Page 1

Harga Eceran Rp3.000,-

Pilot Simpatisan Anwar Ibrahim, Bukan Pembajak

Demi Kebenaran Dan Keadilan

WASPADA

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

RABU, Kliwon, 19 Maret 2014/17 Jumadil Awal 1435 H

KUALA LUMPUR, Malaysia (CNN): Pemimpin oposisi Malaysia Anwar Ibrahim (foto) mengatakan, kapten pilot pesawat Malaysia Airlines MH370 adalah seorang pemegang kartu anggota partainya. Namun, dia menampik jika dikatakan pilot tersebut telah mengalihkan pesawat (membajak) sebagai satu tindakan politik untuk menunjukkan dukungannya. Beberapa jam sebelum MH370 menghilang dalam penerbangan Kuala Lumpur-Beijing pada 8 Maret lalu, Anwar, pemimpin de facto Partai Keadilan Rakyat (PJR) dijatuhi hu-

kuman 5 tahun penjara se-telah pengadilan menolak permohonannya untuk membebaskan diri dari tuduhan sodomi. Beberapa outlet media melaporkan, pilot pesawat, Zaharie Ahmad Shah, telah menghadiri sidang pengadilan Anwar. Kehadirannya dikaitkan dengan hilangnya pesawat tersebut dan berlatar belakang politik sebagai protes terhadap dakwaan pada Anwar. Anwar mengatakan kepada CNN partainya tidak dapat mengukuhkan apakah Zaharie hadir di pengadilan, meski sejumlah temannya melaporkan dia ‘kecewa’ dengan hasil sidang tersebut. Pemimpin oposisi itu mengakui foto Zaharie dari beberapa pertemuan politik dan kemudian mengakui dia adalah anggota partainya — dan seorang kerabat jauh dari menantu perempuannya. Dia menyatakan, tuduhan Zaharie mengarahkan pesawat dari jalur penerbangan yang ditunjuk adalah tindakan politik yang “sangat tidak adil” untuk pilot yang hilang. Lanjut ke hal A2 kol. 4

No: 24524 Tahun Ke-68

Terbit 24 Halaman

20 Maret, ARB Kampanye Di Medan

AP

SEORANG pelajar dari sekolah Benigno “Ninoy” Aquino High School melangkah di atas lukisan yang menggambarkan pesawat Malaysia Airlines MH370 yang hilang Selasa (18/3) di kampus mereka di Makati, timur Manila, Filipina.

MEDAN (Waspada): Ketua Umum DPP Partai Golkar H.Aburizal Bakrie (ARB), dijadwalkan mengikuti kampanye akbar Partai Golkar Sumut yang akan digelar di Lapangan Me rd e k a Me d a n , Ka m i s (20/3). Diperkirakan 20.000 massa menghadari acara itu. Ketua DPD Partai Golkar Sumut H.Ajib Shah, mengatakan itu saat jumpa pers di Sekretariat DPD Partai Golkar Jl. KH.Wahid Hasyim, Selasa (18/3). Saat memberikan keterangan, dia didampingi Sekretaris DPD Partai Golkar Sumut Yasir Ridho Loebis, Bendahara Jimmy Ong, Ketua Angkatan Muda Partai Golkar (AMPG) Sumut Suruhenta S, dan Sekretaris DPD Partai Golkar Medan Sunardi Ali. Ajib Shah, menyebutkan, kedatangan ARB pada kampanye akbar Partai Golkar Sumut merupakan bentuk penghargaan yang tinggi ARB kepa-

da masyarakat Sumut. Sekaligus, ARB ingin menyampaikan secara langsung programprogram Partai Golkar kepada kader dan simpatisan partai, untuk diteruskan kepada masyarakat umum. Sekretaris DPD Partai Golkar Sumut Yasir Ridho, menambahkan, pada kampanye nanti ARB, akan menjelaskan

Lanjut ke hal A2 kol. 6

MH370 Tak Terpantau Radar TNI AU Indonesia Dituduh Punya Andil JAKARTA (Waspada): Media Utusan Malaysia mengutip Cabal Times menulis dugaan konspirasi terbaru hilangnya pesawat Malaysia Airlines. Pesawat ini diterbangkan ke Pang-kalan Amerika Serikat (AS) di Diego Garcia, sebuah kepulauan di Samudera Hindia. Hilangnya pesawat disebut-sebut sebagai skenario AS.

