Issuu on Google+

Harga Eceran: Rp2.500

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

RABU, Wage, 24 Agustus 2011/24 Ramadhan 1432 H

No: 23606 Tahun Ke-65

Terbit 24 Halaman


Khadafi Melawan Putranya Muncul Di Depan Umum

Pemudik Jakarta Turun Ke Medan

TRIPOLI, Libya (Waspada): Media Barat menelan pil pahit atas berita yang diterbitkan, bahwa Moammar Khadafi (foto) sudah ditaklukkan dan tiga anaknya ditawan. Sementara, laporan terbaru mengatakan, baik Khadafi, maupun ketiga putranya baik-baik saja. Sedangkan, pertempuran baru meletus di Tripoli Selasa (23/8) , beberapa jam setelah putra tiba-tiba muncul dan membantah pernyataan pemberontak Libya, bahwa dia telah ditangkap. Pertempuran sengit terjadi di sekitar kompleks kediaman Khadafi di Bab al-Aziziya dan asrama-asrama militer, yang porak-poranda akibat serangan udara NATO. Kemunculan tiba-tiba Seif al-Islam di salah satu hotel Tripoli, di mana para jurnalis asing tinggal menyebabkan

Waspada/Anum Saskia

Muhammad Chow Cin Wi:

Berdakwah Hingga Ke Malaysia Dan Brunai MUHAMMAD Chow Cin Wi (foto) atau akrab disapa Awi Ceng Ho, mengaku sangat merindukan bulan suci Ramadhan. Di bulan ini, lelaki yang berprofesi sebagai ustadz tersebut tidak ingin melewatkan waktu tanpa beramal. “10 Tahun menjadi muslim, membuat saya ingin menjadi bagian yang diperhitungkan dalam agama Islam. Karena itu, saya sudah menekuni dunia dakwah dan menjadi penceramah di berbagai daerah termasuk Brunai Darussalam,” ujar Ustadz Cheng Ho.

Lanjut ke hal A2 kol. 3

Lanjut ke hal A2 kol. 3

Indonesia Prihatin PADALARANG (Antara): Perkembangan situasi konflik di Libya yang semakin memanas ditandai dengan perebutan ibukota Tripoli antara loyalis Khadafi dengan pasukan perlawanan membuat Presiden Susilo Bambang Yudhoyono berharap peperangan segera berakhir dan tidak lagi jatuh korban jiwa. Presiden di sela-sela kunjungannya di Pusat Pelatihan Infanteri, Cipatat, Padalarang Kabupaten Bandung dalam rangka Safari Ramadhan, Selasa (23/8) sore mengatakan korban jiwa yang jatuh akibat konflik tersebut hendaknya tidak ada lagi sehingga penderitaan rakyat Libya berakhir. Lanjut ke hal A2 kol. 1

Masyarakat Mudik Harus Lapor Kepling Waspada/Abdullah Dadeh

MEDAN ( Waspada): Ribuan warga Jakarta mulai bergerak ke Medan menjelang Idul Fitri 2011 (foto). Mereka menggunakan penerbangan Garuda Indone-

sia, Lion Air, Batavia Air, Sriwijaya Air bahkan Air Asia, Selasa (23/8). Suasana di terminal kedatangan dalam negeri Bandara Polonia Medan mulai ramai

dipadati orang-orang asal Sumut yang tinggal di Jakarta dan sekitarnya, namun belum begitu membeludak. Bahkan penerbangan Batavia Air mengoperasikan

penerbangan berbadan lebar jenis Airbus 330, berkapasitas 375 penumpang, mengantisipasi lonjakan

Lanjut ke hal A2 kol. 4

MEDAN (Waspada): Tim Muspida Plus Kota Medan, Selasa(23/8) malam meninjau persiapan Pos Pengamanan (Pos Pam) Operasi Ketupat Lebaran di sejumlah lokasi padat di Kota Medan. Tim yang turun dipimpin Wali Kota Medan, Rahudman Harahap bersama Kapolresta Kombes Pol Tagam Sinaga, Dandim 0201/BS Letkol Inf Doni Hutabarat, Danlanud Medan Kolonel Pnb Taufik Hidayat SE, Wakil Wali Kota Lanjut ke hal A2 kol. 1

Demokrat Bidik Wagub MEDAN (Waspada): Suasana gedung DPRDSU pasca gagalnya penggunaan hak interpelasi oleh anggota dewan diwarnai berbagai rumor. Yang paling keras menyebutkan Partai Demokrat (PD) meAP PUTRA Moammar Khadafi, Seif al-Islam melambaikan tangan manfaatkan interpelasi sebagai alat tawar kepada ke arah para pendukung setia ayahya di Tripoli, Libya , Selasa Plt. Gubsu Gatot Pujonugroho agar Ketua Demokrat (23/8). Al-Islam, yang sebelumnya dilaporkan tertangkap oleh Sumut H.T. Milwan menjadi Wagubsu. pemberontak Libya pada Selasa pagi muncul di tengah-tengah wartwan asing di Tripoli, dan berkonvoi keliling kota.

Lebaran Berpeluang Hujan, Waspadai Banjir Kiriman MEDAN (Waspada) : Hari Lebaran berpotensi hujan pada malam dan pagi hari, kata Hartanto, Kepala data dan informasi (Datin) pada BMKG Wilayah I stasiun Bandara Polonia Medan ketika dikonfirmasi, Selasa (23/8). Kata dia, saat ini di kawasan Medan bahkan Sumatera Utara sedang memasuki musim penghujan, termasuk bersamaan hari Lebaran 1432 H, Selasa dan Rabu (30/31) Agustus 2011. Menurut data pada Badan Meteorologi, Klimatologi dan Geofisika (BMKG) Wilayah I, peluang curah hujan ke depan cukup besar. “Kondisi cuaca di Sumut dipengaruhi musim hujan dan aktifitas gangguan cuaca di Samudra Pasifik,” kata dia. Diakuinya, sungai-sungai ke depan mulai meluap kalau hujan turun beberapa jam terutama di kawasan hulu sungai. Untuk itu jajaran BMKG meminta warga yang bertempat tinggal di sepanjang aliran sungai seperti Sungai Deli, Babura dan lainnya agar meningkatkan kewaspadaan. Lanjut ke hal A2 kol. 7

Iman Dan Akal Oleh Dedi Sahputra DALAM beberapa ayat Alquran, Allah SWT menyeru manusia untuk menggunakan akal pikirannya; Afalaa ta’qiluun (apakah kamu tidak berpikir?), fa’tabiruu ya ulil albab (hendaklah berpikir wahai orang-orang yang berakal!). Sesungguhnya telah Kami turunkan kepada kamu sebuah kitab yang di dalamnya terdapat sebabsebab kemuliaan bagimu. Maka apakah kamu tiada memahaminya?(QS.21:10) Lanjut ke hal A2 kol. 6

Informasi diperoleh Waspada, Selasa (23/8), PD akhirnya mengambil sikap menolak interpelasi karena sudah ada deal dengan Plt Gubsu dalam

hal jabatan Wagubsu. Selanjutnya sikap ini disampaikan ke Fraksi PD di DPRDSU untuk dilaksanakan. Kata sumber, sikap partai

sangat teguh. Tidak dibenarkan ada lagi tawar menawar. Empat anggota FPD yang menandatangani usul hak interpelasi harus menuruti instruksi ini. Mereka adalah Tahan Manahan Panggabean, Akhmad Ikhyar Hasibuan, Sopar Siburian dan Ramli. Tekanan terhadap empat anggota FPD, disebutkan sumber tidak ada. Malah FPD sangat berterimakasih kepada empat kader mereka yang rela menjadi ‘tumbal’ melaksana-

kan misi partai. Untuk mengkonfirmasi rumor dan isu tersebut, Waspada menghubungi empat orang anggota FPD DPRDSU baik langsung maupun via telefon selular. Seperti biasa, tidak ada satupun dari mereka yang bersedia menyebut telah menjadi ‘tumbal’ partai. Mereka mengatakan patuh terhadap keputusan partai.

Lanjut ke hal A2 kol. 4

Kejagung Tak Tanggapi Nazaruddin

Waspada/Syarifuddin Nasution

RUAS jalan Aek Latong, Sipirok, Tapanuli Selatan yang babak belur hingga kini belum layak dilintasi kendaraan besar.

hilir mudik mengakibatkan badan jalan yang sedang diperbaiki PU mudah anjlok Selain itu bila hujan turun, badan jalan rawan longsor, mengakibatkan sirtu dan batu yang dihampar PU tergerus. Bila kondisinya demikian, truk sarat muatan sering tidak

JAKARTA (Antara): Kejaksaan Agung (Kejagung) tidak menanggapi permintaan dari tersangka dugaan suap Wisma Atlet SEA Games, M. Nazaruddin, yang meninginkan lembaga itu dapat menangani kasusnya. “Kita harap semua menanggapi pernyataan tersebut secara jernih,” kata Wakil Jaksa Agung, Darmono, di Jakarta, Selasa (23/8). Dikatakannya, Komisi Pemberantasan Korupsi (KPK) telah diberi wewenang sesuai undang-undang untuk melakukan penyidikan perkara tindak pidana korupsi yang berarti memiliki wewenang untuk melakukan pemeriksaan atas saksi atau tersangka siapapun orangnya. Ia mengemukakan, kalaupun yang bersangkutan tidak mau menjawab atas

Lanjut ke hal A2 kol. 7

Lanjut ke hal A2 kol. 6

Waspada/Edi Saputra

ALAT berat mengerjakan jalan kabupaten sabagai jalan alternatif di Kel. Simpang Tiga Pekan dan Dusun I, Kec. Perbaungan, Selasa.

Antisipasi Kemacatan Aek Latong, Kendaraan Besar Harus Ditertibkan Perbaikan Jalan Alternatif Di Perbaungan Diburu PADANGSIDIMPUAN (Waspada): Untuk mengantisipasi kemacatan di ruas jalan Aek Latong, Sipirok, Tapanuli Selatan, Gubsu harus memerintahkan instansi terkait menertibkan kendaraan sesuai ketentuan berlaku. Ketegasan Gubsu sangat diharapkan mengingat Lebaran sudah di ambang pintu, sementara truk bertonase tinggi masih terus

Waspada/Surya Efendi

WALI Kota Medan Rahudman Harahap bersama Kapolresta Kombes Pol Tagam Sinaga, Dandim 0201/BS Letkol Inf Doni Hutabarat, Danlanud Medan Kolonel Pnb Taufik Hidayat SE dan Wakil Wali Kota Medan Dzulmi Eldin meninjau persiapan Pos Pam di depan Medan Mal Jl. Haryono MT Medan, Selasa (23/8) malam.

Nasib Husin Sitorus Ditentukan Kamis

Pemkab Batubara Upayakan Pengacara LIMAPULUH (Waspada): Persidangan banding atas nasib warga Batubara Husin Sitorus yang divonis hukuman gantung, Kamis (25/8), akan dihadiri Asisten I Pemkab Batubara, Julhendri. Kepada Waspada, Selasa (23/8), Julhendri mengatakan, Rabu (24/8), ia berangkat ke Malaysia menghadiri sidang banding warga Batubara Husin Sitorus di Mahkamah Rayuan. “Pemkab Batubara telah memberi fasilitas pengacara untuk Husin Sitorus dalam sidang banding Kamis. Saya juga akan hadir dalam sidang itu, kita sudah berupaya maksimal, tinggal berdoa saja semoga Husin dapat dibebaskan minimal diringankan hukumannya,” kata mantan Kabag Hukum Pemkab Batubara itu. Dijelaskannya, ia tetap kontak dengan pengacara Sabastian Cha yang mendampingi Husin Sitorus. Perkembangan terakhir yang diketahui hanya tentang jadwal sidang , belum ada yang lain.

PNS Pemprovsu Libur Panjang MEDAN (Waspada): Berkaitan hari besar keagamaan Idul Fitri 2011, Pegawai Negeri Sipil (PNS) di lingkungan Pemerintah Provinsi (Pemprov) Sumut akan libur lebih dari satu minggu. Meski cuti bersama hanya tiga hari, namun posisi 1 Syawal membuat libur kali ini panjang. ”Cuti resmi hanya tiga hari, namun karena melihat posisi Hari Raya Idul Fitri akan terjadi libur panjang,” kata Kepala Bagian Pengadaan dan Pembinaan BKD Provinsi Sumut Kaiman Turnip, Selasa (23/8). Dia menjelaskan, cuti bersama resmi hanya 29 Agustus 2011 dan 1-2 September 2011. Sedangkan 30-31 adalah tanggal merah dan merupakan libur nasional hari Lebaran. Sedangkan 1-2 September 2011 yang jatuh pada hari Kamis dan Jumat cuti bersama, maka PNS akan masuk kembali kerja 5 September 2011.

Lanjut ke hal A2 kol. 7

Sementara Ketua DPRD Batubara Selamat Arifin saat dikonfirmasi Waspada via ponselnya menyatakan tidak mengetahui persis tentang itu.Dia akan menanyakan ke Komisi A yang menanganinya. “Saya akan konfirmasi dulu ke Komisi A,’’ kata Selamat yang juga sekretaris DPD Partai Golkar Batubara tersebut. Nasib Sitorus akan ditetapkan pada sidang banding di Mahkamah Rayuan Malaysia pada 25 Agustus, atas tuduhan menyelundupkan ganja 143 kg pada 2004.(c05)

Ada-ada Saja “Tak Kenal Maka Ditolak” GELAR raja dan ratu nampaknya bukan jaminan bagi pasangan penguasa Swedia, hanya untuk sekedar mendapatkan jamuan makan di sebuah restoran. Nadine Schellenberger, pemilik Zum Gueldenen Stern, sebuah restoran bergaya abad ke 16 di Ladenburg, Jerman, mengaku menolak Raja dan Ratu Sweden saat mereka memesan meja untuk jamuan makan, karena ia tidak mengenali siapa tamunya tersebut. Lanjut ke hal A2 kol. 2

erampang Seramp ang - Ayo PPP tak ngences jadi Wagubsu? - He...he...he...

P.Sidimpuan 19-300C

R.Prapat 24-32 0C

Penyabungan 19-29 0C

Tarutung 18-28 0C

Sibolga 21-320C BMKG Polonia


WASPADA Demi Kebenaran Dan Keadilan

Prakiraan Cuaca Medan 23-31 0C

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

RABU, Wage, 24 Agustus 2011/24 Ramadhan 1432 H z No: 23607 * Tahun Ke-65

Terbit 24 Halaman (A1-12, B1-12) z zHarga Eceran: Rp 2.500,-


Waspada/Syarifuddin Nasution

RUAS jalan Aek Latong, Sipirok, Tapanuli Selatan yang babak belur hingga kini belum layak dilintasi kendaraan besar. Gubsu harus memerintahkan instansi terkait menertibkan kenderaan bertonase lebih.

Agar Aek Latong Lancar:

Gubsu Harus Perintahkan Penertiban Kenderaan Lebihi Tonase PADANGSIDIMPUAN (Waspada): Ruas jalan Aek Latong, Sipirok, Tapanuli Selatan yang babak-belur hingga kini belum layak dilintasi kendaraan besar. Karena itu Gubsu harus memerintahkan instansi terkait menertibkan kenderaan sesuai ketentuan berlaku. Ketegasan Gubsu sangat diharapkan mengingat lebaran sudah di ambang pintu, sementara truk bertonase tinggi masih terus hilir mudik mengakibatkan badan jalan yang sedang diperbaiki PU tersebut mudah anjlok Lanjut ke hal A2 kol 6

Dua Pekerja PT. Z Diberondong Tembakan OTK


Putra Moammar Khadafi, Seif al-Islam (tengah), melambaikan tangan ke arah para pendukung setia ayahya di Tripoli, Libya , Selasa (23/8). Al-Islam, yang sebelumnya dilaporkan tertangkap oleh pemberontak Libya pada Selasa pagi muncul di tengah-tengah wartawan asing di Tripoli, dan berkonvoi keliling kota.

TRIPOLI, Libya (Waspada): Berbeda dengan apa yang dilaporkan media Barat bahwa Moammar Khadafi sudah ditaklukkan dan tiga anaknya berhasil ditawan, namun berita itu dibantah media Barat itu sendiri dengan adanya laporan baru yang mengatakan, baik Khadafi, maupun ketiga putranya masih misterius.

KIP: Tahapan Pilkada Aceh Tetap Sah BANDAACEH (Waspada): Komisi Independen Pemilihan (KIP) Aceh menyambut baik surat dari pimpinan DPRA mengenai pemberitahuan berakhirnya masa jabatan Gubernur dan Wakil Gubernur Aceh periode 2007-2012. Dengan adanya surat pemberitahuan ini, kerja-kerja KIP menjadi lebih kuat secara hukum. “Kami menyambut baik

surat itu, karena dengan adanya surat ini kita menjadi lebih nyaman bekerja secara hukum,” kata Wakil Ketua KIP Aceh Ilham Saputra pada konferensi pers di Media Center KIP, Selasa (23/8) siang. Menurut Ilham, meski surat pemberitahuan mengenai berakhirnya masa tugas Gubernur dan Wakil Gubernur Lanjut ke hal A2 kol 6

Pertempuran baru meletus di Tripoli Selasa (23/8) beberapa jam setelah putranya tiba-tiba muncul dalam keadaan bebas guna membantah pernyataan pemberontak Libya bahwa dia telah ditangkap, satu langkah yang tampaknya memberikan kekuatan pada pasukan yang masih setia kepada rezim yang kini makin terdesak. Pasukan pemberontak dan pro-Khadafi berjuang dalam pertempuran sengit di jalanan di beberapa bagian kota, sehari

Mantan Menteri HAM Dikebumikan Di Lamlo SIGLI ( Waspada): Mantan Menteri Hak Asasi Manusia (HAM) era Presiden Gus Dur DR H Hasballah M Saad, MA, 63, meninggal dunia di Rumah Sakit Mitra Keluarga Bekasi Barat, Selasa (23/8) sekira pukul 01:00. Lanjut ke hal A2 kol 7

Al Bayan

Bulan Dakwah Oleh: Tgk. H. Ameer Hamzah Ramadhan juga dikenal sebagai bulan dakwah Para muballigh diundang ke mana-mana menyampaikan pesan Allah Adakah pesan-pesan mereka berbekas di hati umat? Perlu sebuah penelitian yang cermat BERDAKWAH kepada jalan Allah (amar makruf dan nahi mungkar) adalah tugas semua umat Islam menurut kapasitas masing-masing. Allah berfirman: Serulah manusia ke jalan Tuhan-mu dengan hikmah dan pelajaran yang baik; dan bantahlah mereka dengan cara yang baik pula...(QS. an-Nahlu:125). Rasulullah bersabda: Siapa di antara kamu melihat kemungkaran, ubahlah dengan tangannya, jika tidak mampu, ubahlah dengan lisannya,, jika tidak mampu, ubahlah dengan hatinya. dan yang terakhir ini termasuk selemah-lemah iman (Hr: Muslim). Dalam hadis lain Nabi berpesan: Sampaikan dariku walau satu ayat.

Lanjut ke hal A2 kol 2

Meneg BUMN Kena Serangan Jantung JAKARTA (Antara): Menteri Negara BUMN, Mustafa Abubakar, yang tengah dirawat di RS Medistra, Jakarta, dipastikan menderita penyakit jantung bukan stroke sebagaimana dikabarkan banyak pihak. “Beliau tidak stroke, tapi gangguan jantung,” kata kolega Abubakar di kabinet, Menteri Kelautan dan Perikanan Lanjut ke hal A2 kol 7

setelah para pejuang pemberontak memasuki ibukota tanpa menghadapi perlawanan berarti, sehingga mereka mengatakan telah menguasai kota secara keseluruhan. Asap tebal berwarna kelabu dan putih mengepul di angkasa Tripoli ketika tembak menembak berat dan ledakan keras mengguncang beberapa distrik kota berpenduduk dua juta jiwa itu. Beberapa di antara Lanjut ke hal A2 kol 3

LHOKSEUMAWE (Waspada): Dua pekerja PT. Zaratex menderita luka-luka dan kini dirawat di rumah sakit PT. Arun di Desa Batuphat Kec. Muara Satu, Kota Lhokseu-mawe, Selasa (23/8), akibat mobil yang mereka kendarai diberondong tembakan saat pulang kerja di Desa Paloh Punti. Keduanya, Anju, 40, asal Kota Medan seorang Supervisor PT. Sari Pari bersama sopirnya Hanafiah, 40 warga Blang Pulo Kec. Muara Satu Kota Lhokseumawe saat itu mengendarai mobil Nissan Navara warna hitam BK 8743. Pihak Polres Lhokseumawe sudah mengamankan mobil korban dan sejumlah selongsong peluru jenis FN yang ditemukan petugas di TKP. Informasi dihimpun Waspada, kronologis kejadian sekitar pukul 15.00, Anju berencana pulang dari lokasi Lanjut ke hal A2 kol 6

BC Segel 29 Ribu Ton Garam India BELAWAN (Waspada): Sekitar 29 ribu ton garam asal India impor disegel Bea dan Cukai Belawan di lima gudang milik PT Garindo Sejahtera Abadi selaku importir. Kepala Seksi Penindakan dan Pencegahaan (Kasi P2) Kantor Pelayaan BC Belawan Devid mengatakan penyegelan biasa terkait jenis dan jumlah garam tersebut. “Jadi dalam waktu dekat ini kita akan melakukan penelitian

terhadap jenis garam itu,” katanya saat dihubungi wartawan, Selasa (23/8) malam. Sementara itu, keterangan dari lapangan, semua garam itu tiba di Pelabuhan Belawan dari negara asal menggunakan Kapal MV Good Princess dan di bongkar selama berberapa hari di dermaga 111 Pelabuhan Belawan. Garam impor itu memiliki dokumen pertanggal 27 Juli 2011 dan kapal tiba di Pela-

buhan Belawan pada tanggal yang sama. Namun, karena semua garam masih berada di dalam kapal penyegelan tidak bisa dilakukan. Maka petugas BC menunggu seluruh garam itu selesai dibongar dan disimpan di lima gudang importir. Keterangan lain menyebutkan penyegelan dilakukan merupakan ekses perseteruan antara Menteri Kelautan dan Lanjut ke hal A2 kol 6

Muhammad Chow Cin Wi :

Berdakwah Hingga Ke Malaysia Dan Brunai MUHAMMAD Chow Cin Wi atau akrab disapa Awi Ceng Ho, mengaku sangat merindukan bulan suci Ramadhan. Di bulan ini, lelaki yang berprofesi sebagai ustadz tersebut tidak ingin melewatkan waktu tanpa beramal. “10 Tahun menjadi muslim, membuat saya ingin menjadi bagian yang diperhitungkan dalam agama Islam. Karena itu, saya sudah menekuni

dunia dakwah dan menjadi penceramah di berbagai daerah termasuk Brunai Darussalam,” ujar Ustadz Cheng Ho (foto). Saat ditemui Waspada di tempat usahanya Jln. Mongonsidi, Selasa (23/8), ayah lima anak ini menyebutkan, Ramadhan adalah bulan penuh berkah. Berkahnya bisa dirasakan siapa saja. Bukan hanya muslim, Waspada/Anum Saskia

Lanjut ke hal A2 kol 2


TERIMA TONY BLAIR: Wakil Presiden Boediono (kanan) menerima kunjungan kehormatan dari mantan Perdana Menteri Kerajaan Inggris Tony Blair di Kantor Wakil Presiden, Jakarta, Selasa (23/8).

Kejagung Tidak Tanggapi Permintaan Nazaruddin JAKARTA (Antara): Kejaksaan Agung (Kejagung) tidak menanggapi permintaan dari tersangka dugaan suap Wisma Atlet SEA Games, M. Nazaruddin, yang meninginkan lembaga itu dapat menangani kasusnya. “Kita harap semua menanggapi pernyataan tersebut secara jernih,” kata Wakil Jaksa Agung, Darmono, di Jakarta, Selasa (23/8). Dikatakannya, Komisi Pemberantasan Korupsi (KPK) telah diberi wewenang sesuai undang-undang untuk melakukan penyidikan perkara tindak pidana korupsi yang berarti memiliki wewenang untuk melakukan pemeriksaan atas saksi atau tersangka siapapun orangnya. Ia mengemukakan, kalaupun yang bersangkutan tidak mau menjawab atas pertanyaan penyidik, berarti merupakan tantangan bagi KPK sejauh mana kemampuannya menggali alat bukti lain, kecuali keterangan tersangka. “Sehingga, kasusnya itu apakah layak untuk diajukan ke tahap penuntutan atau disidangkan,” katanya. Oleh karena itu, kata dia, permintaan Nazaruddin itu belum perlu ditanggapi secara serius.

Ada-ada Saja

“Tak Kenal Maka Ditolak” GELAR raja dan ratu nampaknya bukan jaminan bagi pasangan penguasa Swedia, hanya untuk sekedar mendapatkan jamuan makan di sebuah restoran. Nadine Schellenberger, pemilik Zum Gueldenen Stern, sebuah restoran bergaya abad ke 16 di Ladenburg, Jerman, Lanjut ke hal A2 kol 5

Dari Ibnu Abbas r.a. ia berkata: “Diberi kelonggaran bagi orang yang sudah tua untuk berbuka puasa, tapi ia harus memberi makan tiaptiap hari seorang miskin dan tak wajib mengqadhanya.” (HR Imam Duruqutni dan Hakim)

Banda Aceh & Sekitarnya Rabu, 24 Ramadhan 1432 H Berbuka : 18.52 Wib Imsak : 05.07 Wib

Serampang - Pantang menyerah - He.... he....he....

Berita Utama


WASPADA Rabu 24 Agustus 2011

Anggaran Belanja Tanjungbalai Tertinggi 10 Tahun Terakhir TANJUNGBALAI (Waspada): Wali Kota Thamrin Munthe dan Wakil Wali Kota Rolel Harahap, menciptakan rekor dengan mengajukan anggaran belanja Rp428.970.000.000 dalam P. APBD 2011. Ini level tertinggi selama 10 tahun terakhir. Demikian pandangan Fraksi PDI Perjuangan dibacakan juru bicara Leiden Butar-butar pada rapat paripurna DPRD Kota Tanjungbalai, Selasa (23/ 8). Paripurna itu dipimpin Ketua Legislatif Romay Noor, dihadiri pimpinan serta anggota legislatif serta unsur eksekutif di Kota Tanjungbalai. “Kondisi anggaran belanja yang diajukan dalam P.APBD 2011 ini merupakan prestasi tersendiri bagi Pemko Tanjungbalai, dan merupakan alokasi anggaran belanja tertinggi sepanjang 10 tahun terakhir,” se-

but Leiden Butar-butar. Dia melanjutkan, berdasarkan nota keuangan P.APBD yang disampaikan Wali Kota, anggaran belanja daerah sebesar Rp428.970.000.000 dialokasikan kepada belanja tidak langsung Rp232.340.000.000 atau mengalami kenaikan Rp11.670.650.000 dari anggaran sebelumnya Rp220.669.350. 000. Anggaran itu, peruntukannya kepada belanja pegawai Rp203.998.423.000 atau naik sebesar Rp8.892.633.000. Sementara belanja hibah Rp5.410.000.000 atau naik sebesar Rp1.815.000.000, dan belanja sosial Rp20.950.560.000 atau naik Rp945.000.000 serta belanja bantuan keuangan dialokasikan sebesar Rp480.617.000 atau naik Rp17.617.000. Kemudian, untuk belanja langsung diprediksikan sebesar Rp196.630.000.000 atau naik

Menneg BUMN Kena Serangan Jantung JAKARTA (Antara): Menteri Negara BUMN, Mustafa Abubakar, yang tengah dirawat di RS Medistra, Jakarta, dipastikan menderita penyakit jantung bukan stroke sebagaimana dikabarkan banyak pihak. “Beliau tidak stroke, tapi gangguan jantung,” kata kolega Abubakar di kabinet, Menteri Kelautan dan Perikanan Fadel Muhammad, usai menjenguk Mustafa, di ruang ICU Lantai 2, Medistra, Selasa (23/8). Menurut Muhammad, rekannya di pemerintahan itu mendapat perawatan karena terjadi penyumbatan pada jantung yang mengakibatkan kondisi jantungnya melemah. “Tim dokter yang dikepalai Prof Santoso sudah melakukan tindakan kateter jantung. Tidak sempat dioperasi, tapi hanya di-chateter saja,” katanya. Ia juga menginformasikan, kondisi Abubakar saat ini dalam keadaan tidak sadar. Menteri Mustafa sekitar pukul 11:00WIB terpaksa dilarikan ke Rumah Sakit Medistra, untuk mendapat perawatan. Sekretaris Pribadi Menteri BUMN, Faisal Halimi, menuturkan, sebelum dirawat di Medistra, Mustafa pada pukul 03:30

WIB sempat ditangani di RS MMC Kuningan. “Karena di sana peralatannya kurang lengkap maka dipindahkan ke Medistra,” katanya. Mustafa bergabung dalam Kabinet Indonesia Bersatu jilid II sebagai Menteri BUMN sejak Oktober 2009. Pria kelahiran Pidie, 15 Oktober 1949 sebelumnya juga pernah menjabat Dirut Perum Bulog, dan Pelaksana Tugas Gubernur Aceh periode Desember 2005-Februari 2007. Presiden doakan segera sembuh Presiden Susilo Bambang Yudhoyono mendoakan kesembuhan untuk Menteri Badan Usaha Milik Negara (BUMN) Mustafa Abubakar yang saat ini dirawat di Rumah Sakit Medistra, Jakarta. Juru Bicara Kepresidenan Julian Aldrin Pasha melalui pesan singkat di Jakarta, Selasa malam, mengatakan Presiden Yudhoyono yang tengah melaksanakan safari Ramadhan di Jawa Barat berharap Mustafa bisa segera pulih dari sakit. “Bapak Presiden mendoakan kesembuhan bagi Meneg BUMN Mustafa Abubakar,” tulis Julian dalam pesan pendeknya.

Indonesia Prihatin ...

Presiden menjelaskan secara umum Indonesia menyerukan agar secara lebih luas konflik kekerasan, perang saudara yang terjadi di Libya segera berakhir. “Ini semata-mata untuk melindungi keselamatan rakyat Libya dan mana kala harus ada babak baru di Libya seperti perkiraan banyak pihak termasuk kita, hendaknya masa depan atau babak baru itu ditentukan oleh rakyat Libya sendiri,” tegasnya.

“Kita semua tengah mengikuti perkembangan situasi di Libya khususnya Tripoli. Apa yang kita saksikan di Indonesia berpendapat bahwa saat sekarang adalah saat yang membahayakan bagi penduduk Tripoli pada khususnya dan rakyat Libya pada umumnya,” kata Presiden. Kepala Negara menjelaskan,”Indonesia prihatin dengan perkembangan di Libya dan Indonesia menyeru agar perkembangan siuasi yang krtitikal di Tripoli ini tidak mengakibatkan jatuhnya korban jiwa lagi di Libya.”

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Kf7+, BfxK. 2. Mxh5+, Rg8. 3. Mh7+, Rf8. 4. Mh8+mat. (Jika 1....., Rg8. 2. Mxh5, BfxK. 3 & 4. Sama).

Jawaban TTS: TTS Topik

Santapan Ramadhan



5 3 9 8 4 2 1 6 7

2 8 7 5 1 6 3 9 4

9 2 4 6 8 5 7 1 3

7 6 5 3 9 1 8 4 2

3 1 8 2 7 4 6 5 9

1 5 2 4 6 3 9 7 8

Medan Dzulmi Eldin dan Sekda Medan Syaiful Bahri. Pos Pam yang ditinjau yakni Pos Pam depan Bandara Polonia, Pos Pam depan Medan Mal, depan Thamrin Plaza dan Pos Pam depan Stasiun Besar Kereta Api Medan. Dalam kesempatan itu Tim Muspida Plus menyerahkan bantunan paket lebaran kepada petugas Pos Pam. Wali Kota mengatakan, Pos Pam tersebut bertujuan untuk menciptakan keamanan dan kenyamanan bagi masyarakat. Kita berharap petugas Pos Pam dapat benar-benar menciptakan kenyamanan. ‘’Saya juga meminta para camat untuk tetap beradadiPosPam,’’ujarWaliKota. Wali Kota menegaskan kepada masyarakat yang mudik supaya melapor kepada Kepling dan pastikan rumah yang ditinggalkan dalam keadaan aman. Hal senada disampaikan Kapolresta. Tagam. Katanya, Pos Pam disiagakan untuk menjaga kekondusifan dalam Lebaran di Kota Medan.(m50/m46)

F A Ada-ada Saja ... A H L Ia mengatakan Raja Carl XVI A A Gustaf dan Ratu Silvia datang A L A Q ke tempatnya saat ia sedang A menjamu resepsi pernikahan. “Saya tidak mengenali meA L A H I reka. Maksudnya tanpa mahkota dan lambang (kerajaanD U Z red),” ujar Nadine. B “Apakah anda tukang sapu A U jalan atau ratu - kami memang L tidak punya meja atau cukup tenaga di dapur pada saat itu L dan kami sedang sibuk.” A Meski begitu, Nadine dan A L A H suaminya Michael berencana

Jawaban Sudoku:

6 4 1 9 3 7 2 8 5

Masyarakat Mudik ...

8 7 3 1 5 9 4 2 6

4 9 6 7 2 8 5 3 1

mengirim surat permintaan maaf kepada sang Raja dan Ratu. “Kami ingin memberitahu mereka bahwa kami menyesal tidak langsung mengenali mereka dan kami tidak bisa melayani mereka tapi kami akan sangat senang untuk menyambut mereka lain waktu,” ujarnya. Pihak media melaporkan bahwa pasangan kerajaan dan rombongan mereka berhasil mendapat pizza di alun-alun pasar. (orange/rzl)

sebesar Rp31.329.350.000 dari lokasi awal Rp165.300.650.000. Kenaikan belanja langsung Rp31.329.350.000 yang diprioritaskan untuk bidang infrastruktur pada Dinas PU Rp13.514.393.200, dan bidang Pendidikan Rp7.778.392.700 serta bidang kesehatan sebesar Rp3.756.892.915, dan bidang pemerintahan umum sebesar Rp2.528.988.100. Leiden menambahkan, dengan kenaikan alokasi anggaran pada empat sektor prioritas itu, F.PDI Perjuangan berharap Pemko mampu meningkatkan pelayanan kepada masyarakat. Mengenai target penerimaan daerah yang diproyeksikan sebesar Rp400.000.000, F. PDI Perjuangan berharap target tersebut ditingkatkan, mengingat pada 2010, penerimaan dari pinjaman daerah terealisasi Rp736.999.000. (a14)

Khadafi Melawan ... situasi di ibukota, membingungkan. Penampilan putra Khadafi dan mantan calon pewaris kekuasaan itu menggarisbawahi kekuatan pemimpin Libya tersebut untuk menghabisi pemberontak. Sedangkan, pemberontak mengklaim, mereka menguasai sebagian besar Tripoli.Tetapi klaim itu dibantah. Pemberontak masih menghadapi perlawanan yang masih cukup kuat dari para pendukung setia Khadafi yang menembaki mereka dengan mortir dan senapan anti-pesawat udara. Jurubicara pemberontak Mohammed Abdel-Rahman di Tripoli, mengatakan ‘bahaya masih mengancam’ selama pemimpin lama Libya itu masih bebas. Dia memperingatkan brigade pro-Khadafi mengambil posisi di pinggiran Tripoli dan ‘dapat berada di pusat kota dalam setengah jam.’ Para pemimpin pemberontak tersentak dengan kehadiran Seif al-Islam. Seorang jurubicara Sadeq al-Kabir, tidak punya penjelasan dan hanya dapat mengatakan, “Ini mungkin semua bohong.” Senin, pemberontak mengatakan Seif al-Islam telah ditangkap, namun dia tidak memberi-kan rinciannya. Seif al-Islam, dengan penuh jambang dan mengenakan kaos oblong berwarna hijau zaitun muncul di hotel Rixos, Selasa pagi, di mana kira-kira 30 wartawan asing tinggal selama di Tripoli di bawah pemantauan rezim yang berkuasa. Dengan menumpang limosin putih di tengah konvoi mobil SUV bersenjata, dia membawa para wartawan ke beberapa bagian kota yang masih berada di bawah kendalinya. Dia mengatakan, “Kita akan pergi ke beberapa kawasan paling rawan di Tripoli.” Para wartawan The Associated Press termasuk di antara mereka yang melihat dia dan pergi bersamanya dalam peninjauan itu. Masih jauh dari usai Seif al-Islam mengklaim pertempuran di Tripoli masih jauh dari usai. Dia bersikeras ibukota Libya itu masih berada di bawah kekuasaan Khadafi walaupun hingga saat ini keberadaan Khadafi masih belum diketahui. “Keadaan di Tripoli aman terkendali. Semuanya tidak perlu khawatir, Tripoli aman saat ini,” ucap Seif Khadafi di depan pendukungnya Selasa. Seif pun menuduh pihak Barat berada di serangan dari pihak oposisi tersebut. “Pihak Barat sengaja melancarkan perang teknologi dan media untuk menciptakan kekacauan dan teror di Libya,” tegas Seif. Khadafi Masih Di Tripoli Warga Rusia yang mengepalai Federasi Catur Dunia mengatakan, dia telah berbicara denganMoammar Khadafi melalui telefon. Khadafi masih berada di Tripoli dan bertahan. Ilyumzhinov mengatakan dalam satu wawancara dengan kantor berita Interfax bahwa Khadafi menghubunginya sekitar pukul 06:00 sore waktu Moskow (sekitar pukul 09:00 WIB) Selasa, dan katanya dia ‘masih hidup dan sehat dan masih berada di Tripoli.’ (berbagai sumber/m10)

Berdakwah Hingga ... Saat ditemui Waspada di tempat usahanya Jln. Mongonsidi, Selasa (23/8), ayah lima anak ini menyebutkan, Ramadhan adalah bulan penuh berkah. Berkahnya bisa dirasakan siapa saja. Bukan hanya muslim, tetapi penganut agama lain juga turut merasakan kehadiran bulan ini. Misalnya, bidang perekonomian yang mengalami perkembangan cukup fantastis. Terutama perdagangan yang sifatnya konsumtif, seperti makanan berbuka puasa dan sahur. Menjelang Idul Fitri, para pedagang segala jenis kebutuhan bokok dan pakaian juga menerima imbas dengan penjualan yang menguntungkan. “Yang lebih istimewa, kaum muslimin mampu menahan diri dari hal-hal yang membatalkan puasa, terutama menahan

Polres Sergai Amankan 53 Bal Pakaian Bekas Eks LN SEI RAMPAH (Waspada): 53 Bal pakaian bekas eks luar negeri tanpa dokumen diangkut truk Toyota Dina BK 8505 VN, diamankan Sat Intel Polres Serdang Bedagai di Jalinsum Medan Tebingtinggi Km 5859, tepatnya di depan RSUD Sultan Sulaiman Desa Firdaus, Kec. Sei Rempah, Selasa (23/8) shubuh. Menurut informasi, penyitaan dilakukan setelah Sat Intel Polres Sergai mendapat informasi adanya truk membawa pakaian bekas ilegal. Kasat Intel AKP Drs H. Sugiono KN menurunkan anggotanyadanmenjagadi Jalinsum. Antara

PEMUDIK BERDESAKAN: Sejumlah pemudik berdesakan menaiki kapal saat akan mudik menggunakan KM Labobar tujuan Surabaya dan Jakarta, di Pelabuhan Soekarno Hatta, Makassar, Sulsel, Selasa (23/8).

Wapres: Utamakan Keselamatan Pemudik JAKARTA (Antara): Wakil Presiden Boediono berpesan pada semua pihak, termasuk pengelola moda transportasi angkutan lebaran untuk mengutamakankeselamatanpemudik. “Semua diminta hati-hati, keselamatan itu nomor satu (yang utama -red),” kata Juru Bicara Wapres Yopie Hidayat mengutip pesan Wapres yang disampaikan dalam rapat persiapan arus mudik di Kantor Wapres, di Jakarta, Selasa (23/8). Dalam rapat persiapan arus mudik yang dihadiri Menteri Perhubungan (Menhub) Freddy Numberi tersebut, Wapres meminta agar pengaturan lalu lintas kapal diatur sebaik mung-

kin. Demikian pula pelayanan pembelian tiket kereta. Selain itu, Wapres juga berpesan pada pengelola moda transportasi angkutan lebaran untuk memperhatikan kenyamanan penumpang. Khusus untuk di Merak, Wapres meminta agar ada tambahan petugas guna membantu penumpang untuk memberikan informasi. Secara terpisah, Menhub yang ditemui setelah rapat dengan Wapres, mengatakan tujuh kapal tambahan disiapkan untuk mengangkut pemudik yang menyeberang dari Merak ke Bakauheni selama masa mudik 2011. Ia mengatakan, jumlah ka-

pal yang ada saat ini 33, dengan penambahan tujuh kapal maka total 40 kapal akan beroperasi dan diharapkan dapat memperlancar arus mudik di jalur tersebut. “Tiap hari yang beroperasi 38 kapal, ada yang `stand by` juga untuk perbaikan. Kita yakin ini bisa mengurai, pemudik lebih lancar,” katanya setelah rapat kesiapan arus mudik yang dipimpin Wapres Boediono. Kemudian, untuk mengantisipasi kemacetan di arus mudik, ujar Menhub, truk sumbu dua dan truk barang dilarang beroperasi. Dengan kebijakan ini diharapkan tidak ada kemacetan dan penumpang terangkut dengan baik.

Demokrat Bidik ...

mata karena kewenangan dan kekuasaan yang dimiliki fraksi sebagai perpanjangan tangan partai, tapi sebagai sikap kebersamaan anggota fraksi. ‘’Bagi saya, kalau sudah masuk ke ranah fraksi, saya harus terima dengan segala untung ruginya,’’ kata Ramli. Anggota FPD sebagai pengusul hak interpelasi lainnya adalah Ahmad Ikhyar Nasution. Kepada Waspada, dia mengatakan telah berupaya melaksanakan hak-hak yang melekat pada dirinya sebagai anggota dewan. Kemudian fraksi memutuskan lain, itu masalah lain. Menurut Ikhyar, tidak ada alasan lain kecuali menerima dan sepakat dengan keputusan partai menolak hak interpelasi. Alasannya, karena itu merupakan keputusan fraksi. Dalam rapat fraksi tentang interpelasi, kata Ikhyar, tadinya fraksi meminta mereka mencabut usulan interpelasi tersebut. Namun dia menolak, dengan alasan usulan itu memiliki alasan yang benar. Kemudian, dia meminta fraksi menjelaskan alasan mengapa menolak interpelasi, tapi tidak bisa dijelaskan. “Akhirnya, fraksi minta kami satu suara. Ya, saya nurut,’’ kata Ikhyar. Jawaban hampir mengakui adanya kesepakatan untuk menjadikan Ketua Partai De-

mokrat Sumut H.T. Milwan sebagai wakil gubernur dilontarkan Sekretaris PD Sumut Tahan Manahan Panggabean. Dia juga merupakan salah satu anggota FPD yang mengusulkan interpelasi. Melalui telefon selular Tahan Manahan Panggabean, menyebutkan keputusan fraksi menolak interpelasi didasari pada kepentingan lebih luas dan jangkauan partai ke depan. Seperti menjadikan Ketua PD Sumut menjadi Wagubsu? Tahan Panggabean, tidak menjawab pertanyaan ini secara tegas. Dia hanya bilang: ‘’Kan tidak salah kalau Partai Demokrat juga mempunyai cita-cita untuk membangun masyarakat.’’ Namun, kata Tahan, dalam proses penolakan usulan hak interpelasi ini, tidak ada tekanan sedikitpun dilakukan baik oleh fraksi maupun PD kepada anggotanya. Keputusan diambil setelah fraksi dan partai mengikuti proses yang berlangsung sekian waktu, hingga sampai pada sebuah kesimpulan. ‘’Andai kata FPD memutuskan menerima interpelasi, maka 23 anggota fraksi lainnya juga harus ikut keputusan itu. Sama seperti keputusan saat ini, empat anggota fraksi, termasuk saya harus sepakat dengan keputusan fraksi menolak interpelasi,’’ kata Tahan Manahan Panggabean. (m12)

arus mudik dari Jakarta tujuan Medan. Imas, 25, penduduk Cenere Jakarta menyatakan, seperti biasanya dia pulang ke kampung di Lubuk Pakam, mengadakan lebaran bersama keluarga. “Kali ini dia pulang bersama keluarga lainnya, mudah-mudahan suasana lebaran lebih meriah di kampung,” ujarnya saat mendarat dengan penerbangan Lion Air JT-302 dari Jakarta, Selasa. Sementara itu Johanes Gaffar, Kepala Divisi (Kadiv) Pelayanan Darat AP-II Bandara Polonia Medan ketika dikonfirmasi, Selasa membenarkan, prakiraan lonjakan arus mudik

maupun arus balik pada Lebaran 2011 lebih kurang antara 15 hingga 20 persen dibandingkan Lebaran 2010. Peningkatan arus tersebut, kata Gaffar, berdasarkan peningkatan pergerakan pesawat melalui Bandara Polonia Medan. Bahkan pergerakan pesawat dari hari ke hari mengalami peningkatan. Namun pihak Angkasa Pura II sudah mengantisipasi, termasuk memperluas ruang chek in tiket bagi pemudik bahkan tempat pembayaran passenger service chart atau airportax. Begitupun data pemudik H-7 pada 2010 mencapai 14.855 penumpang di antaranya 12.273 penumpang yang berangkat dan datang melalui terminal dalam negeri dan 2.582 pe-

numpang yang berangkat dan datang melalui terminal internasional. Namun H-7, 2011 baru terlihat pergerakan arus mudik dari Jakarta turun ke Medan dari pagi hingga siang. Misalnya Tini, staf penerbangan Valuair menyatakan, pergerakan arus ke luar negeri belum terlihat. Bahkan penerbangan Valuair VF-282 hanya mengangkut 121 penumpang dari kapasitas 180 seat. (m32)

amarah yang langsung membias dalam kehidupan seharihari. Contohnya, saat di jalan raya. Selama Ramadhan, biarpun jalanan macat, jarang sekali ada yang marah-marah,” ujarnya seraya menambahkan, puasa membentuk diri muslim menjadi lebih baik karena berjuang menghadapi berbagai cobaan dan mendapatkan hari kemenangan di Hari Raya Idul Fitri. Di bulan ini, Awi lebih banyak berdakwah dari masjid ke masjid. Meski banyak berdakwah, dia tetap mengutamakan berbuka puasa di rumah bersama istri dan anak-anaknya. “Ada kebahagiaan yang sulit dilukiskan menikmati sajian berbuka puasa di rumah, meski hidangannya sangat sederhana. Tahun ini, saya baru merasakan secara utuh bersama keluarga, sebab tahun lalu saya ada di ber-

bagai daerah,” katanya. Pada Ramadhan tahun 2008, Awi berdakwah ke Kalimantan Tengah dan Kalimantan Timur. Di tahun 2009, Awi berdakwah di Kalimantan Barat, Brunai dan Malaysia. Sedangkan Ramadhan tahun lalu, Awi berdakwah di Aceh. Ramadhan tahun ini, Awi justru memilih berdakwah di Sumatera Utara terutama di Medan. Sebab, Awi ingin memperkenalkan dunia dakwah Islam kepada anak-anaknya. Dia berharap, apa yang disampaikannya kepada kaum muslimin tentang ajaran Islam tetap menjadi pedoman dan mereka tidak menjadi murtad. “Saya terobsesi melakukan syiar dan membuat film tentang dakwah sebagai antisipasi agar tidak ada umat Islam yang murtad atau mengikuti aliran sesat,” demikian Awi. (m37)

Sopar Siburian mengatakan, sudah membayangkan adanya putusan berbeda dari fraksinya dengan sikap yang diambil mendukung interpelasi. Karenanya, sejak rapat paripurna digelar beberapa saat, dia telah melakukan interupsi. ‘Itu saya lakukan berkali-kali,’’ katanya. Sopar mengaku kecewa dengan pimpinan yang memandu pelaksanaan rapat paripurna interpelasi. Katanya pimpinan rapat terlalu percaya diri sehingga mengabaikan masukan dari anggota. Jika diberi kesempatan waktu itu, dia akan menyarankan kepada pimpinan agar membawa masalah interpelasi menjadi hak anggota dewan saja. Keputusannya jangan melibatkan fraksi. ‘’Tapi saya tidak pernah diberi kesempatan. Jadilah seperti ini. Saya harus patuh terhadap putusan fraksi,’’ kata Sopar. Takut dengan fraksi Jawaban sangat tegas disampaikan anggota FPD lainnya Ramli. Kepada Waspada, dia jelas-jelas mengatakan takut membantah keputusan fraksi. ‘’Pada rapat soal interpelasi, fraksi meminta seluruh anggotanya agar satu suara. Ya, kita patuh,’’ katanya. Disebutkan Ramli, sikapnya yang kemudian menuruti kemauan fraksi bukan semata-

Pemudik Jakarta ...

Saat truk dikemudikan Agus Barimbing, 39, warga Jalan S. Parman Tanjungbalai, itu melintas dari arah Tebing menuju Medan, distop dan langsung diamankan petugas. Menurut Kasubbag Humas Polres Serdang Bedagai, AKP ZN Siregar, sopir dan kernet truk masih menjalani pemeriksaan. Sementara pengakuan Agus, dia bersama kernetnya Jahot Purba, 46, warga Tanjungbalai hanya disuruh mengantar barang yang sudah ada di dalam truk ke Medan, tepatnya ke Perumnas Simalingkar Medan. (a08)

BC Segel 29 Ribu Ton Garam Asal India BELAWAN (Waspada): Sekitar 29 ribu ton garam asal India impor disegel Bea dan Cukai Belawan di lima gudang milik PT Garindo Sejahtera Abadi selaku importir. Kepala Seksi Penindakan dan Pencegahaan (Kasi P2) Kantor Pelayaan BC Belawan Devid mengatakan penyegelan biasa terkait jenis dan jumlah garam tersebut. “Jadi dalam waktu dekat ini kita akan melakukan penelitian terhadap jenis garam itu,” katanya saat dihubingi wartawan, Selasa (23/8) malam. Sementara itu, keterangan dari lapangan, semua garam itu tiba di Pelabuhan Belawan dari negara asal menggunakan Kapal MV Good Princess dan di bongkar selama berberapa hari di dermaga 111 Pelabuhan Belawan. Garam impor itu memiliki dokumen pertanggal 27 Juli 2011 dan kapal tiba di Pelabu-

han Belawan pada tanggal yang sama. Namun, karena semua garam masih berada di dalam kapal penyegelan tidak bisa dilakukan. Maka petugas BC menunggu seluruh garam itu selesai dibongkar dan disimpan di lima gudang importir. Keterangan lain menyebutkan penyegelan dilakukan merupakan ekses perseteruan antara Menteri Kelautan dan Perikanan Fadel Muhammad dan Menteri Perdagaan Mari Pengestu. Fadel Muhammad bersikukuh tidak memberi izin garam impor masuk ke Indonesia selama musim panen garam nasional selesai pada Desember 2011. Tindakan penyegelan juga dilakukan terhadap garam yang diimpor oleh PT Sumatraco Langgeng Makmur di Pelabuhan Ciwandan, Banten pada awal Agustus lalu. (h03)

Antisipasi Kemacatan ... mampu melewati jalan menanjak, dan mengakibatkan kemacatan bahkan kecelakaan, sebagaimana bus ALS yang menelan korban jiwa. Gubsu (Raja Inal Siregar) pernah menerbitkan larangan mobil di atas sumbu dua melintasi Aek Latong, namun pelaksanaannya hanya beberapa bulan, kemudian bebas hingga sekarang. Menurut beberapa sopir taksi kepada Waspada di Padangsidimpuan, Selasa (23/8), sejak LLAJR (Dishub) melarang kendaraan bertonase tinggi lewat Aek Latong tidak pernah terjadi kemacatan. Sedangkan melalui Rantau Prapat beberapa ruas jalan kondisinya sangat buruk, selain itu jaraknya terlalu jauh, maka pilihan utama tetap via Sipirok. Karena itu para sopir berharap kepada Gubsu segera menertibkan angkutan yang lewat Aek Latong. Diburu Sementara perbaikan jalan sebagai jalan alternatif sepanjang 960 meter di Kec. Perbaungan, Kab. Serdang Bedagai, pekerjaannya terus diburu untuk bisa dilalui arus lebaran. “Pembangunan jalan alternatif kabupaten, bersumber dari dana APBN tahun 2011 senilai Rp900 juta dengan panjang 960 meter X 6 meter selama ini rusak parah. Padahal sangat dibutuhkan untuk menghindari terjadinya kemacatan di kota Perbaungan,” jelas Kabid Jalan dan Jembatan, Dinas Binamarga Kab. Sergai, Kahirul Khaitami kepada Waspada, Selasa (23/8), di lokasi pekerjaan. Menurutnya, walau diprediksi pekerjaannya belum rampung hingga memasuki Lebaran, namun tetap diupayakan untuk bisa dilalui, setelah Lebaran diselesaikan pengaspalannya. Sementara Kapolres Sergai, AKBP Arif Budiman melalui Kasubbag Humas, AKP.ZN Siregar mengatakan untuk mengantisipasi arus Lebaran di Jalinsum Sergai, pihaknya menyiagakan 7 pos pengaman (Pospam),di 6 titik rawan kemacatan yakni Simpang Tiga Perbaungan, Kota Perbaungan dan Pasar Bengkel Kec. Perbaungan, kemudian Pasar Tumpah Desa Firdaus, Kota Sei Rampah, Kec. Sei Rampah, Pekan Desa Pon Kec. Sei Bamban.(a26/c03)

Lebaran Berpeluang ... “Peluang banjir ke depan bakal terjadi terutama banjir kiriman , sementara tiga hari kedepan intensitas curah hujan di kawasan Medan meningkat dari hari-hari sebelumnya,” kata Hartanto. Bahkan disamping hujan, peluang longsor juga sangat besar baik di kawasan Mandailing Natal (Madina), Dairi bahkan kawasan Tanah Karo, sementara potensi peluang longsor meningkat di kawasan pegunungan. “Para pemudik lebaran juga diingatkan meningkatkan kewaspadaan di sepanjang jalan-jalan yang selama ini terjadi longsor, ke depan peluang longsor juga cukup berpotensi,” kata Kepala Datin BMKG Wilayah I. Menyinggung bagaimana dengan kondisi perairan, kondisi Selat Malaka pada malam hari terjadi cuaca buruk, sedangkan tinggi gelombang laut mencapai 1 hingga 2 meter. Misalnya, di kawasan Pantai Barat seperti Sibolga, Nias dan Aceh Barat, tinggi gelombang antara 1 hingga 2,5 meter, namun belum begitu membahayakan para nelayan melaut dan angkutan kapal ferry. “Kewaspadaan terhadap perairan terutama para nelayan selalu diingatkan pihak BMKG, pada malam hari terjadi cuaca buruk. (m32)

Kejagung Tak ...

PNS Pemprovsu Libur ...

pertanyaan penyidik, berarti merupakan tantangan bagi KPK sejauh mana kemampuannya menggali alat bukti lain, kecuali keterangan tersangka. “Sehingga, kasusnya itu apakah layak untuk diajukan ke tahap penuntutan atau disidangkan,” katanya. Oleh karena itu, kata dia, permintaan Nazaruddin itu belum perlu ditanggapi secara serius. “Kecuali kalau KPK mengalami jalan buntu, dan dicarikan solusinya lagi,” katanya.

”Jadi libur kali ini lebih dari satu minggu. Untuk itu PNS diminta untuk mempergunakan liburan semaksimal mungkin. Jangan nantinya malah menambah libur lagi,” ujar Turnip. Mengenai sanksi yang akan diberikan kepada PNS yang melanggar atau memperpanjang libur akan dikenakan sanksi pelanggaran kedisiplinan. Hal itu diatur dalam peraturan gubernur (Pergub), akan diberikan hukuman seperti pemotongan tambahan penghasilan pegawai (TPP). Kaiman Turnip juga mengatakan, sejauh ini belum ada disampaikan secara resmi larangan untuk menggunakan sarana prasarana dinas untuk melakukan liburan. “Nanti mungkin akan diatur secara resmi,” katanya. Diimbaunya, semua PNS di lingkungan Pemerintah Provinsi Sumut tetap meningkatkan kinerja setelah pelaksanaan libur panjang. Kemungkinan akan diadakan inspeksi mendadak (Sidak) pada hari pertama kerja usai pelaksanaan cuti bersama. (m28)

LENTERA RAMADHAN ... Dalam sebuah hadis juga disebutkan: laa dina liman laa ‘aqla lahu (Tiada agama yang tidak menggunakan akal pikiran). Alam raya dan segala isinya bahkan akan tunduk kepada manusia, tapi ketundukkan itu terbatas hanya kepada orang yang menggunakan akalnya (QS.45:13) Orang-orang besar seperti al-Faraby, alJabary, Ibnu Hamdun, Ibnu Rusyd, Ibnu Sina, Al-Ghazaly dan tokoh lain di abad pertengahan, mereka dikenal sampai sekarang bukan karena kegagahannya atau karena kekayaannya, tapi karena akalnya. Terobosan fenomenal mereka memberikan catatan dengan tinta emas pada sejarah Islam.

... niscaya Allah akan meninggikan orangorang yang beriman di antaramu dan orangorang yang diberi ilmu pengetahuan beberapa derajat.(QS.58:11). Maka teruslah mendayagunakan akal—di sini ada nasihat orang tua— tuntutlah ilmu tiada jemu. Jelas sekali, posisi akal dalam Islam sangat penting. Akal berada pada posisi dituntun oleh aturan agama, bukan sebaliknya; akal sebagai qa’id (penuntun) bagi agama. Orang yang menjadikan akalnya pada posisi supremasi hingga menuntun agamanya, sejatinya adalah orang yang keliru. Sebaliknya orang-orang yang menundukkan dan mengeksplorasi akalnya dalam aturan agama inilah yang disebut manusia berakal dan beriman kepada Allah SWT.

Info Sumut

A3 Pak Gubernur Kok Bisa Hafal Alquran?

WASPADA Rabu 24 Agustus 2011

Kolom Amir Syarifuddin

Kebersamaan HILIR mudik menyambut Lebaran di Sumut sedianya akan berdampak pada sejumlah kerawanan di daerah ini. Untuk mengantisipasi segala kemungkinan buruk yang dapat saja terjadi, awal pekan ini telah pula dilakukan Apel gelar Pasukan Operasi Ketupat Toba 2011. Pangdam I/BB Mayjen TNI Leo Sigers saat membacakan amanat Kapolri Jenderal Timur Pradopo mengatakan, Jajaran Polda Sumut dikatagorikan sebagai prioritas kedua dalam kelompok rawan, setelah Jawa. Berkaitan dengan Lebaran, selain mobi-litas manusia meningkat, potensi gangguan Kamtibmas juga meningkat. Baik kuantitas maupun kualitas. Sehingga perlu menda-patkan perhatian. Seperti pencurian dengan pemberatan, pencurian dengan kekerasan, pencurian dengan senjata api, pencurian kenderaan bermotor maupun penganiayaan berat. Untuk mengantisipasi hal tersebut, Pj Gubernur Sumut, H Gatot Pujonugroho, ST di beberapa sambutannya telah pula me-nekankan tentang pentingnya kebersamaan semua pihak mengantisipasi dan menanggulangi kerawanan di Sumatera Utara. Bahkan, tidak hanya dalam menyambut dan merayakan Lebaran, tetapi juga tetap penting menjaga kebersamaan di hari-hari sesu-dahnya. Dalam konteks menyambut Lebaran di Sumut, kebersamaan yang dimaksudkan Kapolri maupun Pj Gubsu, telah terwujud dengan dikerahkannya 2739 personel, ditambah unsur TNI dan Muspida dengan total 7000 orang. Keseluruhannya diperuntukkan mengantisipasi sekaligus memberi rasa aman dan nyaman kepada masyarakat yang merayakan Idul Fitri. Sementara dalam konteks politik, awal pekan ini, kebersamaan yang terkait kebijakan Pj.Gubsu, secara terang benderang, telah pula terpapar di gedung DPRD Sumatera Utara. Kebersamaan anggota legislatif di

gedung tersebut terbelah. Ada 38 orang dewan yang bersikeras ingin menginterpelasi Pj Gubsu, terkait kebijakannya memutasi 110 pejabat Eselon III di Pemprov Sumut. Sementara 42 anggota dewan yang lain menolak. Sedangkan 14 orang abstain. Inti cerita, rencana interpelasi pun gagal. Karena himpunan kebersamaan yang menolak, ternyata lebih besar. Pj.Gubsu boleh jadi tersenyum melihat kebersamaan 42 anggota dewan tersebut. Sebab, sebagaimana yang diungkapkan banyak pengamat, dalih untuk melakukan interpelasi memang tak begitu kuat. Interpelasi sepatutnya dilakukan untuk kebijakan pemerintah daerah yang penting dan strategis serta berdampak luas pada kehidupan masyarakat daerah dan negara. Sementara dalam konteks pelantikan Eselon III yang dilakukan Pj Gubsu, banyak pula pihak yang menilai bahwa dewan justru akan mengabaikan hal-hal lain yang lebih strategis untuk rakyat, jika fokus perhatian banyak terbesut ke persoalan interpelasi. Lebih dari itu, kebijakan yang sama juga lazim dilakukan oleh berbagai Pj kepala daerah di Sumut, tanpa menimbulkan gemrisik di parlemen. Kendati demikian, PJ.Gubsu tetap pula harus mawas dalam menghimpun dan mengelola kebersamaan. Karena muasal hiruk pikuk interpelasi tersebut, sejatinya tidak hanya dari gedung dewan. Tetapi juga datang dari kalangan sendiri. Mulai dari pejabat Eselon III yang berubah menjadi staf biasa, hingga kepala dinas yang merasa tak tahu menahu. Momen Ramadhan sekaligus menyam-but Lebaran, telah menuntun kita dan pemim-pin daerah ini untuk hidup selaras dalam kebersamaan. Bahkan di berbagai media massa saat ini, kian ramai dengan aktivitas buka puasa bersama yang dilakukan berbagai instansi dan berbagai elemen masyarakat. Lebih dari itu, dengan kebersamaan, nilai ibadah pun makin berganda.***

Hendra November, seorang siswa Aliyah Pesantren Ar Raudhatul Hasanah, penasaran terhadap Pj Gubernur Sumut, H.Gatot Pudjonugroho ST. Pasalnya, saat memberikan ceramah subuh di masjid pesantren tersebut pertengahan pekan lalu, Pj Gubsu bicara runut dengan membacakan beberapa ayat suci Alquran sebagai dasar nasehat “Pak gubernur dulu belajar dari pesantren juga ya? Kok bisa hafal Alquran? Karena tausyiahnya tadi pakai ayat Alquran,” ucap Hendra yang berada di barisan depan jamaah, saat sesi tanya jawab antara Pj Gubsu dengan 2600 santri yang memadati masjid tersebut. Merespon pertanyaan tersebut, Pj. Gubsu memamaparkan, riwayat pendidikannya sejak kecil, keseluruhannya belajar pada sekolah umum. Baik SD, SMP, STM hingga melanjutkan ke Teknik Sipil Institut Teknologi Bandung (ITB). “Tapi ketika saya di USU, saya aktif dalam lembaga dakwah kampus di USU. Sedangkan pesantren saya adalah keluarga,” bebernya. Saat memberikan ceramah, Pj.Gubsu tak henti-hentinya memacu semangat belajar para santri tersebut. Tidak hanya sebatas pada ilmu-ilmu agama, tetapi juga ilmu-ilmu umum. Karena dari pesantren nantinya diharapkan tumbuh generasi berilmu yang tidak hanya cakap dalam urusan ilmu pengetahuan dan teknologi (Iptek) tetapi juga memiliki dasar iman dan takwa (Imtak) yang kuat. Dalam ceramah subuh tersebut, Pj.Gubsu juga mengingatkan para santri, agar terus berinteraksi dengan Alquran. Baik berupa rutinitas membaca, menghafal serta mengamalkan Alquran. ‘’Tadi saya sempat menanyakan kepada beberapa santri, tentang jumlah hafalan Alquran. Rata-rata sudah hafal satu juz. Saya harapkan agar tetap memelihara semangat untuk menghafal Alquran. Terlebih lagi, Ramadhan adalah bulannya Alquran,” tutur Gatot Saat membacakan beberapa ayat Alquran sebagai muatan

Sumut Diharapkan Barometer Perolehan Suara Partai NasDem MEDAN (Waspada): Ketua Umum Partai NasDem Patrice Rio Capella mengharapkan Sumatera Utara menjadi barometer perolehan suara partainya pada Pemilu 2014. Harapan itu didasarkan dari minat dan antusias kader yang luar biasa di bawah kepemim-pinan HM Ali Umri, SH, MKn selaku Ketua Partai Nasdem Sumut. Patrice Rio Capella menyatakan hal itu ketika memberikan sambutan pada silaturrahim Partai NasDem dan Ormas Nasional Demokrat se-Sumatera Utara sekaligus buka puasa bersama dengan anak yatim piatu dan kaum duafa di kantor Partai Nasdem Jalan Sudirman Medan, Minggu (21/8). Disebutkan, sosok Ali Umri di tengah masyarakat juga sangat dikenal dan tak perlu diragukan. Oleh karena itu, pihaknya sangat optimis Partai NasDem akan meraih suara terbesar khususnya di Sumut pada pemilu mendatang. Tapi hal itu tak dapat diraih begitu saja, tanpa adanya kerja keras semua kader baik di tingkat desa/kelurahan, kecamatan, kabupaten dan provinsi. “Kita

harus yakin dengan konsep restorasi yang digagas Abangda H Surya Paloh. Restorasi gerakan perubahan itu harus jadi modal dari partai ini,” kata Patrice. Soal adanya kekurangan partai, hal itu menurut Patrice tak perlu dipermasalahkan. Karena ibarat membuat sebuah rumah baru kurang cat dan keramik itu biasa. “Akan tetapi bagaimana dengan kekurangan tersebut kita bisa berhasil dan ikut bertanding pada Pemilu 2014,” cetus Patrice. Kehadiran Partai NasDem ini, lanjut Patrice, tak sekadar ikut meramaikan pemilihan umum, tetapi demi cita-cita melakukan perubahan di Indonesia. “”Partai NasDem hadir bukan untuk semata-mata ikut dalam pertarungan elektoral, bukan hanya ikut-ikutan mewarnai hiruk pikuk pemilu,” katanya. Ditegaskan kalau kehadiran partainya itu juga bukan merupakan bentuk respon sesaat terhadapakantetapimenjawabkondisi carut marutnya bangsa ini. “Partai NasDem adalah alat perjuangan baru agar demokrasi di Indonesia menemukan kesejatiannya, dan bukan seka-

dar praktik formal prosedural semata,” ucapnya, Targetkan 10 Juta Kader Partai NasDem, urai Rio, menargetkan perekrutan 10 juta kader dan simpatisan sebagai modal kekuatan politik menjelang Pemilu 2014. Upaya itu diwujudkan dengan membentuk struktur kepengurusan hingga tingkat desa/kelurahan. Menurutnya, cita-cita restorasi tidak akan tercapai jika tidak didukung oleh kekuatan politik yang maksimal. “Karena itu, Partai NasDem memiliki target memenangkan pemilu pada 2014 sekaligus berupaya menjadi partai yang memiliki kekuatan mayoritas atau single majority,” katanya Di bagian lain pihaknya juga tak mempermasalahkan parliamentary threshold atau ambang batasperolehankursidiparlemen yang akan diputuskan DPR. Sebelumnya HM Ali Umri, SH,MKn menyatakan sangat optimis Partai NasDem yang resmi dideklarasikan pada 26 Juli 2011 itu akan tampil sebagai salah satu partai yang akan bertarung pada Pemilu 2014.“Tentu saya optimis jika masyarakat

menginginkan adanya suatu perubahan ke arah yang lebih baik melalui partai ini,” katanya. Kepada pengurus Ormas Nasdem maupun Partai NasDem, Ali Umri mengharapkan terus bekerja keras dan berbuat terbaik kepada masyarakat. “Pengurus NasDem tak perlu mengkaji tentang partai ini.Yang lebih terpenting saat ini adalah apa yang perlu kita perbuat untukkepentingan masyarakat,” cetus Ali Umri. Di bagian lain, pada acara silaturahim Partai NasDem dan Ormas Nasdem se-Sumatera Utara itu, Ali Umri beserta pengurus lainya seperti Ketua Nasdem Sumut Prof Dr T Bahri Anwar, Ir Abdullah Amra, MHB, Drs H Anhar Monel, MAP, Ketua Partai NasDem Medan, Maruli Siagian memberikan santunan kepada 200 anak yatim dan kaum duafa se-Kota Medan. “Santunan diberikan sebagai wujud kepedulian partai antarsesama. Tak hanya di Medan, pemberian yang sama di antaranya juga dilakukan di Sergai dan Tapanuli,” pungkas Ali Umri. (m14)


CERAMAH SUBUH : Pj.Gubsu H Gatot Pudjonugroho, ST saat ceramah di hadapan 2600 santri persantren Arraudhatul Hasanah Jl.Letjend Jamin Ginting Medan, pekan lalu. Ceramah usia shalat Shubuh berjamaah itu setelah sebelumnya Pj.Gubsu bersantap sahur berjamaah bersama ribuan santri putera di kawasan pesantren tersebut. materi ceramah, Pj Gubsu juga beberapa kali berinteraksi dengan para santri dengan menanyakan, surah ke berapa dari ayat yang dibacakan tersebut. Selanjutnya, Pj Gubsu mengajak para santri untuk terus berkomitmen menuntut ilmu,

mengejar cita-cita serta memenuhi harapan orang tua yang telah jauh-jauh menghantarkan serta membiayai para santri ke pesantren tersebut—dengan harapan para santri dapat menyongsong masa depan yang lebih baik di dunia dan akhirat.


