menanggapinya dan meminta KPK menjawabnya atau memberi penjelasan mengapa Anas dijadikan tersangka. Menurut, Martin KPK sebaiknya fokus saja pada tugasnya untuk menyidik kasus Hambalang agar cepat terbongkar dan diketahui masyarakat siapasiapa saja sebenarnya yang bermain di dalamnya. “BUMN-BUMN yang terlibat juga perlu diusut tuntas,” kata Martin.

Dia mengingatkan, masyarakat sudah terlalu lama tersandera oleh berita-berita di sekitar kasus Hambalang ini. “Pendeknya KPK jangan sampai terpancing dan ikut terseret pada konflik yang terjadi di Partai Demokrat sekarang,” ujarnya. Wakil rakyat dari daerah pemilihan Sumut III ini menyarankan KPK tidak ambil pusing dan terlalu banyak mengomentari kasus Anas Urbaningrum, sebab rakyat percaya bahwa KPK masih terjamin independensinya dalam mengusut kasus korupsi, termasuk kasus di proyek Hambalang. (aya)

Selasa (26/2). Priyo menjelaskan, DPR RI sudah memutuskan melalui rapat paripurna bahwa kasus Bank Century dilimpahkan ke KPK untuk ditindaklanjuti sesuai dengan prosedur hukum. Kalau bicara proses hukum di KPK, menurut Priyo, pimpinan DPR RI selaku pimpinan Timwas Century menghormati KPK. “KPK saat ini adalah lembaga penegakan hukum yang paling kredibel dan

JK: Saya Ini Penyanyi Tapi Tak Punya Band DEPOK (Antara): Mantan Wakil Presiden Jusuf Kalla (JK) mengibaratkan dirinya seperti penyanyi yang tidak punya band dalam politik Indonesia. “Politik Indonesia itu ibaratnya kompetisi band. Partai itu band yang membutuhkan figur seorang penyanyi,” kata Jusuf Kalla usai memberi kuliah umum di Balai Sidang Universitas Indonesia di Depok, Selasa (26/2). “Saya ini penyanyi tapi tidak punya band,” kata politisi yang lahir di Makassar, Sulawesi Selatan, pada 15 Mei 1942 itu. Dia mengatakan Indonesia “mempunyai banyak band” dan menyebut Golkar sebagai band yang bagus namun kualitas penyanyinya masih harus diperbaiki. “Kalau Demokrat, akibat macam-macam hal jadi cerai, sehingga tidak punya bas dan penyanyi,” katanya. Dia juga menyebut Gubernur DKI Jakarta JokoWidodo (Jokowi) dan Ketua Mahkamah Konstitusi Mahfud MD sebagai penyanyi yang tidak mempunyai band. “Pada tahun 2013 ini band akan mencari penyanyi dan penyanyi akan menemukan band yang cocok,” ujarnya.

KPK Akan Sita Rumah Gubri Jika Terbukti Hasil Korupsi PEKANBARU (Antara): Komisi Pemberantasan Korupsi (KPK) akn menyita rumah-rumah Gubernur Riau, HM Rusli Zainal (RZ) jika terbukti atau diduga merupakan aset hasil dari kejahatan tindak pidana korupsi. “Namun saat ini kami masih mendata aset dan kekayaan tersangka RZ dan tentunya akan dilakukan penyitaan kalau itu diduga hasil kejahatan korupsi,” kata Juru Bicara KPK Johan Budi dihubungi per telepon dari Pekanbaru, Selasa (26/2). Dia menjelaskan, penelusuran aset kekayaan Rusli Zainal, tersangka kasus dugaan korupsi kehutanan dan korupsi penyelenggaraan Pekan Olahraga Nasional (PON) ke XVIII 2012, dilakukan melalui kerjasama dengan lembaga terkait, khususnya dengan Pusat Pelaporan dan Analisis Transaksi Keuangan (PPATK). “Belum melalui saksi-saksi karena penelusuran biasanya tidak dilakukan melalui keterangan saksi-saksi itu,” katanya. Sejauh ini, kata dia, KPK memang belum melakukan upaya penyitaan, termasuk terhadap rumah-rumah pribadi tersangka RZ, karena tergantung dari hasil penelusuran.

Bupati Tanjabar Jambi Mundur Dari Golkar JAKARTA (Waspada): Bupati Tanjungjabung Barat Jambi, Usman Ermulan yang juga Ketua Dewan Pertimbangan Partai Golkar Provinsi Jambi menyatakan mengundurkan diri dari Partai Golkar. Salah satu alasannya, Usman menyatakan merasa kecewa terhadap DPP Partai Golkar yang tidak merespon tuntutan Musdalub Golkar Kabupaten Tanjungjabung Barat (Tanjabar) untuk menggantikan Ketua DPD Golkar Tanjabar yang diajukan 10 dari 13 pengurusan kecamatan yang ada di kabupaten itu. Surat pengunduran dirinya dikirim ke Ketua DPD Partai Golkar Provinsi Jambi dan tembusannya dikirim ke Ketua Umum DPP Partai Golkar Aburizal Bakrie dan Ketua Dewan Pertimbangan Partai Golkar, Akbar Tandjung pada Sabtu (23/2). Usman diangkat sebagai Ketua Wantim Golkar Provinsi Jambi berdasarkan SK DPD Partai Golkar Propinsi Jambi, No. Kep/ 042/DPD G-I/VII/2011 tanggal 12 Juli 2011 tentang pergantian antarwaktu komposisi dan personalia Wantim Partai Golkar Provinsi Jambi periode 2011-2015. Berdasarkan SK tersebut, Usman jadi Ketua Wantim Golkar Provinsi Jambi hingga 2015. Dalam surat pengunduran diri tersebut, Usman yang sekarang menjabat Bupati Tanjabar itu menyatakan, selama kurun waktu tersebut (Juli 2011 hingga 23 Februari 2013), dirinya merasa belum bisa berbuat banyak untuk kepentingan Partai Golkar, mengingat sesuatu dan lain hal serta kesibukannya menjalankan tugas sebagai Bupati Tanjabar, Jambi. Oleh sebab itu, dengan akal dan pikiran yang sehat, serta tanpa dipengaruhi oleh pihak manapun juga, maka terhitung tanggal surat pernyataannya, dirinya menyatakan mengundurkan diri sebagai Ketua Wantim Golkar Provinsi Jambi, sekaligus mengundurkan diri dari keanggotaan Golkar. Saat dikonfirmasi soal pengunduran dirinya itu, Usman mengaku telah melayangkan surat kepada Ketua DPD Golkar Provinsi Jambi, Ketua Umum Partai Golkar dan KetuaWantim Golkar Pusat, Akbar Tandjung. ‘’Ya, saya akan fokus pada jabatan saya sebagai Bupati Tanjabar. Saya akan concern untuk ngurus kepentingan rakyat. Concern saya cuma itu dan saya tidak mau rakyat yang dulu mendukung saya kecewa,’’ tegas Usman Ermulan. (J07)

dipercaya masyarakat,” kata politisi Partai Golkar ini. Sementara itu, Ketua DPR RI Marzuki Alie menyatakan tidak setuju jika Anas Urbaningrum dipanggil sebagai narasumber pada rapat Tim Pengawas Kasus Bank Century DPR RI. “Keputusan DPR RI melalui rapat paripurna, sudah melimpahkan kasus Bank Century ke KPK untuk menindaklanjutinya,” ucap Marzuki. Menurut dia, jika Timwas

Century DPR RI memanggil Anas sebagai narasumber, berarti melanggar keputusan DPR RI. Padahal, kata dia, keputusan melalui rapat paripurna adalah keputusan tertinggi yang menjadi keputusan DPR RI. “Kecuali jika Timwas Century akan melanggar keputusan DPR RI,” tukasnya. Wakil Ketua Dewan Pembina Partai Demokrat ini menjelaskan, Timwas Century DPR

RI berdasarkan keputusan paripurna DPR RI untuk mengawal proses penegakan hukum yang dilakukan KPK. “Bukan malah sebaliknya, akan membuka kembali kasus Century di DPR RI. jangan diputar-balikkan,” katanya. Sebelumnya, mantan Ketua Umum Anas Urbaningrum mengisyaratkan akan membuka rahasia keterkaitan antara Partai Demokrat dengan kasus Bank Century.

Pelajaran Bahasa Berubah Paradigma JAKARTA (Waspada): Pembelajaran Bahasa Indonesia pada kurikulum 2013 mengalami perubahan paradigma. Penggunaan bahasa tidak saja dijadikan sebagai sarana komunikasi, tetapi sebagai sarana mengembangkan kemampuan berpikir. Perubahan itu menjadi penting, karena Bahasa Indonesia dalam kurikulum baru akan berperan sebagai alat mendidik siswa berpikir kritis, lojik dan argumentatif,” kata Plt. Kepala Badan Pengembangan dan Pembinaan Bahasa Kemdikbud, Mahsun, kepada wartawan di Jakarta, Selasa (26/2). Selama ini, Bahasa Indonesia, sama seperti pelajaran lainnya di sekolah, hanya bermuatan teori. Siswa dipaksa menghafal tata bahasa, tanpa ada kesempatan mempertanyakan, menganalisis dan mempraktikannya secara langsung. Akibatnya, kata Mahsun, proses pembelajaran tidak bersifat interaktif, karena siswa hanya diberi tahu tanpa dididik untuk menvari tahu. “Kondisi seperti itu tidak dapat dibirkan terus, karena jamannya sudah menuntut generasi muda yang kritis, mampu memecahkan masalah dan tidak gampang dipatahkan semangatnya,” tandas Mahsun. Dia menyitir tentang sebuah data dari hasil penelitian

terhadap siswa Indonesia pada 2011 lalu. Dikatakan hanya 5 persen siswa Indonesia yang mampu memecahkan persoalan yang membutuhkan pemikiran. Sisanya atau 95 persen hanya sampai pada tingkat hafalan. “Bukan salah siswa atau siapapun juga. Tapi memang sistem pembelajaran kita tidak ditujukan pada upaya membangun kemampuan berpikir siswa. Dan bahasa, adalah salah satu alat efektif yang akan mengubah secara total sistem pembelajaran di Indonesia lewat kurikulum baru 2013,” kata Mahsun. Kurikulum 2013 memang berbasis Bahasa Indonesia. Secara integratif, Bahasa Indonesia akan membawa sejumlah pelajaran lain seperti Matematika, Ilmu Pengetahuan Alam (IPA), Pendidikan Kewarganegaraan, Ilmu Pengetahuan Alam (IPA) ke dalam ruang belajar siswa, khususnya siswa Sekolah Dasar (SD), dengan cara yang lebih menarik. “Untuk SD bukunya sudah siap semua. Sekarang sudah ada di tim penilai dan akan diberikan ke sekolah-sekolah paling lambat akhir Maret ini,” kata Mahsun. Pelatihan Guru Tentu saja, sebagus apapun kurikulum tidak akan berhasil tanpa peran guru. Karena itu, Tim Kurikulum dari Badan

Bahasa sudah menyiapkan juga buku-buku petunjuk bagi para guru untuk menyelenggarakan pelajaran di kelas. “Meski terintegratif antara satu mata pelajaran dengan mata pelajaran lainnya, tetap saja ada masing-masing kompetensi dasarnya. Dan guru lah yang paling berhak menilai apakah kompetensi dasar itu sudah dipenuhi siswa atau belum,” imbuh Mahsun. Dia menyontohkan salah satu teks pelajaran kelas 1 SD. Di dalam teks awal ada satu pelajaran tentang diri sendiri. Siswa diharuskan memperkenalkan dirinya di hadapan teman-teman sekelas dengan bahasa yang baik. “Kompetensi dasarnya ada. Di situ juga ada pelajaran berhitung dan membaca. Siswa menuliskan huruf-huruf pada namanya dan menghitung ada berapa jumlah hurufnya. Itu sudah terintegrasi dengan pelajaran matematika, misalnya. Seperti itulah,” kata Mahsun. Dalam hal ini Mahsun meyakini pemerintah akan aktif memberi pelatihan dan terus menerus memberi kemudahan pada guru untuk turut beradaptasi dalam mengajar dengan sistem baru. “Karena memang keberhasilan metode pengajaran, kuncinya ada di guru,” tandas Mahsun. (dianw)

Roy Suryo: Ketua Umum KNPI Hanya Taufan Rotorasiko MEDAN (Waspada): Menteri Pemuda dan Olahraga (Menpora) Roy Suryo mengatakan kepemimpinan DPP KNPI versi Akbar Zulfakar tidak diakui, yang diakui adalah DPP KNPI di bawah kepemimpinanTaufan Rotorasiko. “Surat edaran kan versi mereka, gak diakui kok. Kalau ada, itu namanya organisasi liar,” tegas Roy Suryo kepada wartawan usai menghadiri pertemuan Komunitas Pemuda dan Olahraga se Sumatera Utara di Aula Martabe, Lantai II Kantor Gubernur Sumatera Utara, pekan lalu. Intinya, lanjut Roy, pemerintah tidak ingin dualisme di mana-mana. Dan diminta kepada seluruh lembaga yang ada untuk tunduk pada aturan yang berlaku. “Presiden sendiri mengakui dan sudah datang di acaranya mas Taufan, jadi saya berharap mas Akbar dengan jajarannya bisa dengan legowo dan menerima itu dengan sebuah sikap yang dewasa,” tuturnya. Roy mengakui saat ini persoalan diserahkan kembali ke daerah-daerah yang terjadi dualisme. “Di Sumut KNPI nya hanya dipimpin Ridho Loebis. Saya serahkan kepada daerah yang bersangkutan, rangkul sebaik-baiknya dan biarkan

YASIR Ridho Loebis orang- orang yang ada di organisasi itu kemudian masuk kembali,” ujarnya. Pakar telematika inipun membantah ketika ditanya apakah menyerahkan persoalan itu ke daerah artinya membiarkan persoalan yang terjadi di tubuh induk organisasi kepemudaan itu. “Bukan membiarkan, justru sudah selesai. Jadi kalau kemudian saya harus memanggil, itu sama saya mengakui, pemerintah tidak mengakui,” tegasnya. Sebelumnya, dalam acara pertemuan komunitas pemuda dan olah raga se Sumatera Utara Roy Suryo juga sempat ditanyakan oleh salah seorang peserta terkait masih adanya konflik di tubuh KNPI. “Dirangkul saja

diajak masuk ke dalam KNPI Mas Taufan. Dinasehati, kasih durian sebanyak-banyaknya sampai mabuk,” ujar Suryo berkelakar disambut tawa para peserta pertemuan yang dihadiri oleh berbagai organisasi kepemudaan di Sumut itu. Sementara itu Ketua KNPI Sumut Yasir Ridho Loebis menyatakan tidak mengetahui dan mengenal Ketua Umum DPP KNPI selain Taufan E N Rotorasiko. “Karena itu komitmen kita hanya mengakui kepemimpinan bung Taufan, karena beliau dilahirkan di sebuah kongres yang sah, digelar bung Doli dan bung Aziz di hotel Said Jakarta tahun 2011. Sebagai aktivis muda kita, harus memahami sebuah proses yang benar, tidak ada orang yang lahir dari pohon bambu begitu juga, tidak ada organisasi yang lahir tanpa proses dan kejelasan asal usulnya,” sebut Ridho di Medan, kemarin. Disebutkannya, dia menjadi Ketua KNPI Sumut menggantikan Rolel Harahap. “Sudah 2 periode saya menjadi Ketua KNPI Sumut melalui dua kali Musda dan terpilih secara demokratis. Masa bakti 2011 sampai 2014 ini, itulah proses yang saya lalui,” ujarnya. (m08/rel)

Konflik Papua, DPD Tolak Pendekatan Militer JAKARTA (Waspada): Wakil Ketua DPD RI Laode Ida menolak jika pemerintah melakukan pendekatan militer atau operasi militer dalam menyelesaikan konflik Papua. Konflik Papua yang terakhir menewaskan 8 prajurit TNI dan 4 warga sipil akibat ditembak oleh kelompok bersenjata, menurut DPD RI perlu pendekatan dialog langsung dengan masyarakat Papua, yang selama ini diabaikan oleh pemerintahan Susilo Bambang Yudhoyono (SBY). Pernyataan itu disampaikan Laode pada wartawan di Jakarta, Selasa (26/2) didampingi anggota DPD RI asal Papua dan Papua Barat, I Wayan Sudirta, Bambang Soesilo dan lain-lain. “DPD menolak pendekatan kekerasan, apalagi operasi militer. Kami mendukung pendekatan dialog langsung dengan mereka yang disebut sebagai Organisasi Papua Merdeka (OPM), karena pada prinsipnya


WAKIL Ketua DPD Laode Ida (tengah), Ketua Komite I DPD Alirman Sori (kiri) dan Bupati Biak Numfor Yusuf Melianus Maryen (kanan) memberikan keterangan pers tentang Penyelesaian Kasus Kekerasan di Papua” di Gedung Nusantara V, Kompleks Parlemen, Senayan, Jakarta, Selasa (26/2). ingin aspirasinya direspon oleh pemerintah pusat. Selama ini Jakarta mengabaikan dialog dan aspirasi masyarakat Papua. Padahal, mereka adalah merupakan bagian dari warga negara

Indonesia,” tandas Laode. Menurut dia, pendekatan militer itu justru berbahaya bagi kedaulatan Indonesia sendiri di mata dunia internasional, karena akan disebut sebagai

pembersihan etnis Papua. Karena itu DPD RI tidak ikhlas terhadap hilangnya satu nyawa pun di Papua. Baik dari aparat TNI/ Polri maupun warga sipil dari kedua belah pihak,” tambahnya. Dia mengatakan, pemerintah harus melakukan koreksi terhadap manajemen militer di Papua. Sebab, dengan menurunkan banyak aparat TNI/Polri ke Papua, tanpa dibarengi dengan perbaikan manajemen militer, maka di lapangan akan terjadi pelanggaran-pelanggaran. “Disamping itu pemerintah harus menegakkan hukum dengan mengusut tuntas asal senjata ilegal yang digunakan oleh OPM. Saya khawatir ada suplai ilegal dalam persenjataan OPM tersebut. Ini harus ditangani serius,” tegas Laode. I Wayan Sudirta dan Bambang Soesilo menyatakan hal yang sama, jika pemerintah tidak serius menangani Papua. Menurut Bambang, konflik itu bisa berawal dari pembangu-

nan infrastruktur yang tidak bergerak dan tidak dijalankan dengan baik oleh kementerian Pekerjaan Umum (PU). Demikian pula masalah perekonomian, yang juga tidak bergerak. “Khusus untuk konflik Papua, DPD dan Komnas HAM perlu turun langsung untuk melakukan investigasi terhadap tewasnya 8 aparat TNI dan 4 warga sipil itu,” katanya. Anggota DPD RI asal Provinsi Papua Ferdinanda Ibo Yatipay mencurigai ada elit Jakarta, yang‘bermain’ di Papua. Apalagi menjelang turunnya anggaran otonomi khusus (Otsus) untuk Papua, pada tahun 2012 mencapai Rp 28,445 triliun. Karena itu harus ada evaluasi terhadap Otsus berikut anggarannya, agar benar-benar untuk membangun perekonomian dan kesejahteraan masyarakat Papua. “Selain itu, pemerintah harus berdialog dengan masyarakat Papua,” ujarnya.(J07)



WASPADA Rabu 27 Februari 2013

Biru Pecah

BINTANG kemenangan Tottenham Gareth Bale mencetak gol indah ke gawang West Ham United di Upton Park, London, Selasa (26/2) dinihari WIB.


Bukti Bakat Besar Bale LONDON (Waspada): Gareth Bale kembali membuktikan bakat besarnya sebagai pemain paling bersinar musim ini di Liga Utama Inggris. Bale menyarangkan dua gol ke gawang West Ham United, Senin (Selasa WIB), sekaligus memotori kemenangan 3-2 Tottenham Hotspur pada matchday 27 Liga Premier itu di Upton Park, London. Gol Bale juga mendongkrak peringkat Spurs ke urutan ketiga klasemen sementara, menggeser tetangganya Chelsea dengan selisih dua angka. “Dia (Bale) mempunyai bakat besar, kami bisa melihat bakatnya hingga menit akhir pertandingan,” puji manajer Spurs AndreVillas-Boas, seperti dilansir Telegraph, Selasa (26/2). Villas Boas pun mendukung penuh Bale untuk mendapatkan penghargaan sebagai pemain terbaik Liga Premier tahun ini.

“Saya kira begitu, penghargaan itu layak buat Bale. Anda harus mengakui, dia (Bale) memiliki musim luar biasa,” papar pelatih asal Portugal itu. Derbi London di markas The Hammers malam itu juga menjadi peringatan kematian 20 tahun mantan kapten LondonWhites, Bobby Moore, yang memenangkan Piala Dunia 1966. Bale membuka keunggulan Spurs menit 13, lantas menunjukkan kehebatannya menit 90 ketika tendangannya melesat melewati kiper Jussi Jaas-kelainen. Aksinya menuntaskan kisah Jaaskelainen, yang sebelumnya amat piawai menyelamatkan gawangnya dari beberapa gebrakan pemain tamu. Tendangan penalti striker

Andy Carroll menit 25 serta gebrakan gelandang Joe Cole menit 58, sempat membuatWest Ham memimpin 2-1. Gelandang Spurs asal Islandia Gylfi Sigurdsson menyamakan kedudukan menit 76, Bale kemudian menjadi bintang kemenangan Lilywhites. Tapi winger berumur 23 tahun asal Wales yang musim ini telah mengoleksi 15 gol liga itu, tetap rendah hati sekaligus menegaskan hal terpenting timnya kembali ke zona Liga Champions. “Saya hanya menikmati sepakbola. Tim bermain bagus yang membuat segalanya lebih mudah. Tapi ini bukan soal saya, ini soal tim,” beber Bale kepada Sky Sports. “Ini kemenangan besar bagi kami. Kami tahu memiliki peluang bagus untuk ke posisi tiga yang memberikan lebih banyak semangat,” tambah bintang incaran Real Madrid dan Barcelona itu.

Sebelum laga digelar, Bale sebenarnya mengaku lebih berkonsentrasi untuk menghadapi derbi London Utara melawan

Klasemen Liga Premier Man United 27 22 2 3 Man City 27 16 8 3 Tottenham 27 15 6 6 Chelsea 27 14 7 6 Arsenal 27 13 8 6 Everton 27 10 12 5 West Brom 27 12 4 11 Liverpool 27 10 9 8 Swansea 27 9 10 8 Stoke City 27 7 12 8 Fulham 27 8 8 11 Norwich 27 7 11 9 Newcastle 27 8 6 13 West Ham 27 8 6 13 Sunderland 27 7 8 12 Southampton 27 6 9 12 Wigan 27 6 6 15 Aston Villa 27 5 9 13 Reading 27 5 8 14 QPR 27 2 11 14

64-31 68 50-24 56 47-32 51 55-30 49 52-30 47 41-34 42 38-36 40 49-34 39 38-34 37 26-32 33 37-42 32 27-41 32 38-48 30 31-41 30 29-36 29 38-49 27 33-51 24 26-52 24 33-51 23 19-43 17

Detektif Intai Pique Cs

KEMESRAAN Gerard Pique dan kekasihnya Shakira diintai detektif swasta saat Barca masih ditukangi Pep Guardiola.

MADRID (Antara): Pep Guardiola pernah menyewa lembaga detektif swasta untuk selalu mengintai kehidupan dan kelakuan para pemain Barcelona dengan melakukan aksi mata-mata. Salah satu target entrenador Guardiola ketika masih menukangi El Barca, tak lain adalah kehidupan pribadi bek sentral Gerard Pique. Menurut surat kabar El Confidencial, aksi lembaga detektif swasta bernama Metodo 3 dengan sepengatuan Guardiola itu mengintai Pique yang menjalin hubungan asmara dengan artis Shakira. “Lembaga detektif swasta Metodo 3 memata-matai para pemain Barcelona atas perintah dari direktur keamanan dan direktur hukum bagi kepentingan Generalitat (pemerintah otonom Catalonia), Xavier Martorell,” tulis laporan itu sebagaimana dikutip dari laman Marca, Selasa (26/2). “Selama Pep menangani skuad Azulgrana, dia menjalin kerjasama dan persahabatan yang erat dengan Martorell. Martorell membantu Guardiola untuk menginformasikan segala apa yang terjadi sepanjang waktu,” tambah laporan itu.. Guardiola kerapkali menelepon untuk mengetahui keberadaan para punggawa El Blaugrana, termasuk ketika mereka berada di rumah.

Lawson Redupkan Bryant Cs DENVER, AS (Waspada): Ty Lawson mencetak 22 angka dan delapan assist ketika Denver Nuggets menang 119-108 atas Los Angeles Lakers, Selasa (26/2) siang WIB. Wilson Chandler menyumbang 23 angka untuk memimpin Denver, yang memenangi tiga dari empat laga NBA terakhirnya. Chandler mengisi tempat yang ditinggalkan Danilo Gallinari yang sedang cedera. Belakangan Lawson me-

mang begitu berbahaya dan telah mencetak minimal 20 poin dalam tujuh laga beruntun. Geliat Lawson cs sekaligus mengakhiri rangkaian tiga kemenangan berturut-turut Lakers. Aksinya meredupkan pamor lima kali juara NBA Kobe Bryant, yang mencetak 29 angka dan sembilan assist serta enam rebound buat Lakers. Bryant rata-rata mencetak lebih dari 28 angka dalam lima pertandingan terakhirnya. Di Toronto,WashingtonWi-

Problem Catur


Putih melangkah, mematikan lawannya empat langkah.

Jawaban di halaman A2. 8







1 A






zards meneruskan kebangkitannya dengan meraih kemenangan ketiga beruntun dengan menaklukkan Toronto Raptors 90-84. Meski Wizards (18-37) memerlukan keajaiban untuk mendapat tempat playoff, namun lubang yang ada sudah tidak begitu dalam lagi. “Kami tidak memerlukan alarm bahaya, kami telah sepakat dengan fakta bahwa paruh kedua musim sangat penting,” klaim forward Martell Websters.



“Kami tidak terfokus pada playoff, kami berfokus pada satu demi satu pertandingan. Kami hidup saat ini, dan ketika pertandingan sudah berakhir, (kami) beranjak ke pertandingan selanjutnya,” ujarnya lagi. Kembalinya guard John Wall, pilihan pertama secara keseluruhan dalam draft 2010 dan bangkitnya rookie Bradley Beal, yang merupakan pilihan ketiga dalam draft tahun lalu, menjadi katalis bagi kebangkitan Washington. “Saya harus terus menembak. Saya membiarkan permainan mendatangi saya, sehingga


Arsenal, Minggu (3/3). “Kami tahu itu akan menjadi laga besar, mereka (Arsenal) tim hebat. Kami sangat ingin mendapat tiga poin demi menjaga harapan ke Liga Champions tetap hidup,” pungkas Bale. (m15/rtr/tlgp/sky)

LONDON (Waspada): Jelang tandang ke markas Middlesbrough untuk melakoni laga tunda putaran kelima Piala FA dinihari WIB nanti, rumor perpecahan melanda Chelsea. Para pemain senior dikabarkan bertengkar dengan manajer interim Rafael Benitez, yang mempertanyakan buruknya permainan Si Biru ketika dipecundangi Manchester City 2-0 pada laga Liga Premier akhir pekan lalu di Etihad Stadium. “Pertengkaran ini berpusat kepada Terry dan Benitez. Keduanya terlihat frustrasi setelah kalah dari ManCity,” beber sumber dalam The Sun, Selasa (26/2). Benitez menuduh pemainnya tampil di bawah rata-rata sejak dia menggantikan Roberto Di Matteo bulan November 2012. Mantan manajer Liverpool dan Inter Milan itu juga menuding, para pelatih telah yang Roman Abramovich karena tidak disukai para pemain senior. Menurut Daily Mail, seorang pemain senior Chelsea yang disinyalir kapten Terry, langsung menyerang balik pelatih asal Spanyol itu. Dia justru menuduh, kekalahan atas Citizens akibat buruknya taktik Benitez.


MANAJER Rafael Benitez (kiri) tak lagi mendapat dukungan dari John Terry, Paulo Ferreira dan pemain senior Chelsea. Ini bukan kali pertama pemain senior The Blues bertengkar dengan manajer. Sebelumnya, mereka juga terlibat adu mulut dengan AndreVillas-Boas yang akhirnya dipecat pada Maret 2012. Tingginya tingkat stress London Blues, menurut bek Gary Cahill, tak terlepas dari agenda pada yang mesti mereka lakoni. Selain berlaga di Liga Premier, Frank Lampard cs kini masih mentas di Piala FA dan Liga Europa. “Kompetisi begitu padatnya, jadwal itu harus kami jalani. Faktor kelelahan pemain tentu akan menjadi resiko yang mesti kami tanggung,” ucap Cahill kepada ESPN. Sepanjang musim ini saja,

Si Biru sudah memainkan 47 pertandingan di semua turnamen, termasuk pada ajang Piala Dunia Antarklub di Jepang, Desember lalu. Meski begitu, Cahill tetap memiliki target maksimal, terutama di FA Cup dan Europe Leage. Begitu pula gelandang bertahan John Obi Mikel, setelah memudarnya harapan perburuan gelar Liga Premier. Mikel memprediksi, Manchester United tak mungkin lagi dikejar Chelsea bahkan The City. “Ini perlombaan satu kuda pacu menuju gelar juara. Kita harus realistis dan saya pikir tak ada yang mempertaruhkan kami atau ManCity mendapatkan gelar juara,” jelas Mikel. (m15/sun/dm/espn)


ROMAN Weidenfeller dan kawan-kawan sangat berambisi merebut Piala Jerman.

Mesti 100 Persen Pukul Munich BERLIN (Waspada): Pelatih Borussia Dortmund, Jurgen Klopp, mengklaim pasukannya akan menampilkan kualitas 100 persen untuk memukul Bayern Munich pada perempatfinal DFB-Pokal. “Penampilan kami pada beberapa pekan terakhir telah membuat kami percaya bahwa kami bisa mendatangkan (kemenangan) itu,” kata Klopp, seperti dikutip dari Goal, Selasa (26/2). “Kami memang tidak mempunyai kualitas mengalahkan Bayern dengan memberikan 98 persen. Namun 100 persen saya tidak memaksakan apaapa,” beber Beal. Selama tujuh tahun terakhir, Raptors dan Wizards sama-sama melewati jalan terjal. Terakhir kali keduanya tampil di playoff terjadi enam musim lalu, namun keduanya tersingkir pada putaran pertama. Sejak mendapat nama baru Wizards pada 1997, Washington hanya empat kali mencapai fase pasca musim dan sebanyak empat kali tersandung di putaran pertama. Toronto gabung NBA pada 1995 dan hanya lolos dalam lima kesempatan. Mereka berada di


1. Ubi bulat, termasuk tumbuhan sayuran yang mengandung pati, vitamin B6 dan C. 4. Jenis sayur, bermanfaat menjaga tingkat gula darah dan mencegah prostat, selain tomat. 7. Bagian tubuh ayam yang rendah lemak jenuh dan kalori. 8. Tumbuhan perdu bahan penghasil minyak, mengurangi risiko penyakit jantung dan resistensi insulin. 9. Dokter bukan spesialis. 10. Penyakit bular mata. 13. Singkatan Spesialis. 14. Abu; Serbuk halus. 15. Kubis, penghasil brokoli untuk mengobati prostat. 16. Penyakit tampek; Rubella; Rubeola. 17. Istilah umum untuk keseluruhan jasad; Tubuh. 18. Warna yang disebut pada suatu penyakit. 20. Usaha untuk membina suatu keadaan yang baik dalam bidang kesehatan. 23. Otak. 25. Berhubungan dengan psike (jiwa). 27. Bagian muka di bawah mulut. 28. Amandel. 29. Obat dibungkus dengan sejenis agar-agar yang harus ditelan. 30. Tumbuhan dari Asia Timur, dijadikan ramuan obat-obatan,

mungkin saja, dan kami yakin bisa menyalurkannya di lapangan,” tegasnya lagi. Munich saat ini memimpin sendirian di puncak klasemen Bundesliga dengan keunggulan 17 poin di atas Dortmund. Gelar liga dengan demikian sangat riskan untuk dipertahankan Roman Weidenfeller dan kawan-kawan. Karenanya, Klopp membidik Piala Jerman sebagai prestasi alternatif. “Saya akan katakan bahwa ini musim sempurna bagi Bayern Munich. Tapi kami punya ambisi di kompetisi ini (DFB Pokal). Kami bertujuan

untuk menjadi lawan yang tidak mengenakkan dan mencapai semifinal,” tekad Klopp. Hanya saja pelatih Bayern Jupp Heynckes juga tak kalah optimistis, Mario Gomez cs bakal menjinakkan pasukan Klopp dinihari nanti di Allianz Arena. “Kami bermain di kandang, kami percaya diri, dan kami bermain dengan standar sepakbola tinggi yang sukar dipercaya. Itu semua membuat kami optimistis,” jelas Heynckes Bayern menang 2-1 atas Dortmund pada Piala Super Jerman awal musim ini, lantas bermain 1-1 di Bundesliga pada

Desember. “Kami mempunyai ambisi besar di ajang piala, dan kami sangat termotivasi,” klaim Heynckes. Ketajaman lini depan kembali menjadi nilai plus FC Hollywood. Selain Gomez, Thomas Muller, Toni Kroos, Arjen Robben dan Franck Ribery, penampilan penyerang anyar Mario Mandzukic pun sangat menjanjikan untuk menyingkirkan Die Borussen. Mandzukic telah mencetak 15 gol dalam 19 penampilan bersama The Bavarian dan kemungkinan menjadi starter dinihari nanti. (m15/goal/dpa)

Hasil Lainnya Detroit v Atlanta Hawks 103-114 Utah v Boston Celtics 107-110 ambang pintu keluar musim ini dengan rekor 4-19, berbanding lurus dengan Wizards 5-28. “Tujuan kami adalah melaju tahun ini. Kami mendapat awal yang berat dan menggali lubang yang teramat dalam,” tekad pelatih Toronto Dwane Case. “Kami memiliki jalan berat untuk dicangkul, tapi kami senang dengan hal itu,” katanya menambahkan. (m15/ant/afp/rtr)


GUARD Lakers Kobe Bryant dijepit pemain Nuggets Kosta Koufos (kanan) dan Andre Iguodala di Denver.


termasuk membangkitkan nafsu syahwat.


1. Obat semacam garam hijau untuk mencegah kerusakan gigi. 2. Tidak muda lagi. 3. Bular hijau pada mata akibat cairan bening kornea dan lensa mata tertahan. 4. Tekanan darah tinggi yang menyebabkan pusing berat. 5. Kram (Inggris). 6. Kekuatan dan enerji fisik sehingga tahan bekerja dan berprestasi dalam olahraga. 9. Alat pencerna makanan di dalam perut. 11. Memasukkan (makanan, obat) ke dalam kerongkongan. 12. Zat yang menyebabkan sakit atau mati (jika dimakan, dihirup). 14. Lendir yang keluar dari kerongkongan. 18. Bertalian dengan jantung. 19. Berhubungan dengan alat kelamin. 21. Pengendali kadar gula dalam darah dengan suntikan. 22. Naluri; Garizah. 23. Penyakit kulit berupa bercak-bercak putih. 24. Pohon yang kulitnya pahit, untuk obat malaria. 26. ——Farma, perusahaan multinasional farmasi.

Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tingkat kesulitan: sedang (***), bisa diselesaikan kurang dari sepuluh menit. Jawaban di halaman A2 kolom 1.

6 4

5 4 1

2 3

1 9


7 4 3


5 9 7 8 1 3


7 5 2

9 4 3 6 6

9 2 6 7 1 ***429


WASPADA Rabu 27 Februari 2013


Querrey Hanya Perlu 44 Menit DELRAY BEACH, AS (Waspada): Sam Querrey (foto) menumbangkan rekan senegaranya dari Amerika Serikat (AS) Michael Russell dalam duel 44 menit pada putaran pertama turnamen tenis Delray Beach Internasional. Dalam duel Senin (Selasa WIB) itu, Querrey membuat tujuh ace untuk memenangi set pertama 6-2 sebelum lawannya mundur karena cedera kaki ketika kedudukan 2-2 pada set kedua. “Saya kira ini hasil yang harus saya jalani sepanjang

tahun ini,” ujar unggulan ketiga Querrey, seperti dilansir Reuters, Selasa (26/2). “Saya melancarkan dua servis dengan bagus dan mendominasi permainan lmelalui pukulan backhand saya. Saya kira saya tampil amat agresif kali ini,” katanya lagi. Querrey yang kalah pada putaran kedua turnamen Memphis minggu lalu, belum pernah melewati babak semifinal di Delray. Tapi kali ini dia hanya perlu waktu 44 menit di lapangan untuk menyingkirkan Russell.

Pada laga lainnya, Xavier Malisse sebagai penyandang gelar 2005 dan 2007, mengalahkan Alejandro Falla 6-3, 6-3. Evgeny Donskoy mengatasi Steve Darcis 7-6 6-3, sedangkan Ivan Dodig mendepak unggulan kelima Alexandr Dolgopolov 6-3, 6-3. “Pada beberapa game awal saya harus berjuang keras. Datang dari turnamen indoor ke turnamen outdoor, saya kira semua pemain harus berjuang keras. Saya pun mengalaminya,” ungkap Dodig. (m15/ant/rtr)


Djohar - Sihar Pecah Kongsi JAKARTA (Waspada): Ketua Umum PSSI, Djohar Arifin Husin, mulai pecah kongsi dengan pendukungnya, dua anggota Komite Eksekutif (Exco) PSSI Sihar Sitorus dan Bob Hippy. Dia pun mengingatkan mereka, supaya tidak salah tafsir apalagi sampai menolak kesepakatan yang telah dilakukan dengan kubu KPSI. Sebelumnya, Sihar dan Bob yang menolak keputusan berdamai dengan didukung Sekjen PSSI Halim Mahfudz, sempat merilis kedatangan La Nyala Mattalitti cs (KPSI) ke Kantor PSSI, beberapa hari lalu, hanyalah kunjungan biasa. Dalam rilis dikirim ke wartawan, juga disebutkan pengembalian hak empat Exco terhukum, yakni La Nyalla Mattalitti, Erwin Dwi Budiman, Roberto Rouw, dan Tonny Apriliani,

masih akan ditentukan dalam Kongres PSSI terdekat. Padahal, sesuai kesepakatan yang telah dilakukan melalui prakarsa Menpora Roy Suryo, keempatnya telah disepakati untuk kembali ke PSSI tanpa syarat. Bahkan, keempatnya pun sudah pernah diundang untuk ikut rapat Exco, hanya saja tidak hadir, karena belum menemui kata sepakat dengan Ketua Umum PSSI. “Dengan hormat, saya beritahukan bahwa Surat FIFA ke Menpora tanggal 13 Februari 2013 adalah sangat serius, dinyatakan dalam surat tersebut, jika masalah tidak selesai se-

belum tanggal 20 Maret 2013, maka Indonesia akan merasakan kerugian yang sangat parah. “Artinya, kita akan mendapat sanksi dari FIFA. Jika hal ini terjadi tentu sangat memalukan bangsa dan merugikan sepakbola nasional,” tulis Djohar dalam suratnya kepada jajaran pengurus PSSI yang salinannya diterima Waspada, Selasa (26/2). “ Tak terbayangkan sumpah serapah masyarakat terhadap kita. Karena itulah, kita harus berjuang sedaya upaya agar ‘cacat sejarah’ ini tak boleh terjadi di masa priode kita,” katanya lagi. Dari pembicaraan yang dia lakukan di Zurich pada 12 Februari 2013 silam dengan duta negara anggota Komite Asosiasi FIFA dan dari AFC, Djohar mengaku, kemungkinan Indonesia

dihukum sangat terbuka. Hal tersebut karena hingga saat ini belum ada kemajuan signifikan untuk penyelesaian atas dualisme kompetisi. “Mereka juga menyampaikan bahwa kita terlalu ngotot dengan power dan menjatuhkan sanksi, tetapi tidak berjalan efektif karena tak didukung pihak berwenang juga pemerintah. Oleh karena itulah Menpora mengambil inisiatif untuk mengajak semua pihak melaksanakan semua perintah FIFA,” urai Djohar mengingatkan. Djohar dalam suratnya juga menyatakan langkah yang dilakukan Menpora untuk penyelesaian masalah di sepakbola nasional tampaknya mendapat dukungan dari FIFA. Hal tersebut dibuktikan dengan adanya komunikasi melalui surat atau email yang dikirim FIFA ke

Menpora. Lagi pula, Djohar kembali mengingatkan, empat poin yang diminta FIFA masih seperti keputusan sebelumnya, yaitu pengembalian empat Exco PSSI, penyatuan kompetisi, revisi statuta, serta melaksanakan kongres dengan peserta voters Solo. “Oleh karena itu kita harus mengambil peran dalam usaha Menpora ini dan tidak boleh sebagai penonton. Saat ini mereka (empat Exco) telah mengambil inisiatif kembali ke PSSI yang mendapat dukungan dari masyarakat, sebab sepakbola kita akan kembali bersatu. “Momen ini jangan kita lewatkan, kita harus tunjukkan bahwa kitalah yang paling ingin bersatunya sepakbola Indonesia, bukan kesan sebaliknya,” tegas Djohar. (yuslan)

Maman Terharu Persiraja Atasi PSLS BANDA ACEH (Waspada): Pelatih Persiraja Banda Aceh, Maman Suryaman, tampak sangat terharu saat wasit meniup peluit akhir. Kemenangan 1-0 atas skuad PSLS Lhokseumawe membuat matanya sembab. Bermain di Stadion H Dimurthala, Banda Aceh, Selasa (26/2), skuad Persiraja nyaris tak diunggulkan penonton, karena tampil dengan pemain minim pengalaman. Namun, dengan modal semangat serta motivasi tinggi, Erik Saputra cs bisa mengutip tiga angka.

Ini menjadi poin penting Persiraja di laga perdana Indonesian Premier League (IPL) 2013. Dalam laga kemarin, tuan rumah tampil dengan 10 pemain. Inilah yang membuat Maman tak bisa menahan keharuan. Gol semata wayang pasukan Laskar Rencong dicetak Septi Heriansyah menit 16. Terlepas dari jebakan offside, mantan pemain PON Aceh 2008 ini sukses memperdayai kiper lawan, Sukirmanto. Petaka harus menimpa tuan rumah. Menit 25, sang kapten

Erik Saputra harus ke luar lapangan karena kartu merah. Aksi tackling-nya terhadap Davis Konah Batoe, membuat pemain itu harus mengakhiri kompetisi musim ini lebih cepat, sebab kaki kanannya patah ditebas kapten Persiraja. Tampil hanya dengan 10 pemain, tak membuat semangat tuan rumah melembek. Sebaliknya, mereka sempat mengancam jala gawang lawan hingga babak pertama berakhir. Skor paruh pertama tak berubah 1-0. Sepanjang 45 menit babak

kedua, tidak ada gol dicetak kedua tim, meski saling mengancam gawang. Menyikapi hasil akhir, Pelatih Persiraja Maman Suryaman berkata singkat. “Ini gila, anakanak bermain luar biasa, dengan 10 pemain mereka mampu mempertahankan kemenangan,” katanya. Dia mengakui kemenangan Hendra Sandi cs berkat tekad dan kemauan pemain yang luar biasa. Meski sepanjang 45 menit pertama dia sempat was-was karena takut mental Andrea dkk down.