Indonesia disebut-sebut punya peran dalam menyembunyikan pesawat dengan nomor penerbangan MH370 ini. Radar Indonesia sudah menangkap pesawat terbang ke Pangkalan AS. Tapi Indonesia tak berani m e m b e b e r k a n h a l i n i k a re n a p u n y a Lanjut ke hal A2 kol. 4

MEDAN (Waspada): Radar Bukit Rata Lhokseumawe, Aceh Utara dan Sabang tidak memantau pesawat MAS MH-370, yang hilang kontak dalam penerbangan Kuala Lumpur-Beijing, Sabtu dinihari (8/3). Pesawat membawa 239 penumpang termasuk krew dari 14 negara, kalau terpantau nelayan Seunodon Aceh Utara di Perairan Pereulak Aceh Timur, sah-sah saja.Namun, di dua radar TNI Angkatan Udara di Aceh tidak terpantau, kata Komandan Lanud (Dan Lanud) Soewondo Kolonel (Pnb). SM. Handoko, saat dikonfirmasi Waspada via telepon selular, Selasa (18/3) malam. Begitupun, kata Handoko, dalam kasus hilangnya pesawat Boeing 777-200 ER milik maskapai penerbangan Malaysia Airlines System (MAS), terus kita pantau perkembangannya. Lanjut ke hal A2 kol. 3

Diduga Teror Pemilu Di Aceh

Kader Partai Sudah 5 Hari Hilang LHOKSEUMAWE (Waspada): Seorang kader partai lokal di Aceh sudah lima hari menghilang. Kejadian ini menambah ketegangan akibat teror dan intimidasi jelang pemilihan umum yang tinggal 23 hari lagi. Seorang anggota Partai Nasional Aceh (PNA) di Kab. Aceh Utara bernama Darmuni, 41, dilaporkan hilang sejak Jumat, 14 Maret. Darmuni yang merupakan kader PNA Kec. Paya Bakong ini hilang sekitar pukul 23:45 WIB, ketika hendak pulang ke rumahnya usai rapat

di kantor PNA Kab. Aceh Utara, di Cunda, Lhokseumawe. “Dari kantor kabupaten, ia pulang bersama ketua PNA kecamatan sampai Simpang Rangkaya, Kec. Tanah Luas, dari sana ia melanjutkan perjalanan sendiri. Saat itulah ia menghilang,” ujar Sekretaris PNA Aceh Utara, Sofyan, Selasa (18/3). Sofyan belum bisa menyimpulkan apakah ada kaitan dengan panasnya politik menjelang Lanjut ke hal A2 kol. 4

China Sisir Daratan

Waspada/Surya Efendi

STAND BY: Pesawat tempur F16 TNI AU stand by di Lanud Soewondo Polonia Medan sejak Senin (17/3), membantu pencarian MH-370. Keberadaan pesawat Malaysia Airlines MH-370 yang kehilangan kontak itu belum terdeteksi pihak TNI AU.

Poldasu Sita 61 Ton Pupuk Palsu Beredar Di Tebingtinggi Dan Sergai MEDAN (Waspada): Aparat Polda Sumut menyita 61 ton pupuk palsu dari sebuah gudang di Kota Tebingtinggi. Pupuk yang diberi label NPK Phoska dan Super Postat Alam SP-3.6 itu kini dititip di salah satu gudang di Medan. Namun, distributornya, LN alias Akiat pemilik CV Karya Tunggal Satu belum diperiksa. “61 Ton pupuk palsu itu sudah disita.Distributornya akan diperiksa Rabu (hari ini),” kata Kasubbid Pengelola Informasi dan Dokumentasi (PID) Humas Polda Sumut AKBP MP Nainggolan kepada wartawan, Selasa (18/3).

Dia menyebutkan, dari keterangan karyawan CV Karya Tunggal Satu yang sudah diperiksa sebagai saksi, pupuk dipasok dari Surabaya, Jawa Timur. “Sudah hampir enam bulan pupuk itu beredar di Sumut, dan dijual kepada petani di Tebingtinggi dan Serdang Bedagai,” kata Nainggolan. Menurutnya, pupuk tersebut sama sekali tidak mempunyai kandungan pupuk, hanya sampah. Keseluruhan pupuk itu, 734 sak pupuk NPK Phoska dan 497 sak pupuk super Postat alam SP-3.6. Kasubdit I/Indag Dit Reskrimsus AKBP Frido Situmo-