NUZULUL QUR’AN Dari kiri ke kanan, Pj Gubsu, H Gatot Pujonugroho, Kapoldasu Wisjnu Ahmad Sastro, wakil Ketua DPRD Sumut, Ir H Chaidir Ritonga MM, Menteri Kominfo, Ir H Tiffatul Sembiring, Ketua Umum DPW PKS Sumut, H M Hafez Lc MA saat menghadiri peringatan Nuzulul Qur’an Senin (22/8) kemarin di Masjid Agung Medan.

Sebelum memberikan ceramah Shubuh di pesantren tersebut, Pj Gubsu terlebih dahulu ikut bersantap sahur berjamaah dengan ribuan santri putra di areal pesantren. Kemunculan Pj.Gubsu di penghujung waktu santap sahur di pesantren terse-

but, sempat membuat para santri kaget. Sebagian santri lain ada yang bersorak kegirangan, sedangkan sebagian santri lain langsung mengajak makan bersama di meja makan dengan menu santap sahur ala santri.(m28)


PELUK HARU : Seorang ibu pejuang 45, memeluk haru Pj Gubsu, H Gatot Pudjonugroho ST, usai upacara bendera di hari kemerdekaan RI ke 66 di Lapangan Merdeka Medan. Sejumlah veteran memeluk Pj Gubsu bergantian sambil meneteskan air mata. Topi yang dikenakan Pj Gubsu sempat beberapa kali terjatuh dalam suasana penuh haru tersebut.

Medan Metropolitan


WASPADA Rabu 24 Agustus 2011

Infrastruktur Pulo Sicanang Memprihatinkan MEDAN (Waspada): Infrastruktur di kawasan Pulo Sicanang tepatnya jalan lingkungan di Blok 12,13, dan 14, hingga kini belum di aspal. Selain itu kondisi lingkungan terkesan kumuh karena sebagian halaman rumah warga dipenuhi air yang menggenang akibat tidak adanya drainase. “Beginilah kondisi pemukiman kami, kalau pasang datang lebih gawat lagi.Tolonglah jalan kami diperbaiki,” keluh Boru Silaban, warga Kelurahan Pulo Sicanang, Medan Belawan, Sabtu (22/8). Buruknya infrastruktur di kawasan Medan Utara ini diakui Landen Marbun SH, anggota DPRD Medan dari daerah pemilihan (Dapil) V yang melakukan reses kedua di kawasan Kelurahan Pulo Sicanang. Di Dapil V yang meliputi Medan Deli, Labuhan, Marelan dan Belawan, khususnya Kelurahan Pulo Sicanang, masih banyak ditemukan jalan-jalan lingkungan (jalan setapak) belum diaspal. Jika hujan turun akan menjadi kubangan kerbau.Tidak hanya itu, umumnya kawasan tersebut juga tidak memiliki

drainase, sehingga bila air pasang rumah penduduk akan tergenang. “Pembangunan sama sekali belum kami rasakan sejak Indonesia ini merdeka. Pembangunan hanya terpusat di Kota Medan, sedangkan kawasan utara menjadi kawasan kumuh dan epidemi penyakit,” tutur D Pasaribu, tokoh masyarakat di Pulo Sicanang. Landen Marbun yang mendengar keluhan warga tersebut langsung melakukan peninjauan keliling ke setiap kampung didampingi warga dan tokoh-tokoh agama. Landen bersama para tokoh agama melihat kondisi jalan lingkungan yang belum diperbaiki, mengakibatkan warga yang akan beribadah ke masjid dan gereja menjadi terganggu karena jalan berlumpur saat hujan datang. Bahkan, anak-anak juga terganggu berangkat ke sekolah bila air sudah naik. Ketua Fraksi PDS DPRD Medan itu meminta warga untuk bersabar dan berdoa semoga upaya yang dilakukan membuahkan hasil. Berbagai keluhan warga akan segera disampaikan dalam laporan reses dan diharapkan Pemerintah Kota Medan memberikan perhatian serius. (m30)

Pengiriman Paket Pos Meningkat 15 Persen Kartu Lebaran Kurang Diminati Waspada/Surya Efendi

MACAT DI KAWASAN PASAR: Becak bermotor dan kendaraan lainnya terjebak macat di Jln. Sutomo kawasan Pasar Sambu Medan, Selasa (23/8). Arus lalulintas di kawasan pusat perbelanjaan modern dan pasar tradisional padat akibat warga berbelanja kebutuhan Lebaran.

Lurah Dan Camat Harus Sediakan Mobil Bak Terbuka Takbiran Dipusatkan Di Jalan Pulau Pinang MEDAN (Waspada): Wali Kota Medan Drs. H. Rahudman Harahap, MM meminta setiap kelurahan dan kecamatan menyediakan satu mobil bak terbuka yang dihias serta dilengkapi beduk untuk disertakan pada pelaksanaan takbiran. Namun tidak dibenarkan adanya iringiringan kendaraan roda dua pada pelaksanaan takbiran tersebut. “Jika setiap kelurahan menyediakan satu mobil bak terbuka, berarti ada 151 mobil yang menjadi peserta takbiran ditambah 21 mobil dari kecamatan. Dengan adanya fasilitas mobil

tersebut diharapkan mampu mengurangi jumlah iring-irigan kenderaan roda dua yang selama ini terjadi pada malam takbiran,” kata Rahudman kepada Waspada usai memimpin rapat

Lurah Sidodadi Santuni Anak Yatim MEDAN (Waspada): Memperingati Hari Ulang Tahun (HUT) ke-66 RI, Lurah Sidodadi, Kecamatan Medan Timur A. Zulfikar Rambe, SSTP, MAP Jumat (19/8), menyantuni puluhan anak yatim dan fakir miskin yang bermukim di kawasan kelurahan tersebut. Acara yang berlangsung di Aula Kantor Lurah Jln. Madong Lubis Medan itu dirangkai dengan buka puasa bersama. Lurah Sidodadi A.Zulfikar Rambe mengatakan, acara tersebut sudah dua kali digelar di Kelurahan Sidodadi. Diharapkan santuan yang diberikan itu tidak dilihat dari jumlahnya, tetapi nilai yang terkandung di dalamnya sebagai wujud kepedulian pihak kelurahan terhadapanakyatimdanfakirmiskindilingkungankelurahanSidodadi. Sementara itu, Ketua LPM Sidodadi H. M. Saleh mengajak masyarakat setempat agar membantu tugas-tugas kelurahan, terutama dalam menciptakan lingkungan bersih. Masyarakat juga mengharapkan acara tersebut dilaksanakan secara rutin olehpihak kelurahan. (m22)


LURAH Sidodadi A. Zulfikar Rambe, SSTP,M.AP menyerahkan santunan berupa uang dan kain sarung kepada anak yatim dan fakir miskin.

di Balai Kota, Selasa (23/8). Turut hadir Kapolresta Medan Kombes Pol Tagam Sinaga, Dandim 0201/BS Letkol Inf Doni Hutabarat, Dan Lanud Kolonel (Pnb) A Rasyid Jauhari, Dan Denpom Mayor CPM Hendra, Asisten, pimpinan Satuan Kerja Perangkat daerah (SKPD), Camat, Kapolsek, Dan Ramil serta Lurah di lingkungan Pemko Medan. Menurut Rahudman, pelaksanaan takbiran difokuskan di Jln. Pulau Pinang seperti tahun lalu. “Untuk melaksanakan takbiran ini, saya sudah menemui Plt. Gubsu, Kapoldasu dan Pangdam I/BB. Takbiran yang dilaksanakan Muspida Tingkat I akan dilepas bersama-sama dari Jln. Pulau Pinang,” jelasnya.

Sementara itu, Kapolresta Medan Kombes Pol Tagam Sinaga mengatakan, pihaknya siap melakukan pengamanan sejak menjelang Lebaran, malam tabiran, pelaksanaan Shalat Idul Fitri dan selama libur Lebaran. Pada pelaksanaan takbiran, Kapolresta memerintahkan seluruh Kapolsek agar mengikutsertakan personelnya di setiap mobil yang digunakan untuk pawai tersebut. “Saya yakin Dandim pun akan melakukan hal ini sebagai upaya menciptakan keamanan,” kata Kapolresta. Guna terciptanya rasa aman dan nyaman bagi warga yang hendak merayakan Idul Fitri 1432 H, Rahudman menginstruksikan seluruh camat, lurah dan kepala lingkungan agar

Badan Pusat Statistik. Secara teknis, kami memang tidak bisa menjelaskan perhitungan tersebut,” kata Kepala Bidang (Kabid) Perdagangan Dalam Negeri (PDN) Disperindagsu Rouly Tambunan, pada acara tersebut. Dengan alasan tersebut, Rouly yang hadir mewakili Kepala Disperindagsu Darwinsyah mengaku tidak bisa merinci berapa stok yang tersedia saat ini. Dia hanya menyebutkan jika perkiraan stok dan kebutuhan tersebut masih sesuai dengan realita di lapangan dan cukup hingga Idul Fitri nanti. ”Data yang ada pada kami dan kami sampaikan hari ini adalah hasil pantauan selama bulan Juni yang kemudian diperbandingkan dengan kebutuhan berdasarkan analisis BPS. Kondisinya saat ini masih aman dan cukup terpenuhi sehingga tidak ada kelangkaan di pasar. Stok itu ada di gudanggudang distributor,” sebutnya.

kartu Lebaran saat ini kurang digemari masyarakat karena pesatnya perkembangan teknologi informasi. Peningkatan pengiriman paket Lebaran juga terjadi pada jasa pengiriman swasta. “Menjelang Lebaran, jumlah pengiriman mencapai 65 hingga 68 ton. Sementara pada hari biasa hanya 58 ton,” kata M. Tinambunan, seorang pekerja Tiki. Batas pengiriman paket Lebaran terakhir ditetapkan pada 26 Agustus 2011. Untuk pengiriman paket regular dikenakan biaya Rp11.000 per kilogram. Sedangkan paket ONS sebesar Rp15.000 per kilogram. Sementara itu, Tini, 35, salah seorang pengguna jasa Tiki mengatakan, dirinya mengirimkan paket kepada adiknya di Banjarmasin. Dia sengaja mengirimkan paket itu karena sang adik tidak bisa pulang ke Medan untuk berkumpul bersama keluarga merayakan Lebaran. (cag)

siaga 24 jam di wilayah masingmasing dan menjalin kerjasama dengan personel TNI/Polri. “Jangan ada camat, lurah dan kepling yang tidak siaga. Khusus kepada camat diminta mengunjungi pos pengamanan secara rutin. Saya akan cek langsung sehingga diketahui siapa camat yang tidak siaga,” kata Rahudman Selain itu, lanjut Rahudman, SKPD terkait seperti Dinas Perhubungan, Dinas Kesehatan, Satpol PP dan Dinas Bina Marga harus cepat melakukan antisipasi guna memberi kenyamanan bagi warga yang berlebaran. Sedangkan Dinas Pertamanan harus bisa menjamin penerangan jalan di sejumlah lokasi. (m50)

Kondisi Stok Bahan Pokok Tak Terpantau MEDAN (Waspada): Dinas Perindustrian dan Perdagangan Sumatera Utara (Disperindagsu) mengaku tidak melakukan pantauan secara khusus terhadap ketersediaan bahan pokok di pasar. Instansi yang paling dekat dengan pemantauan harga ini mengaku hanya menerima laporan ketersediaan bahan pokok tersebut di gudang-gudang distributor. Dengan alasan tersebut, instansi ini mengaku tidak bisa memberikan gambaran ril terkait stok yang tersedia hingga H-7 Idul Fitri 1423 H. Hal ini terungkap saat digelar paparan pantauan dan pengendalian harga oleh Disperindagsu, di Kantor Dinas Komunikasi dan Informatika (Kominfo) Sumut, Selasa (23/8). ”Ketersediaan stok yang ada kami peroleh dari instansi terkait dan para distributor. Ketersediaan tersebut kemudian dibandingkan dengan kebutuhan yang diperoleh datanya dari

MEDAN (Waspada): “Menjelang Lebaran, produksi pengiriman paket via PT. Pos Indonesia mengalami peningkatan sebesar 15 persen,” kata Marketing PT. Pos Indonesia Fitriadi kepada Waspada di kantornya, Jln. Balai Kota, Selasa (23/8). Menurut Fitriadi, peningkatan itu terjadi karena masyarakat begitu antusias mengirimkan paket lewat pos. PT. Pos akan terus melayani pengiriman paket hingga 25 Agustus dan paling lambat sampai ke tujuan pada 26 Agustus. Setelah tanggal itu, PT. Pos tidak menerima pengiriman paket lagi karena kantor sudah libur. Umumnya, paket tersebut dikirim ke kawasan Jabodetabek, Pekanbaru, Jawa Barat terutama Bandung, Jawa Tengah, Yogyakarta dan Jawa Timur terutama. Setiap paket yang dikirim maksimal seberat 30 kg. Selain menerima pengiriman paket, PT Pos Indonesia juga mencetak 15 pieces kartu Lebaran dengan ongkos kirim sebesar Rp1.500. Namun,

Rouly tidak menjawab ketika ditanyakan kondisi stok bahan pokok saat ini. Dia hanya menjelaskan data ketersediaan kebutuhan pokok masyarakat menjelang Ramadhan dan Idul Fitri. Data tersebut sama dengan data yang dipublikasi Disperindagsu pada pertemuan Forum Komunikasi Pimpinan Daerah (FKPD) terkait pengendalianhargaawalRamadhanlalu. Data yang dipublikasikan tersebut terdiri dari stok gula 48.000 ton dengan kebutuhan konsumsi selama Ramadhan dan Idul Fitri 23.000 ton. Kemudian minyak goreng 180.000 ton dengan kebutuhan 24.000 ton, tepung terigu tersedia 18.000 ton dari kebutuhan 14.000 ton. Ketersediaan daging sapi 68.000 ton dengan kebutuhan 45.000 ton, daging ayam tersedia 800.000 ton dari perkiraan kebutuhan 45.000 ton dan telur ayam tersedia 65.800 ton dari kebutuhan yang diperkirakan 42.780 ton.(m28)


SEORANG pekerja di Kantor Pos Besar Medan membawa paket yang akan di distribusikan ke sejumlah wilayah, Selasa (24/8). Menjelang Lebaran, pengiriman paket pos mengalami peningkatan hingga 15 persen dari tahun sebelumnya.

Home Centra Santuni 1.000 Anak Yatim MEDAN (Waspada): Building Inspiration Home Centra dalam program Charity Bersama berupa “Home Centra Peduli Sesama” menyantuni 1.000 anak yatim piatu dari 9 panti asuhan di Medan. Sebanyak 220 orang diantaranya diajak berbuka bersama di halaman Home Centra Jln. Industri Ring Road Setia Budi II, baru-baru ini. Sedangkan dalam acara itu diserahkan secara simbolis beras dan mie instan kepada tiga panti asuhan Panti Asuhan Sunggal, Panti Asuhan Pasar I dan sekitarnya serta Panti Asuhan Pembangunan Pendidikan Islam Padang Bulan. Enam panti asuhan lainnya masing-masing Panti Asuhan Al-Washliyah Pulo Brayan, Panti Asuhan Zending Islam, Panti Asuhan Az-Zahra Medan Permai, Panti Asuhan Al-Washliyah Titi Kuning, Yayasan Al-Fitayan Asam Kumbang dan Yayasan Selayang. Hadir dalam acara itu Presiden Direktur Home Centra Irawan Rusli, Komisaris Irwanto, General Manager (GM) Budi Kho, Customer Development & Marketing Manager Yulia

Devianty dan seluruh staf. Acara itu diisi dengan tausiyah yang disampaikan Al-Ustadz H.Zulkifli dan penampilan Maidani Nasyid dari Medan. Program Charity Bersama Home Centra juga diisi dengan berbagai kegiatan sejak 1-27 Ramadhan di antaranya kuliner, seni budaya Islam, menggambar, kaligrafi dan lomba busana muslim/muslimah serta hiburan. Sedangkan acara berbuka puasa bersama yatim piatu itu bertepatan dengan peringatan HUT ke-66 Kemerdekaan RI. GM Home Sentra Budi Kho dalam sambutannya mewakili Presiden Direktur Home Centra mengatakan, berbagai kegiatan dalam rangkaian program Charity Bersama Home Centra sejak 1-27 Ramadhan berkat dukungan customer. Sementara itu, Ustadz H Zulkifli dalam tausiyahnya bercerita tentang keberadaan anakanak yatim piatu yang mendapat perhatian dari Rasululah SAW. Bahkan, Rasulullah SAW menyuruh umat Islam agar lebih menyayangi anak yatim piatu dibandingkan anak sendiri.(cwan)

Berburu Monza Menjelang Hari Raya MEMASUKI pekan terakhir bulan suci Ramadhan, masyarakat mulai melirik kebutuhan sandang saat perayaan Lebaran. Selain pusat perbelanjaan modern, masyarakat Kota Medan juga menyerbu pasar tradisional. Seperti Pasar Melati di Jln. Flamboyan Raya, Tanjung Anom terlihat dipadati pengunjung. Pasar Melati dikenal sebagai salah satu pusat penjualan pakaian bekas asal luar negeri (impor) atau biasa disebut ‘monza’. Pasar ini merupakan surga bagi para pemburu pakaian, celana, tas dan sepatu bermerek dengan harga relatif miring.

Selasa, Jumat dan Minggu merupakan hari ‘berburu’ monza di pasar Melati. Sebab, hari itu merupakan puncak pekan di Pasar Melati. Seluruh kios monza yang jumlahnya mencapai seratusan, menggelar dagangannya. Beda dengan hari biasa, hanya beberapa kios yang dibuka. Teriakan bersahutan terdengar dari lapak-lapak kecil dan milik para pedagang. “Sepuluh ribu dua, sepuluh ribu dua, sepuluh ribu dua,” teriak mereka. Seketika para pengunjung menyambangi lapak-lapak tersebut. Khusus bulan Ramadhan, harga satu baju berkisar Rp10.000 - Rp.50.000. Harga

tersebut ditentukan berdasarkan kualitas barang. “Rata-rata pedagang disini tahu, barang yang asli dan palsu. Bedanya dari jahitan, kode dan sebagainya,” ujar Nasution, seorang pedagang di Pasar Melati. “Pada Puasa tahun ini, pemburu monza meningkat dari tahun sebelumnya. Tidak tahu pasti apa penyebabnya. Yang jelas, pengunjungnya jauh lebih banyak dari padabiasanya,” tambah Nasution. Sementara itu, Rena Sari Dewi, 21, warga Medan mengaku gemar berbelanja di Pasar Melati tersebut. “Saya sengaja melirik tas yang bekas ketimbang beli baru. Sebab, kualitas dan mereknya terkenal namun

harganya terjangkau. Hal ini yang membuat saya dan kawan-kawan sering berburu ke Pasar Melati,” ujarnya. Beda dengan Pasar Simalingkar, menurut Rena, pasar Melati memiliki tiga hari pekan dalam seminggu. Sementara di Pasar Simaligkar hanya sekali dalam seminggu yakni hanya hari Minggu dan waktunya terbatas dari pagi hingga menjelang siang. Beda dengan Pasar Melati yang dibuka sejak pagi hingga petang. “Namun harga pakaian di Pasar Simalingkar jauh lebih murah dibadingkan Pasar Melati,” tutur Rena. Sebelumnya, Ewin, 44, seorang pedagang di Pasar Simalingkar mengatakan,

barang-barang yang dijual tersebut didatangkan dari berbagai negara seperti Korea, Jepang, Singapura dan China. Sedangkan barang yang paling bagus yang didatangkan dari Eropa. Uniknya animo masyarakat cukup tinggi terhadap keberadaan monza tersebut mulai kalangan mahasiswa hingga pejabat. “Awalnya aku berjualan, aku kira yang belanja disini hanya dari kalangan ekonomi kelas bawah. Namun, kabar yang aku dengar dari kawankawan pedagang, isteri-isteri pejabat pun ikut berburu ambal monza di sini,” ujar Ewin sambil tertawa. (chr)


PRESIDEN Direktur Home Centra Irawan Rusli (tengah) didampingi Komisaris Irwanto (ketiga dari kiri), staf dan perwakilan anak yatim piatu foto bersama usai penyerahan bantuan secara simbolis kepada tiga panti asuhan, Rabu (17/8).

Medan Metropolitan

WASPADA Rabu 24 Agustus 2011

Polisi Tipu Pengusaha HP MEDAN (Waspada): Propam Polresta Medan mengamankan seorang oknum polisi yang bertugas di Sat Sabhara Polresta Medan diduga telah melakukan penipuan terhadap pengusaha handphone yang juga mitra Primer Koperasi Polisi (Primkoppol) di Toko Bersama Jalan Letda Sujono, Kec. Medan Tembung, Selasa (23/8) siang. Briptu PP, 25, kemudian digelandang ke Propam Polresta Medan untuk menjalani pemeriksaan atas penipuan tersebut. Sedangkan korbannya Edy membuat pengaduan di Unit Tipiter Polresta Medan. Informasi di kepolisian menyebutkan, sejak awal 2011, Briptu PP sudah melakukan penipuan. Modusnya, ia mengambil barang dari Toko Bersama milik Edy dengan mencatut tiga

nama personel Sat Sabhara Polresta Medan. Karena mitra Primkoppol, Edy tak curiga dan memberikan handphone berbagai merk kepada PP. Kemudian, oknum polisi itu menjual handphone tersebut kepada masyarakat dengan harga rendah. Setelah berhasil sekali, Briptu PP menjadi ketagihan. Ia pun melakukan aksinya hingga tiga kali. Namun, aksinya

Jadwal Penerbangan Di Bandara Polonia No. Penerbangan Ke Flight


Tiba Dari

GARUDA INDONESIA 1 Jakarta GA-181 2 Jakarta GA-183 3 Jakarta GA-185 4 Jakarta GA-187 5 Jakarta GA-189 6 Jakarta GA-191 7 Jakarta GA-193 8 Jakarta GA-147 9 Jakarta GA-195 10 Banda Aceh GA-142 11 Banda Aceh GA-14.6

05.30 08.40 10.45 11.55 13.55 15.45 18.35 18.30 19.50 09.40 14.50

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Banda Aceh Banda Aceh

GA-180 GA-182 GA-184 GA-186 GA-146 GA-188 GA-190 GA-192 GA-196 GA-143 GA-147

07.55 08.55 11.10 13.00 14.05 15.10 17.50 19.05 21.35 12.25 17.45

CITILINK 1 Jakarta 2 Jakarta

09.45 19.00

Jakarta Jakarta

GA-040 GA-044

09.15 18.30

06.15 09.40 08.05 17.55 10.05 18.25 21.20 13.30 15.05 14.30

Kuala Lumpur Kuala Lumpur Kuala Lumpur Kuala Lumpur Penang Penang Kuala Lumpur Jakarta Bangkok (2,4,6) Hongkong (1,3,5,7)

QZ-8051 QZ-8055 AK-450 AK-454 QZ-8073 AK-5836 AK-456 QZ-7502 QZ-8085 QZ-7431

08.40 12.05 07.35 17.30 09.40 18.00 20.55 13.05 20.10 23.15

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Penang Penang Jakarta Jakarta Jakarta Jakarta Jakarta Surabay Surabaya Banda Aceh Batam

JT-380 JT-300 JT-394 JT-302 JT-210 JT-200 JT-204 JT-398 JT-382 JT-384 JT-202 JT-212 JT-396 JT- 8289 JT-8287 JT-206 JT-208 JT-388 JT-308 JT-218 JT-971 JT-973 JT-397 JT-970

08.20 09.20 10.20 11.20 11.50 12.20 13.20 14.20 15.20 16.20 17.20 17.50 18.20 11.35 15.00 19.20 20.20 21.55 22.20 23.20 12.16 15.55 07.40 12.15

GA-041 GA-045

AIR ASIA 1 Kuala Lumpur QZ-8050 2 Kuala Lumpur QZ- 8054 3 Kuala Lumpur AK- 451 4 Kuala Lumpur AK-455 5 Penang QZ-8072 6 Penang AK-5937 8 Kuala Lumpur AK-457 9 Jakarta QZ-7503 10 Bangkok (1,4,6) QZ-8084 11 Hongkong (1,3,5,7) QZ-7.430 LION AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Jakarta 5 Jakarta 6 Jakarta 7 Jakarta 8 Jakarta 9 Jakarta 10 Jakarta 11 Jakarta 12 Jakartaa 13 Jakarta 14 Penang 15 Penang 16 Jakarta 17 Jakarta 18 Jakarta 19 Jakarta 20 Jakarta 21 Surabaya 22 Surabaya 23 Banda Aceh 24 Batam

JT- 211 JT- 381 JT- 397 JT- 207 JT- 301 JT- 395 JT- 303 JT- 213 JT-201 JT- 387 JT-399 JT-383 JT-205 JT-8288 JT-8286 JT-385 JT-203 JT-215 JT-309 JT-209 JT-972 JT-972 JT-396 JT 970

06.00 07.00 08.20 09.00 10.00 11.00 12.00 12.30 13.00 14.00 15.00 16.00 16.35 09.10 12.30 17.00 18.00 18.30 20,00 21.00 07.00 12.55 19.00 07.00



MALAYSIA 1 Kuala Lumpur MH-861 2 Kuala Lumpur MH-865

09.05 15.45

Kuala Lumpur MH-860 08.25 Kuala Lumpur MH-864 15.00

SILK AIR 1 Singapura 2 Singapura 3 Singapura (7)

MI-233 MI-237 MI-241

08.40 20.35 21.05

Singapura Singapura Singapura (7)

MI-232 MI-238 MI-242

07.50 19.50 20.00

VALUAIR 1 Singapura (4,7) VF-582 2 Singapura (1,3,6) VF-584

09.35 17.25

Singapura (4.7) VF-581 Singapura (1,3,6) VF-583

09.10 17.50

BATAVIA AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Batam

Y6-592 Y6-594 Y6-596 7P-568

10.10 16.15 20.00 13.00

Jakarta Jakarta Jakarta Batam

Y6-591 Y6-593 Y6-595 7P-567

09.55 18.30 19.20 11.05

SRIWIJAYA AIR 1 Jakarta 2 Jakarta 3 Batam 4 Pekanbaru 5 Pekanbaru 6 Banda Aceh 7 Penang 8 Padang

SJ-015 SJ-011 SJ-035 SJ-043 SJ-041 SJ-010 SJ-102 SJ-021

13.25 15.00 16.20 10.20 16.00 11.55 07.20 15.25

Jakarta Jakarta Batam Pekanbaru Pekanbaru Banda Aceh Penang Padang

SJ-010 SJ-016 SJ-034 SJ-042 SJ-040 SJ-011 SJ-103 SJ-020

11.20 18.35 15.45 12.50 15.25 13.25 10. 00 14.50

13.15 11.00

Subang Penang

FY-3412 FY-3402

12.56 10.40

SRIWIJAYA AIR 1 Subang FY -3413 2 Penang FY- 34.03

Jadwal Perjalanan Kereta Api No KA

Nama KA




U.2 U.4 U.6 U.8 U.1 U.3 U.5 U.7 U.10 U.12 U.9 U.11 U.14 U.16 U.18 U.13 U.15 U.17 U.22 U.21 PLB 7000 PLB 7007 PLB 7014 PLB 7017 PLB 7002 PLB 7004 PLB 7008 PLB 7010 PLB 7012 PLB 7001 PLB 7006 PLB 7015 PLB 7003 PLB 7005 PLB 7009 PLB 7011 PLB 7013

Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Putri Deli Putri Deli Putri Deli Putri Deli Putri Deli Putri Deli Siantar Ekspres Siantar Ekspres Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa

Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Bisnis Bisnis Bisnis Bisnis Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonom Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi

Medan Medan Medan Medan Rantau Prapat Rantau Prapat Rantau Prapat Rantau Prapat Medan Medan Binjai Binjai Medan Medan Medan Tanjung Balai Tanjung Balai Tanjung Balai Medan Siantar Medan Medan Medan Medan Medan Medan Medan Medan Medan Tebing Tinggi Belawan Belawan Binjai Binjai Binjai Binjai Binjai

Rantau Prapat Rantau Prapat Rantau Prapat Rantau Prapat Medan Medan Medan Medan Binjai Binjai Medan Medan Tanjung Balai Tanjung Balai Tanjung Balai Medan Medan Medan Siantar Medan Tebing Tinggi Belawan Belawan Belawan Binjai Binjai Binjai Binjai Binjai Medan Medan Medan Medan Medan Medan Medan Medan

Berangkat Datang 08.00 10.30 15.00 22.50 08.00 14.45 17.10 23.00 04.50 20.15 09.20 21.40 06.50 12.50 17.10 07.15 11.55 19.25 11.25 07.00 18.00 07.30 16.50 12.00 07.30 05.00 09.50 12.15 14.40 06.20 08.40 17.50 08.55 06.30 11.00 13.30 15.50

13.21 15.25 20.28 03.52 13.22 19.59 22.01 04.24 05.42 21.07 10.12 22.32 11.17 17.27 22.15 11.54 16.28 22.47 14.50 10.45 20.04 08.17 17.37 12.47 08.22 05.52 10.42 13.07 15.32 07.21 09.27 18.27 09.47 07.22 11.52 14.22 16.42

Informasi Pemesanan -Stasiun KA Medan (061) 4514114, -Stasiun KA R. Prapat (0624) 21617.

itu tercium tiga polisi yang namanya dicatut. Sebab, ketiga polisi yang namanya digunakan untuk mengambil handphone tersebut keheranan gaji mereka selalu terpotong setiap bulannya. Padahal mereka tidak ada mengambil barang di koperasi. Merasa curiga, ketiganya protes ke bagian pengambilan gaji di Polresta Medan. Setelah dilakukan pengusutan, ternyata nama ketiganya dicatut Briptu

PP untuk menipu. Berdasarkan temuan itu, Kapolresta Medan Kombes Pol Tagam Sinaga memerintahkan Propam Polresta Medan untuk memburu PP. Petugas Propam kemudian meminta Edy untuk menghubungi Briptu PP menawarkan barang lagi. Dia yang tidak curiga kemudian mendatangi Toko Bersama milik Edy yang sudah ditunggui Provost. Melihat kedatangan oknum

polisi itu, tiga anggota Provost langsung mengamankannya dengan memboyongnya ke Polresta Medan. Kapolresta Medan Kombes Pol Tagam Sinaga yang dikonfirmasi membenarkan penangkapan Briptu PP. Tagam mengatakan, akan segera mengeluarkan surat pemecatan terhadap tersangka. “Tersangka sedang diperiksa dan akan segera kita pecat,” ujarnya. (m39)

Miras Dan Petasan Terus Dirazia MEDAN (Waspada): Polsek di jajaran Polresta Medan diinstruksikan terus menggelar razia petasan dan minuman keras (miras) selama bulan suci Ramadhan hingga Lebaran, agar tidak ada lagi gangguan terhadap umat Islam yang sedang menjalankan ibadah puasa. “Selain razia petasan dan miras, juga meningkatkan patroli untuk mengantisipasi aksi kejahatan jalanan,” kata Kabag Ops Polresta Medan Kompol Yushfi Munif Nasution, S.Sos, SIK, M.Hum (foto) kepada Waspada, Senin (22/8) sore. Menurutnya, razia di seluruh Polsek jajaran Polresta Me-

dan merupakan perintah pimpinan Polri langsung ditindaklanjuti Kapoldasu Irjen Pol. Drs Wisjnu Amat Sastro, SH dan

diteruskan ke Kapolresta Medan Kombes Pol. Tagam Sinaga, SH. Tujuannya, agar umat Islam yang melaksanakan ibadah selama bulan suci Ramadhan tidak terganggu. Kapolresta sudah berulangkali mengingatkan para pedagang petasan dan miras tanpa izin agar menghentikan usahanya agar situasi Kota Medan tetap kondusif. “Para pedagang dan pemain petasan itu bisa dijerat dengan UU Darurat pasal 12. Tapi karena mereka bukan produsen barang-barang tersebut, maka polisi hanya mengamankan barang bukti lalu dimusnahkan,” ujarnya. (m36)

Poldasu Periksa Dua Pejabat IAIN Rektor: Tak Ada Dikorupsi MEDAN (Waspada): Penyidik Sat Tipikor Poldasu meminta keterangan dua pejabat di Institut Agama Islam Negeri (IAIN) Sumut sebagai saksi dugaan korupsi di IAIN, yang dilaporkan Angkatan Muda Advokasi Hukum Indonesia (AMDHI) dan Forum Mahasiswa Peduli IAIN Sumatera Utara (Formalin). Kedua pejabat itu diperiksa, Selasa (23/8), yaitu Armansyah Harahap, sekretaris panitia yang menjabat Kabag Rumah Tangga (sekarang Kabag Perencanaan) IAIN dan Makmun Suaidi Harahap, Pejabat Pembuat Komitmen (PPK) yang menjabat Kabag Keuangan (sekarang Kabag Rumah Tangga) IAIN. Kabid Humas Poldasu Kombes Pol. Heru Prakoso melalui Kasubbid Humas Poldasu AKBP MP Nainggolan kepada wartawan membenarkan pemeriksaan itu. “Mereka diperiksa terkait dugaan korupsi di IAIN. Pemeriksaan keduanya masih sebagai saksi,” katanya. Sebelumnya, Senin (8/8), AMDHI dan Formalin melaporkan dugaan korupsi di IAIN kepada Ditreskrim Poldasu. Mereka menduga terjadi korupsi sebesar Rp72 miliar pada Tahun Anggaran 2010. Disebutkan mereka beberapa item yang terindikasi di-

korupsi antara lain, penyelenggaraan operasional dan pemeliharaan perkantoran senilai Rp1,4 miliar, belanja keperluan perkantoran seperti pakaian sopir, pakaian pesuruh dan pakaian satpam Rp55 juta. Perawatan gedung kantor Rp140 juta, operasional perkantoran dan pimpinan Rp540.980.000, pelayanan publik atau birokrasi Rp3,1 miliar, pendidikan dan pelatihan teknis Rp971.150.000, pelatihan di institut Rp342 juta, pelatihan di F-Syariah Rp136.800.000, pelatihan di FDa k w a h R p 1 0 2 . 6 0 0 . 0 0 0 , pelatihan di F-Ushuluddin Rp102.600.000, Belanja barang non operasional antara lain, akreditasi jurnal, penerbitan buku ilmiah, tunjangan studi dan biaya hidup S2 serta tunjangan studi dan biayahidupS3senilaiRp478.400.000, seminar di F-Tarbiyah Rp3 juta, seminar F-Syariah Rp19.300.000, akreditasi Prodi Fakultas Rp104 juta, belanja barang non operasional di F-Syariah Rp15 juta. Lalu, pengecatan pagar di duga fiktif Rp760 juta, belanja sarana dan prasarana pendidikan dengan kode anggaran 3417 senilai Rp16 miliar diduga fiktif, pengadaan buku pedoman praktikum senilai Rp150 juta yang ditengarai fiktif dan lain-lain.

Dianiaya Gara-gara Pergoki Suami Selingkuh MEDAN (Waspada): Jernih Br Sembiring (30) warga Dusun II, Desa Sembahe, Kec. Sibolangit, melaporkan suaminya berinisial DK ke Polsekta Pancurbatu, Senin (22/8), karena menjadi korban kekerasan dalam rumah tangga (KDRT). Menurut sumber di kepolisian, sebelumnya korban mendapat informasi suaminya DK sedang berduaan dengan seorang perempuan di pemandian Sembahe. Jernih kemudian mendatangi dan melihat suaminya sedang berduaan di dalam pondok. Korban berusaha memarahi perempuan tersebut, namun dihalangi oleh DK. Ternyata suaminya DK malah memarahi sembari mencekik dan memukul muka korban. Akibatnya, korban mengalami luka memar pada bagian pelipis mata. Kapolsek Pancurbatu AKP Ruruh Wicaksono, SIK.SH.MH melalui Kanit Reskrim AKP Simon R Kendek saat dikonfirmasi wartawan membenarkan adanya laporan tersebut. (chr)

Tidak benar Tetapi apa yang dilaporkan AMDHI dan Formalin ke Poldasu, dianggap Rektor IAIN Sumut Prof. Dr. Nur Ahmad Fadhil Lubis, MA sebagai pecemaran nama baik. “Itu merupakan pencemaran nama baik bagi orang-orang yang dituduhkan. Apa dasar mereka menyebutkan terjadi korupsi anggaran di IAIN, karena semua itu tidak benar,” sebut Prof. Fadhil Lubis, di dampingi Pembantu Rektor (PR) II Prof. Dja’far Sidik, MA ditemui di IAIN Sumut Jln. Medan Estate, Selasa (23/8). Dia mengatakan, menyesalkan adanya laporan tersebut, apalagi dilakukan oleh mahasiswa IAIN sendiri. Padahal, sebut Fadhil Lubis, pihaknya sangat terbuka untuk masalah seperti itu. “Awalnya kita ingin menyelesaikan persoalan ini secara internal saja, tetapi karena sudah terlalu melebar dan meluas, akhirnya kita juga butuh pihak lain untuk menyelesaikannya. Karena itu pula, IAIN akan melaporkan balik para pelapor atas kasus pencemaran nama baik,” katanya. Prof Dja’far Sidik menambahkan, mereka yang dilaporkan hingga kini belum pernah menerima surat panggilan dari Polda terkait pengaduan itu. “Sejauh ini belum pernah menerima surat panggilan dari Poldasu,” ujarnya. Dia juga heran, atas dasar apa laporan itu disampaikan. Kalau dikatakan berdasarkan temuan PPATK, termasuk kategori apa? Karena menurut dia, IAIN termasuk dalam kategori “wajar”. Dia juga tidak habis pikir dengan laporan korupsi sebesar Rp72 miliar. Karena, kata Dja’far, anggaranIAINtahun2010sebesar Rp77 miliar, dimana Rp40 miliar untuk gaji dosen, staf, satpam dan biaya akre-ditasi. “Kalau Rp72 miliar dikorupsi, tentu dosen dan pegawai di sini mengamuk, karena tidak terima gaji,” sebutnya.(m27/m41)


Tiga Ruko Musnah Terbakar MEDAN (Waspada): Tiga rumah toko (ruko) di Jalan Bunga Lau depan RSUP H Adam Malik Medan, Kecamatan Medan Tuntungan, musnah terbakar, Selasa (23/8) dinihari. Ketiga ruko yang dijadikan tempat usaha Apotik Vita Jaya, Grosir Sitabar dan usaha foto copy itu terbakar sekira pukul 01:00. Dalam peristiwa itu tidak ada korban jiwa dan kerugian belum dapat diperkirakan. Informasi di lokasi kejadian menyebutkan, diduga asal api akibat hubungan listrik arus pendek. Salah satu kabel instalasi listrik ke ruko tersebut terkelupas sehingga terkena air karena baru turun hujan. Salah seorang security di RSUP H Adam Malik mengatakan, sebelum terjadi kebakaran,

salah satu kabel listrik PLN terlihat mengeluarkan percikan api. “Kami liat ada percikan api mirip seperti kembang api dari kabel itu. Kami pikir biasa aja. Tiba-tiba timbul api hingga membesar,” ujarnya. Sementara beberapa pengunjung Hotel Sitabar yang berada persis di belakang lokasi ruko yang terbakar berhamburan keluar setelah melihat kobaran api. Para penghuni hotel melati tersebutmerupakanpenjengukpasienyangsedang menjalani perawatan di RSUP H Adam Malik. Sedangkan beberapa warga mengatakan, api menjalar dengan cepat melalap ketiga ruko. Mobil pemadam kebakaran milik Pemko Medan datang setelah ketiga ruko hangus dan rata dengan tanah.(m40)

Kios Tukang Jahit Dan Salon Dilalap Api MEDAN (Waspada): Satu kios tukang jahit dan tempat salon kecantikan di Jalan Beringin, Pasar VII, Desa Tembung, Kecamatan Percut Seituan, Selasa (23/8) siang, musnah terbakar. Tidak ada korban jiwa namun kerugian mencapai puluhan juta rupiah. Informasi yang diperoleh di kepolisian, peristiwa kebakaran tersebut terjadi sekira pukul 13:00. Seorang saksi mata melihat api pertama kali berkobar di kios tukang jahit milik Soleh, 44. Kobaran api makin membesar sehingga merembes ke salon kecantikan yang berada persis di samping kios tukang jahit tersebut dan dalam kondisi tutup. Kios tukang jahit ludes dilalap sijago merah. Saat kebakaran terjadi, pemiliknya Soleh sedang

belanja bakal pakaian di Pajak Ikan Lama, Jalan Ahmad Yani. Saat dia kembali ke kiosnya, ternyata sejumlah bakal pakaian dan baju-baju milik pelanggan musnah terbakar. Kios tukang jahit tersebut juga digunakan sebagai tempat usaha jual minyak tanah dan gas. KanitReskrimPolsekPercutSeituanAKPFaidir Chaniago menjelaskan, penyebab kebakaran masih dalam penyelidikan dan istri tukang jahit tersebut masih dimintai keterangannya karena saat kebakaran terjadi berada di kios tersebut. “Asal api belum diketahui, apakah karena arus pendek atau sebab lainnya, namun tiga saksi dan pemilik salon masih menjalani pemeriksaaan sekaligus dimintai keterangannya,” ujar Faidir. (h04)

Mantan Kadis Bina Marga Diperiksa MEDAN (Waspada): Mantan Kepala Dinas Bina Marga Medan Gindo Maraganti Hasibuan diperiksa lagi oleh penyidik Subdit III/Tipikor Polda Sumut, terkait dugaan korupsi pengadaan alat berat saat dia menjabat, dengan kerugian negara Rp2 miliar. Kasubid Pengelola Informasi dan Data (PID) Humas Polda Sumut AKBP MP Nainggolan membenarkan pemeriksaan Gindo M Hasibuan. “Ini pemeriksaan lanjutan kasus pengadaan alat berat oleh Dinas Bina Marga. Saat proyek itu dikerjakan, yang bersangkutan menjabat sebagai kepala dinas,” katanya. Korupsi tersebut, yakni, pengadaan tiga unit

beko loader, satu unit motor grader dan satu unit asphalt mixing plat yang dananya bersumber dari APBD-PAPBD Pemko Medan TA 2009, dengan kerugian negara sebesar Rp2 miliar. Kasus tersebut dilaporkan dengan No. LP/403/XI/2010/Dit Reskrim Tanggal 15 November 2010. Nainggolan menambahkan, pemeriksaan Gindo itu untuk mengetahui aliran dana pada proyek tersebut. Sebab, sebagai Kadis Bina Marga saat itu dia merupakan pengguna anggaran (PA). “Jadi, ini untuk mengetahui kemana aliran dana proyek tersebut. Karena yang bersangkutan harus tahu sebagai Kadis dan PA juga,” katanya.(m27)

Tewas Membusuk Dalam Rumah MEDAN ( Waspada): E Sitorus, 50, ditemukan telah menjadi mayat di dalam rumahnya Jalan Danau Poso, Kelurahan Sei Agul, Kecamatan Me-dan Barat, Selasa (23/8) sekira pukul 12.00 WIB. Mayat Sitorus pertama kali diketahui oleh tetangganya karena mencium aroma tak sedap dari dalam rumahnya, apalagi selama ini korban diketahui tinggal sendirian, karena anakanaknya telah berumahtangga. Sejumlah tetangganya curiga karena sejak tiga hari ini Sitorus tak keliha-tan, apalagi rumahnya terkunci dari dalam. Tetangganya yang mencium aroma tak sedap tersebut kemudian mencoba mengetahui asal bau dari rumah korban. Saat dilihat ternyata Sitorus telah tewas di dalam

rumah dan diduga sudah dua hari. Warga sekitar lokasi kemudian melaporkan kejadian ini kepada kepala lingkungan dan diteruskan ke Polsekta Medan Barat. Polisi yang mendapat laporan langsung turun ke lokasi untuk melakukan penyelidikan. Berdasarkan hasil pemeriksaan dan keterangan saksi, diduga korban tewas karena sakit, karena berdasarkan keterangan sejumlah warga selama ini korban mengidap penyakit gangguan jiwa. “Sesuai keterangan dari keluarganya, korban meninggal karena sakit dan dia juga mengidap penyakit kejiwaan, ada surat keterangan dari RS Jiwa. Tidak ada tanda-tanda yang mencurigakan ditubuhkorban,”jelasKanitReskrimPolsekMedan Barat AKP Anthoni Simamora. (h04)

Polisi Terima Laporan Korupsi PTKI Medan MEDAN ( Waspada): Polda Sumut menerima laporan dugaan korupsi di Perguruan Tinggi Kimia Industri (PTKI) Jln. Menteng VII, Medan. Tiga pejabatnya sudah dipanggil untuk diklarifikasi yaitu berinisial Ma, TS dan S. “Kita sudah menerima laporan dugaan korupsi itu, dan sedang dipelajari,” kata Kabid Humas Poldasu Kombes Pol. Heru Prakoso kepada wartawan, Selasa (22/8). Mereka,sebutnya,dipanggiluntukmelakukan klarifikasi.“Artinyauntukmengetahuiadatidaknya proyek di kampus PTKI sesuai laporan yang disampaikan ke Poldasu,” kata Heru. Klarifikasi, sebut dia, sifatnya belum dilakukan proses verbal (pro justicia). Setelah dilakukan klarifikasi terhadap

pejabat berwenang dalam proyek tersebut, penyidik kemudian mengumpulkan data. “Saat ini proses pengumpulan data masih berjalan. Sedangkan hasil klarifikasi memang ada proyek di kampus PTKI pada 2010/2011, tapi masih ditelusuri,”sebutHerutidakmenyebutproyekdimaksud. Sementara informasi diterima wartawan, proyek senilai Rp13 miliar di kampus PTKI dibagi menjadi beberapa item antara lain, pembangunan dan rehab serta pengecatan kampus sekaligus penyelenggaraan Operasional dan Pemeliharaan Perkantoran, Pendidikan dan Pelatihan Teknis, Belanja Barang Non Operasional serta lainnya. “Yang ditelusuri penyidik Tipikor Poldasu saat ini terkait nilai anggaran yang diperuntukkan masingmasing item,” kata sumber. (m27)

Pos Pam I Thamrin Sederhana Tapi Unik KEBERADAAN Pos Pengamanan Operasi Ketupat Toba 2011 di Jalan Thamrin persis di depan Thamrin Plaza Medan, selain memperlancar arus lalulintas juga membantu pengamanan

terhadap masyarakat, ter-lebih menjelang perayaan Idul Fitri yang diambang pintu. Pantauan Waspada, Selasa (23/8), sejumlah personel Polri, TNI, Dishub dan tenaga medis senantiasa terlihat berada di da-

lam pos tersebut sembari menanti masyarakat yang datang membutuhkan pelayanan atau pun membutuhkan informasi tentang kamtibmas. Pada malam hari, suasana di Pos Pam I Thamrin terlihat

Waspada/Andi Aria Tirtayasa

Pos Pam I Thamrin yang berada di pinggir Jalan Thamrin Medan sangat bermanfaat bagi masyarakat sekitarnya. Selain memperlancar arus lalulintas juga mencegah terjadinya aksi criminal jalanan di kawasan tersebut.

menarik. Bila masyarakat yang melintasi Pos Pam I Thamrin itu tentu saja akan meliriknya, apalagi pernak-pernik suasana Idul Fitri terlihat menghiasi Pos PAM tersebut. Belum lagi dihiasi sorotan sinar lampu dan bungabunga sehingga menambah keasriannya. Maklum saja, setiap hari Pos Pam I Thamrin dipantau keberadaannya oleh Kapolsek Medan Area Kompol Aries Setiyowati. Ide untuk menghiasi atau mendekorasi Pos Pam I tersebut, jelas Kompol Aries, merupakan hasil masukan-masukan dari personelnya sendiri, apalagi kesehariannya Pos Pam I tersebut menjadi tanggungjawab Kanit Sabhara. “Penampilan Pos Pam memang agak unik dari Pos Pam lainnya sehingga masyarakat yang melihatnya akan senang karena penampilan Pos Pam ini lebih menarik dan asri dipandang,” tambah Aries. Selain itu, suasana asri akan membuat personel yang bertugas merasa betah dan bersemangat dalam melaksanakan tugasnya. Selain itu, tambah Aries, ada warga dan pengusaha yang memberi sumbangan pernak-pernik Ramadhan dan Idul Fitri seperti duplikat ketupat

dan beduk sehingga membuat tampilan Pos Pam lebih menarik dan asri. Aries Setyowati menjelaskan, keberadaan Pos Pam I Thamrin mendapat dukungan dari masyarakat sekitar dan pihak swasta. Selain memperlancar arus lalulintas, juga mencegah terjadinya aksi tindak kriminal seperti jambret dan kejahatan lainnya. “Swadaya masyarakat dan pengusaha membantu keberadaan Pos Pam I cukup besar karena mereka benar-benar merasakan manfaatnya,” katanya kepada Waspada, Selasa (23/8). Dia menambahkan, selama ini arus lalulintas di kawasan tersebut senantiasa macet, kini semakin lancar karena 14 personel yang berada di Pos Pam tersebut mengatur arus lalulintas. “Fungsi pelayanan Polri terhadap masyarakat sangat terlihat di Pos Pam, karena ada saja warga atau masyarakat mendatangi pos tersebut dan senantiasa dilayani,” tutur Aries seraya menambahkan Pos Pam IThamrin beroperasi selama 24 jam. Menurut Aries, selama bulan suci Ramadhan hingga memasuki perayaan Idul Fitri, Pos Pam I Thamrin berupaya

memberi kenyamanan bagi masyarakat yang melaksanakan ibadah puasa Ramadhan dan Idul Fitri, menciptakan keamanan dan ketertiban serta memberi rasa aman bagi masyarakat yang me-rayakan hari besar ke-agamaan itu. Kepada masyarakat yang bermukim di Kecamatan Medan Area dan Medan Denai, pihaknya mengimbau agar masyarakat yang berada di kedua kecamatan samasama menjaga kamtibmas dan menciptakan keamanan, sebab Pos Pam I ini bukan milik Polri melainkan milik masyarakat bersama. Khusus kepada masyarakat yang akan mudik Lebaran, Aries berpesan agar memberitahukannya kepada kepala lingkungan setempat karena kepling akan mengetahui rumah-rumah warga yang ditinggal penghuninya. “Bila warga mudik maka harus melapor kepada kepala lingkungan masingmasing guna mencegah terjadinya aksi pencurian di rumah-rumah kosong,” tuturnya. * Andi AT

Medan Metropolitan


WASPADA Rabu 24 Agustus 2011

5 Saksi Diperiksa Terkait Pembobolan Rumah Kajatisu Kerugian Rp27 Juta MEDAN (Waspada): Polsek Medan Baru melalukan pemeriksaan terhadap lima orang saksi terkait pembobolan rumah dinas (RD) Kepala Kejaksaan Tinggi Sumut (Kajatisu) AK Basumi Masarif, SH, di Jln. Listrik No.11 Medan. “Kelima saksi yang diambil keterangannya yakni, penjaga rumah dinas yang merupakan pegawai honorer Kejatisu Azrai Sirait alias Ai, 23, petugas piket rumah dinas Arifin Pane, 42, (PNS Kejatisu), pembantu rumah tangga, dan ajudan sopir istri Kejatisu Syahbudi Nawi Hasibuan, 30, penduduk Jln. Budi Luhur, Kelurahan Sei Sikambing C-2, Kecamatan Medan Helvetia,” kata sumber Waspada di kepolisian, Selasa (23/8). Menurut sumber, saksi yang akan diperiksa kemungkinan bertambah, sekaligus polisi juga mengumpulkan bukti-bukti lainnya. “Sementara korbannya AK Basumi Masarif, SH, dan istrinya belum diambil keterangannya dan diharapkan dalam waktu dekat ini mereka hadir untuk menjalani pemeriksaan seputar kasus tersebut,” tuturnya. Disebutkannya, para saksi yang diambil keterangannya tidak mengetahui barang apa saja yang diambil pelaku pencurian dan jumlah nilaiya. “Yang tahu barang hilang adalah korbannya sendiri,” sebutnya.

Sementara itu, tiga PNS Kejatisu yang berada di rumah dinas Kajatisu ketika dikonfirmasi seputar kasus itu enggan memberi keterangan. Saat ditanya ada isu-isu yang menyebutkan akibat pencurian itu Kajatisu kehilangan perhiasan emas dan uang seluruhnya bernilai Rp10 miliar lebih, PNS tersebut membantahnya. “Siapa yang bilang barang yang hilang sampai begitu banyak. Kami saja tidak tahu barang apa yang hilang, apalagi nilainya. Untuk lebih jelas, konfirmasikan saja kepada humas Kejatisu karena kami tidak berwenang memberikan keterangan,” ujar mereka. Kapolsek Medan Baru AKP Dony Alexander, SH,SIK saat dikonfirmasi mengatakan, sejumlah saksi sudah diambil keterangan dan pemeriksaan saksi akan bertambah. Menurut Dony, polisi menemukan barang bukti yang ditemukan dari rumah dinas Kajatisu yakni, dua obeng besar bergagang merah, obeng kecil warna kuning, sepasang sandal warna putih merek Sky Way,

Ditpolair Sumut Tangkap 1.000 Ton Minyak BELAWAN (Waspada): Direktorat Polisi Air Sumatera Utara atau Ditpolair Sumut menangkap satu unit kapal tangker Cosmic II berisi 1000 ton minyak bakar jenis MDO (Motor Diesel Oil) saat berada di perairan Kwala Tanjung, Kab. Asahan, Senin (22/8). Dirpolair Sumut Kombes Ario Gatut Kristianto melalui Kapten Kapal Anis Madu Iptu Jimmy Pakpahan mengatakan, minyak tangkapan itu merupakan pesanan PT Inamul yang dibeli PT Petro Bas dari Singapura. “Jadi minyak pesanan PT Inalum untuk kebutuhan mesin- mesinnya,” kata Jimmy. Diduga semua minyak itu ilegal dan untuk meluluskannya masuk ke wilayah RI, minyak MDO itu disebut minyak solar saat pemilik membayar pajak impornya di kantor Bea dan Cukai (BC) Batam sebesar Rp764 juta. Belum ada yang ditetapkan sebagai tersangka dalam kasus itu, namun polisi telah meminta keterangan dari nakhoda James Salam, warga Surabaya, dan menahan kapal tangker Cosmic II beserta muatannya. “Kita menemukan adanya perbedaan jenis minyak yang dalam dokumen pembayaran pajak disebut minyak solar,” tutur Jimmy. Rencananya, Rabu (23/8) hari ini, penyidik dari Ditpolair Jakarta akan datang untuk menyidik permasalah yang diduga melanggal pasal 103 c dan h UU N0 17 tahun 2006 tentang pabean itu. “Jadi penyidiknya langsung dari Jakarta dan kita tunggulah hasilnya setelah mereka datang,” ucap Jimmy. Minyak bakar jenis IDO dan MFO digunakan pada mesinmesin diesel putaran sedang atau lambat (300-1000 rpm) atau dapat juga sebagai bahan bakar untuk pembakaran langsung dalam dapur-dapur industri. (h03)

sepotong kain warna hijau kotak-kotak, baju kaos warna biru tua, sarung bantal warna liris-liris, tangga alumanium. Kerugian Rp27 Juta Sementara menurut informasi, kerugian akibat pembobolan rumah dinas Kajatisu di Jalan Listrik, Medan Baru, pada Minggu (21/8) pagi, hanya berkisar Rp27 juta, tidak sampai puluhan miliaran rupiah seperti yang disebut-sebut. Kajatisu AK Basumi Masarif membenarkan pihaknya kehilangan perhiasan, jam tangan, dan uang akibat pembobolan pintu kamar pribadi dan pintu lemarinya. Namun, Kajatisu mengatakan kerugian yang dialaminya ditaksir hanya berkisar Rp27 juta. “Tidak benar kerugian ataupun kehilangan akibat pencurian tersebut mencapai miliaran rupiah bahkan ada yang menyebutkan mencapai Rp10 miliar.

Namun saya tidak menyangkal ada kehilangan perhiasan, jam tangan, dan uang,” ujar Basuni, Selasa. Begitupun, katanya, agar tidak terjadi kesimpang siuran data yang diterima oleh wartawan, hal ini telah kita serahkan kepada Humas Kejatisu Edi Irsan sehingga dapat diketahui kejadian yang sebenanrya ataupun kerugiannya. Sedangkan Humas Kejatisu Edi Irsan mengatakan, bahwa kasus ini telah diserahkan ke pihak kepolisian untuk mengidentifikasi pelaku, mulai orang terdekat sampai dengan kemungkinan-kemungkinan yang terjadi. “Soal kerugian yang dialami Kajatisu atas dibobolnya rumah dinasnya tidak mencapai miliaran rupiah melainkan ditaksir sekitar Rp27 juta yang berupa uang, perhisan, dan jam tangan,” ujarnya. Pencurian di rumah dinas

Pemko Tertibkan Gepeng MEDAN (Waspada): Dinas Sosial dan Tenaga Kerja (Dinsosnaker) Kota Medan melakukan penertiban terhadap gelandangan dan pengemis (gepeng) di sejumlah persimpangan, Selasa (23/8). Tim dipimpin Plt. Kadisosnaker Kota Medan Marah Husin Lubis didukung dua truk Satpol PP, personel Polresta Medan dan bus Balai Pelayanan Sosial Keliling (BPSK) Provsu mengawali razia di kawasan Titi Kuning persimpangan Jln. Brigjend Katamso - Jln Tri Tura. Dari lokasi itu, tim hanya menurunkan beberapa petugas Satpol PP. Melihat hal itu, gepeng langsung melarikan diri. Selanjutnya, tim menuju persimpangan Jln. Halat – Jln. Ir. H. Juanda – Jln. SM Raja. Di lokasi ini, sejumlah gepeng juga mela-

rikan diri setelah mengetahui kedatangan petugas. Padahal, di lokasi tersebut telah ditempatkan tiga petugas Satpol PP. Namun mereka terkesan tidak melakukan pengawasan karena masih ditemukan gepeng di lokasi tersebut. Razia dilanjutkan ke persimpangan Aksara. Namun, saat tim melewati kawasan Pasar Sambas persimpangan Jln. Pandu – Jln. Asia, terlihat sejumlah gepeng tertidur sembari meminta-minta kepada pengguna jalan. Anehnya, petugas Sat Pol PP tidak mengambil tindakan. Di persimpangan Aksara, tim mengamankan dua gepeng yang membawa bayi dan balita. Gepeng tersebut langsung diangkut ke truk Satpol PP Kota Medan untuk dibawa ke Balai Sosial Pemprovsu.