Mantan asisten Herry Kiswanto musim lalu itu pun tidak segan-segan melayangkan pujian untuk pemain-pemainnya. “Mereka tampil luar biasa, layak mendapat pujian atas prestasi hari ini,” tukas Maman. Pelatih PSLS mengaku skuadnya terlalu percaya diri sehingga akhirnya kehilangan poin. Apalagi tuan rumah juga bermain dengan 10 pemain. “Finishing touch kita memang lemah, ini akan jadi bahan evaluasi kami ke depan,” ujar bekas Pelatih PS Bengkulu ini. (b07) PENGURUS Cabang PSSI Kota Medan bersama Pengurus PSSI Pusat dan PSSI Sumut seusai dilantik di Hermina Hall Medan, Selasa (26/2). -Waspada/Arianda Tanjung-

Sepakbola Medan Harus Bangkit MEDAN (Waspada): PSSI Kota Medan diharapkan kembali menggelar kompetisi antarklub maupun kompetisi kelompok umur, demi mengembalikan kejayaan sebakbola daerah ini yang dalam beberapa tahun belakangan semakin meredup “Pengcab PSSI Medan harus segera menggelar kompetisi antarklub. Kalau bisa, digelar Juni hingga Juli 2013,” ujar Ketua KONI Medan, Drs H Zulhifzi Lubis, dalam acara pelantikan Pengcab PSSI Medan periode 2013-2017 di Hermina Hall Medan, Selasa (26/2). Pria akrab disapa Opuk Ladon itu berharap PSSI Medan segera merumuskan programprogram jangka pendek dan panjang, salah satunya dengan mengintensifkan pembinaan pemain usia dini. “Sepakbola Kota Medan harus bangkit, hal ini bisa dimulai

dengan kembali menggulirkan kompetisi antarklub maupun antar-SSB, sehingga muncul bibit-bibit pesepakbola andal untuk memperkuat PSMS ke depan,” pungkas Zulhfizi. Seusai dilantik, Ketua PSSI Kota Medan, Yohanna Pardede, mengatakan seluruh pengurus harus solid dalam menjalankan roda organisasi. Apalagi sepakbola merupakan olahraga rakyat yang diminati segala kalangan, tanpa memandang usia, jenis kelamin, tingkat sosial, dan latar belakang. “Beberapa program yang akan kita jalankan di antaranya adalah mendata klub-klub dan merangkul pengurus klub untuk bersama memajukan pembinaan dan prestasi sepakbola di Medan. Termasuk juga menghidupkan kembali kompetisi antarklub,” ujar Yohanna. Wakil Wali Kota Medan,

Dzulmi Eldin, mengatakan tugas berat menanti di pundak pengurus PSSI Medan yang baru dilantik, karena masyarakat pasti berharap Yohanna dan kawankawan dapat membangkitkan kembali kejayaan sepakbola kota ini. Eldin pun berharapYohanna menggandeng semua pihak yang peduli terhadap sepakbola Kota Medan, untuk sama-sama membesarkan organisasi yang dipimpinnya. Eldin optimis dengan kebersamaan kejayaan sepakbola Medan dapat kembali diraih. “PSSI Medan punya tanggungjawab mendukung pembinaan di klub-klub maupun SSB. Kita punya mimpi pada tahun 2016, Medan menjadi Kota Atlet dan tentunya itu juga mencakup cabang sepakbola,” katanya. (cat)

Petinju Kaktus Binjai Ukir Prestasi BINJAI (Waspada): Dua dari tiga petinju Sasana Kaktus Kota Binjai berhasil meraih medali perak dan perunggu dalam turnamen piala Ketua DPRD Pekanbaru, baru-baru ini. “Medali perak dipersembahkan Jhonrikson Simorangkir dari kelas 64 Kg dan perunggu oleh Firman Juli Handoyo (56 Kg),” ujar Pembina Sasana Kaktus Binjai Martin Hasibuan SH didampingi Ketua KONI

Binjai Juli Sawitma Nasution dan Ketua Pertina Binjai Hermanto Marpaung saat menyambut kepulangan tiga petinju di Sasana Kaktus, Senin (25/2). Dikatakan, prestasi kedua atlet tersebut sangat membanggakan, mengingat Sasana Kaktus baru saja didirikan, tetapi sudah mampu melahirkan atlet berbakat yang mampu mengukir prestasi di ajang bergengsi. Ketua KONI Binjai, Juli Sawit-

ma Nasution, mengucapkan syukur atas hasil perjuangan dan jerih payah tiga petinju Sasana Kaktus Binjai. Sawitnya berharap prestasi olahraga tinju Kota Binjai kembali bangkit dengan banyaknya lahir atlet andal. Kepala BKD Binjai, Amir Hamzah, mewakili Pemko Binjai mengucapkan terima kasih kepada petinju yang sudah membawa nama baik Kota Binjai di Pekanbaru. Sedangkan Ketua Pertina Binjai, Hermanto Marpaung, menyebut selama mengikuti turnamen Piala Ketua DPRD Pekanbaru, atlet tidak kurang suatu apapun dan pelayanan panitia cukup baik. (a04) ATLET tinju Sasana Kaktus Binjai yang meraih prestasi di Pekanbaru, diabadikan bersama pembina sasana, pengurus KONI, dan Pertina, Senin (25/2) -Waspada/Riswan Rika -

Albatros Gasak Gajah Putra BINJAI (Waspada): Albatros FC mencukur Gajah Putra 70 dalam laga pembuka turnamen Piala Putra Bahruni di Lapangan Padangtualang, Kabupaten Langkat, Selasa (26/2). Tujuh gol Albataros masing-masing lewat hatrik Dani Aldino, dua gol Bambang serta dua gol lainnya disumbangkan Alexander Gho dan Dani Ananda. Albatros selanjutnya akan menghadapi Putra Bahruni pada pertandingan kedua. “Ini hasil yang sangat memuaskan dan membuat kita semakin optimis dapat menjuara turnamen yang sudah memasuki tahun ketiga ini,” ujar Pembina Albaros FC, Alexander Gho. Ketua Panitia, Jumali, mengatakan turnamen tersebut diikuti 16 tim dari Langkat, Medan, dan Binjai. “Iven ini bertujuan menambah pengalaman tanding klub-klub peserta,” ujar nya.(a04)

Waspada/Setia Budi Siregar

WAKIL Ketua III Bidang Kemahasiswaan Mikroskil Saliman ST dan unsur kepengurusan Percasi Sumut, Selasa (26/2), bersama Daniel Hermawan Lumbantobing.

Mikroskil Kirim Lumbantobing Seleknas Junior U-14 M E D A N ( Wa s p a d a ) : STMIK-STIE Mikroskil Chess Club mengirimkan pecatur cilik binaannya, Daniel Hermawan Lumbantobing, mengikuti Seleksi Nasional Junior U-14 di Grand Ballroom SCUA Pusat, Bekasi, 28 Februari hingga 5 Maret mendatang. Mendapat panggilan PB Percasi untuk ikut serta, Lumbantobing diharapkan bisa menunjukkan prestasi terbaik. “Ini kan iven untuk pecatur di bawah 14 tahun (Under 14), sementara Daniel kan masih 10 tahun. Jadi harapan kita minimal dia bisa mengatasi pecatur-pecatur seusianya,” ungkap Wakil Ketua III Bidang Kemahasiswaan Mikroskil, Saliman ST. “Kalau dia menang dari pecatur di atas usianya, maka itu bagus,” tambah Saliman di Kampus Mikroskil, Jalan Thamrin, Selasa (26/2). Jika Daniel bisa masuk tiga besar, pihaknya sudah siap memberangkatkan siswa kelas

5 SD itu untuk ikut Kejuaraan ASEAN di Bangkok, Thailand, Juni mendatang. Pada Turnamen Catur Terbuka Waspada Cup baru-baru ini, Lumbantobing menjuarai KU-14. “Dia sangat berbakat, tapi masih butuh jam terbang. Karena itu, setelah iven ini kita akan kerjasama untuk mencari bapak angkat,” beber Saliman. Acara penglepasan Lumbantobing dihadiri Wakil Ketua Percasi Sumut Tomy Wistan yang juga Ketua Kadin Sergai, Sekum Percasi Sumut Ir Perry Iskandar dan Hendy Ong dari KONI Sumut. Menurut Perry Iskandar, Seleknas U-14 merupakan persiapan pembentukan timnas junior lapis kedua untuk pembinaan jangka panjang oleh PB Percasi. “Iven ini sangat bergengsi, karena yang akan tampil adalah para juara nasional U14 pada tahun 2012,” ucapnya. Menurut rilis PB Percasi dalam website resminya, yang berhak ikut seleknas adalah juara 1 hingga 3 berbagai iven nasional sepanjang 2012. “Daniel dipilih karena tahun lalu juara Jafpa Chess Festival. Jadi dia punya pengalaman bagus untuk bersaing dengan atletatlet pulau Jawa. Dia juga baru saja menjuaraiWaspada Cup U14,” klaim Perry. MF Pitra Andika, Roy Charles dan Goh Liong sebagai pelatih Daniel di Mikroskil, mengakui siswanya itu punya potensi untuk terus berkembang. “Saya optimis dia bisa bersaing di even ini,” tegas Pitra. Danielakandidampingiayahnya Theo Lumbantobing selama iven berlangsung. Dia juga mendapat dukungan dari Kepala SD 060893(JalanDarussalam,Medan Petisah), Dalinem Sembiring . “Kami bangga karena dari sekolah kami ada atlet nasional. Jadi saya beserta semua guru sangat mendukungnya,” tegas Sembiring. (m18)

Gatot Ajak Pemuda Cinta Olahraga 10 Tim Ikut Piala GanTeng MEDAN (Waspada): Plt Gubsu, Gatot Pujo Nugroho ST, mengajak masyarat, khususnya para pemuda untuk mencintai olahraga. Ajakan itu disampaikan Gatot saat membuka resmi turnamen sepakbola Piala GanTeng di Lapangan Laden, Jl Pengabdian Simpang Beo, Desa Lau Dendang, Percut Sei Tuan, akhir pekan kemarin. “Berolahraga dapat menghindarkan para pemuda dari kegiatan-kegiatan tidak bermanfaat dan mengajarkan mereka menjadi pribadi yang se-

nantiasa menjunjung nilai-nilai sportivitas tinggi dan bertanggungjawab,” katanya. Gatot juga berharap para pemuda melalui turnemen sepakbola antardusun itu dapat memacu perkembangan dunia olahraga, khususnya sepakbola Sumut untuk bisa lebih maju lagi di masa mendatang. “Sumut, khususnya Kota Medan, pernah menjadi kiblatnya sepakbola nasional. Banyak pemain nasional lahir dari daerah ini. Namun belakangan dunia sepakbola di Sumut mu-

lai meredup. Untuk itulah sudah saatnya semua pihak bekerja keras membangkitkan prestasi sepakbolaan daerah ini,” seru Gatot. Ketua Panitia Irmanto didampingi Sekretaris Abyadi Siregar dan tokoh masyarakat Lau Dendang, Mujimin, mengatakan turnamen yang diikuti 10 tim dari sembilan Dusun di Lau Dendang itu untuk lebih mempererat tali silaturahim antarwarga dan pemuda. (m42)


Dalih Seri Napoli


WASPADA Rabu, 27 Februari 2013

ROMA (Waspada): Ditahan Udinese 0-0 pada giornata 26 Liga Seri A, Senin (Selasa WIB), Napoli berdalih kurang maksimal karena fokusnya tersedot pada laga lawan Juventus. “Pertandaingan dengan Juventus menjadi yang paling penting. Pasalnya kami ingin mendapatkan hasil,” jelas gelandang serang Marek Hamsik, seperti dilansir Sky Sports, Selasa (26/2). Napoli akan menjamu Juventus di San Paolo, Jumat (1/ 3) malam. Tetapi hasil seri di markas Udinese, Stadiun Friuli, membuat I Partenopei kini tercecer enam poin di bawah sang juara bertahan Super Juve,

Senin, 25 Februari Udinese v Napoli Lazio v Pescara

0-0 2-0

Minggu, 24 Februari Sampdoria v Chievo Atalanta v AS Roma Cagliari v Torino Parma v Catania Juventus v Siena Inter v AC Milan Bologna v Fiorentina

2-0 2-3 4-3 1-2 3-0 1-1 tunda

Sabtu, 23 Februari Palermo v Genoa


yang sebelumnya menggasak Siena 3-0. “Udinese memang selalu menjadi tempat yang sulit. Kami tentu berupaya maksimal dalam permainan dan menginginkan gol,” ucap Hamsik. Gelandang berusia 25 tahun asal Slovenia itu bersama striker Edinson Cavani memotori serangan Napoli ke jantung pertahanan I Friulani. Akselerasi mereka didukung Gokhan Inler, Pablo Armero, Valon Behrami dan Lorenzo Insigne, membuat tim tamu tampil lebih dominan. Namun dari sekian banyak peluang yang tercipta, Hamsik cs gagal memecahkan kebuntuan. “Kami hanya tak beruntung. Bagaimanapun, ketika tim saya bermain seperti itu saya senang. Saya tak bisa mengeluh,” tutur allenatore Napoli Walter Mazzarri. Menguasai penuh jalannya permainan terutama di babak kedua, I Vesuviani tak mampu mengonversi rentetan peluang akibat kecemerlangan penampilan kiper Udinese Daniele

Maradona Kembali


DIEGO Armando Maradona dikawal ketat ketika tiba di Roma Fiumicino Airport. ROMA (Waspada): Diego Armando Maradona mengakhiri dua dekade pengasingannya dari Italia, negara tempat dia pernah berjaya membawa Na-

poli dua kali menjuarai Liga Seri A. Legenda Argentina itu tidak pernah lagi melangkahkan kaki di Italia sejak 1990, ketika dia

WINGER Napoli Pablo Armero (kiri) berakhir imbang dengan pemain Udinese Dusan Basta di Stadion Friuli Stadium, Selasa (26/2) dinihari WIB. -AP-

Padelli. “Saya harus memberikan poin untuk para pemain saya. Malam ini kami menampilkan permainan luar biasa menghadapi lawan tangguh,” puji Maz-

zarri. “Kami mengkreasikan banyak kans, tetapi bolanya tidak mau masuk untuk kami,” katanya menambahkan. (m15/okz/sky/espn)

harus pergi di bawah bayangbayang kolusinya dengan bos mafia serta positif saat tes narkotika. Maradona kemudian diklaim pihak berwenang Italia telah berhutang kepada negara jutaan euro untuk tunggakan pajak. Namun dia berani memasuki Roma Fiumicino Airport, Senin (SelasaWIB), mengenakan jaket hitam, baju hitam dan kacamata hitam. Puluhan penggemarnya berdatangan untuk melihat sang bintang, banyak dari mereka berteriak “Selamat datang kembali!” Maradona hadir untuk menonton mantan klubnya bertanding di Udinese dan puncaknya ketika Napoli menjamu Juventus, Jumat (1/3). Dia dijadwalkan memberikan konferensi pers, Selasa (26/2), termasuk mengenai masalah pajaknya. Maradona dihukum pada 2005 dan diperintahkan untuk membayar 37,2 juta euro (50,4

juta dolar AS), termasuk 23,5 juta euro bunga untuk keterlambatan pembayaran. Pengacaranya baru-baru ini mengklaim, otoritas Italia telah membersihkan utangnya sehingga memungkinkan El Dieto untuk kembali ke Negeri Pizza. Tapi otoritas pajak membantah klaim tersebut. Atas masalah pajaknya itu, Maradona mengatakan tahun lalu: “Saya bukan penipu pajak. Saya bermain sepakbola dan orang lain menandatangani untuk saya.” “Saya tidak takut untuk kembali ke Italia karena saya tidak pernah menandatangani apapun. Orang-orang yang benarbenar bertanggung jawab dapat bebas berjalan-jalan dengan tenang di Naples sementara saya tidak bisa. “Itu tidak adil. Saya ingin kembali ke Italia sebagai seorang pria karena saya tidak pernah mencuri apapun dari siapa pun,” tambahnya, Napoli bersama Maradona menjuarai Liga Italia pada 1987 dan 1990. Kehadirannya diharapkan dapat memotivasi Edinson Cavani cs, yang saat ini menghuni peringkat kedua di Seri A untuk meramas cincin scudetto Si Nyonya Tua. (m15/ant/afp)

Lazio Akhiri Paceklik ROMA (Waspada): Sepasang tendangan jarak jauh yang dilepaskan Stefan Radu dan Senad Lulic, Senin (SelasaWIB), membawa SS Lazio mengempaskan perlawanan Pescara 2-0 di Stadion Olimpico. Sukses pada giornata 26 Liga Seri itu sekaligus mengakhiri paceklik kemenangan I Biancoceleste. Hasil ini juga mengantar Gli Aquilotti ke peringkat tiga sebagai slot terakhir zona Liga Champions, menggeser AC Milan dengan keunggulan dua poin. Tim tamu I Delfini besutan Cristiano Bergodi sebenarnya memulai duel dengan baik. Aksi Birkir Bjarnason dan Mervan Celik mampu merepotkan barisan pertahanan Biancocelesti. Kans terbaik Pescara hadir lewat tendangan Emmanuel Cascione, namun dapat digagalkan kiper Federico Marchetti. Sempat ditekan pada awal laga, tuan rumah Lazio perlahan bangkit dan mengendalikan rit-

Klasemen Liga Seri A Juventus 26 18 4 4 53-17 58 Napoli 26 15 7 4 46-21 52 Lazio 26 14 5 7 37-29 47 AC Milan 26 13 6 7 45-32 45 Inter Milan 26 13 5 8 41-34 44 Fiorentina 25 12 6 7 45-30 42 Catania 26 12 6 8 34-31 42 AS Roma 26 12 4 10 54-47 40 Udinese 26 9 10 7 35-34 37 Sampdoria 26 9 6 11 33-30 32 Parma 26 8 8 10 32-35 32 Torino 26 7 11 8 32-32 31 Cagliari 26 8 7 11 32-44 31 Chievo 26 8 5 13 26-42 29 Atalanta 26 8 5 13 24-38 27 Genoa 26 6 8 12 26-37 26 Bologna 25 7 5 13 33-35 26 Siena 26 7 6 13 27-37 21 Pescara 26 6 3 17 20-53 21 Palermo 26 3 11 12 22-39 20 *Siena dikurangi 6 poin, Atalanta 2, Torino & Sampdoria 1 poin.


WINGER Lazio Alvaro Gonzalez bertarung seru dengan gelandang Pescara Birkir Bjarnason (kanan) di Stadion Olimpico Roma, Selasa (26/2) dinihari WIB. me permainan. Setelah tembakan Hernanes dari jarak sekitar 20 meter meleset tipis dari sasaran, Tim Elang Muda akhirnya memecahkan kebuntuan menit 29. Dari jarak yang serupa dengan upaya Hernanes, Radu yang mendapat bola dari Lulic langsung melesatkan sepakan first-time menembus gawang Pescara. Menit 35 tuan rumah meng-

gandakan keunggulan, juga lewat tembakan jarak jauh. Kali ini Lulic yang sukses memperdaya kiper Ivan Pelizzoli dengan tendangan geledeknya. Di babak kedua, Pescara berusaha bangkit dengan meningkatkan intensitas permainan. Penguasaan bola didominasi I Delfini, namun kans bersih jarang tercipta dan skor 2-0 tak berubah hingga bubaran pertandingan. (m15/goal/uefa)

Pasang IklanTelp. 4528431 HP. 081370328259 Email:

Sumatera Utara

WASPADA Rabu 27 Februari 2013


Zhuhur ‘Ashar

Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

12:40 12:54 12:41 12:48 12:48 12:45 12:41 12:37 12:44 12:43

15:59 16:13 15:59 16:07 16:07 16:01 15:59 15:55 16:02 16:02

Magrib 18:42 18:54 18:43 18:49 18:49 18:48 18:43 18:39 18:45 18:44



Shubuh Syuruq


19:51 20:03 19:52 19:58 19:58 19:57 19:52 19:48 19:54 19:53

05:12 05:26 04:12 05:20 05:20 05:14 05:12 05:08 05:15 05:15

05:22 05:36 05:22 05:30 05:30 05:24 05:22 05:18 05:25 05:25

L.Seumawe L. Pakam Sei Rampah Meulaboh P.Sidimpuan P. Siantar Balige R. Prapat Sabang Pandan

06:37 06:51 06:38 06:46 06:45 06:39 06:37 06:33 06:40 06:40

Zhuhur ‘Ashar 12:47 12:40 12:39 12:51 12:38 12:39 12:39 12:36 12:54 12:40

16:06 16:58 15:57 16:09 15:55 15:57 15:56 15:53 16:13 15:57



Imsak Shubuh Syuruq


18:47 18:41 18:40 18:52 18:41 18:41 18:41 18:38 18:53 18:43

19:56 19:50 19:49 20:01 19:50 19:50 19:50 19:47 20:03 19:52

05:19 05:11 05:10 05:22 05:08 05:10 05:09 05:06 05:26 05:10

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

05:29 05:21 05:20 05:32 05:18 05:20 05:19 05:16 05:36 05:20

06:44 06:36 06:35 06:47 06:33 06:35 06:34 06:31 06:51 06:35

Zhuhur ‘Ashar 12:40 12:41 12:51 12:44 12:41 12:48 12:36 12:46 12:39 12:39

15:57 15:59 16:10 16:01 15:59 16:06 15:54 16:04 15:57 15:57





Shubuh Syuruq


18:43 18:43 18:51 18:46 18:42 18:48 18:38 18:48 18:42 18:40

19:52 19:53 20:01 19:56 19:52 19:58 19:47 19:57 19:51 19:49

05:10 05:12 05:23 05:14 05:12 05:19 05:07 05:17 05:09 05:10

05:20 05:22 05:33 05:24 05:22 05:29 05:17 05:27 05:19 05:20

Panyabungan Teluk Dalam Salak Limapuluh Parapat Gunung Tua Sibuhuan Lhoksukon D.Sanggul Kotapinang Aek Kanopan

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

06:35 06:37 06:49 06:39 06:37 06:45 06:32 06:42 06:35 06:35

Zhuhur 12:37 12:44 12:42 12:37 12:39 12:37 12:36 12:46 12:40 12:35 12:36

‘Ashar Magrib 15:53 16:00 15:59 15:55 15:57 15:53 15:53 16:05 15:57 15:52 15:54

18:40 18:47 18:44 18:39 18:41 18:40 18:39 18:46 18:43 18:37 18:39



Shubuh Syuruq

19:49 19:57 19:53 19:48 19:51 19:49 19:49 19:56 19:52 19:46 19:48

05:06 05:13 05:12 05:08 05:10 05:06 05:06 05:18 05:10 05:05 05:07

05:16 05:23 05:22 05:18 05:20 05:16 05:16 05:28 05:20 05:15 05:17

06:31 06:38 06:37 06:33 06:35 06:31 06:31 06:43 06:35 06:30 06:32

Polres Langkat Panggil Pengusaha Pukat Gerandong STABAT (Waspada): Kapolres Langkat AKBP Leonardus Eric Bhismo menegaskan, pihaknya telah melayangkan surat panggilan pertama kepada para pengusaha pukat gerandong, yang kapalnya diamankan polisi beberapa hari lalu di perairan Kwala Serapuh. “Jika pada panggilan pertama mereka tidak datang, maka akan dilakukan panggilan ke dua hingga ke tiga. Tidak tertutup kemungkinan juga akan dilakukan upaya paksa jika mengabaikan panggilan,” tegas Eric, Selasa (26/2). Meski hanya membutuh-

kan keterangan para pengusaha terkait pengembangan kasus penahanan delapan ABK pukat gerandong, namun akan ada kesimpulan apakah pengusaha terlibat. “Kemungkinan besar pengusaha pukat gerandong melarang para nakhoda kapal me-

laut di zona tangkap nelayan tradisional, tapi itu masih kemungkinan dan kepastiannya kita belum tahu,” lanjut Kapolres. Informasi diperoleh, pemilik delapan kapal yang diamankan sebelumnya, yakni Atek, Fexia, Abin dan Alian, warga Belawan dan ada juga warga Langkat. Mereka berperan sebagai toke yang diduga mengerahkan nelayan pukat gerandong untuk meraup biota laut hingga spesies terkecil. Dalam kasus tersebut Polres Langkat telah menahan delapan tersangka yakni

para nakhoda kapal. Sementara untuk pemilik kapal juga pengusaha pukat, belum ditindak. Terimakasih Sementara itu 15 nelayan tradisional Langkat yang sempat ditahan pihak Polda Sumut dan telah dibenarkan pulang dari RutanTanjung Gusta Medan, kini telah melaksanakan aktivitas melaut. Rajali dan Amsul Fahrizal mewakili rekan-rekannya yang sempat ditahan, di sekretariat DPW PNTI Sumut Jl. Amaliun Medan, Senin (25/2) mengatakan terimakasih kepada Kapoldasu

Irjen Pol Wisjnu Amat Sastro. “Terimakasih juga kepada Ketua Persatuan Nelayan Tradisional Indonesia (PNTI) Kab. Adhan Nur, SE yang berjuang membantu sehingga kami dapat berkumpul kembali bersama keluarga,“ ujar Fahrizal nelayan Desa Kelantan. “Keikhlasan dan kesungguhan Ketua PNTI dan jajarannya membantu proses pembebasan, sangat kami hargai. Beliau memberi semangat kepada kami dan ikut menjemput dari Rutan Tanjung Gusta Medan,” tuturnya.(a03/m24)

Wali Kota Binjai Minta Forum SKPD Prioritaskan Pembangunan BINJAI (Waspada): Wali Kota Binjai, HM. Idaham, SH, M.Si menegaskan, forum SKPD memegang peran penting menentukan skala prioritas pembangunan. Hal itu ditegaskan Wali Kota pada pembukaan Forum SKPD di aula Pemko Binjai, Selasa (26/2). Di depan para SKPD, Kakan Kemenag Binjai H. Al Ahyu, MA, Ketua DPRD Zainuddin Purba, SH, Wali Kota Binjai menyebutkan Forum SKPD, wadah bersama antar pemangku kepentingan yang terlibat dalam proses pembangunan, baik menyusun dan menyempurnakan rancangan rencana kerja SKPD tahun 2014. Tujuan Forum SKPD menselaraskan program dan kegiatan pembangunan sehingga dapat ditetapkan prioritas program dan kegiatan pembangunan. Forum SKPD harus menjaring secara benar dan memprioritaskan pembangunan yang erat berkaitan dengan rakyat. Peraturan pemerintah no. 8 tahun 2008, menetapkan keefektifan pelaksanaan forum SKPD melalui dua hal, normatif dan menentukan prioritas pagu indikatif, sebagai instrumen menginformasikan kemampuan pembiayaan.Wali Kota juga minta camat lebih proaktif, tidak lalai dalam pembahasan di setiap kelompok Forum SKPD dengan berpedoman pada skala prioritas dan mendesak. Dalam Forum SKPD, camat dari lima kecamatan menyampaikan paparan dengan berbagai skala prioritas. Oleh Wali Kota ditekankan program, tidak saja pembangunan fisik. Pembangunan non fisik lebih baik dilakukan seperti penataan lingkungan, penyehatan lingkungan, penertiban perizinan yang merusak lingkungan.(a04)

Warga Pulausembilan Tentang Konversi Hutan Mangrove PANGKALANSUSU (Waspada): Ratusan warga pesisir Desa Pulausembilan, Kec. Pangkalansusu, Senin (25/2) menghentikan operasional excavator di kawasan hutan mangrove yang alih fungsikan perusahaan perkebunan. Warga penentang alih fungsi tidak hanya kaum lelaki, tapi juga para ibu rumah tangga termasuk anak-anak. Mereka mendesak pengusaha menghentikan kegiatan operasi tiga unit excavator yang telah mengancurkan ekosistem. Ismail, salah seorang warga kepada wartawan menyatakan, masyarakat keberatan kawasan hutan ini dialihfungsi menjadi perkebunan kelapa sawit. Ia mendesak Pemkab Langkat menindak pengusaha. Massa anti konversi sempat terlibat perang mulut dengan warga yang pro pengusaha. Ketegangan antar sesama warga berhasil diredakan setelah aparat kepolisian turun ke lapangan menenangkan situasi. Kasus alih fungsi hutan mengrove telah dilaporkan warga ke Pemkab termasuk Komisi II DPRD Kab. Langkat. Tapi pihak perusahaan tidak peduli seruan penghentian kegiatan penghancuran hutan sehingga membuat warga berang.(a02)


PLH. Bupati Sergai Drs. H. Haris Fadillah, M.Si menyematkan tanda peserta sosialisasi dan pelatihan Peraturan Presiden (Perpres) No. 70 tahun 2012, serta ujian sertifikasi pengadaan barang/jasa pemerintah di aula Theme Park Resort Pantai Cermin.

Pemkab Sergai Sosialisasi Perpres No. 70 Tahun 2012 PANTAI CERMIN (Waspada): Pemkab Sergai melakukan sosialisasi dan pelatihan Perpres No. 70 tahun 2012 dan ujian sertifikasi pengadaan barang/jasa pemerintah, dibuka Plh. Bupati Drs. H. Haris Fadillah, M.Si, di aula Theme Park Resort Pantai Cermin, Senin (25/2). Dalam arahannya Plh. Bupati Sergai H. Haris Fadillah mengatakan, pengadaan barang/jasa pemerintah baik yang dibiayai APBN/APBD memerlukan pengawasan dan pelaksanaan lebih efektif dan efisien, mengutamakan penerapan prinsip persaingan usaha yang sehat, transparan, terbuka dan adil bagi semua pihak, transparan, akuntabel dan profesional. “Agar penggunaan keuangan negara berjalan lebih efisien, efektif dan tepat guna, peserta pelatihan agar mengikuti kegiatan ini sebaikbaiknya. Sehingga menghasilkan tenaga yang memiliki pemahaman dan keterampilan serta integritas,” kata Plh. Bupati Sergai. Acara yang dilaksanakan pada 25 sampai 27 Februari 2012 diikuti 100 PNS dari seluruh SKPD se-Sergai. Sebagai narasumber Ir. Zulhenny Darwin dari Kasubbid Pelayanan Sanggah LKPP, dan Ahmad Ferry Tanjung, SH, M.Kn dari Badan Diklat Keuangan Medan.(a08)

Waspada/Ibnu Kasir

BUPATI Langkat H. Ngogesa Sitepu, SH didampingi Camat Hinai Hj.Yushilda Usman dan Ketua TP PKK Hj. Nuraida Ngogesa ketika menghadiri tabligh akbar dan penutupan pesta rakyat serta MTQ se Kec. Hinai.

Pagelaran Seni, Zikir Dan MTQ Di Hinai STABAT (Waspada): Bupati Langkat H. Ngogesa Sitepu, SH menutup pesta rakyat, pagelaran seni bernuansa Islami dirangkai tabligh akbar dan peringatan Maulid Nabi Besar Muhammad SAW, ditandai dengan pemukulan bedug serta penyerahan piala untuk para juara MTQ se Kec. Hinai, di halaman kantor Camat Hinai, Minggu (24/2). Bupati H. Ngogesa yang hadir bersama Ketua TP PKK Hj. Nuraida Ngogesa, sangat mengapresiasi kegiatan yang dipelopori masyarakat, tokoh pemuda dan pemerintah Kec. Hinai. Menurut Ngogesa, dalam setiap kegiatan kita tidak hanya mengandalkan kemampuan sendiri tanpa melibatkan pihak lain. Untuk itu kebersamaan

yang telah menguat sebagai bukti masyarakat kuat rasa silaturahim dan kepeduliannya akan pentingnya agama bagi kebaikan generasi. “Kegiatan seperti ini, membuktikan adanya kebersamaan masyarakat bersama pemerintah guna mendukung visi relijius,” kata Ngogesa seraya menegaskan, kesadaran bersama suasana relijius akan melahirkan akhlak dan moral bagi kebaikan diri dan bangsa. Sebelumnya, Camat Hinai Hj. Yushilda Usman menjelaskan serangkaian kegiatan yang dimulai 12 Januari dalam menyemarakkan Hari Jadi Kab. Langkat, serta 5 Tahun kepemimpinan H. Ngogesa sebagai Bupati Langkat. Kegiatan meliputi pang-

gung hiburan rakyat, ketoprak, nonton bareng pada beberapa desa, festival vocal grup, lomba kader pembangunan desa, lomba balita sehat, berbagai pertandingan olahraga, bazar, zikir akbar, MTQ dan festival seni budaya Islam, melibatkan seluruh komponen masyarakat. Dalam kesempatan itu Mahmuzar selaku ketua panitia yang mewakili unsur pemuda dan elemen masyarakat Kec. Hinai, minta kesediaan Haji Ngogesa untuk mencalonkan diri kembali menjadi Bupati Langkat periode ke dua. Mengakhiri acara, Ustadz H. Baharuddin Damanik menyampaikan tausyiah yang intinya mengajak warga untuk saling peduli dengan menguatkan semangat kebersamaan.(a01)

Bupati DS Buka Festival Kesenian Kuda Lumping PERCUT SEITUAN (Waspada): Bupati Deliserdang Drs H Amri Tambunan melalui Camat Percut Seituan Darwin Zein,S.Sos membuka Festival Seni Budaya tradisional Kuda Lumping tingkat Kabupaten Deliserdang di lapangan Reformasi Bandar Klippa Kecamatan Percut Seituan, Sabtu (23/2). Camat Percut Seituan Darwin Zein,S.Sos antara lain mengatakan, pada prinsipnya pemerintah Kabupaten Deliserdang di bawah pimpinan Drs H Amri Tambunan sangat menyambut positif adanya kegiatan ini karena beliau merupakan orang yang sangat peduli terhadap segala perkembangan du-

nia seni tradisional yang ada di Kab. Deliserdang termasuk kuda lumping. Dikatakannya, saat ini banyak anggota masyarakat kurang peduli serta kurang melestarikan adat budaya yang ada. Oleh karenanya dengan adanya kegiatan ini diharapkan kiranya para seniman khususnya yang berada di Kec. Percut Seituan ini dapat lebih mengembangkan serta meningkatkan semangat dan jiwa seni dimiliki. Kepala Dinas Kebudayaan dan Pariwisata kabupaten Deliserdang Drs H Rahmad Nasution,MAP, diwakili Drs H Dani Hapianto,MSi mengatakan, Pemkab Deliserdang sangat

Waspada/H.M. Husni Siregar

PELAKSANA Harian Bupati Deliserdang, H. Zainuddin Mars memberi arahan pada pertemuan pengusaha dengan Pemkab Deliserdang, di aula Disperindag.

Pemkab DS Minta Pengusaha Hindari Calo Soal Pengurusan Izin LUBUKPAKAM ( Waspada): Pemkab Deliserdang minta kalangan pengusaha menghindari calo untuk pengurusan segala bentuk izin. “Saya sudah berkali-kali mendengar keluhan tentang pengurusan izin di Deliserdang yang termahal, kalau pun cepat izin yang beredar palsu,” tegas Pelaksana Harian Bupati Deliserdang, H. Zainuddin Mars pada temu mitra pengusaha dan Pemkab Deliserdang, di aula Dinas Perindustrian dan Perdagangan (Disperindag) Kab. Deliserdang, Senin (26/2). Ini, tambah Plh. Bupati Deliserdang itu, merupakan kesan negatif sehingga dapat menjadi kendala untuk kemajuan masyarakat Deliserdang sendiri. “Jadi saya harap jangan mengurus izin melalui calo,” tegasnya lagi. Pernyataan Plh. Bupati itu didasari dengan adanya keluhan sejumlah pengusaha yang mengaku kesulitan mengurus izin, di antaranya izin HO, IMB dan lainnya. Selain biaya yang terlalu mahal, jangka waktunya juga lama. Bahkan ada yang mengurus izin air bawah tanah, selain mahal juga memakan waktu tiga tahun. “Nah, ini sudah luar biasa. Jadi saya apresiasi langkah Kadisperindag yang baru yang telah menggagas pertemuan ini, karena persoalan ini sudah menjadi perhatian bupati dan beliau amat teliti memeriksa setiap berkas yang masuk, khususnya soal perizinan,” sebut Zainuddin Mars. Zainuddin tak menampik, adanya penilaian buruk soal perizinan, jelas berdampak pada pembangunan daerah ini. “Pemkab Deliserdang selama ini mengandalkan tiga pilar untuk membangun, yaitu pemerintah dan peran masyarakat serta topangan swasta. Hasilnya Deliserdang mampu melakukan percepatan pembangunan dengan berbagai indikator pembangunan yang meningkat,”

ulangnya. Namun ironisnya, ungkap H. Zainuddin, Deliserdang hanya mampu menyerap pendapatan asli daerah (PAD) Rp300 miliar lebih dari target Rp400 miliar lebih. “Seharusnya PAD Deliserdang Rp1 triliun lebih, apalagi ke depan daerah kita kawasan pembangunan nasional, di antaranya Bandara Kuala Namu. Jadi mulai hari ini secara bertahap kita selesaikan segala kendala untuk menjadikan Deliserdang amat tepat dan paling nyaman untuk para investor menanamkan modalnya,” kata H. Zainuddin optimis. Terakhir Zainuddin Mars berjanji menindak para staf di instansi terkait yang coba-coba menjadi calo kepengurusan segala permohonan izin pengusaha. “Pokoknya staf Kadis dan pengusaha nakal harus pinggir dari Deliserdang. Untuk itu mari bersama-sama kita memberantasnya dan hindari calo,” harap Zainuddin. Sebelumnya dari pengusaha, Ketua APINDO (Asosiasi Pengusaha Indonesia) mengungkapkan, pada pertemuan-pertemuan sebelumnya juga menyoal soal kendala itu, namun fakta di lapangan tak satu pun terealisasi. Apindo menyarankan Komisi C DPRD Deliserdang menjadwalkan segala kendala dari pengusaha dan jika kedapatan ada pengusaha nakal, segera ditindak. Dari Komisi C DPRD Deliserdang, H. Sabar Ginting juga membeberkan bahwa hasil pengecekan pihaknya menemukan dari 10 pengusaha, sembilan menyalah. “Bagaimana mencapai PAD. Yang penting bayar pajak dan segera urus izin langsung sesuai prosedur yang telah ditetapkan,” ajak Sabar yang juga pengusaha tersebut. Kadisperindag Drs. Vuko Redward Bakkara Wilson, M.Si, mengutarakan tujuan temu mitra selain silaturahmi juga mencari solusi segala kendala yang dihadapi para pengusaha dan pemerintah.(a06/m16)


WALI Kota Ir. H.Umar Z Hasibuan, MM berbincang dengan Kadis Perhubungan terkait revitalisasi Pasar Sakti.

memberi perhatian serius terhadap perkembangan dunia seni budaya termasuk kuda lumping untuk ditumbuhkembangkan serta dilestarikan di tengah kehidupan masyarakat. Keluar sebagai pemenang dalam perlombaan Kuda Lumping tingkat Kabupaten Deliserdang Juara I diraih Kelompok Siswo Budoyo dari Kec.Beringin, Juara II kelompok Tri Murti dari Kec.Tanjung Morawa serta Juara III diraih kelompok Dwi Tunggal Sekar dari Kecamatan Percut Seituan. Pemenang memperoleh trophy dan sejumlah uang pembinaan dari Bupati Deliserdang. (crul)

Wali Kota T. Tinggi Prihatin Terhadap Kondisi Pasar Sakti TEBINGTINGGI (Waspada): Wali Kota Tebingtinggi Ir. H. Umar Zunaidi Hasibuan, MM menyatakan keprihatinannya atas kondisi buruk Pasar Sakti. Pasar tradisional itu dinilai tak layak menjadi lokasi berjualan pedagang, karena sarana dan prasarana yang tidak memadai, kios banyak kosong, areal berjualan becek serta aroma busuk yang membuat tidak nyaman. “Pantas pasar ini sepi, masyarakat enggan datang ke sini,” ujar Wali Kota saat mengunjungi lokasi, Senin (25/2). Wali Kota bersamaWakilWali Kota H. Irham Taufik, SH, MAP didampingi Kadis PU Ir. Muhammad Nurdin, Kadispenda Jeffri Sembiring, SE, MM, Kadis Perhubungan Syafrin Harahap, SH, Kabag Humas PP Ahdi Sucipto, SH dan Camat Bajenis Syahdama Yanto, AP. Kepada Kadis PU, Wali Kota menginstruksikan segera merevitalisasi Pasar Sakti. Dikatakan, revitalisasi sangat penting dan strategis guna menampung pedagang yang masih belum memiliki tempat. “Kalau pasar ini dimanfaatkan maksimal, akan sangat

penting untuk ekonomi kota,” tegas Umar Zunaidi. Akan banyak pedagang tertampung dan bisa bersaing dengan pasar modern yang ada. Wali Kota juga berjanji akan berkoordinasi dengan Polres untuk menjamin keamanan di pasar tradisional. Selain itu, untuk membuka akses lebih luas, Pemko Tebingtinggi akan membangun jembatan penghubung antara Kel. Bandar Sakti di Kec. Bajenis, dengan Kel. Karya Jaya di Kec. Rambutan. Terkait relokasi Pasar Gurami di bantaran Sei Padang, Wali Kota belum bisa memastikan, namun sudah ada rencana ke arah sana. Terjatuh Dalam kunjungan mendadak itu, Wakil Wali Kota sempat terjatuh, saat mengunjungi lokasi bakal dibangunnnya jembatan penghubung di Kel. Bandar Sakti. Saat melintasi jalan setapak, Wakil Wali Kota limbung, karena lokasi pijakan yang tak rata. Akibatnya, Wakil Wali Kota sempoyongan dan terjatuh. Salah seorang staf Humas segera membantu Wakil Wali Kota. Tidak ada hal-hal fatal terkait insiden itu.(a09)

Tersangka Kurir Sabu Teriaki Polisi Maling

Waspada/Khairul K Siregar

SALAHSATU peserta grup kuda lumping dari Desa Kolam ketika menampilkan atraksi dalam Festival Seni Budaya Kuda Lumping Tingkat Deliserdang di Lapangan Reformasi Bandar Klippa Kec.Percut Seituan.