Al Bayan

Bukan Dari Islam Oleh Tgk. H. Ameer Hamzah Seburuk-buruk perkara adalah perkara agama yang baru, dan setiap yang baru adalah bid’ah, dan setiap bid’ah adalah sesat dan setiap yang sesat adalah tempatnya neraka. (HR: Muslim, Ahmad dan Ibnu Majah) BANYAK hal yang kita lihat di dunia ini seolah-olah dari Islam. Namun setelah kita selidiki ternyata hal-hal yang baru tersebut tidak ada dalam khazanah Islam. Ia barang baru yang menyusup dalam islam, lalu orangorang awam menganggapnya milik Islam sendiri. Islam yang suci melepaskan diri dari masalah-masalah bid’ah tersebut. Lanjut ke hal A2 kol. 2

waspadamedan.com Waspada Daily

@Harian_Waspada

rang menambahkan, praktik pemalsuan pupuk telah berlangsung selama 6 bulan. Pupuk dijual kepada petani seharga Rp120 ribu/sak. Pupuk yang di distribusikan CV Karya Tunggal Satu itu diketahui palsu setelah diteliti laboratorium Sucofindo serta keterangan dari Dinas Pertanian Sumut. Frido mengimbau kepada masyarakat yang masih menemukan pupuk palsu merek Phoska dan Super Pospat di pasaran, atau merasa menjadi korban penipuan atas peredarannya agar membuat laporan ke Poldasu. Lanjut ke hal A2 kol. 4

BEIJING, China (Waspada): Tim pencari pesawat Malaysia Airlines dari China mulai melakukan penyisiran di daratan negara tersebut. Hal ini menyusul meningkatnya radius kemungkinan pesawat itu berada, di wilayah selatan dan utara Asia. Dua wilayah pencarian yaitu koridor utara yang terbentang dari perbatasan Kazakhstan dan Turkmenistan hingga utara Thailand dan koridor selatan dari Indonesia hingga Samudera India, demikian menurut BBC Selasa (18/3).. China, Selasa menggiatkan 20 satelit untuk mencari pesawat Malaysia Airlines dengan nomor penerbangan MH370 bersama 239 orang penumpang dan awak, yang hilang, termasuk tujuh warga negara Indonesia. Jurubicara Kementerian Luar Negeri China Hong Lei membuat tanggapan itu pada taklimat harian. China telah mulai pencarian pesawat jet yang hilang di wilayah China yang meliputi koridor utara di mana pesawat bisa itu terbang, kata media pemerintah pada hari sebelumnya. Thailand tangkap sinyal Militer Thailand mengatakan radarnya telah mendeteksi satu pesawat yang boleh jadi adalah pesawat Malaysian Airlines (MAS) MH370 hanya beberapa menit setelah komunikasi pesawat yang dinyatakan hilang itu terputus. Thailand tidak berbagi informasi awal karena tidak diminta secara spesifik. Jurubicara AU Thai Montol Suchookorn mengatakan Selasa (18/3), pesawat tersebut mengikut satu jalur memutar ke Selat Malaka, di mana radar Malaysia melacak MH370 sebelumnya 8 Maret lalu. Namun Montol mengatakan militer Thai tidak yakin apakah mereka mendeteksi pesawat yang sama. (ant/rtr/bbc/m10)

AP

PERSONIL Angkatan Udara Vietnam, Kolonel Pham Minh Tuan berusaha melacak keberadaan pesawat Malaysia Airlines MH370 menggunakan teropong dari dalam pesawat tempur di perairan Thailand, Selasa (18/3).

Waspada/Ali Amran

BENDERA GAM BERKIBAR: Aparat TNI dan kepolisian serta masyarakat menyaksikan dan berjaga-jaga di Desa Bambel Gabungan. Dua helai bendera GAM berkibar di tiang listrik pada hari ketiga kegiatan kampanye terbuka di Aceh Tenggara, Selasa (18/3).