“Kita fokus pada gepeng yang membawa anak-anak saja. Sebenarnya, penertiban kali ini bersifat monitoring saja. Selain itu, petugas mengingatkan gepeng agar tidak mengulangi perbuatannya. Itu saja yang kita fokuskan hari ini,” kata seorang petugas. Ditempat terpisah, Kasatpol PP Kota Medan Kriswan mengatakan, penertiban sudah dilakukan sebelumnya. Dalam penertiban kali ini, petugas diminta hanya mengingatkan pada gepeng dengan cara persuasive, jika perlu diambil tindakan saat menemukan gepeng di jalanan. “Kalau menemukan ada gepeng, ya bisa saja diangkut. Tapi kita minta kepada petugas khususnya Satpol PP untuk memberi tindakan persuasif,” tegasnya. (m50)

ICMI: Lestarikan Nilai Budaya Melayu MEDAN (Waspada): Ikatan Cendikiawan Muslim Indonesia (ICMI) Organisasi Daerah (Orda) Medan mengajak generasi muda muslim melestarikan nilai-nilai budaya Melayu yang sangat kental dipengaruhi peradaban Islam. Hal itu dikatakan Ketua ICMI Orda Medan Indra Sakti Harahap ST, MSi pada acara buka puasa bersama di kediaman Wakil Ketua ICMI Medan

T. MiraRosana Sinar di Jln. Abdullah Lubis Medan, Sabtu (20/8). Selain Indra Sakti Harahap, turuthadirSekretarisICMIMedan Faisal Kurnia Siregar,Wakil Ketua Nuzuliaty Madjid, beserta puluhan pengurus dan kader organisasi satuan (Orsat) ICMI dari 21 kecamatan di Medan. Pada kesempatan itu, Indra Sakti Harahap didampingiWakil Ketua ICMI T Mira Sinar mengunjungi perpustakaan Lem-

Sopir Angkot Dibacok MEDAN (Waspada): Sopir angkutan kota (angkot) Perri Sitepu, 25, warga Desa Baru, Kec. Pancurbatu, dibacok temannya sesama sopir di terminal Pancurbatu, Minggu (21/8) malam. Akibatnya, korban dilarikan ke rumah sakit akibat luka bacok pada bagian telinga belakang dan kening. Informasi diperoleh di Mapolsek Pancurbatu, sebelum kejadian tersangka berinisial R mendahului angkot yang dikemudikan korban Perri yang saat itu mengantri menunggu penumpang, secara ugal-ugalan. Setelah sampai di terminal, korban Perri duduk di warung. Tidak lama kemudian angkot yang dikemudikan tersangka masuk ke terminal. Korban dengan perasaan jengkel mendatangi dan menanyakan maksud tersangka di tengah jalan tadi. Tersangka tidak senang sehingga terjadi pertengkaran diantara sesama sopir angkot itu. tiba-tiba tersangka R turun dari angkotnya sambil memegang parang membacok korban. Akibatnya, Perri mengalami luka pada telinga belakang dan keningnya. Usai membacok korban, tersangka melarikan diri. Sedangkan korban yang bersimbah darah lansung dilarikan ke Puskesmas Pancurbatu. Namun, karena luka yang dideritanya cukup parah korban dirujuk ke RSUP H Adam Malik. Sementara keponakan korban, Anugrah Bastanta Sembiring, 17, membuat laporan pengaduan ke Polsek Pancurbatu. Kapolsek Pancurbatu AKP Ruruh Wicaksono, Sik.SH.MH melalui Kanit Reskrim AKP Simon R Kendek, SH saat dikonfirmasi membenarkan kejadian itu. “Pelaku pembacokan masih kita buron,” kata Simon. (chr)

Kajatisu itu diketahui, Minggu (21/8) pukul 06:30, ketika penjaga rumah Azrai Sirait alias Ai bangun tidur. Awalnya dia tidak melihat lagi sandal yang terletak di depan pintu dapur. Dia kemudian mencari sandal tersebut dan menemukan di bawah kamar mandi belakang kamar utama Kajatisu. Azrai lalu melihat kaca kamar mandi dan kawat nyamuk telah terbuka. Selanjutnya dia melaporkan kepada piket rumah dinas bernama Arifin Pane dan A Moses Ginting. Kemudian Ai bersama Pane mengecek kamar utama Kajatisu yang saat kejadian tidak berada di rumah dinasnya, dengan membuka pintu kamar pakai kunci yang dipegang Ai. Keduanya masuk ke dalam kamar mandi melihat kaca dan kawat nyamuk terbuka. Namun tempat tidur dalam keadaan rapi. (m36/m38)


Ketua ICMI Orda Medan Indra Sakti Harahap, ST, MSi didampingi T. Mira Sinar yang juga Wakil Ketua ICMI Medan dan sejumlah pengurus melihat salah satu buku budaya Melayu karya almarhum T. Luckman Sinar, SH.

baga Kajian Melayu yang berisi 5.000 judul buku koleksi T Luckman Sinar, SH. Sebagian besar buku tersebut berisi tentang sejarah dan peradaban empat kerajaan besar Melayu di pesisir Pantai Timur dan lainnya. Para pengurus juga meninjau lokasi sanggar kesenian tari dan musik yang dibina T Mira Sinar. Saat itu, Mira Sinar beserta anggota sanggar menampilkan tari-tarian. Kepadawartawan,IndraSakti menyatakan salut dan bangga terhadap kepedulian T Luckman Sinar terhadap kebudayaan bangsa di Sumatera Utara khususnya budaya Melayu pesisir Pantai Timur yang sangat kental didominasi peradaban Islam. Peradaban Melayu, menurut Indra, merupakan peradaban nusantara terbesar dan termasyhur hingga ke mancanegara seperti Spanyol serta kawasan Timur Tengah. Namun peradaban Melayu tersebut seakan telah luntur diterpa derasnya arus globalisasi. Karena itu, Indra Sakti mengajak generasi muda Islam khususnya di Medan untuk kembali melestarikan nilai-nilai budaya Melayu yang sangat kuat dipengaruhi budaya Islam agar dapat membentengi diri dari serangan budaya asing yang tidak sesuai dengan etika dan moral bangsa. Sementara itu T Mira Sinar memberikan apresiasi kepada Ketua ICMI Medan yang peduli terhadap karya ilmiah berisi tentang kebudayaan Melayu serta etnis di Sumatera Utara saat berkunjung ke perpustakaan almarhum T. Luckman Sinar. (m40)


TES KESEHATAN SOPIR : Robert Sinulingga, 36, sopir bus Antar Kota Antar Provinsi (AKAP) menjalani tes kesehatan Posko Kesehatan Terminal Amplas Medan, Senin (22/8). Tes kesehatan tersebut ditujukan untuk memeriksa kondisi kesehatan sopir agar bebas alkohol sehingga memberi kenyamanan dan keamanan kepada penumpang angkutan Lebaran.

Jannet Steele Apresiasi Kebebasan Pers Di Indonesia MEDAN (Waspada): Profesor jurusan jurnalistik pada program media massa dan hubungan masyarakat di George Washington University, AS, Jannet Steele memberikan apresiasi terhadap kebebasan pers di Indonesia. “Penyajian berita di media-media Indonesia semakin hari semakin baik dan mengalami perubahan yang cukup signifikan,” ujar Jannet dalam kuliah umum di hadapan mahasiswa Universitas Sumatera Utara (USU), Selasa (23/8). Dikatakannya, hal ini jauh berbeda bila dibanding pada masa orde baru, di mana media pada waktu itu cenderung tertutup dan kurang agresif dalam mengungkap fakta. Kebebasan pers di Indonesia juga ditandai dengan semakin banyaknya muncul media cetak maupun online yang cenderung lebih digemari oleh generasi muda. “Media online di Indonesia sudah dapat dijadikan kekuatan untuk melakukan suatu perubahan. Melalui media online, pembaca juga dapat berinteraksi langsung dengan

pembuat berita,” ucapnya. Dijelaskan Jannet, di era kebebasan pers saat ini, para jurnalis Indonesia diharapkan lebih memahami sembilan elemen jurnalis yang merupakan hasil pemikiran dari jurnalis Amerika, Bill Kovach. Sembilan elemen jurnalis itu adalah kewajiban mencari kebenaran, loyalitas utama kepada warga negara, disiplin verifikasi, menjaga independensi dari obyek liputan, menjadi pemantau independensi kekuasaan, memberikan forum bagi publik untuk saling kritik, membuat hal penting menjadi menarik dan relevan, menulis berita komprehensif dan proporsional, serta jurnalis harus mendengarkan hati nurani personalnya. “Elemen-elemen itulah yang harus benarbenar dipahami oleh setiap jurnalis di manapun merekaberadadalammeliputdanmembuatberita. Selain itu, jurnalis juga harus senantiasa mematuhi kode etik jurnalistik yang diterapkan pada masingmasing negara,” tutur Jannet. (m33/chr)

Program KB Tidak Ada Hasil MEDAN (Waspada): Komisi A DPRD Medan menyebutkan anggaran yang dikucurkan untuk Badan KB dan PP Kota Medan tidak digunakan secara maksimal. Hal ini terlihat kinerja program KB di Kota Medan tidak ada hasilnya. Ketua Komisi A DPRD Medan Ilhamsyah mengatakan, Selasa (23/8), dilihat dari laju pertambahan penduduk Kota Medan, mengindikasikan program KB di kota ini tidak jalan. “Sejauh ini saya melihat program KB hanya diprioritaskan untuk warga miskin. Padahal keluargakeluarga kaya sudah ada kecenderungan untuk menambah jumlah anak,” kata Ilhamsyah. Ketua Komisi A DPRD Medan ini mengkritik Badan KB dan PP Kota Medan karena tidak menunjukkan kinerja yang berarti. Misalnya, jumlah penduduk berdasarkan data statistik dan data kependudukan tidak pernah dijabarkan oleh Badan KB dan PP Kota Medan. “Sejauh ini DPRD Medan khususnya Komisi A tidak pernah mengetahui program KB yang dijalankan Badan KB dan PP Kota Medan,” jelas

Ilhamsyah. Menyoroti KB di kalangan etnis Tionghoa, menurut Ilhamsyah, peran Badan KB dan PP Kota Medan sangat lemah. Lembaga ini belum mampu memberikan sosialisasi kepada masyarakat etnis Tionghoa. Akibatnya, etnis Tionghoa tidak pernah tersentuh program KB. “Sejauh ini, kita tidak pernah tahu berapa sebenarnya laju pertumbuhan atau tingkat kelahiran di keluarga etnis Tionghoa,” tambahnya. Ke depan, Komisi A DPRD Medan mengusulkan perlu adanya evaluasi lebih jauh terhadap kinerja Badan KB dan PP Kota Medan agar lebih dimaksimalkan. Harus ada pembenahan serius terhadap program KB di Kota Medan dan lembaga ini tidak hanya sebatas mengusung jargon-jargon program KB sebagai simbol untuk memenuhi organisasi kelembagaan saja. Karena itu, Wali Kota Medan harus mengangkat Kepala Badan KB dan PP Kota Medan yang mengerti tentang program KB. (m30)

Alwashliyah Dukung Gatot MEDAN (Waspada): Ketua Pimpinan Wilayah Aljamiyatul Washliyah Sumatera Utara Drs H Hasbullah Hadi menyampaikan dukungan Alwashliyah terhadap kepemimpinan Pelaksana Tugas Gubernur Sumut (Plt Gubsu) H Gatot Pujonugroho. Dukungan itu disampaikannya dalam acara berbuka puasa bersama dan perayaan nuzulul Quran keluarga besar Aljamiyatul Washliyah dengan Plt Gubsu di kampus Univa Jalan SM Raja Medan, Sabtu (20/8). Sebagai salah satu ormas Islam terbesar, Aljamiyatul Washliyah selalu mengedepankan maslahat atau kepentingan masyarakat banyak. Karena itu Aljamiyatul Washliyah Sumut selalu mendoakan Plt Gubsu Gatot Pujonugroho untuk senantiasa sukses dalam menjalankan program pembangunan di daerah itu. Untuk merealisasikan harapan itu, Aljamiyatul Washliyah juga siap mendukung berbagai program yang ditetapkan Plt Gubsu Gatot Pujonugroho. Bentuk lain pengabdian Aljamiyatul Washliyah adalah mengirimkan para dai ke daerah di Sumut, bahkan hingga ke Tapanuli Tengah dan Sibolga. Pengiriman itu juga dimaksudkan untuk mendengar aspirasi daerah sebagai bahan acuan dalam membuat kebijakan ke depan. Selepas Ramadhan, Aljamiyatul

Washliyah Sumut akan mengadakan rapat kerja daerah (Rakerda) yang mengacu pada aspirasi daerah tersebut. “PW Aljamiyatul Washliyah punya kebijakan dan program yang bukan ditentukan satu orang tetapi kolektif oleh 99 pengurus,” kata Hasbullah Hadi. Dalam acara itu Plt Gubsu Gatot Pujonugroho mengajak masyarakat untuk kembali menjadikan Alquran sebagai petunjuk untuk keselamatan hidup di dunia dan akhirat. Pihaknya juga berharap umat Islam dapat menjadikan Alquran sebagai acuan dalam bermasyarakat, berpolitik, dan berbangsa. Karena itu, pihaknya mengharapkan Aljamiyatul Washliyah dapat menjadi wadah untuk menyadarkan umat kembali pada keislaman. Sedangkan Ustadz Dr H Azhar Sitompul dalam tausiyahnya mengatakan, kekompakan ulama dan pemerintah (umara) merupakan realisasi dari empat pilar dalam kesuksesan berbangsa dan bernegara. Empat pilar itu adalah ilmu ulama, kebijakan pemerintah, kedermawanan orang kaya, dan doa rakyat miskin. Acara berbuka puasa bersama itu dihadiri sejumlah ulama Aljamiyatul Washliyah, tokoh senior Alwashliyah Prof Maslin Batubara, Rektor Univa Prof Syahrin Harahap, Ketua DPP Sumut H. Fadly Nurzal, SAg, Ketua Fraksi PPP DPR-RI Drs H Hasrul Azwar dan anggota DPRD Sumut.(m28)

Luar Negeri

WASPADA Rabu 24 Agustus 2011


Tersangka Pemberontak Bunuh Dua Orang Di Thailand Selatan

Banjir Landa Bangladesh, Satu Juta Orang Terlantar

PATTANI, Thailand (AP): Polisi mengatakan tersangka pemberontak Muslim membunuh dua tentara dan mencederai 14 lainnya dalam dua peristiwa terpisah di daerah bergolak Thailand Selatan. Kol.Pol.SompornMeesukmengatakansatubomjalaandiprovinsi Pattanimenewaskanseorangperwiramiliterdanmencederaidelapan petugas lainnya, dua bikshu Buddha dan tiga warga sipil. Somporn mengatakan bom tersebut meledak ketika sejumlah petugas ditemani biarawan ke satu upacara Selasa (23/8) fajar. Kol. Pol. Kritsada Kaewjandee mengatakan tentara lainnya tewas dan seorang lainnya cedera di provinsi Yala Selasa ketika bom jalanan meledak ketika mereka berjalan kaki melintasinya. Lebih dari 4.700 orang tewas di provinsi berpenduduk Muslim diThailandSelatansejakmeletusnyapemberontakanIslam2004.(m10)

TOKYO,Jepang (AP):SeorangmentericabinetJepangmengatakan, negara itu akan punya PM baru pada awal minggu depan. PM Naoto Kan menghadapi tuntutan untuk mundur di tengah-tengah kecaman terhadap upayanya dalam menangani krisis nuklir akibat gempa bumi dan tsunami 11 Maret lalu. Menteri Perekonomian KaoruYosano mengatakan, Kan memberitahu para anggota kabinet Selasa (23/8) bahwa masa jabatannya tinggal hitungan hari dan mereka diminta untuk siap menerima surat pengunduran dirinya Selasa depan. Parlemen dijadwalkan akan menyerahkan dua RUU penting untuk disahkan Kan pada Jumat. (26/8). Sejumlah polling memperlihatkan dukungan terhadap Kan telah turun di bawah 20 persen. Kelompok kritisi menuduhnya tidak cakap sebagai pemimpin dan para penyintas bencana mengeluhkan usaha pemberian bantuan yang terkesan lamban. Mantan Menlu Seiji Maehara dipavoritkan sebagai penggantinya. Dia diperkirakan ikut serta dalam pencalonan pemimpin partai itu Senin.(m23)

DHAKA, Bangladesh (Antara/AFP): Banjir yang melanda Bangladesh Baratdaya menggenangi tanah pertanian, menyebabkan hampir satu juta orang terlantar, banyak yang terdampar di tanggultanggul tanpa ada pangan atau tempat penampungan, kata para pejabat, Selasa (23/8). Hujan lebat dalam beberapa hari belakangan ini menyebabkan sedikitnya lima sungai meluap, menggenangi lebih dari 1.000 km persegi tanah pertanian di distrik terpencil Satkhira. “Hampir satu juta orang terkena dampak banjir di Satkhira. Di antara mereka, 120.000 orang kehilangan tempat tinggal,” kata administrator distrik itu M.Abdus Samad. Pemerintah meningkatkan usaha-usaha pertologan di daerah itu, kata Samad dan menambahkan mereka yang kehilangan tempat tinggal ditampung di jaringan 284 pusat pertolongan sementara dan menerima bantuan darurat. Lebih dari 1.500 ton beras dan sejumlah besar biskuit bergizi tinggi telah didistribusikan oleh para pekerja pemerintah ke para keluarga yang terlantar, katanya. Program Pangan Dunia (WFP) PBB juga memberikanbantuanpangandaruratkepada57.000orangyangterkena dampak banjir di Satkhia, kata badan pangan itu dalam satu pryataan. “Sejumlah besar dari orang miskin terdampar di tanggul-tanggul, dengan tidak ada akses pada makanan dan tempat penampungan,” kata Michael Duford, penjabat DirekturWFP negara itu. Bangladesh memiliki lebih dari 200 sungai dan secara reguler banjir dalam musim hujan Juni sampai September. Negara itu menerima sekitar 80 persen dari curah hujan tahunannya dalam musim hujan , ketika air hujan lebat meluap dari dua sungai Himalaya— Gangga dan Brahmaputra— yang menimbulkan banyak sungai lokal meluap. Bulan lalu, 21 orang tewas dan 400.000 orangterdamparakibatbajirbandangdantanahlongsordBangladesh tenggara.Pada tahun 2007, dalam episode paling baru banjir menimbulkan banyak korban, hampir 1.100 orang tewas dan lebih dari 2,5 juta orang terlantar.

Pasukan Syria Bunuh 7 Orang Setelah Kunjungan Tim PBB

100 Pemberontak Kurdi Tewas Dibom Jet Turki

Jepang Segera Punya PM Baru

BEIRUT, Lebanon (AP): Pasukan keamanan Syria membunuh sekurang-kurangnyatujuhorangdisatupusatkotabergolakmenyusul kunjungan para anggota dari satu tim kemanusiaan PBB, kata sejumlah aktivis Selasa (23/8). Sementara itu, Badan HAM-PBB melakukan pemungutan suara Selasa menuntut agar Syria mengakhiri penumpasan berdarah dan bekerjasama dengan satu penyelidikan internasional tentang kemungkinan telah melakukan kejahatan terhadap kemanusiaan. PBB mengatakan angka kematian secara keseluruhan dalam aksi penumpasan yang dilakukan Presiden Bashar Assad terhadap para pembangkang telah mencapai 2.200. Tujuh orang tewas Senin, empat di antaranya menghembuskan nafas terakhirnya ketika pasukan Syria melepaskan tembakan untuk membubarkan protes anti-pemerintah di Homs. Para pemrotes berkumpul di lapangan utama kota sebelum kedatangan tim kemanusiaan PBB. Beberapa rekaman video amatir yang dimuat di dalam jejaring online oleh para aktivis menunjukkan kerumunan massa mengerumuni sejumlah mobil berbendera biru PBB, sambil mengibarkan spanduk yang bertulisan ‘SOS’ dan ‘Kami tidak akan pernah berhenti sampai kami memperoleh kebebasan.’ (m10)


PARA anggota Parlemen India dari berbagai partai oposisi memegang plakat dan meneriakkan slogan-slogan dalam satu protes menentang korupsi dan mendukung rancangan UU di parlemen yang bersidang di New Delhi, India, Selasa (23/8). PM India Manmohan Singh menyerukan dilakukannya pertemuan semua partai Rabu untuk mengusahakan penghentian protes yang terjadi di seluruh India yang dipimpin oleh Anna hazare, 74, yang kondisi kesehatannya makin mencemaskan karena dia menolak makan. Protes mogok makan ala-Gandhi itu telah memasuki pekan kedua.

MILF Tolak Usul Damai Filipina MANILA, Filipina (AP): Kelompok pemberontak Muslim terbesar Filipina menolak satu usul pemerintah untuk menerima otonomi di selatan negara tersebut dan menyebut usulan tersebut tidak sesuai, namun mengatakan Selasa (23/8) mereka akan melanjutkan perundingan.


PARA penari tradisional Thailand berfoto bersama dengan patung lilin terbaru dari aktor terkenal dari Bollywood, Amitabh Bachchan, dalam satu acara di Musium Patung Lilin Madame Tussaud di Bangkok, Thailand, Selasa (23/8).

Gema Internasional

Para wakil dari Front Pembebasan Muslim Moro (MILF) bersikeras dengan bentuk ‘substate’ untuk kalangan minoritas Muslim, demikian menurut kepala perunding pemerintah Marvic Leonen kepada wartawan dalam video konferensi dari Kuala Lumpur, Malaysia, di mana pembicaraan diadakan. Posisi pemerintah, minta dihilangkan kata‘substate’ karena itu akan memerlukan perubahan Konstitusi Filipina, kata Leonen. Diamengatakanusulpemerintah berisi otonomi namun pemberontak yakin hal itu jauh dari cukup. Wakil Ketua Pemberontak Ghadzali Jaafar memberitahu televisi ABS-CBN bahwa usul pemerintah ‘tidak memenuhi isu sesungguhnya.’ “Kami ingin pertama memenuhi isu politik,” katanya.“Ini adalah problem politik, bukan problem ekonomi. Kami bukan berbicara di sini tentang pembaruan ekonomi, yang tidak ada gunanya jika mereka tidak memberikan satu solusi politik.” Pemberontak sebelumnya mengugurkan tuntutan mereka untuksebuahnegaraterpisahdan mengatakan mereka bersedia untukbekerjadenganpemerintah guna melindungi hak-hak umat

Islam di negara yang didominasi Katholik Roma. Leonen mengatakan dia belummengungkapkanrinciantentang usul pemerintah. Namun, setiap usul akan membutuhkan “persetujuan dari yang diperintah dandalambatas-bataskedaulatan nasional kita, integritas teritorial dan Konstitusi Filipina,” katanya.

Para perunding pemberontak menerima salinan naskah proposal ketika perundingan dibuka di Kuala Lumpur Senin dan memberitahu panel pemerintah Selasa bahwa mereka akan menyarankan agar komite pusat MILF menolak usul itu. “Hal ini tidak biasa dalam negosiasi bahwa salah satu pihak mengambil posisi garis keras terhadap isi dokumen awal pihak lain,” kata Leonen. Dia mengatakan bahwa panelnya akan pergi berkeliling Filipina untuk menjelaskan isi posisi pemerintah dan mendapatkan umpan balik lebih

Setiap Tahunnya Hampir 5.200 Anak Jatuh Dari Jendela Di AS BEIJING, China (Antara/Xinhuanet-OANA): Di Amerika Serikat, tingkat cedera yang berhubungan dengan anak-anak dan remaja jatuh dari jendela menurun selama periode 19 tahun terakhir, meski tidak hampir secepat di beberapa kota dengan program pencegahan yang komprehensif, kata temuan para peneliti. Dari 1990 hingga 2008, tingkat keseluruhan cedera pada anak-anak dan remaja adalah 7,3 per 100.000 per tahun, tertinggi 11,4 pada 1992 danterendah5,8pada1999,menurutGarySmithdariInstitutPenelitian di Rumah Sakit Anak Nationwide di Columbus, Ohio. Tingkat tahunan cedera turun sedikit tetapi secara signifikan selama masa studi, didorong sepenuhnya oleh pengurangan 0,426 kasus per 100.000 per tahun pada anak-anak hingga usia empat tahun, kata para peneliti dalam laporan online menjelang penerbitan edisi Pediatrics pada September depan. Yang jauh berkurang dari pengurangan tersebut terlihat pada studi program pencegahan jatuh sebelumnya di NewYork dan Boston, yang mencapai penurunan hingga 96 persen selama periode 10 tahun melalui pendidikan, peningkatan akses untuk penjaga jendela, dan mandat untuk menggunakan jendela penjaga di rumah tertentu (hanya di New York City).

ANKARA, Turki (Waspada): Serangan udara yang dilancarkan Turki menewaskan lebih dari 100 pemberontak Kurdi yang tergabung dalam Partai Pekerja Kurdi (PKK) di wilayah Irak. Sekira 80 pemberontak PKK dikabarkan terluka dalam serangan udara tersebut dan 100 orang lainnya tewas. Serangan yang dilancarkan Turki terhadap pemberontak PKK adalah serangan balasan atas tewasnya 13 personel aparat keamanan Turki di bagian tenggara Turki, demikian seperti diberitakan AFP, Selasa (23/8). Meski demikian, kemarin serangan udara Turki yang ditujukan ke pemberontak PKK justru menewaskan tujuh orang warga sipil di Irak yang ada dalam sebuah mobil pickup. Turki pada saat itu mengerahkan enam buah jet tempurnya. Turki pun menargetkan sebanyak 132 serangan ke wilayah tersebut dalam enam hari. Peperangan itu juga akan tetap berlanjut. Sebelumnya pemberontak PKK sempat terlihat menantang Turki. Sebanyak 16 serangan udara pertama Turki yang dilancarkan pada 18 Agustus lalu diduga tidak mengenai pemberontak PBB. Kurdi merupakan salah satu musuh bebuyutan dari Turki. PeperanganTurki dan pemberontak PKK sudah menewaskanbanyak korban. Sekira 40.000 jiwa juga dinyatakan tewas setelah pecahnya bentrokan Turki dan pemberontak PKK pada 1984 silam.(okz)

Mantan PM Thai Bela Kunjungan Kontroversialnya Ke Jepang


Marvic Leonen

lanjut. Dia mengatakan ‘substate’ yang diusulkan pemberontak “memiliki beberapa atribut otonomididalamnya”yangdapat disesuaikan dengan hukum yang ada dan tanpa mengubah konstitusi saat ini. “Kami berpikir bahwa kesenjangan dapat dipersempit dan itu tidak terlalu jauh,” katanya kepada wartawan di Kuala Lumpur. Jaafar mengatakan perundingpemberontakmenginginkan pemerintah agar mengomentari proposal mereka yang diajukan awal tahun ini dan “tidak untuk mengajukan kerangka kerja atau proposal yang sama sekali berbeda.” (m10)

TOKYO, Jepang (AP): Buronan mantan pemimpinThaiThaksin Shinawatra membela kunjungan kontroversialnya ke Jepang Selasa (23/8) dengan mengatakan dia ingin mendukung negara terkena bencana itu yang membantu orang sembuh sendiri dari tsunami besar di tahun 2004. “Saya merasa sepertinya saya terikat pada apa yang terjadi di sana, “ katanya tentang kondisi di timurlaut Jepang, di mana dia berencana untuk mengunjunginya pekan ini guna melihat kerusakan yang disebabkan oleh tsunami besar Jepang 11 Maret. Oposisi Thailand telah mengkritik kunjungannya dan menuduh menteri luar negeri negara itu membantu buronan dengan meminta Tokyo agar memberikan visa untuk Thaksin, yang tinggal di pengasinganuntukmenghindarihukumanduatahunpenjarakarenakorupsi. “Datang ke Jepang benar saya sendiri,” katanya di salah satu dari dua konferensi pers yang diadakan diTokyo pada Selasa. Jepang adalah salah satu donor bantuan terbesar setelah terjadi tsunami di Samudera Hindia tahun 2004 yang menewaskan 230.000 orang di berbagai negara, termasuk Thailand. Thaksin, 62, digulingkan sebagai perdana menteri dalam kudeta militer tahun 2006. Dia tetap menjadi sosok yang sangat memecah belah di tanah airnya, di mana dia dipuja oleh rakyat miskin, tetapi tidak dipercaya oleh elit mapan, termasuk militer. (m10)

AS Imbau Vietnam Bebaskan Para Pemrotes Anti-China HANOI, Vietnam (Antara/AFP): Amerika Serikat Selasa (23/ 8) mengimbau pembebasan para pemrotes yang ditahan ketika pasukan keamananVietnam membubarkan unjuk rasa akhir pekan lalu terkait tindakan-tindakan Beijing di Laut China Selatan. “Kamikhawatirdenganpenahananbeberapaorangyangtampaknya mengutarakan pandangan-pandangan mereka secara damai,” kata seorang jurubicara Kedutaanbesar AS. “Kami mengimbau kepada peme-rintahVietnam agar membebaskan semua orang yang ditahan karena melaksanakan hak-hak asasi manusia mereka dan kebebasan dasar. Sebuah surat kabar resmi polisi memberitakan, Senin 47 orang ditahan pada unjuk rasa Ahad di tengah kota Hanoi. Para pemrotes berkeberatan “invasi” China atas perairan yang kedaulatannya disengketakan kedua negara.

Pengadilan Turki Ala Drama Film Hollywood BEGITU banyak sidang pengadilan di Turki kelihatannya menyerupai atau mirip drama film Hollywood dalam legitimasi proses pengadilan. Dalam drama film Hollywood sidang pengadilan, anda mengetahui bahwa sang hero di-set up sebagai seorang yang buruk, akhirnya sang aktor dinyatakan bersih – tidak seperti digambarkan sebelumnya sebuah jerat diikatkan ketat di lehernya. Sepertinya terlihat sajian bukti atas perbuatan yang diakumulasikan dengan tuduhan terhadap dirinya. Tibatiba mengubahnya dengan pembuktian menjadi tidak bersalah dan diekspos siapa yang melakukan jebakan. Jika militer Turki yang sedang berkemas meninggalkan pentas politik kekuasaan yang selama ini mereka genggam, para pembangkang atau kelompok oposisi diajukan ke pengadilan kemudian ditayangkan dalam film layar lebar atau layar kaca televisi. Keputusan pengadilan sudah dapat diduga: pengadilan Turki telah memenja-

rakan ratusan tertuduh – para perwira militer, wartawan, akademisi dan pengacara hukum. Menurut dugaan para perwira tinggi militer diam-diam merencanakan untuk menjatuhkan pemerintahan yang dipilih dengan demokratis. Perdana Menteri Turki Recep Tayyip Erdogan mengembangkan sidang-sidang peradilan sebagai bukti perubahan Turki menuju demokrasi dan rule of law. Sidang pengadilan ini pun didukung oleh media milik Fetullah Gülen yang juga seorang tokoh agama. Gülen dan para pengikutnya merupakan pendukung kuat pemerintahan Erdogan. Pada realitasnya, sidang pengadilan era kekuasaan di tangan militer lebih banyak menggambarkan pelanggaran hukum dan pengadilan mentransformasikan dalam bentuk atau sebagai senjata politik yang ditujukan pada kelompok oposisi atau penentang pemerintah dan gerakan atau kegiatan kelompok Gülen. Kasus yang dipertontonkan oleh pengadilan di atas lebih

semarak disebut sebagai comical show yang sengaja diciptakan oleh penguasa militer dan disebarluaskan ke seluruh negeri. Settingnya disusun ada sekitar 200 perwira militer yang dituduh merencanakan kudeta tahun 2003 guna menggulingkan pemerintahan yang baru terpilih. Sepertinya para jaksa penuntut memiliki bukti yang solid: perencanaan yang detil disusun dengan karanganyangmenarikolehpara tertuduh,menggambarkanoperasi militer yang menakutkan untuk membuat negaradalamkeadaan yang tidak stabil. Para opsir militer yang menjadi terdakwa menyatakan mereka tidak bersalah dan menegaskan bahwa dokumen kudeta yang dibacakan adalah palsu. Pengadilan juga memiliki peran yang mereka persiapkan sebagai movie-ending. Beberapa terdakwa menyatakan bahwa mereka sedang di luar negeri dan tak memiliki akses pada komputer, bagaimana mungkin mereka menyusun rencana seperti dituduhkan oleh jaksa penuntut.Terdak-

wa lainnya bahkan telah salah menyebutkan nama dan jabatan mereka. Dua laporan forensik telah diciptakan bahwa tulisan tangan di dalam CD dipalsukan. Lihatlah betapa hebatnya permainan di dalam sidang pengadilan era Turki di bawah para perwira tinggi militer.Para opsir muda ini dituduh telah mencuri rahasia negara. Rahasia negara ditemukandirumahparaterdakwa, tetapi polisi melakukan kesalahanelementerdenganmenyusun sebuah setting: seharusnya digeledahrumahAhmadA,tetapiyang digeledah polisi justru rumah Ahmad B. Padahal Ahmad B telah mencekam dalam penjara lebih dari sembilan bulan. Sebagaimana digambarkan dalam film Hollywood, dan gambarannya seperti terjadi di pengadilan Turki, pengadilannya kurang pehatian pada masalah bukti yang disajikan oleh polisi dan jaksa penuntut, namun kasus yang lucu ini dilanjutkan. Para penonton atau masyarakat awam bersemangat melihat putusan apa yang akan dijatuh-

kan pada terdakwa. Bahkan media massa tidak menginformasikan inkonsistensi proses sidang pengadilan, atau dengan kata lain penuh dengan bermacam keganjilan. Kasus perwira muda akhirnya digugurkan dengan petimbangan banyaknya kemustahilan muncul dalam sidang perkara kudeta terhadap pemerintah. Peristiwa sandiwara pengadilan seperti terjadi di Turki adalah gambaran yang bisa disepakati bahwa umumnya di negara-negara yang pemerintahannya dikuasai oleh militer, penegakan hukum sesuai dengan selera penguasa. Maksudnya, praktek totalitarianisme oleh militer bisa dipandang sebagai pengukuhan kelanjutan kekuasaan memimpin negara. Namun diakui pula tidak semua pemimpin negara atau pemerintahan dari kalangan militer berperilaku buruk, ada satu dua yang memimpin negara sesuai demokrasi yang diinginkan rakyat. Dan mereka mendapat dukungan rakyat sepenuhnya. (Kosky)

Press TV

SUASANA di Jerusalem seperti ditayangkan Press TV Senin (22/8) dalam berita tentang aksi pembersihan etnis yang dilakukan Israel.

Israel Lakukan Pencucian Etnis, Segera Usir 384 Aktivis Palestina JERUSALEM (Waspada): Pemerintah Israel berencana akan mengusir 384 aktivis Palestina yang ada di Jerusalem Timur karena aktivitas mereka dinilai mengganggu. Beberapa aktivis menyatakan, mereka dikontak oleh otoritas Israel dan diancam akan diusir dari kota tersebut setelah bulan suci Ramadhan. Tindakan Israel dinilai oleh beberapa pengamat politik seperti akan melakukan pembersihan etnis di Yerusalem terhadap populasi warga Palestina, demikian seperti diberitakan IMEMC, Selasa (23/ 8).SeorangaktivisPalestinaAhmadRafeeqmenyata-

kan, pengusiran aktivis Palestina juga merupakan langkah Israel untuk meYahudikanYerusalem. Israel juga dinyatakan akan menghancurkan perumahan milik warga Palestina di Jerusalem Timur. Selain itu, Israel juga akan memperluas proyek pemukimannya dan proyek ini sudah dikecam banyak negara. Jerusalem Timur merupakan kota yang akan menjadi ibukota Negara Palestina di masa yang akan datang, dengan adanya proyek pembangunan pemukimanYahudi hal ini akan semakin memperpanas hubungan Israel dan Palestina.

A8 1 CM 2 CM


Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000


AUTOMOTIVE Informasi Pembaca


Bursa Automotive : Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower


: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

BMW 320i Limited Edition Th. 95. Mulus, S. Pakai. Hrg. 59Jt. Nego. Hub. 0821 6212 8233 PROMO LEBARAN !!! Ready Stock: Xenia, Luxio, Pick Up, All New Sirion, Bunga Ringan & Proses Cepat. Hub. FAJAR : 0813 9600 0319/0852 9641 9885



Ready: ALL NEW SIRION, XENIA, LUXIO & PICK UP Bunga Ringan & Proses Cepat Hub. Yusuf 0852 6168 1210 061 7777 9356

DAIHATSU Taft GT 4x4 Wrn Hitam, Asli Medan Th. 90, mulus, 6 Speed, Ban 31, VR, PS, Jok Hdp Depan, sound Power, AC Dingin, Hrg. 49Jt. Nego. Hub. 0821 6246 7871 DAIHATSU Espass Minibus Thn. 96. Biru metalik, body mulus, ban baru. AC Dingin Rp. 36 Jt/Nego. Hub. 0812 6344 5757

DAIHATSU Taruna CSX thn. 1999/2000. warna biru/silver, BK asli Medan. Mobil bagus hubungi: 0853 7099 2910 / 0812 6371 045

DAIHATSU Xenia Li DLX Family VVT-i 2006, w. Aqua Blue. Mobil siap pakai, VR, BR, Hub. 0812 6425 379

5 CM 6 CM

Rp. 65.000 Rp. 78.000


Mulus. W. Biru tua met, BK Medan, lengkap, siap pakai. H. 50Jt. Nego. Balik DP 30Jt. Sisa 24 x Satu juta seratus empat puluh ribu. Hub. 0812 6477 946


MITSUBISHI Baru Pajero Sport. Strada Triton, Colt Diesel, Fuso, L-300 dan T-120 dengan Bunga O%, DP Mulai 15%. Persyaratan Mudah. Data dijemput dan Diskon Menarik. Hub.

7 CM 8 CM

Rp. 91.000 Rp. 104.000


HUB: TOMMY 0813.7043.7766

Heskel Tampubolon 0821 6652 9982 / 0878 6842 2332 Ayub Supriadi S Meliala 0813 9773 2729 Bobby Darmawan 0852 9786 9557

TOYOTA Kijang Capsul Model LGX New Bensin 1,8 Th. 2003. Biru mika, sgt terawat, VR, BR, PS, PW, CL, Rmt, E.Miror. AC DB, S. Sistem pake power dan TV, full Acesories, Hrg. 133Jt. Nego Abis. Hub. 0812 6063 7823

MITSUBISHI Colt T120 SS 1.3cc Minibus w. putih mutiara thn. 95. BK Mdn, AC, Tape, mulus, original. Dijual cepat BU;. Hub. HP. 0852 7618 0616 Medan.

TOYOTA Kijang Super ‘90 akhir,Short, Merah, BK Medan asli, CDI, Cakram, Harga 42 Jt/damai Hub. 0852.9616.5574


TOYOTA Avanza G Thn. 2005. W. Merah, BK Medan, Tgn I. BK Panjang, mulus. Hub. 0852 7617 9979 - (061) 77919728 TOYOTA Innova G Diesel, 05 W. Hitam, BK Medan Tgn. I, Pajak panjang, mulus. Hub. 0821 6717 6723 - (061) 77967599

Ready Stock Grand Livina, March. DP Ringan, Cicilan Ringan, Juke, New X-Trail, Serena. Hub. Rangkuti. 0852 7776 1507

NISSAN X-Trail, Th. ‘04, Type XT, matic, wrn hitam metalic, kondisi istimewa, BK 4 BJ. Mobil ctk sekali, pajak 1 thn, 1 tangan dari baru Rp. 175. Kembar Ponsel Jl. SM. Raja No. 200. 0815 337 336 88 / 7851 402 OPEL BLAZER Lt. DOHC Injection Silver met Th. 96. Sgt orisinil dan mulus, mesin sehat, AC Dingin, asli Medan. Hrg. 45Jt. Nego Abis. Hub. 061.77700712

SUZUKI Forsa 1988, Mulus/ sehat/lengkap, siap pakai. Hub. 0852 7692 5330 (TP)/Neg. SUZUKI SIDEKICK DIJUAL SEGERA Thn. 96. Biru met, AC, Tape, PS, PW, VR, BR, Mobil super mulus. Hrg. 71,5 Jt Damai. Hub. Rumah Makan Surya Baru Jl. Karya No. 90 Sei Agul. 20 Mtr Dari Simpang (4) Lampu Meran.


TOYOTA Kijang LGX Solar, 2001, BK Medan, merah maron, mulus, AC DB, V. Rac. Komplit. Hub. 0853 6142 7881 - (061) 7732 3259 TOYOTA Kijang Inova G 2007 Bensin, Manual, Silver, Pajak panjang, TV 3buah, Mulus, Cantik, Siap pakai BK Mdn Asli Rp. 178 Jt/nego Hub. 0852.9615.1588 TOYOTA Kijang Super ‘91. W. Hijau lumut, mulus, BK Asli Medan, AC, Tape, VR, BR, lengkap, siap pakai. 6 Speed. Harga 42Jt/Nego. Hub. 0812 6477 946



PURBA : 0813 9736 0333

Carry PU 1.5 FD, Rp. 8 Jt-an Angs. 2.672.000,APV Arena Rp. 11 Jt-an Angs. 4.073.000,Splash GL Rp. 13 Jt-an Angs. 4.069.000,Swift ST. Rp. 17 Jt-an Angs. 4.726.000,SX4 Rp. 20 Jt-an Angs. 5.510.000,Hub: 0812 654 0809 / 77722121

TOYOTA BARU 100% Innova Fortuner Model Baru, Avanza, Rush Yaris, Altis, Vios, Camry (Cash / Kredit). Hub. Putra Gea - Toyota HP. 0821 6569 2000

SUZUKI Katana 89” wrn hitam mulus, AC, Tape, VR, BR, Jok rapi, pajak panjang 2012. Hrg. 31Jt Nego. Rumah mewah ukuran 15 x 36M. Lantai 2. Full keramik, lihat fb Hub. 0852 60 79 1969

TOYOTA KIJANG SUPER COMMANDO THN ‘88/89 Abu-abu Metalik, Mulus, AC dingin, Siap pakai, Rp. 42 Jt/nego Hub. 0853.6230.0613

HONDA Jazz RS ‘09. W. Silver, manual, BK Medan, Tgn. I, sgt mulus & terawat. Hub. 0813 7504 1805 - (061) 77323259

SUZUKI Sidekick Drag One ‘97 BK Medan, Warna Silver, Mulus HP. 0812.6501.570

TOYOTA Kijang Super Jantan ‘93, Hijau Metalik, AC, Tape, Siap pakai Hrg 48 Jt HP. 0812.6067.5890

SUZUKI Escudo Thn ‘99 W. Hijau, BK Mdn, Cat dan Mesin mulus, Siap pakai, Hrg nego HP. 0813.7094.4002 0853.6255.5172

TOYOTA Kijang Super G Dijual Segera Thn. 94 Abu-abu met long, AC, Tape, PS, PW, VR, BR, Mobil sangat mulus Hrg. 66 Jt damai. Hub. Rumah Makan Surya Baru Jl. Karya No. 90 Sei Agul. 20 Mtr. Dari Simpang (4) Lampu merah.

ISUZU Panther Hi Gred Th. 1995. BK Mdn W. Biru met. Cat dan mesin mulus, siap pakai. Jual Cepat. Butuh Uang HP. 0811 652 506

SUZUKI Katana Thn 2002 BK Mdn, W. Merah Met, Cat dan Mesin mulus Hrg nego HP. 0821.6021.0957

TOYOTA Kijang Grand Extra Jual Cepat. Thn. 96/ 97 Biru met AC DB, PS, PW, CL, Tape, VR, BR, Mobil sangat mulus, 1 nama. Hrg. 76,5 Jt. Damai. Hub. Rumah Makan Surya Baru Jl. Karya No. 90. Sei Agul 20 Mtr Dari Simpang (4) Lampu Merah.

DAIHATSU Espass Minibus Thn ‘96 (1.6) W. Silver Metalik, AC/ Tape, Pintu sorong, Dijual segera Hub Telp. (061) 7723.0319, TP


Hijau Metalik, BK Medan asli, AC dingin, Tape, Pelak Recing, Body kaleng mulus dan mesin okey Peminat serius hub. 0852.7630.2013, TP

HYUNDAI Atoz Th. 2000. W. Silver met. BK Mdn, Cat dan mesin mulus, siap pakai. Jual Cepat. 0821 6634 4121 - 0852 708 00042

9 CM Rp. 126.000 10 CM Rp. 140.000

11 CM Rp. 165.000 12 CM Rp. 180.000

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

Segala akibat yang terjadi diluar tanggujawab PT. Harian WASPADA. Apabila anda mencurigai sesuatu, silahkan hubungi kami di 061-4576602. Terimakasih



0813.8513.9900 (061) 7500.5003



Warna Silver, BK mutasi, Plk recing, Pajak 7-2012, Mbl siap pakai, Harga 55 Jt HP. 0852.6175.2131 TOYOTA Kijang Capsul Tipe LX Thn 2001 akhir, Asli BK Mdn, Biru Met Hrg 98 Jt/ Telp. 786.3182 HP. 0812.6300.0077 TOYOTA L. Cruiser VS ‘95/96, Abu² Metalik, Jok kulit, Ban baru, BK Blank, Komplit & Terawat Hub. 0831.9968.7342

TOYOTA VIOS LIMO THN 2004 Silver, Plat B, Mulus Harga 79 Jt/nego Hub. 0813.6215.1688

TOYOTA Kijang Commando Long, 6 Speed, Thn ‘92, Hijau Met, Mesin sehat, Body mulus,VR, BR, RTP, AC Dingin, Hrg 50 Jt/ nego Hub. (061) 6967.9753 TOYOTA Kijlang Super Standart Long Biru Met, Thn ‘94 Dasboard sedan, VR, BR, PW, CL, RMT, RTP, AC double, S. Pakai, Hrg 56 Jt/nego Hub. 0821.6811.9388

Proses Cepat, Cair 1 Jam Tanpa Usaha. Jaminan: SHM, SK Camat, BPKB Mobil, Spd. Mtr. Truk. Bantu pelunasan BPKB Mobil/Over Leasing. Bunga Rendah dan Bergaransi. Hub. S8F

0618445 716, 0813 6229 00010813 7044 6633






SEDAN Rp. 600.000 Rp. 900.000 Rp. 1.000.000 Rp. 1.400.000

MINI BUS Rp. 700.000 Rp. 1.000.000 Rp. 1.100.000 Rp. 1.600.000


TOYOTA Innova Thn ‘05 Type G, Bensin, W. Htm Met, Ban besar, Velg hrg 30 Jt, 15”, Pakai TV, Mobil mulus, Ctk sekali, 1 Tangan dr baru, Kembar Ponsel Jl. SM. Raja No. 200 (depan UISU) 0857.6097.8888 / 785.1402

BUTUH DANA Jaminan Apa Saja. Sertifikat Tanah Mobil & Sp. Motor. Segala tahun. Hub. 061.8222 774 HP. 0853.6199.1500-0816 314 1807


1. Sony Vaio Core i3 @ 2.13 Ghz/4/320/VGA Nvidia 2 Gb.........Rp. 3.9Jt 2. Acer 4741 Core i5M430@ 2.27 Ghz/2/500/VGA 1 Gb.............Rp. 4.4Jt 3. Apple Macbook 3.1 Core2Duo@ 2.2 Ghz Ram2 Gb................Rp. 4.3Jt 4.COMPAQ 510 Core 2 Duo T5870 @ 2.0 Ghz/Ram 2 Gb/320 Gb/ VGA 512 kondisi baru 100%....................................................Rp. 3,5Jt 5.ACER Aspire 4930 G Core 2 Duo T9400@ 2,53 Ghz/Ram 4 Gb/ HDD 320 Gb/VGA NVidia G Force 1,5 Gb/14”........................Rp. 3,9Jt 6. Acer Dual Core 1 Gb/250Gb/Webcam......................Rp. 2.2Jt 7. DELL Inspiron 1545 Core 2 Duo T6400@ 2.0 Ghz/1/160/VGA 256/15” Bat ok...Rp. 2.9 Jt 8. ADVAN Van Book D 510 1 Gb/250 Gb/VGA 256/13,1” Baru...Rp. 2,2Jt 9. Note Book XWare Ram 1 Gb/HDD 40 Gb/100% mulus.......... Rp. 1.4Jt 10. N.Book HP Mini Atom Ram 2 Gb/HDD 160/Webcam mls perfect............Rp. 1.9Jt 11. N. Book Yor @ 1.66 Ghz/1/80/Webcam 100% mulus..............Rp. 1,5Jt 12. LCD Projector Toshiba XGA bisa OHP Rp. 3.5Jt. NEC 2500 AL msh baru Rp. 3 Jt. Toshiba/Benq/Epson 2500 Al ...........................Rp. 2.5Jt 13. Print Canon Pixma MX 328 Copy, Scan, Fax. 100 % Baru.......Rp. 1,1Jt ELEKTRONIK BELI HARGA TINGGI Hub. CV CV.. MARKET - Telp. 76324682 - 0812 65393000 Jl. Setia Budi No. 424 B dkt Bank BNI Psr. 4 T. Sari


Laptop, TV, LCD, PS, Ampli, Spk, Kulkas, Projector, Handycam, Camera, AC & Keyboard, dll.

LAPTOP, HANDYCAM, CAMERA, PROJECTOR Handicam Sony Hi-8=1Jt, Mini DV=2Jt, DVD/HDD=3Jt, Camera 5 Mp - 12 Mp 500rb - 1,2Jt. Fax = @ 600rb. LCD Projector Optima, Tosiba @ 3Jt.


Jual AC Baru/Bekas, 1/2, 3/4, 1,1 1/2, 2Pk-1,3Jt-2 Jt. AC Window 1 Pk = 800rb, Kulkas 1 Pt - 2 Pt- 600rb1,2Jt. Freezer Soces. Box=2Jt. M. Cuci 1 Tb- 2 Tb= 600rb1,2 Jt. M. Cuci Baru= 1,2 Jt (2 tb 9 kg). Genset 3000 w. 2Jt. 8.000w= 4jt, Pompa Air. Sanyo, P. Cliner


Hub. 4517509 - 69677449 Jl. Sekip 67 A Jual/Beli/T.T. Baru/Bekas




Hub. Jl. Nibung II No. 114 Medan (Samping Medan Plaza) Telp. (061) 4566884 (Hunting) dekat Carrefour.

DO RE MI JOK MOBIL KHUSUS AVANZA/INNOVA Rp. 1.350.000,Jok (model press) + Alas


BPKB No. D. 9932535-B. BK 4718 UI a/n. HERMANSYAH PUTRA. Hub. 0878 6881 3117 TERCECER 1 (Satu) Buah BPKB Asli, BK 4102 GL (Honda tahun 2003). a/n. PT. Penerbit Erlangga Jalan. Beringin Comp. Wartawan No. 45 Medan.

HILANG Kartu Pelaut / SID atas nama Ferry Harianto dengan nomer Kartu 6201 554169. Bagi yang menemukan Hub. Farry 0821 231 57844


- Satu buah BPKB BK 5938 OK, A/n. Heng Long alamat Jl. Sunggal Gg. Bakul, Lk. XI - Satu buah BPKB BK 178 AW A/n. Elis Tjia alamat Jl. KLY. Sudarso, LK. 14-A, No. 36B - Satu buah BPKB BK 6454 HL, A/n. Elis Tjia alamat Jl. KLY. Sudarso Lk. 14-A No. 36B




JL. S. PARMAN BLOK DD No. 3-4 PETIDAH - MEDAN (DEPAN SEKOLAH ST. THOMAS 2 MEDAN) Telp. 061-4522123, 77602123 JL. MAKMUR No. 10 A, MEDAN (MASUK DARI JL. ADAM MALIK / JL. KARYA) TELP. 061-6639123, 76501123










REPARASI AC, KULKAS, MESIN CUCI Kompor Gas, Dispenser H & C TV, M. Pompa Air Sanyo

Hub. SURYA TEKNIK SERVICE Telp.66482216 - 0813 7589 8757- 082162005114 Siap Ketempat




JUAL BELI AC BEKAS, DLL HP. 0812 6053 690 7352833 0812 6064 9333



WC 0812 642 71725




WC 0812 60444275 WC PAK ADI





0813 6147 0812 Jl. Gatot Subroto Medan Ada Garansi




HUB: (061) 7635.2865 0813.6151.3698

Mobil Toyota Kijang / Super IF 82 Diesel A/n. Nurbayti No. Polisi: BK 1389 MA - No. Mesin: 21-9599214 No. Rangka: MHF 11LF82Y0008485 Didalam tas hitam merek “Elgini” Hub. 0811.6203.698

BPKB No. E. 0243575-B, BK 2268 US, A/n. Lifson Sagala Hub HP. 0813.6234.9630

TIMOR Th.1997. BK Mdn SOHC. W. Biru met. a/n. Sendiri. Jual Cepat Hrg. Nego. Hub. 0821 60210 957


Laptop Acer-Core2, Core3=Dtg nego/ Toshiba + Dvd + Camera =1.9 Jt Projctor 1x Jt, Lcd=550rb _Lcd Tv=795rb, Monitor 195 Rb PART LAPTOP LENGKAP LCD, BATRE, HDD, DVD=JAMIN MURAH Komputer:P4=775rb (Servis-Upg-Jual-beli-TT) PH: (061) 7761.2336 Jl. Rantang20s


TOYOTA Avanza G Over Kredit Thn 2011, Silver Met, Balik DP, 56 Jt/nego Sudah 7x bayar, Sisa 29x 4.691.000 Hub. 0812.6477.7088 TOYOTA Kijang Kapsul LGX Diesel thn. 2000. Plat BK W. Coklat silver lengkap. AC DB, Tape, VR, BR, Remot ban baru, mulus, original. Jok asli BU. Hub. HP. 0852 7600 8094 Mdn.



Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput






Pelanggan Yang Terhormat

HA TI-HA TI terhadap penipuan yang mengatas HATI-HA TI-HATI namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk membeli TI-HA TI apabila anda ingin produk anda, dan HA HATI-HA TI-HATI melakukan transaksi jual beli melalui transfer.

Rabu, 24 Agustus 2011




KENANGA CITI HOTEL My Residence in Medan

Jl. Sisingamangaraja No. 82 Medan Telp. (061) 734.2106




Jl. Karya No.68 Sei Agul Medan Telp. 061-663 9308, 7700 9000 HP. 0813 70900 400, 0852 6144 8000 0816 301 761



Mau Menjual Rumah, Tanah, Kendaraan, Barang Kerajinan Tangan atau Barang Dagangan Lain? Ya Tentu...Pasang Iklan di... Surat Kabar Tercinta:


WASPADA Untuk informasi lebih lengkap hub

TEL. (061) 4576602 FAX. (061) 4561347



WASPADA Rabu 24 Agustus 2011

07.00 Sinema 09.00 Dahsyat 11:00 Infotainment INTENS 12:00 Seputar Indonesia 12:30 Sinema Siang 14.30 Cek & Ricek 15.00 Seputar Indonesia 15.30 Silet 16.00 Cerita Anak Langitan 16.30 Larva 16.55 Masterclass Ramadhan 16.45 Cerita Anak Langitan 17.40 Kultum 17.30 Dari Sujud ke Sujud 19.00 Mega Sinetron : Putri Yang Ditukar 20.30 Anugerah 22.30 Konser Kemuliaan Ramadhan 00.30 Seputar Indonesia Malam 02.00 Santri Jojo 02.30 Sahur Semua Sahur


07.00 Inbox 09:03 Halo Selebriti 10:00 SCTV FTV Pagi 11:00 SL Liputan 6 Terkini 12:00 SL Liputan 6 Siang 12:30 Dawai 2 Asmara 15:30 Mutiara Hari Quraish Shihab 16:00 Inbox Spesial 21 Tahun 17:00 SM*SH Ngabuburit 17.45 Mengetuk Pintu Hatui, Azan MAghrib Doa berbuka 18.15 Para Pencari Tuhan 19.30 Malam Puncak 21 Tahun SCTV Harmoni Cinta Indonesia 02.00 Sabarrr Sahur Bareng Rey Rey Reynaldi 03.00 Sinekuis Para PEncari Tuhan

07.00 Upin & Ipin 08:30 Animasi Spesial 09:30 Cerita Pagi 10.30 Diantara Kita 11:00 Sidik 11:30 Lintas Siang 12:00 Layar Kemilau 15.00 Tauladan Ramadhan 16.00 Dikejar Surga 17:00 Lintas Petang 17:40 Upin & Ipin 18.00 Animasi Spesial 19.00 Animasi Spesial 20:00 Sampeyan Muslim 21.00 Ranum 00:00 Lintas Malam 22.00 Sinema Utama 02.00 Lintas MAlam 02.30 Taman Hati 03.30 Dikejar Surga

06:30 Curious George 07:00 Curious George 07:30 Mr. Bean 08:00 Mr. Bean 08:30 Dokumenter: Wild Monkey 09:30 Sinema Pagi : Ten Brothers 11:30 Topik Siang (Live) 12:00 Klik ! 13:30 Sinema Siang: Kid Hurricane 15:30 Topik Petang Update (Live) 15:35 Mantap (Live) 17:00 Pesbukers (Live) 18:35 Sinema Aksi : Dragon Forever 20:30 Ultimate Guinness World Of Record 21:30 Ripley's Believe It Or Not Season 1 22:30 Sinema Spesial 00:25 Topik Malam (Live) 00:45 Lensa Olah Raga

07.00 Sensasi Artis 07.30 FTV Pagi 09.30 FTV Drama 11.30 Patroli 12.00 Dong Yi, Jewel In The Crown 13.30 Bad Boy 14.00 Happy Song 15.00 KiSS Sore 15.30 Fokus 16.30 Cruel Temptation 17.00 Artis Sahabat 18.00 Dia Anakku 19.00 Nada CInta 20.00 Antara Cinta Dan Dusta 22.00 Mega Asia 00.00 Pejantan Cantik 01.00 Fokus Malam

07.05 Editorial Media Indonesia 08.05 Eleven Show 09.05 Headline News 10.05 Eleven Show 11.05 MDG’s Insight 13.30 Jakarta Jakarta 14.30 Metro Sore 15.30 Public Corner 16.05 Discover Indonesia 16.30 Sentilan Sentilun 17.05 Metro Hari Ini 18.05 Metro Hari Ini 19.05 Suara Anda 20.05 Suara Anda 20.30 Journalist On Duty 21.05 Top Nine News 22.05 Mata Najwa 23.00 Metro Sports


07.30 Rangking 1 08.30 Derings 10.00 Happy Family 11.00 Insert 12.00 Reportase Siang 12.30 Jelang Siang 13.00 Bingkai Berita 13.30 Program Spesial 14.30 Police 86 15.00 Keluarga Minus 15.30 Sketsa 17.00 Reportase Sore 18.00 Jika Aku Menjadi 18.45 Big Brother 20.00 Islam Itu Indah 21.00 Bioskop TRANS TV 23.00 Bioskop TRANS TV 01.00 Reportase Malam

09:30 Live News Kabar Pasar Pagi 10:00 Coffee Break 11:30 Live News Kabar Keadilan 12:00 Live News Kabar Siang 13:30 Mutumanikam 14:00 Yang Terlupakan 14:30 Jendela Usaha 15:00 Live News Kabar Pasar 16:00 Kabar ++ 16:30 Tahukah Anda ? 17:00 Renungan Hari Ini 17:30 Live News Kabar Petang 19:30 Janji Wakil Rakyat 20:30 Apa Kabar Indonesia Malam 23:30 Kabar Arena 00:00 Live News Kabar Malam

08.00 Naruto 09.30 Obsesi 10.30 Abdel Temon 11.30 Hot Spot 12.00 Awas Ada Sule 13.00 Main Kata 13.30 Global Siang 14.00 Petualangan Panji 14.30 Deny Manusia Ikan 15.00 Hand Made 15.30 Fokus Selebriti 16.30 Berita Global 17.00 Penguin Of The Madagascar 17.30 Spongebob 19.00 Awas Ada Sule 20.00 Big Movies 23.00 Big Movies

07:30 Selebrita Pagi 08:00 Jalan-Jalan Selebrit. . . 08:30 Hitam Putih 09:30 Ups Salah 10:00 Spotlite 11:30 Redaksi Siang 12:00 Selebrita Siang 12:30 Si Bolang 13:00 Laptop Si Unyil 13:30 Cita-citaku 14:30 Ayo Menyanyi 15:00 Koki Cilik 15:30 Asal Usul Fauna 16:00 Jejak Petualang 16:30 Redaksi Sore 17:00 Jejak Petualang: Sur. 18:00 Ups Salah Sambung 18:30 Hitam Putih 19:30 On The Spot 20:00 Opera Van Java 22:00 Bukan Empat Mata 00:00 Komunitas Unik 00:30 Sport7 Malam 01:00 Redaksi Malam


Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

Brooke Burke-David Charvet Menikah

Selena Gomez-Justin Bieber/ant/rtr

Justin Bieber Putus Dengan Selena Gomez? JUSTIN Bieber kini menjomblo, setelah mantan kekasihnya Selena Gomez menganggap Bieber sangat belum dewasa untuk sebuah jalinan hubungan. Seperti diwartakan, kisah percintaan mereka berada dalam goncangan selama beberapa pekan ini, di tengah laporan bahwa Selena tak senang dengan pertemanan kekasihnya itu dengan sosok

penyanyi Bad boy seperti Chris Brown dan Sean Kingston. Dan tampaknya hal itu dijadikan alasan bagi Selena untuk mencampakkannya dan mencari pria yang lebih dewasa. Seorang teman juga merupakan nara sumber mengatakan kepada Daily Star seperti dikutip bahwa, “Headline terbesar adalah mendapati kisah percintaan itu berakhir.Yang Selena inginkan kini adalah

berteman.” “Ia (Selena) tak merasa Justin belum cukup matang untuk menjalin hubungan jangka panjang. Ia sekarang sedang mencari penggantinya yang sedikit lebih dewasa dan bijaksana.” Justin mengatakan kecewa atas kandasnya hubungan itu. Selena tidak duduk termenung seorang diri di rumahnya dan menangisi kandasnya hubungan itu. (ant)

Pembawa acara bersama Dancing With the Stars- Brooke Burke dan mantan bintang Baywatch- David Charvet telah mengikat tali pernikahan setelah lima tahun berkencan. Brooke mengisya-ratkan di akun Twitternya, dengan posting bahwa ia memiliki “berita besar untuk dibagi”. Wakilnya belakangan mengkonfirmasi laporan mengenai perkawinan tersebut kepada E! News, sebagaimana dilaporkan Reuters, Senin. Pasangan itu, yang keduanya berusia 39 tahun dan memiliki dua anak bersama, menikah pada Jumat di atas kapal pesiar di lepas pantai Karibia, St. Bart, demikian laporan majalah Life & Style. Brooke juga adalah ibu dari dua putri — berusia 9 dan 11 tahun— dari perkawinannya sebelumnya dengan ahli bedah plastik di “Extreme Makeover” Garth Fisher.(ant) Brooke Burke dan David Charvet/

Asmirandah dan Dude Harlino/okz

Asmirandah Di Mata Dude Harlino Hubungan Dude Harlino dengan Asmirandah makin mesra saja. Apalagi, sejoli ini sedang terlibat dalam satu sinetron Ramadhan. Dude mengaku banyak hal yang membuatnya jatuh cinta pada kekasihnya tersebut. “Dia menarik, masih muda tapi hidupnya sudah mandiri. Dia punya spirit kerja keras yang luar biasa. Punya talenta dan

TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 7653.2188

SPRING BED DIJUAL MURAH Spring Bed 6 kaki 2 lapis Rp. 1.150.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun

Hub Telp. (061) 661.8116 - (061) 661.6802 - 7653.2188



bakat akting menyanyi, sutradara,” puji Dude soal Asmirandah saat di bilangan Kuningan, Jakarta Selatan. Tak hanya itu, di mata Dude, Asmirandah semakin terlihat sempurna karena artis tersebut memiliki kemampuan meracik masakan di dapur. “Dia juga pintar masak lho,” ucap pria berdarah Padang-Sunda ini.





Dengan 3 Konsentrasi: 1. Komputer Akuntansi 2. Akuntansi Perpajakan 3. Akuntansi Perkantoran Tempat pendaftaran:

Kampus Akademi Akuntansi YPK Jl. Sakti Lubis/ Pegawai No. 8 Telp. (061) 787.9585 Sp. Limun Medan



Gadis/ Janda Kristen, Jaga anak di Medan, Gaji 700 Rb/ bln bersih Hub. Pak Jov 0812.6553.5559 LOWONGAN KERJA Menerima P/W secepatnya di perusahaan swasta di Medan (100% bukan Sales, Penghasilan Rp. 1.800.000 + Harian Hub. IBU MELIANI SINAGA, AMd HP. 0813.6127.8601 Alamat kantor: Gatot Subroto Komplek Merbau - Mas Carrefour, jam interview pkl. 10.00-16.00 Wib NB: Datang langsung diterima kerja, pengalaman tidak diutamakan, bawa KTP/ SIM dan Guntingan iklan


DCRlls SLTA/ sdrj U/ diddk & lsg dislrkan mjd Guru PG/ TK Hub: Jl. KH. Wahid Hasyim 92 Medan Tp. 7623.5314 - 9158.3487 4533.875 - 456.9269



Informasi Pembaca Bursa Property

GR : Garasi LB : Luas Bangunan KM : Kamar Mandi LT : Luas Tanah KP : Kamar Pembantu RM : Ruang Makan KT : Kamar Tidur RT : Ruang Tamu SHM: Sertifikat Hak Milik


JL. JERMAL III UJUNG NO. 8 MEDAN DENAI HUB. 0852.7763.6855 0852.6211.2259


11x22, KM 3, KT 3, RT 1, KT 1, Garsi mobil panjang 4 mobil masuk, Dpr 1 AC Jl. Perwira sebelah bank Sumut depan Kodam I Bukit Barisan Gatot Subroto Hub. 0852.6167.8082, H. 335 Jt/nego

RUMAH Dijual, LT. 11x12, LB. 7x10,5m, Siapa cepat, Dia dapat Info lengkap 0812.652.1068 - 0852.6000.1143 RUMAH Petak siap huni Dijual, Yang terletak di Jl. Ampera V Blok B No. 11, Uk. 6x12, 2½ Tingkat Peminat serius hub: 7711.2202

Luasnya 2,6 Ha, Jl. Menteng VII dekat Komplek Menteng Indah

Hub. 0813.9710.7889 - 0821.6887.7159 0811.614.459

TANAH DAN RUMAH DIJUAL KEBUN DIJUAL Uk. 1204m, SHM DI JL. SEI ASAHAN ± 80 HA, DI SIBOLANGIT Harga 12 Juta/ Ha - Nego Boleh Beli Sebagian SK Camat Hub. 0821.6060.4911








HUB. 0812.6554.6515




Anda Butuh Perabot Jepara Asli?