PEGAJAHAN (Waspada): Tersangka kurir sabu, PRAM, 36, warga Dusun III, Desa Pegajahan, Kec. Pegajahan, Kab. Serdang Bedagai meneriaki maling kepada personel Sat Narkoba Polres Sergai yang dipimpin Kaur Bin OPS Ipda Achmad Haidir, saat akan diringkus, Senin (25/2) malam. Teriakan pelaku sempat mengundang kerumunan warga, namun setelah dijelaskan mereka adalah personel Satnarkoba, akhirnya warga membubarkan diri dan membiarkan tersangka diboyong ke komando. Sementara itu, usai menjalani pemeriksaan

di ruang Satnarkoba Polres Sergai tersangka yang kesehariannya bekerja mocok-mocok mengaku mendapat barang haram itu dari rekannya SM, tetangganya. Ayah empat anak itu mengaku membeli sabu Rp150 ribu/paket, dan akan diserahkan kepada AM selaku pemesan. Kasat Narkoba Polres Sergai, AKP Hendra kepada Waspada, Selasa (26/2), membenarkan tersangka ditangkap berkat informasi dari warga. Tersangka berikut barang bukti satu paket sabu, serta sepedamotor Yamaha BK 6352 NY telah diamankan sebagai barang bukti.(c03)

Sumatera Utara


Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu Lusia Damayanti (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: H. Halim Hasan. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Zulkifli Harahap. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Promosi: Edward Thahir (Koordinator). Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Sinur Manik (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi). Wartawan Kota Medan: Umum: H. Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Hj. Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa, Avli Yarman. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Arianda Tanjung, Dio Utama. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebingtinggi: Muhammad Idris, Abdul Khalik. Pematangsiantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Tarutung: Parlindungan Hutasoit. Sibolga/Tapanuli Tengah: Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan/Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies, H. Rusli Ismail, Arman Konadi. Aceh Besar: Iskandarsyah. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanafiah. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar, Dedek Juliadi. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Jasvira Sautisa. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan WASPADA dilengkapi dengan kartu pers. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada yang mengaku wartawan WASPADA tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi:

Banjir Bukan Akibat Pintu Air Sigura-gura 459 Korban Banjir Mengeluh Sakit TANJUNGBALAI (Waspada): Penyebab utama banjir yang melanda Kab. Asahan dan Kota Tanjungbalai bukan dampak dari dibukanya pintu pengatur air PLTA Sigura-gura dan Tangga, Asahan. Demikian pengelola kedua Pembangkit Listrik Tenaga Air (PLTA) tersebut, melalui Humas PT Asahan Aluminium (Inalum) H. Eddi Kristianto didampingi stafnya Hotniasi Silitonga, menyampaikan hal itu kepada Waspada sebagai penjelasan kepada masyarakat luas, Selasa (26/2). Hotniasi menyebutkan, pintu dam Sigura-gura sudah dibuka sejak (16/2/2013) dengan volume air yang dibuang 166,4 ton per detik (t/d). Hal itu disebabkan permukaan Danau Toba naik 905.100 meter di atas permukaan laut (mdpl). “Jika musibah ini disebabkan dibukanya pintu air PLTA Sigura-gura dan Tangga, tentu pada tanggal 16 Februari 2013 sudah terjadi banjir, karena perjalanan air dari bendungan sampai ke muara hanya hitungan jam. Nah, ternyata banjir baru terjadi pada 21Februari2013,”terangHotniasi. Secara rinci Hotniasi memaparkan, tanggal 17 Februari per-

mukaan Danau Toba naik menjadi 905.106 mdpl dan air dibuang 220.9 t/d. Pada 18 Februari permukaan 905.118 mdpl dan air dibuang 241.7 t/ d, dan tanggal 19 Februari permukaan 905.153 dpl, air dibuang 253.6 t/d. Kemudian, 20 Februari Danau Toba di posisi 905.169 mdpl, air dibuang 274.2 t/d, selanjutnya tanggal 21 Februari permukaan air danau 905.171 mdpl dan air dibuang 280.6 t/ d. Memasuki 22 Februari, permukaan air mulai menurun menjadi 905.165 mdpl, air yang dibuang pun mulai dikurangi menjadi 271.6 d/t. Tanggal 23 Februari permukaan Danau Toba terus menyusut jadi 905.151 mdpl, air yang dibuang 274.9 t/d. Terakhir, 24 Februari, air di danau berada di level 905.138, sedangkan dibuang 275.3 t/d. “Sesuai perhitungan kami secara profesional, air yang

dibuang 280.6 ton per detik pada tanggal 21 Februari masih tahap normal, tidak akan menyebabkan terjadi banjir di bagian hilir Sungai Asahan. Jadi air dari PLTA bukan penyebab utama, melainkan ada faktor lain,” terang Hotniasi. Menurutnya, penyebab utama banjir antara lain tingginya curah hujan kurun waktu beberapa hari terakhir di kawasan Asahan. Sehingga Sungai Asahan meluap dan diperparah lagi banyaknya anak sungai di sepanjang aliran. Faktor utama lainnya adalah jebolnya tanggul penahan Sungai Asahan di daerah Kec. Simpang Empat, yang menyebabkan air meluap dan membanjiri pemukiman. Jika tanggul itu tidak rusak, tambah Hotniasi, air yang mengalir dari hulu tidak akan meluber ke daratan. Pantauan Waspada, banjir masih menggenangi kawasan Kec. Simpangempat, Kab. Asahan dan Kec. Datukbandar serta Datukbandar Timur Kota Tanjungbalai hingga ketinggian mencapai dua meter. Mengeluh Sakit Sementara itu, sebanyak 459 orang korban banjir di Kec. Sim-

200 Ha Tanaman Padi Puso Diserang Hama Tikus INDRAPURA (Waspada): Sekitar 200 hektar tanaman padi petani Musim Tanam (MT) 2012/2013 pada areal persawahan di Desa Limausundai, Kec. Airputih, Batubara mengalami puso akibat terserang hama tikus. Liputan Waspada di lapangan, Selasa (26/2), tanaman padi yang terserang hama tikus itu terletak di areal persawahan di Dusun V hingga VI. Mulai dari Balai Desa hingga perbatasan Desa Sukaramai. Tanaman padi

ini puso, sehingga tidak panen sama sekali. L. Samosir, 44, salah seorang petani dmengatakan, tanaman padi yang terserang hama tikus adalah hasil tanam pada Oktober dan November lalu. Hama tikus mulai menyerang saat tanaman padi mulai bunting. Serangan tikus relatif cepat membuat petani tak berdaya mencegahnya.Walau berbagai upaya telah dilakukan. Namun tikus tetap mengganas, meluluh lantakkan tanaman padi.

Menurut petani, serangan hama tikus itu lebih disebabkan tidak serentaknya pelaksanaan pola dan tertib tanaman di desa ini. Tanaman yang terserang tikus ini, lebih dahulu dilaksanakan penanamannya dibanding tanaman padi pada areal sawah lain di desa ini. Jarak masa tanamnya sekitar satu bulan. Di Limausundai areal persawahan berjumlah sekitar 700 hektar, termasuk areal yang puso. Semuanya merupakan persawahan irigasi teknis. (c04)

bah rumah tangga. Hal senada juga diungkapkan dr Ahmad Akbar, Rahmayati, dan Putri, petugas kesehatan di pos Desa Seidua Hulu, Kec. Simpangempat, Kab. Asahan. Menurutnya,penyakitkulit,diaere dan penyakit lainnya merupakan dampak dari terjadinya banjir sudah berhari-hari. (a32)

Boat Nelayan Tenggelam 9 Awak Selamat BATUBARA (Waspada): Satu boat penangkap ikan milik pengusaha perikanan yang bertangkahan di Kuala Batubara, tenggelam di laut setelah dihantam gelombang, tepatnya di sekitar Kuala Baganbatak, Desa Baganbaru, Kec. Tanjungtiram, Senin (25/2). Peristiwa tersebut tidak sampai menimbulkan korban dan sembilan awak boat selamat dan telah kembali ke darat. Menurut keterangan Waspada peroleh, pagi itu seperti biasa boat alat tangkap ikan teri turun ke laut. Menjelang siang boat dinakhodai S Manik warga Tanjungtiram mengarah ke Timur Kuala Baganbatak atau 3 mil dari Pelabuhan Tanjungtiram untuk berlabuh menangkap ikan.

Begitu dalam perjalanan tiba-tiba dihantam gelombang disertai angin membuat boat tenggelam. Sedangkan sembilan awak di dalamnya selamat setelah menumpang boatlainnya dan membawa kembali ke tangkahan. Nelayan juga berupaya untuk menarik mengevakuasi boat beserta pukat (alat tangkap) yang tenggelam, namun karena tingginya gelombang dan angin usaha dilakukan sia-sia dan berupaya mengevakuasi kembali hari ini setelah kondisi cuaca membaik. Menurut nelayan, belakangan ini perairan Batubara terjadi gelombang dan angin sehingga mengganggu aktivitas menangkap ikan dan banyak nelayan yang tidak berani ke laut. (a13)

LABUSEL (Waspada): Sejumlah Poliklinik Desa (Polindes) yang dibangun menggunakan dana APBD di beberapa daerah di Kab. Labusel hanya menjadi bangunan kosong tidak berpenghuni. Seperti gedung Polindes Asam Jawa di Dusun Teluk Pinang, Desa Asam Jawa, Kec. Torgamba, misalnya. Tempat itu, kosong melompong saat Waspada menyambangi, Selasa (26/2). Polindes baru ini tidak memiliki tenaga medis dan sarana medis layaknya tempat perobatan dan sarana informasi kesehatan masyarakat. Polindes yang berada di pinggir Jalinsum ini terdiri dari sebuah bangunan dengan panjang sekira 16 meter. Hanya ada beberapa ruang, sebuah ruang besar bagi para petugas medis. Gedung bercat putih itu tampak tidak terawat beberapa tahun. Di sebelahnya terdapat beberapa rumah warga. “Itu dibangun pada tahun 2011 lalu. Sudah hampir dua tahun

terwujud berkat dorongan dan motivasi KPU Pusat dan KPU Provsu, serta campur tangan Pemko dan Dewan Kota. Keberhasilan itu merupakan karya bersama untuk mengangkat harkat martabat KPU didaerah itu sekaligus untuk menambah semangat untuk bekerja. Sementara, Ketua DPRD T.Balai H Romaynoor menyampaikan ucapan terima kasih kepada KPU Pusat yang telah mengucurkan dana APBN untuk membangun gedung permanen itu. Dikatakan, tugas KPU sangat urgen dan untuk itu diperlukan bangunan kokoh dalam menunjang kenyamanan dan keberhasilan KPU sebagai penyelenggara pemilihan umum. Wali Kota Tanjungbalai DR H Thamrin Munthe M.Hum

menyampaikan pujian kepada Ketua KPU Kota itu, sebab berhasil memperoleh dana APBN untuk mendirikan kantor KPU, sementara Pemko hanya memberikan lahan atau pertapakan. “Ini merupakan kerja keras Ketua KPU, bangunan ini merupakan wajah dan wibawa Kota Tanjungbalai,” ujar Thamrin Munthe. Sedangkan Ketua KPU RI Husni Kamil Manik SP menuturkan sejak dilantik menjadi Ketua KPU Pusat, pihaknya telah berupaya untuk membangun kantor-kantor KPU di Indonesia. Tahun 2012 lalu, jelasnya, anggaran KPU Pusat Rp160 miliar untuk KPU seSumut, namun hanya dua kabupaten/kota yang mengajukan pembangunan kantor dari 33 kabupaten/kota. (a32)

namun tidak pernah berfungsi,” kata R Sirait, salah seorang warga di kawasan itu. Informasi yang dihimpun Waspada, mandeknya fungsi Polindes tersebut disebabkan tiadanya peralatan. Parahnya, kalaupun peralatan pendukungnya dilengkapi, Polindes ini tetap tidak dapat berfungsi optimal, karena tenaga medisnya pun tidak tersedia, sebab saat ini jumlah tenaga medis di Labusel masih jauh dari kebutuhan. Selain Polindes Asam Jawa, kondisi serupa terjadi terhadap Polindes di Desa Marsonja, Kec. Sungaikanan. Meski dibangun bagus, namun sampai kini masyarakat setempat tidak dapat memanfaatkannya untuk memeriksa kesehatan dan mengobati penyakitnya. Pihak Dinas Kesehatan Pemkab Labusel tidak dapat dikonfirmasi terkait masalah tersebut. Kepala Dinas Kesehatan, dr Rusman Lubis yang coba dikonfirmasi belum lama ini juga tidak bersedia memberikan keterangan. (c18)

Staf Dewan Pendidikan Dirampok RANTAUPRAPAT (Waspada): Staf Dewan Pendidikan Kab. Labuhanbatu Puput Aisyah, 21, dirampok Orang Tak Dikenal (OTK) di Jalan DR Hamka, Kec. Rantau Selatan, Senin (25/2). Pelaku berhasil menggondol uang tunai Rp1 juta dan telepon seluler Merk Nokia 1 unit milik korban. Korban yang merupakan warga Jalan Dwi Sartika Rantauprapat Selasa (26/2) menceritakan, siang itu ia hendak menjemput adiknya yang bersekolah di Perguruan Nur Ibrahimi di Jalan SM Raja Rantauprapat, dengan mengendarai sepedamotor jenis Beat. Saat tiba di Jalan DR Hamka menuju Simpang Mangga, tiba-tiba ia dipepet oleh seorang pria yang tidak dikenal memakai baju batik

� Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412.

RANTAUPRAPAT (Waspada): Ketua Umum Pengurus Besar (PB) Al-Jam’iyatul Washliyah H. Yusnar Yusuf, PhD melantik Drs. H. Bukhari IS MM sebagai Rektor Universitas Alwashliyah (UNIVA) Labuhanbatu untuk periode 2013-2017, Kamis (21/2) di Aula Kampus Univa setempat. Ketua Majelis Pendidikan PB Alwashliyah Drs. H. Ismail Efendi, MSi menyampaikan, tahapan pemilihan Rektor UNIVA L.Batu telah dilakukan, mulai dari tahap penjaringan terbuka, fit and proper test dan rapat senat pemilihan rektor yang akhirnya menetapkan Drs. H. Bukhari Is, MM sebagai rektor terpilih dan disahkan melalui Surat Keputusan PB Alwashliyah yang ditandatangani oleh Ketua Umum PB. Dalam sambutannya Bukhari yang juga Kandidat Doktor Manajemen dari Universitas Utara Malaysia (UUM) menyampaikan terimakasih kepada seluruh civitas akademika dan PB Alwashliyah. Dalam periode kedua ini Bukhari menargetkan Univa L.Batu menjadi universitas favorit di L.Batu pada tahun 2017 dengan seluruh program studi terakreditas dengan setengah di antaranya berpredikat minimal B. Pada periode sebelumnya, Bukhari telah berhasil mendorong peningkatan kualifikasi pendidikan dosen. Usai pelantikan, Ketua Umum PB Alwashliyah menyampaikan kuliah umum kepada seluruh dosen dan mahasiswa Univa L. Batu. Kuliah Umum dipandu moderator Reza Faisal, MPMat. (a18)

kelapa sawit, terpeleset dan lainnya. Petugas pos kesehatan Kel. Pahang, Khadijah dan Ella mengatakan, penyakit tersebut muncul akibat pasien terlalu lama berinteraksi dengan air. Apalagi genangan itu mengandung kuman dan bibit penyakit karena bercampur dengan lim-

TANJUNGBALAI (Waspada): Ketua KPU RI Husni Kamil Manik SP meresmikan pemakaian gedung KPU Tanjungbalai dan Batubarar, Sabtu (23/2). Peresmian gedung ditandai dengan penandatangan prasasti oleh Husni Kamil Manik SP dan Ketua KPU Provsu Irham Buana SH M.Hum, dilanjutkan dengan penggutingan pita oleh Wali Kota Tanjungbalai DR H Thamrin Munthe M.Hum. Hadir Ketua DPRD Tanjungbalai H Romaynoor SE, Wakapolres Kompol Junaidy, Ketua KPU Tanjungbalai Drs Firmansyah, ketua KPU Batubara, Ketua KPU Labura, Ketua KPU Asahan dan Ketua KPU Pakpak Bharat. Ketua KPU Tanjungbalai Drs Firmansyah dalam sambutannya mengatakan, kantor KPU dua lantai berdiri megah itu

� Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109.

Ketua PB Alwashliyah Lantik Rektor Univa L. Batu

pangempat, Kab. Asahan serta Kec. Datukbandar dan Datukbandar Timur Kota Tanjungbalai mengeluhkan sakit. Umumnya pasien mengalami penyakit kulit seperti gatalgatal dan kutu air, kemudian diare, batuk, demam, serta masuk angin. Ada pula luka-luka ringan seperti terkena paku, duri

Sejumlah Polindes Di Labusel Hanya Bangunan Kosong

� Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385.

Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Waspada/Rasudin Sihotang

DUA warga menggunakan dua ban bekas diikat sebagai alat transportasi utama di tengah genangan banjir, di Kota Tanjungbalai.

Ketua KPU RI Resmikan Gedung KPU T.Balai

KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874.

Harga iklan per mm kolom: Hitam-putih Rp. 13.000,-, berwarna Rp. 36.000,Halaman depan: hitam-putih Rp. 39.000,-, berwarna Rp. 108.000,Ukuran kolom: 40,5 mm. E-mail Iklan:

WASPADA Rabu 27 Februari 2013

mengendarai sepedamotor jenis Beat hitam. Pelaku langsung mengambil dompet korban yang diletakkan di dashboard depan sepedamotornya. Sepintas korban melihat Nopol BK 5847 yang digunakan pelaku. Usai mengambil dompet, pelaku langsung tancap gas. Korban coba berteriak, namun tak satupun warga yang mendengar teriakan korban. Korban coba terus mengejar namun karena kalah cepat, pelaku berhasil kabur ke arah Sigambal. Siang itu juga korban langsung membuat pengaduan ke Polres Labuhanbatu atas peristiwa yang dialaminya. Kapolres L.Batu AKBP Hirbak Wahyu Setiawan Melalui Kasubbag Humas AKP MT Aritonang membenarkan adanya laporan korban ke Mapolres L.Batu. (a18)

Alwasliyah Banyak Berbuat Untuk Batubara Waspada/Rasudin Sihotang

KETUA KPU RI Husni Kamil Manik SP menandatangani prasasti penggunaan gedung KPU Tanjungbalai.

Jasad Nakhoda KM Anugerah Bahari Ditemukan TANJUNGBALAI ( Waspada): Nakhoda Kapal Motor Anugerah Bahari, Alfian, 41, warga Sipori-pori, Desa Kapias Batu Delapan, Kec. Tanjung-

balai, ditemukan telah meninggal dunia mayat di dekat lampu merah, Perairan Asahan, Senin (25/2) Sehari sebelumnya, korban


PETUGAS Basarnas Pos TBA mengevakuasi jenazah nakhoda KM Anugerah Bahari Alfian selanjutnya dibawa ke rumah duka.

dinyatakan hilang dari kapal saat akan berangkat melaut tepatnya di depan Pelabuhan Teluknibung, KotaTanjungbalai. Keluarga korban, Mahidin, 50, menduga korban terjatuh dan terbawa arus deras. “Semalam, waktu kapal mau berangkat, tekong masih ada, tapi tak berapa lama dia langsung menghilang. Dugaan kami terjatuh dari kapal tapi tak ada yang melihat,” tutur Mahidin yang langsung melaporkan kejadian itu ke Basarnas Pos Tanjungbalai-Asahan. Kepala Pos Basarnas Tanjungbalai-Asahan Armei SP dikonfirmasi Waspada membenarkan korban ditemukan sudah tak bernyawa. Dikatakan, pihaknya dibantu nelayan mendapati korban mengambang di koordinat N:03 derajat 01 menit 607detik dan E:099 derajat 57 menit 278 detik. (a32)

INDRAPURA (Waspada): Bupati Batubara H. OK Arya Zulkarnain, SH, MM mengatakan Alwashliyah daerah ini sudah banyak berbuat dalam pembangunan di Kab. Batubara. “Baik pada saat Batubara membangun, maupun pada masa pendirian Kab. Batubara, Alwashliyah banyak memberikan konstribusinya. Saya tahu persis itu,” ujar OK Arya dalam sambutannya saat membuka Rakercab Alwashliyah Kec. Airputih Batubara di aula pertemuan kantor Camat Airputih, Minggu (24/2). Saya berharap, lanjutnya, konstribusi Alwashliyah dalam pembangunan di daerah ini dapat terus ditingkatkan. “Galang terus persatuan dan kesatuan di Batubara ini, sehingga upaya untuk mewujudkan Batubara Sejahtera Berjaya dapat lebih fokus lagi kita lakukan,”

ujar OK Arya. Ketua Panpel Ir. Zainal Abidin dalam laporannya mengatakan, Rakercab ini diikuti 224 peserta dan peninjau. Terdiri atas Majelis, Organ Bagian, Pimpinan Ranting, Dewan Penasehat dan utusan sekolah/madrasah di lingkungan PC Alwashliyah Airputih. Juga dihadiri PD Alwashliyah Batubara dipimpin Ketua Ir. Kusmayadi. Raker berlangsung satu hari penuh. Ketua PC Alwashliyah Airputih Sahril Hasanel Basri mengatakan, Rakercab bertujuan untuk menetapkan program kerja sebagai penjabaran dari program yang diamanahkan Muscab setahun lalu. “Selain itu untuk konsolidasi dan silaturrahim warga Alwashliyah Airputih,” ujar Sahril. (c04)

RDP Komisi D Tak Hasilkan Solusi Untuk UNA ASAHAN(Waspada): Rapat Dengar Pendapat (RDP) Komisi D DPRD Asahan yang sedianya membicarakan tindakan rektor UNA, karena telah melakukan pemecatan kepada sejumlah dekan, Senin (25/2), tidak berhasil membuahkan solusi, dikarenakan rektor Dr. Zuriah Sitorus, MSc tidak datang. Hadir dalam RDP itu Wakil Ketua DPRD Asahan Armen Margolang, Ketua Komisi D, M. Yusuf Manurung dan jajarannya, Koordinator Kopertis Wilayah I Sumut - NAD Prof. Dr. Dian, mantan rektor UNA Prof. Darma Bakti, mantan Pj Rektor Ir Ansoruddin, SekretarisYayasan UNA yang juga Sekdakab Asahan H Sofyan MM, serta para dekan dan sejumlah dosen Fakultas Pertanian UNA.

Pertemuan yang seharusnya dimulai pukul 10.00 itu molor hingga pukul 11.00. Rektor yang seharusnya jadi sosok sentral dalam pertemuan ini tidak hadir. Alasan ketidak hadirannya dikarenakan pergi ke Jakarta untuk mengurus izin prodi. Pihak dekan dan senat UNA melalui Kusmayadi menyangkal alasan rektor yang tidak logis. Karena izin prodi itu dapat dilakukan melalui sistem online. Sementara itu Wakil Ketua DPRD Asahan Armen Margolang mengatakan, dia tidak punya kepentingan pribadi maupun pesanan. “Kita hanya memfasilitasi, akan ada forum lanjutan di tingkat yayasan. Kami di depan untuk menyelesaikan masalah UNA,” kata Armen. (c05)

Sumatera Utara

WASPADA Rabu 27 Februari 2013


Kerugian Banjir Madina Rp35 M PANYABUNGAN (Waspada): Kerugian akibat banjir bandang melanda 17 desa di Kec. Panyabungan dan Nagajuang, Kab. Mandailing Natal, diperkirakan Rp35 miliar lebih. Selain mengakibatkan korban jiwa, banjir yang terjadi Rabu (13/2) dan Kamis (14/2) lalu, juga merusak harta benda, prasarana dan sarana sektor perekonomian masyarakat,

infrastruktur dan lainnya. Kepala Badan Penanggulangan Bencana Daerah (BPBD) Madina Risfan Juliardi Hutasuhut ketika dihubungi di Panyabungan, Selasa (26/2), menga-

MPC PP Madina Bantu Korban Banjir Bandang PANYABUNGAN (Waspada): MPC PP Kabupaten Mandailing Natal (Madina), Sabtu (23/2) memberikan bantuan untuk korban banjir bandang di beberapa desa di Kec. Panyabungan. Bantuan berupa semen 60 sak dan 50 kardus air mineral, serta bahan makanan tambahan lainnya diserahkan untuk desa terkena banjir antara lain Desa Manyabar, Pagarantonga, Sabajambu, Gunungmanaon, Gunungtua Jae, dan Sopobatu. Demikian disampaikan Ketua MPC PP Madina, Syahriwan/ Kocu didampingi wakil Tan Gozali, dan wakil sekretaris Roni PS kepada Waspada di Kantor MPC PP Madina JalanWillem Iskandar, Aek Galoga, Panyabungan, Selasa (26/2). Dijelaskan, bantuan tersebut sebagai bentuk kepedulian PP Madina untuk meringankan beban masyarakat tertimpa musibah. MPC PP Madina berharap bantuan yang diberikan bisa dimanfaatkan warga dengan sebaik-baiknya untuk kepentingan umum. Sebelumnya, selain melakukan turun ke jalan menggalang dana, MPC PP Madina juga turun ke lokasi banjir untuk gotongroyong membantu warga membersihkan pemukiman penuh lumpur dan kayu. (c14)

Waspada/Sarmin Harahap

KETUA MPC PP Madina saat menyerahkan bantuan secara simbolis kepada salah satu desa korban banjir bandang di Desa Manyabar.

Bupati Simalungun Prihatin SDM PNS SIMALUNGUN (Waspada): Bupati Simalungun JR Saragih prihatin masih banyak pejabat di jajaran Pemkab Simalungun yang tidak mendukung peningkatan karier dan kualitas sumber daya manusia (SDM) staf atau bawahannya. Menurutnya, masih banyak pegawai negeri sipil (PNS) di jajaran Pemkab Simalungun yang hanya tamatan SMP dan SMA, namun karena dibiarkan oleh pimpinannya tidak berkeinginan untuk melanjutkan sekolah sehingga kariernya juga tidak bisa meningkat. “Masih banyak PNS di jajaran Pemkab Simalungun yang hanya tamatan SMP atau SMA, padahal sudah mengabdi cukup lama dan tidak pernah didorong oleh pimpinannya untuk melanjutkan sekolah,” papar JR pada acara kuliah perdana Universitas Efarina (Unefa) di Griya Hapoltakan, Pamatang Raya, Senin (25/2). Karenanya JR berharap dengan kehadiran Unefa, para pimpinan satuan kerja perangkat daerah (SKPD) atau pejabat eselon III dan IV mendorong staf atau bawahannya untuk meningkatkan pendidikan hingga perguruan tinggi, sehingga kariernya bisa meningkat. Dia juga menambahkan kesadaran masyarakat Kab. Simalungun untuk menyekolahkan anaknya hingga bangku perguruan tinggi (PT) saat ini juga masih rendah, karena belum memahami pentingnya pendidikan tinggi untuk mengentaskan kemiskinan. Menurut Bupati Simalungun JR Saragih, masih banyak masyarakat yang menganggap pendidikan belum mampu menjamin masa depan anak-anaknya, sehingga jika sudah bisa membaca dan menulis sudah cukup. Sebelumnya KetuaYayasan Efarina, Adrian Tarigan didampingi Rektor Unefa, Erika Revida Saragih mengatakan, saat ini pihaknya masih mengelola empat fakultas yaitu ilmu pendidikan, teknik, kesehatandanekonomi.Diamenambahkanmeskibarudibukanamun saat ini Unefa sudah memiliki sekira 400 mahasiswa yang berasal dari sejumlah daerah di Sumatera Utara, bahkan Riau. (a29)


PESERTA rapat umum pemegang saham (RUPS) PT.Horas Insani Abadi (HIA).

RUPS PT.Horas Insani Abadi P. Siantar Berlangsung Sukses PEMATANGSIANTAR (Waspada): Rapat Umum Pemegang Saham (RUPS) PT Horas Insani Abadi (HIA) Pematangsiantar Tahun 2012 yang dihadiri 20 pemilik saham di Hotel Sapadia kota itu, Sabtu (23/2) berlangsung lancar dan sukses. Staf Humas PT HIA Gold Very Sihombing kepada Waspada, Selasa (26/2) di Pematangsiantar mengatakan, acara RUPS itu diawali dengan penyampaian laporan pertanggungjawaban Direksi Dr. Petrus Yusuf dan jajaran komisaris tahun kerja 2012, laporan keuangan serta kegiatan perusahaan dalam setahun penuh, selanjutnya penyampaian Rencana Anggaran Pendapatan Belanja Perusahaan PT HIA tahun 2013. Jajaran pengurus dan pemilik saham PT HIA dikatakan menerima Pertanggungjawaban dan operasional perusahaan tahun 2012, sekaligus pemilik saham memberi pembebasan dan tanggungjawab (acquit et decharge) kepada direktur dan komisaris. Acara dirangkaikan dengan pemilihan direktur dan komisaris PT HIA masa bakti 2013-2018. Terpilih sebagai Direktur Dr. Petrus Yusuf, Komisaris Utama Ir. Alimin Sipayung, anggota Komisaris Dra. Maphilindo Saragih dan Stefanus Oscar, mereka bekerja terhitung sejak tanggal 27 Februari 2013. Kegiatan dipimpin Dr. Petrus Yusuf. (crap)

takan, data jumlah kerugian yang lengkap masih ditunggu dari masing-masing instansi terkait. Jumlah kerugian nantinya akan difinalkan sekaligus dilaporkan ke Pemkab Madina. “Kerugian akibat banjir di Nagajuang dan Panyabungan yang terjadi bulan ini cukup besar, karena merusak ratusan rumah penduduk, sarana ibadah, sarana pemerintahan, pendidikan, pertanian dan ternak, perikanan serta ke-PU-an,” katanya. Menurutnya, bencana banjir terjadi di Kec. Naga Juang pada Rabu (13/2) melanda tujuh desa yakni Tambiski, Sayurmatua, Banua Rakyat, Humbang 1, Tarutung Panjang, Tambiski Nauli dan Banua Simanosor, mengakibatkan 953

kepala keluarga (KK) atau 4.176 jiwa mengungsi. Meski banjir di sana tidak merusak rumah penduduk, namun luapan Sungai (Aek) Gajah yang diakibatkan tingginya curah hujan, telah menyebabkan tiga warga Desa Tambiski meninggal dunia karena hanyut terbawa arus deras yakni Hannum Siregar, 40, M. Yusuf, 11, dan Geo, 5. Sementara banjir bandang di Kec. Panyabungan Kamis (14/ 2) diakibatkan luapan Sungai (Aek) Rantopuran. Akibat banjir tersebut telah menyebabkan sepuluh desa yakni Sopobatu, Lumbanpasir, Gunungtua Jae, Gunungtua Tonga, Gunungtua Julu, Gunungmanaon, Pangarantonga, Sabajambu, Manya-

bar dan Manyabar Jae, diterjang banjir sehingga membuat warga panik dan mengungsi. “Meski tidak ada korban jiwa, banjir melanda sepuluh desa di Kecamatan Panyabungan, telah menyebabkan 141 rumah penduduk rusak berat dan 267 rumah lainnya rusak ringan, kemudian 980 KK atau 3.841 jiwa penduduk mengungsi,” terangnya. Risfan didampingi Zulkhairi Pulungan (Koordinator Posko Utama) menjelaskan, tindakan darurat yang dilakukan Pemkab Madina dalam penanganan banjir melanda kedua kecamatan itu yaitu penetapan status darurat bencana banjir bandang 14 hari atau terhitung mulai 14 sampai Rabu (27/2) hari ini. (a28)

Mobil Dan Sepedamotor Plat BA ‘Menjamur’ Di Madina PANYABUNGAN (Waspada): Aparat terkait diminta segera menertibkan mobil dan sepedamotor menggunakan plat BA (Sumatera Barat) di wilayah Kab. Mandailing Natal (Madina). “Sebab, ‘menjamurnya’ kendaraan bermotor plat BA di wilayah ini sangat merugikan Pemkab Madina. Permintaan itu disampaikan DPD Organda Sumut melalui Wakil Ketuanya H. Ikhwan Efendi Lubis kepada Waspada, Senin (25/2) di Panyabungan. Menurutnya, keberadaan mobil plat BA di Madina sudah sangat ‘menjamur’. Menurutnya, hampir 25 persen warga Madina sekarang menggunakan mobil atau sepedamotor berplat BA. “Anehnya, hal ini bukan saja dilakukan masyarakat biasa, tapi juga beberapa oknum pejabat di Madina bahkan anggota DPRD menggunakan mobil plat BA menjadi kendaraan pribadi.

Seharusnya mereka ini jadi contoh kepada masyarakat, tapi justru sebaliknya mereka ikutikutan,” ujarnya Dikatakan, memang tidak bisa dibantah, secara geografis Madina sangat dekat dengan Sumatera Barat, tapi bukan berarti orang Madina diperbolehkan mengggunakan mobil plat BA, apalagi mobil tersebut untuk dipakai sendiri. Anehnya lagi, banyak para rekanan/kontraktor di Madina yang menggunakan plat mobil BA, tapi mereka menggerjakan dan mengharapkan proyek dari Pemkab Madina. Menurut dia, hampir 25 persen warga Madina menggunakan kendaraan bermotor berplat BA, terutama di daerah Muarasipongi, Kotanopan, Pakantan, Ulu Pungkut, Natal, Linggabayu dan daerah lainnya. “Ini, samasaja mereka tidak mau membayar pajak ke Pemkab Madina, padahal mereka

lahir, hidup dan besar di Madina. Berapa besar kerugiaan yang dialami Pemkab Madina karena pajak kendaraan mereka beralih ke Provinsi Sumatera Barat,” katanya. Dikatakan, bukan berarti masyarakat tidak diperbolehkan membeli kendaraan ke Sumatera Barat, tapi begitu kendaraan bermotor sudah dibeli, seharusnya platnya dimutasi dari BA ke BB. Sedangkan Amarullah , 45, salah seorang warga Muarasipongi yang menggunakan mobil plat BA yang dijumpai mengatakan, sangat sulit melarang wargaMadinauntuktidakmemakai plat mobil BA. Selain karena georafis yang berdekatan dengan Sumatera Barat, juga harga kendaraan di Sumatera Barat lebih murah, begitu juga dengan pengurusan surat-surat. Bayangkan saja,perbedaanhargasepedamotor saja dengan Madina bisa berbeda antara Rp1 -Rp2 juta. (c15)

Tiga Desa Di Dairi Terisolasi Akibat Banjir Dan Longsor SIDIKALANG (Waspada): Pasca bencana alam yang melanda Kec. Tanah Pinem, Dairi 8 Februari 2013, hingga kini tiga desa di daerah itu masih terisolasi karena akses jalan ke semua penjuru putus total dihantam banjir bandang dan tanah longsor. Akibatnya, warga kewalahan memasarkan hasil bumi dan mendatangkan kebutuhan sehari-hari. Ketiga desa tersebut yakni Desa Alur Subur, Magan Molih dan Desa Kutagambir berbatasan dengan kawasan Aceh Tenggara dan Tanah Karo. Semua akses jalan terputus akibat bencana banjir bandang dan tanah longsor saat daerah itu diguyur hujan berkepanjangan. Santun Sembiring, 57, warga Desa Alur Subur kepada Waspada, Senin (25/2) di Desa Pasir Tengah mengatakan, kondisi warga desa yang terisolasi pasca bencana itu cukup mempri-

hatinkan. Sebab hasil bumi seperti jagung tidak dapat dipasarkan termasuk untuk mendatangkan kebutuhan sehari-hari. Dikatakan, panen raya tanaman jagung di Desa Liang Jering dan Laujuhar berlangsung saat bencana terjadi. Namun biji jagung sulit dipasarkan. Sebagian warga terpaksa memikul sendiri dengan menyelusuri jalan naik turun sekira 3 Km menuju Desa Pasir Tengah. Padahal setiap rumah tangga memiliki hasil panen jagung paling sedikit 3 ton. Di samping hasil bumi yang sulit dipasarkan, harga kebutuhan sehari hari seperti gula pasir dan minyak goreng meroket di desa itu. Karena memang pedagang di desa itu sangat susah mendatangkan kebutuhan sehari-hari dari pekan Laubalang, Tanah Karo. Pedagang hanya dapat menggunakan sepedamotor dengan muatan sangat

terbatas. Harga gula pasir dari Rp14.000 menjadi Rp17.000 per kg. Begitu juga minyak goreng naik dari Rp13.000 menjadi Rp16.000 per kg. Camat Tanag Pinem, Drs. Robert Ginting dikonfirmasi melalui sambungan telepon mengakui, ketiga desa itu masih terisolasi pasca bencana tersebut. Alat berat milik Pemkab kini masih kerja keras di lapangan membuka jalan alternatif. Kepala Dinas PU Bina Marga, Hotmaida Butarbutar kepada Waspada, Selasa (26/2) mengatakan, dua jembatan menuju ketiga desa itu hancur diterjang banjir bandang. Begitu juga badan jalan bertebing amblas ke jurang 30 meter. Lambannya jalan itu diperbaiki, karena satu unit alat berat, terperosok ke lumpur saat membuka jalan alternatif. “Alat berat tertanam lumpur,” ujarnya. (a20)

35 Siswa Berprestasi Perguruan Bersama Studi Banding Ke LN BERASTAGI (Waspada): 35 Siswa SMP dan SMA berprestasi Perguruan Bersama Berastagi mengadakan studi banding ke luar negeri (LN) 17- 22 Februari 2013. Demikian Ketua Yayasan Bersama Sembiring kepada Waspada di Berastagi, Sabtu (23/2). Studi banding dilakukan ke tiga negara ASEAN yakni, Singapore, Malaysia dan Thailand. Menurut Bersama Sembiring, selain 35 siswa, dalam rombongan ini juga diikutsertakan 33 guru dan dua pengawas sekolah pendidikan menengah dari Dinas Pendidikan Kabupaten Karo sebagai pendamping, sehingga total rombongan

70 orang. Sedangkan biaya perjalanan dan penginapan, katanya seluruhnya ditanggung pihak yayasan sebagai wujud kepedulian sekaligus memberi reward kepada siswa berprestasi. Sedangkan bagi guru, ungkapnya, agar dapat lebih termotivasi melaksanakan transfer ilmu guna mencerdaskan anak bangsa khususnya di perguruan Bersama Berastagi. Bersama Sembiring yang merupakan mantan anggota DPRD Karo ini mengatakan, tujuan utama studi banding ke luar negeri ini untuk melihat kemajuan dan pembangunan

dilakukan negara maju terutama dalam bidang pendidikan, pariwisata, budaya dan lain sebagainya sehingga baik siswa maupun guru dapat mempelajarinya sekaligus membandingkannya dengan pembangunan yang ada di negara kita dewasa ini. Kepala Dinas Pendidikan Kabupaten Karo Drs.Sastra Tarigan, M.Pd melepas studi banding Perguruan Bersama Berastagi ke tiga negara. Sastra Tarigan mengimbau agar hasil studi banding, termasuk dalam hal kebersihan, dapat diimplentasikan siswa dan guru dalam kehidupan nyata. (c10)


ROMBONGAN studi banding guru dan siswa Perguruan Bersama Berastagi saat melakukan foto bersama di depan istana negara Malaysia di Kuala Lumpur.

Waspada/Alpin Lubis

ANGGOTA DPRD Madina dari Dapem II berfoto bersama dengan Kepala Desa/Sekdes usai melaksanakan reses di aula Kantor Camat Kotanopan, Kab. Mandailing Natal.

Masalah Infrastruktur Mencuat Saat Reses DPRD Madina PANYABUNGAN (Waspada): Masalah infrastruktur jalan ke desa-desa tertinggal dan pembangunan irigasi di Kec. Kotanopan mencuat ke permukaan saat Reses I anggota DPRD Madina di aula Kantor Camat Kotanopan, Senin (25/2). Reses kali ini hanya dihadiri dua anggota DPRD, yaitu M. Rizky Daulay dan Syamsul Anwar Lubis, SH dari enam anggota DPRD yang berasal dari dapem II. Turut hadir dalam acara ini Plt. Camat Kotanopan H. Suyono, S.Sos, Kepala Desa dan Sekdes se-Kotanopan ditambah tokoh masyarakat. Dalam kesempatan itu, rata-rata keluhan masyarakat mengenai minimnya perhatian pemerintah terhadap perbaikan jalan dan irigasi di daerah ini. Seperti diutarakan Kepala Desa Batahan, Samuel. Mereka berharap agar Pemkab Madina segera memperbaiki jalan ke desa mereka. Sebab,jalansekira9KmdariPagarGunungsampai saat ini belum bisa di lalui kendaraan. Sedangkan Kepala Desa Hutarimbaru M. Yakup kepada anggota DPRD mengeluhkan tidak dibangunnya titi gantung yang ada di desa tersebut. Kondisi titi gantung ini sebenarnya tidak layak untuk dilewati dan keberadaannya sangat urgen bagi warga disebabkan dipergunakan lima desa di seberang sungai Batang Gadis. Kemudian jalan desa ke Paya Ombur agar

segera di tingkatkan. Sama halnya dengan desa Muara Potan, pewakilan masyarakat, Akhiruddin mengharapkan jalan ke desa mereka segera ditingkatkan menjadi aspal. Selama ini jalan masih terbuat dari tanah. Warga juga berharap agar material longsor di sepanjang jalan Aek Marian Simandolam segera diangkat karena sangat menganggu pengguna jalan. Kepala Desa Muara Pungkut Zulkarnain, mengeluhkan irigasi Aek Karlan 50 meter agar segera diperbaiki. Begitu juga titi gantung perlu dibangun di desa ini untuk mempermudah akses warga ke seberang Sungai Batang Gadis. Kepala Desa Patialo Parlaungan, juga mengeluhkan jalan ke desa mereka yang sampai saat ini tidak kunjung selesai. Usai mendengarkan keluhan warga, anggota DPRD Madina M. Rizky Daulay menjawab satu per satu keluhan warga. Dikatakan, terkait jalan ke Desa Batahan, saat ini menjadi proritas untuk memperjuangkan anggarannya. Begitu juga untuk pemeliharaan titi gantung Hutarimbaru sudah diplot dananya di tahun 2013 senilai Rp300 juta. Sedangkan masalah material longsor di jalan Aek Marian dan pembangunan jalan ke desa ini akan dikordinasikan dengan PUD Madina, begitu juga dengan usulan lainnya. (c15)

3 Tersangka Penggelembungan Dana BBM Di P. Siantar PEMATANGSIANTAR (Waspada): Tiga pejabat dan mantan pejabat ditetapkan menjadi tersangka kasus dugaan penggelembungan dana bahan bakar minyak (BBM) 207 di Dinas Kebersihan Pematangsiantar. Tiga tersangka ini yakni mantan Kepala Dinas Kebersihan Pematangsiantar Drs. JS, mantan bendahara Dinas Kebersihan M, S.Sos dan Kepala Sub.Dinas Kebersihan RM. Kepala Kejaksaan Negeri Pematangsiantar, Rudi H. Pamenan, SH melalui Kepala Seksi Pidana Khusus (Kasi Pidsus) Kejaksaan Negeri (Kejari) Pematangsiantar, Muharrom, SH, MH kepada Waspada, Selasa (26/2) mengatakan, dua di antara ketiga terdakwa yaitu M, S.Sos dan RM, Senin (25/2) sore datang memenuhi panggilan kejaksaan, langsung diantar oleh tim Kejari Pematangsiantar yang terdiri dari Herry Santoso, SH, Rizaldi, SH, Siti M. Manulang, SH dan dipimpin Muharrom, SH ke LP kelas II.A. Pematangsiantar di Jalan Asahan Simalungun. “Ke dua terdakwa itu ditempatkan di rua-

ngan 09 Ambarita, yaitu ruangan khusus tindak pidana korupsi selama 20 hari dan jika diperlukan waktunya bisa ditambah,” sebut Muharrom. Sedangkan mantan Kadis Kebersihan Drs. JS belum datang memenuhi panggilan Kejari. Dia melayangkan surat keterangan sakit dikeluarkan Rumah Sakit Umum Daerah (RSUD) H. Abdul Manan Simatupang Kisaran ditandatangani dr. Eka Wildasari. “Surat keterangan sakit itu hanya berlaku tiga hari sejak 25 Februari 2013, dan setelah itu kami akan panggil kembali untuk diperiksa sebagai tersangka,” kata Muharrom. Mantan Kepala Dinas Kebersihan dan mantan Bendahara Dinas Kebersihn serta Kepala Sub Dinas Kebersihan tersebut, didakwa pada 2007 diduga telah melakukan mark up dana anggaran operasional BBM untuk kendaraan truk pengangkut sampah milik Dinas Kebersihan. Total dana yang diduga telah digelembungkan ketiga tersangka Rp657.677.000. (crap)

DPRD Karo Desak Pemkab Hentikan Aktivitas PT. WEP KABANJAHE (Waspada): Tim Verifikasi DPRD Karo mendesak Pemkab Karo untuk menghentikan segala aktivitas PT.Wampu Electric Power (WEP) yang mengelola Pembangkit Listrik Tenaga Air (PLTA) di Desa Rih Tengah Kec. Kutabuluh, Kab. Karo. “Ada banyak izin yang belum diterbitkan. Namun, PT. WEP sudah terus beroperasi dan menjalankan aktivitasnya sampai sekarang,” ujar Ketua Tim Verifikasi DPRD Karo, Effendi Sinukaban kepada Waspada, di ruang kerjanya, Senin (25/2). Tim Verifikasi DPRD Karo dibentuk September 2012 lalu beranggotakan tiga pimpinan DPRD Karo, yaitu Ketua Effendi Sinukaban,Wakil KetuaFeriantaPurbadanOnasisSitepu.Kemudian, Ketua Komisi A Frans Dante Ginting, Ketua Komisi B, Edi Ulina serta anggota Masdin DT Ginting, Sentosa Sinulingga dan Thomas Sitepu. Effendi mengatakan, ada sepuluh izin yang belum dimiliki PT WEP, yaitu izin gangguan usaha PLTA dan jaringan transmisi. Perusahaan ini juga belum memiliki Izin Mendirikan Bangunan (IMB) DAM, sand trap, water way, haed tank, penstock, tail race, swicthyard dan IMB pendirian menara jaringan transmisi.