Setiap hari kerja: 08.00-17.00 Wib Perkuliahan Pagi/ Sore dimulai Tanggal 19 September 2011




HARGA EMAS TERUS MEROKET SAATNYA BERINVESTASI EMAS Laba/ hasil invest diterima setiap hari modal bisa di tarik kapan saja Tanpa terikat kontrak Dibawah Naungan DEPPERINDAG Izin Resmi No. 427/Bappebti/si/VII/2004 Info hub: 0821.6312.5540 - 0819.1994.2857


Hub. 0813.7512.4579 0812.6365.5669




MENJUAL PECI TEMPAHAN Berbagai Model dan Warna Jl. Prof. H.M. Yamin SH. No. 344/Jl. Serdang Depan Gg. Sado Medan, HARI MINGGU TETAP BUKA




Jl. Setia Budi No. 49 A Tj. Rejo (061) 822.3975 Medan samping IPMD


Hubungi: Jl. Bilal No. 90 P. Brayan Medan Telephone Toko : 661.6285 Rumah : 661.1540 Fax : 661.6285 (061) Jl. K.L. Yos Sudarso depan SMA Negeri 1 Tebing Tinggi Telp. (0621) 24243

Di Jl. Psr I Rel Marelan Gg. Tower/ Pinggir Pasar Besar, Harga Rp. 350 Ribu/ meter, Nego Bebas Banjir, Surat SHM





Dude mengaku serius menjalani kisah cintanya dengan pesinetron tersebut. Tetapi, Dude sedikit tertutup jika disinggung soal kapan dirinya akan meresmikan hubungannya dengan Asmirandah ke jenjang pernikahan. “Buat saya ada hal yang harus dibicarakan, ada yang tidak. Biarlah ini saya menikmati keindahan kisah saya,” ujar Dude. Dude dan Asmirandah pernah berperan sebagai sepasang kekasih saat membintangi film ‘Dalam Mihrab Cinta’. Dari spekulasi tersebut, banyak yang menganggap keduanya menjadi sepasang kekasih karena terlibat cinta lokasi. Tetapi, hal ini dibantah Dude. Menurut pria kelahiran 2 Desember 1980 ini, dirinya sudah mengenal Asmirandah sebelum syuting film tersebut. (vvn)



Bono U2 Bantah Sedang Sakit Pentolan Grup band U2, Bono membantah laporan ia telah dilarikan ke rumah sakit setelah mengeluh sakit di dadanya ketika sedang berlibur di selatan Perancis, Minggu (21/8). Seperti diwartakan Reuters, penyanyi berusia 51 tahun itu mengaku tak pergi ke rumah sakit Princess Grace di Monaco. Juru bicaranya mengungkapkan Bono jalani pemeriksaan rutin. “Meskipun cerita dari pers berlawanan, Bono tak mengalami kecemasan akan kesehatannya saat ini,” kata juru bicaranya dalam sebuah pernyataan. “Laporan yang menyatakan ia dilarikan ke rumah sakit untuk mendapatkan perawatan di unit gawat darurat tidak benar. Bono dalam kondisi yang baik dan menikmati liburan keluarganya di wilayah selatan Perancis,” Kecemasan akan kesehatan Bono itu dilaporkan sebuah surat kabar independen Irlandia dan diangkat outlet laman berita musik online. Bono dan grup musik rock Irlandia U2 baru saja menyelesaikan tur dunia yang memecahkan rekor penjualan tiket dunia. Grup itu sedang berusaha membatalkan beberapa konsernya di tahun 2010 dan menarik diri dari festival musik Glastonbury ketika Bono mengalami cedera punggung. (ant)



WASPADA Rabu 24 Agustus 2011

Repetan Redknapp LONDON (Waspada): Manajer Tottenham Hotspur, Harry Redknapp, merepet panjang setelah pasukannya digunduli Manchester United 3-0 dalam laga Liga Premier di Old Trafford, Selasa (23/8) dinihari WIB. Sasaran repetan mantan pelatih West Ham dan Portsmouth itu mulai dari penampilan pemainnya sampai kebijakan manajemen Tottenham di bursa transfer musim panas ini. “Mengecewakan, sebenarnya ada kesempatan buat kami untuk mendapatkan sesuatu. Kami terus menguasai bola da-

lam laga tersebut,” sesal Redknapp, seusai laga Spurs versus United. Setelah bermain tanpa gol sampai menit 60, The Lilywhites akhirnya kebobolan gol sundulan DannyWellbeck menit 61. Setelah itu gawang kiper Brad Friedel kemasukan dua bola lagi melalui Luis Anderdon menit 76 danWayne Rooney menit 87. “Kami sebenarnya memulai babak kedua dengan cukup baik. Gol (pertama MU) datang saat saya kira tim kami sedang tampil bagus. Gol itu yang membuat permainan berubah,” beber Redknap.


MANAJER Spurs Harry Redknapp tidak mau melepas Luka Modric (kanan).

D i a pun berharap, manajemen Spurs dapat merekrut setidaknya dua pemain baru lagi untuk memperkuat skuadnya musim ini. “Jika ada, satu atau dua pemain untuk lini belakang tim. Jika manajemen klub dapat membantu saya mendapatkan mereka, kami akan menjadi tim yang lebih baik,” janjinya dalam Sky Sports, Selasa (23/8). Dia juga bercerita banyak mengenai Luka Modric, yang diberitakan ingin cabut ke Chelsea. Redknapp menegaskan, tidak akan melepas playmaker asal Kroasia itu, tapi justru siap menyodorkan kontrak baru. “Ketua klub mengatakan, Modrid akan ditawari kontrak baru dalam satu atau dua bulan ini dan dia sudah bersedia,” klaim Redknapp. Modric diiming-imingi dengan kontrak senilai 30 juta pound untuk pindah dariWhite Hart Lane ke Stamford Bridge. Rumor kepindahannya tetap kencang, karena tidak turun ketika melawan MU. “Saya yakin dia akan bertahan. Ketua klub sudah memutuskan untuk tidak menjualnya, karena sulit mendapatkan penggantinya,” tambah Redknapp. (m15/sky/afp)

Nasri Tak Mau Main Lawan Udinese LONDON (Waspada): Gelandang Samir Nasri tidak akan memperkuat Arsenal saat tandang ke markas Udinese pada leg kedua Play-off Liga Champions dinihari WIB nanti. Menurut The Guardian, Selasa (23/8), Nasri tidak mau ikut ke Italia, karena transfer dirinya ke Manchester City semakin mendekati kenyataan. Penampilan Nasri ketika The Gunners ditaklukkan Liverpool 0-2 akhir pekan lalu di Emirates Stadium, kemungkinan menjadi partisipasi terakhir gelandang Prancis itu bersama Arsenal. Nasri terus dikaitkan dengan The City setelah dia menolak perpanjangan kontrak bersama London Reds. Dia pun tak turun pada leg pertama, ketika anak asuh ArseneWenger mengalahkan Udinese 1-0 lewat gol tunggal Theo Walcott pada leg pertama pekan lalu. Wenger sendiri masih ngotot ingin mempertahankan Nasri. “Dua klub Manchester tertarik. Saya akan tetap mempertahankan dia (Nasri),” tegasnya. “Saya pikir, dia bahagia di

sini. Tidak ada kepergian Nasri pada kesempatan ini,” tambah The Professor kepada TF1. Gunners juga bertekad menanggalkan segala beban dari pundak saat melawat ke Estadio Friulli, guna melakoni laga yang turut ditayangkan langsung RCTI dinihari nanti mulai pkl 01.45 WIB. “Anda semua bisa lihat semangat kami sekarang. Kami tidak merasa tertekan untuk bisa memberi bukti kepada semua orang, kami cuma harus bisa terus bermain di setiap pertandingan,” klaim bek Bacary Sagna. “Kami tidak peduli dengan tanggapan negatif yang muncul. Kami semua ingin pertarungan sengit di leg kedua, karena hal serupa juga sudah kami tunjukkan di leg pertama,” katanya lagi. Bek muda Ignasi Miquel juga mengharapkan demikian. Remaja berusia 18 tahun itu ber-

BOMBER muda MU Danny Welbeck (kanan) membobol gawang Tottenham Hotspurs di Stadion Old Trafford, Manchester, Selasa (23/8) dinihari WIB.

Sensasi Anak Muda MU LONDON (Waspada): Danny Welbeck, Luis Anderson dan Wayne Rooney, masing-masing menyumbang satu gol saat tim muda Manchester United melanjutkan sensasi dengan menggunduli Tottenham Hotspur 3-0 di Liga Premier.

harap teman-temannya bisa meninggalkan beban masa lalu dan menatap masa depan. “Minggu depan kami memiliki partai melawan United dan yang pertama bersua Udinese di Liga Champions. Tidak ada gunanya kami memikirkan tentang hasil lalu,” tutur Miquel. “Kami mesti tetap positif karena Udinese harus memasukkan dua gol.Berikan 100 persen dan bila kami melakukannya, saya yakin kami bisa memenangi itu,” katanya menambahkan. (m15/vvn/goal/rtr)

Dalam duel di Stadion Old Trafford, Senin (Selasa WIB) tersebut, manajer MU Sir Alex Ferguson kembali memberikan kepercayaan kepada para pemain usia muda. Patrice Evra pun menjadi pemain tertua di antara rekan-rekannya yang masih berusia 20-an tahun. “Saya sungguh senang dengan penampilan mereka. Para pemain muda layak mendapatkan kemenangan ini,” ucap Evra, seperti dikutip dari Goal, Selasa (23/8). “Banyak orang berbicara tentang akademi, dan mereka

BARCELONA, Spanyol (Waspada): Entrenador Barcelona Josep Guardiola puas dengan kesuksesan pasukannya membantai Napoli 5-0 pada laga eksibisi bertajuk trofi Joan Gamper. Gelar ke-35 pada turnamen di Camp Nou Stadium, Barcelona, Senin (Selasa WIB) tersebut, dinilai Guardiola sebagai bukti pasukannya masih menyimpan rasa lapar gelar. Apalagi, gelandang debutan Cesc Fabregas langsung menyatu bahkan mencetak gol pertama yang membuka pesta tim tuan rumah. “Kami sedikit lebih baik. Kami sekarang punya tiga atau empat sesi latihan fisik untuk mencapai level optimal,” ujar Guardiola dalam Yahoo Sports, Selasa (23/8). Empat gol El Catalan lainnya disumbangkan Seydou Keita, Pedro Rodriguez dan dua gol dari mega bintang Lionel

Messi. Ini membuat Guardiola kembali yakin, setelah sempat dibuat was-was akibat skuadnya kesulitan menaklukkan Real Madrid pada dua laga Piala Super Spanyol. “Memenangkan gelar kedua musim ini tentu sangat bagus. Tapi kami harus memenangkan lebih banyak lagi. Dengan dukungan fans kami dapat melakukannya,” optimisme Guardiola. Fabregas menjadi starter saat menjamu Napoli dan kesempatan itu tidak disia-siakan mantan kapten Arsenal tersebut. Menit 26, Fabregas membuka pesta gol tuan rumah memanfaatkan umpan silang Adriano Correa. Lima menit kemudian Barca menggandakan keunggulan melalui gol Keita. Pedro memantapkannya lagi menit 62, lantas ditutup Messi dengan golnya menit 66 dan 77. (m15/goal/yahoo)

ARSITEK Arsenal Arsene Wenger (tengah) ngotot mempertahankan Samir Nasri (kiri).

Leg II Play-off Liga Champions Malam Ini Leg I Plzen (CZE) v FC Copenhagen (DEN) Sturm Graz (AUT) v BATE Borisov (BLR) SC Benfica (POR) v FC Twente (NED) Rubin Kazan (RUS) v Lyon (FRA) Udinese (ITA) v Arsenal (ENG) *RCTI Live Kamis dinihari pkl 01.45 WIB

3-1 1-1 2-1 1-3 0-1

Fabregas Buka Pesta Gol Barca


GELANDANG baru Barcelona Cesc Fabregas (kiri) bergaya merayakan golnya ke gawang Napoli di Camp Nou, Selasa (23/8) dinihari WIB.

Mata Dituduh Mata Duitan



LONDON (Waspada): Manajer Tottenham Hotspur Harry Redknapp menuduh Juan Mata (foto) mata duitan dan menolak gabung dengan timnya karena masalah uang. Gelandang Valencia itu hampir dipastikan gabung Chelsea dengan nilai transfer 29 juta pound. Padahal, Spurs yang pertama menempel Mata. “Kami tertarik dengan Mata dan hampir mencapai sebuah kesepakatan. Tapi dia tidak datang dan Chelsea mendekat,” beber Redknapp, seperti dilansir Daily Mail, Selasa (23/8). Mata diproyeksikan manajer anyar Chelsea Andre Villas-Boas untuk mengisi posisi sayap kiri The Blues, yang dia anggap kurang maksimal. “Kemudian dia berubah pikiran dan mereka (Chelsea) mendapatkannya. Semua karena masalah duit,” tuding Redknapp. Mata langsung membantah tuduhan tersebut. Dia mengaku, lebih memilih London Blues daripada London Whites karena klub milik taipan Rusia Roman Abramovich itu lebih berkualitas dan potensial. “Saya ingin datang ke Inggris dengan memenangkan trofi, itulah alasan mengapa saya menerima tawaran Chelsea,” dalih gelandang Spanyol berusia 23 tahun itu. “Arsenal dan Tottenham tertarik kepada, saya tapi mereka tidak bisa dibandingkan dengan Chelsea. Saya ingin gelar Liga Premier dan ini mungkin tercapai di Chelsea,” tambah Mata. Dia juga mengaku, terpengaruh dengan bujukan kompatriotnya Fernando ‘El Nino’ Torres. Menurut Mata, El Nino telah memberikan banyak gambaran yang membuatnya yakin gabung dengan Si Biru. (m15/vvn/dm/yahoo)

menunjukkannya malam ini. Sungguh luar biasa,” puji bek kiri Prancis tersebut. “Kami masih percaya kepada pemain muda, saya kira para pendukung menghargai itu. Kami selalu yakin untuk menurunkan pemain muda, tapi para pemain memang punya kemampuan hebat,” tambah Sir Alex Ferguson. Dengan masih absennya striker Javier ‘Chicharito’ Hernandez karena cedera, Danny Welbeck kembali menjadi starter, seperti saat Setan Merah memukul West Brom 2-1 pada

pekan perdana. Welbeck, De Gea Welbeck kemudian menunjukkan peningkatan sekaligus membuktikan kemampuannya sebagai pemain inti, setelah sempat satu tahun dipinjamkan ke Sunderland. Dia membuka pesta MU, sehingga menuai pujian langsung dari Ferguson. “Dia punya kemampuan yang sangat baik. Ketika kami meminjamkannya ke Sunderland, di sana dia mulai berkembang. Umurnya baru 20 tahun dan dia punya masa depan yang cerah,” ucap Sir Frgie. Welbeck mencetak gol pertama The Red Devils menit 60. Berselang 10 menit, bomber belia Inggris itu memberi umpan matang untuk gol Anderson. Menit 87, Rooney melengkapi kemenangan Setan Merah,

setelah mendapatkan umpan silang dari winger veteran Ryan Giggs, yang masuk sebagai pemain pengganti. Selain Welbeck, perhatian di Old Trafford juga tertuju kepada kiper baru David De Gea, yang direkrut United dari Atletico Madrid dengan nilai transfer 18,3 juta pound. Sempat diragukan, De Gea ternyata mampu clean sheat menjamu Spurs. “Dia (De Gea) tampil sangat bagus, dengan kakinya, dan dengan apapun. Saya katakan usai pertandingan, semua penonton ada di belakang dirinya,” ujar Evra. “Dukungan itu sangat penting, dan Anda harus berterimakasih kepada semua fans. Dia juga mengaku sangat senang. Saya yakin karena David punya talenta hebat, dan kami semua

Klasemen Liga Premier Man City Man United Wolves Aston Villa Liverpool Chelsea Newcastle Bolton QPR Norwich Stoke Wigan Sunderland Arsenal Fulham Swansea Everton West Brom Blackburn Tottenham

2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 1

2 2 2 1 1 1 1 1 1 0 0 0 0 0 0 0 0 0 0 0

0 0 0 1 1 1 1 0 0 2 2 2 1 1 1 1 0 0 0 0

0 0 0 0 0 0 0 1 1 0 0 0 1 1 1 1 1 2 2 1

7-2 5-1 4-1 3-1 3-1 2-1 1-0 6-3 1-4 2-2 1-1 1-1 1-2 0-2 0-2 0-4 0-1 2-4 2-5 0-3

6 6 6 4 4 4 4 3 3 2 2 2 1 1 1 1 0 0 0 0

siap membantunya,” katanya lagi. (m15/goal/afp/rtr)


WASPADA Rabu 24 Agustus 2011


Gurning Tertantang Kursi Panas PSMS MEDAN (Waspada): Jabatan pelatih PSMS Medan untuk kompetisi mendatang kian santer bakal diisi duet Abdul Rahman Gurning dan Roekinoy. Gurning sendiri berstatus tanpa klub setelah dilepas PSPS Pekanbaru yang kini ditukangi Mundari Karya.

Waspada/Austin Antariksa

68 Klub Ikut Assesment JAKARTA (Waspada): Ketua Komite Kompetisi PSSI, Sihar Sitorus, memastikan sudah ada 68 klub yang telah menyerahkan berkas dokumen untuk diverifikasi tampil di kompetisi profesional level satu dan dua musim depan. Hanya saja, pengusaha muda asal Sumut yang juga mantan pengelola PSMS Medan tersebut mengatakan status puluhan klub yang telah mengajukan dokumennya masih ada beberapa yang bermasalah. Hal itu terkait dengan legalitas klub sesuai yang disyaratkan. “Untuk klub yang musim lalu bermain di ISL (Indonesia Super League), ada 14 klub yang sudah mempunyai badan hukum dalam bentuk PT (Perseroan Terbatas),” kata Sihar kepada wartawan di Jakarta, Selasa (23/8). “Dua klub lagi, yaitu Arema FC Malang dan Persija Jakarta, masih mengalami dualisme kepengurusan. Proses pengesahan Persipura Jayapura dan Semen Padang masih di Kementerian Hukum dan HAM (Kemenhumkam), sehingga masih menunggu penyelesaian,” tambah Sihar. Mengenai deposit yang batas akhirnya Senin (22/8) lalu, Sihar mengaku belum bisa menyebutkan klub yang telah memenuhi kewajibannya. Hal itu karena masih akan bertambah. “Untuk deposit, kami masih tunggu rekap dari bank,”

MANTAN PSMS Markus Horison, Mahyadi Panggabean dan Legimin Raharjo, target buruan Abdul Rahman Gurning.

ungkap Sihar lagi. Mengenai dualisme kepemimpinan di kepengurusan Persija yang kembali menjadi masalah sehingga tim ibukota tersebut belum menyerahkan dokumen, Sihar mengaku pihaknya belum bisa memberikan keputusan, sebab persoalan ini akan dibawa dalam rapat Komite Executive (Exco) PSSI. “Kami kasih waktu sampai Rabu (24/8) ini setelah berbuka puasa. Tentunya dengan harapan mereka datang membawa hasil diskusi, seperti apa dan siapa yang akan mewakili Persija,” kata Sihar menambahkan akan sulit memproses dokumen Persija jika tidak ada kesepakatan. Seperti diketahui, sebelumnya PT Persija Jakarta Jaya di bawah Bambang Soejipto telah menyerahkan dokumen. Hal itu menjadi bermasalah saat PT Persija Jaya Jakarta yang dipimpin Ferry Paulus ikut mendaftar. Dijelaskan, mengenai adanya beberapa pilihan yang diberikan PSSI, jelas sulit diterima. Sebab PSSI memberikan pilihan kedua PT ini harus memilih salah satu di antaranya. Jika hal itu tidak juga dipenuhi, terpaksa diambil keputusan kedua tim tidak bisa ikut kompetisi. “Kami tidak bisa terima keputusan PSSI sebab sesuai aturan, kami yang memiliki legalitas untuk mendaftarkan Persija,” tandas Ferry. (yuslan)

Waspada/Nurkarim Nehe

SALURKAN hobi dan bakat dengan tepat. Salam Bikers! Begitulah tukas Bagus Imran Saptaji yang juga biker junior Monstrac.

Bagus Salurkan Bakat Dengan Tepat SISWA kelasVIII SMPN 6 Kisaran ini terbilang jangkung dan tampak tenang di antara komunitas biker senior maupun oldcrack. Namun Bagus Imran Saptaji kadang bertingkah ekstrem, saat Monstrac (Monster Trail Asahan Community) melakukan touring “Terabas Lereng Bukit Barisan”. “Memang ini tempatnya, om. Bukan di jalanan umum. Salurkan bakat dengan tepat,” ujar Bagus, remaja kelahiran Lampung, 26 Agustus 1997, di atas sepeda motor trail 150cc miliknya, Selasa (23/8). Anak kedua dari dua bersaudara itu mengaku bergabung di Monstrac karena hobi walau

bercita-cita masuk Akademi Kepolisian. “Saya senang sekali ada wadah menyalurkan hobi di mana kita bisa berkreasi, mengembangkan bakat secara terarah tanpa mengganggu ketertiban umum. Monstrac malah ikut menciptakan Kamtibmas, khususnya di pinggiran kota dan pedesaan,” jelas Bagus di Kisaran. Kepada rekan remaja yang hobi sepeda motor, Bagus berpesan agar tidak menyalurkan bakat dan hobi di jalanan alias ikut balap liar. Sebaliknya, salurkan hobi dan bakat dengan tepat. “Salam Biker!,” tukas Bagus mengakhir pembicaraan. *Nurkarim Nehe

Problem Catur


Putih melangkah, mematikan lawannya empat langkah.

Jawaban di halaman A2. 8







1 A








“Saya sudah diminta langsung untuk melatih PSMS. Saya juga sudah deal harga, hanya saja belum saya katakan resmi karena belum ada tanda tangan kontrak,” ujar Gurning, Selasa (23/8). “Salah satu alasan saya memilih kembali ke Medan dikarenakan sudah lelah enam tahun merantau di luar daerah. Keluarga saya pun bilang lebih baik terima tawaran di daerah yang lebih dekat, karena itu saya pun terima pinangan Ayam Kinantan,” tutur mantan pemain Ayam Kinantan era 1980-an ini. Musim lalu, Gurning juga sudah ditawari balik ke Medan untuk melatih Bintang Medan atas ajakan CEO-nya, Dityo Pramono. Kala itu, Dityo mengatakan ingin memakai jasa pelatih lokal saja. Artinya, Dityo yang juga mantan Ketua PSPS itu merasa kurang klop dengan arsitek Bintang Medan asal Jerman, Michael Feichtenbeiner.

Begitu kompetisi musim lalu selesai dan Bintang Medan melebur bersama PSMS, Gurning mengaku dihubungin Sekretaris Umum PSMS, Idris SE. Ditanya soal nilai pinangan, Gurning enggan membeberkan nominalnya. “Soal harga saya memang agak tidak terlalu suka mengumbar, tapi terserah saja kalau memang manajemen mau mengungkapkan,” imbuh Gurning menganggap kembali menangani PSMS merupakan tantangan baginya. “Ini tantangan, tapi saya tidak akan lari dari tantangan ini. Banyak yang bilang kursi pelatih PSMS itu panas, tapi bagi saya gimana supaya yang panas itu masuk kulkas,” ucap pelatih kelahiran 15 Januari 1958 itu mengacu pada tren PSMS yang kerap gonta-ganti pelatih dalam beberapa tahun terakhir. Menyinggung target, Gurning belum bisa bicara banyak

karena belum memiliki skuad yang bisa jadi tolak ukur kemampuan bersaing pada musim depan. Apalagi dirinya juga masih menunggu hasil verifikasi PSMS ke level 1. Namun, Gurning mengaku sudah sempat memberikan daftar pemain yang ingin direkrutnya. Di antaranya, Gurning menyebut Markus Horison dan Legimin Raharjo yang menyatakan ingin balik ke Medan. “Dalam daftar calon rekrutmen, saya ajukan Markus, Mahyadi Panggabean, Legimin, Zukifli Syukur, dan Ahmad Bustomi plus beberapa pemain musim lalu. Kalau manajemen sanggup, saya yakin kita bisa eksis paling tidak di posisi empat besar. Bila menggunakan putra daerah saja, kita hanya bisa target mempertahankan klub tidak degradasi saja,” paparnya. Perihal asisten pelatih, Gurning menegaskan langsung setuju begitu mendengar nama Roekinoy disebut. Pasalnya, pelatih PSMS Muda ini juga duetnya saat membawa PON Sumut merebut medali perunggu di PON 2004 di Palembang lalu. (m33/goal)

Perlu Ditanamkan Rasa Nasionalisme Mundurnya Ian Kabes Dari Timnas MEDAN (Waspada): Pemain yang memperkuat tim nasional Indonesia perlu ditanamkan rasa nasionalisme dalam membela dan mengabdi kepada bangsa dan negara di pentas internasional. Demikian disampaikan Penanggungjawab Timnas Indonesia, Bernhard Limbong (foto), kepada Waspada di Medan, Minggu (21/8) lalu, menanggapi mundurnya Ian Louis Kabes dari tim nasional. Pemain asal Persipura Jayapura itu mundur disebabkan alasan keluarga. Namun begitu, Bernhard yang juga anggota Komisi Di-

siplin PSSI akan memanggil Ian Kabes untuk dimintai keterangan. Dia menyebutkan, pihaknya sampai saat ini belum bisa memiliki asumsi apapun terkait masalah Ian Kabes dan Boaz Salossa yang juga melakukan hal serupa. “Kita tidak mau mencaricari asumsi yang belum tentu benar, tapi tetap kami harus cari tahu alasan sebenarnya kedua pemain tersebut mundur sementara,” katanya. Bagi Limbong, pemain harus memiliki alasan kuat jika hendak meminta izin dari tim nasional, khususnya mereka yang sudah masuk dalam


skuad. “Kalau alasan keluarga, alasan seperti apakah yang bisa ditolerir,” tambah jenderal berbintang satu ini. Ia mengajukan permohonan izin pada pelatih Wim Rijsbergen pekan lalu diikuti Boaz dua hari setelahnya. Limbong menyatakan pihaknya juga akan mencoba mendapatkan keterangan dari pihak manajemen pelatih. Lebih lanjut, Limbong menjelaskan mundurnya Kabes tidak bisa langsung disangkutpautkan dengan kekecewaan mereka akibat adanya perselisihan dengan pelatih Wim Rijsbergen. Sempat beredar kabar bah-

Basket Putri Petik Kemenangan Kedua NAGASAKI, Jepang (Waspada): Timnas bola basket putri Indonesia mampu mengandaskan Malaysia 74-66 pada pertandingan ketiga “FIBA ASIA Championship forWomen 2011 Level II” di Omura, Nagasaki, Jepang, Selasa (23/8). Kemenangan ini langsung disambut dengan antusias oleh jajaran pelatih dan manajemen karena lawan yang dihadapi belum pernah kalah dan selalu menang dengan margin yang cukup tinggi. “Semua pemain melaksanakan instruksi pelatih dengan baik. Yang jelas, kami bersyukur dengan kemenangan ini,” kata Asisten Manager Timnas, Cecilia Dwi Maya. Menurut mantan andalan timnas itu, Wulan Ayuningrum cs diinstruksikan untuk mene-

kan dengan serangan cepat. Alhasil, Indonesia unggul telak 31-16 pada kuarter pertama. Di kuarter kedua, pelatih William McCommon mengubah strategi dengan memasukkan Hanum Fasya dan Fanny Kalumatan menggantikan Wulan Ayuningrum dan Yunita Sugianto. Hasilnya, serangan Merah Putih lebih tajam dan unggul 41-21. Tertinggal cukup jauh, timnas Malaysia terus memberikan perlawanan yang tidak kalah sengitnya di kuarter ketiga. Dampaknya, margin perolehan poin terus mendekat dan tinggal terpaut delapan poin. Margin delapan poin itu membuat McCommon memutar otak dan melakukan rotasi pemain, salah satunya memasukkanWulan Ayuningrum dan Gabriel Sophia yang sebelum-

nya terkena foul trouble. Masuknya kedua pemain ini membuat pola permainan Indonesia membaik. Didukung Yunita Sugianto, poin demi poin berhasil diraih hingga timnas mengakhiri pertandingan dengan kemenangan 74-66. Padapertandinganini,Wulan Ayuningrum membukukan 23 angka diikuti Gabriel Sophia 15 poin, dan Jacklien Ibo 13 angka. Dengandemikian,Indonesiatelah memenangkanduapertandingan atas Sri Lanka (67-53) dan Malaysia. Satu kekalahan diderita pasukan Garuda terjadi saat menghadapi Kazakstan 69-87. Selanjutnya, timnas Merah Putih akan menjalani pertandingan melawan Singapura dan Uzbekistan dalam lanjutan FIBA ASIA Championship forWomen 2011 Level II. (m33/ant)

Ijeck Jadi Manajer Pro Duta FC MEDAN (Waspada): Sebuah keputusan mengejutkan diambil pengurus Pro Duta FC jelang persiapan menghadapi kompetisi mendatang. Klub yang bernama Pro Titan musim lalu ini menunjuk Musa ‘Ijeck’ Rajeckshah sebagai manajer tim. Hal ini disampaikan Presiden Direktur PT Pro Duta Football Indonesia, Wahyu Wahab, Selasa (23/8). Wahyu mengatakan Ijeck dipilih karena masih muda dan komit membantu klub. Atas dasar itu, rapat manajemen klub memutuskan


Ijeck yang juga Ketua Ikatan Motor Indonesia (IMI) Sumut itu akan mulai bekerja pada 9 September mendatang. Selain manajer,Wahyu juga menjelaskan Ijeck bakal menjadi Managing Director Pro Duta. “Nanti pada Rabu (24/8) ini, kami akan adakan konferensi pers mempertemukan Ijeck dengan media,” ungkapnya. Wahyu menjelaskan, selain sosok manajer, klub juga sudah memilih Dirk Buitelaar sebagai pelatih Pro Duta. Pria asal Belanda ini juga merupakan ar-

sitek Pro Titan musim lalu. Dikatakan, Dirk dipilih karena memiliki lisensi A kepelatihan sesuai standar klub yang akan berlatih di kompetisi profesional level 1 nanti. Nantinya, Dirk akan didampingi Selamat Riyadi sebagai asisten pelatih. Saat dikonfirmasi, Ijeck belum mau berbicara panjang lebar soal penunjukan dirinya. Ijeck hanya mengiyakan saat diminta Pro Duta menjadi manajer. “Ya, saya bersedia. Soal alasan, nantilah saya dijelaskan,” tukasnya. (m33/goal)


gharaatin nujuumu wa hada’atil ‘uyuun, wa anta hayyul qayyuum, laa ta’khudzuka sinatun wa laa naum, yaa hayyu yaa qayyuum ahdi’ lailii wa anim ‘aynii). 16.Berdosa dikerjakan (memakan babi dsb). 17.Bacaannya La haula wa laa quwwata illa billahil ‘aliyyil ‘azhiim, artinya: tiada daya upaya dan tiada kekuatan melainkan dengan Allah yang Maha Tinggi dan Maha Agung.

1. Gangguan kesehatan akibat virus dsb. (Baca ini 40 kali sebelum shalat Subuh dan usapkan ke bagian yang sakit: Bismillahirrahmanirrahim, alhamdulillahi rabbil aalamiin, hasbunaallaahu wa ni’mal wakiil tabaarakallaahu ahsanul khaaliqibna, wa laa hawla wa laa quwwata illa billaahil ‘aliyyil ‘azhiim). 5. Surat Al Quran, obat berbagai macam penyakit. (Baca dengan khusu’ dalam hati 7x, dan jika belum sembuh, baca 70x, dijamin sembuh. HR dari Jabir Abdullah al-Anshari dan Imam Shadiq). 7. Surat Al Quran ke-65, ayat 2-3nya mujarab untuk banyak rezeki dan hajat dunia. (Dibaca setiap Selasa dengan membaca shalawat sebelum dan sesudahnya masing-masing 3x). 10.Makhluk yang menutup katup kebenaran pada hatinya. (Akan terbuka dengan membaca shalawat kepada Nabi Muhammad dan keluarganya). 11. Bacaan lazim ketika hendak menaruh barang agar tidak lupa dimana diletakkan. 13.Produk lebah yang disebut QS An-Nahl ayat 68-69 sebagai obat berbagai penyakit. 14.Permohonan kepada Allah seusai shalat. 15.Sulit tidur. (Doa Rasulullah mengatasinya: Allahumma


1. Ganjaran Tuhan atas perbuatan baik. 2. Binatang yang pernah menyengat Rasulullah dan diobatinya sendiri dengan garam plus doa sebagai penawar bisa. 3. Sudah lama hidup, penyakit yang tidak bisa disembuhkan menurut hadis. 4. Al-_____, salah satu surat Al Quran, selain An-Nas, yang diturunkan untuk menyembuhkan Rasulullah dari simpul sihir dukun Yahudi. 6. Lawan kata No. 16 Mendatar. 7. Malu, cela, yang harus ditutup. 8. Saya (untuk merendahkan diri). 9. Salah satu pintu masuk bandara bagi penerbangan jemaah haji atau umrah. 12.Tentara Allah. 13.Status Abu ‘Ash bin Rabi’ bin Abdul ‘Uzza bagi Rasulullah. 14.Penyiaran ajaran agama.

wa Rijsbergen menegur mereka karena sudah melanggar aturan. “Saya kira mereka semua

sama-sama profesional. Kesalahpahaman sangat mungkin terjadi,” lanjutnya. (m18)

Pemerintah Kurang Perhatikan Pencak Silat JAKARTA (Waspada): Pemerintah dinilai kurang memperhatikan olahraga beladiri pencak silat sebagai warisan nenek moyang bangsa Indonesia. Akibatnya, pencak silat kalah pamor dan tidak banyak bicara pada multi event cabang olahraga. “Sulit untuk cepat berkembang. Bayangkan saja, dana operasional untuk Ikatan Pencak Silat Indonesia setahun kurang dari Rp100 juta. Kalau kita mau adakan event yang besar harus cari dana sendiri.” Demikian dikatakan Ketua Persekutuan Pencak Silat Antarbangsa (Persilat), Mayjen (Purn) Eddie M Nalapraya, baru-baru ini di Jakarta. “Pencak silat Indonesia tersendat-sendat, berbeda dengan seni beladiri dari negara lain seperti karate, taekwondo, dan wushu yang berkembang pesat,” tambahnya. Turut hadir dalam pertemuan itu di antaranya Ketua Harian IPSI Muchdi PR, Arswendo Atmowiloto (budayawan ), Djaduk Ferianto, dan Dirut PT Sido Muncul, Irwan Hidayat. Muchdi PR mengharapkan agar pencak silat bisa dimasukkan dalam program ekstra kurikuler pelajaran olahraga di setiap sekolah. “Ini seni beladiri asli leluhur kita, seharusnya menjadi mata pelajaran untuk generasi penerus. Kalau bukan kita, siapa lagi yang mau melestarikan pencak silat?” tanya Muchdi. Menurut Eddie Nalapraya, pemerintah mesti deklarasikan pencak silat sebagai olahraga asli Indonesia. “Pemerintah juga hendaknya memperjuangkan pencak silat dapat dipertandingkan pada tingkat Asian Games dan Olimpiade,” tandasnya. Irwan Hidayat mengaku prihatin sekaligus bangga ketika diminta menjadi sponsor event skala internasional pencak silat di Taman Mini Indonesia Indah (TMII) beberapa waktu lalu. “Waktu saya datang ke acara tersebut, ternyata spanduk Kuku Bima EnerG paling besar dan satu-satunya yang jadi sponsor,” ungkapnya. Pihaknya pun jadi terpacu untuk lebih memperkenalkan dan melestarikan pencak silat di tengah masyarakat dengan meluncurkan iklan dibintangi pesilat dan aktor laga, seperti Iko Uwais, Denada, Ade Rai, dan Donny Kesuma. (j03)

Sudoku Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tidak ada keterlibatan matematika, hanya membutuhkan pertimbangan dan logika. Tingkat kesulitan: sedang (***), bisa diselesaikan dalam waktu kurang dari sepuluh menit. Jawabannya lihat di halaman A2 kolom 1.

9 3 4 3 6 7 9 7 6 1 2 8 5 4 1 4 8 9 7 5 3 9 2 6 2 5 3 9 8 6 4 2 3 3 9 m418




Rabu 24 Agustus 2011

McLaren Merasa Di Atas Angin WOKING, Inggris (Waspada): Lewis Hamilton begitu antusias menyambut F1 GP Belgia, Minggu (28/8) nanti. Pebalap McLarenMercedes ini mengaku timnya tengah berada dalam posisi ‘di atas angin’ untuk berlaga di Sirkuit Spa-Francorchamps. AP

Yamaha Motivasi Spies INDIANA, AS (Waspada): Rider Yamaha Factory Racing, Ben Spies (foto), mengaku tidak sabar untuk kembali ke Indianapolis akhir pekan ini. Sebagai pebalap tuan rumah, Spies berharap dirinya bisa fit saat lomba MotoGP Indianapolis tersebut. Spies, meraih kemenangan pertama pada seri MotoGP Belanda di Sirkuit Assen musim ini, mulai menunjukkan performa meningkat. Pebalap asal Texas ini pun sekarang menduduki posisi keenam dalam klasemen sementara. “Saya sudah menantikan semua balapan tahun ini. Dan cukup gila ketika sebagai rookie tahun lalu mampu memenangi sebuah seri grand prix,” ungkap rekan setim Jorge Lorenzo ini, Selasa (23/8). Kendati begitu, Spies menderita cedera pada MotoGP Republik Ceko di Sirkuit Brno, 14 Agustus lalu. Sempat merasa mati rasa, Spies berharap bisa tampil 100 persen dan menunjukkan penampilan terbaiknya di Indianapolis. “Saya sangat berharap benar-benar fit untuk akhir pekan ini. Saya masih sedikit mati rasa di bagian lengan, tapi ini lebih baik daripada di Brno. Kami telah bekerja keras untuk mendapatkan hasil terbaik dan tentu saja akan memberikan 100 persen kemampuan seperti biasanya,” tutur mantan juara World Superbike ini yakin. “Kita akan memberikan pertunjukan yang bagus untuk semua fans tuan rumah dan melihat apa bisa kita lakukan,” ujarnya lagi. Direktur Tim Yamaha, Massimo Meregalli, mengakui pihaknya memasang harapan tinggi pada MotoGP AS nanti. Di lain pihak, Wilco Zeelenberg selaku manajer tim Yamaha mengatakan Spies harus membantu Lorenzo mengalahkan pebalap tim Repsol Honda jika memiliki kesempatan. “Dengan pengalaman Spies di Indianapolis, kami yakin Yamaha dapat merebut kemenangan atau podium nantinya,” kata Zeelenberg menambahkan Lorenzo dan Spies akan memakai seragam merah dan putih khusus plus suku cadang baru pada motornya masing-masing. (m33/auto)


Renault Pecat Nick Heidfeld SPA-FRANCORCHAMPS, Belgia (Waspada): Tim F1 Renault tidak lagi menampilkan Nick Heidfeld (foto) di ajang F1 Belgia, Minggu (28/8) nanti. Posisi pebalap asal Jerman itu akan digantikan keponakan dari mendiang Ayrton Senna, Bruno Senna. Hanya, informasi ini bukan disampaikan langsung oleh tim Renault, melainkan Eddie Jordan, mantan pemilik tim F1 Jordan. Nama Bruno disebut-sebut sebagai calon pengganti Robert Kubica yang mengalami kecelakaan reli awal tahun ini. Namun ia digeser Heidfeld karena tim lebih mengutamakan pebalap berpengalaman dengan tujuan pengembangan R31. Di awal balapan, prestasi Renault cukup mengejutkan. Saat seri pembuka di Australia, pebalap keduanya, Vitaly Petrov (Rusia), finish ketiga. Prestasi ini berlanjut pada seri kedua di Malaysia yang dipersembahkan Heidfeld di podium ketiga. Setelah itu sampai sekarang, performa Renault seperti tenggelam dan kembali ke papan tengah. Bruno Senna, tahun ini absen balap, ditarik Renault sebagai test driver. Pengalaman balapnya didapat dari tahun lalu bersama tim HRT. Di GP Hungaria lalu, Senna diberi kesempatan membesut Renault pada sesi latihan bebas. “Saya senang ketika masih awal-awal musim, tapi secara keseluruhan belum puas. Kami memakainya (Heidfeld), karena lebih berpengalaman dari Vitaly. Nyatanya, penampilannya tidak konsisten,” tegas Gerard Lopez, pemilik saham mayoritas tim Renault, mengaku performa Heidfeld kurang bagus belakangan ini. (m33/auto)

Pasang HP. 081370328259 Iklan Email:

Bukan tanpa alasan Hamilton mengumbar kepercayaan diri. Juara dunia 2008 ini mengantongi keyakinan bakal menaklukkan Sirkuit Spa lantaran McLaren memenangkan dua seri terakhir, di mana dirinya menjuarai GP Jerman (24 Juli) dan Jenson Button merajai Sirkuit Hungaroring (GP Hungaria), akhir Juli lalu.

Bekal itulah yang menjadi motivasi tersendiri bagi Hamilton, guna menghadapi balapan seri ke-12 musim ini. Pebalap yang kini menempati peringkat tiga klasemen sementara (146 poin) ini begitu yakin timnya berpeluang besar mengamankan podium. “Saya rasa, kami datang ke balapan akhir pekan ini dengan posisi yang cukup baik.

Kami (McLaren) telah memenangkan dua seri sebelumnya dan mobil semakin tangguh,” ujar Hamilton, Selasa (23/8). “Kami bekerja keras mengembangkan mobil, jadi hal ini sangat membangkitkan kepercayaan diri. Artinya, kami bisa memberi tekanan lebih jauh terutama pada sesi kualifikasi. Tentunya, akhir pekan ini juga akan dipengaruhi cuaca yang selalu tidak terduga,” tutur pebalap Inggris itu. Mengingat balapan terakhir di Hungaria sempat berlangsung di bawah guyuran hujan, Hamilton sangat berharap cuaca lebih bersahabat di Spa nanti. Hamilton mengaku sudah tak sabar beraksi di atas mobilnya demi memutus do-


LEWIS HAMILTON yakin McLaren bakal kembali meraih podium di Sirkuit Spa-Francorchamps pada GP Belgia, Minggu (28/8) nanti.

minasi pebalap Red Bull Racing, Sebastian Vettel, sang jua-

ra bertahan yang belum bergeser dari puncak klasemen

dengan raihan 234 poin. (m33/auto)

Sumatera Utara

WASPADA Rabu 24 Agustus 2011

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:31 12:44 12:32 12:39 12:38 12:35 12:32 12:27 12:34 12:34

‘Ashar 15:48 15:59 15:48 15:54 15:54 15:53 15:49 15:44 15:51 15:49

Magrib 18:38 18:54 18:39 18:48 18:47 18:40 18:39 18:34 18:41 18:42



Shubuh Syuruq


19:49 20:04 19:49 19:58 19:57 19:50 19:49 19:44 19:52 10:52

04:55 05:06 04:56 05:01 05:01 05:01 04:56 04:52 04:58 04:57

05:05 05:16 05:06 05:11 05:11 05:11 05:06 05:02 05:08 05:07

L.Seumawe 12:37 L. Pakam 12:30 Sei Rampah12:29 Meulaboh 12:41 P.Sidimpuan12:29 P. Siantar 12:29 Balige 12:29 R. Prapat 12:26 Sabang 12:44 Pandan 12:30

06:21 06:33 06:22 06:28 06:28 06:28 06:22 06:18 06:25 06:23

Zhuhur ‘Ashar 15:52 15:57 15:46 15:57 15:47 15:46 15:47 15:44 15:59 15:48





Shubuh Syuruq


Zhuhur ‘Ashar




Shubuh Syuruq


18:46 18:38 18:37 18:49 18:34 18:36 18:36 18:32 18:54 18:36

19:57 19:48 19:47 19:59 19:44 19:46 19:46 19:42 20:04 19:46

04:59 04:54 04:53 05:04 04:55 04:54 04:55 04:52 05:05 04:56

05:09 05:04 05:03 05:14 05:05 05:04 05:05 05:02 05:15 05:06

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:30 12:32 12:42 12:34 12:31 12:38 12:27 12:37 12:30 12:29

18:36 18:39 18:51 18:41 18:39 18:47 18:33 18:44 18:36 18:36

19:46 19:49 20:01 19:51 19:49 18:57 19:44 19:54 19:46 19:47

04:56 04:57 05:04 05:00 04:55 05:01 04:51 05:01 04:55 04:53

05:06 05:07 05:14 05:10 05:05 05:11 05:01 05:11 05:05 05:03

Panyabungan 12:27 Teluk Dalam12:34 Salak 12:32 Limapuluh 12:28 Parapat 12:30 GunungTua 12:27 Sibuhuan 12:27 Lhoksukon 12:36 D.Sanggul 12:31 Kotapinang 12:25 AekKanopan 12:27

06:26 06:21 06:20 06:31 06:21 06:20 06:21 06:18 06:32 06:23

15:48 15:49 15:57 15:52 15:48 15:54 15:44 15:54 15:48 15:46

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

06:22 06:23 06:30 06:26 06:22 06:28 06:18 06:27 06:22 06:20

Zhuhur ‘Ashar 15:46 15:53 15:50 15:45 15:47 15:45 15:45 15:52 15:48 15:43 15:44




Shubuh Syuruq

18:32 18:39 18:39 18:35 18:36 18:33 18:32 18:45 18:37 18:31 18:33

19:42 19:49 19:49 19:45 19:47 19:43 19:42 19:56 19:47 19:41 19:44

04:54 05:01 04:57 04:52 04:55 04:53 04:53 04:59 04:56 04:51 04:52

05:04 05:11 05:07 05:02 05:05 05:03 05:03 05:09 05:06 05:01 05:02

06:20 06:27 06:24 06:19 06:21 06:19 06:19 06:25 06:22 06:17 06:18

Pergantian Kasek Digugat Ke PTUN Waspada/Muhammad Idris

WAKA Polres Tebingtinggi, Kompol Safwan Khayat, Mhum memeriksa barisan tanda dimulainya Operasi Ketupat 2011, Senin (22/8).

361 Personil Amankan Lebaran Di T. Tinggi TEBINGTINGGI(Waspada):PolresTebingtinggimenurunkan 361 personil pengaman dari berbagai satuan pada lebaran 1431 H di kawasan Kota Tebingtinggi dan sektiaranya, dalam Operasi Ketupat Toba 2011. Personil yang diturunkan yakni TNI dan Polisi Militer serta unsur Linmas, Pramuka, Petugas PKS Sekolah dan Anggota Tagana Tebing tinggi dibagi empat titik Pos Pam. “Operasi ketupat ini untuk memberi rasa nyaman kepada masyarakat yang hendak melakukan perjalanan dan memberikan suasana kondusif bagi masyarakat yang akan merayakan lebaran,” papar Kapolres AKBP Drs. Robet HariantoWatratan, S.Sos diwakili Wakapolres Kompol Safwan Khayat, Mhum saat memimpin apel siaga dimulainya Operasi Ketupat 2011 di Lapangan Merdeka, Tebingtinggi, Senin (22/8) pagi. 361 Personil yang akan menjaga mulai dari -8 lebaran hingga +8lebaran.TitikPosPengamanan(PAM)yakni,PosPamdiSimpang Beo Jalan KL Yosudarso, Pos Pam Jalan Medan-Tebing-tinggi di Desa Paya Bagas, Kec.Tebingtinggi, Sergai. Pos PamTebingtinggi Kisaran di Desa Binjai, Kec. Tebing Syahbandar, Sergai dan Pos Pam di Desa Naga Kesiangan, Kec. Dolok Merawan, Sergai. “Peningkatan keamanan secara kwalitas maupun kwantitas perlu mendapat perhatian seluruh pemangku kepentingan yang bisa menciptakan suasana lebih baik dan kondusif,” jelas Kompol Safwan Khayat, Mhum saat membacakan pidato resmi Kapolri, Jendral Timur Pradopo dihadapan peserta Operasi Ketupat 2011.(a11)

BINJAI (Waspada): Kuasa hukum Kepala Sekolah di Binjai tergabung dalam kelompok Air Mata Kepala Sekolah, Maju Tarigan, SH dan Ramli Sembiring, SH menggugat Wali Kota Binjai dalam kasus pengangkatan dan pergantian jabatan Kasek SD, SMP dan SMA.

Keterangan diperolehWaspada, Selasa (23/8), gugatan itu sudah didaftarkan di Pengadilan Tata Usaha Negara (PTUN) Medan, dengan nomor 69/G/2011/ PTUN-MDN tertanggal 22 Agustus. MajudanRamlimenjelaskan, tindakan tergugat menerbitkan SK No. 821.29-323/K/2011 bertentangan dengan peraturan dan perundang-undangan.Terutama mengganti Kasek SMPN I sebagai

penyelenggara Sekolah Bertaraf Internasional(SBI).Kemendiknas No. 78/2009 mengatur jenjang PendidikanDasardanMenengah. Pada pasal 9 disebutkan Kasek SBI wajib berpendidikan minimalS2dariperguruanTinggiyang program studinya terakreditasi. Pada pasal 26 ayat 4 disebutkan Mutasi Kasek PNS pada SBI atau yang dikembangkan menjadi SBI harus mendapat ijin dari Menteri. SK Direktur Pemb SMP Dirjen Manajemen Pendidikan dan Menengah Depdiknas No. 1446/C3/DS/2008 menyebutkan SMPN I Binjai sebagai Rintisan Sekolah Bertaraf Internasional (RSBI). Pergantian Drs. Hasmir tanpa izin Mendiknas dan penggantinya Heriyanto, SP.d belum berpendidikanS2.PengangkatanGumasang Sianipar guru SMAN I menjadi Kasek SMPN 8. Kemudian Pergantian kasek SD 026606 Sakdiyahbelummendudukijabatan Kasek dua tahun. Kasek SDN

020252 Musyiyah dimutasi menjadi guru. Namun Kasek di SDitutidsakditetapkanKaseknya. PengangkatanKasekSDN026559 Jamilah, tetapi penjabat lama Aminton Pakpahan tidak ditetapkan tempat tugasnya. SK mutasi kasekdiBinjaibanyaktidakberdasarkanSKdanperaturanMendiknas, sehingga cacat hukum dan kuasa hukum guru minta dibatalkan melalui PTUN. Sementara informasi di Pemko Binjai menyebutkan tidak gentar terhadap gugatan para guru, sebab ada otonomi. “Jarang gugatan kepada pemerintah menang,” ujar salah seorang penjabat Pemko Binjai. Begitu pun, MajuTarigan, SH dan Ramli Sembiring, SH mengemukakan gugatan itu tidak mencari yang kalah atau menang, tapi mencari keadilan, agar Pemko Binjai tidak sembrono memutasi, bahkan banyak penjabat eselon II di nonjob tapi mereka takut mengadu ke PTUN.(a04)

Tabrak Tronton Parkir, Pengendara Sepedamotor Tewas LUBUKPAKAM(Waspada):Tabraktrontonparkir,pengendara sepedamotorYamahaVega ZR BK 2605 LH, Sumaryadi, 35, warga Gg Darmo, Desa Bangun Sari Tanjung Morawa, tewas ditempat. Insiden maut ini terjadi di Jalinsum Km 34-35 Dusun Kenanga Desa Sukamandi Hilir, Kecamatan Pagar Merbau Deli Serdang, Minggu malam (21/8) sekira pukul 21:50. Sumber yang dihimpun, Sumaryadi mengendarai sepedamotor dating dari arah Tebing Tinggi menuju Lubuk Pakam. Setibanya di Desa Suka Mani Hilir, setahu bagaimana, Sumaryadi, menabrak truk tronton BK 9243 LN yang sedang parker, sementara sopirnya tengah makan di warung seberang jalan. Sumaryadi tewas seketika dalam kondisi kepala luka robek. Selanjutnya, jenazah Sumaryadi dibawa ke RSUD Deliserdang, Lubuk Pakam. Untuk pengusutan sepedamotor korban dan truk tronton BK 9243 LN diamankan Sat Lantas Polres Deli serdang.(a07)

Waspada/Hotma Darwis Pasaribu

KAPOLRES Deliserdang, AKBP. H.Wawan Munawar SIk, MSi memeriksa apel pasukan siap amankan Ramadhan dan Idul Fitri, Senin (22/8).

808 Personil Amankan Ramadhan Dan Idul Fitri LUBUKPAKAM (Waspada): 808 Aparat keamanan siap amankan Ramadhan hingga Hari Raya Idul Fitri di wilayah hukum Deliserdang, dengan membentuk 9 pos pengamanan. Ratusanpersoniltergabungdari589personilPolresDeliserdang bersama jajarannya ditambah 219 personil dari Kodim 0204/ DS, Sub Denpom I/1-3 Lubuk Pakam, Satpol PP, Dinas Perhubungan, Dinas Kesehatan, Pemadam Kebakaran, Bankom Orari, Derek mobil, PMI dan sejumlah Pramuka. Hal itu disampaikan Kapolres Deliserdang, AKBP. H.Wawan Munawar, SIk, MSi, melalui Kasubag Humas, AKP Abdul Hamid Sitorus, usai gelar pasukan Operasi Ketupat Toba 2011, dalam rangka pengamanan Lebaran Idul Fitri 1432-H di halaman Mapolres Deli Serdang, Senin (22/8). Selainitu,PolresDeliserdangbersamatimterkaitakanmemberi penjagaan bagi warga yang melaksanakan sholat Idil Fitri ataupun bagi warga yang sengaja meninggalkan kediamannya. Untuk pengamanan arus mudik lebaran, Polres akan membentuk pos-pos di simpang kayu besar Tanjung Morawa, pos Cemara di simpang empat timbangan dan pos pelayanan di Jalinsum Km 30 di Desa Sukamandi Hilir Kecamatan Pagar Merbau, yang letaknya tidak jauh dari perbatasan Deli Serdang dan Sergai. Sedang. Bahkan dibentuk juga pos pelayanan di tempat-tempat keramaian di Delimas Plaza, Suzuya Plaza, Stasiun Kereta Api, Terminal Bus, pos kota Tanjung Morawa, dan pantai Kasanova Biru-biru.(a07)

Sambut Hari Raya Idul Fitra 1432 H:

Bupati Dan Muspida Sergai Beri Bingkisan 34 Personil Marinir TG. BERINGIN (Waspada): Dalam menyambut Hari Raya Idul Fitri 1432 H Bupati Serdang HT. Erry Nuradi bersama unsyur Muspida Kab. Serdang Bedagai mengunjungi Pulau Berhala, Kec. Tg. Beringin, Kab. Serdang Bedagai dan menyerahkanbingkisanlebarankepada34personil Marinir TNI AL yang bertugas jaga di Pulau itu, Minggu (21/8) pagi. TurutdalamkunjungantersebutDandim0204/ DS Letkol Arh Wawik Dwinanto, S.Sos, Kapolres Sergai AKBP Arif Budiman, S.Ik., MH, Kajari Sei Rampah Erwin Harahap, SH, Wakil Ketua DPRD Sergai Drs. H. Sayuti Nur, M.Pd, Kadis Pendidikan Drs. Rifai Bakri Tanjung, M.AP, Kadis Kanla Ir. H.M. Ramlan Matondang M.Sc, Kadis Tarukim Pertamanan dan Kebersihan H. Herman Sitorus SH, Kabag Humas Dra.Indah Dwi Kumala, Camat Tanjung Beringin Aminuddin S.Sos, Danramil 11/TB Kapten Art JP. Girsang. Komandan Pleton (Danton) Marinir TNI AL Pulau Berhala Lettu (Mar) Sugiarto menjelaskan, jumlah keseluruhan personel prajurit Marinir TNI AL yang bertugas di Pulau Berhala Kec. Tg. Beringin ada 34 orang, sebulan sekali dilakukan

pergantian. Sementara Bupati Sergai Ir. H.T. Erry Nuradi,M.Sidalamarahannyamengatakan,Pulau Ber-hala merupakan 1 dari 92 pulau terluar di Indonesia yang berbatasan langsung dengan negara tetangga Malaysia. Saya memberi apresiasi yang luar biasa kepada seluruh Prajurit Marinir TNI AL yang bertugas di Pulau Berhala, atas segala pengorbanan yang harus jauh dari keluarga demi menjalankan tugas dan tanggungjawab. Sebagaimana filosofi yang berbunyi “jangan tanya apa yang sudah diberikan negara kepadamu, tapi tanyalah apa yang sudah kamu berikan untuk negara,” ungkap Bupati Sergai Ir. H.T. Erry Nuradi, M.Si. Senada dengan Bupati, Dandim 0204/DS Letkol ArhWawik Dwinanto, S.Sos menuturkan keberadaan para Prajurit Marinir TNI AL guna menjaga wilayah perbatasan di Pulau Berhala tersebut merupakan tugas yang sangat mulia. Sementara Wakil Ketua DPRD Sergai Drs. H. Sayuti Nur, M.Pd mendo’akan agar kiranya segala pengorbanan yang diiringi keikhlasan para Prajurit Marinir TNI AL tersebut akan menjadi ibadahyangdiridhoiolehAllahSWT,katanya.(a08)

Safari Peduli PKK Langkat Berlanjut Waspada/Andi Nasution

WARGA Kecamatan Tanjungmorawa, Deliserdang mendesak percepat pengerjaan pelebaran Jalinsum Medan-Tanjungmorawa yang dinilai lamban. Tampak alat berat sedang mengeraskan tanah, Selasa (23/8).

Warga Desak Percepat Pelebaran Jalinsum TANJUNGMORAWA (Waspada): Warga Kecamatan Tanjungmorawa, Kabupaten Deliserdang mendesak pemerintah utamanya Provsu mempercepat pengerjaan pelebaran Jalinsum Medan-Tanjungmorawa dari depan kantor Direksi PTPN II hingga Kedaung Group. Desakan itu disampaikan sejumlah tokoh masyarakat Tanjungmorawa kepada Waspada, Selasa (23/8). Desakan itu juga sangat beralasan, di samping volume kendaraan yang mulai meningkat memasuki arus mudik lebaran, juga dapat membahayakan para pengemudi karena median badan jalan belum juga dikerjakan. H. Ibnu Hajar, tokoh masyarakat di Tanjungmorawa minta Pemprovsu sesegera mungkin

mempercepat pengerjaan pelebaran jalan itu. Dia menegaskan, Kadis PU Deliserdang agar lebih tanggap terhadap pembangunan yang ada di Kabupaten Deliserdang, walaupun itu proyek provinsi. Dikatakan, bila kondisi jalan terus seperti itu pada arus mudik nanti, dikhawatirkan setiap hari terjadi kemacetan arus lalulintas yang panjang. “Dan lebih parah lagi tidak menutup kemungkinan rawan kecelakaan karena median badan jalan belum dikerjakan. Siapa yang bertanggungjawab bila hal itu terjadi.” Tokoh masyarakat lainnya, H. Sofian Hosein menegaskan hal senada. “Memang ada polisi siagaditiap-tiappospengamanan Operasi Ketupat, tapi apa mungkinpadapuncakarusmudikleba-

ran kemacetan dapat dihindari bila kondisi jalan terus seperti itu. Untuk itu diminta Pemprovsu mempercepat pengerjaannya.” Sementara Kapolsek TanjungmorawaAKPMaltoSDatuanyang ditemuidipospengamananOperasi Ketupat di halaman Suzuya Tanjungmorawa juga mengharapkan Pemprovsu mempercepatpengerjaannya.“Kitaberharap sebelum puncak arus mudik lebaran, pengerjaan pelebaran jalan itu selesai. Juga diharapkan Pemprovsu memerintahkan rekanan untuk membersihkan materialdanrambupengerjaanjalan disingkirkan dari badan jalan gunamembantupetugaskepolisian, karena material dan rambu-rambuitudapatmenimbulkankemacetan bahkan kecelakaan lalulintas,” tandas Kapolsek.(c02)

HUT PAN Sergai Diwarnai Deklarasi PMD Dan Bhaksos SEIRAMPAH (Waspada): Menyambut hari ulang tahun (HUT) Partai Amanat Nasional ( PAN) ke 13 yang digelar DPD PAN Kab.Serdang Bedagai diwarnai pendeklarasian Perkumpulan Matahari Desa (PMD) oleh 13 pelaku usaha riil dan bahkti sosial (bhaksos) penyerahan paket sembako kepada 80 kaum duafa dan anak yatim, Senin (22/8) sore di kantor partai Jalan Negara Desa Firdaus, Kec. Sei Rampah. Hadir Ketua POK DPW PAN

Sumut, Hapcin Suharry,Wakil Ketua, Hendra Cipta, Wakil Sekretaris, Suandi, Wakil Bendahara, Julbadri, Bupati Sergai, H.T Erry Nuradi, Ketua MPP DPD PAN SergaiyangjugaWakilKetuaDPRD Sergai, H. Sayutinur, Ketua DPD PANSergai,H.Soekirman,Anggota Fraksi PAN DPRD Sergai. Ketua DPD PAN Sergai, H. Soekirman mengatakan bertepatan di HUT ke13,DPDPANSergai mengawalidengantiga(tri)sukses yakni sukses administrasi dengan

Komputer Rusak, Bayar Rekening Tulis Dikertas P. BRANDAN (Waspada): Konsumen PLN Ranting P. Brandan kecewa atas pembayaran rekening listrik oleh petugas koperasi Jalan Dahlia, Kelurahan Brandan Barat karena tanpa kuitansi pembayaran yang sah. Pelanggan hanya diberi secarik kertas, ungkap pelanggan, kemarin. Keterangan yang dihimpun, komputer di loket koperasi pembayaran rekening PLN Jalan Dahlia tidak berfungsi, sehingga bukti pembayaran hanya di atas kertas.“Ini kan tak sah,” ujarnya. Kepala Ranting PLN P. Brandan, H. Sinaga ketika dikonfirmasi via selular membenarkan, komputer di loket rusak, semestinya konsumen membayar ke loket PLN Ranting Babalan di Jalan Sumatera.(c01)

Waspada/Edi Gultom

BUPATI Sergai Ir. H.T. Erry Nuradi, M.Si bersama Kapolres Sergai AKBP Arif Budiman, S.IK., MH, Dandim 0204/DS Letkol Arh Wawik Dwinanto S.Sos, Kajari Sei Rampah Erwin Harahap, SH dan Wakil Ketua DPRD Drs. H. Sayuti Nur, M.Pd photo bersama setelah memberikan bingkisan kepada perajurit TNI AL yang sedang bertugas di Pulau Berhala,Minggu (21/8) pagi.

Waspada/Edi Saputra

KETUA MPP DPD PAN Sergai, H. Sayutinur didampingi Ketua DPD PAN Sergai,H.Soekirman dan sejumlah pengurus dan undangan membagikan sembako kepada anak yatim dan kaum duafa di halaman kantor partai Jalan Negara Desa Firdaus, Kec. Sei Rampah. Foto direkam, Senin (22/8) sore.

membagikan Rencana Anggaran Pendapatan Belanja Partai (RAPBP) kepada seluruh undangan agar mengetahui sebagai bentuk transparansi. “Ke dua sukses program yang dalam kesempatan ini pendeklarasian PMD oleh 13 orang dari unsur pengurus partai dan masyarakatumumyangmemiliki berbagai jenis usaha rill di Sergai, yang ke depan diharap mampu menciptakanlapangankerjabaru. Ke tiga, sukses Pemilu 2014 yang diharapkan gabungan sukses administrasi dan program akan meningkatkan perolehan suara PAN khusunya DPD PAN Sergai pada Pemilu mendatang.” Bupati Sergai, HT Erry Nuradi mengapresiasi pendeklarasian PMD, di mana saat ini sangat dibutuhkan peran serta kemandirianberagampelakuusahayang ke depan dapat membantu PemkabSergaimenciptakanlapangan pekerjaan baru, sehingga PAN akan dilirik masyarakat di 2014 mendatang, ujarnya. Ketua DPW PAN Sumut diwakiliKetuaPOK,HapcinHarry mengaku salut kepada kepengurusanDPDPANSergaikhusunya Ketua DPDnya yang telah membuat RAPBP dan membagikannyakepadapubliksebagaibentuktransparansiyangmerupakan terobosan baru kiranya dapat diikuti DPD PAN lainnya.(c03)

STABAT (Waspada): Safari Peduli Sesama TP. PKK Langkat yang berlangsung Ramadhan ini, kembali berlanjut guna memberi santunan berupa sembakodantaliasihkepadawargakurangmampu di Kecamatan Stabat dan Gebang belum lama ini. Kami datang untuk menjalin silaturahmi bersama warga terutama yang kurang mampu, kata Hj. Nuraida Ngogesa selaku Ketua TP-PKK Langkat mengawali dialog pada setiap kali berada di perumahan warga yang dikunjungi, Kamis (18/ 8). Kehadiran isteri orang nomor satu di Bumi Langkat tersebut, terkait pembagian sembako, sarung serta menyampaikan amanah berupa tali asih dari Bupati Langkat H. Ngogesa Sitepu. Beberapa rumah dari keluarga kurang mampu yangdikunjungidiKecamatanGebangdiantaranya Inong, 34, warga Lk V Desa Airhitam, Jumiah ,75 warga Lk V Desa Simpang Kolam, Abdul Gani, 31 warga Lk IV Kelurahan Pekan Gebang, Abdul Azis, 59, Abdul Mukti ,76 warga LkV Kolam Dalam Kelurahan Pekan Gebang, Budiono, 55, Tumiran ,51, Ribut, 55, Sugiono, 45,Yuspati,54, Salamah , 58, danNekLasiah,78,wargaDusunVDesaPaluhManis Sebelumnya di Kec. Stabat, rombongan dipimpin Hj. Nuraida Ngogesa menyerahkan ban-

tuan untuk Nek Paini ,70, warga Dusun IV Pasar 6 Desa Ara Condong serta sejumlah kediaman warga lain di antaranya, Syarifah Hanum, 63, Amiruddin, 48 dan Amirwan, 68 warga Ulu Brayun. Kamariah, 76, dan Salamiah 76, Suwandi ,42, DusunVIII Kampung Nangka, Galuh 65 warga Dusun IV PasarVI, Sarkam,70, dan Thuriah (77) Dusun II Randu Alas Desa Ara Condong dan Baharuddin,47,wargaKelurahanKwalaBingai.(a01)

Waspada/Ibnu Kasir

KETUA TP-PKK Langkat Hj. Nuraida Ngogesa mengunjungi rumah warga dari keluarga kurang mampu di Kec. Gebang, belum lama ini.

Pemkab Deliserdang Gelar Bakti Sosial 10 Panti Asuhan LUBUK PAKAM (Waspada): Pemerintah Kabupaten Deliserdang menggelar bakti sosial secara serentak mengunjungi 10 panti asuhan sekaligus menyerahkanbantuansembakoberas,kacanghijau, telur ayam dan mi instan, Senin (22/8). Bakti sosial sebagai kepedulian antar sesama serta rasa syukur atas nikmat kemerdekaan serangkaian peringatan HUT RI ke 66 tahun 2011. Kunjungan ke panti asuhan dibagi 10 tim masing-masing tim I dikoordinir Ketua Tim Penggerak PKKDeliserdangmelaluiWakilKetuaNy.Hj.Asdiana Zainuddin bersama sejumlah pimpinan SKPD dan Camat Lubuk Pakam Drs. Citra Efendy Capah mengunjungi Panti Asuhan Umar Bin Khatab Yayasan Muhammadiyah di Lubuk Pakam. Ny. Hj. Asdiana mengatakan bantuan sebagai tanda kasih sayang sesama warga Deliserdang dengan harapan anak-anak menjadi generasi penerus yang berkualitas. Sedangkan kepada pengurus Panti Asuhan dapat lebih sabar mendidik anak-nak panti, sehingga menjadi amal yang baik di hadapan Allah SWT, harap Ny. Hj. Asdiana. Tim II dikoordinir Ketua DharmaWanita Persatuan Ny. Hj. Fauziah Azwar, mengunjungi Panti Asuhan Madinatul Munawwaroh Desa Bandar Labuhan Kecamatan Tanjungmorawa.

Tim III dikoordinir Kadis Dikpora Ny. Hj. Sa’adah Lubis, SPd, MAP mengunjungi Panti Asuhan KaryaTulus DesaTuntungan Kecamatan Pancur Batu, Tim IV dikoordinir Kadis Pengelolaan Keuangan Daerah Drs H. Hasbi Budiman, M.Si mengunjungi Panti Asuhan Hamdani Desa Tanjung Selamat Kecamatan Sunggal. Tim V dikoordinir Kadis Perindag Ir Artini S. Marpaung mengunjungi Panti Asuhan Pekabaran Injil Desa Sidourip Kecamatan Beringin, Tim VI dikoordinir Kepala Dinas PU Ir. Faisal mengunjungi Panti Asuhan Aisyah Desa Tembung Kecamatan Percut Sei Tuan. TimVII dikoordinir Kaban RSUD Deliserdang dr. Hj. Aida Harahap mengunjungi Panti Asuhan Pelayanan Orang Tua Sejahtera Desa Makmur Kecamatan Sibolangit,TimVIII dikoordinir Kepala Bappeda Ir. H. Irman DJ. Oemar mengunjungi Panti Asuhan Anugrah Sungai Air Hidup Desa Namobintang Kecamatan Pancur Batu, Tim IX dikoordinir Kepala Dinas Kesehatan dr H. Masdulhaq Siregar, SpOG (K), MHA mengunjungi Panti Asuhan Santa Lusia Desa Laut Dendang Kecamatan Percut Sei Tuan dan Tim X dikoordidnir Kadis Perikanan dan Kelautan Ir Zulkifli Nasution mengunjungi Panti Asuhan Betlehem Desa Bandar Baru Kecamatan Sibolangit.(a06)

Waspada/HM Husni Siregar

WAKIL Ketua TP PKK Deliserdang Ny. Hj. Asdiana Zainuddin diabadikan bersama anak-anak yatim Panti Asuhan Umar Bin Khatab Yayasan Muhammadiyah, Lubuk Pakam usai memberi bantuan HUT RI ke 66 tingkat Deliserdang, Senin (22/8).


Sumatera Utara

WASPADA Rabu 24 Agustus 2011

Waspada/Bothaniman Jaya Telaumbanua

PEMERINTAH Pusat terus meningkatkan pengembangan Pelabuhan Gunungsitoli dengan berbagai fasilitas sehingga akses transportasi laut masuk Kepulauan Nias makin memadai.

Puluhan Pemuda Protes Pembalakan Hutan SIMALUNGUN (Waspada): Puluhan pemuda yang tergabung dalam Sahabat Lingkungan (SALING) melakukan aksi demo dan teatetrikal dan demo di DPRD Simalungun, Pamatang Raya, Senin (22/8). Aksi tersebut mereka gelar sebagai bentuk protes terhadap aksi pembalakan hutan yang terjadi akhir-akhir ini di sejumlah kecamatan di Simalungun. Kedatangan puluhan pemuda itu sempat mengejutkan kalangan anggota DPRD Simalungun, karena selain beroras9, para pemuda itu juga menggelar aksi teatrikal pembalakan hutan di Simalungun dengan berkedok IPKTM (Izin Pemanfaatan Kayu Tanah Milik). Aksi yang dikordinatori John Roysen Purba dalam pernyataan sikapnya mengatakan, hutan di Kab. Simalungun sudah banyak rusak akibat penebanganliar. Antara lain di Kec. Dolok Silou dan Silou Kahean, hutan Sigiringgiring di Kec. Purba dan hutan

di Seribujandi. “Yang parahnya lagi, lahanlahan masyarakat berbatasan dengan hutan juga dirampas oleh oknum-oknum tidak bertanggungjawab.DiSindarDolok,Nagori MariahDolok,Kec.DolokSilouterjadipenyerobotanlahanolehpengusaha kayu margaTarigan bekerjasama serta dilindungi oknum aparat berseragam,” cetus Purba. Sekaitan dengan hal itu, pengunjukrasa minta Pemkab menghentikan pengeluaran IPKTM. Kemudian, minta pelaku perambah hutan ditangkap. Bupati Simalungun juga diminta mengevaluasi kinerja Kepala Dinas Kehutanan, dan DPRD mengawasi pengeluaran IPKTM serta melakukan reboisasi atas hutan yang sudah rusak. Menyahuti aspirasi pengunjukrasa,KetuaDPRDSimalungun BintonTindaondidampingiKetua Komisi I Manandus Sitanggang dan Luhut Sitinjak, Abu Sofyan Siregar, Mariono dan Dodi serta Sekwan, SML Simangunsong,

menyampaikan terima kasih terhadap para pemuda yang peduli terhadap kelestarian lingkungan terutama hutan. Dijelaskan, DPRD Simalungunsangatsetujupengeluaran IPKTM ditinjau kembali, karena memang sudah ada sejak tahun 2006.Dikatakan,selamainidewan jugatetapmengingatkanPemkab Simalungun agar selektif dalam pengeluaran IPKTM. Artinya, Pemkab Simalungun harus benar-benar mengetahui kondisi atau keadaan lahan sebelum dikeluarkannya IPKTM. Terkait dugaan terjadinya tangkap lepas terhadap perambah hutan, Binton mengatakan pihaknya tidak dapat menindak secara langsung, namun permasalahan itu akan ditindaklanjuti. “Kalau memang mengetahui dan punya bukti, baru dapat kita tangkap,” tegas Binton. Setelah menerima penjelasan dari Ketua DPRD dan anggota dewan, para pengunjukrasa akhirnya membubarkan diri dengan tertib.(a29)

Dikeroyok Gara-gara Suara Sepeda Motor PEMATANGSIANTAR (Waspada): Gara-gara suara sepeda motornya mendadak keras, seorang pelajar SMK Juli Andriano, 17, warga Jalan Gurilla, Blok IX Sibatubatu,Kel.BahSorma,Kecamatan Siantar Sitalasari, Kota Pematangsiantar babak belur dikeroyok beberapa pria. Pengeroyokan itu, sesuai keterangan pengaduan korban di Polsek Siantar Martoba, Polres Pematangsiantar, Minggu (21/ 8) dilakukan Fr, 19, wiraswasta, wargaJalanSibatubatu,GangPulau Batu, Kel. Bah Sorma, Kec. Siantar Sitalasari dan kawan-kawan. Kejadian itu di Jalan Sibatu-batu, Kel. Bah Sorma, Kec. Siantar Sitalasari,Sabtu(20/8)pukul22:30. Sebelum pengeroyokan, sekitar pukul 22:15, korban dengan

mengenderai sepeda motornya melaju menuju pulang ke rumah dan melewati Fr dan kawankawannyayangjugamengenderai sepeda motor. Saat melewati Fr dan kawankawannya, mendadak sepeda motor korban mengeluarkan suara keras, karena saat mengganti gigi sepeda motor, korban gantung melakukannya. Namun, Fr dan kawan-kawannya menganggap korban sengaja menggeber suara sepeda motornya di dekat mereka hingga mereka langsung memaki-maki korban dengan kata-kata kasar. Korban tidak menanggapinya dan terus melaju pulang ke rumahnya. Beberapa saat kemudian, korban kembali keluar rumahnya dan berangkat dengan mengen-

derai sepeda motornya menuju arah Kel. Tanjung Pinggir. Saat melintas di Jalan Sibatubatu, tibatiba salah seorang kawan Fr menarik sepeda motor korban hingga sepeda motor korban oleng dan terpaksa berhenti. Fr dan kawan-kawannya segera mendekati korban dan langsung mengeroyok dan memukuli korban membabibuta. FR dan kawannya berhenti sesudah puas memukuli korban hingga korban segera pergi meninggalkan Fr dankawannya. Kapolres Pematangsiantar AKBP Alberd TB Sianipar, SIK, MH saat dikonfirmasi melalui Kasubbag Humas AKP Altur Pasaribu dan Kasat Reskrim AKP Azharuddin, Senin (22/8) membenarkan.(a30)

334 Personil Aparat Amankan Lebaran PEMATANGSIANTAR (Waspada): 334 Personil aparat berwajib dikerahkan untuk pengamanan sebelum dan sesudah Hari Raya Idul Fitri. Kapolres Simalungun AKBP M Agus Fajar, SIK melalui Kasubbag Humas AKP H Panggabean, SH menyebutkan itu usai gelar pasukan Operasi Ketupat Toba 2011 di lapangan kantor bupati di Kel. Pematang Raya, Kecamatan Raya, Senin (22/8). Dalam gelar pasukan itu, Dandim0207/SimalungunLetkol Arh. R Edi Setiawan sebagai Irup, Danup AKP Putra Jani Purba dan Perwira Upacara Kompol Ramli Sirait. Panggabean menyebutkan

personil yang dikerahkan terdiri personil Polres 160 orang, Brimob 20, Kodim 0207/Simalungun 30, Yonif 122/TS 30, Denpom I/1 20, Korsik 10, Satpol PP 15, Dishub 15, Kesehatan 5, Pemadam Kebakaran 5, Dinas Bina Marga 10, Derek4 danTim SAR DanauToba 10. Gelar pasukan Operasi Ketupat Toba juga di Kota Pematangsiantar,danWaliKotaHulman Sitorus, SE sebagai Irup dan Danup Ipda David Sinaga. Walikota juga menyematkan tanda peserta Operasi Ketupat Toba2011kepadamasing-masing perwakilan. Gelar pasukan yang dilaksanakandilapanganHAdamMalik,

Senin(22/8)dihadiriDanrem022/ PT Kolonel Inf Karsiyanto,Wakil Walikota Drs Koni Ismail Siregar, Kapolres AKBP Alberd TB Sianipar, SIK, MH,Waka Polres Kompol M Anggi Siregar, SIK dan lainnya. SedangkanWalikotamenambahkan wilayah Pematangsiantar sebagai daerah yang dilintasi Jalinsum memerlukan kesiapan dankesiagaandalammenghadapi perayaan Hari Raya Idul Fitri itu yang berdampak pada peningkatan aktivitas dan mobilitas masyarakat. Polres Pematangsiantar,agarsemaksimalmungkin memberikan rasa aman dan nyaman kepada masyarakat, harap Wali Kota.(a30)

Waspada/Edoard Sinaga

INSPEKSI pasukan Pam Lebaran 1432 H oleh Walikota Hulman Sitorus, SE selaku Irupdi lapangan H Adam Malik, Kota Pematangsiantar, Senin (22/8).

Wali Kota Gunungsitoli Tinjau Pasar GUNUNGSITOLI (Waspada):Wali Kota Gunungsitoli, Drs. MarthinusLase, M.SP dan instansi terkait menjelang lebaran meninjau harga sembilan bahan pokok di beberapa pasar, Jumat (19/8). Pasar itu Nou dan Beringin di Jalan Sudirman untuk melihat langsungfluktuasihargasembako. Wali Kota Gunungsitoli Marthinus Lase didampingi Kadis Perindustrian, Koperasi, UKM dan

Perdagangan Kota Gunungsitoli Abdul Majid C, SE berdialog dengan para pedagang. Selain pedagang, Wali Kota Gunungsitoli juga berdialog dengan masyarakat yang berbelanja sembako. Wali Kota belum melihat ada peningkatan harga yang signifikan. Marthinus mengatakan. Pemko tidak ingin masyarakat khususnya umat Muslim mudah memperoleh sembako.

Dia mengimbau seluruh pedagang tidak mencari kesempatanmenjelanglebaranmenaikkan harga sembako. Menyinggung masalah sampah,Wali Kota menjelaskan beberapaMingguterakhirPemko mengalami kesulitan karena terkendala armada pengangkut mengalami kerusakan. Namun, telah diantisipasi dengan menyewa angkut sampah.(a25)

Bersambung ke hal. B3

Sambungan dari hal. B2

WASPADA Rabu 24 Agustus 2011

Sumatera Utara


Waspada/Idaham Butar-butar

OPERASI Pasar Murah untuk warga desa Parsombaan sekitar, termasuk desa Sihiuk, Pagaran Mompang, dan desa Parsombaan, Kec. Lubuk Barumun, Minggu (21/8).

Pasar Murah PT VAL Membantu Masyarakat LUBUK BARUMUN (Waspada): Operasi Pasar Murah minyak goring (migor) yang dilaksanakan PT Victorindo Alam Lestari (PT VAL) dan PT Permata Hijau Sawit (PHS) di wilayah Kab. Padanglawas sangat membantu masyarakat, di saat harga migor naik sepanjang Ramadhan menjelang Lebaran Idul fitri. Demikian salah seorang warga kepada Waspada di desa Parsombaan, Minggu (21/8), di sekitar lokasi lokasi operasi pasar murah minyak goreng yang dilaksanakan oleh PT VAL. Dengan operasi pasar murah yang dilaksanakan PTVAL, di mana saat ini harga minyak goreng curah bisa mencapai Rp10.000/liter, di sini dijual dengan harga Rp7.500/liter. Hal ini benar-benar membantu bagi masya rakat Padang Lawas, khususnya dari kalangan

ekonomi lemah, untuk itu kita sangat berte rimakasih atas perhatian pihak manajemen perusahaan yang telah berinisiatif melaksanakan operasi pasar migor di daerah ini. David Siburian KDP PT VAL diwakili KTU, Ranto Nasution, saat membuka pelaksanakan operasi pasar murah di desa Parsombaan, Kec. Lubuk Barumun, mengatakan pelaksanaan operasi pasar murah migor yang dilakukan itu merupakan bentuk kepedulian pihak manajemen perusahaankepadamasyarakatsekitarlingkungan perusahaan. Dikatakannya, dalam operasi pasar murah migor yang dilaksanakan PT PHS dan PT VAL tahun ini, akan menyalurkan sekitar 8.000 liter minyak goreng untuk wilayah Kab. Padang Lawas. (a32)

PANYABUNGAN(Waspada):Berbagaielemen masyarakat di Kabupaten Mandailing Natal (Madina( mengingatkan seluruh Satuan Kerja PerangkatDaerah(SKPD)danrekanantransparan danterbuka,denganmencantumkanplankproyek. ”Hal ini penting supaya masyarakat bisa mengawasi proyek yang sedang berjalan. Plank sudah menjadi keharusan proyek yang dibiayai negara. Di dalamnya mencakup transparansi anggaran, volume pekerjaan, nama rekanan hingga waktu pengerjaaan,” ujar AbdulWaris Rangkuti, sebagaiWakil Ketua DPC PKB Madina di Panyabungan, Selasa (23/8). Dia mengatakan, selama ini banyak pekerjaan fisikdiMadinatidakadaplankproyeknya.Akibatnya sulit diawasi. Tapi 2011 proyek pembangunan harus terbuka kepada masyarakat (publik).Waris menjelaskan, karnea sebagian besar pekerjaan proyek berbiaya besar, setidaknya setiap SKPD pengelola harus memerintahkan rekanan untuk tertib administrasi dan memasang plank proyek. Plank tersebut dipasang di lokasi yang mudah dibaca. ”Selama ini plank proyek dipasang hanya untuk dokumen proyek tersebut, dan tidak pernah dipajang agar diketahui umum,” tambahnya. Sorotan serupa juga disampaikan aktivis LSM S.Syukur Nasution. Kontraktor dan pengawas proyekdiMadinajanganmengabaikanpembuatan dan pemasangan plank proyek. Sangat disesalkan, katanya, kesadaran kontraktor serta pengawas masih rendah.

Menurutnya, masih banyak yang menganggap plank proyek sepele dan tidak perlu. Mereka menganggap itu hanya buang-buang waktu. Padahal lanjutnya, dengan tidak dibuatnya plank proyek sesaat setelah waktu pelaksanaan proyekdimulaimenandakansecaratidaklangsung mereka bisa dikenai tuduhan menutup-nutupi suatuhakpublikuntukmendapatinformasi.Sesuai UU KIP (Keterbukaan Informasi Publik). “Tidak adanya plank proyek terpasang di Madina, maka publik meyakini proyek itu penuh KKN. proses tendernya tidak jelas, pelaksanaannya juga tak jelas diawasi. Belum lagi tuduhan penyelewengandanakarenaanggaranpembuatan papan nama sendiri selalu ada dalam kontrak manapun,” paparnya. Sedangkan Harun Arrasyid Lubis sebagai tokoh pemuda, juga menganggap pembuatan papan proyek di setiap proyek fisik di Madina, bukan hanya sebagai komponen pelengkap, tetapi harus dapat menjelma menjadi identitas eksistensi proyek itu sendiri. Papan proyek jelasnya, bukan hanya sebagai plank, tetapi juga merupakan penjamin pertama apakah transparansi anggaran dapat dilaksanakan atau tidak. Dariawalproyekyangdikerjakanharusmelalui proses pra lelang, pelelangan, pelaksanaan, pengawasan sampai akhir yaitu pemeliharaan sebuah proyek pembangunan. Dalam pra lelang tidakbolehlagiadapengumumanadanyapekerjaan atau bentuk pekerjaan yang ditutup-tutupi.(a28)

diri dalam mengabdi kepada agama, masyarakat, partai, keluarga dan negara. “Karena hanya dengan inropeksi diri itulah, kita mampu memanajemen diri untuk membina mental masyarakat lewat dakwah dan visi misi par-tai.Dengandemikian,DPDPANMadinabukan hanya wadah berkumpulnya kalangan intelektual, agamais, humanis, dan simpatis.Tapi juga wadah perjuangan asiprasi masyarakat untuk perbaikan kehidupan di semua elemen,” ucap Sidiq. Anak Yatim Hari ke 3 safari Ramadhan DPD Partai Amanat Nasional (PAN) Madina menyantuni belasan anak yatim piatu, baru-baru ini di Kecamatan Panyabungan Timur. Penyantunan dilaksanakan usai buka puasa dansholatbersamarombonganDPDPANMadina bersama elemen masyarakat Kecamatan Panyabungan Timur, diperkirakan berjumlah seratusan orang, di Mesjid Nurul Iman Desa Padang Laru Panyabungan Timur. Penyantunan anak yatim diserahkan anggota DPRD Madina dari PAN, Sofyan Edy Saputra alias Pisank didampingi Ketua DPD PAN Madina, H. Nis’at Sidiq Nasution, Sekretaris, Hj. Sitimour, dan Wakil Ketua, H. Syahminan Rangkuty. Ketua DPD PAN Madina juga memberi bantuan ambal untuk tambahan perlengkapan mesjid. Hadir sesepuh PAN Madina, H. Marataman, Ahmad Bahori, Edy Gultom, dan sejumlah pengurus teras PAN lainnya.(c14)

Pemkab Madina Dan Kontraktor Anggap Plank Proyek Tak Perlu

Polisi Ringkus Delapan Tersangka Curanmor, Dua Ditembak RANTAUPRAPAT (Waspada): Polres Labuhanbatu meringkus 8 tersangka pencurian kendaraan bermotor (Curanmor) dan jambret, sedangkan duadiantaranyaditembakkakinya karena coba melarikan diri. Para tersangka beraksi di wilayah hukum Polsek Aek Kanopan, Labura serta PolsekTorgamba, Sei Kanan, Labusel. KapolresLabuhanbatuAKBP

Hirbak Wahyu Setiawan, S.Ik didampingiWakapolres Kompol Tetra Darmariawan S.Ik, Kasat Intelkam AKP Mijer, Kasubbag Humas AKP MT Aritonang, Kaurbin Reskrim Iptu Herry S, Senin (22/8) di Aula mapolres membenarkan penangkapan para tersangka curanmor dan jambret. Kapolres mengatakan, delapan tersangka di antaranya dari

Polsek Kualuh Hulu, 4 tersangka dan dua di antaranya dengan pencurian kekerasan (Curas) yakni AM alias Camman sebagai gembong curanmor yang kerap beraksi di Aek Kanopan, dia ditembak kakinya, sedangkan tersangka lain Sy, MS, RYK. Tiga tersangka dari Polsek

Torgamba yakni, BPS (ditembak bagian kaki) dan BHS keduanya merupakan tersangka penjambretan,sertatersangkacuranmor RR. Sedangkan dari Polsek Sei Kanan tersangka AS yang dipukuli warga setempat, jelas Kapolres. Sedangkan AM alias Cam-

Ketua DPRD Tapsel Santuni 1.000 Anak Yatim Dan Fakir Miskin P. SIDIMPUAN (Waspada): Sebagai bentuk rasa syukur kepada Allah SWT dan kepedulian terhadap sesama umat, Ketua DPRD Tapanuli Selatan, H Rahmat Nasution S.Sos, bersama ke-

luargamenyantuni1.000ananak yatim dan fakir miskin di rumah pribadinya, di Jalan Sutan Muhammad Arief No.113, Kota Padangsidimpuan. Menyantuni anak yatim dan


BSM P. Sidimpuan Santuni 70 Anak Yatim P. SIDIMPUAN (Waspada): Bank Sayariah Mandiri (BSM) Cabang Padangsidimpuan menyantuni 70 anak yatim. Demikian dikatakan Kepala Cabang BSM-Psp Basrah Siregar melalui Ketua panitia, Irsan Tahir kepada Waspada, Senin (22/8) petang di kantor Cabang BSM Kota Padangsidimpuan. Hadir ratusan karyawan dari beberapa kantor cabang pembantu Panyabungan, Sipirok, Gunungtua, Sibuhuan dan Batangtoru. Sedangkan santunan yang diberikan terhadap anak yatim dan puluhan kaum dhuafa berupa uang tunai dan sajadah untuk mushalla di panti asuhan. Selain itu ungkapnya, kegiatan peduli terhadap kaum Dhuafa dan anak yatim dari panti asuhan di Jalan Melati bekerjasama dengan Lembaga Amal Zakat Nasional (Laznas BSM). Laznas BSM simpati umat dan mitra umat merupakan kepedulian serta ucapan syukur atas berbagai keberhasilan yang diraih BSM, selain itu acara tersebut juga sebagai momentum untuk meningkatkan silaturrahmi bersama karyawan BSM. Sementara, tausiyah disampaikan Ustadz H Ali Anas Nasution, MA. Menurutnya, hikmah Ramadhan dapat membentuk karakter dan kepribadian Muslim yang sabar, saling berbagi antara orang kaya dan orang miskin sebagai cerminan timbal balik kehidupan.(c13)

PAN Madina Safari Ramadhan Dan Santuni Anak Yatim

P. SIDIMPUAN (Waspada) : Wujud terima kasih Kepada Allah SWT telah memberikan rizki-Nya kepada Yayasan Keluarga Sejahtera,sehiggaAMIKINTelComGLOBALINDOPadangsidimpuan menggelar buka puasa bersama ratusan anak yatim se-Kota Padangsidimpuan di aula MAN 2 Padangsidimpuan, baru-baru ini Acara dihadiri Ketua Yayasan Keluarga Sejahtera Sumut Ir Samsuddin Lubis,MM, pimpinan cabang Amik INTel Com GLOBAL INDO se- Sumut, Kepala Kantor Kementrian Agama Kota Padangsidimpuan diwakili KasubbagTU, M. Lukman Siregar, Ustadz Syahrul Efendi Siregar dari Medan, para satf dan mahasiswa/wi AMIK INTel Com GLOBAL INDO Padangsidimpuan KetuaYayasan Keluarga Sejahtera Sumut, Ir. Samsuddin Lubis, MM mengatakan, pelaksanaan acara buka puasa bersama tersebut didasari pada rasa kesadaran dalam mensyukuri nikmat dan rizki yangtelahdiberikanAllahSWT.Selainitu,kegiatantersebutdilaksanakan sebagai salah satu kreatifitas dilingkungan AMIK INTel Com GLOBAL INDOuntukmengisikegiatanditengah-tengahbulansuciRamadhan, bulan yang selalu dinanti-nanti oleh seluruh ummat muslim sedunia untuk menjalankan ibadah. (c13)

fakir miskin dari berbagai panti asuhan, lingkungan, desa, kelurahan se Tapsel dan Padangsidimpuan ini digelar selama tiga hari, mulai Senin kemarin. Acara santunan yang dirangkai buka puasa bersama ini juga dilanjutkan dengan shalat Magrib, Isya, danTarawih berjamaah dan tausyiah disampaikan al ustadz. Seperti Kamis (18/8) malam kemarin, tausyiah disampaikan Ustadz Yusuf Amiril Soleh Nasution gelar Tuan Nalomok. H Rahmat Nasution dalam sambutannya meminta anak yatim dan fakir miskin pada momen HUT Kemerdekaan RI ke-66 dan bulan suci penuh berkahinitidakmaukalahdengan keadaan. Tetap rajin menuntut ilmu dan beribadah sebagai bekal untuk masa depan yang lebih cerah nantinya. “Anakyatimadalahbagiandari calon penerus bangsa, harus lebih giat sehingga cita-cita bisa tercapai kelakdikemudianhari,”ujarKetua DPD Partai Golkar Tapsel ini memberikan motivasi.(a27)

4 Kecamatan Di Madina Belum Miliki Pasar Permanen

PANYABUNGAN (Waspada): DPD Partai Amanat Nasional (PAN) Madina menggelar safari Ramadhan 1413 H diisi buka puasa bersama dan pemberian bantuan perlengkapan sholat di masjid. Demikian disampaikan Ketua DPD PAN Madina,H.Nis’atSidiqNasution,kepadaWaspada, Selasa (23/8), di kantornya Jalan Lintas Sumatera, Desa Pidoli-Panyabungan. Katanya, Safari Ramadhan di pusatkan di beberapa titik ibu kota kecamatan dimulai dari Kecamatan Muara Sipongi, Kamis (11/8), di Masjid Al – Islam, dan Sabtu (13/8) di Masjid Nurul Huda Kec.Siabu.KemudianSenin(15/8)diPanyabungan Timur penyantunan anak yatim piatu. Kegiatan dipimpin Ketua DPD II PAN Kabuapten Mandailing Natal (Madina), H. Nis;at Sidiq Nasution dan Sekretaris, Hj. Sitimour. Kemudian pengurus teras DPD II serta pimpinan ranting dan kader. Al Ustad pemberi tauziah siraman rohani, Syahminan Rangkuty dan Ahmad Soleh yang merupakan pengurus DPD PAN, tokoh masyarakat, alim ulama, NNB, dan simpatisan PAN di perkirakan ratusan orang. Ketua PAN Madina, Nis’at Sidiq mengatakan, Safari Ramadhan ini dalam mempererat ukuah Islamiyah di antara kader PAN dan umumnya dengan masyarakat Madina. Ia berharap pengurus dan kader PAN tingkat kabupaten sampai desa, dapat menjadikan momen bulan suci Ramadhan untuk intropeksi

PANYABUNGAN (Waspada): Empat kecamatan di Kab. MandailingNatal(Madina)belummemiliki pasar permanen yakni Muara Batang Gadis, Huta Bargot, Ulupungkut dan Puncak Sorik Merapi. Meskipun ada tapi hanya pasar yang dibangun masyarakat sendiri atas prakarsa mereka dan belumdibinapemerintahdaerah. Berdasarkan keterangan, pasar di DesaTabuyung. Kec. Muara Batang Gadis dibangun beberapa tahun lalu dengan dana Program Pengembangan Kecamatan (PPK)dantidakdifungsikanpedagang dengan berbagai alasan. Diantaranya,lokasipasarjauh dari jalan utama sehingga pedagang maupun pembeli sulit mengangkut barang terutam musim hujan dan jalan menuju lokasi masih tanah. Hampir sama kondisinya di Ulupungkut. Pemerintah telah membangun pasar terdiri dari

yang dikelola Dinas Pasar Madina 30 yang tersebar di 17 kecamatan, sementara jumlah pasar desa 15 di beberapa desa. Pasar desa itu juga belum terbina/dikelola optimal, padahal prospek pengembangannya cukup baik untuk meningkatkan sumber-sumber Pendapatan Asli Daerah(PAD)dengansistimkerjasama bagi hasil. Pasardesasalahsatukekayaan desadanmerupakansumberpendapatan desa serta sarana pengembangan ekonomi masyarakat dan pendapatan desa yang hasilnya diperuntukkan untuk pembangunan desa dan umumnya pasar desa buka pada pagi hari. Untuk itu, pasar tradisional di Madina sangat memerlukan pembinaan dan pengembangan dalam rangka intensifikasi dan ektensifikasi sumber-sumber Pendapatan Asli Daerah ( PAD).(a28)

KETUA DPD II PAN Madina,H.Nis’at Sidiq Nasution didampingi Sekretaris,Hj.Sitimour menyerahkan bantuan perlengkapan mesjid, di Masjid Nurul Huda, Kecamatan Siabu.

AMIK INTel Com GLOBAL INDO Santuni Ratusan Anak Yatim

KEPALA Kantor Cabang BSM Padangsidimpuan Basrah Siregar, menyantuni anak yatim dari panti asuhan Jalan Melati Kota Padangsidimpuan di kediamannya, Sabtu (20/80 petang.

man (ditembak) merupakan pemain lama yang kerap beraksi di wilayah hukum Polsek Kualuh Hulu denganTKP DusunVI, Desa Sidua-dua, Kec. Kualuh Selatan, Labuhanbatu Utara, mencuri sepeda motor Supra X 125 TD BK 2345 YAJ yang parkir depan rumah.(a17)

kios dua unit dan loods 18 unit dan sampai sekarang tidak difungsikan pedagang karena masih berfungsinya pasar tradisional yang dikelola pemuka masyarakat setempat. Alasan para pedagang, lokasi pasar tradisional di pinggir jalan dan sudah lama para pedagang berjualan di pasar Sutan Singasoro. Sementara, Kec. Hutabargot sampai saat ini belum ada dana pemerintah untuk pembangunannya, sehingga masyarakat di kecamatan itu masih tetap memanfaatkanpasaryangsudah lama usianya dan merupakan bangunan masyarakat. Begitu juga pasar Hutanamale Kec. Puncak Sorik Marapi, masih perlu pembinaan, karena lokasipasarsekarangmerupakan tanah hibah dari Syekh Juaidi Tolha dan masih perlu penambahan kios dan loods. Keterangan diperoleh, pasar

Waspada/Sarmin Harahap

Sumatera Utara


Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir

Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: Edward Thahir. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Armin R. Nasution. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Aji Wahyudi (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Feirizal Purba (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi). Wartawan Kota Medan: Umum: Zulkifli Harahap, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, David Swayana, Gito AP, Rizaldi Anwar, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa, Maini Anggita, Silfa Humaira. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Dedek Juliadi, Hajrul Azhari Ritonga. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebing Tinggi: Muhammad Idris, Abdul Khalik. Pematang Siantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Pakpak Bharat: Arlius Tumanggor. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun. Kuala Simpang: Muhammad Hanafiah, Hasanul Hidayat. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar. Lhoksukon: Musyawir. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengon: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Bustanuddin, Wintoni. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan Waspada dilengkapi dengan kartu pers. Tidak dibenarkan menerima uang dalam bentuk apapun. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan: hitam-putih Rp. 33.000,-, berwarna Rp. 90.000,Ukuran kolom: 40,5 mm. E-mail Iklan: Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Polisi Bekuk ‘Pembunuh Batam’ Di Asahan BUNTUPANE, Asahan (Waspada): Polres Barelang, Polda Kepulau Riau (Kepri) bekerjasama dengan Polsek Parapatjanji Polres Asahan membekuk tersangka pembunuh, Selasa (23/8) sekitar pukul 00:30. Informasi dihimpun, tersangka ST, 23, warga Dusun IV, Desa Buntupane, Kecamatan Buntupane, Kabupaten Asahan, diringkus di rumah orangtuanya, oleh Personil Polres Barelang, dan Polsek Prapatjanji. Tersangka diamankan karena melakukan pembunuhan seorang pria, di Batam pada 11 Agustus lalu. Kapolres Asahan, AKBP Marzuki MM, dikonfirmasi melalui Kapolsek Prapatjanji, AKP Syahril M, membenarkan penangkapan itu, dan kini tersangka masih dalam pemeriksaan dan akan dibawa ke Batam, untuk diproses sesuai tindakannya. “Kita dengan Polres Barelang, bekerjasama mencari tersangka, berkat informasi warga, tersangka dapat kita ringkus. Tersangka juga diketahui telah bekerja di Batam, namun karena membunuh rekan kerjanya, dia melarikan diri dan pulang kampung,” jelas Sayhril.(a15)

DPC PPP Labuhanbatu Peringati Nuzul Qur’an RANTAUPRAPAT (Waspada): Dewan Pengurus Cabang Partai Persatuan Pembangunan (DPC-PPP) Kabupaten Labuhanbatu mengadakan malam Nuzul Qur’an di sekretariat DPC PPP jalan Sisingamangaraja Rantauprapat, Minggu (21/8) malam. Wakil Bupati Labuhanbatu Suhari Pane mewakili Pemerintah DaerahKabupatenLabuhanbatu,mengatakanvisitentangperubahan yang sedang diprogram antara lain pembangun jalan di pesisir pantai dan pembangunan listrik melalui mesin ginzet yang rencananya akhir bulan Agustus ini dapat dinikmati warga di sekitar pesisir pantai atau selambat-lambatnya awal bulan Septenber 2011. Suhari juga memberi aspreasi terhadap para lulusan Al’washliyah Labuhanbatu atas keberhasilannya diterima di perguruan tinggi negeri dalam menuntut ilmu dan berharap kepada semua siswa/ i yang ada di perguruan Al’washliyah Labuhanbatu menjadi tauladan di tengah-tengah masyarakat yang berilmu dan bertaqwa. Sebelumnya Ketua DPC PPP Labuhanbatu IrWira Abdi Dasopang MSp,mengatakansaatMuktamarPPPdiBandungulamase-Indonesia menyebutkan PPP Rumah Besar Umat Islam, karena cita-cita yang idealis oleh kader PPP sangat mendukung. “Beban yang kami pikul rasanya ringan, apabila dukungan dari berbagai ormas Islam untuk bersama di Rumah Besar umat Islam,” ujar Wira. (c07)

WASPADA Rabu 24 Agustus 2011

Pengemis Menjamur Dan Meresahkan Di Labusel Ka Satpol PP: Masih Pantau Sistem Operasinya KOTAPINANG (Waspada): Beberapa waktu belakangan keberadaan pengemis di Kabupaten Labuhanbatu Selatan makin menjamur. Ulah pengemis tersebut kian meresahkan, sebab puluhan pengemis setiap hari beroperasi di pasar, kantor pemerintah, bahkan hingga ke pemukiman warga. Pengamatan Waspada, praktik yang dilakukan pengemis ini berbagai cara, mulai menggunakan proposal pembangunan masjid, panti asuhan, membawa orang cacat, hingga memanfaatkananak-anakdanorangtua.Mereka mengemis dari satu warung ke warung lain, pertokoan, bahkan ke rumah-rumah warga. Parahnya, di antara pengemis itu terlihatadayangmasihkuatuntuk melakukan usaha lain yang lebih baik, namun mereka lebih memilih hidup mengharapkan belas kasihan orang. Menurut warga, yang membuatresahyaknibanyakpengemis

yang suka ngotot saat mengharapkan sedekah. Bukan itu saja, pengemis-pengemisitupuntidak segan-segan mendatangi warga yang sedang makan di warung. “Mereka berdiri di depan kita, merekatidakmauberanjak,sebelum diberi uang. Kalau pas ada uang kecil nggak masalah, kalau lagi nggak bawa recehan kan malu,dikirainawakkikirkali,”kata salah seorang warga Kotapinang, Rusdiansyah, Selasa (23/8). Rosmida warga Desa Asam Jawa, KecTorgamba juga mengaku, hampir setiap hari ada pengemis mendatangi pemukiman mereka. Pengemis-pengemis itu bahkan nekat membuka pintu pagar rumah warga meski telah dikunci. “Memang meresahkan juga,” kata ibu tiga anak itu. Hermansyah, warga Desa Bangai, Kec.Torgamba menduga, sebagian besar pengemis yang kerapberoperasidiwilayahLabuseltersebutbukanpendudukLabusel. Sebab, setiap kali pengemis datangmenyambangikediamannya,diatidakpernahmengenalinya. Dugaan itu boleh jadi benar, salahseorangpengemisbernama Irwan, 10, yang ditemui Selasa saat mengemis di salah satu ru-

mah makan menyebut dirinya warga Sigambal, Kec. Bilah Hulu, Kab. Labuhanbatu. Bocah yang mengaku masih sekolah di salah satu SD di kampungnya itu mengatakan datang ke Kotapinang bersama teman-temannya. Namun saat ditanya siapa yang membawa, dia memilih bungkam lalu pergi. MenanggapiituKepalaSatpol PP Pemkab Labusel, Ichlas mengatakan, sejauh ini memang belum ada koordinasi antara Dinas Sosial, Tenaga Kerja, dan Transmigrasi dengan pihaknya, tetapi rencana untuk menertibkan keberadaan pengemis-pengemis tersebut sudah ada. Namun rencana itu belum dapat dilakukan karena pihaknya masih kesulitan memastikan keberadaan pengemis tersebut. Dia juga mengakui, sebagian besar pengemis yang beroperasi saatinibukanlahpendudukLabusel, melainkan datang dari daerah lain.“Merekainikanbergerakterus dan kebanyakan bukan warga Labusel.Jadikitamasihmemantau sistemoperasinya.Nantikalaumemangsudahjelaskitaakantangkap danbinaagarmerekatidakmengemis lagi,” kata Ichlas.(c18)


PASAR murah minyak goreng dari PMKS PT Nubika Jaya, diserbu warga Dusun Bloksongo Desa Sisumut.

Jelang Idul Fitri PMKS PT Nubika Jaya Berikan Bansos

KOTAPINANG (Waspada): Pabrik Minyak Kelapa Sawit (PMKS) PT Nubika Jaya Dusun Bloksongo Desa Sisumut, Kec. Kotapinang Labuhanbatu Selatan (Labusel) Senin (22/8), memberikan Bansos (bantuan Sosial) berupa kainsarungdanuangtalikasihsertaminyakgoreng di dusun Karangsari kantor Kepala Desa Sisumut dan Dusun Bloksongo Desa Sisumut. Menurut Manager PT Nubika Jaya Suddin Sembiring, kali ini PT. Nubika Jaya menyalurkan bantuan kain sarung dan uang tali kasih kepada 221 masyarakat miskin, masyarakat jompo dan anak yatim se Desa Sisumut. Selain itu PMKS PT Nubika Jaya membuka pasar murah berupa minyak goreng, harganya sangat membantu masyarakat Rp7.500/liter, kini sudah menghabis kan 1 ton minyak goreng untuk warga Desa Sisumut, warga Kelurahan Kotapinang dan Tanjung Medan Kec. Kampung Rakyat.“Kegiatan

ini membantu warga menjelang lebaran,” katanya. Sembiring menyebutkan bahwa Bansos kegiatan rutinitas PMKS PT Nubika Jaya setiap tahun dan dilaksanakan setiap Ramadan. Ini program CSR dari dana bina lingkungan merupakan suatu wujud kepedulian perusahaan kepada lingkungan dan masyarakat kurang mampu. Idarsyah, Kepala Desa Sisumut mengucapkan terima kasih kepada PT Nubika Jaya. Atas kegiatan Bansos ini masyarakat Desa Sisumut terbantu terutama masyarakat kurang mampu, jompo, dan anak yatim. Harapan Kepala Desa hendaknya kegiatan ini berkesinambungan dan ditingkatkan sehingga terjalin hubungan komunikasi yang baik antara masyarakat dan perusahaan. Hadir KDP PT Nubika Jaya Roby Yanto TJO, KTU Beni Hutasoit, Kabag Humas Amran Aritonang dan staf KDP Mr.Nasution serta karyawan.(a19)

Magabudhi Asahan Dan Cetiya Dhammacakka Berbagi Kasih KISARAN (Waspada): Dalam menyambut Hari Raya Idul Fitri 1432 H, Pengurus Cabang Majelis Agama Buddha Theravada Indonesia (MAGABUDHI) Kabupaten Asahan bekerjasama dengan Cetiya Dhammacakka Kisaran menggelar peduli kasih dengan warga umat Muslim di sekitar lingkungan. Kegiatan yang diadakan di halaman Cetiya Dhammacakka jalan Panglima Polem Kisaran, Selasa (23/8). Dalam pemberian paket peduli kasih ini, panitia menyiapkan sebanyak 40 paket yang terdiri dari beras, gula, mie instan, bihun, minyak goreng serta kain sarung dan sajadah. Program peduli kasih ini merupakan yang ketiga kalinya dilaksanakan sejak terbentuknya MAGABUDHI di kabupaten Asahan ujar Joseph Waspada/Rahmad F Siregar

Kerusakan di hulu Kab.Simalungun dan Toba Samosir mengakibatkan pendangkalan alur sungai Asahan. Foto direkam Senin (22/8).

Pendangkalan Sungai Asahan 20 Cm Pertahun Thamrin Munthe ‘Curhat’ Ke Pemprovsu TANJUNGBALAI (Waspada): Walikota Tanjungbalai Thamrin Munthe ‘curhat’ ke Pemerintah Provinsi Sumut (Pemprovsu) terkait kondisi fisik sungai Asahan akibat rusaknya Cacthment Area di hulu sungai secara terus menerus. Kerusakan di hulu Kab. Simalungun dan Toba Samosir itu, membawa dampak signifikan terhadap pendangkalan alur sungai Asahan. Diperkirakan, pendangkalannya mencapai 20 centimeter per tahun atau volumesendimentasipadaalurpelayaran lebar 80 meter sebesar 2.250.00 m3 per tahun. Demikian ekspos Thamrin pada rapat kordinasiantaraPemkoTanjungbalai dan Pemkab Asahan dengan Pemprovsu untuk penanggulangan sendimentasi sungai Asahan, kemarin. Menurut Thamrin, tingginya sendimentasi sungai Asahan setiap tahun berdampak pada percepatan kerusakan dinding sungai atau erosi akibat gerusan arus sungai yang melebar setiap

tahun.Kemudian,lanjutThamrin, permukaanairnaikdanberimbas pada banjir di daerah pemukiman. “Hal ini menyebabkan kerusakan infrastruktur dan menurunkanderajatkehidupanmasyarakat. Jadi, dengan tingginya kenaikan sedimentasi dan kenaikan muka air laut pertahunnya, diperkirakan seluruh Kota Tanjungbalai akan terendam dalam 10 tahun ke depan,” terang Thamrin. Selain itu, menurut Thamrin, pendangkalan sungai Asahan mengakibatkankapalperangTNI AL tak mampu melaksanakan patroli di wilayah Tanjungbalai, danjugamenghambatkelancaran tugas patroli Satuan Polisi Air. Satu lagi, tambahnya, pendangkalan itumenggangguaktifitasekonomi masyarakat yang memanfaatkan alur pelayaran di sepanjang sungai Asahan sehingga banyak industri terancam gulung tikar dan berdampak pada meningkatnya angka kemiskinan di kota itu.

Menurut Thamrin Munthe, Pemko Tanjungbalai telah berupaya untuk mengatasi pendangkalan sungai Asahan itu, namun belummembuahkanhasil.Untuk itu, kata Thamrin, perlu perhatian serius dan tindaklanjut dari PemerintahPusatgunapengerukan sendimentasi atau pendalaman pada sepanjang alur pelayaran di sungai Asahan. Oleh sebab itu, Thamrin mengusulkan 3 alternatif penanganansendimentasisungai Asahan. Pertama, pengerukan sedimen dengan menggunakan dana APBN dan pasir tersebut dijadikan bahan timbunan atau reklamasi dinding sungai. Kedua, menggandeng investor dan pasir dijadikan bahan baku industri dalam negeri. “Jika alternatif I dan II tidak dapat direalisasikan dengan segera, diusulkan alternatif ketiga, yaitu limbah sedimen berupa pasir tersebut ditawarkan kepada pihak yang berminat untuk dijual ataudiekspor,”pungkasThamrin. (a14)

Satu Rumah Ludes Terbakar TANJUNGBALAI (Waspada): SaturumahludesterbakardiJalan HusniThamrin, LkV, Kel. Pahang, Kec. Datukbandar,T. Balai, Selasa (23/8)sekirapukul06:00.Penyebab kebakarandidugaakibatkorsleting listrik yang ditanam di tanah. Informasi dihimpun, kejadian berawal saat pemilik, Suryono, 48, bersama isterinya Dame, 45, berada di warung milik mereka berjarak sekitar 100 meter darirumah.Tiba-tibaanakkorban Rusliana serta cucu Ramah berlari keluar rumah sambil ber-

teriak minta tolong sebab api sudah membesar. Korban dan warga lalu berusaha memadamkan api dengan peralatan seadanya menggunakan air bekas guyuran hujan yang ada di sekitar lokasi. Namun, api dengan cepat menjalar ke setiap tiang, kosen, pintu, seng dan rangka rumah yang umumnya terbuat dari kayu. Si jago merah baru berhasil dikuasai setelah 30 menit berlalu dengan bantuan dua unit mobil pemadam kebakaran milik Pem-

koTanjungbalai. Dalam musibah itu, tidak ada korban jiwa, tetapi tak barang-barang yang sempat diselamatkan kecuali satu unit sepedamotormerekSuzukiSmash. Kapolres Tanjungbalai AKBP Puja Laksana melalui Kasubbag Humas AKPY Sinulingga didampingi Kapolsek Datukbandar AKP H Sihite dan Kanit Reskrim Aiptu S Sirait membenarkan. Diterangkan,tidakadakorbanjiwanamun kerugian diperkirakan mencapai Rp70jutatermasuksatuunitsepeda motor jenis HondaVario.(a32)

Randy, SH. Wakil Ketua PC Magabudhi Asahan. Dalam sambutan yang disampaikan oleh Joseph Randy, bahwa program ini merupakan kalender kerja Majelis dan sekaligus juga pelaksanaan daripada ajaran agama bahwa seluruh umat manusia adalah sama walaupun ada perbedaan ras, agama dan antar golongan. Oleh sebab itu, dalam cinta kasih harus diberikan kepada semua orang. Hadir dalam kegiatan ini Lurah Kelurahan Kisaran Kota, Taufan Irianto beserta Kepala Lingkungan II, Udin. Taufan Irianto menyampai kan paket yang diberikan jangan dinilai dari harganya tapi ini keikhlasan semua pengurus yang memang berniat meringankan para ibu menyambut Hari Raya Idul Fitri.(a31)

Jelang Lebaran Pedagang Makin Banyak, Pembeli Minim KISARAN (Waspada): Menjelang lebaran pedagang musim mulai marak di Kota Kisaran, namun para pembeli hanya sedikit karena pendapatan warga tidak berimbang. Hal itu diungkapkan pedagang di Pasar Impres, Jalan Diponegoro, Hasbi, Selasa (23/ 8). Menurutnya bila menjelang hari ‘H’ pedagang bertebaran di Kota Kisaran, namun karena pendapatan warga tidak stabil sehingga daya beli

menurun. Sedangkan seorang calon pembeli, Aminah, warga Gambir Baru, Kisaran, mengatakan harga menjelang lebaran melonjak naik, sehingga di harus bisa bijak memilih mana yang menjadi prioritas dalam kehidupan keluarga. “Harus bijak dalam mengatus keuangan,disebabkanpendapatan dengan pengeluaran untuk persiapan lebaran tidak berimbang,” ungkap Aminah.(a15)

Pendapatan Menurun, Anak Nelayan Cari Gurita ASAHAN (Waspada): Anak nelayan di Desa Baganasahan, Kec. Tanjungbalai, Kab. Asahan, terpaksa bekerja demi memenuhi kebutuhan keluarga. Kendati kebanyakan masih berusia dini, mereka tak takut ke laut walau hanya menggunakan sampan seruai muatan 3 orang, namun ‘dipaksa’ jadi bermuatan 6 penumpang. Berangkat sekitar jam 16:00, dan pulang ke darat pada pukul 04:00. “Kami biasa mencari Gurita diperairan Sarang HelangatauBetingTanjungSiapi-api,”katapencari Gurita, Riko, 13, warga Desa Baganasahan Baru kepada Waspada, Senin (22/8). Menurut Riko, jarak tempuh BaganasahanSaranghelang sekitar 1,5 jam dengan menggunakan sampan seruai. Dia banting tulang mencari Gurita demi membantu kehidupan keluarga, apalagi sejak Riko berhenti sekolah sejak kelas 4 SD karena keterbatasan biaya. Riko memilih berburu Gurita karena selain harganya cukup lumayan, menangkapnya juga mudah. Hanya dengan ketelitian mata dan kecekatan tangan, Riko mampu mengumpulkan hasil tangkapan dengan hasil rata-rata 4 kilogram-5 kilogram. “Lumayan bang untuk kebutuhan sehari-hari,” ujar Riko. Gurita hasil tangkapannya itu, biasanya dijual sekitar Rp7 ribu per kilogram- Rp14 ribu per kilogram. Khusus Riko, tak sulit untuk menjual hasil tangkapan Guritanya, sebab ayahnya sudah beralih profesi dari nelayan tradisional menjadi penjual Gurita. “Ikan di laut sudah langka, dan imbasnya pendapatan pun menurun makanya

aku beralih profesi menjadi penjual Gurita,” kata ayah Riko, Syahrial, 45. Sebagai orang tua, Syahrial mengaku prihatin dengan kondisi Riko. Akan tetapi, akibat himpitan ekonomi, dia terpaksa merelakan Riko berhenti sekolah dan bertarung di laut demi sesuap nasi. “Jika ditanya hati kecilku ini, tak relanya kalau anakku bekerja di laut, apalagi sampai dinihari baru pulang. Akan tetapi, mau bagaimana lagi, kondisiekonomikamisangatsulitdenganterpaksa aku merelakan Riko mencari Gurita di laut,” ujar Syahrial. Dia menambahkan, Gurita hasil tangkapan Riko dan anak-anak lainnya dibeli seharga Rp14 ribu per kilogram. Selain dijual di pasar Baganasahan dan Kota Tanjungbalai, menurut Syahrial, Gurita-gurita itu dikirim ke Medan untuk diekspor. “Penghasilannya hanya sekedar untuk menyambung hidup,” tutur Syahrial. Sementara, Ketua Asosiasi Nelayan Pesisir Pantai Asahan Hermansyah Siregar prihatin melihat kondisi anak-anak nelayan yang mencari Gurita. “Keselamatan terancam, dan mereka tak pernah istirahat, sebab pulang dari laut sudah pukul 14:00,” kata Siregar. Untuk itu, dia meminta agar Pemkab Asahan memperhatikan serius kehidupan nelayan di Baganasahan, sehingga tidak ada lagi anak putus sekolah yang bekerja di laut. “Tolong pak Bupati, perhatikan nasib nelayan di sini, anak-anaknya banyak yang putus sekolah dan terpaksa bekerja hanya untuk mencari sesuap nasi,” ketus Siregar.(a14)

H-6 Harga Sembako Di Labusel Normal KOTAPINANG (Waspada): Enam hari menjelang Idul Fitri (H-6) harga sembilan bahan pokok di Labuhanbatu Selatan (Labusel) masih relatif normal. Diperkirakan kenaikan mulai terjadi H-2. Berdasarkan pengamatan Waspada di Pasar Inpres Kotapinang, Selasa (23/8) harga sejumlah kebutuhan pokok masih belum ada kenaikan. Sejumlah pedagang mengaku, stok barang dari distributor tidak terhambat, sedangkan permintaan meskipun mengalami peningkatan namun masih dapat dipenuhi, sehingga tidak terjadi fluktuasi harga. Namun diperkirakan

kenaikan akan terjadi dua hari menjelang lebaran. Harga beras misalnya, saat ini masih dijual Rp97 ribu/karung ukuran 10 kg. Sementara harga cabaidijualRp20ribu/kg,bawang merah Rp14 ribu/kg, harga tomat Rp6 ribu/kg. Sementara tepung terigu dijual Rp8.500/kg, sementara daging sapi Rp70 ribu/kg. “Sejauh ini belum ada kenaikan harga. Tapi nggak tahu kalau menjelang lebaran ada kenaikan. Tapi biasanya kalau memang ada lonjakan pasti sejak sepuluh hari menjelang lebaran sudah ada kenaikan. Biasanya dua hari menjelang lebaran mungkin naik,” kata Rahma, salah seorang

pedagang. Kabag Perekonomian Pemkab Labusel, Zulkifli Siregar mengatakan, meskipun terjadi kenaikan, namun lonjakan harga masih terbilang wajar berkisar Rp200 hingga Rp1000/kg untuk setiap komoditas. Kenaikan pada beberapa komoditi ternyata tidak membuat lesu permintaan pembeli. Menurutnya, relatif normalnyahargasembakotersebutkarena sejak awal-awal Ramadan Pemkab sudah melakukan penetrasi harga melalui pasar murah. ���Sampai saat ini pasar murah masih berjalan, sehingga harga dapat distabilkan,” katanya.(c18)

Waspada/Rahmad F Siregar

SEKUMPULAN pencari Gurita didominasi anak usia dini, berangkat dari Baganasahan, Kec. Tanjungbalai, Kab. Asahan menuju perairan Sarang Helang atau Beting Tanjung Siapi-api, Senin (22/8). Biasanya, mereka kembali ke rumah pukul 04:00 membawa hasil tangkapan 3-4 kg.


WASPADA Rabu 24 Agustus 2011

Tim Penegakan Syariat Islam Razia Pedagang Makanan Siang Hari LANGSA (Waspada) : Dinas Syariat Islam Kota Langsa bersama tim penegakan syariat yang terdiri dari unsur muspika, polres, koramil dan petugas WH melakukan razia terhadap sejumlah pedagang yang menjual makanan di siang hari, Selasa (23/8). Razia merupakan kegiatan rutin tim penegakan Syariat Islam selama bulan Ramadhan di Kota Langsa untuk memberikan rasa aman kepada masyarakat dalam menjalankan ibadah puasa. Kepala Dinas Syariat Islam Kota Langsa, Drs Mursyidin Budiman menyebutkan, tujuan razia itu untuk menjaga dan mengingatkan pedagang agar tidak menjual makanan siap saji atau siap makan dalam bentuk apapun di siang hari selama Ramadhan. “Semua pedagang sudah kita umumkan, penjualan makanan siap saji seperti penganan berbuka puasa baru boleh dibuka usai shalat ashar sekira pukul 16:30,” sebut Mursyidin. Menurutnya, razia rutin itu dilakukan selain pengamanan selama Ramadhan, juga karena masih ada pedagang makanan yang kurang kesadarannya untuk menjaga kesucian Ramadhan dengan tidak menjual makanan disiang hari. “Seperti kemarin (Selasa-red) walau sudah tiap hari kita lakukan razia, namun tetap saja ada pedagang yang berani menjual makanan dan kopi siang hari. Herannya lagi ada juga masyarakat yang nekat santai minum kopi sambil makan kue di warung itu,” sebut Mursyidin lagi. Untuk itu dirinya menghimbau kepada seluruh masyarakat Kota Langsa agar bersama-sama menjaga kesucian Ramadhan dengan tidak melakukan tindakan yang dapat menodai kesucian ramadhan itu sendiri. Juga kepada pedagang makanan diminta untuk tetap mematuhi aturan yang telah ditetapkan tentang waktu untuk menjajakan makanannya. (b22)

Pengiriman Kartu Lebaran Semakin Langka Di Aceh Tamiang KUALASIMPANG ( Waspada): Pengiriman Kartu ucapan selamat lebaran 1432 H oleh masyarakat melalui kantor PT.Pos Indonesia Cabang Kualasimpang, Kabupaten Aceh Tamiang semakin langka ,bahkan sampai menjelang H-7 Hari Raya Idul Fitri 1432 H hanya ada dua lembar kartu lebaran yang dikirim dari luar Aceh Tamiang yang masuk ke Kantor Pos di Kota Kualasimpang itu. “ Memang sudah sangat langka yang mengirim kartu lebaran melalui kantor Pos. Bahkan, sampai hari ini hanya ada dua lembar kartu lebaran yang dikirim dari luar daerah masuk ke kantor Pos ini,” kata Kepala Kantor Cabang PT.Pos Indonesia Kualasimpang, Kabupaten Aceh Tamiang, Ahmad Gamal ketika dikonfirmasi Waspada, Senin ( 22/8) Menurut Ahmad, menurunnya animo masyarakat, khususnya umat Islam yang mengirim kartu lebaran ucapan selamat hari raya pada tahun ini karena faktor teknologi yang sudah semakin maju yaitu sudah ada HP dan iternet serta bisa juga mengirim kartu ucapan selamat hari raya melalui facebook. “ Teknologi sudah maju, maka bisa saja warga mengirim ucapan selamat hari raya kepada sanak saudara, keluarga, rekan dan relasi yang dikirim melalui SMS ,” ujar Ahmad. Hanya saja , menurut Ahmad, kalau mengirim ucapan selamat hari raya melalui SMS kurang ada kesan yang bisa dijadikan kenang-kenangan bagi yang menerima ucapan tersebut karena habis dibaca bisa saja langsung dihapus. “ Sedangkan kalau kirim ucapan selamat hari lebaran pakai kartu lebaran tentu saja ada kesan yang bisa dijadikan kenangkenangan bagi penerimanya ,sebab kartu lebaran yang gambarnya cantik,indah dan unik bisa saja disimpan untuk dijadikan kenang-kenangan,” tutur Ahmad. Sedangkan pelayanan lainnya ,tegas Ahmad, seperti pengiriman wesel pos, wesel Union, kredit sepedamotor, pengiriman paket, pembayaran gaji pensiun, pengiriman surat –surat dan lainnya tetap berjalan lancar dilayani oleh PT Pos Indonesia Cabang Kota Kualasimpang, Kabupaten Aceh Tamiang. (b24)

Pengiriman Baju Dan Kue Kering Melalui Jasa Pos Meningkat LANGSA (Waspada) : Menjelang Idul Fitri 1432 Hijriah, jasa pengiriman barang dengan menggunakan jasa dari PT Pos meningkat. Manajer Pelayanan PT Pos cabang Langsa, Darmawan yang ditemui, Selasa (23/8) mengatakan, peningkatan jumlah barang terjadi hampir 15 persen dari bulan biasanya. Ditambahkan, dari beragam barang yang dikirim pada umumnya yang paling banyak adalah barang berupa baju serta kue kering. “Kita menerima kiriman baju serta kue kering yang lumayan banyak saat ini,” ujarnya. Meski diakui saat ini terjadi begitu banyak pengurangan penggunaan jasa pos saat menjelang lebaran seperti pengiriman kartu lebaran, serta penjualan prangko, namun aktivitas di kantor pos tetap ramai. Sampai saat ini PT Pos cabang Langsa kurang melayani pengiriman barang berupa kendaraan roda dua. Hal itu, menurut Darmawan, karena pihaknya hanya melayani pengiriman barang di wilayah satu yaitu banda Aceh serta Medan serta masih adanya selisih ongkos angkut kendaraan yang masih lumayan besar sehingga para pengirim masih mempertimbangkan hal itu. (b25)

Waspada/Muhammad Riza

BUPATI Pidie Jaya HM Gade Salam didampingi Hj Salmiati Gade Salam (menggedong balita-red) serta dibantu Kasi Gizi Dinkes Pidie Jaya memberi vitamin A kepada salah satu balita pada acara pekan vitamin A di Desa Gharu, Kec. Bandar Dua, Pidie Jaya, Selasa (23/8).

2.000 Balita Di Pijay Dapat Vitamin A MEUREUDU (Waspada) : 2.000 Balita di Kabupaten Pidie Jaya diberikan Vitamin A pada acara Pekan Vitamin A dipusatkan di Desa Gahru, Kecamatan Bandar Dua, Selasa (23/8). Penetesan Vitamin A tersebut dilakukan secara simbolis oleh Bupati Pidie Jaya HM Gade Salam dan Hj Salmiati Gade Salam didampingi Kadis Kesehatan Pijay Munawar Ibrahim, SKP.MPh dan Kasi Gizi Nurwaidah. Bupati Pidie Jaya HM Gade Salam, Selasa (23/8) usai acara memberikan vitamin A mengatakan, pihaknya mengakui hingga sekarang ini masih ada balita yang kurang vitamin dan gazi. Namun dengan kerja keras semua pihak didukung Kader Posyandu diharapkan dapat meminimalisir angka dari gizi buruk atau bayi rabun senja. “Dengan hadirnya mereka (kader Poyandu) dapat mengurangi dampak dari bayi kurang gizi, apalagi di Pijay masih ada 11.000 balita dan 2.000 di antara kita berikan vitamin A untuk menghindari dampak kesehatan rabun senja,” paparnya. Kadis Kesehatan Pijay Munawar Ibrahim, mengatakan, program gerakan pekan vitamin A ini ditargetkan dalam kurun satu pekan bisa mencapai 80 persen. (b20)


PA Langsa Tolak Temui Sekjen Kemendagri LANGSA (Waspada) : DPW Partai Aceh Kota Langsa dengan tegas menolak ajakan tim DPRK pergi ke Jakarta untuk menemui Sekjen Kemendagri yang alasannya untuk berkonsultasi masalah status hukum serta legalitas M Zulfri sebagai Ketua DPRK Langsa.

Ketua DPW PA Kota Langsa Iskandar didampingi Sekretarisnya Furqan, Selasa (23/8) mengatakan, PA tidak perlu ikutikutan ke Jakarta dengan menggunakan uang rakyat, apalagi hanya sekadar untuk berkonsultasi hal yang sudah jelas duduk perkaranya. Karena masalah status hukum M Zulfri, kata dia, sudah sangat jelas dalam surat Kemendagri yang lalu, yang berhak memberhentikannya adalah partai di mana dia bernaung. Dalam hal ini tentunya Partai Aceh. “ Maka itu PA tidak perlu menafsir lagi surat itu, karena isinya sudah sangat jelas,” kata Iskandar. Penolakan juga disampaikan PA dalam rapat yang difasi-

litasi olehWalikota Langsa, Selasa pukul 14:30 yang berlangsung di ruang rapat Walikota Langsa. Hadir di sana Muspida plus, para pimpinan fraksi DPRK, unsur pimpinan DPW PA Langsa, para anggota dewan dari Fraksi PA. Dalam pertemuan itu mereka itu tetap menolak ke Jakarta dan menolak penurunan Zulfri sebagai Ketua DPRK. Mereka menyampaikan itu setelah usulan Walikota Langsa Zulkifli Zainon yang menyarankan agar tidak terjadi kecacatan produk hukum yang dihasilkan DPRK Langsa, agar Zulfri tetap jadi anggota dewan namun posisinya digantikan oleh anggota Fraksi PA yang lain. Sementara itu, Ketua PN Langsa Lukman Bachmin yang ditemui usai rapat menganalogikan seorang hakim sesuai dengan hukum sudah pensiun, kendati SK belum turun, namun dia sudah tidak boleh lahgi menangani kasus. Yang terpenting menurutnya, semua pihak harus berpegang pada hati nurani. Sementara itu para anggota DPRK lainnya sebagaimana disampaikan oleh T Hidayat, Wakil Ketua II DPRK Langsa, mereka tetap akan berangkat ke Jakarta untuk bertemu dengan Sekjen Kemendagri. Berlarut-larutnya persoa-

lan status hukum serta legalitas M Zulfri sebagai Ketua DPRK Langsa sehingga berbuntut pada insiden pengeluaran secara paksa M Zulfri dari ruang rapat paripurna dewan 18 Agustus lalu, kini memasuki babak baru.