“Pada 2012 lalu, kami sudah memanggil PT. WEP. Mereka berjanji akan memenuhi dan melengkapi perizinannya. Nyatanya, sampai sekarang janji tersebut tidak terlaksana dan aktifitas terus dilakukan,” katanya. DPRD Karo mendukung sepenuhnya ada perusahaan besar yang melakukan penanaman modal di daerah ini. Namun, mereka meminta segala kebijakan dan proses pelaksanaannya harus sesuai dengan mekanisme dan peraturan yang berlaku. Politisi PDI Perjuangan ini menambahkan, ia berharap Pemkab Karo tidak mengulangi kesalahan yang sama, seperti yang terjadi pada PT. Merek Indah Lestari (MIL), Pabrik Kelapa Sawit di Desa Lau Pakam, Kec. Mardinding dan sejumlah minimarket yang ada di Karo. “Jika kali ini Pemkab tidak mengambil ketegasan, kami akan mengambil langkah-langkah yang sesuai dengan hak yang berlaku,” tukasnya. Kepala Kantor Pelayanan Perizinan Terpadu Kabupaten Karo, Ngaku Ramos Perangin-Angin, saat dikonfirmasi mengenai hal ini, mengaku akan melayangkan surat kepada PT.WEP untuk segera menghentikan aktifitasnya sebelum semua izin diterbitkan. (a36)

1.422 Personel Amankan Pilgubsu Di Humbahas HUMBAHAS (Waspada): 1.422 Personel gabungan, siap mengamankan Pemilihan Gubernur dan Wakil Gubernur Sumatera Utara (Pilgubsu) 7 Maret 2013 di Kab. Humbang Hasundutan (Humbahas). “Ke-1422 personel itu terdiri dari 238 personel Polri, 30 personel TNI dan 1.154 personel Linmas Kab. Humbahas,” ujar Kapolres Humbahas AKBP Heri Sulismono SIK saat ditemui wartawan di Mapolres, baru-baru ini. Heri menambahkan, untuk memastikan kesiapan personel pengamanan Pilgubsu, pihaknya sudah melakukan gelar pasukan Operasi Mantap Praja Toba 2013 di Lapangan Mapolres Humbahas, Desa Tapian Nauli, Kec. Lintong Nihuta, Kab. Humbahas. Dikatakan, operasi mantap praja dimaksudkan untuk mengawasi potensi kerawanan pada setiap tahapan Pilgubsu, termasuk mengantisi-

pasi isu negatif yang bersifat provokatif, politik uang dan ganguan keamanan terhadap logistik Pilgubsua. Lebih lanjut, Heri mengatakan, sesuai instruksi Kapolda Sumut Irjend PolWisjnu Amat Sastro, Operasi Mantap Praja Toba akan digelar selama 119 hari terhitung 18 Februari sampai dengan 16 Juni 2013. Dalam amanatnya, Kapolda juga meminta, agar seluruh anggota yang terlibat dalam pengamanan Pilgubsu, supaya memahami, menguasai, dan mengajak masyarakat untuk menciptakan situasi kondusif. Mantan personel Brimob itu menyampaikan kepada seluruh personel Polres Humbahas dalam pesta demokrasi 7 Maret 2013 agar netral. “Seluruh Personel Polres Humbahas agar netral dalam Pilgubsu mendatang. Jangan menjadi tim sukses salahsatu calon walaupun itu keluarga kita,” katanya. (a21)

Pentas Pilkada

B4 Pilih ESJA Untuk Kemajuan Pertanian Sumut MEDA (Waspada):Wakil Sekjen DPN HKTI (Dewan Pimpinan Nasional - Himpunan Kerukunan Tani Indonesia) Baltasar Tarigan, SE menilai, satu-satunya pasangan Cagubsu/Cawagubsu yang diyakini akan memberi perhatian kepada ekonomi kerakyatan adalah duet Effendi Simbolon dan Jumiran Abdi (ESJA). Menurut Baltasar (foto), ada dua alasan utama, mengapa dia meyakini hal tersebut, yaitu pertama, faktor PDI Perjuangan yang memang menjadikan ekonomi kerakyatan sebagai salah satu prioritas dengan membentuk BPEK (Badan Pemberdayaan Ekonomi Kerakyatan) DPP PDI Perjuangan. Kedua adalah faktor kandidat, yang memang diketahuinya memberi perhatian penuh pada masalah ini. “Jadi ada semacam amanah dari PDI Perjuangan, bahwa siapa pun dia, baik sebagai kepala daerah maupun wakil rakyat, haruslah tetap memasukkan ekonomi kerakyatan sebagai salah satu program prioritas dalam pengabdian ke masyarakat. Dan sebagai kader yang dikenal loyal, saya kira Effendi Simbolon sangat paham akan hal itu,” katanya saat berbincang dengan wartawan di Medan, Selasa (26/2). “Lalu tentu saja faktor dari diri Effendi Simbolon sendiri, dibantu sosok Jumiran Abdi, yang saya yakini sangat mementingkan ekonomi

kerakyatan, khususnya menyangkut pertanian, nelayan, dan sejenisnya. Dalam berbagai kesempatan, saya sudah melihat, bagaimana Effendi Simbolon, dalam kiprahnya sebagai anggota DPR RI, selalu mementingkan hal-hal bersentuhan dengan rakyat,” sambung Wakil Ketua BPEK PDI Perjuangan ini. Untuk itulah dia mengajak kepada seluruh penggiat maupun pelaku pemberdayaan ekonomi kerakyatan, khususnya sektor pertanian dan perkebunan untuk memilih sosok yang sudah pasti akan memajukan sektor-sektor pertanian, nelayan, dan sejenisnya. “Saya yakin, dengan dasar yang saya sebutkan di atas, apabila nanti Sumatera Utara dipimpin oleh Effendi simbolon dan Jumiran Abdi,. Imbauan dan ajakan memilih Effendi Simbolon - Jumiran Abdi juga disampaikan Baltasar Tarigan ke komunitas Karo yang kebetulan memang mayoritas berbasis pada agrobisnis. “Kebetulan pula di daerah asal saya, mayoritas ekonominya berbasis pada agrobisnis. Maka makin tepatlah kalau kita memilih seorang kepala daerah yang punya kemampuan, dan terutama tentunya, kemauan untuk itu,” ujar Sekum PP BKS PGI (Pengurus Pusat - Badan Kerja Sama Persekutuan Gereja-Gereja di Indonesia) ini.(m14)

Armada Gema GusMan Dan Gardu Prabowo Bantu Penambang Pasir RANTAUPRAPAT (Waspada): Armada Generasi Muda GusMan dan Gardu Prabowo memberi bantuan alat penambang pasir tradisional berupa sekop kepada 320 penambang pasir yang beroperasi di empat wilayah di sepanjang aliran Sungai Bilah Rantauprapat, Sabtu (23/2). Keempat wilayah tersebut, yakni Sibuaya 150 penambang, Paindoan 80 penambang, Titi Sungai Bilah 40 penambang dan 50 penambang di Urung Kompas. Ketua Armada Generasi Muda GusMan, Indramono (Incun) didampingi Bendahara T. Jefri Sani mengatakan, pemberian bantuan ini merupakan ciri-ciri daerah L.Batu yang kepeduliannya sosialnya sangat tinggi. “Bantuan yang diberikan kali ini berupa skop sebanyak 320 buah.’’ Ketua Gardu Prabwo L.Batu Drs Lilianto Hasibuan mengatakan, sebagai bentuk kepedulian sosial terhadap warga pinggiran Sungai Bilah, yang selama ini t melestarikan dan menjaga ekosistem sungai dan peduli dengan lingkungan, yang selama sebagai buruh tambang pasir tradisional. Selain itu merupakan program sosial bagi masyarakat dan bertujuan mensejahterakan masyarakat sekitar.

Di samping itu, menjelang Pilgubsu 7 Maret mendatang, warga L.Batu diminta untuk turut memberikan pencerahan kepada warga lainnya agar bisa memilih pemimpin yang tepat dan tidak tertipu,” ujar Lilianto Hasibuan didampingiWakil Ketua Gardu Prabwo Raja Syahdan Dalimunthe, Bendahara Hasnah Putri Jaya SIregar dan Ketua OKK Gardu Prabowo Mahyar M. Bendahara Gardu Prabowo Hasnah Putri Jaya Siregar mengatakan, maju mundurnya suatu bangsa tergantung kepada pemimpinnya. ‘’Karena itu, jika pada 7 Maret mendatang rakyat salah memilih Gubernur dan Wakil Gubernur, maka Sumut akan mengalami kehancuran, maka dari itu kita pandang ke depan, kita butuh orang yang kuat dan perbuatan yang nyata untuk mensejahterakan masyarakat,” ujarnya. Perwakilan penambang pasir di Lingkungan Paindoan Irwan Hanafi Siregar mengatakan mereka tidak melihat besar-kecilnya sumbangan. Namun, per hatian ini memunculkan kebersamaan dan solidaritas diharapkan Armada Generasi Muda GusMan dan Gardu Prabowo memberikan solusi terhadap masalah-masalah yang dihadapi warga L.Batu ini ke depan,” ujarnya. (a18)

WASPADA Rabu 27 Februari 2013

Tengku Erry Kunjungi Panti Asuhan Darul Aitam MEDAN (Waspada): Cawagubsu nomor urut 5 Tengku Erry Nuradi berkunjung ke Panti Asuhan Yatim Piatu Aceh Sepakat, Yayasan Darul Aita, Jl. Medan Area Selatan, Minggu (24/2). Pasangan GanTeng ini sengaja datang pada tengah malam sekitar pukul 22.00 WIB untuk mengetahui seperti apa kehidupan anak yatim piatu di lokasi asrama. Tanpa pemberitahuan sebelumnya, mobil Tengku Erry langsung masuk ke halaman panti. Kemudian Tengku Erry turun dan melangkah ke arah meja dan beberapa kursi sederhana yang tersusun rapi sebagai pos penerima tamu. Detik berikutnya, pria tak banyak bicara itu menatap deretan pintu kamar asrama yang terkunci rapat. Sebagian teras kamar terlihat redup. Seorang lelaki tiba-tiba muncul karena mendengar banyak suara di luar. Ia adalah Ustadz Herry, salah seorang pengajar di Panti Asuhan Yatim Piatu Aceh Sepakat, Yayasan Darul Aitam. Saat melihat kehadiran Tengku Erry, Ustadz Herry langsung mengulurkan tangan. Seorang pengelola lain kemudian memanggil sejumlah anak panti asuhan dari kamar masing-masing untuk berkenalan dengan

Tengku Erry. Dalam pertemuan tengah malam itu, Tengku Erry berdialog ringan dengan penghuni panti. Sesekali Tengku Erry meminta seorang anak melafazkan surah pendek seperti doa makan, doa sebelum tidur dan beberapa doa yang lazim dibaca sehari-harinya. “Belajartekunya.Manfaatkan waktu yang ada sebaik mungkin. Dimata Allah, lebih mulia orang yang memiliki ilmu dibanding orang berharta banyak,” sebut Erry memberi semangat. Tengku Erry juga menyebutkan, pasangan GanTeng akan melakukan terobosan baru dalam pengelolaan panti asuhan

di Sumut. Salah satunya mengutamakan pendidikan gratis bagi anak penghuni panti asuhan. “Dalam program pendidikan gratis nantinya, anak panti asuhan dan yayasan sosial, akan mendapat prioritas. Pendidikan kaum tidak mampu harus menjadi tanggungjawab pemerintah,” sebut Erry. Sementara Ustadz Herry mengaku, jumlah anak yatim dan anak piatu yang ditampung di Panti Asuhan Yatim Piatu Aceh Sepakat, Yayasan Darul Aitam sebanyak 100 lebih. Sebagian besar warga Medan, sedang sisanya berasal dari luar daerah. “Ada yang dititipkan keluarganya. Ada juga yang diajak ke

Waspada/Surya Efendi

TENGKU Erry Nuradi memberi sejumlah pertanyaan untuk dijawab anak-anak Panti Asuhan Darul Aitam Jl. Medan Area Selatan, Minggu (24/2) malam.

Mahasiswa Harus Jadi Pemilih Cerdas MEDAN (Waspada): Pemilihan gubernur Sumatera Utara 7 Maret tinggal menghitung hari. Mahasiswa diimbau agar objektif dan menjadi pemilih cerdas dalam menentukan calon gubernurnya. Demikian dikatakan anggota DPD asal pemilihan Sumatera Utara Parlindungan Purba menjawab pertanyaan mahasiswa di acara Workshop on Journalism MedanBagus.Com bekerjasama dengan Teguh School of Democracy di Gedung LPPM USU Medan, Sabtu (23/2). “Memilih calon gubernur itu bukan karena agamanya, sukunya apalagi uangnya, tetapi karena integritas dan kapabilitas

sang calon. Ingat, kalau kita salah menentukan pilihan, maka akan menyesal lima tahun ke depan,” ujar dia. Parlindungan memberikan tips pada mahasiswa agar tak ragu apalagi susah menentukan calon gubernur yang bakal dipilih. Dia berharap mahasiswa tidak memilih cagub karena uang, tapi pilihlah sesuai hati nurani dan objektivitas. “Kalau mau pilih, ya pilihlah sosok yang sederhana dan yang menjadi dirinya sendiri. Bukan cagub yang mengandalkan politik pencitraan. Kita lihat, garagara Jokowi yang suka blusukan akhirnya SBY pun ikut blusukan. Itu pula yang banyak ditiru

para calon gubernur sekarang ini,” sindir Parlindungan. Sementara Direktur Teguh School of Democracy Teguh Santosa yang berbicara soal Media dan Konstruksi Sebuah Bangsa, menilai saat ini media tak hanya dimiliki satu pihak saja, tapi media kini sudah dimiliki seluruh lapisan masyarakat. Masyarakat, ujar Dosen London School of Public Relations itu, dapat berpartisipasi memberi sumbangsih pemikiran di media terhadap sebuah masalah yang terjadi di tengah-tengah masyarakat. Peran mahasiswa, kata Teguh.(m27)

panti karena tidak memiliki kedua orangtua lagi,” sebut Herry. Herry menjelaskan, anak yatim dan piatu yang ditampung mendapat pendidikan disejumlah sekolah tidak jauh dari panti asuhan. Biaya pendi-

dikan ditanggung oleh yayasan. “Pihak yayasan semampunya menyediakan biaya makan, tempat tinggal, kebutuhan sehari dan pendidikan. Ala kadarnya saja. Jauh dari mewah,” ujar Herry.(m46)

Ekonomi & Bisnis

WASPADA Rabu, 27 Februari 2013


Bukopin Layani Pembayaran Iuran Peserta Jamsostek

BNI Jadi Pengelola Lapangan Gas Blok Mahakam

MEDAN (Waspada): Bank Bukopin bekerjasama dengan PT Jamsostek dalam bentuk virtual account untuk melayani pembayaran iuran peserta Jaminan Sosial Tenaga Kerja (Jamsostek). Dengan kerjasama ini, perusahaan bisa membayar iuran jamsostek karyawannya melalui Bank Bukopin dan akan langsung memperoleh bukti pembayaran nomor virtual account yang sudah tercatat di Jamsostek. “Melalui Bank Bukopin, perusahaan bisa lebih mudah untuk membayar iuran Jamsostek dan langsung memperoleh bukti pembayaran yang merupakan nomor virtual account yang sudah tercatat di Jamsostek. Kepada perusahaan yang sudah melakukan pendaftaran, maka akan memperoleh nomor pendaftaran perusahaan (NPP),” kata Pemimpin Cabang Bukopin Medan Bambang Widyatmoko, SE, MM kepada Waspada, Selasa (26/2). Bambang menjelaskan, Bank Bukopin memberikan kemudahan dalam hal pembayaran iuran peserta Jamsostek yakni dengan cara melalui Teller dengan mengisi slip setoran Bank Bukopin, dapat juga melalui anjungan tunai mandiri (ATM) dengan memasukkan nomor rekening virtual account Jamsostek di jaringan ATM Bersama dan Jaringan Prima dan melalui Bukopin Cash Management. Bank Bukopin merupakan salah satu dari empat bank yang bekerjasama dengan PT Jamsostek untuk pelayanan pembayaran iuran peserta Jamsostek dan untuk transaksi. “Sampai dengan Januari 2013 Bank Bukopin merupakan bank yang paling banyak transaksi virtual account untuk transaksi layanan pembayaran iuran peserta Jamsostek dan yang paling sedikit transaksi koreksi diantara keempat bank yang bekerjama,” ujarnya. (m41)

JAKARTA (Waspada): PT Bank Negara Indonesia (BNI) Tbk, dipercaya menjadi bank pertama yang mengelola dan memberikan trust atau pelayanan jasa penitipan yang disertai pengelolaan aset. “Adalah pengelola lapangan gas Blok Mahakam yang menjadi pengguna pertama jasa trust BNI. Yakni PT Pertamina (Persero), Total E&P Indonesie, dan INPEX Corporation,” kata Direktur Utama BNI Gatot M. Suwondo, di Jakarta, Senin (25/2). Usai penandatanganan perjanjian Gatot, mengatakan hal ini menjadi tonggak baru bagi industri Migas Indonesia karena kini pelayanan trust sudah beralih ke perbankan nasional. Sehingga target penggunaan local content dalam industri minyak dan gas semakin nyata terwujud. Hadir pada kesempatan itu Direktur Utama Pertamina Karen Agustiawan, President Total E&P Indonesie Elisabeth Proust, dan disaksikan oleh Kepala Satuan Kerja Khusus Pelaksana Kegiatan Usaha Hulu Minyak dan Gas Bumi (SKK Migas) Rudi Rubiandini. Menurut Gatot, perjanjian tersebut menjadi tonggak sejarah baru bagi industri perbankan di Indonesia. Dimana untuk pertama kalinya bank yang berasal dari Indonesia, yaitu BNI (melalui Cabang Singapura) memberikan layanan trust yang selama berpuluhpuluh tahun dikuasai oleh bank asing di luar negeri. Sebagai trust, kata Gatot, BNI Kantor Cabang Singapura akan menjalankan fungsi sebagai agen pembayar (Payment Agent). Yaitu menerima hasil penjualan gas dari Blok Mahakam dan menyalurkan pembayaran ke pihak beneficiary yang disepakati dalam perjanjian. Secara hukum, pelayanan trust ini sudah sejalan dengan kebijakan otoritas moneter yang telah menerbitkan Peraturan Bank Indonesia Nomor 14/17/PBI/2012 tanggal 23 November 2012 tentang Kegiatan Usaha Bank Berupa Penitipan dan Pengelolaan (trust). Nilai perikatan antara BNI dan pengelola Blok Mahakam ini tergolong signifikan dalam tataran transaksi keuangan di sektor minyak dan gas Indonesia karena volume tranksaksi penjualan gas Blok Mahakam mencapai 10-12 shipment per bulan, dengan nilai sebesar 50-60 juta dolar AS untuk setiap shipment-nya. Gatot mengatakan, keberhasilan pelayanan trust BNI ini akan terus ditingkatkan, antara lain dengan memperkuat jasa serupa di pasar domestik. Oleh karena itu, BNI siap untuk Go Live Trustee Domestik pada 1 Juli 2013. (Rel)

Rp1,8 M Untuk Usaha Kecil BIREUEN (Waspada): Pemerintah Kabupaten (Pemkab) Bireuen menyiapkan anggaran Rp1,8 miliar lebih untuk membantu pelaku usaha kecil. Baik sektor industri maupun perdagangan. Kadisperindagkop Bireuen Darwansyah, Selasa (26/2), menyebutkan dana itu merupakan bagian dari dana Pengembangan Ekonomi Rakyat (PER) tahun 2013 guna memfasilitasi bantuan usaha kepada masyarakat kecil, serta bantuan untuk koperasi. Katanya pihaknya saat ini sedang bersiap untuk menyerahkan bantuan kepada calon penerima berdasarkan hasil verifikasi tahun 2012. Bantuan yang disalurkan seluruhnya berbentuk barang, tidak ada bantuan dalam bentuk uang tunai. Darwansyah, menyebutkan bantuan untuk pelaku ekonomi kecil ini tersebar di 17 kecamatan, berupa peralatan perbengkelan, peralatan tukang perabot, peralatan menjahit, peralatan pendukung usaha perajin garam, bantuan usaha keripik, dan usaha pakan ternak. Selain itu, bantuan juga diberikan berupak rak mie, rak rokok, gerobak sorong, tenda untuk pedagang kaki lima, serta bantuan ratusan paket timbangan pegas. Disebutkannya para penerima bantuan ini sudah terdata sebelumnya melalui usulan yang disampaikan kepada Pemkab Bireuen dan telah diverifikasi. Atas dasar usulan awal itulah Pemkab Bireuen mengalokasi dana Rp1,8 miliar lebih. ‘’Sedangkan bagi usulan yang baru masuk, Bupati Bireuen juga mengupayakan dapat membantu. Namun dananya harus diupayakan dari sumber lain,” ucap Darwansyah. (b17)

Petani Keluhkan Perubahan Cuaca BLANGKEJEREN (Waspada ): Hujan yang terus mengguyur Kab. Gayo Lues pada Januari-Februari, membuat petani palawija di Kec. Blangkejeren merugi. Mereka juga tidak berani berspekulasi menanam cabai atau palawija lainnya. Para petani khawatir akan semakin merugi. Seorang petani cabai asal Desa Penggalangan, Inen Try, 52, mengeluhkan cuaca yang tidak menentu. Dia mengaku takut menanam palawija. ‘’Yang dikhawatirkan tanaman enggak tumbuh, atau tumbuh tapi kebanyakan air sehingga hasil panennya tidak bisa maksimal,” ujarnya, Selasa (26/2). Menurutnya, jenis tanaman palawija seperti kacang, cabai, tomat, dan kedelai tidak bisa tumbuh subur bila kebanyakan air. Petani lainnya di Desa Palok, Mursidi, 28, mengaku mengalami kerugian cukup besar karena tanaman cabainya banyak yang mati. “Akibat hujan, kalaupun ada tanaman yang bertahan, tapi buahnya banyak yang busuk dan rontok, dan hampir semua terkena antrax,” keluhnya. Hama patek, katanya juga sering menyerang pada musim hujan. Ditandai gejala muncul bercak kehitaman pada batang. Jika dibiarkan akan menjalar ke buah. Akibatnya cabai menjadi kering dan tidak laku dijual Petani tembakau Hal yang sama juga dikeluhkan petani tembakau di Gayo Lues. Perubahan cuaca telah membuat mereka merugi. Curah hujan yang cukup banyak membuat daun tembakau yang dijemur tidak kering. Petani Blangtenggulun, Kec. Blangkejeren, Jul, 26, Selasa (26/2), mengaku kesulitan untuk menjemur daun tembakau yang sudah di panen, karena tidak ada sinar matahari dan curah hujan masih tinggi. Kalau dibiarkan, daun tembakau itu akan rusak dan kualitasnya berkurang. (cjs)

Daftar Harga Bahan Pokok Di Medan, Selasa (25/2) Beras Ramos 1 Beras Ramos 2 Beras KKB 1 Beras KKB 2 Beras Arias Beras Jongkong IR 64 Beras Jongkong Kasar Beras Jongkong IR 64/Kw3 Gula Pasir Minyak Goreng Curah Kuning Daging Sapi Murni Daging Ayam Broiler Daging Ayam Kampung Telur Ayam Broiler Telur Ayam Kampung Garam Kasar Garam Halus Terigu Segi Tiga Biru Cabai Merah Cabai Rawit Cabai Hijau Bawang Merah Bawang Putih Tomat Kol Kentang Ikan Asin Teri (no.2) Kacang Hijau Kacang Tanah Kacang Kedelai Minyak Tanah Susu KM Bendera 357 gr Susu KM Indomilk 390 gr Susu Bubuk Bendera 400 gr Susu Bubuk Indomilk 400 gr

: Rp9.400 per kg : Rp9.200 per kg : Rp9.700 per kg : Rp9.500 per kg : Rp9.000 per kg : Rp9.000 per kg : Rp8.500 per kg : Rp8.500 per kg : Rp13.000 per kg : Rp10.000 per kg : Rp85.000 per kg : Rp22.000 per kg : Rp50.000 per kg : Rp1000 per butir : Rp1.500 per butir : Rp1.200 per kg : Rp2.000 per kg : Rp7.000 per kg : Rp20.000 per kg : Rp30.000 per kg : Rp10.000 per kg : Rp23.000 per kg : Rp23.000 per kg : Rp6.000 per kg : Rp3.000 per kg : Rp5.000 per kg : Rp75.000 per kg : Rp12.000 per kg : Rp23.000 per kg : Rp8.000 per kg : Rp9.000 per liter : Rp7.600 per kaleng : Rp8.200 per kaleng : Rp25.500 per kotak : Rp27.200 per kotak (m41)

Harga Emas London Murni (LM)


Perhiasan (97%)


Emas Perhiasan (70%)


Emas Putih (75%)




(50 %)


MUSIM IKAN SIRO. Seorang nelayan menata keranjang ikan siro di Tempat Pelelangan Ikan (TPI) Pelabuhan Tegal, Jateng, Selasa (26/2). Menurut nelayan, saat ini musim tangkapan ikan siro hanya sedikit untuk tangkapan ikan jenis lain, namun harga ikan siro naik dari Rp 150 ribu per keranjang (25 kilo) menjadi Rp 200 ribu per keranjang.

Kuota Solar Berkurang MEDAN (Antara): Kuota solar untuk Sumatera Bagian Utara (Sumbagut) tahun ini direncanakan berkurang 244.340 kiloliter (KL). Dengan begitu kuota yang diterima pada tahun 2012 sebanyak 2.780.286 KL, akan berkurang menjadi 2.535.946 KL. Menurut General Manager Fuel Reail Marketing Rigion I Sumbagut Gandhi Sriwidodo, Selasa (26/2), penurunan kuota

itu dilakukan menyusul penerapan Peraturan Menteri Energi dan Sumber Daya Mineral (Permen ESDM) nomor 1 tahun 2013 tentang Pengendalian Penggunaan Bahan Bakar Minyak (BBM. Disebutkan Gandhi, kuota solar itu juga lebih kecil dari realisasi penyaluran di 2012 sebesar 2.764.255 KL. Meski kuota solar itu sudah ditekan, tetapi diyakini penyaluran realisasi tetap di atas kuota. Dari kuota 2.535.946 KL itu penyaluran diestimasikan menjadi 2.722.579 KL. Untuk menekan penyaluran solar di atas kuota, Pertamina berharap Pemerintah Provinsi, kabupaten/kota, pengusaha

SPBU dan perusahaan pertambangan, perkebunan dan kehutanan yang terhitung 1 Maret 2013 dilarang menggunakan solar bersubsidi. Pertamina sendiri sudah dan akan melakukan berbagai langkah agar kebutuhan solar nonsubsidi semakin mudah diperoleh. Jumlah SPBU nonsubsidi di Sumut misalnya sudah ada 15 SPBU. Pertamina juga menyediakan SPBU berjalan (mobile SPBU) yang sudah ada 20 unit. Dengan begitu diharapkan penyediaan solar nonsubsidi tentunya pengusaha perkebunan, pertambangan dan kehutanan tidak kesulitan memenuhi kebutuhan BBM-nya pasca Permen ESDM I/2013 itu.

Sementara itu, Komite BPH Migas Ibrahim Hasyim, menyebutkan pengurangan kuota solar secara nasional memang sudah sangat mendesak untuk menekan besaran subsidi pemerintah dari BBM, khususnya solar yang sebagian besar untuk kebutuhan industri dan perkebunan yang tidak layak disubsidi. Apalagi di Sumbagut khususnya Sumut, yang penyaluran solarnya ternyata di atas angka rata-rata penyaluran daerah lain. “Kalau daerah lain penyerapan solar masih sekita 8 persen per bulan, maka di Sumut sudah sekitar 9 persen. Jadi pemerintah benar-benar harus menekannya,” katanya.

Impor Kedelai Naik Capai 15 Ribu Ton MEDAN (Waspada): Memasuki awal 2013, impor kacang kedelai mengalami kenaikan, dibanding kurun waktu yang sama tahun lalu. Pada Januari, impor bahan baku produksi tempe dan tahu ke Sumut mencapai 15.000 ton lebih. Sedangkan pada bulan yang sama 2012 hanya 12.000 ton lebih. Asisten Manajer Hukum dan Humas Pelindo I BICT H. Suratman, mengatakan itu, Selasa (26/2). Menurutnya kenaikan ini diperkirakan karena adanya kebijakan pemerintah tentang kebijakan impor kacang kedelai yang selama ini menjadi keluhan dari para produsen tempe dan tahu.

Pemerintah telah mengeluarkan kebijakan penghapusan bea masuk (BM) kedelai impor sebesar 5 persen menjadi nol persen. Sehingga volume impor pada tahun 2012 sempat turun, disbanding tahun 2011. Berdasarkan data impor melalui Belawan International ContainerTerminal PT Pelabuhan Indonesia I (Persero), jumlah impor kacang kedelai selama 2012 hanya 131.348 ton, jumlah ini turun dari impor 2011 telah mencapai 159.948 ton. Pedagang tahu di Simpang Limun menyambut baik adanya kebijakan pemerintah tentang penertiban Harga Patokan Pemerintah (HPP) kacang kede-

lai. Karena Kementerian Perdagangan segera mengeluarkan Peraturan Menteri Perdagangan terkait dengan ketentuan harga pembelian pemerintah (HPP) untuk kedelai. Produsen tempe Suardi, menyebutkan peraturan itu akan segera dikeluarkan pemerintah sehingga harga kacang kedelai di pasaran akan stabil dari sebelum terjadi kenaikan yang dinilai tidak logis. Selain itu kebutuhan kacang kedelai saat ini masih bergantung sepenuhnya dengan impor, karena produksi dalam negeri tidak mencukupi dari jumlah yang dibutuhkan. Menurut Suardi, sesuai data

kebutuhan kacang kedelai secara nasional saat ini relatif besar, sekitar 2,5 juta ton, sedangkan tingkat ketergantungan terhadap impor masih tinggi, yaitu sebesar 1,8 juta ton atau 70 persen dari kebutuhan nasional. Sedangkan harga rata-rata nasional 2013, tercatat harga kacang kedelai lokal sebesar Rp9.366 per kg, turun 2,75 persen dari harga bulan sebelumnya, yaitu Rp9.624 per kg. Harga untuk kedelai impor tercatat Rp9.040 per kg, yang juga mengalami penurunan 2,68 persen dari harga bulan sebelumnya Rp9.283 per kg. (m35)

Pengendalian BBM Bersubsidi Belum Maksimal MEDAN (Waspada): Penerapan Peraturan Menteri (Permen) Energi Sumber Daya Mineral (ESDM) No.1 tahun 2013 tentang tentang Pengendalian Penggunaan BBM Bersubsidi bagi kendaraan milik pemerintahan, BUMN, BUMD, mobil pertambangan, perkebunan dan kehutanan belum berjalan di Sumatera Utara. Di lapangan, masih banyak mobil dinas yang menggunakan premium. Menjawab ini, Kepala Dinas Pertambangan dan Energi Mineral (Distamben) Sumut Binsar Situmorang mengakui, harusnya Permen ESDM No.1 tahun 2013 sudah diberlakukan sejak 1 Februari 2013 lalu. Sebagian mobil-mobil dinas milik pemerintahan sudah menggunakan bahan bakar non subsidi, namun masih ada sebagian pengguna mobil dinas yang menggunakan BBM bersubsidi. Berbicara kepada wartawan, Selasa (26/2), Binsar Situ-

morang, mengatakan sebagian besar pengguna mobil dinas sudah sadar untuk menggunakan BBM non subsidi, meskipun memang masih ada yang belum sadar dan masih menggunakan BBM bersubsidi. Berkaitan dengan itulah, kata Binsar, pihaknya hari itu melakukan Bimbingan Teknis Implementasi Peraturan Menteri ESDM No.1/2013 Tentang Pengendalian Penggunaan BBM antara Distamben Sumut, Badan Pengatur Hilir Minyak dan Gas(BPH Migas), dan Pertamina Wilayah Sumbagut. Mengenai pemasangan stiker untuk mobil-mobil dinas pemerintahan, BUMN, BUMD, mobil perkebunan, kehutanan dan pertambangan tersebut, Binsar mengatakan, ini merupakan salah satu sistem pengawasan yang belum bisa dilaksanakan sehingga Permen tersebut belum berjalan maksimal. Menurutnya, pihaknya masih

menunggu dari BPH Migas dalam pemasangan stiker tersebut dan diperkirakan Maret pemasangan stiker bisa dilakukan. Komite BPH Migas Ibrahim Hasyim, mengatakan untuk stiker penanda kendaraan yang dilarang memakai BBM bersubsidi akan dibuat secara khusus di masing-masing daerah. Ibrahim Hasyim mengatakan, pengguan BBM subsidi yang over kuota biasanya terjadi di daerah perkebunan dan pertambangan. Untuk Sumatera meliputi Padang, Riau dan Sumatera Utara. Tingkat konsumsi BBM subsidi dalam sebulan mencapai 9,6 persen. Sementara rata-rata pemakaian hanya 8,6 persen. Sementara itu, General Manager PT Pertamina Fuel Retail Marketing Region I Sumbagut Gandhi Sri Widodo mengatakan, pada tahun ini pihaknya akan menambah 83

Stasiun Pengisian Bahan Bakar Umum (SPBU) yang menyediakan BBM solar non subsidi bagi kendaraan angkutan perkebunan, pertambangan dan kehutanan. Dimana saat ini outlet BBM solar non subsidi yang tersedia baru enam, yaitu berada di Medan, Tapanuli Tengah, Pematang Siantar serta Tebing Tinggi. Selain itu, katanya, Pertamina juga akan menyiapkan 200 SPBU BBM non subsidi di wilayah Sumbagut, namun bertahap. Pada tahun ini akan ditambah 83 outlet. Penyedian SPBU itu sendiri untuk mendukung dan melancarkan peraturan Menteri (ESDM) mengenai pelarangan memakai Bahan Bakar Minyak (BBM) bersubsidi bagi seluruh kendaraan dinas instansi pemerintah, Pemda, BUMN, BU M D, m o b i l a n g k u t a n pertambangan, perkebunan, dan kehutanan. (m41)

Tingkatkan Pengetahuan Masyarakat MAPPI Gelar Sosialisasi MEDAN (Waspada) : Untuk meningkatkan pengetahuan masyarakat terhadap jasa Penilaian di Indonesia, maka Masyarakat Profesi Penilai Indonesia (MAPPI) akan mengadakan sosialisasi ruang lingkup jasa Penilaian dan Profesi Penilai kepada pengguna jasa penilaian dan masyarakat umumnya. Hal itu diungkapkan Ketua Pengurus Daerah MAPPI Sumbagut, Hilal Rasyad, MAPPI (Cert), di Medan, Selasa (26/2) seraya menyatakan dengan adanya sosialisasi ini diharapkan masyarakat khususnya para penegak hukum mengetahui bagaimana kerja dan tupoksi jasa Penilai. “Kedepan kita tidak ingin terjadi kembali adanya anggota

dari asosiasi MAPPI yang terbawa-bawa atau tersangkut di dalam kasus hukum,” ujarnya. Untuk mencegah hal ini terulang kembali, lanjut Hilal, kita akan melakukan sosialisasi seperti apakah kerja anggota asosiasi MAPPI di masyarakat. “ Tentunya sosialisasi tersebut dilaksanakan di tengah-tengah masyarakat khususnya terhadap penegak hukum.” Hal itu juga diungkapkan Kepala Biro Hukum dan Advokasi MAPPI Robinson Tampubolon, SE, MM, MAPPI (Cert) yang menyayangkan salah satu Penilai Publik anggota MAPPI yang dikaitkan dalam kasus hukum di Medan. “Selayaknya jika adanya pelanggaran kode etik tidaklah

harus sampai kepada koridor hukum di pengadilan sebelum digelar terlebih dahulu sidang oleh Dewan Penilai MAPPI karena pelanggaran kode etik seharusnya domainnya MAPPI,” ujar Robinson. “Meski diketahui belum ada dasar hukum yang kuat tentang sidang profesi, namun demi kejelasan dari ilmu praktek penilaian itu sendiri sudah pantas menjadi pertimbangan digelar sidang kode etik profesi terlebih dahulu” lanjut Robinson. Robinson prihatin adanya anggota MAPPI yang terjerat kasus hukum terlepas dari bersalah atau tidak sudah selayaknya dilaksanakan sidang profesi. Bila dilihat opini yang beredar, tambahnya, pelanggaran

terhadap Standar Penilaian Indonesia (SPI) yang merupakan standar profesi oleh anggota seharusnya tidak dapat dikategorikan sebagai pidana. “Jika hal ini terus berlanjut dikhawatirkan asosiasi profesi penilai yang kontribusinya cukup strategis dalam mendukung perekonomian negara menjadi menimbulkan keraguan serta ketidaknyamanan dalam member ikan jasa penilaian,” lanjutnya kembali. Robinson juga mengakui kejadian tersebut menjadi masukan yang sangat berharga sebagai percepatan penyelesaian UU penilai sehingga UU tersebut dapat menjadi pegangan bagi penegak hukum jika kasus tersebut terulang kembali. (m38)

BPTP Aceh Kembangkan M-KRPL BANDA ACEH (Waspada) : Balai PengkajianTeknologi Pertanian (BPTP) Aceh melaksanakan pengembangan komoditas sayuran, obat-obatan, dan buah-buah Model Kawasan Rumah Pangan Lestari (M-KRPL) di delapan kabupaten di Aceh. Kegiatan sama sudah pernah dilakukan di Desa Lipah Rayeuk, Kec.Jeumpa, Kab. Bireuen dan Kec. Meurah Dua Kab. Pidie Jaya. Kepala BPTP Aceh H.Teuku Iskandar, Selasa (26/2), mengatakan dari beberapa daerah yang telah melaksanakan kegiatan ini ternyata mendapat sambutan positif dari masyarakat. Katanya, kegiatan yang dilakukan di Bireuen berjalan efektif dengan peserta awal sebanyak 35 keluarga. “Sekarang ini masing-masing rumah tangga sudah memanfaatkan pekarangan dengan menanam berbagai komoditas sayuran, obat-obatan, dan buah-buahan,” kata Iskandar. Dari 35 rumah tangga peserta yang diberi modal awal, saat ini sudah lebih dari 50 rumah tangga mengikuti pola yang dianjurkan petugas BPTP. Bahkan sampai sekarang ada penambahan 400 rumah tangga dari delapan kabupaten yang melaksanakan secara swadaya. Dan jumlah itu akan terus bertambah. Untuk mendukung kegiatan KRPL, pihak BPTP Aceh merintis satu unit Kebun Bibit Desa (KBD) untuk satu desa di delapan kabupaten, sehingga kebutuhan benih/bibit bagi peserta dapat terpenuhi. Selain itu kegiatan yang sedang difokuskan adalah pemanfaatan tanah kosong untuk tanaman plasma nutfah (pangan dan obatobatan) dan pemanfaatan lahan pekarangan pada fasilitas umum (mushalla, kantor desa, sekolah, puskesmas, dan kantor camat), sebutnya. Sementara itu, kata T. Iskandar, Pemerintah Kabupaten Pidie Jaya merupakan salah satu daerah yang sangat berminat untuk mengembangkan M-KRPL. Mereka mengajak BPTP untuk melakukan pembinaan. Ditambahkan, secara definitif sampai saat ini KRPL direncanakan di delapan kabupaten diantaranya, Kabupaten Bireuen, Aceh Besar, Pidie, Pidie Jaya, dan Aceh Utara. Namun tidak tertutup kemungkinan kegiatan KRPL menjadi lebih unit model pedesaan dan perkotaan. “Kita senang, model ini dapat menyebar ke lokasi lain, apalagi pemkab memberi respons positif,” demikian Iskandar.(b09)

Intel Kenalkan Ultrabook Convertible SURABAYA (Waspada): Ultrabook Convertible berupa produk penggabungan kemampuan tablet dan personal computer (PC), dengan layar sentuh, diperkenalkan oleh Intel, perusahaan inovasi komputasi terkemuka di dunia sekaligus pendisain teknologi utama yang berfungsi sebagai dasar prangkat komputasi dunia. Intel, Selasa, (26/2), memperkenalkannya kepada sejumlah awak media sekaligus mengundang psikolog Psikolog Rosdiana Setyaningrum, M.Psi,dan para bloger di Black Canyon Coffee Surabaya. T own Square, Surabaya. Direktur Marketing Intel Indonesia, Hermawan Sutanto, mengenalkan produk ini sebagai perangkat yang “power full” aplikasi yang menyediakan akses yang dimiliki dua perangkat itu. Intel ingin kebutuhan masyarakat dengan gaya hidup yang makin dinamis terpenuhi dengan cukup satu perangkat saja. Lebih simpel, praktis namun tetap mendukung fungsi kerja dan hiburan yang dibutuhkan. “Konsep device ini untuk menggabungkan kemampuan PC dan mobilitas tablet. Cukup dengan satu perangkat, segala kebutuhan itu tercukupi,” kata Hermawan Dia menambahkan dengan tren bekerja dari luar kantor saat ini yang berkembang luas. Bahkan, kelompok pekerja ini memiliki istilah sendiri, yakni telecommuters terus mengglobal , serta adanya 3 dari 10 pekerja lebih memilih untuk bekerja dari luar kantor, menjadikan produk ini akan jadi pilihan. “ Dalam lingkup regional, sebanyak 24 persen pekerja AsiaPasifik memilih untuk melakukan telecommute secara teratur. Sementara itu, Indonesia sendiri 34 persen telah berkembang menjadi negara terbesar kedua, setelah India yang mencapai 56 persen, dalam hal jumlah pekerja telecommuters, “ kata Hermawan yang menambahkan data ini menunjukkan tren bekerja dari luar kantor ini sedang dan akan terus berkembang. (m37)

Waspada/ Anum Saskia

Director of Marketing Intel Indonesia Hermawan Sutanto saat perkenalkan Ultrabook touch experience oleh Intel yang dipamerkan saat kegiatan temu media dan intel Indonesia corporation di Surabaya.