Hasil rapat paripurna para anggota DPRK Langsa yang dilaksanakan pada 18 Agustus merekomendasikan sebuah tim dari DPRK Langsa beserta DPW Partai Aceh (PA) dan Fraksi PA di dewan bertemu Sekjen serta Kepala Biro Hukum

Ke-menterian Dalam Negeri. Bahkan surat undangan untuk ikut serta berkonsultasi dengan Kemendagri telah dilayangkan kepada pengurus DPW PA, dengan nomor 1424/171.3/ 2011 tanggal 18 Agustus 2011. Wakil Ketua I DPRK Langsa

Syahyuzar AKA yang ditemui, Senin (22/8) mengatakan, keputusan mengajak pengurus DPW PA merupakan terobosan untuk mengatasi multitafsir setiap surat yang dikeluarkan oleh Kemendagri berkenaan dengan status M Zulfri. b22/b25)

10 Km Jalan Julok-Indra Makmur Rusak Parah JULOK (Waspada) : Sepanjang 10 kilometer jalan lintas kabupaten yang menghubungkan Julok-Alue Ie Mirah di Kecamatan Indra Makmur, Kabupaten Aceh Timur, dalam kondisi rusak parah. Meski kerap diprotes warga melalui media, namun hingga kini pemerintah terkesan tutup mata. Pantauan Waspada, jalan yang saban hari tidak pernah sepi dari lalu lalang pengguna jalan terlihat berlubang dan bergelombang. Sejumlah titik bahkan masih digenangi air hujan ditambah air selokan perumahan warga di pinggiran jalan utama itu. Beberapa warga di lokasi itu mengaku, kondisi jalan utama tersebut rusak akibat kurangnya kepedulian pemerintah daerah dalam membatasi tonase angkutan replenting dari perusahaan BUMN di kawasan Indra Makmur, sehingga jalan yang tergolong tipe c itu mudah rusak. “Sudah banyak yang foto bang, tapi sampai sekarang belum pernah dibangun secara parmanen, kecuali hanya seba-

tas ‘tempel’. Itupun hanya di lokasi tertentu yang sudah tidak bisa dilewati lagi,” ujar Zamzami, 34, pengguna jalan yang berprofesi sebagai pedagang ikan keliling. Ketua Forum Pemuda Julok (FPJ), Hasballah Kadimin mengatakan, lintasan Julok-Indra Makmur kerusakannya mulai terjadi pasca konflik berkecamuk di Aceh di tahun 2005. Disebutkannya, kerusakan jalan melintasi sejumlah desa yakni mulai dari Desa Blang Mideun, Blang Jambee, Buket Panyang hingga ke Desa Botren, Kecamatan Indra Makmur. Sementara mulai dari Desa Blang Nisam hingga ke pusat Ibukota Kecamatan Indra Makmur sudah dibangun, tetapi beberapa titik kembali mengalami kerusakan. Bupati Aceh Timur Muslim Hasballah melalui Kadis PU HM Yusuf Adam mengakui jalan lintasan Julok-Alue Ie Mirah dalam kondisi rusak. Namun pihaknya terus berupaya mengusulkannya pembangunan jalan tersebut ke Pemprov Aceh. (cmad)

Nelayan Aceh Timur Resah Aksi Puluhan Pukat Trawl Marak IDI (Waspada): Dalam tiga bulan terakhir, ratusan nelayan yang selama ini menggantungkan nasibnya di perairan Kabupaten Aceh Timur, mulai resah. Pasalnya, aksi puluhan pukat trawl lokal yang notabenya melanggar Keppres 39 Tahun 1980, itu kian merajalela. Informasi yang diperoleh Waspada menyebutkan, aksi pukat trawl lokal yang sering disebut-sebut pukat rimueng (pukat harimau—red) terjadi menyusul jarangnya pemeriksaan pihak terkait dalam mengontrol alat tangkap ikan yang dibawa kapal-kapal nelayan saat keluar dari dermaga (Kuala) di Aceh Timur. Resahnya nelayan di sejumlah titik seperti nelayan di Kuala Idi Rayeuk, Kuala Idi Cut dan Kuala Julok serta beberapa lokasi lainnya karena aksi pukat trawl harimau itu tidak hanya mengeruk ikan yang bisa dijual ke pasaran (ukuran sedang dan besar—red), tetapi segala jenis ikan kecil tersangkut di dalam alat tangkap jenis pukat harimau itu. Kepala UPTD Dinas Kelautan dan Perikanan (DKP) Pelabuhan Perikanan Pantai (PPP) Idi, Ir T Diauddin kepada Waspada, Selasa (23/8) membenarkan informasi tersebut di perairan Aceh Timur. “Ya benar, informasi adanya alat tangkap ikan jenis pukat harimau di perairan Aceh Timur, seperti di perairan Idi dan perairan Julok serta Simpang Ulim,” katanya. T Diauddin menambahkan, sebagaimana informasi nelayan setempat, aksi trawl lokal berkisar antara 2-4 kilometer dari pesisir pantai. “Jika aksi trawl lokal itu benar-benar telah meresahkan nelayan kita,

maka instansi terkait harus menindak tegas, apalagi melanggar dari prosedur yang ada,” ujarnya seraya menandaskan, aksi trawl lokal (pukat harimau—red) tak hanya mengganggu nelayan kecil, tetapi juga mengganggu ekosistem laut, seperti rusaknya terumbu karang yang harus dilindungi. Diauddin menyebutkan, aksi pukat trawl yang informasinya kerap beraksi mulai dari perairan Ranto Selamat dan Bireum Bayeun (berabatasan dengan perairan Langsa) hingga ke perairan Jambo Aye (berbatasan dengan perairan Aceh Utara). “Jika ini terjadi, maka aksi tersebut melangar Keppres 39 tahun 1980 dan UU Nomor 31 Tahun 2004 tentang sumber hayati laut dengan ancaman hukum 5 tahun penjara dan denda Rp1,2 miliar,” katanya. Kepala Dinas Kelautan dan Perikanan Aceh Timur, Ir T Dahlan, MAP secara terpisah kemarin mengaku belum mengetahui adanya aksi trawl lokal disana. Namun demikian, pihaknya dalam waktu dekat akan duduk bersama dengan pengurus Panglima Laot (PL) di Aceh Timur. “Jika memang nanti ada, maka akan kita tindak tegas, sebab itu melanggar dari ketentuan yang ada,” katanya. Informasi lain menyebutkan, trawl lokal yang menggunakan pukat harimau berasal dari beberapa titik, yakni di Kuala Peureulak dan Birem Bayeun. “Pengguna pukat harimau itu juga nelayan kita di Aceh Timur, namun karena mengganggu nelayan dan perahu kecil yang menangkap ikan di titik 2-4 kilometer dari pesisir pantai, maka kita minta ditindak tegas,” kata Hasan, nelayan di Kuala Idi. (cmad)


PERWAKILAN warga berbincang serius dengan pihak rekanan proyek jalan Pantonlabu-Geulumpang Umpung Unoe, dalam proses mediasi yang melibatkan Muspika, di Meunasah Desa Meunasah Panton, Senin (22/8).

Hingga 2012, Pemko Langsa Hentikan Penerimaan PNS

Jalan Pantonlabu-Geulumpang Umpung Unoe Dibuka

LANGSA (Waspada) : Sesuai dengan moratorium penerimaan Pegawai Negeri Sipil (PNS) yang dicanangkan Kementerian Aparatur Negara, Pemko Langsa tidak akan menerima PNS sampai tahun 2012 mendatang. Demikian Zulfiqar, Kepala Bidang Pemberdayaan Pegawai pada Badan Kepegawaian Pemberdayaan dan Pelatihan (BKPP) Kota Langsa, saat ditemui di ruang kerjanya, Selasa (23/8). Ditambahkan, saat ini jumlah seluruh PNS di lingkungan Kota Langsa telah mencapai 5.000 PNS, sehingga dianggap sudah sangat mencukupi, untuk melayani kebutuhan masyarakat Kota Langsa. “Pada dasarnya kita mematuhi semua keputusan pemerintah pusat, hal itu juga sesuai dengan kondisi ril di Kota Langsa yang sampai saat ini pegawainya sudah lebih dari mencukupi untuk melayani warga kota,” ujarnya. Sesuai rasio kecukupan pegawai adalah 3 persen dari total jumlah penduduk satu daerah, dengan menggunakan asumsi tersebut dirasakan saat ini kebutuhan pegawai terutama di bidang administrasi telah mencukupi. Pihaknya akan mempertimbangkan penerimaan PNS baru yang setelah tahun 2012 dengan pertimbangan kebutuhan serta melihat jumlah PNS yang pensiun. (b25)

PANTONLABU (Waspada) : Setelah melalui proses mediasi yang alot dengan pihak kontraktor, warga Desa Meunasah Panton, Kecamatan Tanah Jambo Aye, Aceh Utara, akhirnya bersedia membuka Jalan Pantonlabu-Geulumpang Umpung Unoe, Senin (22/8) yang sempat diblokir. Pantauan di lokasi, proses mediasi yang melibatkan semua unsur Muspika itu digelar di Meunasah Desa Meunasah Panton. Mediasi berlangsung tegang. Berulangkali perwakilan warga mengecam pihak kontraktor karena sering ingkar janji, terutama menyangkut penyiraman badan jalan dan pembangunan

Bengkel Keliling Di Langsa LANGSA (Waspada) : Guna memudahkan para pemudik di jalur Lintas Aceh-Sumatera, Satuan Polisi Lalulintas (Satlantas) Polres Langsa menyediakan sarana bengkel keliling. Kapolres Langsa AKBP Yosi Muhamartha melalui Kasat Lantas AKP Budi Dharma, Selasa (23/8) mengatakan, keberadaan bengkel keliling merupakan salah satu fasilitas yang diberikan Satlantas Langsa untuk operasi Ketupat Rencong 2011 guna memudahkan kelancaran arus mudik. “Kita persiapkan bengkel keliling bagi para pemudik, sehingga kita harapkan arus mudik tahun ini dapat berjalan lancar, selain itu kita juga mempersiapkan tiga pos pemantauan di sepanjang jalur mudik serta pos informasi,” ujarnya saat ditemui di sela-sela pelantikan pengurus abang becak Kota Langsa, di Kantor Pemko Langsa, kemarin. Ditambahkan, selain mempersiapkan berbagai fasilitas untuk kemudahan para pemudik, Satlantas Polres Langsa juga menerjunkan 60 personilnya yang ditempatkan di pos Kec. Langsa Timur, Pos di Kec. Bireum Bayeun serta Merdeka Kota Langsa. (b25)

gorong-gorong atau boks cover. Beruntung ketegangan itu akhirnya mencair setelah Taufik dari PT Tamitana selaku pihak rekanan memastikan akan rutin menyiram jalan dan segera merampungkan pekerjaan box cover. Taufik juga menerima ultimatum warga yang akan memblokir total jalan jika janjinya kali ini kembali diingkari. Camat Tanah Jambo Aye Amir Hamzah meminta rekanan bekerja profesional dan transparan sehingga masayarakat tidak terus dirugikan. “Jangan sampai ketika beritanya sudah masuk koran, baru pekerjaan dilanjutkan. Laksanakan proyek ini dengan jujur,” tandasnya. (cmus)

Tuli Dan Butakah Mereka GAMPONG Meunasah Panton letaknya di sebelah timur Kota Lhokseumawe atau sekitar 63 km dari pusat Pemerintahan Kabupaten Aceh Utara. Gampong itu berada dalam wilayah Kecamatan Tanah jambo Aye. Rata-rata warga di sana bermata pencaharian sebagai petani sawah, petani tambak dan sebagian lainnya berdagang. Roda perekonomian masyarakat di sana masih terus berputar meskipun dengan terseokseok, namun masyarakat di sana tidak pernah mengeluh kepada siapa pun termasuk kepada pemerintah. Semua persoalaan hidup menjadi tanggungjawab mereka masing-masing. Mereka tidak peduli dengan kulit legam dibakar matahari, mereka juga tidak peduli jika harus bermandi peluh demi untuk menafkahi keluarganya. Masyarakat di sana dapat dikatakan kuat dan sabar dalam menghadapi berbagai persoalan hidup. Namun, ternyata kesabaran yang mereka miliki selama ini mulai goyah. Mengapa tidak, sudah hampir empat tahun warga di sana menghirup debu jalananan yang rusak. Debudebu ikut terhisap melalui hidung, lalu masuk ke paru-paru mereka. Kesehatan para warga di sana telah dipertaruhkan oleh pemerintah. Jalan Meunasah Panton tembus Geulumpang Umpung Unoe memang telah lama rusak akibat dimakan usia, namun tidak menimbulkan kepulan debu yang berlebihan, paling masyarakat tidak nyaman saat berkendaraan di jalan itu, namun tidak menganggu kesehatan. Mereka masih bisa bebas menghirup udara pagi yang segar. Kini jalan sepanjang 12 km itu mulai diperbaiki oleh PT Tanjung Tamitana. Jalan itu digreder dan semua lubang ditimbun tanah, kemudian dilanjutkan dengan perkerasan jalan. Sejurus kemudian kontraktor membiarkan jalan itu tanpa perbaikan lebih lanjut. Alasannya untuk mendapatkan kepadatan sehingga jalan tidak labil. Kondisi ini berjalan hampir dua tahun lamanya. Selama itu pula, jalan tersebut tidak pernah disiram. Akibatnya, debu-debu jalanan itu berterbangan kesana kemari akibat diterba kendaraan bermotor.Dari jauh, sekilas tampak seperti kabut, karena debu tersebut telah menyelimuti jalan dan rumah warga. “Setiap pagi, masyarakat harus membersihkan rumah mereka dari debu, karena tidak sanggup membersihkan setiap hari, banyak warga melindungi rumah mereka dengan palstik karena debu bukan hanya mengotori atap dan dinding rumah, tapi juga masuk ke dalam rumah. Sudah dua tahun kami complain kontrak-

tor dan pemerintah khususnya Dinas Bina Marga Aceh Utara melalui media cetak, dan bahkan kami sudah pernah complain langsung ke Dinas tersebut. Mereka selalu mengatakan, kalau jalan itu segera diaspal, nyatanya sampai hari ini belum dilakukan,” kata Bakhtiar H Anas, Geusyik Gampong Meunasah Panton. Karena tidak mendapat respon, masyarakat memblokir jalan itu dengan cara menanam pohon pisang untuk beberapa hari. Aksi ini juga tidak mendapat respon, kemudian warga memblokir jalan tersebut dengan cara meletakkan beton box cover di badan jalan, sehingga jalan itu hanya bisa dilintasi oleh pejalan kaki dan sepeda motor. Aksi ini dilakukan warga, Minggu (21/8) kemarin. Kata Bakhtiar H Anas, masyarakat telah kehabisan cara dan habis kata-kata. Di mulut warga keluar supah serapah terhadap pemerintah dan kontraktor. Belum selesai persoalan debu, PT.Tanjung Tamitana memotong badan jalan untuk memasang gorong-gorong. Akibat ulah tersebut, pipa PDAM Tirta Mon Pase putus, suplai air bersih untuk warga 12 gampong terhenti. Air PDAM Tirta Mon Pase tumpah ruah ke badan jalan, lalu masuk memenuhi areal persawahan warga. Anehnya, kontraktor merasa tidak berdosa. “Sampai saat ini beton boks cover belum dipasang. Sementara badan jalan dibiarkan berlubang. Ada sekitar 100 titik yang telah dilubangi tanpa kejelasan perbaikan dari kontraktor. Hasilnya, selain harus menghirup debu warga juga kesulitan untuk mendapatkan air bersih. Kenapa pemerintah membiarkan PT. Tanjung Tamitana menang dalam proyek tersebut. Apakah mungkin tender jalan ini dimenangkan dengan cara-cara yang tidak jelas,” Tanya orang nomor satu di Gampong Meuansah Panton itu. Yang paling menyedihkan, setiap pagi, ratusan pelajar SMA N I Pantonlabu, SMP dan murid SD yang melintasi jalan itu, baik dengan kaki maupun dengan kendaraan bermotor, baju putih yang dikenakan berubah warna, bahkan perubahan juga terjadi pada warna rambut. Anehnya kondisi ini seperti ada pembiaran oleh pihak terkait. CutYoyo, staf PT Tanjung Tamitana mengaku, jalan tersebut sudah siap untuk diaspal dan bahkan pihaknya telah menyiapkan berbagai keperluan termasuk alat berat. Pekerjaan harus dihentikan sementara waktu karena kas Aceh Utara sedang kosong. Bakhtiar tidak terima dengan penjelasan itu, karena dia tahu, paket jalan itu dikerjakan secara multiyears (bertahap). Artinya, kontraktor harus menyelesaikan paket proyek tersebut ada atau tidaknya uang dari pemerintah, karena klaim kebutuhan biaya dapat dilakukan kontraktor setelah semuanya selesai. P emerintah Aceh Utara dan PT. Tanjung Tamitana seolah senang dengan penderitaan yang dialami masyarakat. Sudah tuli dan butakah mereka, sehingga mereka tidak peka. Maimun Asnawi, SH.I



WASPADA Rabu 24 Agustus 2011

PNS Di Bireuen Tuntut Uang Minum

Walikota Lhokseumawe

Bayar Gaji Pegawai Lebih Awal LHOKSEUMAWE (Waspada) : Walikota Lhokseumawe Munir Usman dua hari lalu telah memerintahkan Marwadi, Kepala DPKAD untuk membayar gaji pegawai lebih cepat dari biasanya karena menyambut Idul Fitri 1432 H. “Gaji pegawai untuk September 2011 kita bayar hari ini, Selasa (23/8) melalui Bank Aceh. Ini kita laksanakan sesuai perintah Pak Wali, mengingat kita semua akan menyambut lebaran. Maka dari itu, kita tidak menunggu transfer dana gaji dari DAU,” kata Marwadi. Jumlah PNS di Kota Lhokseumawe mencapai 3.893 orang dengan kebutuhan gaji mencapai Rp11.8 miliar. Gaji pegawai paling kecil Rp1,5 juta dan paling besar Rp5 juta. Selain PNS, honor pegawai bakti juga dibayar lebih cepat yang jumlahnya mencapai Rp1,1 miliar. Hal ini juga berlaku untuk pembayaran gaji anggota dewan senilai Rp431 juta. Selain itu, bagi guru yang telah bersertifikasi diberikan gaji tambahan sebanyak satu kali gaji selama enam bulan yang jumlahnya mencapai Rp8.147.499. Dan bagi guru yang non sertifikasi mendapatkan tambahan penghasilan guru (TPG) sebanyak Rp250 ribu per bulan. Jumlah guru yang menerima dana ini mencapai 1.454 orang untuk enam bulan senilai Rp1,8 miliar. “Total dana yang harus kita keluarkan hari ini mencapai Rp23 miliar lebih. Dana ini semua habis untuk membayar gaji pegawai. Karena kebutuhan mendadak, maka Pemkot Lhokseumawe untuk membayar gaji pegawai menjelang lebaran tidak harus menunggu transfer DAU pada 12 September. (cmun)

Petasan Dan Senjata Mainan Dilarang Jual BIREUEN (Waspada) : Sehubungan dengan mulai banyaknya pedagang petasan dan senjata mainan di Kota Bireuen terutama di pinggir jalan Andalas kota, Kapolres Bireuen AKBP HR Dadik J melalui Kapolsek Jeumpa Iptu PM Kataren melarang menjual barang itu di wilayah kota setempat sebagaimana aturan yang disampaikan pihak Mabes Polri dari Jakarta. “Berbagai jenis petasan dan senjatan mainan yang berbahaya dilarang jual, hal itu berdasarkan aturan dari Mabes Polri, karena petasan itu membahayakan baik bagi yang membakarnya maupun masyarakat banyak,” ujar PM Kataren. Menurut Kataren, jajaran Polres Bireuen juga sudah berulang kali merazia para pedagang petasan dan senjata mainan, namun hingga kini mereka masih membandel dan terkesan yang disampaikan itu kepada mereka pedagang alasan pihaknya saja. Padahal itu mereka lakukan atas perintah atas dan lagipula barang berbahaya itu juga untuk memberi rasa aman kepada warga. (cmh)

Tim Gabungan Di Aceh Tengah Siap Amankan Lebaran TAKENGEN (Waspada) : Kapolres Aceh Tengah AKBP Edwin Rachmat Adikusumo mengukuhkan, 150 personil ketupat 2011 untuk mengamankan dan mempermudah masyarakat yang merayakan Lebaran. 5 Pos di Aceh Tengah sudah disiapkan untuk membantu masyarakat. Tim gabungan ini akan melaksanakan tugas selama 16 hari menjelang dan saat lebaran. Selain polisi, untuk mengamankan lebaran juga diturunkan satu peleton Satpol PP, petugas perhubungan, Sub Denpom Aceh Tengah, Dinas Kesehatan, pramuka dan RAPI. Acara pelantikan petugas lebaran yang dilangsungkan di Mapolres Aceh Tengah, Senin (22/8), berlangsung khidmat. Aceh Tengah memiliki 5 pos untuk mengamankan lebaran. Dua pos simpatik di Paya Tumpi dan Terminal Takengen, satu pos pam di Simpang lima dan dua pos pantau di Bebuli Mendale dan OneOne. Di seluruh pos ini akan diberi bantuan untuk mempermudah masyarakat berlebaran. (b18)

Kantor Panglima Laot Kec. Peudada Digasak Maling BIREUEN (Waspada): Kantor Panglima Laot, Kecamatan Peudada di komplek Pelabuhan Pendaratan Ikan (PPI), Bireuen digasak maling. Pelaku masuk dan membawa kabur satu unit komputer setelah membongkar dinding kantor yang terbuat dari triplek. Keterangan Wakil Panglima Laot Peudada, Mardani, 45, Sabtu (20/8) mengatakan, kejadian tersebut terjadi Kamis (18/8). “Saya baru mengetahui ada pencuri yang masuk ke kantor kami pada pagi harinya, saat melihat dinding kantor sebelah barat terbuka,” ucapnya. Dia menyebutkan, di ruangan yang yang gasak maling itu sebenarnya ada tiga unit komputer, namun pencuri hanya menjarah hanya satu unit. “Mungkin saja karena dia sendiri atau karena ada yang melintas sehingga pelaku hanya sempat mengambil satu komputer,” ucapnya. (cb03/cmh)

Pembelajaran Mengisi Ramadhan Siswa MAN Bireuen Berakhir BIREUEN (Waspada): Kepala Madrasah Aliyah Negeri Bireuen Azhary, SAg menutup kegiatan pembelajaran Agama mengisi Ramadhan bagi siswa MAN, Sabtu (20/8). Kegiatan mengisi Ramadhan diikuti 514 siswa sejak 8 Ramadhan 1432 hijriah mengikuti pembelajaran intra kurikuler dan extra kurikuler. Kegiatan mengisi Ramadhan diakhiri dengan tadarus bersama di lokal belajar masing-masing. Kepala MAN Bireuen Azhary S Ag menyampaikan terima kasih kepada seluruh siswa yang telah mengikuti pembelajaran Agama mengisi Ramadhan dengan tekun dan ceria. Kegiatan ini sangat bermanfaat bagi para siswa untuk memperdalam pembelajaran agama. “Kendati para siswa-siswi sudah berAkhir mengikuti pembelajaran mengisi Ramadhan di sekolah bukan berarti pembelajaran itu sudah selesai akan tetapi harus diulang kaji secara berkelanjutan di rumah,” harap Azhary. (b16)

H Saifannur Buka Puasa Bersama Pejabat Dan Masyarakat PEUSANGAN (Waspada): Pengusaha Bireuen H Saifannur, SSos menggelar jamuan buka puasa bersama pejabat dan masyarakat di rumah kediamannya Desa Paya Meuneng, Kec. Peusangan, Bireuen, Jumat (19/8). Jamuan buka puasa bersama turut dihadiri Bupati Bireuen Nurdin Abdulo Rahman, para unsur Muspida, tokoh-tokoh agama para pejabat sipil, TNI, Polri, pers, warga setempat dan fakir miskin, anak yatim di lingkungannya. Pengamatan Waspada, menjelang berbuka suasana di komplek kediaman H Saifannur sudah berjubel dipadati sekitar seribuan undangan indentik seperti menghadiri sebuah pesta besar. Usai acara berbuka para undangan melaksanakan shalat magrib berjamaah di pelataran rumah H Saifannur dan sebagian di antara warga terdekat melaksanakan shalat tarawih di tempat yang sama. (b16)

Tersangka Curanmor Di Bireuen Nyaris Dihajar Warga BIREUEN (Waspada) : Seorang tersangka kasus pencurian sepeda motor nyaris dihajar warga di Desa Geulanggang Baroe, Kota Juang, Senin (22/8) setelah shalat Asar. Pasalnya dia diketahui berusaha mengambil Honda Kharisma BL 5883 Z, milik Zulfa Hanum, seorang ibu rumah tangga. Sempat terjadi duel antara korban dengan tersangka. Tersangka curanmor Sa, 36, warga Jeumpa, Bireuen tertangkap tangan saat hendak mengeluarkan sepedamotor di rumah Zulfa Hanum. Kapolres Bireuen AKBP HR Dadik J melalui Kasat Reskrim, Iptu Novi Edyanto mengatakan, kasus itu telah ditangani pihaknya dan tersangka juga telah diamankan. (cmh)

Guru Di Aceh Utara Pertanyakan Uang NAD

Waspada/Maimun Asnawi

AKBP Kukuh Santoso, Kapolresta Lhokseumawe, Selasa (23/8) berdiskusi dengan Kasat Lantas di Posko Lebaran Terminal Cunda.

6 Titik Rawan Lakalantas Di Aceh Utara LHOKSEUMAWE (Waspada): Kadis Perhubungan dan Pariwisata Badli melalui Moehammad Nasir, Kabid Darat menjelaskan Aceh Utara memiliki enam titik rawan kecelakaan lalulintas di lintasan jalan Medan-Banda Aceh. Berbicara, Selasa (23/8), Nasir menyebutkan, keenam titik rawan yakni dari arah barat yaitu Simpang Muara Batu, Keude Krueng Mane, Simpang Krueng Geukueh, Simpang Ektreun, Simpang Dama dan Simpang Rawang Itek. Di enam lokasi tersebut telah dipasangkan spanduk peringatan bahaya kecelakaan. Mengantisipasi itu, Pemkab Aceh Utara membangun 4 unit posko lebaran di lintasan jalan

Banda Aceh-Medan. Posko itu dibentuk untuk mencegah kecelakaan berlalulintas dan untuk memberikan berbagai informasi kepada para pemudik. Para pemudik juga dibolehkan untuk beristirahat di posko itu. Nasir menjelaskan, keempat posko itu dibangun di Simpang Kreung Geukueh, Kecamatan Dewantara dan Keude Geudong, Kecamatan Samudera. Ke dua posko ini berada dalam wilayah Mapolres Kota Lhokseumawe. Selanjutnya, Simpang Landeng di Kecamatan Syamtalira Aron dan Pantonlabu. Ke dua posko ini berada dalam wilayah Mapolres Aceh Utara. Perhubungan menempatkan personil di pos-pos lebaran itu sebanyak 24 orang. “Pos ini sengaja kita bentuk untuk memberikan pengamanan kepada angkutan pemudik. Nasir mengatakan, H-7 telah arus pemudik telah mulai tampak, terbukti banyaknya

sepedamotor yang memenuhi ruang jalan, diperkirakan mencapai 5.000 unit, begitu juga dengan mobil yang telah mencapai 200 unit setiap harinya. Sementara jumlah mobil pribadi yang berlalu lalang di lintasan jalan Medan-Banda Aceh diperkirakan mencapai 2.500 unit. “Jumlahnya akan bertambah lagi pada H-3. Pada H-7 saja jumlahnya sudah cukup banyak,” katanya. Sementara AKBP Kukuh Santoso, Kapolres Kota Lhokseumawe, Selasa (23/8) meninjau ke lokasi posko untuk memastikan kesiapan petugas di lapangan. Kapolres telah mempersiapkan 280 personil untuk operasi ketupat, namun yang tinggal di posko hanya 40 orang. Selain itu, pihaknya bekerjasama dengan WH dan Satpol PP, RAPI, PMI, Dinas Kesehatan. Di lokasi rawan kecelakaan pihaknya memasangkan spanduk peringatan kepada pemudik. (cmun)

Polres Bireuen Buka Lima Pos Pelayanan BIREUEN ( Waspada) : Menghadapi Idul Fitri 1432 Hijriah, Polres Bireuen menggelar pasukan Ketupat Rencong 2011 di halaman Mapolres setempat untuk memberikan pengamanan dan pelayanan bagi masyarakat. Pembukaan Pospam dan Pos Pelayanan sejak Selasa (23/ 8) untuk memberikan pengamanan dan pelayanan bagi masyarakat terhadap arus mudik lebaran, lebaran dan arus balik lebaran hingga 8 September. Kapolres Bireuen AKBP HR Dadiek Juneidi melalui Kasat Lantas AKP H Suharmadi (foto) di kantornya, Selasa (23/8) mengatakan, untuk memberikan pengamanan dan pelayanan kepada masyarakat telah membuka satu Pospam di Simpang IV kota Bireuen, dan lima Pos Pelayanan di lintasan Jalinsum kawasan rawan kecelakaan. Jika membutuhkan bantu-

an pengamanan terhadap adanya gangguan keamanan dan kecelakaan dalam perjalanan masyarakat dapat langsung menghubungi via SMS ke HP Pos Pelayanan No 08528955 9605. Kelima Pos Pelayanan yang sudah mulai beroperasi untuk kawasan tengah kota Bireuen di Simpang IV, Cot Gapu, kawasan timur Kuta Blang, kawasan Selaran Cot Panglima Km-29 jalan Bireuen – Takengon, kawasan barat kota Bireuen dibuka di Batee Iliek perbatasan Pidie Jaya. Kesemua Pos Pelayanan menurunkan petugas terpadu, Polantas, POM, TNI/Polri, Dishub, Satpol PP, Dinkes, PMI, Pramuka, Orari dan Rapi Kasat Lantas mengingatkan, di Jalinsum Kabupaten Bireuen terdapat 7 titik kawasan rawan kecelakaan yang sangat membutuhkan kehati-hatian para

pengemudi baik kendaraan roda dua maupun roda empat mematuhi peraturan lalu lintas agar semua pengguna jalan saat mudik, berlebaran dan balik lebaran terhindar dari kecelakaan. Ketujuh titik rawan kecelakaan di bagian paling barat Bireuen kawasan Simpang Meugit Samalanga, Simpang (tikungan mesra) Peudada, Pucok Alue Rheing Peudada, di bagian tengah Jalan lurus dan mulus kawasan Blang Bladeh – Cot Keutapang, bagian kawasan selatan Cot Panglima Km-29 jalan masih dalam perbaikan pembedahan gunung jika hujan jalan licin berlumpur. Di kawasan timur Bireuen, Km-222 Paya Meuneng , tikungan Glee Kapai Siumpang Pante Lhong, Pantee Pisang Peusangan, Simpang Pulo Awe Kuta Blang, dan Simpang Leubu Kecamatan Gandapura. (b16)

Pemindahan Ibukota Aceh Utara Ke Lhoksukon

Ratusan Geuchik Minta Aceh Sepakat Medan Turun Tangan LHOKSUKON (Waspada) : Terkait pemindahan ibukota Kabupaten Aceh Utara ke Lhoksukon, ratusan Geuchik/kepala desa (Kades) di delapan wilayah kecamatan eks Kewedanaan Lhoksukon meminta Aceh Sepakat Medan turun tangan. “Masyarakat tidak sanggup lagi berteriak, agar aktivitas operasional sekretariat Pemkab Aceh Utara pindah ke lokasi ibukota di Lhoksukon,” sebut beberapa geuchik di wilayah eks Kewedanaan Lhoksukon, pada silaturahmi dengan Ketua DPC V Aceh Sepakat Medan-Sunggal, H Sulaiman Ibrahim di aula mess Korem 011/LW Jl Iskandarmuda Lhokseumawe, Senin (22/8) . Menurut geuchik, ketetapan lokasi ibukota Aceh Utara di Lhoksukon, tertuang dalam Peraturan Pemerintah (PP) No 18/2003 yang ditandatangani Presiden RI semasa Megawati Sorkarnoputri, 7 Maret 2003. “Namun sampai sekarang, operasional ibukota Aceh Utara, artinya semua kegiatan kesekretariatan Pemkab Aceh Utara masih berkutat di Lhokseumawe,” kata Muhammad Yacob, Kades Gampong Meunasah Blang. Ketua DPC V Aceh Sepakat

Waspada/M Jakfar Achmad

PARA Geuchik/Kades pada forum silaturahim dengan Ketua DPC V Aceh Sepakat Medan-Sunggal H Sulaiman Ibrahim di aula mess Korem 011/LW Jl Iskandarmuda Lhokseumawe, Senin (22/8) malam. Medan-Sunggal H Sulaiman Ibrahim mengakui, DPP dan jajarannya DPC Aceh Sepakat Medan, sejak proses awal di tingkat Aceh Utara-Jakarta berpartisipasi, sehingga lahirnya PP No 18/2003 yang mengatur tata cara pemindahan ibukota kabupaten yang membawahi 27 tingkat kecamatan ini. “Sampai dengan lahirnya birokrat baru pasca perdamaian Helsinki, Aceh Sepakat tak pernah berhenti meminta kesadaran bupati dan lembaga legislatif

(DPRK) agar memprogramkan Anggaran Pendapatan dan Belanja Kabupaten (APBK) untuk biaya pemindahan ibukota Aceh Utara ke Lokasi Lhoksukon. “Perjuangan ini selalu terkendala dengan alasan-alasan irasional, sampai akhirnya terbentuk forum bersama (Forbes) yang melibatkan para ulama, namun penentu kebijakan di Aceh Utara tak pernah bergeming,” ujar Ketua DPC V Aceh Sepakat Medan-Sunggal. (b10)

BIREUEN (Waspada): Sejumlah Pegawai Negeri Sipil (PNS) di jajaran Pemkab Bireuen menuntut hak mereka yaitu uang minum, uang rapel 10 persen dan uang beras jatah mereka dan jatah uang sertifikasi dan non sertifikasi bagi yang belum diberikan sampai sekarang ini. Sementara itu, sejumlah guru di Kabupaten Aceh Utara juga mempertanyakan uang NAD, Non Sertifikasi dan uang tunjangan prestasi kerja (TPK) mereka yang belum mereka terima sampai sekarang ini. Keterangan yang dihimpun, Selasa (23/8), PNS Pemkab Bireuen tak sabar lagi, bahkan mereka mengancam akan datang bersama keluarga mereka ke Meuligoe bupati bila jatah mereka itu belum dibayar sebelum Idul Fitri 1432 Hijriah. “Kami dari dewan pendiri dan pemerkasa berdirinya Lembaga Perlindungan Aparatur Republik Indonesia (Lempari) mendukung untuk diadakan gerakan dan aksi dukungan moral untuk menuntut dan memperjelas hak-hak

aparatur secara beradab di kabupaten ini,” kata Adli, seorang PNS di Bireuen, Selasa (23/8).

PANTONLABU (Waspada) : Kedapatan mencuri 12 potong pakaian baru di sejumlah toko pakaian di Pantonlabu, dua ibu rumah tangga terpaksa meringkuk di bui Mapolsek Tanah Jambo Aye, Aceh Utara. Tersangka AMN, 50, asal Desa Pardede, Lhokseumawe dan RZH, 41, asal Simpang Len Krueng Geukueh, Kecamatan Dewantara, Aceh Utara. Khusus AMN mengaku khilaf. Sedangkan RZH membantah terlibat meski polisi telah menyita barang bukti.

Kapolres Aceh Utara AKBP Farid BE melalui Kapolsek Tanah Jambo Aye, Iptu Mardan P, Selasa (23/8) menjelaskan, AMN ditangkap petugas saat hendak pulang di Terminal Pantonlabu, Senin (22/8). Sementara RZH sempat kabur dan baru berhasil dijemput dari rumahnya pada hari yang sama. “Keduanya masih terikat famili. Mareka mengaku datang ke Pantonlabu untuk mencari suami RZH yang sudah lama tidak pulang,” kata Kapolsek. (cmus)

Guru Pertanyakan Uang Non Dan Sertifikasi Ketua Koalisi Barisan Guru Bersatu (KobarGB) Bireuen M Jafar dan ketua PGRI Bireuen, Zainuddin, saat berada di Kantor Pemkab Bireuen mengatakan, uang sertifikasi dan non sertifikasi jatah guru sudah dua triwulan belum diterima. “Kami datang menanyakan masalah ini, dan kami dapat informasi bahwa pusat baru mentransfer uang satu triwulan (Jannuari-Maret) kami akan minta bukti pada pejabat terkait untuk dapat menjelaskan kepada teman-teman kami ini,” kata M Jafar yang diiyakan Zainuddin. Seorang guru dari Aceh Utara mempertanyakan uang NAD, non sertifikasi, sertifikasi dan uang Tunjangan Prestasi Kerja (TPK) jatah mereka priode beberapa bulan mengapa belum jelas dibayarkan. (cmh)

Curi Baju Baru, Dua IRT Dibui

Sesama Wanita Menikah Di Abdya

Ranto Alias Rohani Mengaku Keduanya Sudah Bercerai BLANGPIDIE (Waspada) : Pasangan suami istri Rinto dan Nuraini, wanita yang diduga telah melakukan pernikahan sesama jenis mengaku, pernikahan mereka itu sudah dibubarkan oleh KUA Kecamatan Darul Makmur, lantaran keduanya sama-sama berjenis kelamin perempuan. “Pernikahan kami itu sudah dibubarkan oleh kuaket (KUA), karena kami sama-sama berjenis kelamin perempuan dan hubungan kami sekarang hanya sebatas adik dan kakak, tak lebih” kata Ranto di kantor Satpol PP, WH dan Pemadam Kebakaran Abdya, Selasa (23/8). Ranto yang pada saat itu turut didamping Nuraini mengaku hubungan yang dijalin keduanya selama ini hanya sebatas hubungan adik dan kakak, dan mereka tidak pernah merasa ada ikatan suami-istri diantaran keduanya. “Kalau memang saya merasa suaminya (Nuraini) tentu saya akan cemburu saat dia telepon pacarnya tengah malam. Tapi ini tidak, malah HP saya kasih ke dia untuk menelepon pacarnya,” aku Ranto sembari dibenarkan Nuraini. Terkait proses lanjutan kedua wanita itu, Kasatpol PP, WH dan Pemadam Kebakaran Abdya, Muddasir, mengaku akan menyerahkan kasus itu ke Polres Abdya . “Yang ada cuma dugaan pemalsuan identitas dan itu ranahnya pihak kepolisian. Untuk itu sore nanti mereka kita serahkan saja ke polisi untuk ditindaklanjuti sesuai prosedur hukum yang berlaku,” papar Muddasir. Informasi yang dihimpun Waspada, kasus itu bermula ketika warga Gampong Blangpadang, Kecamatan Tangan-tangan, Aceh Barat Daya, pada Minggu (21/8) malam lalu, mengamankan satu pasangan “suami-istri” yang diketahui sama-sama berjenis kelamin perempuan.

Keduanya diboyong ke KantorWaliyatul Hisbah (WH), setelah sebelumnya diserahkan warga ke polisi. Pasangan “suami-istri” itumasing-masing Ranto alias Rohani,35, yang bertindak sebagai “suami”, warga Karang Anyer, Kecamatan Darul Makmur, Nagan Raya, dan Nuraini, 21,sebagai “istri”, warga Gampong Blangpadang. Keduanya disebut-sebut telah menikah pada Maret lalu, di Gampong Sarah Batee, Kecamatan Darul Makmur, Nagan Raya. Waspadai Pasangan Nikah Yang Tidak Terdaftar Masih terkait kasus tersebut, sejumlah pemuka agama mengungkapkan keprihatinan mereka atas perubahan pola pikir dan perilaku hidup masyarakat yang saban hari semakin menyimpang. Kondisi itu dinilai menjadi sebagai sebuah i’tibar (pelajaran) terhadap munculnya kasus itu di lain waktu dengan lebih mewaspadai terhadap paangan pendatang yang diragukan ke-absahan pernikahannya. Dalam Islam semua tuntunan tentang pernikahan dianggap sudah sangat jelas dan tegas, sehingga apabila ada pasangan yang dianggap melenceng dalam proses pernikahannya tentu akan menimbulkan keraguan dan hal itu perlu dilakukan secara pendalaman untuk menghindari munculnya kasus serupa. “Ini sebuah perilaku hidup yang jelas sangat tidak normatif, ke depan kita meminta pengawasan terhadap pasangan yang tidak memiliki kejelasan keabsahan pernikahannya tentu perlu ditelusuri, namun tetap dengan mengedepankan cara-cara yang baik,” sebut Tgk.Said Marwan Saleh, Wakil Ketua MPU Abdya. (csdp)

Kadhi Liar Gentayangan Di Bireuen BIREUEN (Waspada): Seorang kadhi liar yang pernah ditangkap Dinas Syariat Islam beberapa waktu,kembali beraksi. Sebelumnya dia dinasehati sembari mengaku tidak mengulangi lagi perkerjaan itu. Selain dilarang Negara juga diharamkan dalam Islam. Namun kali ini dia kembali beraksi dengan cara mengganti namanya dan meminta kepada pasangan yang dinikahkan supaya tidak mengaku nama aslinya. Pelaku bernama Ridwan, namun kali namanya digantai dengan namanya Tgk Muhammad Ridha, warga Kecamatan Peudada, kabupaten setempat. Sebagaimana diakui sepasang kekasih yang mengaku belum lama ini menikah padanya dan saat itu meminta kepada pasangan ini tidak mengakui namanya itu Ridwan. Hal itu diungkapkan Kadis Syariat Islam, Bireuen, Drs Tgk Umar Budiman, melalui Kasie Penyidikan Pencegahan dan Perdamaian Drs Tgk M Daud yang didampingi Tgk Usman Kelana, Senin (22/8). “Karena tertangkap pasangan inilah aksi Tgk Ridwan terungkap lagi, padahal kami sudah mengingatkan Tgk Ridwan supaya tidak main-main dengan hukum agama Islam pada saat ditangkap pertama sekali,” kata Tgk M Daud. Diungkapkan, pada Kamis (19/8) pasangan N,23, lelaki asal Kecamatan Peulimbang, Bireuen ditangkap warganya di rumah N bersama dan pasangannya J,21, asal Pante Raja, Pidie Jaya. Warga menduga keduanya belum menikah namun sudah satu rumah. Keduanya ditangkap dan saat diminta buku nikah tidak bisa diperlihatkan selain menunjukkan selembar surat keterangan nikah yang ditandatangani Tgk Muhammad Ridha tertanggal 13 Maret 2011. Karena warga melihat itu adalah surat nikah di kadhi liar, maka keduanya diserahkan ke Dinas Syariat Islam. “Terungkapnya khadi liar bernama Tgk Ridwan yang berganti nama menjadi Tgk Muhammad Ridha itu, setelah pihaknya meminta keterangan pada pasangan yang ditangkap warga itu, bahkan kepada pasangan ini Tgk Ridwan berpesan supaya tidak mengaku menikah padanya namun kepada Tgk Muhammad Ridha. Saat itulah kami mengetahui kalau Tgk Ridwan telah berganti nama. Karena beberapa waktu lalu khadi liar itu telah pernah kami amankan terkait kasus yang sama, beberapa waktu lalu,” terang Tgk Daud. Dikatakan M Daud, pihaknya atas perintah Kadis Syariat pihaknya disuruh jemput kadhi liar itu lalu diperiksa kembali, bila memang sebagaimana dugaan maka tidak tertutup kemungkinan diserahkan kepada polisi karena memang kasus itu kasus melanggar hukum nasional juga sudah berulangkali dan juga melanggar hukum Islam. “Kemungkinan Tgk Ridwan itu setelah kami jemput akan kami serahkan kepihak yang ber-

wajib agar diproses sebagaimana aturan yang berlaku. Karena yang disebut dengan seorang kadhi yang sah berdasarkan UU perkawinan nomor 01 tahun 1974 adalah diangkat negara, berarti Tgk Ridwan ini bisa diancam hukuman empat tahun penjara dan bisa dijerat dengan KUHPidana pasal 269 tentang perkawinan juga hukuman empat tahun penjara,” kata Usman dan M Daud. Sementara itu pasangan yang dinikah liar itu, mengaku, dia terpaksa menikah secara liar, karena calon mertuanya tiba-tiba tidak menyetujui hubungannya padahal saat itu sudah ada NA keduanya. “Kami tidak ada niat menikah liar seperti ini, namun orang tua calon istri saya itu tiba-tiba tidak setuju, lalu kami cari jalan lain dan jumpalah dengan Tgk kadhi liar itu (Ridwan-red) dan saat itu beliau berpesan kepada saya suapay tidak mengaku namanya Ridwan,” kata tersangka N menjawab Waspada secara terpisah. Meresahkan Keberadaan kadhi liar di Kabupaten Bireuen dinilai sudah sangat meresahkan. Bahkan, sebagian praktik pernikahan ilegal ini telah diamankan petugasWH, namun keberadaannya semakin bertambah. Demikian antara lain disampaikan Komandan WH Dinas Syariat Islam setempat, Usman Kelana, Selasa (23/8). Dia menyebutkan, untuk memuluskan praktiknya, ada kadhi liar yang menggantikan identitasnya. “Kami mencatat ada sedikitnya 7 kadhi liar yang tersebar di tiga kecamatan, termasuk Tgk MR, asal Peudada yang kemudian menukar namanya menjadi Tgk M Ridha,” jelasnya. Menurutnya, selain dari Kecamatan Peudada, penghulu liar ini juga berasal dari Kecamatan Jeunieb dan Kutblang. “5 Kadhi liar berasal dari Kecamatan Peudada, sisanya dari Jeunieb dan Kutablang,” jelas Usman. Dalam praktik pernikahan liar ini, katanya, selain tidak resmi juga terindikasi ada pernikahan yang dilakukan tanpa wali dari calon mempelai wanita. Bahkan, disinyalir ada wanita yang diceraikan suaminya, kemudian dinikahkan oleh kadhi liar kendati belum berakhir masa iddahnya. Karenanya, untuk menghindari praktik ini maka perlu tindakan yang tegas terhadap pelakunya sebagaimana diatur dalam KUHP pasal 279 ayat 1, 2 dan 3 yang menegaskan setiap pernikahan tercatat dan terdaftar dalam lembaran negara. Melanggar pasal ini diancam maksimal 7 tahun kurungan. Selain itu, keberadaan nikah liar juga bertentangan dengan Undang-undang Perkawinan RI No:1/1974. “Makanya kami mohon MPU untuk segera menindaklanjuti masalah ini,” katanya. (cmh/cb03)


WASPADA Rabu 24 Agustus 2011

Bupati Aceh Selatan Diultimatum Soal Penukaran Lahan

Aceh Butuh Tenaga Skill BANDA ACEH(Waspada): Pemerintah Aceh mulai mengurangi rekrutmen pegawai negeri sipil (PNS) guna mengantisipasi terjadinya lonjakan tenaga kerja di pemerintahan. “Sejak beberapa tahun lalu kita sudah mengurangi jumlah rekrutmen dan kita hanya buka formasi tenaga skill yang dibutuhkan,” kata Wakil Gubernur Aceh Muhammad Nazar, di sela-sela buka puasa bersama di Banda Aceh, Selasa (22/8). Kata dia, saat ini yang paling dibutuhkan adalah tenaga pengawasan, auditor, perencanaan serta beberapa tenaga teknis lainnya yang benar-benar produktif. Artinya formasi yang direkrut di semua bidang. Namun, ke depan akan diambil kebijakan hanya untuk formasi tertentu yang sifatnya lebih mengarah kepada kemampuan teknis. Menyangkut kebijakan moratorium PNS yang dilakukan pemerintah pusat, Muhammad Nazar mengatakan hal itu sudah dilakukan beberapa kabupaten/kota di Aceh. “Seperti di Banda Aceh, sejak tiga tahun terakhir tidak membuka formasi bagi calon PNS. Hal ini dilakukan karena kemampuan keuangan daerah sangat terbatas,” ungkap Wakil Gubernur. Oleh karena itu, lanjut Nazar, Pemerintah Aceh terus mendorong pemerintah kabupaten/kota agar merekrut PNS sesuai kebutuhan dengan dibarengi kemampuan yang ada.(b06) Waspada/Muhammad H. Ishak

DIGENANGI AIR: Pengguna jalan terlihat menghindari genangan air di badan jalan ‘bak’ kubangan kerbau di Seuneubok Baroe, Kecamatan Julok, Aceh Timur, Selasa (23/8).

Wabup Pegang Kendali Pemerintah Aceh Singkil SINGKIL(Waspada): Kendali Pemerintahan Kabupaten Aceh Singkil dilaporkan kini dipegang Wakil Bupati Drs H Khazali Bahar, setelah kondisi kesehatan Bupati H Makmursyah Putra drastis menurun dua bulan terakhir. Sekretaris Daerah Aceh Singkil Drs HM Yakub KS, MM yang dikonfirmasi Waspada, Senin (22/8) mengatakan, pelimpahan wewenang atau mandat yang telah diupayakan belum terealisasi Kata Yakub, dia bersama Wabup Khazali sebelumnya pernah ke Medan untuk mengurus mandat, namun karena saat itu kondisi Makmur yang dirawat di salah saru RSU swasta memprihatinkan, upaya itu tidak terealisasi. Sekarang yang ada, mandat berupa pesan singkat short massage service (SMS). “Mandatnya hanya berupa SMS,’’ sebut Yakub Di tempat terpisah Ketua Komisi A DPRK Tamiruddin Lingga kepada Waspada di Singkil, membenarkan telah turun mandat penuh kepada Wabup, katanya. Hingga berita ini diturunkan Wabup Khazali yang coba dihubungi Waspada di kantornya belum berhasil. (b30)

GM Sel Berbagi Rezeki BANDA ACEH (Waspada) : Gudang grosir GM Sel, sebuah usaha yang bergerak di bidang penjualan handphone, voucher, asesoris dan spare part di Banda Aceh, membagi-bagi rezeki kepada mitranya yang dirangkai dengan buka puasa bersama di sebuah restoran di kawasan Lamyong, Banda Aceh, Minggu (21/8). Dalam kegiatan, GM Sel membagikan 5000 kupon kepada para mitra dan pelanggan yang membeli dengan nilai tertentu. Undian ini menyediakan hadiah berupa kulkas, mesin cuci, TV flat, dispenser dan ratusan hadiah lainnya dengan hadiah utama sepedamotor. Pemilik GM Sel Adi Sulaiman Majid menyebutkan, kegiatan gathering ini bertujuan untuk menjalin silaturrahim antara perusahaannya dengan mitra yang selama ini berperan banyak dalam memajukan perusahaan ini. Saat ini, kata Adi, GM Sel merupakan dealer utama multi brand HP produk China untuk wilayah Aceh serta dealer resmi beberapa merk HP seperti Nokia, Samsung dan LG. “Saat ini kita memiliki tiga gudang grosir di Banda Aceh, yakni 2 di Peunayong dan di Peuniti,” jelasnya.(b07)

Sekda Pimpin Raker Panitia HUT Subulussalam SUBULUSSALAM (Waspada) : Plh Sekdako Subulussalam Damhuri didampingi Wakil Wali Kota Affan Bintang, LO Polres Kompol Mirwaji, Asisten I dan II Rusdi Hasan dan Azwir serta staf ahli Anharuddin mepimpin Rapat Kerja (Raker) Panitia Hari Jadi Subulussalam ke-49, September 2011. Dalam Raker, Selasa (23/8) di aula Setdako, hadir sejumlah Kepala SKPK/mewakili dan segenap unsur terkait. Dalam menyemarakkan hari jadi itu disepakati digelar sejumlah kegiatan, pertandingan dan lomba seperti bidang seni, budaya, kebersihan dan olahraga. Sedangkan acara puncak digelar di Lapangan Beringin Subulussalam. Gaji PNS September dibayar jelang Idul Fithri. Dalam kesempatan itu Damhuri menyebutkan, gaji PNS di lingkungan Pemko Subulussalam untuk September 2011 dibayarkan Agustus 2011 atau sebelum Idul Fithri pekan depan. Kepastian itu menurut Damhuri menyusul PP 52 tahun 2011 tentang pembayaran gaji PNS September 2011. Menyoal masa libur kerja pra dan pasca Idul Fithri tahun ini, Damhuri mengatakan, 29 Agustus dan 1-2 September merupakan cuti bersama. Sedangkan pada, 30-31 Agustus libur umum. Bayarkan TC Di sela-sela rapat, salah seorang PNS berharap Pemko membayarkan TC. Pasalnya, andaipun PP tidak terbit, dengan dibayar TC Januari-Agustus 2011 sudah cukup. “Kalau Pemda nggak sanggup bayar TC, kembalikan saja enam hari kerja,” kritik sumber memastikan, enam bulan TC 2010 belum dibayar daerah ini. Dikonfirmasi usai memimpin rapat, Plh. Sekda, Damhuri menyebutkan kalau tiga bulan TC PNS 2011 daerah ini akan dibayarkan segera. “Gaji bulan September dan TC tiga bulan, dalam dua atau tiga hari ini akan dibayarkan,” terang Damhuri. (b33)

Petinggi Kerajaan Brunei Kunjungi Aceh Jaya BANDA ACEH (Waspada) : Petinggi Kerajaan Brunei ABDB YM Mejar Jenderal Dato Paduka Seri Haji Amiruddin Ihsan Bin Poksm DSP Haji Abidin didampingi Gubernur Aceh Irwandi Yusuf mengunjungi Dusun Teupin Rambot, Kecamatan Panga, Kabupaten Aceh Jaya, Selasa (23/8). Kunjungan tersebut untuk melihat dari dekat bantuan negara Brunei di kawasan tersebut berupa pembangunan masjid dan pesantren. Paduka Seri Haji Amiruddin dan rombongan disambut denga tarian ranup lampuan oleh masyarakat Teupin Rambot. Paduka Seri Haji Amiruddin dalam kesempatan tersebut menyampaikan akan terus membantu masyarakat Teupin Rambot lewat penyaluran zakat masyarakat dan bantuan Kerajaan Brunei. Selain Gubernur Aceh, tampak juga pejabat Pemkab Aceh Jaya dan Muspida Aceh Jaya dan tokoh masyarakat Kecamatan Panga. (b32)

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu) Garuda Indonesia

Berangkat (flight, tujuan, waktu)

GA 146 Jakarta/Medan


GA 147 Medan/Jakarta


Y6 537 Medan


Y6 538 Medan


JT 304 Jakarta JT 396 Jakarta/Medan

11:35 20:00

JT 397 Medan/Jakarta JT 307 Jakarta

06:40 12:15

SJ 010 Jakarta/Medan


SJ 011 Medan/Jakarta


Batavia Air Lion Air

Sriwijaya Air Air Asia

AK 305 Kuala Lumpur *


AK 306 Kuala Lumpur*


FY 3401 Penang **


FY3400 Penang **


Fire Fly

* Setiap Senin, Rabu , Jumat dan Minggu. ** Setiap Selasa, Kamis dan Minggu.


Korban Perampokan Masih Trauma MEULABOH (Waspada) : Ramli, 43, korban perampokan di Desa Seumara, Kec. Pante Cereumen, Kab. Aceh Barat berangsur pulih. Senin (22/8), warga Leuhan, Johan Pahlawan, Aceh Barat telah diperkenankan tim medis RSUD Cut Nyak Dhien untuk kembali ke rumahnya. Ramli sempat dirawat ke Instalasi Gawat Darurat (IGD), sebelum akhirnya dirujuk ke ruang Intensive Care Unit (ICU). Korban menderita tiga luka tembak, dua punggung kiri tembus ke dada dan bahu kanan tembus ke punggung belakang. “Tangan kiri saya yang masih kebas, tidak terasa kalau digerakkan. Peluru tidak ada yang tertinggal. Ada sedikit serpihannya di bahu kanan,” kata Ramli di rumahnya Lr Raja Aceh Dusun Leuhan Tengoh, Senin (22/8). Masih Trauma Insiden perampokan itu menyisakan kisah pilu dan trauma bagi Ramli, 43, korban

selamat dalam peristiwa itu. Ramli terlihat tegar, meski perampokan yang menimpannya telah merenggut nyawa Yusran sepupunya. “Tidak ada firasat apapun. Semua seperti biasa. Kami berangkat dari rumah sekitar pukul 08:00 pagi dan pulang siang jam tiga selesai hari pekan15:00,” kata Ramli. “Saat berjualan di pasar, juga seperti biasa. seingat saya saat memang ada sosok pria yang mirip kedua pelaku. Mereka mondar-mandir di pasar, seorang di antarannya menggunakan jeans coklat dan kemeja. Perawakannya kecil,” tambah Ramli. Pun demikian kesedihan tak mampu disembunyikannya. Betapa tidak, profesi berdagang emas yang digeluti sejak empat tahun silam berakhir tragis dengan meninggalnya Yusran di tangan perampok. Peristiwa itu mengakibatkan Muhammad Firdaus, bayi berusia dua bulan kehilangan sosok sang ayah.