WASPADA Rabu 27 Februari 2013


Golput Tinggi KPU Gagal


ilgubsu tinggal menghitung hari: 7 Maret 2013, berarti tinggal delapan hari lagi. Wajar kalau kelima pasangan Cagubsu dan Cawagubsu bekerja keras memaksimalkan masa kampanyenya saat ini untuk memperkenalkan diri dan memasarkan program kerja atau visi misinya kepada 10 juta pemilih. Kemarin, Daftar Pemilih Tetap (DPT) pemilihan Gubernur Sumatera Utara (Pilgubsu) 2013 sudah diperbaharui oleh KPU. Dari 10.295.013 menjadi 10.310.872 atau bertambah 15.859 dengan jumlah Tempat Pemungutan Suara (TPS) 26.452 unit. Artinya, kita memberi apresiasi atas tugas-tugas KPU yang memperbaharui data DPT walau diyakini masih banyak warga Sumut belum terdata. Namun hal yang jauh lebih penting adalah tugas melakukan sosialiasi dan mengupayakan Pilgubsu berlangsung tertib dan aman dengan mengedepankan asas jurdil (jujur dan adil) dan luber (langsung umum, bebas, rahasia). Minimnya sosialisasi Pilgubsu oleh KPU Sumut dan KPUD di kabupaten-kota memang sangat disesalkan sehingga menimbulkan banyak gugatan dari masyarakat dan juga kandidat, seperti Effendi Simbolon dan Gatot Pujo Nugroho yang mengaku sudah melakukan pemantauan ke lapangan dan menerima informasi masih banyak masyarakat yang tidak tahu ada Pilgubsu, apalagi tanggal pencoblosannya, terlebih lagi siapa calon-calonnya, sehingga mustahillah mereka bisa menentukan pilihannya jika tidak mengenal siapa calon pemimpin dan apa program yang ditawarkan para calon. Minimnya sosialiasi ini patut dipertanyakan mengingat besarnya biaya Pilgubsu yang konon mencapai Rp646,4 miliar. Katanya, dana tersebut akan dipakai untuk beragam kebutuhan seperti sosialisasi, transportasi, pengawasan dan pengamanan pesta demokrasi rakyat Sumut pada Kamis 7 Maret 2013. Intisari Justru itu, penggunaan anggaran KPU Sumut yang begitu besar perlu diaudit untuk mengetahui ke mana saja digunakan sehingMari kita sukseskan ga akan ketahuan jika terdapat penyimpangan dan korupsi di dalam pelaksanaannya. Pilgubsu 7 Maret nanti. Terlebih dana untuk sosialisasi apakah sudah Pilih yang terbaik sesuai dijalankan dengan benar. Jangan dihabiskan sekadar bimtek-bimtek yang tidak menyenhati nurani, jangan tuh pemilih. Tidak jelas manfaatnya bagi golput! masyarakat. Hemat kita, beban yang harus ditanggung para kandidat Pilgubsu semakin berat akibat KPU sepertinya kurang peduli dengan sosialisasi yang sebenarnya teramat perlu untuk menyukseskan Pilgubsu. Terbukti dari keluhan kandidat Cagubsu-Cawagubsu masih banyak warga Sumut tidak tahu ada pesta demokrasi mencari pemimpin Sumut. Akibatnya para kandidat terpaksa ikut melakukan sosialisasi yang seharusnya tugas KPU. Dana masing-masing kandidat ikut membengkak. Konsekuensi lemahnya KPU melakukan sosialisasi dikhawatirkan berakibat membesarnya jumlah masyarakat yang tidak memilih. Jumlah golput bisa diakibatkan lemahnya KPU dalam melakukan sosialiasi sehingga masyarakat tidak tahu dan tidak tertarik mencoblos akibat KPU gagal dalam memberikan informasi terkait apa itu Pilgubsu, apa manfaatnya dan bagaimana rakyat diajak menggunakan hak-hak politiknya. Ini paling banyak di kawasan pedesaan dan daerah-daerah terpencil, di berbagai kawasan pulau yang jauh dari pusat keramaian, sementara sarana komunikasi dan transportasi sangat terbatas. Luasnya wilayah Sumut menjadi kendala KPU melakukan sosialisasi, namun seharusnya hal itu sudah diketahui KPU Sumut sehingga tidak ada alasan buat KPU tidak bisa menjangkau daerah-daerah terisolir dalam upaya pendaftaran dan sosialisasi. Jumlah golput diperkirakan tinggi tidak saja karena jangkauan sosialisasi dan kualitas sosialisasi dari KPU lemah sehingga tidak menarik masyarakat untuk ikut berpartisipasi, tapi juga akibat sistem penjaringan calonnya juga lemah sehingga figur kuat malah tidak terakomodir oleh parpol dan juga terganjal di jalur independen. Tentu saja beda dengan di kota, KPU tidak perlu bersusah payah melakukan sosialisasi karena media massa dan para kandidat serta tim suksesnya silih berganti menemui rakyat sehingga tanpa sosialiasi dari KPU pun warga perkotaan sudah mengerti akan berlangsung Pilgubsu. Hanya saja, mereka belum tentu ikut mencoblos jika calonnya tidak berkualitas atau merasa apatis dengan sistem Pilkada yang gagal menghasilkan pemimpin bersih, pro-rakyat. Mari kita sukseskan Pilgubsu 7 Maret nanti. Pilih satu dari lima kandidat yaitu: Pasangan Gus Irawan Pasaribu - Soekirman, Effendi Simbolon - Jumiran Abdi, Chairuman Harahap - Fadly Nurzal, Amri Tambunan - RE Nainggolan, dan Gatot Pujo Nugroho - Tengku Erry Nuradi. Mari kita gunakan hak pilih. Walau kinerja KPU dan Panwaslu perlu disorot dan dikawal untuk dievaluasi. Walau anggaran KPU sangat besar tidak sebanding dengan minimnya sosialisasi, dan walau track record kandidat yang muncul belum sesuai dengan harapan, namun kita harapkan gunakan hak pilih, pilih yang terbaik sesuai hati nurani agar jumlah Golput tidak sampai 30 persen. Jika golput tinggi KPU-nya gagal.+


Faks 061 4510025

Facebook Smswaspada

+6281385066033 Saya tidak setuju kalau koruptor itu dihukum mati, sebab urusan mati itu urusan ALLAH, yg tepat koruptor itu dimiskinkan saja semua hartanya diambil negara jangan ada yg tersisa, biarkan merek tinggal di kolong jembatan, biar dia rasakan penderitaan rakyat yg dia rampok itu, dari hamba ALLAH +6283197966570 HOLLAND BERHASRAT MELESTARIKAN BANGUNAN yang didirikan Kakek ~Moyang mereka di Ibukota Netherland~Hindie ; Batavia • Mohon ditambah Mester ! Di kota~kota yang lain , buildings yang didirikan kakek~moyang Mester , masih banyak yang dipakai berfungsi sebagaimana fungsinya semula • Seperti ; Kantoor Post besar di Soematera~timoer yang menghadap Esplanade Medan~Deli • Demikian pula dengan Menara Tangki Ayer yang masih kokoh untuk menampung Ayer bersih dari Oemboel Sibolangit • Mester boleh lihat dikota~kota lain , juga masih banyak Gedong~Gedong peninggalan Kakek~Moyang Mester yang masih berfungsi • Jadi , program Mester,mohon diperluas ! Kami beranggapan , yang akan di lestarikan berupa Gedong~ Gedong yang dibangun Governement Netherland~Hindie • “Bukankah begitu , Mester ?”# khamis 21 february di tepibarat Medan city +6285206193746 Kepad yth Bapak Kapoldasu. Usut tuntas 86 kasus penyelundupan minuman keras bermerk dr luar negri yg ditangkap di titi gantung tg balai disebuah mobil toyota terios hitam dgn barang bukti 15 doz minuman keras. Dalam hitungan jam, TSK sudah dilepas.Info dilingkungan Polresta Tg Balai bahwa pemilik barang tersebut orang yg kebal hukum karena sudah punya backing sampai ke tingkat Poldasu..Kapolda selalu bicara akan menegakkan hukum yg seadil2 nya diwilayah hukum Sumut, tapi kalau dilapangan ternyata seperti ini, berarti hanya pembohongan publik belaka. +6283197966570 IRMAN PUTRASIDIN , BONI HARGENS , LA ODE IDA , meminta agar President & Menteri , keluar dari Par.Pol. mereka • Mereka meminta dibuat U.U.ny a • MANA MUNGKIN • Selagi kita tetap memakai system Pemerintahan REPUBLIC dengan 3 Tungku ; Yudicative , Legislative , Executive , yang diadopsi dari PERANCIS oleh Para Pendiri Negara yang berbentuk Republic di muka Bumi ini • Montesque’s idea • President tetap memegang Par.Pol.nya • Semua President of Nations , tetap memegang Par.Pol.nya , tidakada yang melepaskan diri • Demikian pula dengan Ministers == Para Menteri • Nantilah kalau Irman Putrasidin , Boni Hargens dan La Ode Ida , berhasil meyaqinkan Dunia bahwa lebih baik setiap President melepaskan diri dari Par.P ol.nya , agar Barack Obama , focus mengurus Ra’yat U.S.A. , agar FranceHolland , focus mengurus Ra’yat Perancis • Irman , Boni , La Ode , harus ke New York , masuk ke Markaz Unit ed Nations , lalu kemukakan buah fikiran kalian ! “Sanggup ??” kr.sikameng +626175042559 Bersukur kali awak atas dipecatnya Aceng Fikri oleh SBY dari Bupati Garut .Setiap zalim akan hancur karena nya +6283197966570 GATOT PUDJO NUGROHO resmi di angkat dan di dudukkan di Kursi Nomor Satu di Prov. Sum.Ut. oleh President R.I. • Sebahagian Pengamat mengatakan ; “Ini suatu kerugian bagi Gatot • Lebih baik Mas Gatot, tetap sebagai Pelaksana Tugas Governor Sum. Ut. • Tidak mendahului Taqdir , katakanlah, Suara mayoritas berpihak pada Gatot~Teng ku, pada Pemilihan hari khamis 07 March nanti, itu berarti ; Sudah dua priode Mas Gatot menjadi Governor Sum.Ut. ! • Memang dapat dijelaskan pada lima tahun mendatang, duduk persoalannya, tetapi terjadi perdebatan serious dahulu, apabila Mas Gatot pada tahun 2023 mendatang berkhajat mencalonkan diri lagi menjadi Governor Sum.Ut. !”# arba’ 20 fe bruary di wism a atjeh family kr. sikameng #

Demokrat Pasca SBY Oleh Dr Drs H.Ramli Lubis, SH, MM Perseteruan politik antara Anas dengan SBY terlihat jelas, tetapi substansi hukum kasus Hambalang semakin mengabur,


asca kemenangan gilang gemilang Partai Demokrat pada Pemiluhan Umum (Pemilu) 2009, partai ini menjadi the ruling party. Tapi tak lama berselang kemudian,mekanismepartaiyangdianutdalam iklim demokrasi membuat partai ini harus menggelar kongres nasional untuk memilih kepemimpinan dan kengurusan baru. Dari sinilah sebenarnya gonjangganjing partai ini terjadi. Sebagai tokoh sentral, sosok SBY dipercaya dipercaya pemegang peran kunci daribesarnyanamademokratsaatini.Dan memang nyatanya, SBY juga memainkan posisi kunci di partai ini, yakni sebagai Ketua Dewan Pembina—yang memiliki wewenang besar dalam setiap keputusan partai, termasuk menonaktifkan Ketua Umum terpilih. Namun dalam kongres kemarin, regenerasi tidak berjalan mulus. Anas Urbaningrum, tokoh Himpunan Mahasiswa Islam (HMI) yang sempat singgah ke kepengurusan Komisi Pemilihan Umum (KPU)—muncul menjadi Ketua Umum Partai Demokrat terpilih. Secara mengejutkan dia mengalahkan dua calon kuat lainnya yakni Andi Mallarengeng dan

Marzuki Alie. Disebut regenerasi tidak mulus dan mengejutkan adalah karena Anas dipercaya bukanlah sosok yang dipersiapkan SBY sebagai penerus tatah kepemimpinan.Tapi nyatanya ini memang terjadi. Dengan terpilihnya Anas Urbaningrum sebagai Ketua Umum Partai Demokrat untuk periode 2010-2015, maka partai ini menjadi partai pertama yang merintis regenerasi menuju Pemilu tahun 2014. Dalam catatan, Anas, yang berusia 40 tahun, adalah politisi termuda yang memimpin partai terbesar di Indonesia. Dengan gayanya yang kalem, waktu itu Anas menyambut kemenangannya dengan sikap terbuka dan mempersatukan, setelah persaingan panas tiga kubu. Kontes tidak selalu tertib, namun pemilihan berlangsung demokratis dan transparan. Catatan selanjutnya adalah, bahwa dengan terpilihnya Anas sebagai Ketua Umum Partai Demokrat, maka partai ini menjadi partai pertama yang merintis regenerasi menuju Pemilu tahun 2014. Anas Urbaningrum, politikus yang dikenal santun asal Blitar, Jawa Timur. Ia lulusan Ilmu Politik Universitas Airlangga

dan Gajah Mada. Himpunan Mahasiswa Islam (HMI) sebagai organisasi kemahasiswaan yang pernah dipimpinnya, mencerminkan akar dukungannya yang kuat di daerah. Sebenarnya, karir politik Anas semula di Golkar namun kemudian pindah ke Partai Demokrat—dan berhasil pula menjadi Ketua Umum. Padahal rivalnya dalam pemilihan Ketua Umum, Andi Malaranggeng, diduga mendapat dukungan dari keluarga SBY, namun kalah di babak pertama. Padahal nyata Andi menggandeng putra SBY, Eddie Baskoro atau Ibas. Sampai saat terpilihnya Anas, para pengamat meyakinkan bahwa dibanding partai besar lain, Partai Demokrat paling sukses membangun regenerasi. Ini merujuk pada, misalnya ketika PDI-P yang belum bisa menggantikan Megawati, begitu juga dengan Hanura dengan Wirantonya. Namun para pengamat juga menduga, langkah politik SBY menjelang Pemilu, pasca terpilihnya Anas adalah menginginkan kepastian dan kestabilan. Dugaannya adalah bahwa Demokrat akan membangun semacam koalisi besar jangka panjang yang cenderung permanen—kira-kira mirip seperti Barisan Nasional yang memimpin Malaysia sejak merdeka. Namun pandangan itu serta merta berubah di tengah jalan ketika tsumani Hambalang menggerus beberapa tokoh sentral Partai Demokrat. Sendi-sendi penyangga partai ini rontok satu per satu,

tak terkecuali sang Ketua Umum. Mujur, SBY masih berada di luar jangkauan tsunami Hambalang tersebut. Maka percaturan politik yang dimainkan kemudian menjadi berubah sama sskali dari dugaan desain awal. Substansi Hukum Kenyataannya Anas dengan geng-nya menunjukkan sinyal perlawanan. Ini baru lembar pertama, karena masih ada lembaran buku lainnya yang akan sama-sama kita lihat bersama, katanya setelah ditetapkan sebagai tersangka setelah sebelumnya dinonaktifkan dari Ketua Umum Partai Demokrat. Satu hal yang kini menjadi catatan adalah bahwa isu atau wacana yang berkembang telah mengalami pergeseran masalah dari substansi hukum kepada masalah politik. Perseteruan politik antara Anas dengan SBY terlihat jelas, tetapi substansi hukum kasus Hambalang semakin mengabur, Partai Demokrat di masa SBY telah menunjukkan keberhasilan bahkan kebesaran partai ini.Tapi kita masih menunggu, DemokratpascaSBY—apakahmasihterus bisa memertahankan supremasinya ataukah akan tergsrus. Jika yang kedua inilah yang terjadi maka kesimpulan itu benar adanya: bahwa kebesaran yang dibangun oleh dominasi pencitraan tidak akan sanggup menghadapi dinamika politik hukum yang terjadi. Penulis adalah MantanWakilWali Kota Medan.

Kampanye Politik Oleh Anang Anas Azhar “Dalam pandangan historis, ternyata rakyat Indonesia sering dihadapkan pada fakta sejarah, bahwa kampanye politik sejak dulu hingga sekarang, sering melahirkan konflik yang berujung kepada sengketa hukum di pengadilan.


eberapa tahun terakhir, kampanye dianggap senjata paling ampuh untuk mengubah perilaku pemilih pada pemilihan kepala daerah. Kampanye diartikan sebagai media marketing politik untuk menyampaikan visi dan misi pasangan calon kepala daerah. Oleh sebagian rakyat kita, kampanye dianggap sebagai pesta rakyat. Namun tak jarang, kampanye politik berujung konflik dan adu otot. Banyak pihak yang mempersepsikan, tahapan kampanye yang dilakukan pasangancalonberujungrusuh.Konflikyang terjadi, tidak hanya adu otak dan perang program, namun bisa jadi konflik dalam adu otot untuk menunjukkan kebesaran pendukung dari satu pasangan calon. Dinamika ini terjadi, setidaknya untuk memberikan penajaman kepada rakyat, agar pasangan calon yang memperoleh dukungan terbanyak mendapat simpati rakyat untuk dipilih pada pemilihan kepala daerah. Secara psikologis, makin besar jumlah massa pendukung akan makin besar pula pengaruh para calon terhadap rakyat pemilih.Faktayangkitatemukandilapangan, kegiatan kampanye politik jarang terhenti pada realitas pemaparan dan dialog saja di antara pasangan calon di tempat tertutup. Tapi lebih jauh dari itu, kampanye dipersepsikan harus mengerahkan massa untuk menunjukkan kebesaran pasangan calon. Persepsi ini muncul, karena pasangan calon dan pendukung harus memenangi pemilihan kepala daerah. Dalam pandangan historis, ternyata rakyat Indonesia sering dihadapkan pada fakta sejarah, bahwa kampanye politik sejak dulu hingga sekarang, sering melahirkankonflikyangberujungkepadasengketa hukum di pengadilan. Konflik antara pendukung massa pasangan calon dilakukan secara terbuka, sebab lokasi kampanye dilakukanditempatumum.Praktikseperti ini,membuktikanbahwarakyatkitamasih rentandisulutkonflikpadasaatkampanye. Kasus yang terjadi di tanah air misalnya, konflik kampanye yang berbenturan dengan lawan pendukung pasangan calon sering terjadi. Dan bisa jadi, isu yang dilempardalamkampanyetersebutmenyudutkan pasangan calon atau menyudut-

kan pendukung massa dari salahsatu pasangan calon. Aturan Kampanye Harus diakui, isi pesan dari kampanye untuk menarik simpati rakyat. Pesan yang dikemas secara baik, diharap mampu mendogkrak elektabilitas pasangan calon, untuk menjatuhkan pilihannya di tempat pemilihan suara. Lantas, bagaimana aturan kampanye yang diinginkan agar kampanye berjalan santun dan demokratis? Jika kita merujuk pada Undang-Undang No. 8Tahun 2012 dapat disimpulkan bahwa yang dimaksud dengan kampanye santun, yaitu kegiatan-kegiatan penyampaian visi, misi, dan program pada waktu tahapan kampanye Pemilu. Dalam Undang-undang ini, selain waktu, diatur juga soalmaterikampanye,metodekampanye, larangan dalam kampanye dan sanksi atas pelanggarankampanye.Regulasiinidiatur secara teknis dalam peraturan-peraturan KPU. Permasalahannya, untuk kegiatankegiatan di luar tahapan, penyelenggara Pemilu biasanya tidak bisa mengambil tindakan atau memberikan sanksi terhadap pihak-pihak, baik partai politik maupun orang per orang yang melakukan kampanye di luar yang telah diatur dalam Undang-undang. Kampanye politik juga sering terjadi dalam bentuk kampanye melalui media danpemasanganatribut.Kondisiiniterlalu banyak memenuhi ruang-ruang dalam masyarakat kita. Intensitas kegiatan berbentuk kampanye semakin meningkat, apalagi di Sumatera Utara, dalam tahapan pemilihan gubernur, kini sedang berlangsung, pemasangan baliho dari lima konstentas Pilgubsu bertebar di mana-mana. Seakan tak ada ruang lagi, untuk kegiatan masyarakat.Balihodanspanduk-spanduk yang menampilkan gambar-gambar pasangan calon menjadi pesan kampanye agar mendapat simpati politik dari rakyat pemilih. Ironisnya, rakyat kita seakan dipaksa habis-habisan oleh berbagai kekuatan politik atau pihak yang akan maju dalam Pilgubsu untuk memilih pasangan calon. Iklan-iklan yang direka sedemikian rupa, serta janji-janji yang diucapkan saat kam-

panye politik diperdagangkan secara terbuka. Selama ini, tahapan Pemilu yang menjadiperhatian,yaitupemungutandan penghitungan suara. Fokus perhatian seluruh stakeholders politik dan Pemilu yang hanya tertuju pada kalah-menang dan seringkali menyebabkan kurangnya perhatian dan pemahaman akan pentingnya tahapan-tahapan lainnya dalam pemilu, terutama persoalan kampanye yang baik dan berkualitas. Dalam pasal 77, UU No. 8Tahun 2012 dinyatakan,kampanyepemilumerupakan bagian dari pendidikan politik masyarakat dan dilaksanakan terbuka dan bertanggungjawab.Maknadaribertanggungjawab berarti kampanye dilaksanakan sesuai dengan undang-undang atau ketentuan yang berlaku. Atau bisa juga bermakna setiap janji dalam kampanye dapat dipertanggungjawabkan, setelah memperoleh jabatan atau kekuasaan. Kepentingan-kepentingan kampanye politik para kontestan, baik parpol ataupun perseorangan masih sebatas“yang penting terpilih, soal bagaimana caranya itu belakangan”. Kampanye politik yang dipahami sedemikian rupa, pada akhirnya tidak diikuti dengan konsistensi para politisi untuk menjaga kontinuitas. Tahapankampanyetanpapemahaman yang baik dari kontestan ataupun masyarakat hanya akan terlihat seperti pesta umbul-umbul, baliho, spanduk, poster, stiker dengan berbagai slogan dan janjijanji kampanye. Semua atribut kampanye inibegitubanyakbertebarandiwaktumasa Pemilu dan pemilihan kepala daerah. Bahkan dalam bentuk kalender, souvenir dan bentuk lainnyamasuk sampai ke rumah-rumah warga. Belum lagi kampanyePemiludanpemilihankepaladaerah yang memenuhi media televisi. Kontestan Pemilu atau calon-calon kepala daerah yang rata-rata kini memiliki uang tak tanggung-tanggung membayar TV, lengkap dengan artis-artisnya. Media internet pun tak luput dijadikan media kampanye para kontestan pemilu. Beberapa temuan kasus di atas, jika dilihat dari aspek penyampaikan politik merupakan hal yang wajar. Tapi, tidak sedikit juga rakyat kita menganggap bahwa kampanye politik yang dilakukan dalam lima tahunan pada pemilihan kepala daerah, disebut juga sebagai pesta rakyat. Pesta rakyat, karena rakyatlah yang berdaulat, rakyat juga menentukan sepenuhnyadalammemilihpasangancalon.Rakyat diagungkan,disanjungbahwarakyatharus diadvokasi. Slogan-slogan ini kita ditemukan dalam kampanye politik, maka penulis berpendapat kampanye politik yang dilakukan pasangan calon disebut juga ajang pesta rakyat.

Penutup Aturandanfaktapolitikyangdisampaikan dalam tulisan ini, seharusnya menyadarkan pada kontestan dan pendukung pasangancalon,agardalammelaksanakan kampanyepolitiknyalebihsantun,beradab dan memiliki pesan-pesan pendidikan politik,agarrakyatmenetapkanpilihannya tidak berdasarkan tekanan, melainkan hati nurani. Hati nurani adalah puncak segalanya dalam menentukan sikap para pemilih. Pemilih jangan tertipu oleh jargon-jargon isi kampanye yang menyesatkan. Janjijanji pasangan calon yang diucapkan, merupakan utang besar kepada rakyat, jika pasangan calon tersebut dipilih. Penulis adalah Dosen Fisipol UMSU dan Ketua Pimpinan Pusat Pemuda Muhammadiyah

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengandisertaiCDataumelaluiemail: opini-waspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkandiMediamanapun.Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Sutan Bhatoegana: Harus bijak pilih Cagubsu - Tapi jangan pula kebijak-an! * Demokrat silahkan Anas buka-bukaan - Lembar dalam juga perlu dibuka * 746 anak di Sumut alami gizi buruk - Wah perlu perhatian Cagubsu neh!


D Wak


Medan Metropolitan

WASPADA Rabu 27 Februari 2013

Tingkatkan PAD:

Kadispenda Tongkrongi Loket Parkir MEDAN (Waspada): Sebagai upaya meningkatkan Pendapatan Asli Daerah (PAD) dari sektor perparkiran, Kepala Dinas Pendapatan (Kadispenda) Kota Medan melakukan terobosan baru dengan menongkrongi loket parkir. Hal ini terkait dengan upaya mapping (pemetaan) parkir di sejumlah tempat keramaian seperti plaza, mall dan gedung perkantoran yang menyediakan layanan jasa perparkiran. Kebijakan ini dilakukan agar dapat mengetahui berapa besar pajak parkir yang dikutip pengelola parkir dalam setiap bulan. “Saat ini, kita berupaya meningkatkan fungsi pajak di bidang parkir dengan melakukan mapping. Dalam hal ini, petugas Dispenda akan ditempatkan di tempat pengutipan parkir. Dengan begitu kita dapat mengetahui omset dari pajak parkir diperoleh pihak pengelola. Selain itu, kita juga mencoba melakukan komunikasi dengan wajib pajak apa yang menjadi kendala mereka dalam membayar pajak,” kata Kadispenda Kota Medan HM Husni kepada Waspada saat meninjau loket pembayaran parkir di Plaza Medan Fair, Selasa (26/2). Husni mengatakan, mapping pajak parkir ini dilakukan selama 15 hari. “Dengan penongkrongan ini, kita dapat mencatat jumlah kendaraan yang parkir. Petugas ditempatkan dengan dua shift. Pertama dari pagi hingga siang dan shift kedua dari siang hingga malam. Setiap hari dibuat laporan hasil mapping. Barulah kita mendapatkan gambaran berapa kewajiban pengelola parkir yang harus dibayar setiap bulan,” ujar Husni didampingi Kabid Penagihan Dispenda Medan Yusdarlina dan Kasi Penagihan dan Perhitungan Dispenda Medan Sutan Partahi. Mapping dilakukan secara bertahap yakni 15 hari pertama di Plaza Medan Fair. Setelah itu, dilanjutkan ke plaza, mall dan

perkantoran lainnya. “Ini merupakan hari ke-14 kita lakukan mapping di Plaza Medan Fair. Setelah itu, kita akan melakukan mapping ke Sun Plaza dan tempat-tempat parkir lainnya, Bandara Polonia, rumah sakit dan perkantoran. Pemetaan ini dilakukan untuk memaksimalkan amanah yang telah diberikan Wali Kota Medan Rahudman Harahap kepada kita agar mengupayakan semaksimal mungkin PAD. Kita juga meminta kepada wajib pajak agar benar-benar menyetorkan pajaknya dengan yang sebenarnya,” jelas Husni. Soal target PAD dari pajak parkir di Medan, mantan Kabag Aset dan Kabag Umum ini menyebutkan, untuk tahun ini target dari sektor pajak parkir sebesar Rp16 miliar. “Dari mapping inilah kita akan mengetahui seperti apa gambaran pajak parkir. Kita juga bisa melihat perhitungan tercapai atau tidaknya target pajak. Karena itu, kita sedang melakukan konsolidasi data, operasional dan memaksimalkan fungsi-fungsi ini agar dapat tercapai target tersebut,” ucap Husni. Pantauan Waspada di lapangan, seorang petugas Dispenda bernama Marodohom terlihat berdiri di dekat pintu keluar kendaraan roda empat di Plaza Medan Fair. Marodohom mencatat setiap kendaraan yang keluar. Dia juga mencatat berapa jam parkir dan pajak parkir yang dikutip pengelola. Kebijakan mapping pajak parkir yang dilakukan Dispenda Medan ini diapresiasi warga Kota Medan. Rizka warga Medan Polonia mengatakan, terobosan baru yang dilakukan Kadispenda Medan sangat baik. Dengan begitu dapat diketahui berapa sebenarnya gambaran pajak parkir yang dikutip pengelola parkir. Dengan demikian, pengelola parkir tidak bisa lagi mempermainkan setoran pajak parkirnya ke Dispenda Medan.(m50)

Waspada/ME Ginting

KEPALA Dinas Pendapatan Kota Medan HM Husni didampingi Kabid Penagihan Yusdarlina meninjau loket pembayaran parkir di Plaza Medan Fair, Selasa (26/2).

Angkot Mitra 30 Dirampok Sopir Dibuang Ke Kebun Tebu MEDAN (Waspada): Tiga pria bersenjata tajam merampok angkot Mitra 30 trayek Amplas – Belawan di Jln. Cemara dekat Tol Belmera, kawasan Percutseituan, Selasa (26/2) subuh. Tidak hanya itu, pelaku menelanjangi sang sopir, M. Sofyan, 31, serta mengikat tangan dan kakinya. Setelah itu, korban dibuang ke kawasan perkebunan tebu Jln. Sei Mencirim, Kecamatan Sunggal, Deliserdang. Informasi diperoleh Waspada di lapangan, peristiwa itu terjadi pukul 05:00, saat korban M. Sofyan, penduduk Jln. Sipongi Gang Sehati Medan, membawa angkot Mitra 30 trayek Amplas – Belawan, atas seizin sopir satu Ucok. Ketika angkot melintasi kawasan Lapangan Merdeka Medan, di stop dua pelaku yang menyaru penumpang yakni satu orang duduk di depan samping sopir dan satu lagi duduk di belakang. Dalam perjalanan menuju Belawan, satu per satu penum-

Waspada/Ismanto Ismail

KAPOLSEK Sunggal Kompol M Luther Dachi SSos, SH (dua kanan) didampingi Kanit Reskrim Iptu Bambang Gunadi Hutabarat, SH, MH (kiri) menginterogasi sopir angkot M. Sofyan, yang menjadi korban perampokan.

Fakultas Biologi UMA Seminarkan Kulit Durian MEDAN (Waspada): Sumatera Utara merupakan penghasil buah durian terbesar di Indonesia. Sementara Kabupaten Langkat daerah penghasil durian terbesar di Sumatera Utara. “Produksi durian di Sumut sebesar 579,471 ton per tahun, sementara Langkat menghasilkan 3.627 ton per tahun dari luas lahan 850 hektare.” Demikian disampaikan Dosen Biologi UMA Rosliana lubis, SSI, MSi pada Seminar Inovasi Produk dari Limbah Kulit Durian di Aula Fisip, Kampus UMA, Jln. Kolam, baru-baru ini. “Dari satu buah durian, 57 persen adalah kulit, sehingga dikuatirkan menjadi sampah jika tak dimanfaatkan. Per tahun Sumut menghasilkan 332,712 ton kulit durian , sehingga akan berdampak bagi lingkungan dan bisa menimbulkan banjir jika limbah kulit durian tidak diberdayakan. Karbohidrat, menurutnya, merupakan komponen dasar untuk membuat serat. Karena itu, solusi yang ditawarkan adalah mengolah limbah kulit durian menjadi serat alami dimodifikasi menjadi sebuah bentuk produk seperti souvenir, papan meja, bingkai foto dan sebagainya. Sementara itu, Rektor UMA Prof. Dr. HA Ya’kub Matondang, MA mengatakan, UMA telah menerapkan program tiga kompetensi, di antaranya keilmuan, kepribadian dan kompetensi kewirausahaan. Dengan adanya seminar, diharapkan bisa mengembangkan usaha kecil dan menengah termasuk pengelolaan limbah kulit durian menjadi sebuah produk yang mempunyai nilai jual tinggi.(m49)

PNS Tewas Ditabrak Truk MEDAN (Waspada): Seorang Pegawai Negeri Sipil (PNS) yang bertugas di Kantor Kelurahan Mabar dekat RPH (Rumah Potong Hewan) tewas ditabrak truk kontainer di Jln. Platina 1 Paya Rumpun, Kel. Titi Papan, Kec. Medan Deli, Selasa, (26/2) pukul 08.00 Wib. Korban Antoni Arefa, 51, warga Jln. Tangguk Sentosa II Blok III Griya Martubung, Kel. Martubung, Kec. Medan Labuhan, mengendarai sepedamotor Honda Supra berboncengan dengan anaknya yang hendak diantar korban kerja. Menurut Amri, 30, adik ipar korban, di Instalansi Jenazah RSU Pirngadi Medan, saat korban melintas di lokasi kejadian, mencoba menghindari lubang di badan jalan. Namun, korban bersama sepedamotornya terjatuh ke samping kanan, saat bersamaan melintas truk kontainer dari arah berlawanan. Akibatnya, tubuh korban dilindas truk itu hingga tewas di tempat. Sedangkan anak korban bernama Dini yang berada diboncengan diduga terjatuh ke sampingkiri hingga luput dari lindasan truk. Namun, Dini mengalami patah tangan dan luka lainnya. Kata Amri, setiap harinya korban mengantar anaknya Dini bekerja di daerah Mabar. “Setelah itu, barulah korban berangkat bekerja ke kantor Lurah Mabar,” ujarnya. Amri mengaku mendapat kabar abang iparnya mengalami kecelakaan hingga tewas dari anak kedua korban bernama Roby. Usai dilakukan autopsi, jasad korban dibawa ke rumah duka di Jln. Tangguk Sentosa II Blok III Griya Martubung, untuk dikebumikan. (h02/cay)

Pemko Biarkan Ribuan Lampu Jalan Padam MEDAN (Waspada): Pemerintah Kota Medan membiarkan ribuan lampu penerangan jalan umum padam di sejumlah ruas jalan di Medan. Akibatnya, warga menjadi resah setiap malam karena takut dengan aksi-aksi kriminalitas yang mengancam keselamatan. Berdasarkan data dari Dinas Pertamanan Kota Medan, jumlah lampu jalan yang padam sebanyak 6.500 titik dan baru 400 lampu yang dapat diperbaiki. Pantauan Waspada di lapangan, sejumlah ruas jalan di Medan memang masih banyak yang padam. Seperti di Jln. Panglima Denai, Darussalam, Ayahanda, Mandala By Pass, Sisingamangaraja, Sembada, Sei Padang, Lizardi Putra Komplek Kejaksaan kawasan Pemda, Jln. Kapten Rahmad Buddin Medan Marelan, dan lainnya. Belum lagi masih banyak lampu jalan umum di sejumlah ruas jalan kecil seperti gang-gang di Medan yang padam. Ilhamsah, warga Jln. Sembada Medan, mengatakan dirinya sangat terganggu dengan padamnya lampu jalan setiap malam. Apalagi, jika lampu padam di malam hari maka dapat mengakibatkan tingkat aksi kriminalitas semakin tinggi. “Kita merasa tidak nyaman kalau jalan pada malam hari. Rasa was-was selalu saja menghantui saya kalau pulang kerja di malam hari. Saya khawatir, apalagi saat ini aksi perampokan, genk motor juga begitu gencar. Bukan hanya materi

yang melayang, bahkan sampai nyawa pun bisa melayang,” ujar Ilham. Dia berharap agar Pemerintah Kota (Pemko) Medan dapat segera memperbaiki lampu penerangan jalan umum yang masih padam di sejumlah ruas jalan di Medan. “Kalau bisa segeralah diperbaiki oleh Pemko Medan, agar warga yang pulang bekerja di malam hari bisa nyaman dan tidak was-was seperti saya,” tuturnya. Sementara itu, Kepala Dinas Pertamanan Medan Zulkifli Sitepu mengakui, hingga saat ini memang masih banyak lampu penerangan jalan umum yang padam. Menurutnya, berdasarkan data dari Dinas Pertamanan Medan sebanyak 6.500 lampu jalan di Medan yang padam. “Hingga saat ini kita memang baru bisa memperbaiki sebanyak 400 lampu jalan yang rusak itu, lampu jalan yang rusak itu tersebar di 21 kecamatan dan itu berasal dari laporan kecamatan,” kata Zulkifli. Begitupun, dia memprediksikan, jumlah lampu penerangan jalan umum yang rusak juga bisa lebih dari 6.500. Sebab, itu masih dalam laporan. Sementara di luar laporan masyarakat, camat dan lurah tentunya masih banyak lampu jalan yang rusak. Kata dia, selama ini pihaknya berupaya untuk mempercepat perbaikan lampu penerangan jalan umum di Medan, namun masih terdapat berbagai kendala yang dihadapi. Adapun

kendala tersebut seperti keberadaan stok material untuk mengganti bola lampu ataupun untuk memperbaiki lampu masih merupakan stok di tahun anggaran 2012, sehingga stoknya juga terbatas. Sementara, untuk pengajuan stok material di tahun 2013, untuk pengadaannya masih dalam tahapan proses. Selain itu, banyaknya pencurian lampu jalan juga seperti convektor lampu jalan mengakibatkan semakin banyak lampu jalan di Medan yang padam. “Pencurian lampu jalan dan convektor lampu juga banyak terjadi, terutama lampu-lampu jalan yang tidak tinggi, ada bola lampu, panelnya, kabelnya juga dicuri, sehingga kalau convektornya dicuri satu ruas jalan itu bisa padam,” tutur Zulkifli. Kondisi fasilitas pendukung seperti mobil tangga yang dimiliki Dinas Pertamanan Medan juga dikatakan masih minim. Sebab, hingga saat ini Dinas Pertamanan Medan memiliki empat mobil tangga, tapi hanya dua yang bisa beroperasi, sedangkan dua unit lagi mobil tangganya rusak. Untuk mengatasi kendala itu, Dinas Pertamanan Medan telah melakukan strategi yakni dengan menerapkan sistem piket sebagai penanganan utama. “Kita sekarang sudah adakan piket malam untuk mengawasi lampu-lampu yang mati, dengan begitu kita bisa segera memperbaiki lampu-lampu jalan yang rusak,” ujar Zulkifli. (m50)

pang turun. Sampai di Simpang Kantor, Labuhandeli. dua pelaku yang naik dari kawasan Lapangan Merdeka tetap berada di dalam angkot. Seorang pelaku yang duduk di depan mengatakan akan menyewa angkot korban untuk mengantar ibunya ke Pinangbaris, Medan Sunggal. Korban menyetujuinya dengan meminta ongkos Rp120 ribu. Dari Simpang Kantor, angkot menuju Tanjungmulia lalu memasuki Jln. Cemara. Namun, dekat pintu tol, korban diperintahkan berhenti karena satu pelaku lagi yang baru turun dari mobil Toyota Avanza warna hitam hendak naik ke angkot. Namun, tiba-tiba pelaku yang duduk di samping sopir dan di belakang langsung mencekik leher korban sembari menodongkan senjata tajam. Sedangkan pelaku yang baru turun dari mobil Avanza meng-ambil alih kemudi angkot tersebut. Pelaku membawa angkot masuk jalan tol di Jln. Cemara dan keluar di kawasan Titi Papan, Labuhandeli. Selanjutnya menuju ke Hamparanperak.

Selama di dalam angkot, korban dianiaya dan ditelanjangi hingga hanya mengenakan pakaian dalam. Kemudian perampok tersebut membawa angkot memasuki kawasan Hamparanperak dan keluar di Jln. Binjai, Tandem Hilir. Setelah itu, angkot melaju menuju ke arah Jln. Medan-Binjai dan masuk ke Jln. Sei Mencirim, Kec. Sunggal, Deliserdang. Sesampai di kawasan Sei Mencirim tepatnya di lokasi perkebunan tebu sekira pukul 10:30, korban dibuang. Selanjutnya pelaku membawa kabur angkot tersebut. Kapolsek Sunggal Kompol M Luther Dachi SSos, SH, didampingi Kanit Reskrim Iptu Bambang Gunadi Hutabarat SH, MH mengatakan, pihaknya sudah menurunkan personel ke Tempat Kejadian Perkara (TKP) guna melakukan penyelidikan. Sementara korban M Sofyan kepada Waspada mengatakan, selain membawa kabur angkot, kawanan rampok mengambil dompet korban berisi uang Rp300 ribu, SIM dan surat-surat lainnya.(m36)

Guru, Siswa Dari Asia-Eropa Ikuti Konferensi Internasional Ke-2 MEDAN (Waspada): Guru dan siswa dari Asia dan Eropa yaitu Malaysia, Filipina, Italia, Yunani, Jerman, Perancis, serta dari Jatim, Jakarta, Mojokerto, mengikuti Konferensi Internasional Ke-2 yang diselenggarakan Madrasah Aliyah Negeri (MAN) 1 Medan (sebagai tuan rumah), di Hotel Santika Medan, Selasa (26/2) s/d 2 Maret 2013. Ketua panitia Dr H Burhanuddin MPd, didampingi Humas M Buwing mengatakan, tujuan konferensi internasional melibatkan guru dan siswa dari Asia-Eropa untuk berinteraksi, mengenal satu sama lain, membangun pemahaman antar budaya untuk dapat bekerjasama membangun dunia yang lebih damai melalui pendidikan. Para peserta membahas berbagai isu mengenai pembelajaran budaya dan lingkungan, menampilkan pemakalah Prof Iwan Pranoto (Indonesia), Dr Zafeiroula Kagkalidou (Yunani), Dr Maria Linda Venterilla (Filipina), Mrs Ioanna Psina (Yunani) dan Mrs Fotteini (Yunani).