Muhammad Firdaus merupakan anak pertama pasangan alm. Yusran, 31, dan Khairun Nisa, 28. “Seandainya saat itu pelaku kembali ke tempat saya tergeletak, saya sudah siap jika harus mati. Karena saya bertekad melawan,” kenang Ramli. Namun takdir berkata lain, kedua pelaku langsung meninggalkannya yang terjerebab usai terkena 3 butir peluru. Sebelumnya seorang pelaku sempat bermaksud mendatangi Ramli yang terpaut sekitar 20 meter dari posisi Yusran yang telah terjerembab usai ditembak di bagian kepala dan punggung oleh pelaku. “Niat itu tidak terlaksana, pelaku yang berada di atas motor melihat kehadiran Sainibunpencari pucuk bamboo di lokasi. Dia meminta pelaku yang memegang pistol segera naik. Pelaku juga sempat menodongkan senjata ke Sainibun sebelum akhirnya kabur. Habis itu saya tidak sadar lagi,” ujar Ramli. (cak)

Terlibat Narkoba, Tiga Anggota Polres Bireuen Dipecat BIREUEN (Waspada) : Pemecatan tiga anggota Polres Bireuen yang terlibat narkoba bukan hal yang diinginkan dan banggakan. Hal ini agar menjadi peringatan bagi setiap anggota Polri jangan bermain-main dengan narkoba. Kejadian yang terjadi pertama kalinya melibatkan tiga anggota Pores Bireuen hendaknya dijadikan sebagai kasus yg terakhir. ‘’Jangan sampai gara-gara oknum anggota Polri melibatkan diri dalam kasus narkoba dan tindak kejahatan lainnya akan menghilangkan kepercayaan masyarakat serta pelaksanaan tugas Polri menjadi kan-

das,” papar Kapolres Bireuen AKBP HR Dadiek Juneidi pada upacara pemberhentian tiga anggota Polres Bireuen tidak dengan hormat di lapangan apel Mapolres setempat, Selasa (23/8). Upacara turut dihadiriWaka Polres, seluruh Kasat, Kabag, perwira dan bintara Polres. Ketiga anggota Polres yang dipecat tidak dengan hormat tanpa menghadirkan ketiga anggota yang bersangkutan dalam upacara berdasarkan Surat Keputusan Kapolda Aceh Kep/ Khirdin/93/VI/2011 dan Kep/ Khirdin/102/VII2011 tentang PTDH (Perberhentian tidak dengan hormat) masing-masing,

Bripka Adriman Nrp 77120180 jabatan Kasat Sabara Polres Bireuen diberhentikan tidak dengan hormat terhitung 30 Juni 2011. Briptu Muhammad Imran, SE Nrp 85051514 jabatan Basat Sabara Polres Bireuen diberhentikan tidak dengan hormat terhitung 31 Juli 2011. Keduanya melakukan tindak kejahatan melanggar pasal 12 ayat (1) huruf a BP RI No 1 tahun 2003. Dan Bripda Taufik Syah Putra Nrp 87041591 jabatan Bintara Polres Bireun diberhentikan tidak dengan hormat terhitung 30 Juni 2011 melanggar pasal 14 ayat (1) huruf a BP RI No 1 tahun 2003. (b16)

TAPAKTUAN (Waspada) : Kasus tukar guling lahan yang dimohon PT First Mujur Plantation dan Industri di kawasan Kabupaten Aceh Selatan seluas 11.187 hektare sebagai lahan pengganti atas kawasan hutan produksi di wilayah Sumut mendapat kecamatan keras dari sejumlah anggota DPRK Aceh Selatan. Bahkan anggota dewan asal Bakongan, Ridwan Mas mengultimatum Bupati HusinYusuf segera membatalkan tukar guling lahan di lokasi Kecamatan Trumon dan Bakongan dengan mencabut kembali rekomendasi yang terlanjur dikeluarkan dalam waktu 30 hari. “Saya minta saudara bupati segera mencabut kembali rekomendasi penukaran lahan di wilayah Trumon dan Bakongan dalam waktu 30 hari,” ucap Ridwan Mas saat interupsi pada sidang paripurna dewan dengan agenda pemandangan umum anggota dewan dipimpin wakil ketua dewan Marsidiq di gedung dewan di Tapaktuan, Senin (22/8) sore. Dalam sidang yang juga dihadiri Bupati HusinYusuf, Sekdakab Harmaini serta sejumlah SKPD itu, Ridwan mensinyalir bentuk penukaran tersebut sebagai trik menjual lahan kepada pihak lain. “Kalau tak mampu membangun Bakongan dan Trumon, daerah kami jangan diobok-obok,” sebut anggota dewan dari daerah pemilihan Bakongan itu. Rekomendasi Bupati Aceh Selatan Husin Yusuf bernomor 522/1112, tertanggal 7 Oktober 2010, menanggapi permohonan Direktur PT

First Mujur Plantation dan Industri nomor 064/ FMPI/Mhn/X/2010, tanggal 6 Oktober 2010, HusinYusuf menyetujui tukar guling lahan tersebut sepanjang tidak bertentangan dengan ketentuan, disesuaikan dengan ketersediaan lahan/ aspek kepemilikan masyarakat. “Rekomendasi ini sejalan dengan rekomendasi Gubernur Aceh Irwandi Yusuf nomor 522/ 16076, tanggal 27 April 2010,” tulis Bupati Husin Yusuf dalam rekomendasi tersebut. Selain Ridwan Mas, tudingan serupa dikemukakan Azmir kepada wartawan secara terpisah. “Apapun alasannya, kita tak bisa menerima kebijakan bupati ini tanpa koordinasi dengan dewan,” jelas Azmir. Sedangkan Deni Irmansyah yang menyampaikan pemandangan umumnya menyebutkan, kasus tukar guling lahan tersebut merupakan kebijakan konyol dan merugikan daerah karena beralihnya fungsi lahan dari hutan produksi menjadi hutan lindung. “Soalnya ini merupakan bentuk pelanggaran Rencana Tata Ruang Wilayah (RTRW) Aceh Selatan dilakukan pihak eksekutif,” kata Deni Irmansyah. Bupati Aceh Selatan Husin Yusuf yang ditanya wartawan terkait kasus tukar guling lahan yang dipersoal dewan menyebutkan, pihaknya tidak pernah menjual lahan kepada pihak lain. “Inikan baru rekomendasi, masalahnya belum final dan prosesnya masih panjang,” katai Husin didampingi Sekda Harmaini dan Asisten Tata Praja Nasarurrahman. (b19)

JK Akan Hadiri Setengah Abad Unsyiah BANDA ACEH (Waspada): Menyambut Dies Natalis ke 50, Universitas Syiah Kuala merencanakan mengudang tokoh perdamaian Aceh, HM Jusuf Kalla sebagai dies reader. Mantan Wakil Presiden itu didauat berorasi pada hari jadi Unsyiah. Kepala Bagian Humas Unsyiah, Drs AWahab Abdi, M.Si kepada Waspada, Senin (22/8) menyebutkan, pihaknya mengundang tokoh nasional itu untuk membangkitkan semangat kewirausahaan mahasiswa Aceh. Kata Wahab, sebagai dies reader, Ketua PMI Pusat itu, akan berbicara tentang kewirausahaan. JK dinilai pantas, mengingat lelaki asal Sulawesi Selatan itu dikenal sebagai tokoh wiraswasata yang sukses di Tanah Air ini. MenurutWahab, dengan kehadiran JK diharapkan bisa memberikan berbagai ide dalam mengembangkan berbagai usaha. Apalagi, ini sejalan dengan program Unsyiah dalam tiga tahun terakhir yakni mengembangkan sistem pendidikan berwawasan kewirausahaan dan mendorong mahasiswa untuk terjun ke dunia. Ditambahkannya, pendidikan kewirausahaan yang diberikan bagi mahasiswa tersebut

adalah salah satu solusi untuk menghilangkan orientasi setiap lulusan. “Selama ini, orientasi para sarjana kita hanya bekerja di pemerintahan dengan menjadi pegawai negeri,” sebutWahab. Pihak Unsyiah, kata Wahab, berharap lulusan dari kampus berjuluk ‘Jantong Hate Rakyat Aceh’ itu mampu membuka usaha baru sehingga menciptakan lapangan kerja baru di Aceh di masa depan. “Mahasiswa itu sejatinya harus menjadi pelopor dalam melahirkan berbagai ragam kegiatan ekonomi berbasis inovatif, kreatif dan produktif sehingga dapat membuka lapangan kerja baru di masyarakat,” kata AWahab. Rektor Unsyiah, Prof Dr Darni M Daud saat mewisuda 1.170 mahasiswa, Sabtu (20/8), meminta para lulusan perguruan tinggi untuk menggeser orientasi menjadi Pegawai Negeri Sipil (PNS) dalam benaknya. Kata dia, dari 170 juta masyarakat Indonesia yang berada pada usia produktif, hanya 0,18 persen yang terjun ke dunia wirausaha. Angka ini tertinggal jauh dibandingkan negaranegara seperti Amerika Serikat (12 persen), China (10 persen), Jepang (10 persen), India (7 persen), dan Malaysia tiga persen.b05)

Kebijakan Mutasi Di Disdik Abdya Dinilai Tak Profesional BLANGPIDIE (Waspada) : Pemindahan Ali Hamzah, guru SMK Negeri 1 Manggeng ke SMP Negeri 1 Cot Mane, Blangpidie, dinilai oleh sejumlah pihak sebagai kebijakan yang sangat memalukan. Selain dilatarbelakangi persoalan politik, pemindahan guru saat ini yang dilakukan Dinas Pendidikan Aceh Barat Daya telah menciptakan kondisi yang membuat situasi para guru menjadi ‘penjilat’ untuk kepentingan penguasa. Pernyataan bernada ‘keras’ dikemukakan aktifis LSM dari Forum Komunikasi Pemuda Abdya (FKPA) Edi Syahputra, Senin (22/8). Selain menimpa Ali Hamzah, mutasi lainnya terhadap para guru, menurutnya, lebih dilatarbelakangi faktor ‘like and dislike’, kondisi tersebut dinilai akan meruntuhkan mekanisme peningkatan kapasitas seorang guru serta membuat program pengembangan potensi sekolah ikut

terpengaruh karena proses pemindahan secara tidak berazaskan kepatutan. Sekretaris PGRI Abdya Wardana menyarankan Dinas Pendidikan melakukan pengaturan proses mutasi secara tepat dan profesional, sehingga apabila mutasi dilatarbelakangi tujuan politis dikhawtirkan guru ikut terseret ke ranah yang di luar koridor tugasnya, kondisi tersebut tentu dinilai akan ikut mempengaruhi persoalan mutu pendidikan di daerah. Ali Hamzah, guru SMK Negeri 1 Manggeng yang baru saja dimutasi ke SMP Negeri 1 Cot Mane mengungkapkan kesiapannya terhadap mutasi yang menimpa dirinya itu, walaupun mutasi tersebut lebih disebabkan karena dirinya tidak mendukung Akmal Ibrahim. Kepala Dinas Pendidikan Abdya Maiyuli RH hingga berita ini diturunkan tidak berhasil dimintai tanggapannya. (csdp)

Kompos, Dari Rumah Tangga Buat Keluarga MEMASUKI jalan kompleks Balai Pengkajian Teknologi Pertanian terasa begitu nyaman. Suasananya pun sejuk binti segar. Ini tak lain akibat rimbunnya penghijauan di kawasan tersebut. Kenyamanan nan sejuk itu juga terpatri dari senyum penghuninya. Salah satu Nyonya Fitria, 43 tahun. Dia seorang ibu rumah tangga di sana. Tinggalnya di jalan Tanoh Abee II. 11 perumahan di jalan ini, semua aktif berkompos. Pada Jumat pekan lalu, dia tak sendiri di sana. Ada dua temannya yang sedang menjaga anak dan rumah; Ny Inong ,42, dan Ny Isna,36. “Tinggal kami bertiga, ibu-ibu yang lain sudah pergi kerja,” katanya kepada Waspada. Selain ketiganya, Waspada juga dipandu Miksalmina,28, seorang fasilitator dari Dinas

Kebersihan dan Keindahan Kota (DK3) Banda Aceh. Dalam empat tahun terakhir lembaga ini menggencarkan kampanye menjaga lingkungan, terutama melalui program komposting. Ny Fitria yang bertindak selaku ‘juru bicara’ terlihat amat mahir menjelaskan proses pembuatan kompos. “Sudah dua tahun kami membuat kompos dari sampah rumah tangga,” tambah Ny Isna. Selama itulah, 11 ibu rumah tangga di kompleks itu menggalakkan pembuatan kompos di masing-masing rumah. Buktinya, di setiap sudut pagar terdapat dua tong biru yang dipakai untuk komposter. “Yok kita lihat ini,” kata Fitria sembari membuka tutup tong. “Ini belum jadi,” ujar dia menunjuk komposter (tong) pertama. “Satu hari sekali harus dibolak-balik agar campurannya merata, supaya tak bau dicampur serbuk kayu,” kata dia. Komposter pertama dipakai untuk sampah yang baru dibuat, ini membutuhkan waktu

Langkah-langkah pembuatan kompos 1. Siapkan sampah basah (sisa makanan,buah dan sayur) 2. Siapkan sampah kering (serbuk gergaji, dedaunan kering) 3. Potong kecil-kecil seluruh sampah 4. Campurkan sampah basah dan sampah kering dengan perbandingan 1 banding 1 (1:1). 5. Siram tumpukan sampah setiap hari 6. Aduk-aduk tumpukan sampah setiap hari 7. Selanjutnya, untuk setiap penambahan sampah basah dilakukan pengadukan dan ditutup dengan sampah kering. Note: 1. Tumpukan yang besarnya satu meter kubik atau lebih besar akan membuat proses kompos lebih optimal 2. Semakin kecil potongan sampah semakin cepat menjadi kompos 3. Lama pembuatan kompos bervariasi dari 6 minggu sampai 8 minggu 4. Ciri-ciri kompos yang baik adalah gelap, rapuh, sudah berbau tanah, material sampah telah terurai/terdekomposisi dengan baik.

satu bulan. Begitu isinya ‘matang’, lalu di pindahkan ke komposter kedua. Apabila komposnya sudah matang, lalu dimasukkan ke dalam komposter ketiga, demikian selanjutnya. “Ini sudah jadi. Siap dipakai untuk pupuk tanaman depan rumah,” ujarnya sembari menunjuk tanaman cabai yang daunnya menghijau. Sejak itu pula mereka mulai merasakan manfaat dari membuat kompos. Selain sampah rumah tangga tak terbuang percuma, manfaat lain juga dirasa keluarga. “Kita jadi terbiasa hidup bersih dan menjaga lingkungan,” tukasnya. Pada sisi lain, Isna dkk juga bisa memakai kompos produksi rumah tangga itu untuk menyuburkan bunga di pekarangan rumah. Juga buat tanaman lain seperti cabai, kacang panjang dan lainnya. “Minimal untuk kebutuhan dapur seperti cabai dan sayur tak perlu dibeli lagi,” ujarnya. “Kalau sekali-kali perlu untuk ngerujak, tak perlu ke pasar lagi lah,” sambung Inong menebar senyum. Keluarga ini mengaku sudah membiasakan diri memilah sampah kering dan sampah basah. “Sampah-sampah plastik kami tampung pada satu tempat,” ujar Isna lagi sembari menunjuk ke penampung sampah plastik yang dibuat khusus. Kini, penampung sampah plastik itu penuh sesak. “Nanti pihak DK3 akan mengutip sampah plastik. Mereka akan membelinya. Uang kami pakai untuk membayar restibusi sampah,” jelas mereka. Miksalmina menambahkan, botol yang dikumpulkan warga, terutama botol mineral akan dibeli DK3. Kata dia, untuk botol mineral jenis PP diharga

Rp. 3.500 per kilo, PET Rp. 2.500 per kilo dan HDPE (botol oli) Rp. 2.500-3.000. Sedangkan untuk sampah anorganik seperti plastik kresek bisa dimanfaatkan untuk kerajinan tas, bunga, dan lain-lain. Kata Miksalmina, kerajinan ini dilakukan para ibu rumah tangga di Pango dan Panteriek. Dalam menjaga lingkungan, kebiasaan keluarga Fitria cs patut ditiru. Sejak rutin membuat kompos mereka sudah lama tak lagi membakar sampah. “Bahkan, ada yang di kompleks lain bakar sampah kami larang,” papar Fitia. Ada satu misi mulia yang akan mereka praktikkan ke depan. Mereka ingin mengampanyekan program buat kompos kepada setiap keluarga di Banda Aceh. “Sedikit-sedikit kami sudah mulai kampanyekan kompos ini, terutama untuk kerabat dekat dulu di daerah lain,” tambah Isna yang diamini Fitria. Kendati sudah berhasil meracik kompos kecil-kecilan, ketiga ibu rumah tangga ini mengaku belum berpikir terjun ke bisnis kompos. “Belum berpikir ke sana,” sahut Inong. Pada sisi lain, trio kompos ini berharap masyarakat di Aceh lainnya ikut pula menjaga kebersihan, melestarikan lingkungan dan membuang sampah pada tempatnya. “Kalau mau buat kompos itu lebih bagus lagi,” sambung Fitria lagi. Warga desa lain, H Teuku Ismail Is, yang tinggal di jalan Keunari Timur, Peurada, juga sudah mulai ‘bertani’ kompos. Dia baru Januari tahun ini aktif, tapi, tak kalah mahir dengan mereka yang duluan berkompos ria. Miksalmina yang ikut mendampingi menjelaskan, proses

Waspada/Munawardi Ismail

Warga Gampong Baro,Kota Banda Aceh membuang sampah plastik ke tempat penampungan khusus. Sedangkan sampah rumah tangga mereka jadikan kompos. pembuatan kompos binaan DK3 tidak menggunakan bahan mempercepat proses kompos atau bioaktivator. “Karena di dalam sampah tersebut sudah ada mikroorganisme sendiri,” katanya. Karena tanpa bioaktivator, proses pengomposannya menjadi agak lama. Itu kekurangannya, kata dia. Pada sisi lain, dia menilai tak efektif memakai bioaktivator pada pengomposan rumah tangga karena sampahnya sedikit. Selain terkendala waktu, masalah lain yang dihadapi sebagian warga biasanya saat pembuatan kompos ada ulat, serta lama berprosesnya. “Apalagi masyarakat kita belum terbiasa, jadi seakan-akan memberatkan,” tambah Miksalmina. Di antara warga yang tak merasa berat itu adalah Ismail Is. Bahkan, di rumah pensiunan amtenar itu ada tiga komposter. Ketiganya berbeda fungsi. Komposter pertama, dipakai buat ‘memeram’ sampah sehari-hari.

Komposter kedua dipakai untuk menampung kompos setengah jadi yang diambil dari komposter pertama. Dan yang ketiga, berisi kompos siap panen. “Ini sudah jadi, hasilnya, kami pakai untuk pupuk tanaman depan rumah,” kata penggemar berat sepakbola ini. Mantan Direktur PDAM Tirta Daroy ini juga rajin. “Setiap hari ini saya bolak-balik biar merata antara sampah basah dengan yang kering. Kalau terlalu banyak air bisa campur dengan serbuk kayu,” jelas dia. Ismail tidak kerja sendiri. Dia bersama tujuh rumah tangga lain juga melakukan hal yang sama. Bahkan mereka sudah merasakan manfaat dari pupuk kompos. Karena itu, Ismail punya pesan untuk warga yang belum sempat buat kompos. “Ji k a b e ra t m e m b u a t kompos, biasakan memisahkan sampah kering dengan sampah basah, dan buanglah sampah pada tempatnya,” pesan Ismail Is. Ringan bukan? Munawardi Ismail



WASPADA Rabu 24 Agustus 2011

Perjuangan Penderita Tuna Rungu Diterima Militer AS KEITH Nolan butuh waktu selama sepuluh tahun berjuang agar bisa diterima di angkatan bersenjata. Selama sepuluh tahun tersebut dia berulangkali mengirimkan lamaran ke Korps Pelatihan Perwira Cadangan Angkatan Bersenjata (ROTC) AS. Usaha Keith sepertinya masih membutuhkan waktu lebih panjang meskipun dia terpilih sebagai anggota terbaik dalam program ROTC di Bravo Company di Universitas California State. Para instrukturnya sangat terkesan pada ketrampilan Keith, namun mereka tidak bisa membuat keputusan sendiri. Mungkin, Keith tidak akan

pernah merasakan bagaimana bekerja di angkatan bersenjata jika kebijakan militer yang berlaku sekarang ini masih mengharuskan seorang kadet melewati uji pendengaran yang diawasi pihak angkatan bersenjata. Pengumuman berakhirnya pelatihan menjadi saat-saat yang sangat menyakitkan bagi pria berusia 29 tahun yang selama ini berprofesi sebagai

guru, yang bertekad meruntuhkan semua rintangan dan mencapai impiannya selama ini yakni bekerja di bidang intelijen militer. “Keinginan terbesar saya adalah bekerja di angkatan bersenjata,” ujar Keith. “Saya ingin mengabdi pada negara dan saya tidak mau terbelenggu dengan kenyataan bahwa saya tuli.” Jumlah tentara dengan cacat tubuh yang bekerja aktif semakin meningkat seiring dengan kenyataan bahwa kemajuan medis sekarang ini memungkinkan pasien selamat dari luka parah akibat perang. Semua bidang di angkatan bersenjata AS selama sepuluh tahun terakhir telah membuka peluang bagi tentara yang menderita luka parah dan

cacat tetap untuk tetap bertugas aktif dengan memberikan pekerjaan yang bisa mereka lakukan. Sampai sekarang sekitar 300 tentara yang menderita cacat parah – sebagian di antaranya buta karena ledakan, kehilangan kaki atau menderita luka parah di kepala – bekerja dengan berbagai macam jabatan, dan kerja mereka penting, terutama dalam membantu tentara lain yang tengah dalam masa penyembuhan, kata Erich Langer, jubir di Komando Transisi Tentara di Alexandria, Virginia. Sebagian di antara mereka bahkan kembali ke zona perang. “Kasus-kasus ini membantu dibukanya peluang lebih besar bagi mereka yang menderita cacat tubuh seperti saya,”

Wanita Ini Ingin Berbobot 730 Kg OBESINYA menjadi wanita tergemuk sepanjang masa. Di saat jutaan wanita melakukan diet ketat demi memiliki tubuh langsing, Susanne Eman, 32, (foto) justru mengumbar nafsu makan demi meraih mimpi memiliki bobot 115 stone atau sekitar 730 kilogram. Seperti dikutip dari laman The Sun, Eman kini berbobot 52 stone 330,2 kilogram. Dia mengasup lebih 20 ribu kalori per hari, atau 10 kali lipat dari kebutuhan normal wanita dewasa, yakni 2.000 kalori sehari. Eman sangat percaya diri dengan tubuhnya yang superbesar. Selain merasa lebih mudah memikat pria pujaan, ia juga merasa spesial ketika terpilih menjadi model sebuah situs untuk komunitas pemilik tubuh besar. “Semakin besar tubuhku, aku merasa semakin percaya diri dan seksi,” ujarnya. Obsesinya menjadi gemuk semakin tak terkendali sejak dua tahun lalu saat berhasil memiliki bobot 35 stone atau sekitar 222,2 kilogram. Dengan tubuh besar, ia merasa mendapat banyak perhatian. “Aku mulai menarik lebih banyak orang, itu membuatku merasa nyaman,” ujarnya. Di akhir tahun ini, ia ingin bobotnya naik 32 kilogram atau mencapai 361,9 ilogram. Dan

menjadi 730 kilogram di usia 41 atau 42 tahun. “Saya ingin mematahkan stigma populer yang menyebut bahwa menjadi gemuk adalah hal yang sangat buruk,” ujar wanita asal Casa Grande, Arizona, Amerika Serikat ini. Demi memenuhi

kebutuhan makannya, ia bisa menghabiskan delapan jam untuk mengisi enam troli di supermarket setiap bulan. Sebagai gambaran, ia biasa menutup makan malamnya dengan delapan sendok es krim berikut brownies setiap malam. Dengan pola makannya

semacam itu, ia merasa sangat sehat karena mengimbangi dengan olahraga peregangan otot setiap hari. Ia juga melakukan pemeriksaan medis seperti tekanan darah dan kadar gula darah setiap seminggu sekali. “Jika angka mulai menunjukkan tanda bahaya aku segera menghubungi dokter pribadiku,” ujar ibu dua anak ini. Sang dokter, Patrick Flite, sudah berulang kali memeringatkan Eman bahwa tindakan menggemukkan badan di luar batas itu sangat berisiko. “Dia seperti bermain Russian Roulette dengan hidupnya Tapi, dia mampu membuat keputusan sendiri dan aku belum melihat ada masalah kejiwaan atau apa pun yang salah,” kata Flite. Obsesi Eman jauh melebihi pikiran Donna Simpson (42), yang berniat menaikkan bobotnya 177 kilogram menjadi 450 kilogram dalam beberapa tahun ke depan. Dalam sehari, ia harus mengasup sedikitnya 12.000 kalori atau enam kali lipat kebutuhan wanita normal. Jika Eman bisa menembus bobot 730 kilogram, ia akan mengalahkan pemegang rekor sebelumnya yakni Carol Yager yang diyakini berbobot 723 kilogram. Wanita asal Flint Michigan itu meninggal di usia 34 tahun pada 1994 silam. (vvn/rzl)

Keith Nolan, dibantu penterjemahnya, menggunakan bahasa isyarat ketika berbicara dalam sebuah kesempatan. harap Keith. Keith mengatakan, kehadiran mereka menunjukkan ada tempat di kemilitern bagi orangorang cacat. Dia melihat perubahan kebijakan di militer sebagai jendela harapan sehingga mereka yang menderita tuli – bukan hanya tentara – bisa diterima di angkatan bersenjata. Keith yang terlahir tuli dari orangtua yang menderita cacat serupa, dari dulu bercita-cita ingin bekerja di angkatan bersenjata setelah mengetahui kakek dan buyutnya ikut berjuang dalam Perang Dunia II. Ayahnya, Kevin Nolan, seorang anggota dewan kota di Northhampton, Massachusetts, mengajar putranya untuk tidak peduli pada cacat yang dideritanya.

“Saya dan istri saya sangat sedih mendengar dia program ROTC sudah berakhir. Begitupun kami sangat bangga Keith terpilih sebagai anggota terbaik,” ucap Kevin. Galang dukungan Kapten Sid Mendoza, seeorang pengawas pelatihan program di Northridge, mengatakan dia tidak tahu kalau Keith menderita tuna rungu, ketika melihat surat lamaran kerjanya di Internet. Pertama kali bertemu dengan Keith, Sid mengatakan dia mencari tahu cara untuk memberinya pengalaman militer karena dia sangat tertarik pada dunia angkatan bersenjata. Dengan bantuan penterjemah tuna rungu, Keith berhasil melewati pelatihan itu de-

ngan sangat bagus. “Kami juga merasa berat melepasnya, karena kami melihat antusias di dalam dirinya, namun keputusan bukan di tangan kami,” kata Sid. Seorang anggota kongres dari partai Republik Henry A. Waxman mengatakan, anggota kongres berencana bertemu Keith untuk memperjuangkan cita-citanya. Keith berharap Henry mengusulkan RUU yang mengijinkan orang tuli bekerja di angkatan bersenjata. Sementara ini, Keith terus menggalang dukungan bagi perjuangannya, dengan berbicara di sejumlah perguruan tinggi dan kegiatan publik lainnya. Di laman Facebooknya, sudah lebih 2.000 orang mendu-

kung usahanya tersebut. Dalam perjuangannya, Keith sampai berkunjung ke Israel pada tahun 2010 di mana dia bertemu dengan 10 tentara yang tuli. Tentara-tentara yang dijumpainya itu bekerja di segala bidang mulai dari intelijen sampai melatih anjing pelacak. “Mereka terkejut ketika mengetahui AS tidak membuka kesempatan bagi orang tuli seperti saya,” cetus Keith. “Tapi, dengan dukungan yang saya terima dari sipil dan militer serta dari pengalaman yang saya dapatkan, saya yakin ada posisi yang bisa saya kerjakan di militer tanpa mengganggu system kerja pasukan angkatan bersenjata,” ucapnya pasti. Syafri/AP

Berlian ‘Mata Emas’ Dilelang SEPOTONG berlian berwarna kuning yang dijuluki ‘Golden Eye’ (mata emas) yang disita dalam satu penyidikan kasus narkoba dan pencucian uang di Ohio akan dilelang dengan penawaran awal 900.000 dolar. Berlian 43,51 karat itu milik seorang pengusaha di Ohio yang didakwa bersalah melakukan pencucian uang dan persekongkolan. Jaksa penuntut mengatakan dia mencoba menjual berlian itu dan satu rumah yang dulunya milik Mike Tyson seharga 19,5 juta dolar kepada agen FBI yang tengah menyamar Permata itu – panjangnya sekitar 1 inci, lebar ¾ inci dan tebal ½ inci – disita dalam operasi penyerbuan dan diserahkan kepada pemerintah federal. Permata tersebut diyakini sebagai berlian kuning tanpa cacat terbesar yang pernah ada, kata Jenny Lynch, jubir perusahaan lelang online Bid4Assets.

Inilah berlian kuning ‘Golden Eye’ yang tak ternilai harganya. Perusahaan itu, yang markasnya di Silver Spring, Md, akan melelang berlian tersebut bulan depan atas nama Dinas Marshal. “Ini permata terbesar dan paling berharga yang akan kami lelang dalam sejarah 12 tahun berdirinya perusahaan ini,” kata Lynch. Berita lelang berlian ini sudah menarik perhatian di dalam AS sendiri dan juga luar negeri, kata Lisa Black, koordinator unit penyitaan di Dinas Marshal di Ohio. Sanking mahalnya permata tersebut, untuk menawarnya

saja seseorang perlu mempersiapkan dana sedikitnya 180.000 dolar. Karena Bid4Assets menetapkan seseorang harus memberikan deposit yang nantinya dikembalikan sebesar 180.000 dolar untuk bisa melihat permata tersebut dan menawarnya ketika lelang sedang berlangsung 6 September sampai 8 September.mendatang, kataWakil Marshal Ryan Helfrich. Mereka yang terlibat dalam lelang tersebut menolak menyebutkan harga tertinggi Golden Eye, tapi jaksa federal sebe-

lumnya mengatakan, berlian tersebut kemungkinan akan laku sampai jutaan dolar. Asal berlian tersebut masih diselimuti misteri, karena pihak otoritas tidak tahu dari mana pemiliknya – pengusaha Paul Monea – mendapatkan permata tersebut. Tom Moses, seorang Wakil Ketua Lembaga Permata Amerika, mengatakan berlian tersebut kemungkinan berasal dari Afrika Selatan, khususnya karena warna kuningnya yang lebih pekat. “Menurut sejarah, jenis berlian kuning besar seperti ini berasal dari sana,” katanya. “Berlian seperti ini, semakin kuning semakin mahal harganya.” Hasil dari lelang tersebut sebagian akan diberikan kepada para korban Paul Monea dan sebagian lainnya diserahkan kepada pemerintah federal dan lembaga lokal yang membantu penyelidikan, kata Dinas Marshal. Syafri/AP

Jusuf Sokartara, Anak Medan Petualang Dunia USIANYA memang sudah 67 tahun. Muhammad Jusuf Sokartara namanya. Namun, guratan kegantengan masih terlihat di wajahnya. Meskipun usia lanjut akan mengikutinya, tapi semangat petualangnya tak pernah pupus. Bahkan, penampilannya sehari-hari begitu energik ditambah kamera yang setiap saat menemani dirinya. Jusuf Sokartara (foto), dulu dikenal suka bepergian. Pada masa mudanya, Jusuf menggemari olahraga balap sepeda. Berbekal Sepeda dan kamera, Jusuf pun pernah berkeliling dunia dengan sepedanya hingga ke benua Eropa dan akhirnya bekerja dan bermukim di Negeri Belanda sejak 1972 hingga sekarang. Selama 39 tahun di negara yang pernah menjajah Indonesia ini, Jusuf bekerja di bagian Kargo penerbangan KLM, perusahaan maskapai penerbangan milik pemerintah Belanda, tapi telah pension sejak tiga tahun lalu. Jusuf dan keluarganya bermukim di Amsterdam, tak jauh dari Bandara Internasional Schiphol. Setelah pensiun, Jusuf bekerja sebagai guide (pemandured) bagi orang-orang Indonesia yang mengunjungi Negeri Belanda. Banyak sudah WNI yang dibawanya keliling benua Eropa. Mulai dari wartawan, turis, bintang film, pengusaha hingga politikus. Ada rasa kebanggaan tersendiri baginya setelah mendampingi teman-teman dari Indonesia. Jusuf mengakui, teman-teman Indonesianya cukup banyak, meski dirinya tinggal di Belanda. Mulai dari buruh kasar, artis film, cendekiawan, pengamat ekonomi, politikus, menteri dan sejumlah orang penting lainnya di negeri ini. Bahkan, seorang pengusaha dari Indonesia memberinya hadiah mobil. Pengusaha tersebut kagum dengan kegigihan Jusuf yang mengendarai mobil butut dan kemudian menggantinya dengan mobil Ford Winstar USA keluaran 2001 kala itu. “Selama di Belanda, saya membawa pengusaha tersebut keliling Eropa. Dia heran melihat mobil butut yang saya kendarai bisa ‘melanglang buana’. Pengusaha itu pun memberi saya mobil baru. Kejadian yang tak bisa saya lupakan itu terjadi pada Juli 2010,” kenang Jusuf. Menurut Jusuf, jadi guide, selain sebagai penghasilan tambahan, juga secara tak langsung akan menambah wawasan dan persahabatan. Kalau dirinya berkunjung ke Jakarta, maka akan tinggal di rumah sahabat-sahabat barunya itu. “Selain menambah teman, wawasan kita semakin bertambah, karena yang datang dari berbagai disiplin ilmu,” ujar Jusuf bersemangat. Meski telah lama hidup di Belanda bersama istri dan empat anaknya, namun gaya hidup orang Medan tak bisa hilang. “Kalo hidup di Belanda, kita tidak boleh diam aja. Kalo diam, kita bisa ‘dipijak-pijak’. Artinya penampilan kita harus garang atau ‘patentengan’ supaya disegani masyarakat Belanda,” tutur Jusuf yang berkali-kali mengunjungi redaksi Majalah DUNIA WANITA bila dirinya mudik ke Medan.

Jusuf menuturkan, Teruna Jasa Said – dewan komisaris Waspada Group, pun pernah datang ke Belanda dan bertemu dengannya. “Kami sudah lama berteman dengan Teruna Jasa Said, apalagi saya dulunya juga menulis tentang Belanda yang dimuat di Majalah DUNIA WANITA dan Harian Waspada,” sebut Jusuf yang menguasai bahasa Inggris, Jerman, Urdu dan bahasa Belanda yang fasih sekali. Ditemui di kediaman keluarga besarnya di Kelurahan Sarirejo, Kecamatan Medan Polonia, awal pekan ini saat mengunjungi kerabat keluarganya, Jusuf baru saja tiba di rumahnya usai mencetak film-film yang ada di kameranya. Kamera yang dibelinya di Aljazair itu, kini pendamping hidupnya sehari-hari. Maklum saja, memotret adalah hobinya yang tak bisa ditinggalkannya. Sukar Dicari Tiada Tara Nama lengkapnya Muhammad Jusuf Sokartara. Lahir di Brastagi, Sumatera Utara, 14 Maret, 67 tahun silam. Nama Muhammad Jusuf adalah pilihannya sendiri setelah dewasa. Sengaja memilih Jusuf, salah satu nama Nabi. Sosok Nabi Jusuf orangnya ganteng dan banyak lagi contoh teladan dan kisah-kisahnya yang menarik. Sedangkan Sokartara merupakan nama tambahan dari teman-teman kala Jusuf beranjak remaja. Hingga kini nama Muhamad Jusuf Sokartara pun terus melekat. Menurut Jusuf, nama Sokartara merupakan pemberian dari teman-teman masa kecilnya. Jusuf berkisah, sejak kanak-kanak hingga jelang remaja, dirinya jarang berada di rumah. Pun saat berada di satu tempat, dirinya merasa tak betah. Jusuf sering bepergian seorang diri sehingga teman-temannya merasa kehilangan dirinya. Saking sukarnya bertemu dengan Jusuf, teman-temannya memanggilnya Sokartara, akronim dari sukar dicari, payah didapat tiada tara. “Sampai sekarang nama Sokartara tetap melekat,” ujar Jusuf Sokartara sembari tertawa. Tak hanya temannya, Gubernur Sumatera Utara kala itu, Marah Halim Harahap dan Bupati Deliserdang Baharoeddin Siregar (kala itu) juga mengaku sulit kalau mau mencarinya. “Mana si Jusuf itu. Memang betullah namanya Sokartara. Sukar dicari, payah didapat tiada tara,” sebut Jusuf mengenang ucapan mantan gubernur Sumatera Utara itu. Sarat pengalaman dan penuh petualangan membuat penampilan Jusuf tak bisa dianggap remeh. Namun, dari penampilan, tutur bahasa dan gaya diplomasi serta menjadi guide tamutamu dari Indonesia yang berkunjung ke Belanda, orang tak menduga kalau sosok Jusuf hanya sampai mengecap pendidikan di bangku Kelas IV Sekolah Rakjat di Kabupaten Tanah Karo. Jadi tak heran kalau ia juga menguasai bahasa Karo. Gagal Naik Haji Sejak tahun 1965, Jusuf suka bersepeda. Bahkan, dirinya menjadi atlet sepeda dari Sumatera Utara, seangkatan dengan Sanusi.

Kenangan manis yang tak terlupakan yakni saat Jusuf dikeluarkan dari pemusatan latihan (training centre) di Jakarta pada 1969. Kala itu, empat pembalap sepeda dari Sumatera Utara masingmasing Sanusi, Sehan, Samuri dan Sokartara (4S) mengikuti TC untuk mengikuti lomba balap sepeda di Eropa. Jusuf menilai pelatih balap sepeda tidak fair dan terkesan pilih kasih saat melakukan pelatihan terhadap atlet sehingga sebagai atlet dari Sumatera, Jusuf protes. Protes Jusuf ternyata tak diterima oleh pelatih tersebut hingga keduanya bersitegang. Saking emosinya, Jusuf memukul pelatih tersebut hingga namanya dicoret dari pemusatan latihan dan ia kembali ke Medan. Di tahun 1969, jiwa petualang Jusuf terus diasahnya. Jusuf pun keliling dunia dengan mengendarai sepeda balapnya. Berpetualang “keliling dunia bersepeda” sudah dilakukannya. Maksudnya, bersepeda ke manapun ia pergi. Mengayuhnya di tempat yang dilaluinya, dan bahkan pernah membawa sepeda ke dalam kabin pesawat terbang. Agar petualangannya terwujud, Jusuf pun menemui sejumlah orang penting di Jakarta kala itu. Menko Kesra Alamsjah Ratu Perwiranegara yang saat itu masih bertugas di Sekretariat Negara ditemuinya, termasuk juga Adam Malik dan Ibnu Sutowo, orang kaya sekaligus pengusaha yang pernah menjabat Dirut Pertamina. Berbekal uang dari sejumlah tokoh penting dan pengusaha yang ia temui, Jusuf terbang ke Singapura bersama sepedanya. Dari Singapura, Jusuf mengayuh sepedanya hingga ke Johor terus ke Penang. Selama dalam perjalanannya itu, Jusuf mengalami kecelakaan. “Aku sempat beberapa hari dirawat di rumah sakit karena kecelakaan,” jelas Jusuf. Dari Malaysia, Jusuf meneruskan petualangannya ke India. Berbekal bantuan dari Konsulat Jenderal RI di Malaysia, Jusuf menumpang kapal feri ke Madras, India. Setibanya di Madras, Jusuf mengayuh sepedanya ke Bombay (Mumbai) dan New Delhi. Ada pengalaman dan kendala yang dihadapi Jusuf. Saat berada di kota Sangrur, Negara Bagian Punjab, India Utara, Jusuf ditangkap aparat keamanan karena dituding sebagai mata-mata (agen spionase). Maklum saja, saat itu sedang berkecamuk perang antara India dan Pakistan hingga Jusuf sempat merasakan pengapnya penjara di India. Sebulan ditahan, Jusuf akhirnya dilepas. “Aku baru dilepas setelah ditahan sebulan di India,” katanya. Di lepas dari penjara, Jusuf meninggalkan India dan menyeberang ke Pakistan. Pemerintahan Pakistan kala itu masih dipimpin oleh Perdana Menteri Benazir Bhutto. Di negeri ini, ada pengalaman yang sangat mengesankan bagi dirinya. “Setelah mereka tahu aku dari Indonesia, aparat keamanan tidak jadi memeriksaku. Bahkan, sejumlah aparat keamanan serentak menyebut nama presiden RI: Soekarno, Soekarno..., brother, brother.” Jusuf malah mendapat perlakuan istimewa,

dikasih makan, menginap di rumah-rumah penduduk, dan diberi selimut bagus. Di Pakistan ini, setiap hari Jusuf menempuh jarak antara 130 km dan 150 km. Dari Pakistan, Jusuf menyeberang Afganistan dan terus ke Iran. Di Iran inilah impiannya untuk “mengayuh” sepeda ke Tanah Suci (Arab Saudi) pupus. Pasalnya, Kedubes RI di Afganistan waktu itu menganggap Jusuf hanya membuat repot pihak Kedubes saja sehingga Jusuf gagal untuk menunaikan ibadah haji. Kegagalan ke Tanah Suci, tak membuat kendor semangatnya untuk terus mengayuh sepeda. Jusuf pun mengayuh sepedanya hingga ke Eropa Timur, tempat hunian negara-negara berfaham komunis. Di negara Blok Timur itu, Jusuf bersepeda ke Hungaria, Rumania hingga ke Uni Soviet. “Kini, tinggal dua negara yang ingin saya datangi yakni Amerika Serikat dan Kuba,” kata Jusuf. Jusuf kepingin melihat dari dekat lokasi air terjun Niagara (Niagara Fall). Selama berpetualang dengan sepeda, Jusuf juga tak lupa mengabadikan lokasi-lokasi atau sesuatu yang unik dilihatnya. Begitu juga saat masih bekerja di bagian kargo KLM Belanda, kamera tak lepas dari dirinya. Maklum saja, fotografi adalah hobinya. Bahkan, Jusuf juga sering mengirimkan foto-foto unik atau kegiatan hasil karyanya ke berbagai suratkabar di tanah air termasuk ke redaksi Majalah DUNIA WANITA dan Waspada. Anehnya, meskipun suka berpetualang, Jusuf mengaku tak pernah mengatur rencana kepergiannya itu. “ Kalo hari ini bisa di Medan, besok sudah sampai Jakarta, Kuala Lumpur, Manila, atau Hanoi. Kiat saya hanya pasrah dan ikhlas. Bila ikhlas, tentu ada jalan,” tuturnya mengakhiri percakapannya. (h04/rzl)

Ekonomi & Bisnis

WASPADA Rabu 24 Agustus 2011


LAPK: Razia Listrik Cacat Hukum

● Tunggakan Pelanggan PLN Sumut Rp120 M MEDAN (Waspada): Manager SDM dan Organisasi PLN Sumut Ir. Setiabudi Suhud mengatakan, tunggakan pemakaian listrik di Sumatera Utara masih tinggi. Tercatat hingga 22 Agustus 2011, tunggakan rekening pelanggan PLN di Sumut sekitar Rp120 miliar.

“Tunggakan masih tinggi, sekitar Rp120 miliar. Untuk tagihan rekening di Sumut per bulan sekitar Rp450 miliar dari 2,5 juta pelanggan,” kata Setiabudi saat membuka workshop serta pelatihan P2TL dan pengendalian tunggakan di Udiklat Tuntungan, Senin (22/8). Kegiatan digelar bekerjasama dengan Kejatisu dan Poldasu berlangsung 3 hari dan diikuti 74 peserta dari PLN Sumut, Lubukpakam, Binjai dan Medan. Hadir pada acara itu GM PLN Sumut Krisna Sumbaputra, Manager Niaga Mirza Arsyad, Manager Perencanaan Yugo Riatmo, Humas Yulizar, Manager PLN Binjai Ir

Pintor Rumapea. Setiabudi menyebutkan, dalam hubungan PLN dengan pelanggan ada perjanjian jualbeli tenaga listrik dan ini kesepakatan, kalau tanggal 20 belum dibayar maka sepakat diputus sementara pada tanggal 21. Kalau 60 hari belum juga dibayar, maka dibongkar rampung. Kalau mau nyambung lagi setelah bongkar rampung itu, diperlakukan seperti bayar nyambung baru dan juga tunggakannya harus dilunasi. Mengenai, adanya uang jaminan langganan (UJL) terhadap pelanggan yang diputus listriknya, Setiabudi mengatakan, itu akan diperhitungkan

dan UJL rencananya dikembalikan kepada pelanggan. Dana UJL di Sumut saat ini masih tahap penghitungan dan uangnya ada di PLN dan itu tidak berbunga . Harus dibenahi Sementara itu, Direktur Lembaga Advokasi dan Perlindungan Konsumen (LAPK) Farid Wajdi menilai, operasi P2TL harus dibenahi mengingat prosesnya diduga bermasalah. “Indikatornya adalah begitu banyak operasi tenaga listrik yang dilakukan petugas P2TL tidak satupun masuk ranah hukum. Padahal, sesuai Undang-undang Ketenagalistrikan, mencuri listrik masuk kategori tindak pidana,” ujarnya. Farid menilai, sangat mungkin ada upaya ‘kejar setoran’ guna mengeruk keuntungan pribadi dari operasi tenaga listrik yang dilakukan petugas P2TL itu. Petugas lapangan kurang profesional dalam menduga apakah konsumen benar

melanggar atau tidak. Bahkan terkesan sangat arogan dengan tameng operasi P2TL. Masalahnya pemahaman masyarakat mengenai P2TL masih minim karena kurang sosialisasi. Misalnya menyangkut kerusakan segel pengaman meteran. “Bagaimana mungkin segel pengaman divonis sengaja dirusak atau dikloning pelanggan, padahal memang segel telah aus atau daluarsa dimakan waktu,” katanya. Menurutnya, tindakan ‘main tebas’ memutus sambungan atau mencopot meteran tanpa melihat kasus per kasus jelas tidak adil. “Bagaimana mungkin operasi P2TL dilaksanakan secara fair kalau operasi itu mengandung cacat hukum dan bertentangan dengan ketentuan berlaku. Banyak disangka mencuri, tapi kemudian tidak terbukti, tidak disertai dengan upaya rehabilitasi,” pungkasnya. (m41)

Gaji PNS 26Agustus, Pensiunan 23Agustus JAKARTA (Waspada): Kabar baik bagi pegawai negeri sipil (PNS) dalam menyambut lebaran. Pembayaran gaji PNS yang seharusnya awal September akan dimajukan menjadi Jumat, 26 Agustus 2011. Menurut Menteri Keuangan Agus Martowardojo, pembayaran gaji dipercepat karena terbentur cuti bersama. Selain itu, percepatan pembayaran gaji ini juga untuk membantu kebutuhan finansial PNS menyambut lebaran. Biasanya, pembayaran gaji PNS dilakukan setiap tanggal 1 tiap bulannya. “Nanti lebaran tanggal 3031 Agustus, kemudian ada libur bersama pada 29 Agustus dan

1-2 September. Sesudah itu, Sabtu-Minggu tanggal 3-4 September. Jadi, secara kedinasan baru buka kantor pada 5 September,” ujar Agus saat ditemui usai rapat paripurna di Gedung DPR, Senayan, Jakarta, Selasa (23/8). Berdasarkan kondisi itu, maka diputuskan pembayaran gaji PNS dimajukan menjadi 26 Agustus 2011. Namun, Agus mengingatkan kepada para pegawai agar pandai mengatur keuangannya selama sebulan ke depan. “PNS harus pandai dan bijaksana dalam mengelola keuangan yang sehat, karena jangan sampai gaji yang diterima sebelum tanggal 1 dan

kemudian dibelanjakan lagi, dan akhirnya untuk hidup di bulan September jadi sulit,” tuturnya. Pensiunan 23 Agustus Pembayaran pensiun untuk September 2011 dipercepat mulai tanggal 23 Agustus 2011, jelas Kepala Kantor Cabang Utama PT Taspen (Persero) Medan , Wiharto, Selasa (23/8). Wiharto didampingi staf Humas Sabar Siregar menyebutkan, pemerintah telah melakukan kebijakan untuk mempercepat pembayaran pensiun bulan September 2011 mulai 23 Agustus 2011 untuk penerima pensiun melalui rekening bank dan mulai tang-

gal 25 September 2011 untuk penerima pensiun melalui kantor pos. Bagi penerima pensiun sendiri janda/duda yang meninggal dunia pada atau setelah 23 Agustus 2011 (pensiun punah) berhak untuk menerima pensiun bulan September 2011, dan sejak Oktober 2011 distop karena tidak berhak lagi, jelas Wiharto. ‘’Sedangkan bagi penerima pensiun sendiri, janda atau duda yang meninggal dunia pada atau sebelum 23 Agustus 2011 (pensiun punah) tidak berhak untuk menerima pensiun September 2011,’’tambahnya. (m29/vvn)

Medan Green And Clean

Seleksi 30 Besar Terbaik MdGC 2011

Waspada/Armin Nasution

PEJABAT BNI didampingi Kadis Pendidikan kota Medan saat menyerahkan bantuan renovasi kepada perwakilan enam sekolah.


Regional Manager Bank Mandiri Kantor Wilayah I Medan, Djoko Warsito menyerahkan bantuan langsung kepada anak yatim.

BNI Kucurkan Dana Bank Mandiri Salurkan Bantuan Bina Lingkungan Renovasi Sarana Pendidikan MEDAN (Waspada): Bank Negara Indonesia (BNI) merenovasi sarana/prasarana enam gedung SD di Medan. Keenamnya SD Negeri N0 064016, SD AlWashliyah, SD Pembangunan Didikan Islam, SD HKBP Teladan, Perguruan Al Hidayah dan Perguruan Islam Al Iklas. Selain itu, BNI juga menyalurkan beasiswa kepada siswa CEO BNI Kantor Wilayah Medan Achmad Santosa Miad dalam sambutan yang diwakili Head of Consumer and Retail Hendrik Poluan mengatakan kegiatan yang masuk dalam rangkaian HUT ke -65 BNI ini merupakan bagian dari program Corporate Social Responsibility (CSR) bank tersebut. “Salah satu kegiatan menyambut HUT ke- 65 BNI meliputi program BNI Berbagi, yakni program BNI Sahabat Sekolah. Dimana kegiatannya mencakup renovasi SD dan pemberian beasiswa,” jelasnya dalam acara BNI Sahabat Sekolah yang dilakukan di SD HKBP Teladan Medan, Selasa (23/8). Hadir dalam acara tersebut jajaran BNI Kanwil Medan, Kadis Pendidikan Kota Medan Hasan Basri dan para guru serta murid.

“Program BNI Sahabat Sekolah ini juga wujud rasa syukur dan terima kasih BNI, terutama pada semua lapisan masyarakat. Sudah menjadi komitmen BNI untuk terus melayani negeri dan memberikan kontribusi terbaiknya bagi masyarakat,” ujarnya. Kepala Dinas Pendidikan Kota Medan Hasan Basri dalam kesempatan itu mengatakan, langkah yang dilakukan BNI tersebut merupakan hal yang harus dihargai. Hasan Basri mengungkapkan, pendidikan merupakan hal yang harus diraih oleh semua orang. “Pendidikan adalah untuk semua orang, baik itu pendidikan formal maupun non formal,” tegasnya. Hasan Basri juga mengingatkan, semua pihak memiliki peran dalam bidang pendidikan, artinya mau memperhatikan kebutuhan dunia pendidikan. Sementara Gewin Galingging dari SD HKBP Teladan yang mewakili sekolah penerima bantuan, mengungkapkan terima kasihnya atas perhatian yang diberikan BNI melalui BNI Kantor Wilayah Medan.(m06)

MEDAN (Waspada) : Untuk meringankan beban dan memberikan kebahagiaan kepada anak-anak yatim di Indonesia, Bank Mandiri menyalurkan bantuan bina lingkungan dengan total Rp4,125 miliar. Regional Manager Bank Mandiri Kantor Wilayah I Medan, DjokoWarsito mengatakan Corporate Social Responsibility (CSR) pada tahun ini mencapai Rp4,125 miliar dimana untuk kantor wilayah I Medan mencapai Rp250 juta. “Bantuan dengan total nilai Rp4,125 miliar tersebut terdiri Rp2,625 miliar untuk santunan 10.500 anak yatim dan dhuafa serta santunan berupa peralatan ibadah kepada 3.600 penjaga keamanan dan pintu kereta api senilai Rp540 juta,” ujarnya dalam acara buka puasa bersama anak yatim Ramadhan 1432 H, di Convention Hall, Tiara, Medan, Senin (22/8). Tentunya, lanjutnya, bantuan ini berasal dari dana Program Bina Lingkungan tahun anggaran 2011. Ini adalah salah satu bentuk kepedulian Bank Mandiri terhadap lingkungan merupakan kegiatan corporate social responsibility. Djoko mengatakan, untuk Kanwil I Medan, bantuan ini diserahkan kepada 1000 anak yatim yang tersebar di Kota Medan, Aceh, Pematangsiantar,

Batam dan Pekanbaru. “Penyaluran CSR Bank Mandiri dilakukan melalui Program Kemitraan dan Bina Lingkungan. Dana Bina Lingkungan yang telah disalurkan Bank Mandiri pada tahun 2011 sampai dengan Juni sebesar Rp40,99 Miliar untuk berbagai kegiatan. Sedangkan program Kemitraan yang telah disalurkan pada tahun 2011 sampai dengan Juni sebesar Rp45,59 miliar. Djoko mengatakan, santunan kepada anak yatim dan dhuafa secara nasional tersebut berbentuk uang saku, perlengkapan sekolah dan perlengkapan shalat senilai Rp250.000 per paket. “Besar harapan kami, bantuan yang tidak seberapa ini dapat meringankan beban dan memberikan kebahagiaan ke anak-anak yatim dan dhuafa. Bulan Ramadhan merupakan momentum yang tepat untuk mendapatkan pencerahan setelah sebelas bulan disibukkan dengan persoalan-persoalan duniawi,” ujarnya. Dalam acara tersebut, diserahkan santunan kepada 300 anak yatim yang berasal dari Panti Asuhan Alwashliyah Jalan Ismailiah Medan dan Pinang Baris, Yayasan Zending Islam Jalan Sisingamangaraja Medan dan Masjid Amaliyah yang terletak di Jalan Setia Luhur. (m38)

Sarana Transportasi KISMK Butuh Pembenahan SARANA transportasi untuk keluar-masuk KISMK (Kawasan Industri Sei Mangkei) menuju pelabuhan Kuala Tanjung bisa dicapai melalui jalan darat dari Kota Lima Puluh menuju Kota Perdagangan saat ini kondisinya cukup bagus, namun masih kurang lebar dan kualitas jalan perlu ditingkatkan. Kemudian jalur kereta api sejauh 40.86 km, yang meliputi Bandar Tinggi sampai ke Kuala Tanjung sepanjang 18,25 km, Bandar tinggi sampai ke Stasiun Perlanaan sepanjang 15,75 km, dari Stasiun Perlanaan sampai ke KISMK sepanjang 6,8 km. Sedangkan fasilitas pelabuhan Kuala Tanjung, menurut Kabag Perencanaan dan Pengkajian PTPN III Dr. Krisna Surya Buana pada wartawan akhir pekan lalu di Sei Mangkei, termasuk pengembangan dermaga. Menurutnya, berdasarkan informasi yang di sampaikan manajer operasional PT Pelindo I pada 13 april 2011, sedang disiapkan masterplan pengembangan dermaga termasuk kelengkapannya untuk melayani produk turunan berbasis sawit dari KISMK. Masih terkendala Sedangkan menurut Manejer KISMK Ir. H. Abdul Halim,

Sama dengan pembangunan jalur rel KA baru dari stasiun Bandar Tinggi menuju pelabuhan Kuala Tanjung sepanjang ± 18,25 Km juga menjadi tanggung jawab PT KAI serta Dirjen perkeretaapian.

Waspada/akmal az

KAWASAN Industri Sei Mangkei (KISMK) terlihat tertata rapi. Sarana transportasi untuk keluar-masuk KISMK masih membutuhkan pembenahan. pembangunan jalan darat dari Simpang Mayang menuju KISMK sepanjang ± 3 Km atau dari Simpang Mayang menuju Kecamatan Bosar Maligas sepanjang ±14 Km merupakan tanggung jawab Pemkab/Pemprov. Saat ini kondisi jalan tersebut berlobang-lobang, apalagi di musim penghujan, lobanglobang itu berubah seperti menjadi kubangan kerbau. Begitu pula pembangunan

untuk peningkatan kualitas jalan provinsi/negara, termasuk pelebaran badan jalan,dari Kota Lima Puluh menuju Kota Perdagangan juga merupakan tanggung jawab Pemkab/ Pemprov. Sedangkan pembangunan jalur rel KA baru dari KISMK sepanjang ± 6,86 Km untuk menuju Stasiun Perlanaan dan Stasiun Bandar Tinggi dimana penyusunan DED masih dalam proses,dijadwalkan selesai September 2011 merupakan tanggung jawab PT KAI.

Pemisahan lahan Abdul Halim juga mengungkapkan pihaknya masih menunggu penerbitan surat izin dari BPN pusat untuk pemisahan lahan dari status HGU menjadi HGB, sehingga lahan tersebut memiliki Hak Pengelolaan Lahan (HPL) oleh KISMK. “Plt Gubernur Sumatera Utara telah mengajukan secara resmi kepada BPN pusat melalui surat nomor.593.4/7131 tanggal 6 juli 2011,perihal izin pemisahan HGU KISMK, ujar Halim. KISMK juga masih menunggu penerbitan RTRW KISMK sehingga menjadi bagian yang tidak terpisahkan dari RTRW kawasan industri Provinsi Sumatera Utara. “Berdasarkan surat dari Wakil Gubernur Sumatera Utara nomor.650/2162 tanggal 7 maret 2011,perihal rencana pengembangan KISMK dalam Ranperda RTRW-Sumatera Utara 2010-2030, sedang dalam proses legalisasi dan tahap pembahasan antara pemerintah provinsi dan DPRD-SU,” ujar Halim. (m05)

Sambut Idul Fitri, Pegadaian Meulaboh Kucurkan Rp3,4 M BMT Tulang

MEDAN (Waspada) : Warga Lingkungan I dan IX Kecamatan Medan Selayang, Kelurahan Padang Bulan Selayang II beserta dengan Kepala Lingkungan I Jumani dan Kepala lingkungan IX H.Sariman, Selasa (16/8) kelihatan sibuk berbenah dengan bergotong royong di lingkungan masingmasing. Dari hasil pantauan relawan MdGC (Medan Green and Clean) Abdul Khalik dan PD MdGC Susanto Maulana di lokasi kunjungan, sebagian warga ada yang membuat trotoar berbunga, menanam bunga dan membersihkan gang dengan sapu. Walaupun dalam suasana puasa Ramadhan warga yang didominasi ibu-ibu rumah tangga ini terlihat begitu semangat membersihkan dan mempercantik lingkungannya. Jumani dan Sariman secara terpisah menyampaikan tekadnya untuk mememaksimalkan potensi dirinya beserta warga warga masyarakat untuk memperbaiki lingkungannya dalam rangka memenangkan kompetisi MdGC 2011. Diharapkan melalui semangat kemerdekaan RI dan Puasa Ramadhan tercipta lingkungan yang lebih baik lagi.(m06)

MEULABOH (Waspada) : Menyambut Idul Fitri 1432 Hijriah, Perum Pegadaian Meulaboh terus dipadati masyarakat yang ingin menggunakan jasa lembaga penyimpanan barang itu. Selain ingin menggadaikan, warga juga ingin menebus kembali barang sebelumnya disimpan salah satu perusahaan tertua milik pemerintah itu. Samsul, pimpinan Cabang Perum Pegadaian Syariah Meulaboh mengatakan, memasuki 15 Ramadhan pihaknya telah menyalurkan dana ke masyarakat sedikitnya Rp3,4 miliar. Jumlah itu diperkirakan akan terus bertambah hingga menjelang Idul Fitri mendatang. “Dibanding tahun sebelumnya dengan periode sama terjadi peningkatan 24,7 persen,” kata Samsul, Senin (22/8). Meski diperkirakan bertambah, Samsul menyatakan pihaknya tidak memerlukan penambahan dana karena jumlah masyarakat yang menebus barang juga akan meningkat. Dana dari warga yang menebus, kata Samsul dapat kembali digunakan untuk menyalurkan kredit sehingga tidak mem-

butuhkan penambahan dari Kanwil Perum Pegadaian Aceh. “Berbeda dengan wilayah lain seperti di jawa, warga kebanyakan menggadaikan barang berharga untuk kebutuhan mudik. Tapi di Aceh, masyarakat menebus juga banyak karena ingin menggunakannya saat lebaran,” kata Samsul. Samsul mengatakan sebagian besar barang yang kembali ditebus pemiliknya dalam bentuk perhiasan seperti emas selain produk jasa lainnya yang tersedia.Pemilihan perum penggadaian oleh warga untuk memperoleh dana segara kata Samsul, lebih karena faktor proses yang mudah dan pertimbangan keamanan. Di sisi lain, Samsul juga menawarkan warga menggunakan jasa program MULIA ( Murabahah Logam Mulia untuk Berinvestasi Abadi) untuk berinvestasi. “Dengan DP 30 persen keinginan masyarakat untuk memiliki emas sudah terpenuhi. Berikutnya cicilan hanya 7 persen yang besar angsuran tidak berubah, sesuaikan saat transaksi terjadi,” pungkas Samsul. (cak)

Punggung Ekonomi MEDAN (Waspada): Sekjen Pusat Inkubasi Bisnis Usaha Kecil (PINBUK) Pusat, Andi Estetiono menegaskan, kehadiran Baitul Maal Wat Tamwil (BMT) merupakan salah satu model lembaga keuangan syariah yang paling sederhana dan saat ini banyak muncul untuk membantu masyarakat. “Bahkan di saat krisis, BMT hadir sebagai tulang punggung ekonomi bangsa sehingga perekonomian masyarakat stabil,” kata Andi Estetiono pada acara silaturrahmi dan berbuka puasa bersama di kantor PINBUK Sumut Jalan HM Yamin Medan, Selasa (16/8) petang. Hadir dalam kesempatan itu, Direktur PINBUK Sumut Hoironi Hasibuan didampingi pengurus di antaranya Suhifandi Choir, Syafrizal, M Nursyam Ashmarqandi, Dedi Suheri, perwakilan Telkom dan pengurus serta pimpinan BMT-BMT. Menurut Andi, BMT itu modalnya niat dan kuat, apalagi jika dikelola dengan baik, BMT

merupakan masa depan dan tulang punggung ekonomi bangsa. Andi yang juga dikenal sebagai Kepala Cabang PNM Medan ini menambahkan, ada lima poin membuat BMT tersebut besar, antara lain Sumber Daya Manusia (SDM), Modal, IT dan jaringan. “Jangan BMT sudah besar tetapi karena orang yang di dalamnya membuat BMT tersebut hancur. Sudah ada kejadian seperti ini,” ujarnya. BMT mengembangkan usaha-usaha produktif dan investasi dalam meningkatkan kualitas kegiatan ekonomi pengusaha kecil dengan antara lain mendorong kegiatan menabung dan menunjang kegiatan ekonominya. “Namun umumnya kesadaran orang masih bermain di banking yang konvensional. Padahal jika diketahui BMT sangat strategis untuk membangkitkan ekonomi ummat khususnya ekonomi syariah,” jelasnya. (m39)



Mudik, Gunakan Akal Sehat


emua moda transportasi, baik udara, laut, darat mengalami peningkatan pada hari libur, terlebih lebaran (Idul Fitri). Jumlah penumpang di bandara, pelabuhan laut, dan stasiun bus mengalami lonjakan penumpang yang akan pulang ke kampung halamannya (mudik) untuk merayakan hari raya Idul Fitri 1432 H yang tinggal sepekan lagi. Tingginya jumlah pemudik terus meningkat setiap tahun, tapi jumlah pemudik yang menggunakan sepeda motor diperkirakan paling banyak dalam dua tahun belakangan ini, terutama di P. Jawa. Data Direktur Lalulintas Polda Metro Jaya, jumlah pemudik sepeda motor tahun ini diperkirakan mencapai lebih 8 juta orang atau meningkat 14 persen dari tahun sebelumnya. Pada arus mudik tahun 2010, jumlah sepeda motor mencapai 3,6 juta unit dengan jumlah penumpang mencapai 7,2 juta orang. Untuk mudik tahun ini, jumlah sepeda motor diperkirakan mencapai 4,1 juta unit dengan jumlah penumpang mencapai 8,3 juta orang. Hemat kita, meski dinilai lebih praktis dan hemat biaya, namun mudik dengan menggunakan sepeda motor memiliki tingkat risiko lebih besar (berbahaya). Jumlah kecelakaan di jalan raya sangat tinggi bahkan melebihi jumlah korban perang. Apalagi saat menjelang - saat berhari raya- dan saat pasca lebaran untuk balik. Penyebabnya bisa karena lelah, mengantuk, kondisi kendaraan tidak laik jalan, tidak mematuhi ketentuan berlalu lintas, padatnya arus kendaraan, mau cepat sampai sehingga ngebut, sempitnya badan jalan dan rusak pula, maupun faktor-X lainnya. Penambahan jumlah kendaraan yang demikian tinggi setiap tahun, khususnya jenis roda dua membuat situasi di jalan raya semakin ramai/padat. Sehingga diperlukan akal sehat untuk bisa selamat dalam perjalanan mudik. Artinya, segala kemungkinan harus dipikirkan masak-masak. Misalnya, jangan tancap gas, memperhatikan kondisi jalanan yang padat, penuh sesak dengan berbagai moda angkutan, dan memperIntisari hatikan faktor keselamatan lainnya agar terhindar dari kecelakaan yang tidak diMudik positif, tapi ja- inginkan. Menurut catatan sejarah, tradisi mudik ngan memaksakan diri. sudah berlangsung sangat lama dalam Apalagi berutang hanya kehidupan dan budaya masyarakat kita. tidak afdol jika tidak pulang untuk menunjukkan ke- Rasanya kampung setahun sekali. Memang hal itu pada orang lain kita su- positif dan menjadi kebahagiaan tersendah berhasil dalam peran- diri dapat merayakan hari raya, bersilaturrahim bersama keluarga dan temantauan. teman semasa kecil di kampung halaman tercinta. Oleh karena itu tugas pemerintah untuk memfasilitasi kelompok masyarakat yang mudik dengan mempersiapkan sarana angkutan, membenahi fasilitas jalan, menjaga keamanan dll sehingga peserta mudik tidak mengalami kendala di tengah jalan. Rumah yang mereka tinggalkan pun bisa aman, tidak terjadi pencurian maupun tindak criminal dan musibah lainnya. Justru itu, perlu kita ingatkan: pemudik dengan kendaraan bermotor berhatihatilah di jalan raya. Jangan memaksakan diri terus jalan, kalau sudah lelah segeralah berhenti, istirahat 1-2 jam, bila badan sudah segar kembali baru dilanjutkan menuju tempat tujuan masing-masing. Idealnya, setelah menempuh perjalanan dua jam beristirahatlah sejenak agar kebugaran tubuh terjaga. Ingat perjalanan jarak jauh bisa memicu stres jika situasinya macet, kondisi jalan buruk, dan kelelahan. Jangan sampai tujuan bersenang-senang berubah menjadi dukacita. Oleh karena itu, gunakan akal sehat saat mudik. Bak kata pepatah ‘’biar lambat asal selamat’’ agar silaturrahim bersama sanak keluarga, hantai tolan, jiran tetangga berjalan optimal. Sekalipun bertatap muka secara langsung jauh lebih baik, namun jika ada halangan, maka janganlah memaksakan diri untuk pulang kampung (mudik). Apalagi sampai berutang, atau menggunakan kendaraan tidak laik jalan. Sebab, hubungan silaturrahim masih bisa dilakukan dengan sarana komunikasi tak langsung, seperti bertelefon, berkirim SMS, surat dll. Sehingga kita masih bisa saling bermaafan, berbagi cerita dan pengalaman tanpa harus bertatap muka. Memang hal itu kurang memuaskan dibandingklan kita dapat berkumpul, bercanda ria, berbagi suka dan duka, saling menasihati yang umumnya baru dapat dilakukan setahun sekali. Sebab, pada hari-hari biasa kita kurang menaruh perhatian sekalipun hal itu seharusnya dilakukan sesering mungkin. Inti dari bersilaturrahim adalah menjalankan ibadah. Oleh karena itu pasang niat, jangan melupakan kewajiban sebagai hamba Allah SWT dan umat Nabi Muhammad SAW untuk menjalankan syariat agama Islam, seperti melaksanakan kewajiban dan menjauhi semua larangan-Nya. Jangan lupa membayar zakat, puasa, takbir, shalat, berinfak dll. Jangan sampai terjebak dalam tingkah laku yang melanggar syariat, seperti foya-foya menghamburkan uang, apalagi maksiat.+


Faks 061 4510025


+6281376228044 Yth. Pak Arifin Srg, kalo kita lihat pendapat bapak itu, berarti Waliullah yang di P. Jawa itu dapat dipastikan masuk neraka ya, karena banyak bid’ah diperbuat mereka saat mengembangkan agama Islam dulunya, Wsslam. +6281397641590 Apakah Pak Arifin melakukan shalat Tarawih 11 rakaat juga di bulan lain selain Ramadhan sesuai bunyi hadits yang bapak kemukakan? Kalau jawaban bapak ya berarti bapak benar. Tapi kalau jawaban tidak berarti bapak pembohong. Jadi hadits tersebut tidak cocok dijadikan sebagai dalil sholat tarawih 11 rakaat. +6285296770976 Kepada Pak Kapoldasu tlng ditindak di Desa Perdamaean/Simpang Penara dekat kuburan Tanjungmorawa ada biliar buka smpai pagi sangt mengangu apa lg siang hari para pemainnya melinting ganja sepertinya tdk terjamah hukum berganja siang hari tlng ditindak tegas pak. Dari Andi Syahputra +6287868321600 Wahai saudaraku,terlalu banyak kita mengomentari kasus Nazarudin ini seolah kita yang mengomentari ini tak akan berlaku sama pada saat kita punya kesempatan yg sama.Ibarat kita ini anak kecil yg mengomentari masakan ibunya yg dirasa kurang enak,padahal begitu dia yg disuruh masak hasilnya malah lebih parah. Jadi marilah mengomentari hal yg lain semisal peluang-peluang usaha yg dpt kita lakukan untuk menambah penghasilan yg halal buat keluarga.Setuju saudara? +628126501779 Si Adnan Buyung tak usah ragu soal intgritas SBY. Apapun dan bagaimanapun SBY tetap terbaik dan rakyat ttp mendukung. Daripada tukang fitnah, jeplak & provokator murahan! +6285361731832 Kepada Waspada Yth,tolong sampaikan kepada Telkomsel untuk selesaikan masalah kerugian yang telah saya alami.Dr Nanang, yang selalu setia menjadi pembaca mu. +6282165400389 Aslm,Yth bpk Kanwil Depag Medan, kenapa sampai sekarang uang tunjangan sertifikasi guru 2010 belum keluar. Sedangkan lebaran sebentar lagi pak, jadi tolong la pak kami guru swasta ini pak sangat membutuhkan uang itu untuk lebaran pak. wassalam +6285371719165 Yth Ketua Yayasan SMA Muhammadiyah-09 Aek.Kanopan Kualuh Hulu Labuhan Batu Utara, harap uang SPP dipertimbang kan, karena bnyk keluarga yg tak mampuh. Ntuk membayar SPP.

WASPADA Rabu 24 Agustus 2011

Dinamika Perjalanan RUU BPJS Oleh Dr Drs H.Ramli Lubis, MM Dinamika RUU BPJS itu terus mengalir. Kita berharap semua bermuara pada kepentingan rakyat, agar hakhak rakyat akan kesehatan dapat terjamin secara utuh.


ersoalan kesehatan bagi anak negeri adalah persoalan krusial yang telah berlangsung sejak lama. Selalu ada saja kasus terdengar tentang orang miskin yang tak mampu bayar biaya rumah sakit. Atau cerita tentang ibu ibu yang tak mampu menebus anaknya yang dilahirkan di sebuah rumah sakit. Orang miskin tak boleh sakit, begitu ungkapan sinis yang terdengar. Padahal dalam Undang-Undang Dasar Negara Republik Indonesia 1945 Pasal 28H ayat (1) disebutkan bahwa, “Setiap orang berhak hidup sejahtera lahir dan batin, bertempat tinggal, dan mendapatkan lingkungan hidup baik dan sehat serta berhak memperoleh pelayanan kesehatan”. Selanjutnya dalam ayat (3) menguatkan hak dasar tersebut yang menyebutkan, “Setiap orang berhak atas jaminan sosial yang memungkinkan pengembangan dirinya secara utuh sebagai manusia yang bermartabat”. Belakangan ini terdengar berita pembahasan tentang Badan Penyelenggara Jaminan Sosial (BPJS) di legislatif. Badan ini digandang-gandangkan sebagai badan yang akan menjawab berbagai persoalan jaminan kesehatan rakyat, khususnya rakyat miskin. Oleh karenanya cukup mengejutkan pernyataan Departemen Keuangan dan Kantor Wakil Presiden. Mewakili kantor Wakil Presiden Prastuti Suwondo mengatakan BPJS tidak dirumuskan untuk menanggung semua pelayanan kesehatan. Karena hanya pelayanan kesehat-an dasar saja yang akan dijamin oleh BPJS. Dia menjelaskan bahwa berbeda dengan Jamkesmas yang menjamin semua pelayanan kesehatan dan penyakit, maka UU No 40/2004 Tentang SJSN dan RUU BPJS yang sedang dibahas tidak akan menanggung semua penyakit. Maka gerakan yang dipelopori beberapa serikat pekerja untuk mendukung dibentuknya BPJS, sebagai amanah dari UU No 40/2004 Tentang SJSN dan RUU BPJS, sepertinya akan kembali mengalami kebuntuan. Hal tersebut disebabkan atas ketidaksepahaman diantara para anggota DPR mengenai bentuk badan yang tepat dalam menjalankan jaminan sosial bagi masyarakat.