MAN 1 Medan merupakan anggota komunitas internasional Asia Europe Classroom Network (AEC-NET). “Pada tahun 2013 Indonesia mendapat kehormatan dalam penyelenggaraan konferensi My World Conference kedua, dimana MAN 1 mendapat kepercayaan sebagai tuan rumah penyelenggara (mewakili Pemko Medan) merupakan satu kebanggaan tersendiri,” kata Burhanuddin. Kegiatan Konferensi Internasional Ke-2 sangat bervariasi, namun bertujuan agar siswa dan guru Asia-Eropa bisa berinteraksi dan belajar bersama. Siswa mancanegara yang hadir mengikuti homestay, menginap di rumah siswa dari MAN1 Medan. Juga ada cultural workshop, dimana para siswa dari masingmasing negara memperkenalkan budayanya dengan menampilkan tari-tarian dan berbagai kesenian lainnya. Para siswa juga bergabung mengikuti lokakarya mengenai kegiatan berburu jamur, dan beternak jamur, sekaligus membuat karya

seni dan jamur. Siswa juga belajar mengenal augmented reality, bagaimana menghubungkan objek virtual dengan dunia nyata. Kata Burhanuddin, guru Asia-Eropa juga belajar mengenai sistem pendidikan Indonesia. Guru melakukan observasi kelas, mengamati cara guru mengajar, melihat karya siswa, serta mengunjungi perpustakaan dan laboratorium. Serta mengikuti workshop mengenai mengajarkan matematika melalui seni dan bagaimana pelajaran bahasa bisa membangun kesadaran siswa mengenai isu lingkungan dan budaya. Wali Kota Medan H Rahudman Harahap ketika membuka Konferensi Internasional Ke-2 mengharapkan agar para peserta khususnya dari Indonesia, dapat memanfaatkannya untuk saling tukar ilmu pengetahuan dengan peserta mancanegara. Acara turut dihadiri Wakil Wali Kota Medan, Sekda Kota Medan, Kadis Pendidikan dan Kamenag Kota Medan, serta SKPD lainnya.(m24)

Polisi Dalami Keterlibatan Bripka BN MEDAN (Waspada): Sampai saat ini, penyidik Reskrim Polresta Medan terus mendalami keterlibatan oknum polisi Bripka BN dalam kasus perampokan di Dunia Internasional Taylor Jln. Gatot Subroto Medan. “Masih kita dalami berapa kali yang bersangkutan terlibat aksi perampokan di Medan,” kata sumber di Polresta Medan, Senin (25/2). Saat ini, Bripka BN sudah dijebloskan dalam tahanan Polresta Medan. “Tersangka dijebloskan dalam tahanan karena terlibat tindak pidana,” katanya. Menurut sumber, Bripka BN setiap hari masuk kerja. Namun, selama menjalani dinas, tidak ada prestasinya yang menonjol. “Orangnya biasa-biasa saja. Tiap hari masuk dinas,” katanya. Sumber juga belum bisa menjelaskan kenapa Bripka BN bisa terlibat kasus perampokan. “Apakah ada masalah dengan ekonomi atau sebab lain belum

bisa dipastikan,” tambahnya. Jalani Pemeriksaan Sementara itu,Wakasat Reskrim AKP Hendra mengatakan, penyidik Reskrim Unit Jahtanras Polresta Medan telah melakukan pemeriksaan terhadap tujuh tersangka di RS Bhayangkara Medan. “Sudah dilakukan pemeriksaan terhadap tujuh tersangka yang ditembak kakinya,” jelas Hendra. Dari hasil pemeriksaan, oknum polisi Bripka BN terlibat dalam aksi perampokan dan berperan sebagai pemantau lokasi dan pemberi informasi kepada pelaku lainnya. Informasi lainnya yang diperoleh Waspada di Polresta Medan, saat menjalani pemeriksaan Bripka BN membantah terlibat aksi perampokan di Jln. Gatot Subroto Medan. Bahkan saat menjalani pemeriksaan di Propam Polresta Medan, Bripka BN tetap membantah terlibat perampokan. Menurut Kasi Propam Pol-

resta Medan AKP Afdhal Junaidi, saat menjalani pemeriksaan di Propam, BN tidak mengakui terlibat dalam perampokan bersenpi itu. Meski oknum polisi itu tidak mengakui keterlibatannya, pihaknya akan memeriksa saksi-saksi. “Kita tidak bisa memaksa dia mengaku, tapi ada saksi-saksi. Kita akan periksa saksi-saksi lain,” katanya. Dijelaskannya, pemeriksaan yang dilakukan Propam terhadap Bripka BN merupakan pelanggaran kode etik dan disiplin. Sedangkan tindak kriminalnya akan diperiksa Sat Reskrim. “Kita hanya memeriksa pelanggaran kode etik dan disiplin saja, kalau kriminalnya tanya saja ke Reskrim,” kata AKP Afdhal. Menurut Afdhal, sebelum menjalani pemeriksaan di Reskrim, Propam Polresta Medan telah melakukan pemeriksaan selama dua jam pada Sabtu (23/ 2).“Pemeriksaanawal,kitaperiksa selama dua jam,” ujarnya.(m39)


WASPADA Rabu 27 Februari 2013


PeralihanTanah Dan BanditTanah Surat Terbuka Untuk KPU Sumut Dengan hormat, Dimaklumi bahwa sepanjang masih berlaku undang-undang dan peraturan tentang Pemilihan Umum, maka Pemilihan Umum akan tetap dilaksanakan. Terkait untuk menjadi anggota PPK, PPS dan KPPS di Kota Binjai diperlukan 2222 orang personil. Persyaratan yang saya garis bawahi ialah pelamar tidak anggota partai politik. Untuk Binjai misalnya, dibutuhkan: 1. PPK 5 Kecamatan 5 x 5 orang = 25 orang 2. PPS 37 Kelurahan 37 x 3 orang = 111 orang 3. KPPS 298 x 7 orang = 2086 orang + Diperkirakan berjumlah = 2222 orang Keanggotaan harus bersih dari keanggotaan partai politik yang hanya diyakini melalui surat pernyataan yang semestinya bermaterai Rp. 6,000,Tetapi nyatanya boleh tidak dibubuhi materai, seolah asal jadi. Dari angka di atas, tahukah KPU Binjai jika ada yang menyembunyikan keanggotaan partai politiknya? Oleh karena itu, sebaiknya dipertimbangkan tentang syarat: “tidak menjadi anggota partai politik” agar ditiadakan dengan pertimbangan bahwa: 1. Tidak membatasi haknya sebagai warga negara. 2. Menghapuskan rasa curiga, apalagi jika pejabat yang bersangkutan mendengar informasi seenaknya. 3. Pemerintah membutuhkan dan mengayomi partai politik, kenapa anggota partai politik diabaikan. 4. Untuk menghindarkan sifat sembunyi-sembunyi. Mohon dipertimbangkan, jika perlu saran ini diteruskan ke KPU tingkat atas. Mohon maaf apabila saran ini kurang berkenan, terima kasih. Hormat Saya Amiruddin

Trend Kampanye Ala Jokowi Trend kampanye blusukan ala jokowi sekarang sedang menjadi trend bagi para politikus indonesia yang ingin mendapatkan simpati dari warga masyarakat termasuk juga para kandidat buat pilkada sumatera utara, para calon kandidat untuk sumut 1 sekarang berlomba mencari simpati masyarakat sumatera utara dengan ikut ikutan masuk ke gang – gang dan daerah terpencil bahkan di wilayah yang terjadi bencana , itu semua agar mendapat suara nanti pada saat pilkada nanti. Apakah dengan mengikuti cara kampanye blusukan ala Jokowi para kandidat calon sumut satu akan menang seperti Jokowi yang telah memimpin jakarta????? Belum tentu, masyarakat sekarang lebih pintar dan lebih tahu mana yang terbaik buat memimpin sumut nantinya jadi trend kampanye ala Jokowi yang berhasil di Jakarta belum tentu berhasil di sumatera utara, Dan Jokowi sendiri telah membuktikan dirinya sebagai walikota terbaik no 3 didunia lalu apa yang telah dibuktikan oleh para calon kandidat di Sumatera Utara sendiri , walaupun begitu jika ada para kandidat yang ingin mengikuti kampanye blusukannya jokowi ya anda harus benar – benar telah membuktikan hasil kerja anda buat sumatera utara jangan hanya pada waktu kampanye aja sibuk mendatangi masyarakatnya begitu selesai pemilihan lupa sama yang telah memilih. W.YUDA.W Stabat, Langkat

Hujan, Banjir, Musibah Assalamu’alaikum.W.W. Banjir di ibu kota Negara Indonesia Jakarta telah Mempermalukan Bangsa Indonesia dimata bangsa lain, dan ini merupakan “AZAB” AKIBAT serta AKUMULASI dari: 1.Kelakuan Buruk dan Prilaku Maksiat Pejabat Negara dan warga kepada Allah SWT, sesungguhnya ini peringatan Keras dari Allah bagi semua Pejabat & semua anak bangsa, khusus kepada pejabat & umat Islam, yang k/aktivitas Pembangunan dinegara ini, termasuk kemungkinan besar pasti pejabat (suka) nambah istri dengan cara siri ATAU suka melakukan perbuatan Zinah 2.Walau tidak separah yang ditimpakan Allah pada warga yang dihantam Gempa dan Badai tetapi akhirnya rakyat miskin tak bersalahpun ikut jadi korban 3.Diantara perbuatan Maksiat kepada Allah SWT adalah karena sebagian Pejabat Negara telah berbuat “MUNGKAR” dengan maraknya Prilaku Korupsi & Mark Up uang negara termasuk “SUKA MELAKUKAN PERBUATAN SYIRIK” kepada Allah SWT, 4.Sejak Reformasi dan hingga saat ini sangat banyak MUSIBAH BESAR ditimpakan Allah kepada anak bangsa ini, 5.Segera TAUBATAN NASUHA Wahai semua Pejabat dan juga kepada warga yang suka melanggar Hukum ALLAH & MELUPAKAN Allah SWT, sebelum Nyawa kita diambil NYA. Ir.Zulkifli AM Wassalam +6281263191734

Ultah Rhyback Attack III Ke 12 Dikampus ITM Perhelatan luar biasa di kampus ITM 10/2-2013 di sinilah perhelatan itu dimulai. Para Underground dengan baju hitam hitam ciri has Metal. Merupakan matra kehormatan di jalur bawah tanah silih berganti berdatangan kekampus tersebut, dipelopori oleh bung Owet. Kita lihat kinerja panitia bekerja cukup profesional dan Bung Owet sangat dekat dengan para pemburu berita. Secara universal dari perjalanan mereka membuat even dinilai cukup pengalaman. Rata-rata penonton puas, terpuaskan setiap kali mereka menggelar acara, dimanapun Rhyback selalu bikin gebrakan. Rhyback ada di enam kota yakni; Brandan, Stabat, Binjai, Belawan, Indrapura, serta Batubara. Dalam acara tersebut ada 31 band yang ikutan mulai 22 Souls s/d NXM REWELL, DZAT, INTIFADA, THE VENGEANCE OF S, ICREDIBLE, CURSED OF FACE, ILUSI, DEMON OF AMBROSIA, SYAHID, SPB MST DE, SQUADRON, LAKNAT, ROWO RONTHEK, dll. Makin datangnya malam suasana musik cadas yang dibawakan mereka semakin menggetarkan hati. E THE REAL band dari Singapura merupakan bintang tamu kehormatan, penonton menssuportnya. Satu hal lagi tahun 2013 ini merupakan tahun kebangkitan Underground dan akhirnya Bravo untuk Bung Owet dan Selamat Ultah nih Rhyback yang ke 12. Akhairulqalam atas berkenaannya redaksi harian Waspada menerima dan memuat tulisan saya ini di kolom Surat Pembaca di haturkan terimakasih. Salam Undergraund Untuk Semua Uli Surya Abdurrahmansyah HTG Binjai Barat

Oleh Prof Dr Muhammad Yamin Lubis, SH, MS, CN “…peralihan atau transaksi tanah, yang akhir-akhir ini sering dilaksankan secara ilegal atau tidak prosedur hukum, akhirnya menciptakan kesemrawutan di tengah masyarakat.


alam hukum tanah, beralih dan dialihkan adalah dua perbuatan hukum yang berbeda dilakukan di atas tanah. Namun, dalam PP 24/97 dan PMNA 3/97, lebih banyak ditemukan pekerjaan peralihan hak daripada kata pengalihan, untuk dilakukan pencatatannya oleh Kantor Pertanahan. Maka peralihan tanah ini adalah perbuatan hukum legal yang dilindungi asal memenuhi syarat dan prosedur—harus dilaksanakan pencatatan demi terciptanya perlindungan dan kepastian hukum hak atas tanah tersebut. Bahkan, setiap benda yang bernilai ekonomis tinggi, jika dialihkan harus secara hukum dan menurut hukum yang sah sehingga peralihan tersebut benar. Yang mengalihkan maupun yang menerima pengalihan sama-sama dilindungi hukum. Benda di sini adalah harus merupakan objek hukum. Asal jangan benda tersebut tidak sah diperdagangkan, seperti manusia dan atau barang haram seperti ganja dan atau sejenis Narkoba, maka tidak perlu surat atau persyaratan hukumnya. Artinya, setiap peralihan benda milik (yang menjadi objek hukum) jika dialihkan haruslah sesuai ketentuan hukum yang benar. Manakala para pihak terjadi wanprestasi atas tindakan ikutannya, maka dapat dimintai pertanggungjawaban hukum atasanya Mereka yang merasa dirugikan juga harus dilindungi hukum dan dapat minta perlindungan hukum pada negara untuk menunaikan haknya yang terkoreksi atas perbuatan seseorang. Ketentuan inilah yang disebut transaksi dan dapat disebut perbuatan hukum. Maka, transaksi ini tidak boleh cacat atau melawan hukum. Khusus peralihan atau transaksi tanah, yang akhir-akhir ini sering dilaksankan secara ilegal atau tidak prosedur hukum, akhirnya menciptakan kesemrawutan di tengah masyarakat. Oleh karenanya, dalam transaksi tanah, sangat perlu kehatihatian atas perbuatan hukumnya, bahkan orang yang melakukan transaksinya dan bukti-bukti yang mendasasrinya juga harus diperhatikan agar tidak menjadi sengketa di kemudian hari. Apalagi, di dalamnya masih bisa dibedakan transaksi tanah, yang bersertifikat dan atau transaksi tanah yang

belum bersertifikat. Karena, jika tanah yang ditransaksikan telah bersertifikat, maka perbuatan hukum atasnya harus dilakukan di depan PPAT dengan akta PPAT. Jika tidak, transaksi ini mungkin saja dapat sah bila memenuhi ketentuan dan sarat adanya transaksi seperti disebutkan dalam pasal 1320 BW. Namun, perbuatan untuk melakukan balik namanya tidak bisa dilakukan, jika persyaratan administratif yang ditentukan oleh hukum agraria tidak dipenuhi. Di dalamnya ada dua tindakan hukum, yakni tindakan atas pengalihan dan tindakan untuk melakukan balik nama di Kantor Pertanahan. Sehingga bila tindakan keperdataannya sah dan administrasinya benar, maka dengan demikian baru disebut masuk sesuai dengan kehendak hukum, atau disebut terang (peteng) atau legal. Jadi ,jika seseorang masih dapat melakukan perbuatan hukum padahal syarat hukum tidak dipenuhi apakah karena kolusi dan pembayaran upeti dan atau sejenisnya, tentulah seseorang tersebut dapat disebut berbuat ilegal dan bila dalam tindakan terhadap tanah, dengan niat mencari uang di dalamnya maka tindakan inilah yang sering disebut jadinya tindakan mafia tanah atau tidakan yang dilakukan oleh bandit-bandit tanah. Tindakan peralihan hak atas tanah sebagaimana diributkan saat ini atas adanya pengalihan sebagian tanah Kantor Gubernur Jalan Pancing, yang saat ini katanya dikuasai IMI dan diduga telah pula pernah dialihkan pada perusahaan tertentu untuk pembangunan perumahan, tentu sangat menarik untuk diberi komentar hukumnya menurut dimensi hukum agraria agar tidak terjadi kesalahan dan tidak disebut tindakan mafia tanah. Jika memang telah terjadi perbuatan hukum yang bermaksud mengalihkannya di tanah tersebut karena telah sesuai dengan kehendak hukum agraria artinya sah dan legal maka pasti tidak pernah diributkan. Jika tidak benar peralihannya dilakukan menurut hukum agraria, atau telah terjadi pengalihan tanah tersebut yang tidak sah atau di luar ketentuan hukum, tentu ke depan akan menyisakan persoalan baru. Akibatnya dapat merugikan negara sebab pemiliknya adalah negara. Dan jika tanah dimaksud telah menja-

di tanah milik privat tentu harus dipertanyakan kenapa juga menajadi milik privat. Sebab, semua orang tahu, di daerah desa lokasi ini tidak ada milik privat, yang ada adalah milik publik dengan HPL no 590 atas nama Gubernur Kepala Daerah Tingkat I Sumatera Utara. Tulisan ini tidak bermaksud untuk mencampuri dan mengeruhkan suasana, namun sebagai seorang yang mengetahui hukum agraria, karena sudah sering diributkan, tentu sebagai anak bangsa terpanggil untuk menjernihkannya dalam koridor hukum agraria sehingga tidak ada yang dirugikan atasnya ke depan. Agar siapa sajapun yang melakukan peralihan hak atas tanah atau tanah, maka kunci utama yang harus dipedomani ada minimal tiga hal untuk diperhatikan di dalamnya, sehingga peralihannya dapat sejalan dengan kehendak hukum: yakni pertama, setiap yang melakukan peralihan tanah/hak atas tanah harus memperhatikan keberadaan bukti haknya, atau dasar penguasaan hak tersebut. Bukti boleh berupa alas hak saja atau lebih baik bila bukti haknya berupa sertifikat; kedua yang disebut di bukti hak tersebut memang dia orangnya. Jadi orang yanag mengalihkan itu dapat dipastikan adalah benar-benar orang yang punya hak; dan yang ketiga memang berwenang pula dia untuk melakukan peralihan hak atas tanah dimaksud. Artinya, jika misalnya tanah warisan yang dialihkan tidak hanya cukup seorang saja yang melakukan peralihan jika ahli warisnya memang lebih dari satu, sungguh pun dia sudah punya bukti dan dia adalah salahsatu orang yang dibukti tersebut. Karena yang satu saja melakukan peralihan dalam hal kepemilkan banyak orang, tentulah seseorang ini belum berwenang disebutkan sebab kepemilikannya belum dibagi. Ini yang sering tidak diperhatikan sehingga menjadi persoalan bagi yang akan melakukan transaksi tanah, kewenangannya tidak penuh lalu dialihkannya juga tanah tersebut. Jika terjadi transaksi ini namanya di luar kewenangan dan di luar haknya. Prinsip hukum akan berlaku “orang hanya boleh menyerahkan hak sesuai hak yang ada padanya”. Jika ketiga hal tersebut tidak dipedomani, maka akan bermasalahlah perbuatan hukum peralihan tanah atau hak atas tanah dimaksud. Artinya, jika dipedomani, maka secara perdata sah dan secara administratif akan dapat dilaksanakan nantinya dalam hal kepentingan pendaftarannya termasuk balik namanya. Maka jika hal ini dilihat dari keadaan peralihan atas tanah Jalan Pancing, maka lihatlah bukti kepemilikannya lebih awal,lalu orang

yang mengalihkan dan kewenangan mengalihkannya, tentu akan dapat dinyatakan benar bahwa jika terjadi peralihan akan tepat dan dalam koridor hukum. Lalu siapa yang mengalihkan, apakah dia punya kewenangan, jika ya, maka sah peralihan, dan jika tidak tentu peralihan adalah ilegal. Sehingga jika terjadi juga peralihan atasnya padahal ketiga syarat tersebut tidak ada, maka hati-hatilah, itu adalah perbuatan ilegal. Sepanjang yang menyangkut bukti kepemilikan, bukankah lokasi ini hanya diperuntukkan untuk kepentingan publik, pendidikan dan kepentingan sosial, sejak adanya SK Gubernur No 590/2758/K/89 ditandatangani Raja Inal Siregar (bukan Kaharudin Nasution), pada lokasi ini sudah diberikan peruntukannya dalam kapling yang terdiri dari pendidikan, sosial keagamaan , organisasi politik dan beberapa yayasan dan jika tidak salah yang salah satu persil diperuntukkan bagi HIKMA untuk kepentingan pengembangan kebudayaan pada persil 10. Tentulah sangat aneh jika persil yang diperuntukkan bagi Gubernur Tingkat I dalam rangka peningkatan pelayanan masyarakatnya, sesuai dengan SK Gubsu- 590 tersebut menjadi peruntukan bagi pengembangan perumahan, yang notrabenenya milik pemerintah atau bukan swasta (privat) , dan pantas diusut siapa saja yang melakukan peralihan tersebut, untuk melihat apakah dia berwenang sehingga tidak terjadi peralihan aset negara yang tidak legal, seperti yang selama ini disinyalir banyak terjadi atas tanah aset negara di daerah ini beralih ke pihak ketiga bahkan jadi raib dari aset negara. Tapi anehnya, di negara ini dapat saja terjadi hal yang demikian dan mereka bilang itu biasa saja dan gampang serta mudah diselesaikan. Perkara belakanganlah. Seharusnya orang-orang yang berwenang dan diberi amanah saat ini atas kewenangan mengalihkan tanah aset negara tersebut harus mencermati dengan baik. Karena pasti jika ada yang menyebut peralihan tanah tanpa alas hak, tanpa kewenangan dan tanpa prosedur itu legal, hanyalah mafia-mafia tanah tersebut yang mempermainkan hukum demi memperkaya diri dan ini bisa jadi objek penyelidikan KPK. Dan jika terus terjadi, tunggu saatnya persoalan tanah akan sangat komplek dan terus-terusan di negara ini. Semoga para calon Gubsu dapat memperhatikan atas adanya peralihan tanah yang katanya dapat diurus tapi di luar hukum. Penulis adalah Guru Besar Hukum Agraria USU, Ketua Program Studi Magister Kenotariatan USU

Pembelajaran Menyenangkan Dapat Menyesatkan Oleh Abdul Hakim Siregar, MSi “…konsep pembelajaran menyenangkan (learning is fun) dapat menyesatkan, karena bisa mengikis keseriusan dan kesungguhsungguhan yang dibutuhkan dalam pembelajaran atau kerja intelektual tingkat tinggi.


ara guru yang pernah mengikuti Diklat semisal Pendidikan dan Pelatihan Profesi Guru pasti lazim mendengar konsep pembelajaran PAKEM atau PAIKEM (Partisipasif, Aktif, Kreatif, Inovatif, Efektif, dan Menyenangkan). Saya sendiri, setidaknya dua kali berhadapan dengan dosen sekaligus tutor Diklat yang komat-kamit, dari mulutnya, Pakem–Paikem. Katanya, konsep pembelajaran kini menyenangkan (learning is fun). Bahkan, saya sempat ditegur seorang dosen bahasa Inggris, saat mengikuti matrikulasi bahasa Inggris di UIN (Universitas Islam Negeri) Yogyakarta pada 2008. Mr.Roma, nama dosen bahasa Inggris tersebut, menuding saya terlalu serius mengikuti perkuliahan. Katanya, saya jarang tertawa. Kali kedua, ketika saya mengikuti Diklat Prajabatan Calon Pegawai Negeri Sipil (CPNS) Kementerian Agama di Balai Diklat Keagamaan Medan, 0923 November 2010. Para widyaiswara CPNS itu sering membuat guyonan saat Diklat. Setidaknya, dua tutor, Bu Seriwati Bukit dan Pak Mahmun Syarif Nasution menegur saya karena dianggap terlalu serius. Dugaan saya, bagi mereka, kata “serius” berkonotasi negatif (kaku/stres). Saya sendiri memaknainya positif, yakni kata “serius” sinonim dengan “sungguh-sungguh.” Menyesatkan Tanyalah Instruktur atau tutor Diklat, pecandu konsep pembelajaran Pakem (Partisipasif, Aktif, Kreatif, Efektif, dan Menyenangkan)! Apakah konsep Pakem terpadu? Ataukah konsep Pakem terpisah–berdiri sendiri (PA-K-E-M)? Apakah konsep Pakem bersifat umum, meliputi semua matapelajaran atau khusus — hanya mata pelajaran (pokok bahasan) tertentu? Materi apa saja yang sesuai dengan Pakem dan materi mana yang tidak cocok Pakem? Siapakah yang sanggup merancang konsep Pakem dalam satu paket RPP? Bagaimana menerapkan konsep Pakem di ruang kelas? Apakah siswa benar-benar Pakem? Atau malah poken (pasar; dalam istilah bahasa

Batak), gaduh? Bagaimana hasil pembelajarannya? Tuntaskah KD (kompetensi dasar) dalam pembelajaran? Saya tidak membahas semua konsep Pakem itu. Cuma, satu saja, M-nya, yakni pembelajaran menyenangkan (M). Konsep pembelajaran menyenangkan (learning is fun/joyfull instruction) berinduk semang pada prinsip pembelajaran berpusat pada siswa, student centered learning. Sebagai antitesa pembelajaran sebelumnya yang didominasi guru, teacher center. Pembelajaran menyenangkan (M) menghendaki hubungan baik guru dan siswa, tanpa ada perasaan terpaksa atau tertekan. Guru memosisikan diri sebagai mitra sejawat siswa. Pada akhirnya, terciptalah iklim demokratisasi pembelajaran. Tandingannya, otorisasi guru. Padahal, pembelajaran tidaklah sesederhana itu. Pembelajaran sangat kompleks. Umpamanya, bagaimana merancang pembelajaran yang menyenangkan seluruh siswa? Mustahil, kan? Setiap pembelajaran, tetap saja ada siswa yang senang, yang kurang senang, bahkan sebagian mungkin benar-benar merasa bosan. Nah, bagaimana ini? Lagipula, dari mana sebetulnya sumber pembelajaran menyenangkan, individu guru atau siswa atau sekaligus duaduanya? Ataukah termasuk saranaprasarana sekolah dan media pembelajaran yang memadai? Lalu, bagaimana pula caranya menyingkirkan perasaan tertekan? Pasalnya, tekanan bahkan stres dalam kadar tertentu ada baiknya dalam pembelajaran supaya siswa lebih sungguh-sungguh. Justru karena itu, iklan lowongan kerja kerap membubuhi dan membutuhkan orang yang tahan tekanan (under pressure). Sekarang, bagaimana jadinya kalau sekolah sudah menafikan tekanan, berkilah pada konsep pembelajaran menyenangkan (M)? Tugas siswa di rumah, PR (pekerjaan rumah) misalnya, bukankah termasuk beban siswa? Secara umum, para siswa merasa terbebani gara-gara PR. Bahkan sampai kita mahasiswa

tugas kuliah, seperti makalah, skripsi, tesis, dan disertasi menjadi ganjalan di pikiran sebelum disiapkan. Lantaran itulah, kita mengerjakannya biar plong. Kalau tidak ada perasaan tertekan seperti itu, mungkin PR atau tugas kuliah itu tak akan kunjung selesai. Ini tentunya, tidak menampik niat tulus, motivasi lain di luar kata, tertekan.Termasuk ujian, sedikit banyaknya akan terasa menekan (khawatir tidak lulus) bagi siswa, sehingga mereka menghapal sebelum ujian. Jika tidak ada rasa tertekan, jangan-jangan menunjukkan ketidakpedulian, acuh tak acuh terhadap pembelajaran. Sekali lagi, bukan menampik niat ikhlas dan panggilan jiwa (greatness) dalam belajar, cinta ilmu.

Dengan demikian, konsep pembelajaran menyenangkan (learning is fun) dapat menyesatkan, karena bisa mengikis keseriusan dan kesungguhsungguhan yang dibutuhkan dalam pembelajaran atau kerja intelektual tingkat tinggi. Pembelajaran menyenangkan (fun) menjungkirbalikkan kerja keras pada kelakar, tidak menyelesaikan masalah. Secara terbalik, membuat kita menghindari tekanan dan tantangan. Padahal, humor yang paling baik ialah yang paling benar– apa adanya, tidak mengandung unsur dusta–apalagi bualan yang sengaja dibuat-buat guna hiburan sesaat. Penulis adalah Guru MSN2 & SMASNI Padangsidimpuan


B8 07.00 Dahsyat 09.00 Sinema Pagi 11:00 Infotainment : INTENS 12:00 Seputar Indonesia Siang 12:30 Namaku Cinta 14.30 Cek & Ricek 15.00 Silet 15.30 Hanya Kamu 16.30 Seputar Indonesia 17.00 Yang Muda Yang Bercinta 18.30 Cinta 7 Susun 19.30 Tukang Bubur Naik Haji 22.30 Sedap Malam 23.30 Film Tengah Malam


07:00 Inbox 09.00 Liputan 6 Terkini 09:03 Halo Selebriti 10:00 SCTV FTV 12:00 SL Liputan 6 Siang 12:30 SCTV FTV Siang 14.03 SCTV FTV Siang 14:30 SL Eat Bulaga Indonesia 16.00 Liputan 6 Terkini 16:03 SL Eat Bulaga Indonesia 16:30 SL Liputan 6 Petang 17.00 Cookies 18.00 Biang Kerok Cilik 19.30 Ji Ung Pendekar Cabe Rawit 20.30 SCTV SInetron : Ustad Fotocopy 22.30 Liputan 6 Terkini 23.00 SCTV FTV Utama

07.30 Serial Pilihan 09.00 Serial Pilihan 10:30 Kisah Unggulan 11:30 Lintas Siang 12:00 Layar Kemilau 13:30 I Drama 15:00 Diantara Kita 15:30 Lintas Petang 16.00 Animasi Spesial 18.00 Somad 19:00 Legenda MD The Series 21.00 Raden Kian Santang 22:00 Berbagi Cinta 23:00 Intermeaao 00.00 Lintas Malam

07:30 Perempuan Hebat 08.00 Selebrity Punya Story 08:30 Seleb @ Seleb 09.00 Sinema Spesial 10:30 New Friends 11:30 Topik Siang 12:00 Klik ! 13:00 Tom & Jerry 14:00 Tom & Jerry 14:30 Chottan Bheem 15.00 Ghost Gang 15.30 Chotta Bheem 16:30 Suka Suka NIzam 17:30 Topik Petang 18:00 Pesbukers 19:30 Catatan Si Olga 20:30 Princess Hours 21:30 Mel’s Update 22:30 Bexxstyle 23:30 Cakrawala

07:00 KISS Pagi 08:00 Sinema TV Pagi 10:00 Sinema TV Spesial 12:00 Patroli 12:30 Sinema Drama Indonesia 14:30 KISS Sore 15:30 Fokus 16.00 Kata Hati 17.00 Drama Seri Indonesia 18:00 Drama Seri Indonesia 20:00 Drama Seri Keluarga 22:00 Mega Bollywood

07:05 WIB Bedah Editorial Media Indonesia 08:05 WIB 8 Eleven Show 11:30 WIB Metro Siang 13:05 WIB Wideshot 16:30 WIB Java Overland 18:05 WIB Metro Hari Ini 19:05 WIB Suara Anda 20:30 WIB Otoblitz 21:05 WIB Top Nine News 21:30 WIB Mata Najwa 22:30 WIB Stand Up Comedy 23:05 WIB Metro Realitas 23:30WIB Metro Sports

WASPADA Rabu 27 Februari 2013

07:30 Ranking 1 08:30 Sinema Pagi Indonesia 10:30 Moccachino 11.00 Insert Siang 12:00 Reportase Siang 12:00 Bioskop Indonesia 14:00 Reportase Siang 14:30 Sketsa 15.450 Show Imah 16:45 Reportase Sore 17:15 Insert Investigasi 18:00 Ethnic Runaway 19:00 Oh Ternyata 20:00 Bioskop TransTV 00:00 Bioskop TransTV

09:30 Live News Kabar Pasar Pagi 10:00 Coffee Break 11:30 Live News Kabar Siang 13:30 Apa Kabar Indonesia Siang 15:30 Live News Kabar Pasar 16:00 Live News Kabar Petang 19:00 Kabar Utama 20:00 Apa Kabar Indonesia Malam 21:00 Live News Kabar Malam 22:00 Menyingkap Tabir 22:30 Kabar Arena 23:00 Radio Show

08:00 The Penguins Of Madagascar 08:30 Sketsa Tawa 09.00 Dapoer Cobek 09.30 Hot Spot 10:00 Obsesi 11:00 Buletin Indonesia Siang 12:00 Untung Ada Sule 13.00 Kungfu Panda 13:30 Avatar 14:00 100 % Ampuh 17:00 Fokus Selebriti 17:30 Transformers Prime 18.00 Jomblowati 19.00 Raja Dan Aku 20.00 Kinara 21.00 Big Movie 23:30 Big Movie

07:30 Selebrita Pagi 08:00 Makan Besar 08:30 Gak Nyangka 09:00 Ups Salah 09:30 Spotlite 10:30 Warna 12:00 Selebrita Siang 12:30 Si Bolang 13:00 Laptop Si Unyil 13:30 Dunia Binatang 14:00 Brownies 15:00 Fish N Chef 16:00 Redaksi Sore 17:00 Orang Pinggiran 18:00 Hitam Putih 19:00 On The Spot 20:00 Opera Van Java 22:00 Bukan Empat Mata 23:30 Berburu 00:00 Jejak Jejak Misterius 00:30 Sport7 Malam

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan


Jurus Jitu “Naga Bonar” Mendulang Suara

Daniel Day-Lewis Tiga Kali Aktor Terbaik

LANGKAH positif Deddy Mizwar merambah dunia politik dengan maju sebagai calon wakil Gubernur Jawa Barat mendampingi Cagub Gubernur Ahmad Heryawan, pantas diikuti para kandidat yang maju dalam Pilkada. Pasalnya, sineas dan aktor kawakan berjuluk Si Naga Bonar bersama pasangannya memiliki jurus jitu dalam mendulang suara hingga unggul sementara dalam perhitungan cepat Pilgub/Cawagub Jabar. “Jurus jitunya sederhana, tapi teramat sulit diterapkan kandidat lain. Yakni menghindari bahkan anti menebar janji-janji muluk dalam serangkaian kampanye Pilkada di bumi Parahyangan,” papar Deddy Mizwar di Bekasi Jawa Barat. Menurut aktor peraih 5 Piala Citra FFI termasuk dua diantaranya lewat peran utama Jenderal Naga Bonar dalam film Naga Bonar (1987) dan Naga Bonar Jadi 2 (2007) ini, sejak maju dalam Pilkada Jabar 2013-2015, dirinya dan Kang Aher sepakat benar-benar anti menebar janji-janji muluk kepada masyarakat Jabar. “Tapi, lebih mengedepankan janji rasional yang benar-benar yakin dapat direalisasikan ketika kami menjadi orang nomor satu dan dua Jabar. Sebab, sekali berbohong , otomatis kita akan berbohong selama lima tahun kedepan,” papar suami dari R Giselawati Wiranegara yang sudah terjun sebagai aktor sejak membintangi film Cinta Abadi tahun 1976. Ditambahkan pria kelahiran Jakarta 5 Maret 1955 ini, dirinya sangat sadar jabatan publik bisa membuat pemimpin masuk syurga – tapi bisa pula terjerembab ke neraka. “Setelah tiga puluh lima tahun lebih memberi inspirasi masyarakat luas lewat dunia perfilman nasional, kini saatnya saya lebih fokus beribadah. Diantaranya bahu-membahu dengan Kang Aher merealisasikan program pembangunan yang rasional, ”tandas produser dan pemeran Bang Jack dalam sinetron Para Pencari Tuhan yang siap mengakhiri kontrak sejumlah iklan ternama bila seandainya pihak produsennya enggan menggunakan ikon pejabat publik. * (AgusT)

Aktor Inggris Daniel Day-Lewis menjadi satu-satunya aktor meraih Aktor Terbaik di Academy Awards sebanyak tiga kali. Tahun ini, Day-Lewis meraih Piala Oscar untuk Lincoln, film dibintanginya sebagai pemeran utama, sebagai Presiden Abraham Lincoln. Ia pun mendapat standing ovation dari tamu Academy Awards ketika namanya dipanggil Merryl Streep. “Saya tidak tahu bagaimana ini bisa terjadi. Saya sangat berterima kasih untuk penghargaan terhormat ini,” kata Day-Lewis. Ia pun menyatakan rasa bangganya menjadi salah satu nominator bersama aktor lainnya, Bradley Cooper dalam Silver Linings Playbook, Hugh Jackman dalam Les Miserables, Joaquin Phoenix (The Master), dan Denzel Washington dalam Flight. Day-Lewis pernah mendapat Piala Oscar untuk kategori Aktor Terbaik ketika ia memerankan Christy Brown dalam My Left Foot (1989) dan There Will Be Blood (2007).(ant)

Madonna tampil dalam tur dunia MDNA di Staples Center, Loas Angeles, California, Oktober tahun lalu/rtr

Madonna Artis PopTerkaya Madonna mengalahkan Bruce Springsteen dan pendiri Pink Floyd, Roger Waters sebagai musisi dengan bayaran tertinggi tahun 2012 versi Billboard.

Deddy Mizwar

Peringatan 50 Tahun James Bond Di Panggung Oscar Dame Shirley Bassey membuat pengunjung ajang Academy Awards 2013 terpukau saat memimpin peringatan ulang tahun ke-50 James Bond dengan melantunkan Goldfinger, lagu tema film James Bond tahun 1964 yang melambungkan namanya. Perempuan berusia Daniel Craig /rtr 76 tahun itu mengenakan gaun warna emas serta kalung dan anting-anting emas saat tampil mem-bawakan lagu latar film waralaba Bond, yang bermula tahun 1962 dengan film Dr. No dibintangi Sean Connery. Nama Bassey melekat dengan film Bond. Selain menyanyikan Goldfinger, dia juga mempopulerkan Diamond’s Are Forever (1971) dan Moonraker (1979). DivaWelsh itu tampil setelah aktris Halle Berry, muncul sebagai gadis Bond bernama Jinx tahun 2002 dalam film Die Another Day (2002) dibintangi Pierce Brosnan, membuka pertunjukan penghormatan. “Malam ini kita memperingati 50 tahun film James Bond,” kata Berry seperti dikutip Reuters. Aktris memenangkan penghargaan aktris terbaik Oscar lewat film Monster’s Ball (2001) itu mengaku bangga menjadi bagian dari film Bond. Ia juga mengatakan, musik latar film berhubungan erat dengan James Bond, seperti juga martini dan mobil-mobil eksotik. Film James Bond tercatat sering masuk nominasi penghargaan kategori teknik atau musik dalam ajang pemberian penghargaan Oscar. Tahun ini film ketiga Bond dibintangi Daniel Craig, Skyfall masuk lima nominasi kategori pengharaan Oscar termasuk sinematografi terbaik, lagu latar terbaik, dan musik latar terbaik. Penyanyi Inggris, Adele,24 meraih Piala Oscar kategori lagu terbaik Skyfall yang merupakan lagu latar film Skyfall. “Ini menakjubkan,” kata Adele kepada pengunjung Oscar.(ant)

Selama lima tahung belakangan, penyanyi berusia 54 tahun ini telah dua kali menjadi artis terkaya. Menurut Billboard, tur dunia MDNA selama 88 hari membantunya menghasilkan 34,6 juta dolar AS, seperti dikutip dari laman BBC. Menurut data dihimpun Billboard dari Boxscore dan Nielsen SoundScan, Bruce Springsteen berada di bawah Madonna. Ia berpenghasilan 33,4 juta dolar setelah tur album Wrecking Ballnya laku keras. Penjualan aksesoris juga turut menambah penghasilannya. Konser-konser Springsteen menyumbang 92 persen dari penghasilan totalnya. Sang pendiri Pink Floyd berada di urutan ketiga. Tur The Wall Livenya ditaksir berharga 21 juta dolar. Di bawahWaters adalah band hard rock asal California,Van Halen. Mereka berpenghasilan 20 juta dolar setelah mempromosikan album A Different

Kind of Truth. Editorial analis dari Billboard, Glenn Peoples, mengatakan kebanyakan uang mereka berasal dari bayaran konser yang tinggi. “Ironisnya, pemasukan artis yang banyak melakukan tur jauh di atas penjualan album mereka,” kata Peoples. Musisi lainnya masuk 10 besar artis terkaya adalah Kenny Chesney, Dave Matthews band, Tim McGraw, Jason Aldean, dan Coldplay. Justin Bieber menduduki posisi terakhir dengan 16 juta dolar. Sebanyak 10 juta dolar berasal dari tur Believe. “Mereka yang ada di 10 besar, 84,2 persen penghasilannya berasal dari konser. Angkanya mungkin lebih tinggi,” kata Peoples. Madonna menjadi satu-satunya perempuan yang berada di daftar artis terkaya. Pemenang tahun lalu, Taylor Swift, jatuh ke posisi 15 karena ia tidak melakukan tur tahun lalu. Meski begitu, penghasilan Swift masih bagus. Ia memiliki 12,7 juta dolar dari penjualan lebih dari tiga juta album digital dan 15,6 juta lagu digital. Adele, memiliki album terlaris di AS tahun 2011 dan 2012, berada di posisi 11 dengan penghasilan 14 juta dolar.(ant)

Daniel Day-Lewis/

Venna Melinda saat berinteraksi kepada warga miskin dan anak jalanan di sekitar jembatan Grogol, Jakarta Barat/ant

Venna Melinda Berat Gugat Cerai Aktris yang kemudian terjun ke dunia politik Venna Melinda membenarkan bahwa ia menggugat cerai suaminya Ivan Fadilla Soedjoko. NamunVenna enggan menjelaskan penyebab keretakan rumah tangganya. Ia hanya berkata bahwa hal ini sangat berat baginya. “Iya. Pokoknya intinya berat buat saya,” kata Venna setelah sidang paripurna di DPR, Selasa. Ia mengatakan tidak melaporkan masalah gugatan cerainya tersebut ke fraksi. “Ini kan pribadi, saya rasa yang penting keluarga dan anak-anak sudah tahu. Gak lapor kok ke fraksi,” kata Puteri Indonesia 1994 ini.(ant)

Promo Audiopharmacy Di Visi FM Band hip hop asal Amerika Serikat-Audiopharmacy sukses menggelar konsernya di Medan akhir pekan lalu. Sebelum band digawangi Teao-gitar, Ras K Dee-vokal, Keep-yahjoy-bassit dan Pulsedrummer, Konsul Amerika Serikat di Medan Kathryn Crockart berkenaan melakukan wawancara di Radio Kardopa dan Visi FM. Beliau mengajak kaula muda menyaksikan konser band ini karena akan memberi pengalaman baru buat penggemar hip hop di Medan, apalagi band ini membawa warna musik yang specifik. Dengan kedatangan Audiopharmacy tentu diharapkan menambah wawasan serta apresiasi kaum muda terhadap musik hip hop yang memang sangat digandrungi anak muda. (m19)

Konsul Amerika Serikat di Medan Kathryn Crockart diulosi Tiorida Simanjuntak (kanan) selaku pimpinan Radio Visi FM dan Kardopa setelah melakukan wawancara radio sehubungan kedatangan band Audiopharmacy ke Medan

Bedlam Height

Bedlam Musim 2 Terus Menghantui

Kisah horor drama membalut gedung Bedlam Height terus menghantui para penghuni baru. Para hantu abadi ini gusar dan tidak menginginkan siapapun menempati rumah mereka. Kekelaman Bedlam 2 di saluran Thrill, tiap Sabtu pukul 22:00. Bedlam 2 mengisahkan tentang seorang paramedis bernama Ellie Flint (Lacey Turney, East Enders) yang bisa melihat hantu. Karena lelah dengan penglihatan dialaminya ini dan ingin menghentikannya, ia pun pergi ke Bedlam Heights, untuk menemui Jed Harper (Theo James), yang punya penglihatan sama dengan Ellie. Di sana ia berkenalan dengan bartender yang juga blogger supernatural Max (Jack Roth, The Cafe), teman sekamar Jed. Jed sendiri tewas karena terbunuh hantu di hunian tersebut, kirakira di waktu yang sama saat Ellie mulai mendapat penglihatan. Ellie terus mencari jawaban tentang apa yang terjadi pada dirinya dengan kemampuan tidak dia inginkan ini. Setelah tunangannya meninggalkannya, ia pun tak henti tersiksa penglihatanpenglihatan tentang kisah kelam Bedlam Heights. Gedung tua itu sendiri sebelumnya adalah sebuah rumah sakit jiwa dan kini dipasarkan untuk menjadi apartemen mewah. Bedlam Heights dijalankan Warren Bettany (Hugo Speer, The Interpreter) - yang adalah paman Jed, bersama kekasihnya Keira (Gemma Chan, Secret Diary of a Call Girl, Fresh Meat) dan asistennya Dan diperankan aktor pendatang baru Nikesh Patel. Ketegangan yang intens pun terus terjadi seiring dengan kematian yang menghampiri satu persatu penghuninya. Gedung tua yang mencekam dengan lorong yang gelap konon sungguhsungguh berhantu, membuat tiap detik begitu menegangkan. Mampukah Ellie menjawab misteri bangunan tua itu? Mengapa hantu-hantu Bedlam terus menebar teror dan dendam? Dan apakah maksud dari simbol B yang ada pada pundak Ellie? Saluran Thrill dapat diakses melalui Indovision (ch. 19); Okevision (ch. 8); Aora (ch, 221); Telkom Vision (ch. 610); CentrinTV (ch. 313) dan OrangeTV (ch. 162).(ant)


WASPADA Rabu 27 Februari 2013

Truk Mogok, Medan-Banda Aceh Macet

PIM Dapat Pasokan Satu Kargo Gas

LHOKSUKON (Waspada): Truk interculer yang bermuatan pinang dan kakao mogok di jembatan darurat jalan nasional Menda-Banda Aceh, tepatnya di Gampong Meunasah Dayah, Lhoksukon, Aceh Utara. Truk tadi mengalami patah per belakang. Akibatnya, semua mobil berbadan besar harus dialihkan ke jalur alternatif melintasi Kecamatan Matangkuli dan keluar melalui Simpang Ceubrek, Syamtalira Aron. Truk interculer mogok sejak, Selasa (26/2) pukul 00:30. Pengalihan rute dikawal oleh petugas dari Satuan Lalulintas Mapolres Aceh Utara. Amatan Waspada, para petugas bukan hanya mengalihkan mobil berbadan besar ke jalur alternatif namun mobil beroda empat juga harus dialihkan ke jalur tersebut, karena jembatan darurat mulai amblas. Amblasnya jembatan darurat tersebut akibat tingginya curah hujan dalam dua hari terakhir. Hasansyah, tokoh masyarakat Aceh Utara

KRUENG GEUKUH (Waspada): PT Pupuk Iskandar Muda kembali mendapat pasokan gas sebanyak satu kargo dari Tangguh. Dengan pasokan gas untuk bahan baku tersebut diprediksi hanya mampu menghidupkan pabrik pupuk untuk masa 54 hari. Manajer Humas PT PIM melalui Superintendent Komunikasi dan Protokol, Yusrizal, Selasa (26/2) mengakui, PIM kembali mendapat pasokan gas satu kargo dari Tangguh. Namun, sistem suplai tetap dilakukan melalui swap dari PT Arun LNG. Mekanisme swap yaitu kilang LNG Arun mengalihkan alokasi gas dari pembeli Korea Selatan ke PIM melalui pipa. Sebagai gantinya, dengan alokasi gas yang sama, kilang LNG Tangguh akan mengapalkan LNG ke Korea Selatan. Yusrizal juga mengakui, satu kargo gas diperkirakan mampu menghidupkan pabrik selama 54 hari. Sementara produksi PIM setiap hari mencapai 1.750 ton. Dirut PT PIM Eko Sunarko kepada para wartawan mengakui, gas alam selain untuk bahan baku pupuk juga masih digunakan untuk menggerakan turbin. Sedangkan ke depan diharapkan untuk menggerakkan turbin akan digunakan batu bara. (b15)

Gajah Liar Mengamuk, Warga Mengungsi

Indikasi Bireuenisasi Di Kemenag Aceh Utara LHOKSEUMAWE (Waspada): Terkait adanya protes guru madrasah pasca pelantikan sejumlah kepala seksi di Kantor Kementerian Agama Aceh Utara, 4 Februari lalu, dan terdindikasi banyak jabatan diisi orang asal Bireuen, dewan meminta kebijakan ini dievaluasi. Dewan dimaksud, Ahmad Satari, anggota Komisi E DPRK Aceh Utara yang membidangi pendidikan, Senin (25/2) mengatakan, sangat menyangkan penempatan sejumlah jabatan Kasi diisi pejabat asal Kabupaten Bireuen, karena di daerah sendiri memiliki kader yang layak dipromosikan dalam jabatan tersebut. Dia menilai, di balik mutasi ini wajar muncul protes dari tenaga pendidik atau guru di daerahnya. Kecuali tenaga yang ditempatkan itu memang dasar pegawai sebelum terjadi pemekaran antara Aceh Utara dan Bireuen. Menyelesaikan ini, pihaknya akan melakukan koordinasi dengan Kepala Kemenag Aceh Utara, Zulkifli Idris, bagaimana solusi yang terbaik agar persoalan menyangkut dengan tenaga pendidik dapat segera diselesaikan. (cmk)

Toko Kelontong Dibobol Maling PANTONLABU (Waspada): Toko kelontong Jasa Aduen di Jalan Tgk Chik Di Tiro—Pantonlabu, Kec. Tanah Jambo Aye, Aceh Utara, dibobol maling, Selasa (26/2) dini hari. Barang berupa rokok dan gula pasir senilai Rp35 juta lewong dibawa kabur pelaku. “Pelaku masuk lewat pintu depan dengan merusak gembok,” kata M Nasir, 30, pengelola toko kelontong Jasa Aduen, di lokasi kejadian. M Nasir mengaku baru mengetahui pencurian tersebut ketika hendak membuka toko, sekitar pukul 07:30. Saat itu, dia mendapati pintu depan sudah renggang dan lampu listrik dalam posisi padam. “Pelaku mematikan listrik dalam toko lewat saklar MCB. Sedangkan lampu depan, termasuk lampu teras toko tetangga, dimatikan dengan cara bolanya diputar. Pelaku sepertinya lebih satu orang dan memakai mobil. Sebab, selain rokok, mereka juga mengambil 8 zak gula,” papar M Nasir. Kapolres Aceh Utara AKBP Farid melalui Kapolsek Tanah Jambo Aye Iptu Mukhtar, mengatakan, kasus ini masih dalam proses penyelidikan. (b19)

TRUK interculer mogok di jembatan darurat di jalan nasional Medan-Banda Aceh tepatnya di Gampong Meunasah Dayah, Lhoksukon, Aceh Utara, Selasa (26/2) .