Sebaiknya pemerintah dalam hal ini Kementerian dan Badan terkait serta Anggota DPR lebih mengedepankan kepentingan rakyat dalam mengambil keputusan mengenai BPJS sebagai asuransi jaminan sosial bagi rakyat. Sehingga rencana pemerintah untuk mengurangi jumlah penduduk miskin di Indonesia yang telah tercantum dalam rancangan APBN 2012, dapat direalisasikan dengan sebaik-baiknya. Dilema Nyatanya UU itu sudah delapan tahun diundangkan namun alat kelengkapannya tidak juga selesai disiapkan. Pemerintah dan DPR masih berkutat membahas RUU BPJS yang akan menjadi operator SJSN. Padahal batas pengesahan UU itu semestinya 22 Juli ini setelah molor beberapa kali. Panitia Kerja RUU BPJS DPR belum juga merumuskan bab ketentuan peralihan karena pemerintah tak juga menyampaikan drafnya. Bab ketentuan peralihan sangat penting karena menentukan peta jalan pelaksanaan jaminan sosial sesuai UU SJSN. Dalam perjalanan, DPR dan pemerintah menyepakati pembentukan dua BPJS baru dengan syarat proses peralihan berjalan dua tahun. DPR ingin agar keempat BPJS berubah badan hukum dari perseroan yang berorientasi laba menjadi badan hukum publik yang berorientasi meningkatkan manfaat bagi peserta. Dalam amanatnya, pelaksanaan SJSN sesuai sembilan prinsip jaminan sosial, antara lain peserta turut mengiur, gotong royong untuk menolong peserta miskin, dan setiap rakyat Indonesia berhak mendapat jaminan sosial meski di luar domisilinya. Manfaat lain pelaksanaan jaminan sosial adalah memiliki mekanisme pengumpulan dana yang bisa membiayai berbagai proyek padat

karya jangka panjang sehingga mengurangi pengangguran dan kemiskinan. Artinya, kian banyak masyarakat memiliki pekerjaan dan pendapatan akan mendorong kesejahteraan mereka sehingga mampu mengiur jaminan sosial. Tingkat kepastian kerja pun akan meningkat dari efek domino pemanfaatan dana jaminan sosial yang diawasi ketat oleh wakil pekerja, pengusaha, pemerintah, tokoh masyarakat, dan ahli yang independen. Dalam aplikasinya kita melihat terjadi perbedaan pendapat antara DPR dan pemerintah dalam hal bentuk badan pelaksana jaminan sosial. Meski banyak pihak meragukan pertentangan itu untuk kepentingan rakyat, karena dinilai menyentuh substansi pokok permasalahan rakyat Indonesia. Tapi tentu saja rakyat tak akan berhenti berharap. Rapat kerja panitia khusus BPJS dijadwalkan berlanjut itu diharapkan menemukan titik terang bagi perjuangan untuk kepentingan rakyat. Dari sisi pemerintah menyebutkan, dewan pengawas adalah organ BPJS yang berfungsi melakukan pengawasan sesuai fungsi, tugas dan kewenangan atas pelaksanaan tugas BPJS. Sementara itu, Menteri BUMN Mustafa Abubakar menyatakan jika tata cara penunjukan dewan pengawasan akan dibahas dalam rapat yang akan datang. Tak kurang Presiden Susilo Bambang Yudhoyono juga telah memberikan pernyataan seputar pertemuan dan konsultasi informal de-ngan pimpinan DPR RI, terkait RUU BPJS. Dalam pertemuan itu, pemerintah dan dewan menyepakati bahwa dalam keadaan tertentu untuk niat dan tujuan baik, pimpinan kabinet dan pimpinan dewan bertemu untuk mengagendakan opsi terbaik dalam pembahasan RUU, secara khusus untuk RUU BPJS dan RUU Otoritas Jasa Keuangan, serta RUU lainnya. Presiden telah pula menugasi secara khusus Wapres Boediono untuk memimpin langsung dan mengintegrasikan kepada menteri-menteri teknis. Dalam pertemuan dan konsultasi tersebut, pemerintah menyadari, hadirnya RUU BPJS berkaitan dengan kepentingan rakyat.

Dari sekian banyak pembahasan, memang mengerucut kepada dua butir yang mesti diimplementasikan. Yaitu dengan meleburnya lembaga Jamsostek, Taspen, Asabri dan Askes. Namun presiden berpesan agar peleburan semuanya itu ditata dengan baik. Menurutnya, sering proses peleburan organisasi di negara manapun, akan menyisakan masalah kultural, kebijakan, hingga masalah salah paham sesama anggota, yang dikelola asuransi tersebut. Kita harapkan perspektif presiden ini nyata adanya. Karena RUU BPJS ini bukan tanpa kritik dan penolakan. Suatu kelompk buruh menilai bahwa sistem asuransi merupakan bentuk pelepasan tanggung jawab pemerintah dalam memberikan pelayanan kepada masyarakat bentuk jaminan sosial. Jika pemerintah mau memberikan jaminan sosial kepada rakyat, tidak perlu embel-embel (syarat) berupa iuran. Pemerintah seharusnya memberikan pelayanan dan kesejahteraan kepada rakyat sesuai dengan amanat UUD 1945, misalnya, dalam pasal 28, pasal 34. Selain itu juga, pro-kontra terhadap pembahasan RUU BPJS terutama antara pihak eksekutif dan legislatif tidak menyentuh pada pokok persoalan tetapi pada perdebatan penggabungan/peleburan Jamsostek, Askes, Taspen dan Asabri dalam satu badan. RUU ini dituding hanya untuk memperebutkan lahan karena dana yang ada di Jamsostek, Askes, Taspen dan Asabri jumlahnya sangat banyak. Lembaga eksekutif terutama Kementrian Keuangan dan pihak dan Jamsostek belum sepakat pengesahan RUU BPJS lebih pada persoalan rebutan dana yang sangat besar. Dinamika RUU BPJS itu terus mengalir. Kita berharap semua bermuara pada kepentingan rakyat, agar hak-hak rakyat akan kesehatan dapat terjamin secara utuh. Karena jaminan sosial merupakan hak dasar yang melekat pada setiap warga negara. Jaminan untuk memperoleh penghidupan dan kehidupan yang baik merupakan harapan bagi setiap rakyat. Rakyat berhak atas pendidikan, kesehatan, jaminan hari tua, jaminan kecelakaan kerja (bagi buruh), dan sebagainya. Dan untu k menjamin hak-hak tersebut, maka negara mempunyai tanggung jawab untuk mengfasilitasi dan membiayai tanpa membedakan jenis kelamin, agama, ras, status sosial, aliran idiologi dan sebagainya. Penulis adalah Mantan Wakil Walikota Medan.

Tiupan Kebohongan Nazaruddin Oleh Riza Fakhrumi Tahir Untuk menilai apakah Nazar layak menjadi whistle blower, sebaiknya kita menguji integritas dan kredibilitasnya.


aya heran, banyak pengamat berbicara tentang skenario yang memungkinkan mantan Bendahara Umum DPP Partai Demokrat (PD) Muhammad Nazaruddin menjadi whistle blower, “peniup peluit” dalam berbagai skandal keuangan negara yang diduga melibatkannya. Termasuk kemungkinan Nazar masuk dalam program perlindungan Lembaga Perlindungan Saksi dan Korban (LPSK). Munculnya wacana whistle blower dan perlindungan saksi, membuat saya sangat khawatir, jangan -jangan sudah ada setting untuk memahlawankan Nazaruddin (Nazar), yang dengan bukti-bukti dan testimoninya bisa mendapatkan perlindungan luar biasa, bahkan keringanan hukuman. Boleh jadi Nazar punya fakta dan data, sesuai dengan “nyanyian” dan “kicauannya” selama 75 hari pelariannya di luar negeri. Tapi, apakah dia bisa menjadi whistle blower ? Tidak segampang itu. Untuk menjadi whistle blower dalam sebuah skandal, tidak cukup dengan keberanian, data, bukti dan testimoni, tapi orang itu sejatinya punya integritas dan kredibilitasnya tidak diragukan. Boleh saja Nazar mengungkap data, fakta dan testimoni. Tapi apakah dia bisa disebut sebagai orang yang punya integritas dan kredibel, yang kemudian layak menjadi whistle blower dan mendapat perlindungan LPSK ? Menguji kredibilitas Nazaruddin Untuk menilai apakah Nazar layak menjadi whistle blower, sebaiknya kita menguji integritas dan kredibilitasnya. Dimulai ketika pertama kali Nazar membantah terlibat dalam skandal korupsi pembangunan wisma atlet Sea Games di Palembang—memutus mata rantai hubungannya dengan Mindo Rosalina Manulang—perempuan yang mengait-ngaitkan nama Nazar dalam pembangunan wisma atlet, hingga melarikan diri ke Singapura dan tertangkap di Cartagena, Kolombia, dengan menggunakan paspor orang lain. Menyangkal atau membantah adalah hak Nazar. Pembelaan terhadap Nazar yang dilakukan Ahmad Mubarok, Jakfar Hafsah, Soetan Bhatoenaga, Ramadhan Pohan, Benny K.Harman, Ruhut Sitompul dan lain-lain sebelum dipecat dari keanggotaan PD, juga sesuatu yang wajar dan itu kewajiban sesama kader partai. Upaya menjustifikasi bahwa Nazar bersih dan tidak terlibat dalam skandal keuangan negara itu, baik melalui media massa maupun

peradilan, saya tetap menganggap hal itu sebagai kewajaran karena di mata hukum dia punya hak untuk membela diri. Apakah tuduhan kepadanya benar atau tidak, layak dihukum atau tidak, bukti-bukti yang diberikan akurat atau lemah, keterangan Nazar dan saksi-saksi dapat dipertanggungjawabkan secara hukum atau tidak, itu domain penyidik, jaksa dan hakim. Ketika secara normal Nazar menggunakan haknya membantah dan membela diri di media massa, publik tidak terlalu heboh memandang skandal Nazar. Tapi, ketika pada 23 Mei 2011 Nazar melarikan diri ke Singapura, surga bagi para penjahat dan koruptor asal Indonesia, tak berapa lama setelah konferensi pers di gedung DPR-RI, publik mulai gerah dan bertanya-tanya, siapa, ada apa dan mengapa dengan Nazar. Meskipun pada 6 Juni 2011 Soetan Bhatoenaga mengatakan Nazar hanya berobat di Singapura. Tokoh senior PD, Prof. Ahmad Mubarok menjamin dalam beberapa hari ke depan Nazar akan pulang ke Indonesia. Parahnya, dalam kondisi sakit di luar negeri, Nazar melakukan tindakan pre-emptive dengan mengirim SMS, BBM dan wawancara via skype yang disiarkan media massa secara luas. Isinya, mengungkap keterlibatan Menpora Andi Alfian Malarangeng, Ketua Umum DPP PD Anas Urbaningrum, beberapa anggota DPR dari FPD, Mahyudin, Angelina Sondakh, Mirwan Amir dan FPDI Perjuangan I Wayan Koster, Wakil Ketua KPK Chandra M. Hamzah, penyidik KPK Ade Rahardja, juru bicara KPK Djohan Budi Gubernur Sumatera Selatan Alex Nurdin. Nazar mengultimatum agar KPK menangkap Andi, Anas, Mahyuddin, Anggelina, Mirwan, Chandra, Ade, Djohan dan Alex terlebih dahulu, baru kemudian dia akan pulang ke Indonesia. Nazar tidak perduli lagi dengan respon rakyat Indonesia dan Ketua Dewan Pembina PD, Susilo Bambang Yudhoyono. Dia malah pelesiran ke Malaysia, Kamboja, Vietnam dan Dominika. Ahmad Mubarok mengatakan, saat wawancara di skype, Nazar sedang di Argentina. Ada juga spekulasi, Nazar sempat ke Medan dan pulang ke kampung kelahirannya di Bangun, Simalungun. Sepandai-pandainya tupai melompat, akan jatuh juga. Begitulah Nazar. Pelariannya berakhir di Kolombia, sebuah negeri di Amerika Selatan. Dia tertangkap di Cartagena, sebuah

kota wisata berjarak enam jam dari Bogota, ibukota Kolombia, Senin (7/ 8) waktu setempat. Ketika ditangkap polisi Kolombia, Nazar mengaku bernama Syarifuddin, sesuai nama yang tertera di paspor. Kenapa Nazar harus melarikan diri ke Singapura, Malaysia, Vietnam, Kamboja, Dominika, Argentina dan Kolombia, dan di luar negeri membuat testimoni? Apapun yang menjadi motif Nazar, aksi melarikan diri ke luar negeri dan dari sana menyerang orang-orang di Indonesia, merupakan tindakan sangat tidak bermoral. Ini bukti Nazar bukan orang yang punya integritas dan kredibilitas serta nasionalismenya yang diragukan karena lebih percaya negeri orang ketimbang negeri sendiri. Tiupan kebohongan Setelah Nazar ditangkap, sekarang mata tertuju ke KPK. Pada saat itulah KPK dan aparat penegak hukum perlu mengingat kembali bahwa sejak skandal wisma atlet terungkap hingga tertangkap di Cartagena, Nazar sudah tiga kali meniupkan pluit kebohongan kepada rakyat dan bangsa Indonesia, baik yang disampaikannya sendiri maupun melalui orang lain. Pertama, Nazar mengatakan tidak terlibat dalam kasus yang disangkakan kepadanya dan menyangkal mengenal Mindo Rosalina Manulang. Nyatanya, Nazar sendiri yang membuka, baik melalui SMS, BBM maupun skype tentang keterlibatannya dan sejumlah orang. Sedangkan Mindo Manulang, sudah menjadi tersangka dan sangat merindukan kesaksian Nazar. Kedua, melalui Soetan Bhatoenaga, Nazar mengaku ke Singapura bukan melarikan diri tapi berobat. Soetan mengungkap, Nazar mengidap penyakit jantung dan berat badannya turun 18 kilogram. Mungkinkah dalam waktu dua minggu sejak kabur 23 Mei hingga 6 Juni 2011 saat Soetan Bhatoenaga memberi keterangan pers, berat badan Nazar bisa menyusut 18 kilogram ? Pengidap penyakit kronis sekalipun, tidak akan seperti itu. Apalagi ternyata dari luar negeri Nazar justru menciptakan situasi konflik dengan melibatkan banyak pihak ke dalam kasusnya. Jadi, Nazar atau Soetan yang berbohong ? Ketiga, saat pelesiran ke berbagai negara, Nazar menyaru sebagai Syarifuddin. Bahkan, kepada Pemerintah Indonesia yang diwakili Michael Manufandu, Dubes RI di Kolombia, Nazar bersikukuh sebagai Syarifuddin. Nyatanya, Syarifuddin adalah kemenakan Nazar yang mukim di Medan. Paspor Syarifuddinlah yang digunakan Nazar pelesiran ke mancanegara hingga ke Cartagena. Itulah tiga tiupan kebohongan Nazar, yang menjadi salah satu penyebab

rakyat Indonesia menjadikan Nazar sebagai common enemy. Ini belum termasuk kebohongan – kebohongannya sebagai seorang pengusaha ketika mendapatkan proyek dan memanfaatkan uang rakyat untuk kepentingan diri sendiri dan kelompok. Dengan tiga tiupan kebohongan itu, publik tentu tidak akan percaya begitu saja dengan data, fakta dan testimoni yang diungkap Nazar, baik di media massa maupun di KPK. Persoalannya, apakah KPK dengan serta merta memanfaatkan bukti, fakta dan testimoni Nazar untuk menjerat orang – orang yang disebut Nazar terlibat ? Rakyat Indonesia masih punya harapan kepada KPK untuk bekerja secara professional sesuai dengan SOP yang dimilikinya. Semuanya tergantung pada integritas dan kredibilitas para penyidik KPK, jaksa dan hakim. Tampaknya, KPK juga harus ekstra hati – hati dalam memeriksa Nazar, sehingga tidak terpengaruh opini (Bersambung ke hal B 9)

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di Media manapun.Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Hak interpelasi DPRDSU gagal - Tanya kenapa, he...he...he * Abang becak buka puasa bersama Kapoldasu - Tradisi baru, perlu dilestarikan * Pertumbuhan penduduk Medan pesat - Kayaknya sudah lupa dengan KB!


D Wak


WASPADA Rabu 24 Agustuss 2011


HakInterpelasiAnggotaDewan MH: Kalau dilihat dari anggota dewan yang mewakili partainya, saya kira hampir semua. Tapi apabila dilihat dari secara keseluruhan, sesama anggota dewan dari satu Fraksi jelas pecah suara. Ada yang pro dan yang kontra. Ini dibuktikan dari hasil voting melalui rapat paripurna DPRDSU Senin, sangat kentara terjadinya perpecahan suara.

Sonny Firdaus

Marasal Hutasoit

Mohon Bantuan Dalam segala kesederhanaan dan dengan niat yang tulus, kami menyampaikan surat permohonan bantuan ini kepada para dermawan, muslim dan uslima dimanapun berada dalam lindungan Allah SWT. Semoga ibu dan bapak berkenan membaca surat ini. Saya kakek dari Mulyana(12 tahun) dengan penuh rasa hormat menyampaikan permohonan bantuan kepada bapak/ibu dimanapun berada. Dan bila seijin dari Allah SWT dan mengharapkan ridho Allah saja, maka kami ingin mengetuk pintu hati ibu dan bapak dalam keikhlasan bapak dan ibu semoga ada pembaca budiman yang dermawan sudi menyantuni cucu saya yang sudah yatim piatu ini. Bapak/ibu yang terhormat, adapun saya dengan istri saya Nama : Ujang Sadikun , Warga Bogor, Istri : Raminah, Agama : Islam, Alamat : Kampung babakan Peundeuy, Gg. Haji ANom RT.003 RW.04 Kelurahan Baranang Siang Kecamatan Bogor Timur Jawa Barat. Bapak/ibu yang terhormat, pekerjaan saya hanya kuli penarik becak di pasar, dengan becak sewaan. Anak saya ada 2 orang dan semuanya perempuan dan sudah menikah. Satu dari anak saya tersebut meninggal dunia beberapa tahun yang lalu dengan meninggalkan anak 3 orang, jadi anak-anak dari almarhumah menjadi tanggungjawab saya sehari-hari dan dirawat oleh isteri saya. Bapak/ibu yang terhormat, salah seorang anak dari almarhumah tersebut bernama Mulyana (foto )berusia 12 tahun, saat ini sedang menderita sakit kelumpuhan permanen tanpa sebab yang jelas. Karena ketiadaan biaya maka sampai saat ini cucu saya tersebut hampir mengalami kelumpuhan diseluruh tubuhnya, sehari-hari dia hanya terbaring, beberapa bahagian tubuh seperti tanagn dan kaki semakin hari semakin mengecil. Derita cucu saya ini semakin bertambah setelah kedua matanya tidak lagi bisa melihat atau buta karena serangan virus. Kedua bola matanya sekarang mengempis dan hilang. Kami dengan kemampuan yang ada tidak lagi mampu berbuat banyak untuk cucu saya ini, melalui surat ini saya sangat mengharapkan ada dermawan yang sudi membantu cucu saya ini. Dalam ujian hidup ini, cucu saya juga menderita penyakit ginjal serius, sehingga harus menjalani pencucian darah setiap 2-3 bulan, sudah sejak dua tahun ini Mulyana dibantu oleh RS PMI Bogor untuk menjalani terapi pengobatan dan pencucian darah. Namun karena biaya pencucian darah semakin mahal, maka cucu saya Mulyanan hanya dapat menderita tanpa sanggup berbuat apa-apa. Oleh karena itu, kami sangat memohon bantuan dari demawan yang diberikan Allah SWT rezeki berlebih, semoga berkenan membantu kami, setidaknya mengurangi beban hidup yang semakin berat ini, kiranya Allah yang Maha Pemurah melimpahkan kasih saying-Nya serta membalas amal kebaikan bapak/ibu sekalian. Dalam kebingungan ini saya pasrah kepada Allah SWT. Sungguh menyedihkan dan kasihan Mulyana yang terus dirundung penyakit tanpa henti disaat kawan-kawannya aktif dan sehat bersekolah dan bermain. Saya dan Isteri saya hanya bisa mengucapkan Alhamdulillah dan syukur terima kasih sedalam-dalamnya atas segala jasa baik dan uluran tangan bapak/ ibu para dermawan , Bantuan bapak/ibu dermawan dapat dikrimkan ke : Bank Mandiri , No rekening : 115.00.05937232 atas nama Raminah . Bapak/ibu yang terhormat, kami menyampaikan mohon maaf yang sedalam-dalamnya apabila ada hal-hal yang kurang berkenan dalampenyampaian surat ini. Atas perhatian dan bantuannya kami ucapkan terima kasih, semoga Allah melipat gandakan amal soleh bapak/ibu dermawan sekalian. Billahittaufiq Walhidayah, Assalamualaikum Warahmatullahi Wabarakatuh. Hormat kami, Ujang Sadikun dan Raminah Kp. Babakan Peundeuy RT.003/RW.04,gang Haji ANom Kelurahan Baranangsiang, Bogor Timur Jawa Barat. Mulyana ingin sekali sembuh .

Kerajaan Haru Yang Di Lupakan Ada Kerajaan Haru, ada pula Kesultanan Deli. Nama ‘Haru’ dalam kajian sejarah Sumatera Timur ternyata sering menyimpan misteri. Nama ‘haru’ tersebut untuk pertama kalinya muncul dalam catatan Daratan Tiongkok ketika Haru mengirimkan misi ke negara tirai bambu tersebut dalam tahun 1282 M di era kekuasaan pemerintahan Kubhilai Khan. Kemudian Haru diketahui sering konfrontasi atau berperang berkali-kali melawan Malaka. Dan di pertengahan abad ke-16 bermitra dengan Riau-Johor untuk menghadapi penetrasi Aceh yang muncul sebagai kekuatan baru di perairan selatan Malaka. Konon pada tahun 1539 Aceh mampu menaklukkan Haru, namun sang penakluk tetap saja mengalami pemberontakan disana. Terhitung mulai akhir abad ke-16 nama Haru mengalami perubahan. Haru kemudian lebih dikenal dengan ‘Ghuri’. Lalu pada awal abad ke-17 menjadi ‘Deli’. Meskipun Haru telah berubah nama dengan Deli, Aceh masih sering mengirimkan pasukan militer yang kuat untuk menaklukkan Deli (bekas wilayah kekuasaan di bilangan Sumatera Timur.) Di era pemerintahan Sultan Iskandar Muda yakni pada tahun 1619 dan 1642 telah terjadi konfrontasi dengan Aceh dan Kesultanan Deli berontak terhadap dominasi sang penakluk. Menurut cerita rakyat setempat, Aceh kemudian menempatkan seorang figur atau sosok Penglima yang ‘sakti’ sebagai wakil Aceh di daerah taklukkan mereka. Panglima perang tersebut bernama atau lazim dipanggil Seri Paduka Gocah Pahlawan, yang kemudian dikenal sebagai cikal bakal Sultan Sultan Deli dan Serdang. Pertempuran bersenjata yang terjadi diwilayah Haru, membuat rakyat merana. Umumnya mereka sering ‘diamankan’ untuk diboyong ke Aceh dijadikan ‘kuli’ kasar secara paksa. Situasi itu Haru menjadi minus dalam hal kependudukan, dan sering dijadikan sarang bajak laut atau perompak lanun. Pada awal abad ke-17 ini telah terjadi gelombang imigrasi (perpindahan) suku-suku dari Tanah Karo menuju wilayah pesisir Langkat, Deli Serdang. Bersamaan dengan perpindahan suku dari Simalungun ke pesisir Batubara, Asahan. Disusul dengan perpindahan orang-orang Tapanuli Selatan ke pesisir Kualuh, Kota Pinang, Panai dan Bilah. Pada kala itu, urung diwilayah Deli (Medan) dibangun menjadi salah satu Kuta dari Urung XII-Kuta. Diantara sejarawan ada yang berpendapat bahwa Tuanku Seri Paduka Gocah Panglawan yang bergelar Laksamana Kudan intan itu tidak lain adalah Laksamana Malem Dagang yang memimpin armada kapal laut Aceh menghadapi Portugis tahun 1629 dan yang menaklukkan Pahanag tahun 1617, Kedah tahun 1620 dan Nias tahun 1624 dan wilayah lainnya yang oleh Laksamana Beaulieu dikompensasi dengan bermacam hadiah. Dalam catatan sejarah Melayu konvensional dan Hikayat Raja-Raja Pasai dapat dibaca tentang kisah perjalanan rombongan Nahkoda Ismail dan Fakir Muhammad yang datang dan singgah di Fansuri (Wilayah Barus sekarang) sambil memperkenalkan Islam disana. Lalu berlanjut ke Lamuri (Lamuri, Ramni), ke Haru kemudian dari sana meng Islam kan Raja Samudera Pasai bernama Merah Silu, menjadi Sultan Malikus Saleh. Farizal Nst. (Penulis Guru BP SMA Neg-I Tamora, Pekan Melok Sumut).

Setelah tiga bulan bergulir, hak interplasi DPRD Sumatera Utara, akhirnya kandas setelah voting yang dilakukan Senin (22/8) melalui rapat paripurna di Gedung DPRD Sumatera Utara Jalan Imam Bonjol Medan, hanya 38 orang yang memilih setuju. Kelompok anggota dewan yang pro hak interplasi hanya kalah tipis dibanding dengan yang setuju, 42 orang saja yang menolak, sisanya tidak memberikan suara dengan berbagai alasan. Dari 38 yang memilih agar dilakukan hak interplasi terhadap Pj.Gubsu H.Gatot Pudjonugroho, ST. Ir.Marasal Hutasoit (foto) nampaknya paling kecewa dengan hasil voting tersebut. Karena anggota dewan yang satu ini dari Komisi A itu termasuk salah seorang inisiator, dan malah vocal dalam menggiring agar segera terlaksana hak interplasi. Sementara Sonny Firdaus, SH, (foto) Wakil Komisi A terlihat agak lesu usai voting walau dia sendiri mengaku legowo dengan hasil voting yang akhirnya menggagalkan pelaksanaan hak interplasi untuk meminta pertanggung jawaban Pj.Gubsu H.Gatot Pudjonugroho, ST--dengan sejumlah kebijakan yang dinilai kontroversial dilakukan sejak dia menjalankan tongkat estafet kepimimpinan di pemerintahan Provinsi Sumatera Utara--setelah Gubsu definitif H.Syamsul Arifin dinyatakan non-aktif karena terasangka dugaan kasus korupsi sewaktu menjabat Bupati Langkat. Berikut adalah petikan wawancara antara Wartawan Waspada Aidi Yursal (Aye) dengan Marasal Hutosoit (MH) dan Sonny Firdaus (SF).

Aidi Yursal (AYe): Pak Marasal, kena-pa Bapak begitu kecewa dengan hasil voting yang dilakukan DPRDSU dalam sidang paripurna Senin (22/ 8) itu? Marasal Hutasoit (MH): Kekecewaan saya sebenarnya cukup beralasan, karena semula sekitar empat puluhan orang sudah menyatakan siap memberi-kan suaranya untuk menyetujui pelak-sanaan hak interplasi, nyatanya pada hari pemilihan mangkir. Dan saya sendiri tidak begitu mengerti dengan sikap rekan-rekan yang tadinya sejalan dengan kita namun kenyataannya hengkang. AYe: Sebenarnya berapa orang

yang tercatat sebagai penggagas atau pengu-sul hak interplasi DPRDSU untuk Pj. Gubsu Gatot Pudjonugroho? MH: Yang ikut menggagas ada 16 anggota dewan, berasal dari berbagai fraksi, dan salah satunya adalah saya sendiri dari Fraksi Partai Damai Sejahtera. Saya juga merupakan inisiator dari yang sejak awalnya telah mengumandangkan agar hak interplasi itu segera dilaksanakan, karena beberapa kebijakan Pj.Gubsu dinilai menyimpang. AYe: Apa semua Fraksi di DPRDSU sebagai pengusul dari hak interplasi?

AYe: Memang soal hak interplasi DPRDSU sudah sejak beberapa bulan lalu dihebohkan. Munculnya setelah Wakil Gubsu Gatot Pujonugroho menjadi Pelaksana tugas (Plt) Gubsu setelah Gubernur difinitif H.Syamsul Arifin berstatus non-aktif karena terkait kasus dugaan korupsi sewaktu menjabat Bupati Langkat beberapa tahun lalu. Apa saja yang menjadi alasan kelompok pengu-sul, termasuk Bapak Marasal sendiri, agar hak interplasi itu segera dilakukan? MH: Alasan kami dari kelompok pengusul adalah supaya Pj.Gubsu bersedia memberikan kepada anggota dewan alasan kenapa dia melakukan berbagai kebijakan yang dinilai melanggar aturan main dalam pemerintahan. Sebagai seorang Pj.Gubsu, seharusnya Pak Gatot itu tidak bisa terlalu maju dalam menerapkan kebijakan pemerintahan namun harus berpedoman pada undang-un-dang, apalagi mengubah kebijakan yang telah dilakukan oleh Gubsu difinitif, Pak Syamsul Arifin. AYe: Sebagai inisiator, Pak Marasal mungkin bisa menyebutkan apa-apa saja kebijakan yang dilakukan Pj. Gubsu sehingga memancing rasa kecewa kalangan anggota dewan, termasuk Pak Marasal sendiri? MH: Sejak mulai menjadi Pj.Gubsu pasca ditahan (non-akrtif) Gubsu difinitif H.Syamsul Arifin, terbilang banyak. Tetapi yang paling menjadi sorotan anggota dewan adalah menyangkut proses pengangkatan 110 orang pejabat eselon III dan pemberhentian 26 orang esolon III, tanggal 10 Juni 2011. Kita membuat hak interplasi itu untuk memanggil Pj.Gubsu dan mempertanyakan untuk sekaligus meminta penjelasan kenapa dilakukan penggantian sejumlah personil pada jabatan struktural. AYe: Apa dampak paling dirasakan

atau merugikan dengan penggantian pejabat struktural eselon III itu? MH: Salah satunya adalah masalah Kuasa Pengguna Anggaran (KPA). Adalah dinilai tidak tepat dan tidak efektif penggantian itu mengingat para pejabat struktural eselon III yang dimutasi pada umumnya pejabat yang bertanggungjawab sebagai Kuasa Pengguna Anggaran. Dengan penggantian itu akan mengaki-batkan penggantian KPA baru, yang lazimnya proses penetapan KPA itu membutuhkan waktu sekitar satu bulan dan proses pelelangan barang dan jasa bisa memakan waktu dua bulan. Dengan aki-bat itu, dikhuatirkan daya serap APBD tahun 2011 tidak terealisasi dengan baik. Pengajuan calon Sekda Pemprosu juga tidak tepat, karena sebelumnya Gubsu Non-aktif semasa aktif telah mengajukan hal serupa namun belum ada penetapan dari pemerintah pusat. Aye: Pak Sonny, Bapak termasuk salah seorang anggota dewan sebagai penggagas hak interplasi itu. Bagaimana sikap Bapak dengan gagalnya hak interplasi itu akibat kalah voting? Sonny Firdaus (SF): Tadinya kita memang ikut mendukung, tetapi setelah kalah dalam voting, kita mesti legowo. Itu sudah biasa dalam pertarungan politik, jangnkan dalam voting untuk menentukan hak interplasi, dalam pemilihan umum anggota legislatif pun kita mesti demikian. Andaikata, suara kita tidak cukup untuk mendudukan kita pada kursi legislatif (DPRDSU), ya kita mesti dengan lapang dada menerimanya walau pengorbanan dan perjuangan untuk itu sudah dilakukan dengan berbagai daya dan upaya. AYe: Apa Pak Sonny akan punya pilihan lain, yaitu akan ikut mengusulkan hak angket untuk meminta penjelasan Pj. Gubsu terhadap berbagai kebijakan yang dinilai menyimpang? SF: Saya belum bisa putuskan hal itu. Yang jelas kita mesti menerima dengan lapang dada hasil voting yang digelar DPRDSU tentang setuju atau tidak pelaksanaan hak interplasi. Sekali lagi saya katakan, dalam hal seperti itu, mesti ada yang kalah dan yang menang. Dan kita terima dengan hati lapang.

Melawan Bobroknya Sistem Pendidikan Oleh Yulhasni Secara tidak sadar,pendidikan sekolah formal menggiring anak-anak menjadi semakin pasif.


ewaktu Jepang hancur lebur dihantam sekutu pasca bom atom menghantam kota Hiroshima dan Nagasaki 1945, Kaisar Hirohita lantas berpidato. Katanya,“Masihadaberapakah orangguruyangmasihhidup?Selamatkan mereka, Sebab dengan merekalah negara ini bisa bangkit kembali.’’ Semua dunia mengetahui, 30 tahun kemudian Jepang menjadi negara adidaya di Asia kembali dengan kualitas pendidikan yang baik. Itulah cara negara menghargai dunia pendidikan. Jepang memahami sekali bagaimana pendidikan menjadi ukuran keberhasilan sebuahbangsa.DiIndonesia, sistempendidikankitamasihterusmengalami perubahan dan cenderung agak lambat mengikuti perkembangan dan kebutuhan zaman. Itu belum lagi diperparah oleh carut marutnya dunia pendidikan kitaolehsejumlahskandaldanpraktik yang selalu mencoreng dunia pendidikan Indonesia. Namun meski demikian, ide untuk merubah sistem pendidikan yang lebih baik terus saja bergulir. Berbagai metode yang efektif untuk menjadikan pendidikan di Indonesia benar-benar berkualitas terus dicari. Salah satunya adalah metode homescholling (rumah sekolah). Apa yang kita pahami tentang homeschooling,homeeducation,atausekolah rumah? Pasti akan banyak penafsiran yang muncul. Homeschooling (sekolah rumah) memiliki banyak model dalam penerapannya. Sebut saja, schooling at home yang memindahkan bentuk sekolah ke rumah. Modelinilengkapdengankelasnya,laboraturium kecil sampai dengan memanggil tenaga khusus. Selanjutnya adalah model homeschooling seperti bimbingan belajar. Model ini boleh saja diterapkan dan tidak salah. Namun, metode yang dinilai paling efektif untuk diterapkan dalam homeschoolingadalahmodelunschoolingkarena merupakan modifikasi dari model school at home dan bimbingan belajar. Melalui homeschoolingmodelini,makaanak-anak akan benar-benar terwadahi untuk tumbuh secara natural. Sekolah rumah di beberapa kota besar

di Indonesia telah menjad kebutuhan penting sebagian masyarakat. Kecenderungan ini karena munculnya ketidakpercayaankepadasekolahformalyang tidak mampu menangkap kemampuan intelegensia siswanya. Sekolah formal dalam kenyataannya sampai sekarang telahterkungkungkepadasistempenilaian yang sempit. Hal yang paling mendasar menjadi hambatan dunia pendidikan di Indonesia untuk melahirkan lulusan yang berkualitas adalah masih banyaknya sekolah yang mempunyai pola pikir tradisional.Sekolahhanyamenekankanpada kemampuan logika (mate-matika) dan bahasa. Kenyataan ini senada dengan yang diungkapkan oleh Seto Mulyadi (2003), seorang praktisi pendidikan anak, bahwasuatukekeliruan yang besar jika setiapkenaikanke-las, prestasianakdidik hanya di-ukur dari kemampuan matematika dan bahasa. Dengan demikian sistem pendidikan nasional yang mengukur tingkat kecerdasan anak didik yang semata-mata hanya menekankan kemampuan logika dan bahasa perlu direvisi. Penerapan sistem tradisional tersebut berakibatgugurnyasejumlahpotensiyang dimiliki siswa sejak di pendidikan dasar. Alhasil untuk melahirkan generasi yang berkualitas, sistem pendidikan kita telah membunuhnyasejakusiadini.Anak-anak negeri ini tidak diajarkan untuk mengembangkan potensi yang mereka miliki. Sekolah telah mempraktikkan sistem yang keliru dalam menumbuhkembangkan bakat dan potensi anak. Kita bisa melihat bagaimana apresiasi sekolah terhadap anak-anak berprestasi di bidang ilmu matematika. Selain men-

dapatkan beasiswa mereka juga diperkenalkan sebagai anak yang cerdas. Sedangkan siswa yang (barangkali) karena tidak dieksplorasi bakat dan potensinya di bidang lain, cenderung dikategorikan sebagai anak terbelakang. Pada rumah sekolah, sistem pendidikan yang formal hanya berlaku pada konteks pengajaran yang sistematis. Artinya di sini tetap juga dipergunakan silabus, RPP dan bentuk tindakan kelas lainnya, meski dengan bentuk dan jenis yang berbeda. Di sini digunakan berbagai metode pengajaran yang dikenal jamak sebagai bentuk penggalian potensi dan bakat siswa. Salah satu metode yang jamak diterapkan adalah metode multiple intelengensia (kecerdasan intelektual). Kecerdasan intelektual tidak hanya mencakup matematika dan bahasa saja, tetapi juga harus dilihat dari aspek kinetis, musical, visual-spatial, interpersonal, intrapersonal, dan naturalis. Jenis-jenis kecerdasan intelektual tersebut dikenal dengan sebutan kecerdasan jamak (Multiple Intelligences) yang diperkenalkan oleh Howard Gard-ner padan tahun 1983. Gardner mengatakan bahwa kita cenderung hanya menghargai orang-orang yang memang ahli di dalam kemampuan logika (matematika) dan bahasa. Kita harus memberikan perhatian yang seimbang terhadap orang-orang yang memiliki talenta (gift) di dalam kecerdasan yang lainnya seperti artis, arsitek, musikus, ahli alam, designer, penari, terapis, entrepreneurs, dan lain-lain. Sangat disayangkan bahwa saat ini banyak anak-anak yang memiliki talenta (gift), tidak mendapatkan reinforcement di sekolahnya. Banyak sekali anak yang pada kenyataannya dianggap sebagai anak yang “Learning Disabled” atau ADD (Attention Deficit Disorder), atau Underachiever, pada saat pola pemikiran mereka yang unik tidak dapat diakomo-

dasi oleh sekolah. Pihak sekolah hanya menekankan pada kemampuan logika (matematika) dan bahasa. Rumah Sekolah justru sebaliknya, sistem ini menggalu seluruh kemampuan dan potensi yang dimiliki si anak. Meski tidak dilaksanakan di sekolah formal, Sekolah Rumah dinilai telah menjadi sebuah terobosan di dunia pendidikan non formal di tanah air. Model ini tidak lain sebuah pemberontakan yang sistematis atas tidak beresnya negara mengelola pendidikan di tanah air ini. Seperti diketahui, di sini, anakanak yang sejak kecil belajar melalui homeschooling, tidak akan mengenal dunia sekolah formal. Ketika TK mereka terbiasa bermain dan saat memasuki SD konteksnya menjadi berubah. Anakanak cenderung menjadi terkekang karena tidak bisa lepas bertanya, dan membuat mereka menjadi kurang aktif. Secara tidak sadar, pendidikan sekolah formal menggiring anak-anak menjadi semakin pasif. Sekolah formal cenderung membuat waktu belajar dan waktu bermain menjadi terpisah. Umumnya, anak-anak yang bersekolah di sekolah formal sesampai di rumah cenderung mengalami kejenuhan untuk menyentuh bukunya. Tetapi, anak-anak yang sudah menjalani homeschooling sejak kecil tetap akan tumbuh semangat belajarnya, karena waktu bermain dan waktu belajar mereka tidak pernah dipisahkan. Selain itu, karena dibiarkan tumbuh natural, anak-anak homeschooling lebih berani bertanya dan lebih eksploratif. Dengan alasan itulah makanya Sekolah Rumah mendapatkan apresiasi yang cukup tinggi di kalangan sebagian orang tua di tanah air, terutama mereka yang sama sekali tidak mempercayai sistem pendidikan formal dengan tenaga pendidik yang tidak terlatih sebagai guru. Pada sistem pendidikan kita saat sekarang, guru tidak mampu menjadi orang yang betul-betul berfungsi layaknya tenaga pendidik. Munif Chatib dalam bukunya Gurunya Manusia menulis seorang guru sejati adalah guru yang dirindukan siswanya, guru profesional yang dapat menjalankan sekolahnya manusia. Mungkin dengan ini, sistem pendidikan kita yang bobrok pelanpelan bisa diperbaiki. Dosen Bahasa Dan Sastra Indonesia FKIP UMSU.

Tiupan... (Lanjutan dari hal B 8) menjadikan Nazar sebagai whistle blower yang perlu mendapat perlindungan khusus LPSK. Apalagi, dia diduga terlibat dalam skandal keuangan negara bernilai Rp 6 triliun lebih di Dephub, Depnakertrans, Depdiknas, Kemenpora dan sejumlah BUMN. Tidak husnul khatimah Kalau sejak awal yakin tidak terlibat, Nazar harusnya menghadapi tuduhan itu secara jantan dan membuk-

tikan di pengadilan bahwa dia tidak terlibat dalam skandal keuangan negara, tidak serta merta melarikan diri ke luar negeri. Kalau Nazar punya integritas dan kredibilitasnya tinggi, dia juga harus membuktikan Andi, Anas, Angie, Mirwan, Mahyuddin, Koster, Chandra, Ade dan Johan memang terlibat dalam skandal keuangan negara di Kemenegpora dan lembaga lainnya, sehingga tidak perlu “bernyanyi”, mengancam, mengultimatum bahkan melakukan tawar menawar dari luar negeri. Apa gunanya Nazar lari dan bertahan di luar negeri, kalau dalam hitung-

an hari sudah tertangkap. Seandainya Nazar pulang ke Indonesia mememuhi imbauan SBY, situasinya pasti berbeda dengan yang kita saksikan pada detik – detik akhir dia akan memijakkan kaki di Bandara Halim Perdanakesuma Jakarta, Sabtu (13/8) malam. Sedih sekali. Setelah diekspulsi (diusir) pemerintah Kolombia, Nazar pulang ke Indonesia tidak dalam posisi husnul khatimah. Berharap menjadi akhir yang baik, malah menjadi awal yang buruk. Dia pasti akan menghadapi persoalan lebih berat dari yang seharusnya dia tanggung, akibat tiup-

an kebohongannya yang nyaring itu. Oleh karenanya, jangan beri peluang sedikitpun bagi Nazar menjadi whistle blower yang mendapat perlakuan dan perlindungan khusus? Nazar itu the lie of public blower, peniup kebohongan kepada publik. Oleh karenanya, sebagai the lie of public blower, Nazar juga layak dihukum, karena sudah tiga kali membohongi rakyat dan bangsa Indonesia. Penulis adalah Wakil Sekretaris DPD Partai GOLKAR Provinsi Sumatera Utara dan Sekretaris PDK KOSGORO 1957 Provinsi Sumatera Utara.


Semarak Ramadhan

WASPADA, Rabu 24 Agustus 2011



Imsak 04:55 Imsak 04:55 Subuh 05:05 Subuh 05:05 Maghrib 18:36 Maghrib 18:36



Imsak 04:54 Imsak 04:54 Subuh 05:04 Subuh 05:04 Maghrib 18:36 Maghrib 18:35



Imsak 04:54 Imsak 04:54 Subuh 05:04 Subuh 05:04 Maghrib 18:35 Maghrib 18:35

Buka Puasa Bersama Ibu PKK

Kesejagadan KEHADIRAN Islam tidak saja untuk orang yang bersedia menganutnya tetapi juga untuk orang yang akan menganutnya.Tegasnya, Islam hadir untuk menjadi rahmat bagi seluruh alam. (Islam Rahmatan lil ‘alamin). Dengan begitu maka semua ibadah dalam Islam mengandung pesan kesejagadan, Rahmatan lil ‘alamin. Berangkat dari dasar pemikiran ini maka sangat diperlukan adanya analisis terhadap inspirasi kesejagadan yang terkandung dalam ibadah Ramadhan karena diduga keras ibadah ini tidak saja dimaksudkan untuk menciptakan keasyikan antara orang yang beriman dengan Tuhannya (hablum minallah), tetapi juga tertatanya hubungan harmonis antara manusia dengan sesamanya dan alam sekitarnya (hablum minannas). Kegagalan pada salah satu aspek dari dua hubungan ini akan menentukan nilai kesejagadannya (Q.S. 3/Ali ‘Imran: 112). Bertitik tolak dari petunjuk Allah itu, maka puasa Ramadhan sejatinya bukan saja menahan diri dari ‘melakukan’ tetapi juga menahan diri dari ‘tidak melakukan’. Seseorang tidak saja harus berusaha menahan diri dari melakukan kezaliman dan eksploitasi terhadap orang lain, tetapi juga menahan diri dari tidak melakukan (bersikap acuh) terhadap pemberdayaan dan peningkatan harkat dan martabat orang lain. Paling tidak ada tiga simbol kesejagadan yang di inspirasikan Ramadhan. Pertama, upaya memberdayakan aspek insan (kemanusiaan) manusia. Dengan demikian penguatan penghargaan terhadap kemanusiaan sebagai salah satu aspek hak azasi manusia. Lihatlah dalam suasana Ramadhan setiap orang mendapat penghargaan yang layak betapapun miskin dan papanya dan betapapun rendah status sosialnya. Kedua, dalam Ramadhan seorang muslim diminta menahan diri agar tidak berdiam diri. Mereka dituntut melakukan berbagai upaya pemberdayaan masyarakat yang lemah dan terbelakang. Mereka diminta bertindak sebagai pemberi, minimal sebagai pemberi zakat diri (zakat fitrah). Ketiga, simbol dan praktek yang di inspirasikan Ramadhan adalah semangat kesejagadan Alquran. Kitab ini berbicara dengan manusia (ya ayyuhannâs) bukan saja berbicara dengan orang yang beriman (ya ayyuhalladzina amanu). Pada saat yang sama Alquran menyampaikan pesan Iqra’, pesan ilmu pengetahuan yang merupakan penggerak utama kesejagadan. Dengan demikian sejatinyalah bila umat Islam bertindak sebagai insan yang berguna, bermanfaat dan menjadi anutan bagi manusia lain karena ia telah terlatih dalam kegiatan-kegiatan yang menekankan pesan kesejagadan selama Ramadhan. Wa Allahu a’lamu bi al-Shawab.

Memahami Makna Kesederhanaan ACARA buka bersama identik dengan suasana akrab dan kekeluargaan. Acara yang lebih mengedepankan suasana agamais ini juga sangat dinikmati ibu-ibu PKK diketuai Sutias Handayani Gatot Pujonugroho saat acara buka bersama. Acara berbuka bersama sekalian Nuzul Quran yang dilangsungkan di kediaman Sutias Handayani Gatot Pujonugroho pada Minggu (21/8) malam di Kompleks Taman Setia Budi itu, semua pesertanya duduk lesehan. “Kita ambil tema lesehan biar lebih akrab dan tidak ada penghalang antara satu dengan yang lainnya,” ujar Sutias. Mengangkat momen Ramadhan yang juga bertepatan dengan turunnya kitab suci Alquran menjadi ajang silaturahmi bagi ibu PKK ini, karena melalui momen buka bersama ini tali silaturrahim semakin erat. “Selama ini interaksi kita lakukan dalam dunia kerja, jadi de-

ngan momen ramadhan sekaligus nuzul quran mendekatkan kita satu sama yang lain. Karena pada dasarnya di mata Allah, kita tidak ada beda,” ujar Sutias yang memiliki lima putri ini. Dengan tema lesehan, para ibu PKK Pemprovsu yang beranggota lebih 40-an orang ini dapat saling akrab dan memahami makna kesederhanaan. “Kita kan perempuan dan ibu, jadi kita lebih dekat dengan makna kesederhanaan,” katanya. Mengusung tema memperingati Nuzul Quran, acara yang dimulai sejak pukul 17:00 itu diisi dengan pembacaan ayat suci Alquran dan dua penceramah sekaligus. Salah satu penceramah adalah Firza, salah satu Dai kecil dari Medan. “Firza jadi penceramah di sini, untuk menunjukkan bukan hanya orang dewasa yang bisa memberikan pengetahuan, kadang anak kecil juga dapat memberikan pengetahuan yang baru


Zakat Uang Beasiswa

Jawab: Wa’alaikum salam wr. wb. Terima kasih atas pertanyaannya, semoga saudara Anda cepat menyelesaikan studinya di luar negeri. Amin Allah Swt berfirman: “Hai orang-orang yang beriman, nafkahkanlah (keluarkan zakat) sebagian dari hasil usahamu yang baik-baik dan sebagian dari apa yang Kami keluarkan dari bumi untuk kamu.” (QS, Al-Baqarah (2): 267) Rasul bersabda:“Bila engkau memiliki 20 dinar emas dan sudah mencapai satu tahun maka zakatnya setengah dinar (2,5%)”. (HR Ahmad) Beasiswa salah satu bantuan biaya dalam studi seseorang anak didik, baik untuk studi di dalam negeri maupun luar negeri. Ada dua pendapat ulama dalam hal zakat beasiswa: Pertama, ada ulama menjelaskan bahwa beasiswa tidak termasuk dalam obyek zakat dan tidak wajib zakat, sebab mereka yang mendapatkan beasiswa studi sebagai mustahik dan umumnya beasiswa ada yang bersumber dari dana zakat dan ada juga dari sumber lain. Karena itu, uang yang dia terima itu tidak diistilahkan dengan gaji, tetapi beasiswa, dan secara umum jumlahnya lebih kecil dari gaji. Oleh karena itu pendapat ulama pertama ini menegaskan zakat beasiswa tidak ada sebab ia dikelompokkan dalam kategori mustahiq (orang berhak mendapatkan zakat) yaitu ke dalam golongan fi sabilillah. Kedua, ada ulama yang mewajibkan zakat atas seluruh harta termasuk tabungan dan beasiswa jika melebihi nishab zakat maka wajib berzakat 2,5 %. Menurutnya, jika beasiswa yang diterima melebihi kebutuhan hidup sehingga kelebihan itu senilai sekitar 85 gram emas dan itu dimiliki penuh selama setahun, barulah wajib membayar zakat sejumlah 2,5 persen dari nilai tersebut. Kelompok ini menegaskan pembayaran zakat ditunaikan setahun sekali, tapi kalau sekiranya setahun terlalu memberatkan bisa diangsur perbulan. Menurut hemat kami dari kedua pendapat ulama itu, kami lebih cendrung kepada pendapat kedua menjelaskan beasiswa wajib dikeluarkan zakatnya setahun sekali (atau bisa juga perbulan sekali) jika harta itu sudah memenuhi kebutuhan hidup dan cukup nishab. Jadi, kalau uang yang diperoleh dari beasiswa itu setelah ditabung selama satu tahun dan sisanya mencapai nishab maka terkena zakat. Namun jika beasiswa itu hanya mencukupi kebutuhan bulanan saja dan tidak terdapat sisa di dalamnya, kemudian setelah satu tahun ternyata uang sisa tersebut tidak mencapai nishab, maka tidak terkena kewajiban zakat. Wallahu a’lam bish-shawab.

Nuzul Quran DPD KNPI Medan Jadikan Alquran Sebagai Imam UMAT Islam diingatkan agar menjadikan Alquran sebagai imam atau pedoman mencapai kebahagiaan. “Kitab suci Alquran yang diturunkan pada bulan Ramadhan merupakan petunjuk bagi sekalian manusia dan menjadi pemisah atau pembeda antara yang hak dengan yang bathil.” Demikian tausyah Ustad H Albar pada peringatan Nuzul Quran dilaksanakan DPD KNPI Medan di Masjid Al Istiadah Jln. Amal, Medan Sungal, Sabtu (20/8) malam. Dai asal Jakarta itu menyebutkan, Alquran jangan hanya menjadi pajangan di rumah, tetapi harus dibaca. “Ada beberapa keutamaan bila selalu membaca Alquran, yakni rezeki dipermudah, menyelesaikan persoalan yang dihadapi, memiliki kelembutan hati dan keutamaan lainnya,” sebut H Albar. Walikota Medan H Rahudman Harahap yang hadir malam itu memberikan apresiasinya kepada kegiatan KNPI Medan dipimpin Zulham Effendi Siregar, karena selalu aktif membina potensi kepemudaan di Medan. Rahudman juga mengingatkan kepada umat Islam untuk menjadikan peringatan Nuzul Quran sebagai petunjuk utama dalam peningkatan kualitas masyarakat Medan. Atas nama Pemko Medan,Walikota kemudian memberikan bantuan Rp40 juta untuk renovasi Masjid Al Istiadah. Sementara, Ketua KNPI Medan Zulham Effendi Siregar di dampingi sejumlah pengurus mengingatkan bahwa tantangan pemuda hari ini semakin berat dan kompleks, seiring derasnya kemajuan informasi dan teknologi yang ada di genggaman kita. Sebab itu generasi muda khususnya pemuda Islam harus menjadikan Alquran sebagai pedoman dalam melangkah, berpikir dan bertindak sehingga dapat menjadi umat terbaik dan memberikan manfaat kepada masyarakat secara meluas.(m27)

Waspada/Dedi Riono

SPV Promosi CV Indako Trading Co, ArifYudi Asmara mengundi kupon KuisWaspada Ramadhan Honda Berbagi Berkah Periode III di Lantai III Gedung Bumi Wartawa Harian Waspada Medan, Selasa (23/8).

Kuis Waspada Ramadhan Honda Berbagi Berkah

Warga Tanjungpura Raih Hadiah Utama SYAFARUDDIN Manurung, warga Jln. Syekh Usnan No. 56 Tanjungpura, Kab. Langkat meraih hadiah utama Kuis Waspada Ramadhan Honda Berbagi Berkah periode III pada pengundian di Lantai III Gedung Bumi Warta Harian Waspada Medan, Selasa (23/8). Sebagai pemenang utama, Syafaruddin berhak atas hadiah

Ikatan Alumni Menwa Sumut Buka Puasa Bersama

KETUA KBIH Kodam I/BB Letkol H Irwan Nur Batubara melaksanakan buka puasa bersama jemaah calon haji KBIH Kodam I/BB di Masjid Al Taqwa Makodam I/BB.

Soal: Assalamu’alaikum Wr.Wb. Ustadz, saudara saya saat ini berada di luar negeri melanjutkan studi dengan beasiswa. Apakah dia juga wajib mengeluarkan zakat setiap bulannya seperti halnya zakat profesi ? Ataukah hanya perlu mengeluarkan zakat tabungan saja ? (Mahya, Medan)

pada kita,” kata Sutias. Setelah Firza memberikan tausyah, dilanjutkan dengan ceramah dari Ustadzah Saadah Muchtar, Lc yang menerangkan momen Nuzul Quran dijadikan sebagai ajang berinteraksi dengan Quran dan peningkatan pemahan terhadap Alquran. “Peringatan malam Nuzul Quran dijadikan semangat untuk meningkatkan pemahaman Alquran untuk direalisasikan dalam hidup sehingga perjalanan hidup lebih terarah dan berjalan lurus,” ucap ustadzah tamatan dari Mesir itu. Setelah acara tausiyah, para ibu mendapatkan informasi tentang PKPU, yang merupakan sebuah NGO yang diakui dunia. NGO yang bergerak dalam bidang penyaluran infak dan sedekah ini akan menerima pemberian infak ini. “Kita juga bersedia menjemput infak dan sedekah tersebut,” tutur Dini, sebagai juru bicara PKPU. (m28)

Jamaah Calon Haji KBIH Kodam Buka Puasa Bersama Kelompok Bimbingan Ibadah Haji (KBIH) Kodam I/BB menyelenggarakan buka puasa bersama di Masjid at-Taqwa Makodam I/BB, Sabtu (20/8). Acara diikuti 107 calon haji dan diselenggarakan atas usul jamaah, yang diharapkan bisa lebih mempererat hubungan bathin antara sesama jamaah dan me-mupuk kebersamaan mulai dari tanah air sampai berada di tanah suci. Ketua KBIH Kodam I/BB Letkol Caj Drs H Irwan Nuh Batubara, MSi menyambut baik acara buka puasa bersama jamaah yang tergabung dalam KBIH Kodam I/BB. “Ini bermanfaat membangun kebersamaan, persaudaraan, dan mengikat tali silaturrahmi. Dengan adanya kebersamaan, saling peduli dan persaudaraan yang kuat, insyah Allah akan mampu melaksanakan ibadah dengan baik,” kata Irwan Nuh. Al Ustadz Azwardin Nasution selaku pembimbing ibadah jamaah KBIH Kodam I/BB menyampaikan, ibadah puasa yang sedang dilakukan saat ini bertujuan membentuk pribadi-pribadi yang Muttaqin, yaitu pribadi Muslim dan Muslimat yang siap melaksanakan semua perintah Allah SWT dan menjauhi semua yang dilarangNya. “Dengan kepribadian yang taqwa, diharapkan para Calhaj Jamaah KBIH Kodam I/BB siap menjadi tamu Allah yang baik, dan sepulangnya nanti dari tanah suci menjadi haji mabrur dan bermanfaat untuk dirinya, keluarga masyarakat dan bangsa Indonesia.” Hadir saat itu Wakabintaldam I/BB Letkol Caj Drs. H. Irwan Nuh Batubara, MSi selaku Ketua KBIH Kodam I/BB, Kasis Metnik Bintaldam I/BB Mayor Caj Drs Zakaria Ansori, Kasibinrohis Bintaldam I/BB Mayor Inf Jalaluddin Dalimunthe, SAg dan pengurus KBIH Kodam I/BB serta para undangan. (m14)

Rubrik Tan ya J a wa b any Ja MUI Medan Oleh: Dr. H. Ahmad Zuhri, Lc, MA (Ketua Komisi Fatwa MUI Kota Medan)

Mustahiq Zakat Bagi Non Muslim Tanya: Apakah seorang non-Muslim jika termasuk dari salah satu asnaf zakat, seperti fakir atau miskin termasuk Mustahiq Zakat? Wasalam : Hamdi AZ. Pesantren Nurul Fikri Serang Banten. Jawab: Sebagai suatu ibadah pokok, zakat termasuk salah satu rukun Islam, sehingga keberadaannya dianggap sebagai ma’lum min ad diin bi adl dlaurah, yaitu diketahui secara otomatis adanya dan merupakan bagian mutlak dari keislaman seseorang. Sehingga tidak aneh kalau Allah SWT mensejajarkan kata shalat dan kewajiban berzakat dalam berbagai bentuk kata tidak kurang dari 27 ayat. Mutahaiq Zakat bagi non-Muslim adalah haram Dalam Alquran dinyatakan bahwa ada 8 ashnaf (kelompok yang berhak menerima zakat). Yang menjadi permasalahan apakah orang non-Muslim termasuk dari salah satu dari 8 kelompok tersebut? Memang terjadi perbedaan dikalangan para ulama apakah non-muslim yang miskin umpanya berhak menerima zakat, Ada yang membolehkan atas dasar pemahaman mereka terhadap kata SHADAQAH/INFAQ dalam Alquran. Ada yang menganggap sebagai zakat dan ada pula beranggapan infaq/ sumbangan semata. Berdasarkan Firman Allah dalam Surat al-Baqarah ayat 172. Artinya: Bukanlah kewajibanmu menjadikan mereka mendapat petunjuk, akan tetapi Allah-lah yang memberi petunjuk (memberi taufiq) siapa yang dikehendaki-Nya, dan apa saja harta yang baik yang kamu nafkahkan (di jalan Allah), maka pahalanya itu untuk kamu sendiri. Dan janganlah kamu membelanjakan sesuatu melainkan karena mencari keridhaan Allah, dan apa saja harta yang baik yang kamu nafkahkan, niscaya kamu akan diberi pahalanya dengan cukup sedang kamu sedikitpun tidak akan dianiaya (dirugikan). Adapun zakat hukumnya haram bagi non muslim mendapat bahagian tertentu darinya (Mustahiq) dengan dalil: 1. Perintah zakat untuk umat Islam, maka konsekwensi dari perintah tersebut adalah untuk umat Islam, termasuk mustahiqnya. 2. Zakat adalah ibadah khusus bahkan merupakan rukun Islam, maka ibadah khusus tidak bisa di campur adukkan dengan ibadah umum (muamalah) lainnya. 3. Hadits nabi: “Aku diperintahkan mengambil zakat dari orang-orang kaya kalian (Muslim) dan nengembalikannya kepada orangorang fakir diantara kalian (Muslim). Wasalam.

Ketua DPW Ikatan Alumni Resimen Mahasiswa (IARMI) Sumut H Ahmad Arif, SE, MM mengatakan Allah Swt memberikan satu bulan yang dapat dimanfaatkan manusia melakukan ibadah untuk menjadi pribadi lebih baik. Satu bulan yang dinamakan bulan Ramadhan, bulan yang sangat dahsyat keagungannya. “Kami mengajak kita sebagai umat muslim yang juga sebagai alumni Menwa menjadikan momentum ramadhan ini untuk menjadi pribadipribadi yang baik,” ajak Ahmad Arif, saat acara buka puasa bersama DPW IARMI Sumut, Minggu (21/8) di kediamannya Jln. Amaliun Medan. Tampak hadir seluruh pengurus DPW IARMI Sumut dan keluarga. Ahmad Arif yang juga ketua Fraksi PAN DPRD Medan itu turut menyampaikan kepada segenap keluarga besar IARMI

Sumut dapat menjadikan momen buka puasa bersama sebagai bagian dari mempererat silaturahim dalam kepungurusan alumni serta meningkatkan keimanan dan ketakwaan kepada Allah Swt. Terkait dengan kepengurusan IARMI, Ahmad Arif yang baru terpilih pada Musda beberapa waktu lalu, mengajak seluruh pengurus melakukan konsolidasi menyongsong pelantikan pengurus. “Tantangan bagi pengurus akan semakin berat untuk menjaga eksistensi dan kesinambungan organisasi ini. Saya berharap semua alumni dan pengurus bekerja sama dalam membesarkan organisasi ini,” sebutnya. Dalam acara buka puasa bersama itu turut disampaikan tausyah yang dilanjutkan dengan shalat berjamaah dan makan bersama.(m46)

uang tunai senilai Rp1 juta. Keberuntungan memenangkan hadiah utama pada acara pengundian kemarin, setelah kuponnya diundi SPV Promosi CV Indako Trading Co, Arif Yudi Asmara, disaksikan sejumlah karyawan Waspada. Untuk dua pemenang hadiah kedua yang masing-masing mendapat uang tunai Rp750 ribu, jatuh kepada Fachruddin Nasution, penduduk Jln. DR Mansyur No. 38 Medan dan Rahmadi, warga Jln. Sei Asahan No. 16 C Medan. Selain tiga pemenang, juga terdapat tiga pemenang ma-

sing-masing mendapat uang tunai Rp500 ribu, empat pemenang Rp300 ribu, dan lima pemenang uang tunai 150 ribu (lihat daftar pemenang). Bagi para pemenang dapat mengambil hadiah di Ruang Pemasaran Lantai I Kantor Harian Waspada Jln. Brigjen Katamso No 1 Medan terhitung mulai Rabu (24/8) setiap jam kerja, dengan membawa fotokopi identitas diri sesuai yang tertera di kupon pemenang. Hadiah diambil paling lambat tiga bulan setelah pengumuman pemenang diterbitkan di Waspada.(m42)

Daftar Pemenang Periode III 1 Pemenang Rp1 juta -Syafaruddin Manurung, Jalan Syekh Usnan No 56 Tanjungpura 2 Pemenang Rp750 ribu -Fachruddin Nasution, Jalan DR Mansyur No 38 Medan -Rahmadi, Jalan Sei Asahan No 16 C Medan 3 Pemenang Rp500 Ribu - Zulkifli, Jalan SM Raja Gg Jadi No 14 Medan -Hendriyanto, Jalan Percut Sei Tuan Deliserdang -Ricky Gunawan, Jalan Kemuning No 36 B Medan 4 Pemenang Rp 300 ribu -Juliadi, Jalan Jati Gg Melati No 71 A -Putriyanti, Jalan Bromo No 75 C Medan -Agus Sumantri, Hutapurwosari Atas, Kab. Simalungun -M Rifa’I, Jalan HM Joni No 136 C Medan 5 Pemenang Rp150 ribu -Usmar, Jalan Jermal 6 Gg Bidan 3 Medan Denai -Muhammad Nurdin, Jalan Pancasila Medan Sunggal -Satiawan ST, Jalan Prof A Sofyan No 2E USU Medan -Syafi’i WR, Jalan Rawa I Gg Sentosa No 21 Mandala -Susetio, Jalan Surau No 19 Medan

Waspada, Rabu 24 Agustus 2011