Pembangunan Infrastruktur Di Aceh Masih Belum Terencana BANDA ACEH (Waspada): Pembangunan infrastruktur di Aceh, terutama jalan, masih belum terencana dengan baik, membuat pertumbuhan ekonomi di Aceh berjalan lamban. Hal itu mencuat dalam diskusi publik membahas hasil analisis Anggaran Aceh 2011 bidang infrastruktur, yang dihadiri akademisi, perwakilan Pemerintah Aceh, aktivis dan para jurnalis. Kegiatan yang difasilitasi oleh tim PECAPP (Public Expenditure Analysis and Capacity Strengthening Program), bagian dari program CPDA - Bank Dunia dengan pendanaan AusAid, digelar di Cafe 3 in 1 Banda Aceh, Selasa (26/2) Peneliti Senior PECAPP, Teuku Triansa Putra, memaparkan hasil kajiannya tentang infrastruktur di Aceh tahun 2011, dengan fokus pada pembangunan jalan. Menurut Triansa, dari kajian itu banyak terdapat perencanaan yang kurang tepat dengan kebutuhan masyarakat. “Sehingga pembangunan infrastruktur jalan belum menunjang pertumbuhan ekonomi di Aceh,” katanya. Dia mencontohkan, jalan dan jembatan merupakan prioritas pembangunan infrastruktur tahun 2011 dengan porsi sebesar 49 persen dari total belanja bidang Bina Marga Cipta Karya sebesar Rp1,2 triliun. Sementara biaya pemeliharaan jalan mendapat porsi kecil, hanya 9 persen. Biaya pemeliharaan berada di bawah rata-rata nasional, 12 persen.

PECAPP juga menilai, pembangunan jalan di kabupaten/ kota di Aceh belum sesuai kebutuhan dan prioritas. Misalnya di Aceh Jaya, yang memiliki kondisi jalan terburuk (data 2010), mendapat kucuran dana Otsus 2011 sebesar Rp37 miliar untuk pembangunan dan pemeliharaan jalan. Sementara Aceh Barat yang sudah memiliki jalan dengan kondisi baik sebesar 22 persen, juga mendapat kucuran dana Otsus pembangunan dan pemeliharaan jalan dengan jumlah sama. “Harusnya Pemerintah Aceh melihat prioritas pengalokasian dana sesuai dengan kebutuhan serta mempertimbangkan kesenjangan sarana jalan antar daerah,” ujarnya. Kebanyakan daerah di sepanjang pantai barat dan daerah tengah Aceh memiliki sarana infrastruktur yang masih sangat rendah. Pada tahun 2010, tercatat lebih dari 90 persen kondisi jalan kabupaten Nagan Raya dan Aceh Jaya dalam keadaan rusak. Aceh Tengah dan Gayo Lues juga memiliki lebih dari 50 persen jalan kabupaten dalam kondisi rusak. Sementara sebagian besar daerah di sepanjang pantai timur Aceh, seperti Aceh Besar, Pidie, dan Aceh Utara memiliki kondisi jalan kabupaten yang lebih baik, hanya sekitar 30 persen jalan kabupaten dalam kondisi rusak. Hal ini hendaknya menjadi salah satu pertimbangan perencanaan pembangunan infrastruktur bagi pemerintah provinsi, Sesuai data PECAPP, Triansa menilai perencanaan pembangunan jalan kabupaten yang menggunakan dana otsus dapat lebih ditingkatkan sesuai de-

ngan kebutuhan masing-masing daerah. “untuk akses yang lebih besar terhadap pertumbuhan ekonomi yang merata,” ujarnya. Dia juga menekankan bahwa kebutuhan terhadap perencanaan pembangunan jalan yang terintegrasi dengan menggunakan indikator tertentu seperti potensi pertumbuhan ekonomi, kepadatan populasi serta cakupan wilayah seharusnya menjadi semakin penting, melihat besaran jumlah alokasi infrastuktur yang dikucurkan pada masa mendatang. “Tanpa perencanaan yang matang, dapat dipastikan pembangunan jalan tidak akan menghasilkan daya ledak yang besar terhadap pembangunan Aceh,” tandasnya. Sudah Sesuai Kebutuhan Sementara Munthadar Abdul Fatah mewakili Badan Perencanaan Pembangunan Daerah Aceh (Bapedda) Aceh, menilai pembangunan jalan di Aceh selama ini sudah sesuai kebutuhan. Pembangunan bidang infrastruktur yang terintegrasi merupakan prioritas dari pemerintah Aceh. Menurutnya, dalam perkembangan ekonomi Aceh ke depan, dibutuhkan suatu jalan yang bisa meningkatkan aksesibilitas dan konektifitas yang cepat dan efektif menuju pusatpusat distribusi (pelabuhan). Misalnya jalan dari Blangkejeren (Gayo Lues) ke Peureulak (Aceh Timur), akan membantu akses hasil perkebunan ke Pelabuhan Langsa. “Harapannya, pertumbuhan ekonomi Aceh ke depan meningkat,” kata Munthadar. (b04)

Polisi Gerebek Lapak Judi PANTONLABU (Waspada): Aparat Satuan Reserse dan Kriminal Polres Aceh Utara menggerebek lapak judi joker di sebuah warung kopi di Pantonlabu, Kec. Tanah Jambo Aye, Aceh Utara, Senin (25/2) dini hari. Tujuh tersangka, termasuk pemilik warung sempat diamankan di Mapolres Aceh Utara, di Lhoksukon. Namun karena kasus ini diproses dengan Qanun Syariat Islam tentang judi atau maisir, para tersangka tidak bisa ditahan dan akhirnya diserahkan ke aparat desa untuk dibina. Para tersangka, Mns, 41, Ham, 42, dan Tsl, 41, ketiganya warga Pantonlabu, Dem,33, warga Matangkumbang, Baktiya, Aceh Utara, Zai, 32, warga Teupin Bayu, Kec. Tanah Jambo Aye, Syd,35, warga Rawang Iteik, Kec. Tanah Jambo Aye dan Mts, 42, warga Meunasah Panton, Kec. Tanah Jambo Aye. “Mereka kita tangkap berdasarkan informasi dari masyarakat. Dari mereka juga kita sita satu laptop, satu notebook, satu set kartu joker dan uang Rp425 ribu. Meski tidak ditahan, mereka tetap diproses sesuai hukum berlaku,” kata Kapolres Aceh Utara AKBP Farid BE melalui Kasat Reskrim AKP Achmad Fauzy. (b19)

Penerbangan Di Bandara SIM Banda Aceh Garuda Indonesia

GA 142 Jakarta/Medan GA 146 Jakarta/Medan

Lion Air

JT 304 Jakarta JT 306 Jakarta/Medan JT 396 Jakarta/Medan

Sriwijaya Air

SJ 010 Jakarta/Medan

Air Asia

QZ 8023 Medan AK 1305 Kuala Lumpur *

Fire Fly

FY 3401 Penang* * Setiap Senin, Rabu, Jumat dan Minggu.

Berangkat (flight, tujuan, waktu)

10:40 16:00

GA 143 Medan/Jakarta GA 147 Medan/Jakarta

11:20 16:45

11:35 15:55 21:30

JT 397 Medan/Jakarta JT 307 Jakarta JT 305 Medan/Jakarta

06:00 12:15 16:35


SJ 011 Medan/Jakarta


12:00 11:00

QZ 8022 Medan AK 1306 Kuala Lumpur*

12:25 11:30


FY 3400 Penang*


menyesalkan atas kejadian tersebut. Seharusnya peristiwa itu tidak perlu terjadi, jika pembangunan jembatan tidak ditelantarkan oleh rekanan, dan seharusnya Pejabat Pembuat Komitmen (PPK) Jalan Nasional-I Balai PU Medan harus bertindak cepat, untuk menghindari terjadinya kecelakaan lalulintas. Risawan Bentara, Kadis Bina Marga Aceh Utara mengatakan, pihaknya tidak dapat berbuat banyak untuk persoalan ini, karena proyek jembatan di jalan nasional itu merupakan kewenangan Balai PU Medan. Thaibur, PPK Jalan Nasional-I, Selasa (26/ 2) mengaku telah mengetahui kejadian yang terjadi. Namun pihaknya tidak bisa berbuat banyak, karena untuk melakukan tender ulang proyek jembatan itu harus menjawab beberapa sanggahan rekanan bahkan hingga pada sanggahan banding. (b18)

Biaya Pembangunan Jalan Bireuen-Takengen Belum Dibayar Waspada/Maimun Asnawi

BANDAR JULI (Waspada) : Terancam amukan gajah liar (gajah keng) di Desa Pergunungan Pante Peusangan, Kecamatan Juli, Bireuen, empat keluarga (17 jiwa) sejak tiga hari lalu terpaksa mengungsi ke meunasah desa. Sementara tiga keluarga (11 jiwa) lainnya mengungsi ke rumah familinya. Keuchiek Desa Pantee Peusangan Moechtar Ismail menjelaskan, Selasa (26/2), tujuh KK yang mengungsi itu sebelumnya masih menempati rumahnya yang sudah rusak diamuk gajah. Ketujuh KK (28 jiwa) warga Pante Peusangan semakin cemas terhadap amukan gajah untuk mencegah hal-hal yang tidak diinginkan warga mengungsi menyelamatkan diri ke meunasah dan rumah familinya. Kadis Perkebunan dan Kehutanan Bireuen Irwan mengatakan, hasil pantauan petugas Disbunhut, gajah keng bergading yang memisahkan diri dengan kawanan gajah liar masih berada di kawasan hutan Pante Peusangan dan sekitarnya. Sementara kawanan gajah liar sudah turun ke kawasan Sawang Aceh Utara yang lokasinya berdekatan dengan pegunungan Pante Peusangan. (b12)

Tiba (flight, asal, waktu)


anggaran pembangunan jalan PEUSANGAN (Waspayang pernah terjadi longsor da): Direktur Mutiara Aceh sangat parah beberapa waktu Lestari Saifannur tidak mau lalu itu sehingga sarana tranmenyebutkan jumlah sisa sportasi kawasan tersebut saat anggaran pembangunan itu terancam putus, karena ada jalan kawasan Cot Panglima perbedaan perhitungan volume KM 27-30, Kecamatan Juli, pekerajaan antara tim auditnya Bireuen, yang belum dibayar dengan tim audit yang diturunpemerintah. Meskipun pekan pemerintah. kerjaannya telah lama ramNamun, beberapa tim audit pung. telah turun ke lokasi dan me“Saya serahkan kepada ngukurnya termasuk dari Untim audit yang berhak mesyiah. Tetapi, sampai sekarang ngaudit yang menentukan belum juga penyelesaiannya hal berapa sisa anggaran yang sudah dan yang belum dibaDirektur Mutiara Aceh tersebut. Saifan berharap, kepada yarkan kepada saya oleh PeLestari Saifannur pihak terkait masalah pembamerintah Aceh, biarlah tim audit yang menentukan,” katanya, Selasa (26/ yaran jalan yang telah dikerjakan, hendaknya 2), terkait informasi dirinya belum habis cepat diselesaikan oleh pemerintah Aceh, menerima pembayaran hasil pekerjaan karena masalah itu adalah hak pemerintah provinsi untuk menyelesaikan sebagaimana pembangunan jalan Bireuen-Takengen. Menurutnya, belum habis dibayarnya awalnya. (cb02)

Waspada/Abdul Mukthi Hasan

SITUASI jalan kawasan Kota Bireuen, Selasa (26/2) saat guyur hujan lebat sejak malam hingga sore hari kemarin.

Sejumlah Ruas Jalinsum Bireuen Tergenang BIREUEN (Waspada): Akibat hujan deras yang mengguyur wilayah Bireuen dan sekitarnya, jalan lintas umum wilayah setempat tergenang. Bahkan pada beberapa lokasi sulit dilintasi. Pantauan Waspada, Selasa (26/2), sejumlah kendaraan roda empat dan dua berjalan ekstra hati-hati menyusuri jalan dalam guyuran hujan, dan setibanya di kawasan Simpang Desa Pulu Ara, sejumlah kendaraan itu melintasi jalan yang telah dipenuhi air termasuk di beberapa titik lainnya. Pada kesempatan itu juga terlihat sejumlah anak sekolah dan juga pegawai dengan seragam dinasnya melintasi kawasan tersebut ada

diantara mereka memakai mantel ada yang menggunakan payung. “Beberapa titik jalan tergenang akibat salurannya tersumbat dan ada juga yang tidak ada lagi saluran sehingga jalannya tergenang walaupun sedikit hujan turun selama ini,” kata Hasballah, seorang warga. Selain itu, jalan nasional yang sulit dilintasi akibat tergenang diguyur hujan dalam dua hari terakhir ini, di kawasan depan pintu gerbang SMAN Gandapura, kawasan Desa Cot Tunong dan kawasan depan kios buah pasar Kecamatan Kutablang. Sehingga kendaraan yang tiba di lokasi terbuat harus melambatkan larinya. (cb02)

Hujan Deras Wilayah Barat Aceh Utara Banjir

Waspada/AR Djuli

ENAM wanita Lansia terbaik yang mendapat anugerah penghargaan dari Yayasan Telaga Amal.

Wanita Satu Abad Di Bireuen Masih Produktif Berkarya BIREUEN ( Waspada) : Enam wanita lanjut usia (Lansia) dari 1.623 Lansia binaanYayasan Telaga Amal Bireuen, mendapat penghargaan sebagai wanita Gaseh Lansia terbaik 2013. Dua dari enam wanita Lansia terbaik Hj Nurhadiah, 90, dan Nek Fatimah, berusia 100 tahun (satu abad) kelompok dari gaseh lansia Desa Guelanggang, Gampong Kecamatan Kota Juang Bireuen binaan Yayasan Telaga Amal sejak 2009 masih produktif berkarya di bidang kerajinan. Penghargaan yang dianugerahkan kepada enam wanita Lansia berusia 70-100 tahun selain memiliki pengetahuan kesehatan, Lansia dan pengetahuan lingkungan juga masih produktif berkarya memproduksi barang-barang kerajinan,

antara lain, topi, tas wanita, kipas, keranjang, terbuat koran bekas, keranjang terbuat dari lidi kelapa dan bambu , tudung saji dari rotan, karung beras dari pandan dan lain-lain. Sementara para lansia lainnya ikut memamerkan hasil karya pertanian sayur mayur dan buah-buahan segar berbagai jenis, -kue khas Aceh, produksi susu kedele dan anyaman dinding tepas dari bambu. Hal itu terungkap saat Yayasan Tenaga Amal menggelar pameran hasil karya kelompok Lansia, kerajinan, industri kecil rumahtangga,hasilpertaniandan perkebunan dibuka Bupati Bireuen Ruslan M Daud diwakili SekdaZulkifliSPdihalamanPendopo Bupati, Sabtu pekan lalu. Dalam kesempatan itu Sekda Zulkifli SP menyerahkan pe-

nghargaan dan hadiah kepada enam wanita Lansia itu. Sekda memberikan apresiasi dan penghargaan kepada Mursyidah A Latief, pimpinan Yayasan Telaga Amal Bireuen yang telah memberikan kepeduliannya yang sangat besar melakukan pembinaan terhadap ribuan lansia dan pengasuhan pendidikan anak yatim di 14 desa di Kecamatan Jeumpa dan Kota Juang Bireuen. Ketua Yayasan Telaga Amal Mursyidah A Latief menyampaikan, Yayasan Telaga Amal Bireuen sudah diakui sebagai Yayasan Lansia di dunia internasional. Saat iniYayasan Telaga Amal sudah membina 1.623 lansia 14 desa dan pengasuhan pendidikan anak yatim dan anak fakir miskin di panti yayasan. (b12)

LHOKSEUMAWE (Waspada): Hujan deras yang melanda Aceh Utara dan sekitarnya mengakibatkan sejumlah wilayah Aceh Utara bagian barat terendam banjir. Kondisi tersebut diperparah dengan minimnya pembangunan drainase yang mengakibatkan air sulit mengalir ke luar permukiman warga. Imum Mukim Blang Dalam, Juanda, Selasa (26/2) melaporkan, Sungai Keude Amplah meluap sehingga sejumlah desa yang dilintasinya mengalami banjir. “Kami mengalami banjir kiriman,” jelas Juanda. Sungai itu merupakan sungai dari kawasan pedalaman Buloh Blang Ara. Dia juga me-

ngakui, banjir sudah rutin terjadi setiap tahun. Ironisnya, pemerintah daerah setempat tidak pernah melakukan upaya antisipasi. Banjir juga terjadi di kawasan Kecamatan Dewantara. Muhammad Risyad, 50, warga Desa Uteuen Gelinggang, mengakui rumahnya kerap terendam. Dia bersama warga lain terpaksa mengungsi ke lokasi yang lebih aman. Warga lain mengakui, saluran pembuang untuk mengantisipasi banjir belum dibangun di Uteun Geulinggang. Akibatnya, setiap kali terjadi hujan air menggenangi rumah warga. Sementara saluran menuju ke Blang Naleung Mameh, Pemko Lhokseumawe tersumbat. (b15)

Wartawan Gadungan Meresahkan LHOKSEUMAWE (Waspada): Selama ini keberadaan wartawan gadungan yang berkeliaran mengaku sebagai wartawan Waspada kini mulai meresahkan masyarakat dan pejabat di Kota Lhokseumawe dan Kabupaten Aceh Utara. Hal itu diungkapkan Kepala Biro Harian Waspada Perwakilan Kota Lhokseumawe – Kabupaten Aceh Utara Bustami Saleh, Selasa (26/2) terkait keberadaan wartawan Waspada gadungan berkeliaran. Bustami mengatakan, dirinya telah mendapatkan laporan pengaduan dari sejumlah nara sumber baik masyarakat atau pun pejabat yang mengeluhkan dengan keberadaan oknum wartawan yang sering mengaku sebagai wartawan Waspada. Di antara oknum yang pernah mengaku sebagai wartawan Waspada berinisial FSL, NSR dan EFND dari media cetak terbitan lokal dan Medan. Pada umumnya mereka sering mendatangi setiap sekolah di Kota Lhokseumawe dan

Kabupaten Aceh Utara dengan tujuan memeras oknum pejabat menyuguhi kasus berindikasi korupsi. Bukan hanya lingkungan dinas pemerintahan saja yang menjadi mangsa wartawan gadungan, lanjutnya, tapi juga mendatangi sejumlah instansi tetangga dan perusahaan industri hilir. Bustami mengaku keberadaan wartawan gadungan telah mencemarkan nama baik wartawan Waspada yang meliput di lapangan. Bustami juga mengancam akan membuat laporan pengaduan ke polisi untuk menangkap para wartawan gadungan yang selama ini meresahkan nara sumber baik masyarakat atau pun pejabat pemerintah daerah. Untuk menghindari tipuan dari wartawan gadungan, Bustami mengimbau kepada masyarakat dan pejabat agar tidak segan – segan memeriksa identitas oknum wartawan, surat tugas resmi meliput dan memintai kartu pers resmi. (b16)



Terkait Aset Aceh Timur, Pemkab Diminta Tegas

Bupati Aceh Tamiang Lantik Sembilan Datok Penghulu Di Seruway KUALASIMPANG (Waspada): Bupati Aceh Tamiang, H Hamdan Sati,ST melantik sembilan Datok Penghulu Kampung di Aula Kantor Camat Seruway, Selasa (26/2) Kesembilan Datok Penghulu Kampung dalam wilayah Kecamatan Seruawy yang dilantik Bupati Aceh Tamiang yaitu Datok Penghulu Kampung Pekan Seruway, Khairil Azman, AMd, Datok Penghulu Kampung Binjai, Suhendri, Datok Penghulu Kampung Perkebunan Gedung Biara, Sadikin, Datok Penghulu Kampung Alur Alim,Dodi Hambali, Datok Penghulu Kampung Sungai Kuruk Tiga, Rifi Hamdani, Datok Penghulu Kampung Sungai Kuruk Dua, Ahmad Hasan, Datok Penghulu Kampung Matang Sentang, Boimin,Datok Penghulu Kampung Tangsi Lama,Darmawan dan Datok Penghulu Kampung Perkebunan Seruway, Muhammad. Bupati Aceh Tamiang , H Hamdan Sati dalam sambutannya antara lain mengharapkan kepada Datok Penghulu Kampung dapat melaksanakan tugas dan kewajibannya sesuai dengan peraturan yang berlaku. Acara pelantikan juga ditandai dengan penyematan tanda jabatan dan dihadiri Kapolres Aceh Tamiang, AKBP Dicky Sondani, Camat Seruway, Asra dan sejumlah undangan lainnya. (b23)

Polisi Tangkap Dua Remaja Terlibat Narkoba KUALASIMPANG (Waspada): Aparat Satnarkoba Polres Aceh Tamiang menangkap dua orang remaja yang diduga sebagai penyalahgunaan narkoba jenis sabu-sabu di halaman belakang kantor Bupati Aceh Tamiang,Desa Bundar, Karang Baru, Minggu (24/2) sekira pukul 24:00 Demikian Kapolres Aceh Tamiang, AKBP Dicky Sondani melalui Kasat Narkoba, AKP Nitti Prayitno , Selasa (26/2) Menurut Kasat Narkoba, kedua remaja HF bin Jauhari,17,pekerjaan tidak tetap dan RA bin Samsul Bahri,17, pelajar kelas 2 SMA. Kedua remaja yang terlibat dalam permainan barang haram itu adalah warga DS. Suka Rakyat, Kecamatan Seruway,Kabupaten Aceh Tamiang. Nitti mengungkapkan, penangkapan yang berlangsung di belakang Kantor Bupati Aceh Tamiang atau dekat tribun bekas arena MTQ. Menurut Kasat Narkoba, pihaknya mengamankan sebanyak dua paket besar narkoba jenis sabu-sabu seberat 9,78 gram sebagai barang bukti dari tangan tersangka.(b23)

PNA Jaring Dua Calon DPRK PEUSANGAN (Waspada): Hasil pemilihan calon anggota DPRK Bireuen yang digelar Partai Nasional Aceh (PNA) dari Kecamatan Peusangan Selatan, kabupaten setempat, Senin (25/ 2), terpilih dua dari tiga calon yang lulus seleksi. Dua calon tersebut, Muzakkir alias Toke Takengon dari mantan kombatan TNA dan Syafruddin dari tokoh masyarakat. Sedangkan seorang yang terpilih adalah, Diaudiin, mantan anggota TNI. “Acara pemilihan berlangsung di Desa Uten Raya, ikut dihadiri sejumlah mantan kombatan termasuk Tgk M Yahya Keurumbok berjalan lancar dan aman dan acaranya berlangsung terbuka di hadapan masyarakat,” kata Muzakkir, Sekretaris PNA. Menurut Muzakkir, dari tiga calon tersebut dipilih masyarakat dan saat penghitungan suara, Muzakkir alias Toke Takengon memperoleh 46 suara, Syafruddin 24 suara dan Diauddin 22 suara. “Pemilihan ini adalah pilihan rakyat setelah lulus seleksi dan mereka akan diusung PNA untuk menjadi calon anggota DPRK Bireuen periode mendatang,” jelasnya. (cb02)

Genangan Air Hambat Kelancaran Lalulintas BIREUEN (Waspada): Hujan yang mengguyur Kota Bireuen dan sekitarnya membuat beberapa titik di jalur linstas SumutAceh di sana tergenang sehingga menghambat jalur lalulintas. Pasalnya, sejumlah pelintas harus mengurangi kecepatan. Pantauan, Selasa (26/2), titik genangan air antara lain di jalan dua jalur arah menuju Matangglumpang Dua, dekat jembatan Titie Leupe, serta di depan pertokoan sekitar Simpang Arjun. Selain itu, air juga menggenangi badan jalan di sekitar SPBU Desa Reulet. Bahkan, untuk mencegah terjadi kecelakaan di sana, warga meletakkan ban bekas pada badan jalan yang berlubang yang tergenang. (b17)

Kantor KUA Jeumpa Diresmikan BIREUEN (Waspada): Kepala Kantor Kementerian Agama Bireuen H Zulhelmi A Rahman meresmikan kantor Urusan Agama (KUA), Kecamatan Jeumpa di Desa Blang Blahdeh, kecamatan setempat, Selasa (26/2). Zulhelmi A Rahman mengatakan, dengan diresmikan kantor permanen tersebut diharapkan dapat meningkatkan pelayan kepada masyarakat ke depan . “Kita harapkan program saweu gampong muspika dapat melibatkan pegawai KUA ini,” katanya. (cb02)

Waspada/Muhammad Hanafiah

BUPATI Aceh Tamiang, H.Hamdan Sati,ST menyematkan lencana tanda jabatan kepada Datok Penghulu Kampung di Aula Kantor Camat Seruway, Kab.Aceh Tamiang, Selasa (26/2).

Proses Verifikasi Dan Validasi Honorer K1 Langsa Kewenangan BKN Dan Pusat LANGSA (Waspada): Proses verifikasi dan validiasi tenaga honorer Kategori Satu (K1) CPNS Pemko Langsa tahun 2012 yang saat ini sedang menjadi permasalahan bukan tanggungjawab Badan Kepegawaian Pelatihan dan Pendidikan (BKPP) Kota Langsa, tapi sepenuhnya kewenangan dari Badan Kepegawaian Nasional (BKN) dan Menpan. Hal itu diutarakan Kepala BKPP Kota Langsa Syahrul Thaeb saat ditemui wartawan menyikapi dugaan kasus pemalsuan proses verifikasi dan validiasi tenaga honorer Kategori Satu (K1) CPNS Pemko Langsa tahun 2012, Selasa (26/2). Menurutnya, kronologisnya pada tahun 2010 BKPP mendapat surat Surat Edaran Menpan No. 5 Tahun 2010 tanggal 28 Juni 2010 tentang pendataan tenaga honer yang bekerja di Pemerintahan Kota Langsa. Jadi dengan surat itu, kemudian pihaknya membuat surat keWali Kota untuk SKPK dan SKPD di Kota Langsa No. PEG.800/1983/2010 tanggal 9 Juli 2010 perihal pendataan tenaga honorer, yang bertujuan agar mengirim data tenaga honorer di instansi masing-masing. Selanjutnya, sambil menunggu surat itu, kemudian dibentuk tim yang tertuang dalam surat ditujukan keWali Kota No.681/800/2012 tanggal 21 Juli 2010 tentang pembentukan tim pendataan tenaga honorer di Kota Langsa. “Setelah menghimpun tim dan menerima data

dari SKPD dan SKPK terjaring 237 orang yang terdata, kemudian kami laporkan keWali Kota dengan surat No.PEG.800/2323/ 2010 tertanggal 25 Agustus 2010 perihal tenaga honorer K1 untuk dikirim ke BKN dan Menpan,” katanya. Lalu, terang Syahrul Thaeb, turun surat dari BKN No F.I.26/ 30/X.279/7/39 tanggal 30 September 2010 yang isinya perihal tim verifikasi dan validiasi tenaga honorer K1. Baru tim memvalidasi data yang kami kirim dan kembali dibawa pulang oleh tim ke pusat. Dari proses itu, yang gugur empat orang, setelah dievaluasi dan validasi turun surat Menpan No.03/2012 tanggal 12 Maret 2012 tentang tenaga honorer K1 dan K2. “Dalam surat itu kami diamanahkan agar mengumumkan selama 14 nama-nama tersebut diumumkan di papan pengumuman di kantor. Selain itu, pengumuman itu juga kami iklankan di surat kabar pada tanggal 4 April 2012. Selama masa pengumuman 14 hari itu kita memintakritikan,saran,masukan apaterjadikecolongandankesilapan dalam proses penyeleksian berkas dan lain-lain,” sebutnya. Dari proses itu, kemudian delapan orang ditemukan terdapat kesalahan berkas dan lainlain yang selanjutnya delapan orang itu dibatalkan karena data yang tidak akurat. Selanjutnya dilaporkan ke delapan orang itu melalui surat Wali Kota No. PEG.800/1127/2012 tanggal 19 April 2012. Setelah diproses, kembali ditemukan empat orang yang dibatalkan dan dilaporkan ke Wali Kota dengan suratWali Kota No.PEG.800/1241/ 2012 tanggal 1 Mei 2012 perihal revisi tenaga honorer K1. Menyikapi itu semua, pro-

ses penyeleksian hingga tersangkutnya saya dalam kasus ini yang dituduh memanipulasi semua proses verifikasi dan validasi data honorer K1 tidak benar. ‘’Saya bekerja berdasarkan PP 48 tahun 2005 tentang pengangkatan tenaga honorer menjadi CPNS sebagaimana telah diubah di PP 43 tahun 2007, karena kami bekerja berdasarkan PP itu,’’ katanya. Namun, setelah proses Berkas Acara Perkara (BAP) di kepolisian, pihak penyidik menduga menemukan yang memanipulasi data ternyata dari tenaga honorer sendiri sejumlah 3 orang yakni Muhammad Iqbal, Chairina dan Eka Priyanti. “Data yang dilampirkan mereka berupa slip gaji, absensi, surat keterangan aktif, SK terus menerus Tanggal Mulai Tugas (TMT), diangkat oleh pejabat yang berwenang, di instansi pemerintah, gajinya dibayar dari APBD atau APBN dengan masa kerja 1 tahun per 31 Desember secara terus-menerus, berusia sekurang-kurangnya umur 19 tahun tidak boleh lebih berumur 46 tahun per 1 Januari 2006, diduga ada yang dipalsukan,” pungkasnya. Kemudian, semua berkasberkas itu dileges oleh SKPK di masing-masing tempat mereka bekerja sebelum dikirim ke BKPP. Lantas, jika ditilik dari kasus yang menimpa saya siapa yang sebenarnya salah, bukan BKPP. Tapi dinas terkait, bukan malah BKPP yang memanipulasi data itu,” pungkasnya. Di samping itu, produk SK tenaga honor K1 ini mulai 1 Januari 2005, sedangkan saya baru dilantik menjadi Kepala BKPP Kota Langsa pada tanggal 28 Agustus 2007 dan efektif September. (m43)

Pasar Bireuen Masih Amburadul BIREUEN (Waspada): Kondisi pasar Bireuen sampai sekarang ini masih amburadul. Salah satu buktinya sejumlah sepeda motor seenaknya masuk dalam pasar terkesan tidak ada yang tertib. Kendaraan roda dua tersebut berjalan di lorong-lorong sempit di depan para pedagang menggelar dagangan. Pantauan Waspada dalam beberapa hari terakhir, sejumlah kendaraan roda dua masuk dalam pasar yang penuh dengan padagang menggelar dagangan sehingga suasna pasar terlihat sangat kacau. Selain itu, sampai sekarang ini jalan masuk pasar belum terlihat tertib karena sering beradu dengan kendaraan keluar. Belum lagi, masalah pedagang yang menggelar dagangan di pinggir jalan dan juga ada beberapa pedagang ikan yang menggelar dagangan di samping pedagang sayur. (cb02)

POMAL TNI AL Sumbang Darah LHOKSEUMAWE (Waspada): Polisi Militer Angkatan Laut (Pomal) Lanal TNI AL Lhokseumawe menyumbang 100 kantong darah kepada masyarakat melalui UDD PMI Aceh Utara. Kegiatan berlangsung di Komplek TNI AL Cut Nyak Dhien, Gampong Paloh Igeuh, Kecamatan Dewantara, Aceh Utara, Selasa (26/2). Danlanal Lhokseumawe, Letkol Laut (P) Tjatur Soniarto melaui Dandenpomal Kapten Laut (PM) Yasir Fadly Dayan mengatakan, kegiatan donor dilakukan hari ini merupakan bagian dari memperingati HUT ke-67 Pomal ke-67. “Harapan kita, Pomal lebih profesional dalam bertugas dan pengabdian kepada masyarakat di daerah serta dapat membantu ketersediaan stok darah di PMI Aceh Utara,” ucap Yasir.(cmk)

Waspada/Mustafa Kamal

PETUGAS PMI Aceh Utara memeriksa prajurit Pomal saat donor darah di Komplek TNI AL Cut Nyak Dhien, Gampong Paloh Igeuh Kecamatan Dewantara, Aceh Utara, Selasa (26/2)

WASPADA Rabu 27 Februari 2013

Waspada/Arman Konadi

KETURUNAN dan ahli waris raja-raja dari berbagai daerah bermusyawarah guna menyatukan pewaris keturunan raja-raja Aceh di Kantor Dinas Kebudayaan dan Pariwisata Aceh, Selasa (26/2).

Pewaris Tahta Raja Se-Aceh Bentuk Forum Komunikasi BANDAACEH (Waspada): Sembilan pewaris dan keturunan raja se-Aceh menggelar pertemuan di gedung Dinas Pariwisata Aceh, Banda Aceh, Selasa (26/2). Mereka berencana membentuk forum komunikasi antarpewaris tahta dan keturunan raja Aceh. Forum pertemuan yang diketuai Teuku Zulkarnain, keturunan Raja Nagan dan Teuku Saifullah, pemangku Raya Daya ke-13 itu bertujuan mempersatukan keturunan raja di Aceh. Selain keduanya, pertemuan dihadiri keturunan raja Pidie, Sulaiman, keturunan raja dari Nagan, Negeri Daya, Pasee, Peurelak, Aceh, Trumon, Tamiang, dan Linge. Dalam sambutannya, Teuku Zulkarnain mengatakan, pertemuan yang baru pertama digelar tersebut bertujuan

membentuk forum komunikasi antarketurunan raja di Aceh, serta membuka wawasan keturunan raja tentang budaya masa lalu. “Kami memandang perlu membentuk forum ini untuk mempertahankan komunikasi antarketurunan raja agar makin kuat,” kata Zulkarnain. Menurutnya, selain sebagai wadah silaturrahim, kegiatan forum dimaksud juga bertujuan menunjukkan jati diri bahwa di Aceh terdapat banyak raja yang pernah memangku. “Fokusnya akan lebih kami pada perkumpulan keturunan raja dan tidak ada unsur politik,” jelasnya. Marzuki, ketua panitia pertemuan mengatakan, forum komunikasi tersebut dibentuk untuk mengingat kembali sejarah kerajaan Aceh, karena dinilai semakin dilupakan masyarakat Aceh. Dikatakan, raja bukanlah

orang dalam pemerintahan melainkan sosok yang diagungkan masyarakat. “Yang duduk dalam pemerintah itu Mentroe (Menterired). Raja bukan pemerintah,” kata pria yang akrab disapa Ampon Nagan ini. Dijelaskan, terdapat sembilan kerajaan yang tersebar di seluruh Aceh yang berjuluk Bumi Serambi Mekkah. Kerajaan tersebut masing-masing terletak di Pidie Sulaiman, keturunan raja dari Nagan, Negeri Daya, Pasee, Peurelak, Aceh, Trumon, Tamiang. “Meski yang hadir hari ini bukan semuanya keturunan raja , tapi ada perwakilan dari sembilan raja-raja di Aceh. Selain kerajaan, di Aceh juga terdapat kesultanan yang bertugas mengatur seluruh rajaa,” paparnya. (cb06)

IDI (Waspada): Pemkab badan serta dinas lainnya yang Aceh Timur diminta untuk telah kosong di Kota Langsa memperjelas status belasan pasca difungsikannya Pusat Gedung/Kantor termasuk Pemkab Aceh Timur di Idi oleh Pendopo Bupati dan GeBupati Aceh Timur Hasballah dung DPRK setempat di KoM Thaib (Rocky) sejak 1 Agustus ta Langsa. Sementara itu, pe2012 lalu. “Kita sambut baik penempatan PNS Kota Langsa mulangan pusat ibukota Aceh di Gedung Islamic Centre Timur dari Langsa ke Idi, tapi Aceh Timur di Kota Langsa persoalan aset harus diperjelas juga harus diambil sikap secarahukum,”sebutSafaruddin. tegas. Di sisi lain, lanjut pakar hu“Kita minta Pemkab kum ini, beberapa gedung dihaAceh Timur tegas dalam merapkan tidak diserahkan ke nertibkan aset-aset Aceh Pemko Langsa seperti Gedung Direktur Eksekutif Badan Perencanaan, PemTimur dipusat ibukota induk YARA, Safaruddin, SH bangunan Daerah (BAPPEDA) yakni di Kota Langsa, karena sesuai temuan Wabup Aceh Timur baru-baru yang letaknya sangat strategis di Kota Langsa. ini sebagian aset Aceh Timur telah dikuasai para Pasalnya, gedung dimaksud letaknya sangat PNS dalam jaja-ran Kota Langsa,” kata Direktur strategis dan merupakan Gedung Peninggalan EksekutifYaya-san Advokasi Rakyat Aceh (YARA) Kolonial Belanda yang memiliki sejarah yang Safaruddin kepada Waspada, Selasa (26/2). unik. Kata dia, aset Aceh Timur di Kota Langsa “Selain Bappeda, Pendopo Bupati dan Getidak sedikit dan nilainya mencapai triliunan dung DPRK Aceh Timur juga tidak diserahkan seperti Pendopo Bupati, Gedung/Sekretariat ke Kota Langsa, tapi itu semua kembali ke DPRK, Kantor DPKKD dan berbagai kantor/ Pemkab Aceh Timur,” kata Safaruddin. (b24)

MTsN Idi Cut Butuh Tambahan RKB IDI (Waspada): MadrasahTsanawiyah (MTs) Negeri Idi Cut di Gampong Matang Geutoi, Kecamatan Darul Aman, Kabupaten Aceh Timur membutuhkan 2 ruang kelas belajar (RKB) dari 18 RKB yang tersedia. Hal itu dinilai mendesak mengingat 40 siswa/i masih belajar di RKB yang kondisinya bak kandang ayam. Kepala MTsN Idi Cut, Drs Nawawi, MPd kepada Waspada Selasa (26/2) menjelaskan, siswa/i di sana berjumlah 610 orang yang berasal dari belasan desa dalam Kecamatan Darul Aman, bahkan tak sedikit pelajar tingkat menengah itu berasal dari kecamatan tetangga seperti Nurussalam dan Idi Rayeuk. “Tapi kita masih kekurangan dua RKB, sehingga gedung swadaya masyarakat tahun 1999 itu masih kita manfaatkan sampai sekarang, meskipun tak layak pakai lagi,” katanya. Nawawi menambahkan, selain kekurangan RKB beserta mobiler, pihaknya juga membutuhkan mushala sebagai sarana ibadah umat Islam. Meskipun MTsN telah dinegerikan sejak tahun 1999 tetapi hingga sekarang Kantor Kementerian AgamaWilayah Provinsi Aceh belum mengadakan mushala ke MTsN Idi Cut, sehing-

ga para tenaga pendidik dan pelajar yang sudah akil baligh terpaksa menunaikan ibadah shalat dzuhur setiap hari—kecuali Minggu/libur— ke rumah masing-masing. Padahal, menurut Nawawi yang akrap disapa Abi itu, jika mushala tersedia di sana maka pihaknya bisa memanfaatkan untuk berbagai kegiatan ekstra keislaman serta bisa dijadikan ruang praktikum shalat jenazah.“Jika mushallah tersedia disana maka berbagai kegiatan bisa dijalankan, baik pagi ataupun sore hari,” katanya seraya menyebutkan kabar dari pihak provinsi sudah dialokasikan anggaran untuk mushallah MTsN Idi Cut tetapi pihaknya belum sepenuhnya yakin. Disinggung kebutuhan mendesak lain, dengan lancar Abi menyebutkan kekurangan yang sangat terasa lain adalah minimnya guru PNS yang ditempatkan kesana dan butuh pagar keliling sepanjang 600 meter serta Laboratorium Bahasa, IPA dan Komputer. “Kita sudah mengusulkan berbagai kebutuhan ke Kantor Kemenag Aceh Timur dan Kanwil Kemenag Aceh untuk diteruskan ke Jakarta, tapi saat ini belum ada tanda-tanda,” tutup Nawawi. (b24)

Mahasiswa PPL Diduga Perkosa Siswanya LANGSA (Waspada): Oknum mahasiswa, RHM, warga Kec. Langsa Kota yang sedang melakukan Praktek Kerja Lapangan (PPL) di salah satu sekolah MTs di Kota Langsa diduga memperkosa salah seorang siswanya yang masih berusia 15 tahun belum lama ini. Demikian orangtua korban karyawan PTPN I Langsa PKS Sementok kepada wartawan saat membuat laporan ke Polres Kota Langsa, Selasa (26/2). Menurut laporan di kepolisian, Nomor Laporan Polisi LP/54/II/2013/ACEH/RES Langsa tentang pemerkosaan yang terjadi pada, Kamis, 24 Januari 2013 sekira pukul 20:00 di Gp. Meurandeh Kec Langsa Lama Kota Langsa dengan terlapor RHM, 21, warga Langsa Kota. Dikatakan ayah korban, pemerkosan terjadi sudah satu bulan yang lalu namun anaknya tidak memberitahukan. Saat diketahui kalau anaknya sering mengeluh sakit, mereka kemudian membawanya ke IGD RSUD Kota Langsa,

Senin (25/2) dan di rumah sakit anaknya mengakui telah terjadi tindakan pelecehan seksual. Dijelaskannya, saat melapor ke Polres Langsa, anaknya bercerita kejadian itu bermula saat RHM mengirim SMS mengajak untuk keluar, namun korban menolak. Lalu RHM mengatakan akan mengancam seumur hidup dan akan mengeluarkan korban dari sekolah. Tanpa sepengetahuan korban, tiba-tiba RHM datang ke lorong rumah korban untuk menjemputnya. Kemudian RHM pergi ke rumah temannya dan di sanalah RHM menyuruh saksi untuk membersihkan tempat tidur kamar. Lalu RHM menarik paksa korban ke kamar dan langsung memperkosanya sebanyak satu kali. Kuasa hukum dari korban Muslim A Gani, SH di damping Dina Yuliani, SH.MH selaku Advokat pada Law Firm Acheh Legal Consult mengatakan, kasus ini akan dilanjutkan sebagai proses hukum yang berlaku di Indonesia. (m43)

KIP Mulai Rekrut Calon PPK IDI (Waspada): Komisi penyerahan persyaratan admiIndependen Pemilihan nistrasi. Sedangkan penelitian (KIP) Kab. Aceh Timur mulai dan pengumuman hasil admimerekrut calon anggota nistrasi dilaksanakan oleh KIP Panitia Pemilihan Kecamapada tanggal 10 Maret 2013. tan (PPK) di 24 kecamatan “Selain pengumuman peneriyang tersebar mulai dari maan calon anggota PPK sifatSimpang Jernih (timur) nya berubah-ubah sesuai dan hingga ke Madat (barat). tetap diberitahukan sebaKetua KIP Aceh Timur, gaimana ketentuan,” katanya. Iskandar A.Gani, SE (foto) Selanjutnya, kata Iskandar, kepada Waspada. Selasa (26/ ujian tes tertulis dilaksanakan 2) menjelaskan, tahapan 14 Maret dan hasilnya diumumperekrutan calon anggota kan 2 hari kemudian yakni 10 Ketua KIP Aceh Timur, calon anggota PPK dinyatakan PPK telah dimulai sesuai Iskandar A.Gani, SE. lulus per kecamatan. “Lalu, kehasil rapat pleno Nomor 2/ DA/KPU-Atim/II/2013 10 anggota PPK yang lulus tertanggal 26 Februari 2013. “Pengumuman tersebut wajib mengikuti tahapan berikutnya penerimaan calon anggota PPK di Aceh Timur sesuai dengan ketetapan berikutnya,” ujar mulai besok tanggal 27 Februari - 5 Maret 2013 Iskandar seraya mengharapkan, warga yang yang ditempel ditiap-tiap kantor kecamatan,” memenuhi persyaratan dapat mencalonkan katanya. diri atau mendaftar di Kantor KIP Aceh Timur Selanjutnya, lanjut Iskandar, tanggal 6-8 di Idi dengan memenuhi persyaratan seperti Maret 2013 adalah masa pendaftaran dan memiliki Ijazah SMA atau sederajat. (b24)

Kajati Aceh Diminta Usut Kolusi Tender 2012 Di Aceh Singkil SINGKIL(Waspada): Kasus dugaan kolusi tender proyek 2012 di Aceh Singkil dituding sarat kolusi. Sumber Waspada di Singkil, Selasa (26/2) menyebutkan, satu contoh dugaan kolusi tentang tender di kabupaten itu terkait paket proyek jalan lingkar Kampung Kerani, Rimo dengan pagu anggaran Rp 800 juta. Paket bersumber dari dana APBK 2012 pada Dinas Pekerjaan Umum (PU) Aceh Singkil. Anehnya, meski telah disanggah banding yang ditujukan kepada Bupati melalui Unit Layanan Pengadaan (ULP) di Setdakab Singkil terkait dugaan kolusi pemenangan tender paket proyek, upaya penyelesaiannya sebagaimana ketentuan Keputusan Presiden (Kepres) tentang Pengadaan Barang dan Jasa instansi pemerintah. Sumber di kelompok kerja (Pokja) ULP menyebutkan telah dilakukan negosiasi, sehingga pihak penyanggah tidak melakukan upaya hukum lanjutan. Pokja 1 ULP PU melalui pengumuman tender menetapkan CV Rawa Singkil sebagai pemenang dengan nilai penawaran sebesar Rp751.832 juta. Namun hasil itu disanggah banding merupakan upaya lanjutan sanggah yang dilakukan CV Gunmeri Bekasta sebelumnya terhadap Pokja ULP Data lain yang diperoleh Waspada, CV Rawa Singkil pada, pembukaan penawaran berada pada urutan 5, sedangkan saat pengumuman koreksi aritmatik di urutan ke 4. Data urutan hasil koreksi aritmatik, CV Lindung Bulan, CV Gunmeri Bekasta (Rp730.294 juta), CV Galatta dan CV Rawa Singkil (Rp751

832 juta) . Akibat dugaan kolusi itu kerugian negara ditaksir sebesar Rp 21, 8 juta karena panitia tidak memverifikasi perusahaan urut 1 hingga 3 Keterangan di atas merupakan satu contoh dari sejumlah dugaan kolusi tender di Aceh Singkil. Bahkan pada tender paket proyek pembangunan lods Pekan Mandumpang pernah beredar isu hasil pemenang tender pertama diganti dengan tudingan desakan oknum tertentu kepada pejabat teras di sana. Sekdakab Aceh Singkil HM Yakub KS yang pernah dikonfirmasi Waspada, terkait pergantian pemenang tender lodspekanitumembantah. “Pemenang tender paket proyek lods pekan Mandumpang 2012 tidak ada pergantian,” jelas Yakub saat itu. Namun informasi yang diperoleh Waspada dari seorang pekerja lapangan tidak membantah adanya dugaan pergantian pemenang paket itu. Namun sumber tadi mengaku mengantongi surat tanah lokasi pembangunan lods pekan. “Saya yang punya tanah lokasi Pekan mingguan Mandumpang,” katanya dan menjelaskan surat yang dimiliki perusahaan pemenang pertama diduga palsu karena hanya surat keterangan bukan kepemilikan. Keterangan itu menurut sejumlah kontraktor di sana yang enggan disebut jati diri mereka merupakan bukti dugaan kolusi sarat di Aceh Singkil dan berharap Kajati Aceh turun tangan karena institusi hukum di kabupaten dituding enggan mengungkap kasus-kasus dugaan kolusi tender di sana. (b27)


WASPADA Rabu 27 Februari 2013

Kondisi Panti Asuhan Tunas Murni Memprihatinkan

Zikir Diminta Tuntaskan Lima Janji SUBULUSSALAM (Waspada): Komite Mahasiswa Pemuda Aceh (KMPA) Kota Subulussalam meminta Gubernur Aceh dan Wakilnya, Zaini Abdullah-Muzakir Manaf (Zikir) menuntaskan lima janji pada 2013 ini. Koordinator KMPA Ardhiyanto Ujung, Selasa (26/2) meminta Zikir menjaga marwah Memorandum of Understanding (MoU) Helsinky dan UU Pemerintahan Aceh (UUPA). Pemerintah pusat dan Aceh harus serius memperjuangkan turunanUUPAdandijadikanpedomandalammenyusundanmembuat kebijakan/aturan sehingga antar keduanya tidak saling tuding. Zikir diminta bangun industri baru di wilayah tengah tenggara Aceh, perusahaan kopi bertaraf internasional di Gayo, kawasan industri coklat di wilayah Aceh Tenggara serta pelabuhan CPO dan pabrik minyak curah di Subulussalam-Singkil. Penekanan ini, sejalan dengan wacana Pemda setempat yang akan membangun sarana terkait sehingga PA hanya memberikan dorongan. PA diminta memperbaiki infrastruktur jalan wilayah tengah tenggara, karena rusak parah, terlebih di saat musim penghujan acap terjadi longsor. Jalan berkualitas di jalur Gayo-KutacaneSubulussalam-Singkil pun harus dibangun. (b28)

Jumlah Kursi DPRK Dipertanyakan SUBULUSSALAM (Waspada): Menanggapi wacana kursi DPRK Subulussalam pada 2014 tidak berubah, khusus di daerah pemilihan (dapil) III Kecamatan Penanggalan dipertanyakan masyarakat setempat. Pasalnya, peningkatan jumlah penduduk di kecamatan itu lebih tinggi dibanding kecamatan lain. Syahril Tinambunan, tokoh LSM dan Ketua DPD PAN Subulussalam, Selasa (26/2) mengaku heran jika jumlah kursi dapil III tetap atau tidak berubah untuk Pemilu 2014. “Sebagai masyarakat, saya protes jika jumlah kursi dapil III tetap,” ujar Syahril. Menurut Syahril, saat menghadiri pertemuan sejumlah pimpinan partai dengan KIP setempat disebutkan bahwa ada teknis pembulatan yang menjadi ketentuan dalam penentuan jumlah kursi per dapil. Sependapat terjadi pertambahan penduduk di semua kecamatan, Syahril menilai kalau Kec. Penanggalan (dapil III) lebih tinggi. Dikatakan Syahril, Kec. Simpang Kiri 8,1 dibulatkan menjadi 8. Lalu, Sultan Daulat dan Penanggalan, yakni 3,68 dan 3,62 menjadi 4 serta Kec. Rundeng dan Longkib 4,1 menjadi 4. (b28)

Kantor Wali Kota Subulussalam Ditempati 4 Maret SUBULUSSALAM (Waspada): Dinilai telah rampung, Kantor Wali Kota Subulussalam di Lae Oram, Kec. Simpang Kiri dan sejumlah kantor yang selokasi di sana dijadwalkan mulai difungsikan, Senin (4/3). Wali Kota Subulussalam Merah Sakti saat melantik Penjabat Sementara (Pjs) Kepala Desa Belegen Mulia, Adnan, Selasa (26/ 2) mengatakan, kantor yang dinilai sangat representatif itu akan segera difungsikan dan berharap jalan roda pemerintahan semakin lebih baik. Adnan, staf Setcam Simpang Kiri dilantik menjadi Pjs Kades Belegen Mulia, Kec. Simpang Kiri, Subulussalam diharapkan mampu memberikan kontribusi yang terbaik bagi masyarakat setempat. (b28)

Alumni SMA Beureunuen Peringati Maulid BANDA ACEH ( Waspada): Sekitar 500 alumni SMA Beureunueun/SMA Negeri 1 Mutiara, Pijay dari berbagai angkatan sejak 1975 dan dari berbagai profesi, memperingati Maulid Nabi Muhammad SAW, Minggu (24/2) di gedung AAC Dayan Dawood Darussalam Banda Aceh. Kegiatan maulid juga dirangkai dengan penyantunan kepada 20 anak yatim dari panti asuhan Nirmala, Banda Aceh. Ikut hadir M Nasir Djamil, anggota DPR-RI yang juga tokoh masyarakat Kecamatan Mutiara, dan ikut memberikan pengarahan kepada alumni sekolah itu. Masrul Aidi, LC sebagai penceramah mengatakan, dalam sosok seorang yatim sejak kecil, Rasulullah tidak pernah merepotkan orang lain. Rasul sejak kecil sangat mandiri dan giat berusaha. Sementara Basri A. Bakar, mewakili Ketua Alumni dan Hj Zakiah Hasan Basri sebagai ketua panitia maulid, secara senada mengatakan, perlunya perekatan yang kuat antara alumni agar berbagai karya yang ingin disumbangkan kepada masyarakat mendapat nilai maksimal. Ketua Umum Alumni SMA Beureunueun Nurdin F Joes secara terpisah mengisyaratkan dirinya akan menyerahkan tampuk kepemimpinan kepengurusan alumni dalam musyawarah besar alumni mendatang. Nurdin merupakan ketua umum pertama alumni itu. (b06)

DSI Aceh Berlakukan Pengajian Rutin BANDA ACEH (Waspada): Untuk memaksimalkan penerapan Syariat Islam dalam kalangan aparatur pemerintah, Dinas Syariat Islam Aceh melakukan program pengajian rutin yang diselenggarakan pada mushalla As-Salam, komplek keistemewaan Aceh Demikian disampaikan Kadis Syariat Islam Aceh Syahrizal Abbas saat membuka pengajian rutin tentang khazanah Agama di Mushala As-Salam, Selasa (26/2). Kadis menambahkan, program pengajian ini dilakukan semata-mata untuk menambahkan ilmu pengetahuan aparatur negara dalam melaksanakan tugas di Dinas Syariat Islam Aceh “Pengajian ini terbuka untuk umum, bila ada masyarakat untuk menambahkan wawasan keIslaman dan ilmu pengetahuan silahkan saja mengikuti,” papar Syahrizal Abbas. (cb01)

Satpol PP Tertibkan Papan Reklame Toko Di Jalan Hasan Saleh BANDA ACEH(Waspada): Kepala Satuan Polisi Pamong Praja (Satpol PP) Pemko Banda Aceh Edi Syahputra, SH mengatakan penertiban terhadap papan reklame toko atau neon box di Jalan Hasan Saleh yang dilakukan pihaknya sudah disosialisasikan sebelumnya kepada pemilik toko. “Ini sudah kita komunikasikan dengan Kepala KPTSP Kota Emila Sofayana, dan memang harus dibersihkan karena telah menyalahi aturan,” ujar Edi Syahputra, Selasa (26/2) di selasela penertiban. Kata dia, penertiban ini dilakukan karena papan reklame dan neon box di sepanjang Jalan Hasan Saleh teleh melebihi batas yang telah ditetapkan. Penertiban ini sekaligus untuk melebarkan ruas jalan dan memberi akses bagi para pejalan kaki yang saat ini haknya sudah terganggu dengan tiang-tiang papan reklame, jelasnya. Selain papan reklame, Edi juga mengisyaratkan akan menertibkan emperan toko yang telah dimanfaatkan oleh pemiliknya untuk menempatkan barang. Bahkan ada emperan yang telah dipagari dengan jeruji besi dan memakai pintu rolling door. “Emperan kan tidak boleh untuk menempatkan barang, bahkan kita lihat ada emperan yang sudah dipagari hingga empat meter dari pintu toko, ini jelas menyalahi aturan,” terang Edi. Terkait dengan kanopi, Edi mengatakan dalam waktu dekat juga akan ditertibkan, namun terlebih dulu akan diberikan sosialisasi selama dua bulan kepada pemilik toko. “Kanopi yang diizinkan adalah 2,5 meter tidak boleh pakai tiang penyangga, harus digantung. Ini juga sudah kita sosialisasikan,” paparnya. Sekira 50 petugas Satpol PP dibantu aparat TNI dan kepolisian tidak menemui kesulitan dalam melakukan penertiban. Papan reklame berhasil dirubuhkan tanpa perlawanan dari pemilik toko karena telah di sosialisasikan sebelumnya oleh petugas. (b02)

B11 KUTACANE (Waspada) : Kondisi bangunan hunian 76 anak –anak di Pantai Asuhan Tunas Murni Aceh Tenggara sangat memprihatikan. Ruang tidur berikut perlengkapan yang tersedia sangat memprihatikan. Dalam kunjungan kerja Drs Baharudin, Kadis Sosial Tenaga Kerja dan Yransmigrasi ke Panti Asuhan Tunas Murni, Selasa (26/2), didampingi Addin, Kepala UPT Panti Asuhan, tampak 4 ruang tidur anak – anak penghuni panti sebagian besar dalam kondisi reot. Demikian juga kondisi bangunan papan yang ditempati, merupakan bangunan kayu tahun 1970, telah rusak dimakan usia. Addin mengatakan, sebelumnya melalui dinas sosial telah diusulkan pembangunan ge-

Waspada/Mahadi Pinem

KONDISI Panti Asuhan Tunas Murni cukup memprihatinkan.Foto direkam, Selasa (26/2)

Kas Pemerintah Aceh Bocor Rp33,58 Miliar BANDA ACEH (Waspada) : Berdasarkan hasil audit yang dilakukan BPK (Badan Pemeriksa Keuangan) Perwakilan Aceh, ditemukan kebocoran Kas Pemerintah Aceh senilai Rp33,58 miliar yang terjadi sepanjang 2011. Kebocoran itu hingga saat ini belum dapat dipertanggungjawabkan. Kepala Bagian Hubungan Masyarakat Badan Pemeriksa Keuangan (BPK) Perwakilan Aceh, Rinaldi mengungkapkan hal itu kepada wartawan, Senin (25/2). Temuan kebocoran itu terangkum dalam Laporan Hasil Pemeriksaan (LHP) BPK, yang menemukan ada selisih sebanyak Rp33,58 miliar antara penerimaan dan pengeluaran dalam kas daerah tersebut. Selain itu, dalam Laporan Hasil Pemeriksaan, BPK juga merekomendasikan agar Gubernur Aceh memerintahkan kuasa Bendahara Umum Anggaran (BUA) mempertanggungjawabkan selisih dana kas

tersebut. Rinaldi mengungkapkan, dalam LHP BPK tahun 2012 atas laporan keuangan Pemerintah Aceh ke Gubernur Aceh dan Ketua DPRA untuk menelusurinya sehingga diketahui penyebab kebocoran. Namunsetelah ditunggu, sampai saat ini belumadapenjelasandariGubernur Aceh ke BPK terkait selisih kurang kas daerah Rp33,58 miliar itu,” ungkap Rinaldi. Disebutkan Rinaldi, BPK telah meminta Gubernur Aceh memerintahkan Tim Penyelesaian Kerugian Daerah (TPKD) atau Majelis Pertimbangan untuk menagih kepada BUA atau pihak lain yang harus bertanggungjawab. “Sampai saat ini kami belum mendapatkan hasilnya. Jika memang tak ada pertanggungjawaban, tak ada jalan lain ini harus ditindaklanjuti dan harus diselesaikan secara hukum,” jelas Rinaldi. Koordinator Gerakan Antikorupsi (GeRAK) Aceh, Askhalani yang mengomentari kasus ini, mengatakan, jika tak ada kejelasan, pihaknya pada Maret 2013 nanti akan melaporkan kasus kebocoran anggaran Rp33.58 miliar itu ke Komisi

Pemberantasan Korupsi (KPK). “Kita akan laporkan kasus kebocoran Kas Daerah Pemerintah Aceh tersebut ke KPK. Karena, sepertinya kalau dilapor ke kepolisian dan kejaksaan di Aceh, kasus ini tak akan jalan sesuai harapan. Harapan kami adalah KPK untuk mengusut kasus dengan tuntas,” kata Askhalani. Berdasarkan hasil penelaahan sementara dilakukan GeRAK Aceh, kebocoran kas daerah itu terkait permainan dalam pelaporan upah pungutan pajak dan bunga bank yang diperoleh dari penyimpanan kas daerah di sejumlah bank pemerintah. “Pelaporan atas penerimaan daerah sebanyak Rp1,8 triliun pada saat itu tak sesuai prosedur. Ini bentuk permainan terhadap PAD (Pendapatan Aslli Daerah) dari pajak kendaraan, retribusi dan lain sebagainya, yang dari tahun ke tahun ditetapkan hampir sama,” jelasnya. Dikatakan, Pemerintah Aceh terkesan sengaja tak menindaklanjuti temuan BPK tersebut. Inspektorat Aceh yang bertugas menelusuri kebocoran tersebut tak pernah memberikan laporan. (b09)

Pidie Berlakukan BBM Non Subsidi Mobil Dinas SIGLI (Waspada): Pemerintah Kabupaten Pidie masih menunggu surat Gubernur Aceh untuk memberlakukan Bahan Bakar Minyak (BBM) non subsidi bagi seluruh kendaraan dinas. “Bila surat gubernur sudah datang, kita langsung laksanakan kebijakan tersebut,” papar Sekda Pidie Said Mulyadi, Selasa (26/2). Said Mulyadi mengungkapkan kendati sat ini kebijakan itu belum dilaksanakan, namun ia selaku Sekda Pidie selalu mengarahkan aparat pemerintah di jajarannya untuk menggunakan BBM non bersubsidi ketika menggunakan kendaraan dinas. Hal ini paling tidak un-

Said Mulyadi Sekda Pidie tuk memberi contoh kepada masyarakat mampu.

Diakuinya ketika menggunakan BBM non subsidi, berarti anggarannya harus lebih banyak. Namun Pemkab Pidie akan melakukan penyesuaian anggaran biaya operasional pada perubahan anggaran 2013 dengan mengacu pada upaya penghematan. “Kami sedang merumuskan bersama staf, tetapi saya mengarah paling tidak aparat pemerintah memberi contoh penghematan karena arahnya tentu kami ingin menganjurkan jajaran kami menggunakan BBM yang nonsubsidi. Ketika menggunakan BBM nonsub-sidi, berarti anggarannya harus lebih banyak,” jelas Said Mulyadi. (b10)

Pelaksanaan UN 2013 Makin Ketat BANDA ACEH (Waspada): Pelaksanaan Ujian Nasional (UN) tahun ajaran 2012/2013 makin ketat, setiap peserta akan mendapatkan naskah soal yang berbeda. “Kalau dalam satu ruangan ujian 20 peserta, maka mereka mendapat soal yang berbeda,” kata Laisani. Ketua panitia UN Aceh 2013 ini mengatakan, penambahan paket soal yang berbeda untuk peserta jenjang SMA/MA, SMK, dan SMP/MTS merupakan hal yang membedakan dengan UN tahun 2012 lalu. “UN 2012 lalu hanya ada lima paket soal,” ungkapnya.

Sedangkan untuk peserta SMALB, SMPLB, Paket C Kejuruan dan Paket B/Wustha, kata Laisani, tiap lokal lima paket soal.“Khusus Paket A/Ula hanya ada satu paket soal,” ujarnya pada pelatihan tim sosialisasi dan penyelenggara UN 2013, Selasa (26/2) di Banda Aceh. Pada sisi lain, pengawasan UN 2013 ini juga makin ditingkatkan. “Pelaksanaan UN untuk Paket C sekarang jadi tanggungjawab pengawasan perguruan tinggi, di mana Kemendikbud menunjuk Universitas Syiah Kuala sebagai koordinator untuk Aceh.

Hal lain yang membedakan kebijakan UN tahun 2013 dengan 2012 lalu, tambahnya, terkait dengan guru pengawas. Di mana untuk tahun ini guru pengawas diatur secara silang. “Jadi semua kebijakan UN itu, tujuannya untuk meminimalisir kecurangan,” papar Laisani. Sementara untuk nilai kelulusan siswa, ujarnya, masih seperti UN tahun lalu yaitu gabungan antara hasil UN dengan US (ujian sekolah). “Nilai kelulusan itu gabungan hasil UN 60 persen dan US 40 persen,” ungkap Laisani yang juga Kabid Dikmenjur Disdik Aceh. (b06)

Kamiliah Wardani, Juara II Olimpiade Matematika Nasional TAKENGEN (Waspada): Kamiliah Wardani, 13, pelajar SMPN 1 Takengen menyabet prestasi di kancah nasional. Pelajar kelas 3 ini meraup Juara II Olimpiade Matematika dan sains tingkat nasional yang diselenggarakan Ikatan Alumni Universitas Brawijaya di Malang Jawa timur, 1-4 Februari 2013 lalu. Kamiliah menjadi juara seleksi di tingkat kabupaten, selanjutnya dia diundang ke Olimpiade Sains dan Matematika itu. Bersaing dengan 20 ribu peserta dari seluruh Indonesia baik tingkat SD, SMP dan SMA, ia sukses masuk nominasi 50 finalis tingkat SMP. Dari 50 soal yang diselesaikan, ia mengungguli peserta dari Palembang dan kalah tipis dengan peserta dari

Jambi. Didampingi ibunya, Wirda, Selasa (26/2) Kamilia berkisah, prestasinya tak terlepas dari keinginannya jadi ilmuan dan tekun belajar. Pelajar yang jadi langganan juara umum di sekolahnya ini mengaku tak terlalu memaksa diri dalam belajar, namun saat belajar ia sangat tekun menyelesaikan soal-soal matematika. “Gaya belajar saya sih biasa saja, tidak bisa dipaksakan, kalo dipaksakan malah tidak bisa. Ada waktu luang saya manfaatkan untuk belajar. Jika tidak, sama seperti pelajar lainnya, saya juga suka nonton televisi dan bermain bersama teman,” katanya. Ibunya mengakui bahwa di

rumah anak ini juga sangat tekun, meski tak dipaksakan oleh orangtuanya untuk belajar. Jika dipaksa, materi pelajaran justru sukar masuk ke benaknya. Kamiliah menuturkan, ia sudah menyukai ilmu hitungmenghitung dan biologi sejak kelas 3 SD. Dalam belajar, sulung empat bersaudara ini dibimbing beberapa gurunya, Kasmiati, Fitri Nasution, Sukaryati dan Rakinem. Kepala SMPN 1 Takengen Amna mengaku bangga dan berharap ada Kamilia lainnya akan muncul mewakili Aceh Tengah. Prosesi pemberian plakat, tropi dan medali beberapa waktu lalu dilakukan Sekjen Universitas Brawijaya DR Ir Maftuch. (b33/b32)

dung huni yang layak untuk menampung anakanak di panti asuhan, melalui dana otsus senilai Rp2,4miliar,namunbelumdiketahui tindak-lanjut usulan pada dana otsus tersebut. Dikatakan, saat ini jumlah anak panti asuhan di bawah binaan pantiTunas Murni ini berdasarkan jenis kelamin, perempuan 17 orang, dan pria 59 orang. Kecuali kondisi ruang tidur yang memprihatikan, juga tampak sumpek, dimana satu ruang diisi 20 orang, juga kondisi lemari dan dipan maupun tilam yang dipakai selama ini, tampak sebagian rusak. Kadis Sosial Tenaga Kerja dan Transmigras Agara Baharudin menyampaikan, dengan dilakukan kunjungan ini akan dijadikan kajian untuk perbaikan ke depan. (b25)

Bangunan SD Terancam Amblas BLANGPIDIE (Waspada) : Bangunan Sekolah Dasar (SD) Swasta di Desa Seunaloh, Kecamatan Blangpidie, Aceh Barat Daya terancam amblas ke sungai. Pasalnya, aliran Sungai Kreung Beukah semakin mendekat ke fasilitas pendidikan itu, hanya berjarak 10 meter dari bangunan tanpa tanggul pengaman. Kepada Waspada, Selasa (26/2) Jasman, warga Seunaloh menginginkan supaya pemerintah segera turun ke lokasi untuk melihat kondisi tebing sungai yang lambat laun terus mengikis dan membuat bangunan sekolah tersebut akan terjun ke sungai. “Sangat dikhawatirkan andai pemerintah tidak menanggapinya dengan serius, kita menyayangkan anak-anak yang masihdudukdibangkukelassatusekolahtersebut, bilagurunyalengahpastiakanmengancamnyawa

siswa di sekolah itu,” ungkapnya. Bila dibiarkan seperti itu, lanjut Jasman, bangunan sekolah yang baru saja difungsikan pada 2012 itu akan hancur. Pernyataan yang sama juga ditanggapi anggota Ikatan Sarjana Pendidikan Indonesia (ISPI) Abdya Ivandi Akmal. Dia mengatakan, kalau kondisi bangunan sekolah sama sekali tidak strategis di lokasi tersebut karena Sungai Krueng Beukah yang mengalir ratusan meter tersebut akan menghantam tebing sungai, apalagi keadaan sekarang curah hujan sangat tinggi. “Solusinya, tebing sungai itu perlu pengaman, untuk itu pihak sekolah dan juga masyarakat segera membuat permohonan kepada pihak terkait supaya ada tindak lanjut,” ujarnya. (b08)

Anggota POM Tewas Ditikam Adik Ipar BANDA ACEH (Waspada): Seorang anggota Polisi Militer (POM) Kodam Iskandar Muda, Sersan Mayor (Serma) Supriono tewas ditikam adik iparnya sendiri di rumah mertuanya di Gampong Peulanggahan, Kecamatan Kutaraja, Banda Aceh, Senin (25/2) sekira pukul 18:30. Menurut keterangan yang dihimpun di TKP, kejadian berawal dari permasalahan keluarga. Supriono yang sebelumnya tinggal serumah dengan mertua dan istrinya, pulang untuk berpamitan kepada keluarga sekaligus mengambil barang-barang yang masih berada di rumah, karena korban telah menyewa sebuah rumah. Namun saat di rumah terjadi cek-cok, kedua pelaku berinisial Ms dan Kh, mantan anggota TNI yang sudah disersi langsung membogem korban. Dalam waktu yang bersamaan Kh mengambil sebilah pisau di dapur dan menikam korban hingga lima tusukan di bagian dada dan perut hingga korban tewas di tempat. Setelah menusuk korban, Kh naik ke lantai dua (rumah TKP) untuk mengambil helm dan langsung kabur. Namun Ms langsung ke Polsek untuk menyerahkan diri dan kemudian dibawa

ke Polresta Banda Aceh sekira pukul 20:30 dan saat ini sudah dipindahkan ke Polda Aceh. Setelah kejadian, korban sempat dilarikan ke Rumah Sakit Harapan Bunda, namun tidak tertolong, akhirnya jenazah korban dibawa ke Rumah Sakit Umum Zainoel Abidin (RSUZA) untuk keperluan otopsi. Sementara di tempat kejadian perkara bekas ceceran darah korban masih tercecer di ambal ruang tamu dan barang bukti berupa sebilah pisau dapur stainless sudah diamankan pihak POM. Kepala Penerangan Kodam (Kapendam) Iskandar Muda, Kolonel Subagio Irianto menjelaskan, kasus ini telah ditangani pihak kepolisian, karena pelakunya adalah warga sipil.“Kita serahkan penyelesaian kasus ini kepada polisi,” terangnya. Kabid Humas Polda Aceh Gustav Leo menjelaskan, kasus ini ditangani Polresta Banda Aceh karena wilayah hukum Polresta, sementara satu orang diduga pelaku inisial Ms sudah diamankan di Mapolda Aceh karena faktor keamanan, sedangkan satu orang lagi kabarnya sudah menyerahkan diri. (cb01)

Puskesmas Di Abdya Kekurangan Obat BLANGPIDIE (Waspada) : Sejumlah Puskesmas di Kabupaten Aceh Barat Daya dilaporkan kekurangan obat-obatan, meski begitu pelayanan kesehatan masyarakat masih tetap dilakukan, namun bila kekurangan obat berlangsung lama, maka dikhawatirkan berdampak pada lumpuhnya aktivitas puskesmas. Kadis Kesehatan Abdya Martunis, Selasa (26/2) mengungkapkan, minimnya obat-obatan yang tersedia di masing-masing puskesmas di wilayah itu berdasarkan laporan para Kepala Puskesmas (Kapus). “Selasa (26/2) kita telah turun ke 2 puskesmas di pantai timur Abdya yakni Lembah Sabil

dan Manggeng, dari hasil pemeriksaan yang kita lakukan menunjukkan obat-obatan di 2 puskesmas itu memang kurang dan perlu banyak penambahan,” ungkap Martunis. Kekurangan obat-obatan di masing-masing puskesmas, menurut Martunis, sangat tidak disayangkan, di mana puskesmas merupakan sarana yang sangat vital dalam melayani kesehatan masyarakat sebelum dilanjutkan ke layanan kesehatan yang lebih tinggi yakni rumah sakit.“Bila obat-obatan kurang, ini akan berdampak pada tidak optimalnya layanan terhadap pasien,” katanya. (b08)

Walhi Aceh Pertanyakan Kasus Perusakan Lingkungan BLANGPIDIE (Waspada) : Penandatanga- saat ituyang menggunakan pasal tentang nan bersama Nota Kesepahaman Tujuh Pilar lingkungan dan menjerat para pelaku, namun Polmas Plus Perlindungan Lingkungan dan anehnya kasus tersebut kini sudah tidak diketahui Sumberdaya Alam oleh Kapolda Aceh Irjen Pol lagi perkembangannya, apalagi para pelaku yang Herman Effendi bersama sejumlah lembaga sudah berstatus tersangka, sejauh ini belum di Mapolda Aceh (Rabu, 20/2) lalu, kini mulai diketahuiperkembanganterhadapkasustersebut,” dipertanyakan komitmen dan tindaklanjutnya. kata Zulfikar. Hal itu berkenaan dengan sejumlah kasus Zulfikar juga menilai proses hukum terhaperusakan lingkungan serta perambahan hutan dap para pelaku perusak lingkungan sampai yang masih terjadi di beberapa daerah yang saat ini masih mengambang dan belum ada sejauh ini dianggap belum ditangani secara yang sampai ke meja hijau. serius, namun demikian sejumlah kalangan Oleh karenanya Walhi Aceh mendesak Katetap memberikan apresiasi atas sikap Kapolda polda dan jajaran yang ada dibawahnya untuk dalam upaya penegakan hukum terkait pena- memberikan bukti nyata kepada publik sehingnganan kasus lingkungan seperti dalam kasus ga kasus perusakan lingkungan dapat diseret rawa tripa yang sudah menetapkan 4 tersangka. ke pengadilan sehingga memberikan dampak “Sikap Kapolda Aceh dalam kasus rawa tripa positif dalam penegakan hukum khususnya serta penandatanganan nota kesepahaman di bidang lingkungan hidup di daerah Aceh. bersama kita apresiasi, namun demikian kita Kabid Humas Polda Aceh Kombes Pol Gusjuga patut mempertanyakan komitmennya ter- tav Leo menyarankan agar menghubungi secara hadap sejumlah kasus di daerah yang sejauh langsung pihak Polres Abdya yang telah menguini tidak ditangani serius dan cendcerung terli- sut kasus tersebut, apalagi dalam kasus perusahat sudah dipetieskan oleh para penyidik di kan lingkungan dan perambahan hutan lindung lapangan,” ungkap DirekturWahana Lingku-ngan di kawasan Babahrot itu sudah memiliki terHidup (Walhi) Aceh, TM Zulfikar, dalam siaran sangka dan sampai kini masih mengambang. persnya kepada Waspada, Selasa (26/2). Kapolres Abdya AKBP Eko Budi Susilo melaMenurut TM Zulfikar, dalam kasus perusa- lui Kasat Reskrim Iptu Marzuki membantah kan lingkungan dan perambahan hutan lindung telah mempetieskan kasus tersebut. Menurutyang sangat mencolok dan telah ditangani sebe- nya, kasus yang telah menyeret Kadis Kehutanan lumnya oleh pihak kepolisian adalah penetapan dan beberapa pelaku lain sebagai tersangka tersangka terhadap perusakan hutan lindung itu masih terus dikembangkan. (cb05) di kawasan Babahrot, Aceh Barat Daya. Kasus tersebut sempat menyedot perhatian banyak kalangan, karena Kapolres Abdya saat itu menggunakan UU Lingkungan Hidup dan menjerat para pelaku perusakan hutan lindung, kasus tersebut menyedot perhatian banyak pihak ketika itu karena Kapolres secara tegas melakukan upaya perlindungan lingkungan hidup dengan menggunakan UU Lingkungan yang disebut oleh Walhi Aceh sebagai bentuk tindakan yang paling luarbiasa Waspada/Dokumentasi Walhi Aceh pada saat itu. DALAM foto yang dirilis Walhi Aceh terlihat kondisi hutan lindung “Kita patut acungi jem- di kawasan pegunungan Babahrot, Abdya, rusak parah. Kasus pol dan berikan apresiasi perusakan lingkungan yang sempat diusut Polres Abdya masih terhadap Kapolres Abdya mengambang.

Pentas Pilkada


WASPADA Rabu 27 Februari 2013

PULUHAN ribu massa pendukung pasangan no 4 Cagubsu dan Cawagubsu Haji Amri Tambunan dan RE Nainggolan membanjiri Lapangan Merdekan Medan saat kampanye, Selasa (26/2) sore.

Waspada/HM Husni Siregar

Puluhan Ribu Massa Hadiri Kampanye Amri RE Di Lapangan Merdeka Medan

Marzuki Ali Sampaikan 4 Pesan SBY Kepada Masyarakat Sumut MEDAN (Waspada) : Kampanye akbar pasangan“pelangi” Cagubsu/Cawagubsu nomor urut 4 Drs Haji Amri Tambunan-Dr RE Nainggolan MM berlangsung luar biasa, sukses dan meriah di Lapangan Merdeka Medan, Selasa (26/2) sore. Puluhan ribu massa yang “memutih birukan” lokasi kampanye menyambut antusias kahadiran pasangan birokrat yang sudah teruji dan berpengalaman mengelola pemerintahan, pembangunan dan kemasyarakatan diyakini akan mampu membawa Sumut ke arah yang lebih baik hadir bersama Ketua DPR RI H Marzuki Alie, DR Syarif Hasan (Menkop), Wakil Ketua Umum DPP Partai Demokrat Jhony Allen Marbun, H Sutan Batoegana, Ketua DPD PD Sumut HT Milwan serta sejumlah Jurkam lainnya. Ketua DPR-RI H Marzuki Alie diawal orasi politiknya menyerukan kepada puluhan ribu massa agar dalam memilih pemimpintidakbolehcoba-coba. Pasangan nomor urut 4 AmriRE merupakan calon pemimpin Sumut yang sudah teruji yang memiliki pengalaman dan kemampuan untuk membawa Sumut kearah yang lebih baik. Tampil orator di hadapan puluhan ribu massa, Ketua DPR RI itu menyampaikan 4 pesan Presiden SBY selaku Ketua Majelis Tinggi Partai Demokrat kepada masyarakat Sumut dimana dalam memilih pemimpin melalui Pilgubsu 7 Maret 2013 jangan sembarangan.Kita harus melihat apa orang yang akan dipilih menjadi pemimpin itu sudah memiliki pengalaman. Pasangan Amri-RE yang merupakan birokrat tulen dengan pengalamannya diberbagai jabatan strategis pemerintahan di Sumut selama ini telah menunjukkan kinerja yang luar biasa. Dengan pengalaman dan kemampuan yang dimiliki pasangan Cagubsu/Cawagubsu yang diusung Partai Demokrat diyakini Sumut ke depan akan lebih baik dan maju, kata Marzuki Alie yang disambut yel…yel…. “Amri Menang…” Amri-RE yang telah teruji mengelola pemerintahan, pembangunan dan pembinaan kemasyarakatan merupakan salah satu dari pasangan Cagubsu/Cawagubsu yang menunjukkan kebhinekaan.Karenanya, kedua kandidat yang diusung

Waspada/HM Husni Siregar

MARZUKI Ali didampingi Wakil Ketua DPP PD Jhoni Allen Marbun, Menkop Syarif Hasan dan pasangan Cagubsu/Cawagubsu Drs Haji Amri TambunanDr RE Nainggolan MM saat menyampaikan orasi politiknya di hadapan puluhan ribu massa pendukung Amri-RE pada kampanye akbar di Lapangan Merdeka Medan, Selasa (26/2) sore. Partai Demokrat ini mendapat dukungan mayoritas masyarakat Sumut. Sementara itu DR Syarif Hasan yang sehariannya menjabat Menteri Koperasi dalam orasinya mengajak seluruh warga Sumut pada pesta demokrasi Pilgubsu 7 Maret 2013 memilih pemimpin yang memiliki integritas tinggi. Kalau kita ingin melihat Sumut ke depan maju dan berkembang baik pada sektor pendidikan, infrastruktur, adanya jaminan kesehatan masyarakat,ekonomi lebih baik begitu juga sosial dan keamanan, tak ada pilihan lain, kita harus memenangkan Amri-RE pada Pilgubsu 7 Maret 2013. Kedua kandidat yang ditampilkan ini tidak perlu diragukan, berbekal pengalaman dan kemampuan yang mereka miliki dalam mengelola pemerintahan,pembangunan dan pembinaan kemasyarakatan yang karirnya diawali dari lurah hingga bupati bahkan Sekwildasu diyakini akan mampu membawa perubahan Sumut ke arah yang lebih baik. Kalau pada 15 tahun silam Sumut merupakan provinsi terbaik di Pu-

lau Sumatera dan kini tertinggal dibandingkan sejumlah provinsi lainnya seperti Riau, Sumbar, Sumsel diyakini di bawah “duet” kepemimpinan Amri-RE Sumut akan bangkit mengejar ketertinggalannya, kata Ketua DPD Partai Demokrat Sumut HT Milwan. Sementara itu, Wakil Ketua DPP Partai Demokrat Jhony Allen Marbun dalam orasi politiknya menyebutkan Sumut yang kini tertinggal dari beberapa provinsi lain kini mendapat perhatian dan kepedulian dari sejumlah tokoh nasional. Terbukti pada hari ini hadir di tengah-tengah masyarakat Sumut Ketua DPR-RI Marzuki Alie begitu juga Pak Syarif Hasan. Mereka memiliki kapasitas kebijakan dan kapasitas anggaran untuk membawa Sumut kearah yang lebih baik. Karenanya, kalau tokoh-tokoh nasional sudah menetapkan pasangan AmriRE untuk menjadi pemimpin di Sumut kita tak perlu ragu dan mari kita menangkan Amri-RE pada Pilgubsu 7 Maret 2013. Sementara itu, Cagubsu Drs Haji Amri Tambunan dalam

orasi politiknya menyampaikan dirinya bersama RE Nainggolan akan melakukan perubahan di Sumut jika terpilih menjadi pemimpin melalui Pilgubsu 7 Maret 2013. Pesta demokrasi Pilgubsu merupakan saat yang tepat bagi warga Sumut untuk melakukan perubahan. Apa kita ingin perubahan? tanya Amri Tambunan yang dijawab puluhan ribu massa “ingin”. Pendidikan di Sumut ter-tinggal begitu juga irigasi sekira 30 persen lebih mengalami kerusakan begitu juga kehidupan nelayan kita. Beberapa waktu lalu saya berjuang sendiri tanpa bantuan provinsi melepaskan nelayan kita dari tahanan negara jiran tetangga. Semua itu harus kita benahi sehingga Sumut yang dulu merupakan provinsi terbaik dapat kita kembalikan lagi, tegas Amri yang disambut antusias massa dengan “Amri-RE Menang….”. “Saya tahu persis masyarakat Medan kekurangan air minum dan air bersih. Itu bukan kesalahan Pemko Medan. Namun itu merupakan tanggung jawab provinsi dengan PDAM Tirtanadi. Permasalahan-per-

Waspada/HM Husni Siregar

MASSA pendukung Cagubsu dan Cawagubsu H Amri Tambunan dan RE Nainggolan mengangkat tangan sambil menunjukkan empat jari tanda dukungan ke pasangan no urut 4.

masalahan itu harus diselesaikan, agar masyarakat tidak terganggu untuk mendapatkan air bersih yang merupakan kebutuhan pokok bagi masyarakat. Sementara itu, Cawagubsu Dr RE Nainggolan MM yang mendapat kesempatan dari Cagubsu Drs Haji Amri Tambunan untuk menyampaikan orasi politiknya menyapa puluhan ribu massa dengan pertanyaan apa disini ada suku Jawa, Batak, Karo, Simalungun, Melayu, Minang, Nias dan lainnya dijawab massa “Ada…”. Ini membuktikan Amri-RE nantinya dalam pemerintahannya akan tetap memperhatikan semua suku dan etnis yang ada. Tak satupun suku dan etnis yang ada di Sumut akan tertinggalkan, tegas RE. Begitu juga kaum perempuan akan diberdayakan semaksimal mungkin dan angka pengangguran di Sumut yang cukup tinggi hingga mencapai 460 ribu akan ditekan semaksimal mungkin. Sedangkan pada sektor pendidikan dimana wajib belajar 9 tahun di Sumut belum tuntas, lima tahun ke depan wajib belajar 12 tahun akan dituntaskan di Sumut jika

Amri-RE bisa memenangkan pertarungan Pilgubsu 7 Maret 2013. Pada kampanye yang dihadiri puluhan ribu massa dari berbagai elemen seperti kader Partai Demokrat, organisasi sayap pemenangan Amri–RE seperti ARE Center, KOMPI (komunitas pelangi), TEPAT (teman perjuangan Amri Tambunan), SAHABAT RE, EMPAT (elemen pendukung Amri Tambunan), Posko STM 28, KC 29 (Karya Cipta 29) dan lainnya. Juga tampil menyampaikan orasi politik fungsionaris DPP Partai Demokrat Sutan Bathoegana, Sekretaris Tim Pemenangan Amri-RE Sumut Bahdin Nur Tanjung yang juga tokoh pemuda Muhammadiyah Sumut serta Ketua Tim Pemenangan Syahrial Ams, SH. Kemeriahan kampanye pasangan Amri-RE yang sempat memacetkan sejumlah ruas jalan kota Medan semakin memuncak ketika sejumlah artis ibukota dan Medan mampu menggoyang massa diantaranya Julius Sitanggang, Tio Fanta Pinem, Cici Imut serta Wulansari.(a06)

Amri RE Kampanye, Medan Macat MEDAN (Waspada): Kampanye Amri RE, pasangan cagubsu-cawagubsu nomor 4 yang digelar di Lapangan Merdeka Medan, mengakibatkan arus lalu lintas di kota ini sejak pukul 14:00 Selasa (26/2), padat merayap dan di sejumlah titik terjadi kemacatan. Pantauan Waspada, kemacatan terjadi karena ratusan kendaraan yang membawa massa pendudukung Amri RE dari luar kota memasuki inti kota untuk meramaikan kampanye di Lapangan Merdeka. Sedangkan arus lalu lintas di sejumlah ruas jalan inti kota macat dan tersendat, antara lain Jl.Brigjen Katamso dari mulai simpang Jl.Masjid Raya hingga ke Jl. Putri Hijau.Jl. Hj.Ani Idrus, Jl. Asia, Jl. Diponegoro, Jl.Palang Merah,Jl.A Yani dan Jl. Kereta Api. Kemacatan terlihat makin parah saat kampanye bubar dan bersamaan dengan pulangnya para pekerja. Menurut informasi, seribuan massa pendukung Amri RE datang dari berbagai daerah, yakni Serdang Bedagai, Tebingtinggi, Binjai, Tanah Karo, Simalungun, Pematangsiantar dan dari semua kecamatan di Deliserdang. Sementara, aparat kepolisian lalu lintas Polresta Medan hingga pukul 18:00 masih sibuk mengatur arus lalu lintas yang belum normal.(m11)

Waspada/HM Husni Siregar

CAGUBSU dan Cawagubsu H Amri Tambunan menyapa massa pendukungnya yang hadir pada kampanye di Lapangan Merdeka Medan, Selasa (26/2) sore

Waspada, Rabu 27 Februari 2013  

waspada daily