4 Tahun Pembunuhan Sadis Masih Misteri TANJUNGBALAI (Waspada): Aparat kepolisian di Tanjungbalai hingga kini belum mampu menangkap pembunuh bocah perempuan berusia 8 tahun, Geni Syalom Cicilia Louli, yang mayatnya ditemukan 4 tahun lalu. Pihak keluarga yang berharap polisi dapat mengungkap kasus itu, ternyata tidak juga. “Cukup sedih dengan keadaan sekarang. Anak saya dibunuh dengan sadis, tidak mungkin terjadi tanpa ada pelakunya. Hendaknya di waktu yang panjang ini pelakunya sudah ditangkap,” kata paman korban Gerson Louli kepada Waspada di Tanjungbalai Selasa (18/3). Gerson menuturkan, peristiwa itu berawal pada 10 Ja-

nuari 2010, ketika Gerson mengantar korban bersekolah Minggu di Gereja BNKP Jalan Arteri, Kec. Datukbandar, Tanjungbalai. Selang 90 menit, Gerson kembali ke gereja menjemput Cicilia. Namun, gereja telah kosong dan Cicilia tak berada di sana. Gerson heran karena Cisilia tak pernah mau dijemput orang lain kecuali pamannya. Setelah 13 hari menghilang, terdengar kabar jasad bocah perempuan itu ditemukan warga di tengah perkebunan kelapa tidak jauh dari jalan lintas Airjoman, Dusun I, Desa Airjoman, Kec. Airjoman, Asahan. “Mayat korban ditemukan warga di kebun sawit,” ujar Kapolsek Air Joman, Polres Asa-

Dimarahi, Trauma Jadi Penyebab Pilot Atau Kopilot Bunuh Diri Bersama Ratusan Penumpang MEMANG ngeri-ngeri sedap jika pilot atau kopilot keluar dari ruang kokpit untuk pergi ke toilet atau berjalan di sepanjang kabin pesawat. Sedapnya, tentu perjalanan tetap aman terkendali meskipun pilot atau kopilot sempat ke luar dari kokpit. Ngerinya, saat pilot atau kopilot berada di luar ruangannya, pesawat terjun bebas dan jatuh terhempas di laut akibat perbuatan bunuh diri dari pilot atau kopilot. Salah satu peristiwa bunuh diri itu terjadi pada 31 Oktober 1999 ketika pesawat Mesir EgyptAir Penerbangan 990 jatuh ke Samudera Atlantik dalam perjalanan dari Los Angeles dan New York, AS, ke Kairo, Mesir. Kopilot bunuh diri dengan menjatuhkan pesawat ketika pilot sedang ke toilet, menewaskan semua penumpangnya yang berjumlah 203 penumpang dan 14 awak. Menemukan kotak hitam pun menjadi penting untuk mengetahui penyebab jatuhnya pesawat. Dari perekam suara kokpit di dalam kotak hitam itu, diketahui bahwa kapten ada memberitahukan kepada kopilot bahwa dia akan pergi ke toilet. Lalu, kopilot Al-Batouti berkata “Tawkalt ala Allah” yang berarti “Aku berserah kepada Allah”, ketika itu, autopilot telah dimatikan, lalu ia mengulangi lagi kata “Aku berserah kepada Allah”. Saat elevator dalam posisi turun 3 derajat, dia mengulangi kembali kata “Aku berserah kepada Allah” sampai 7 kali.

Sang Kapten, yang baru kembali dari toilet, terkejut. “Apa yang terjadi?”, lalu ia berjuang menaikkan pesawat, sementara kopilot tetap mengontrol pesawat turun sampai terhempas ke laut hingga CVR dan FDR (perekam data penerbangan) berhenti merekam setelah pesawat porak poranda di Samudera Atlantik. Penyebab kecelakaan dan spekulasi Menurut pihak berwenang (NTSB), pesawat tersebut jatuh akibat tindakan kopilot Gamal Al-Batouti yang sengaja memanipulasi kontrol pesawat. Al-Batouti memiliki masalah dengan perilakunya, yakni sering menggoda wanita pelayan hotel dimana dia dan rekan-rekannya sesama pilot EgyptAir menginap. Hal ini mengakibatkan beliau sering dimarahi oleh atasannya. Bahkan di pesawat pun dia dimarahi atasannya: “Ini penerbangan kau yang terakhir,” kata sang atasan, lalu dijawab oleh kopilot: “Ya, ini juga penerbangan kau yang terakhir.” Benar ucapannya. Palak dimarahi atasannya itu, kopilot menjatuhkan pesawat yang ditinggalkan pilot. Namun, menurut otoritas penerbangan Mesir, kecelakaan tersebut disebabkan oleh kemacetan sistem kemudi ekor

Lanjut ke hal A2 kol. 1

han, AKP Abdul Rahman, yang masih menjabat waktu itu. Kasus tersebut kemudian ditindaklanjuti Sat Reskrim Polres Tanjungbalai. Kondisi jenazah sangat memilukan, tubuh mengalami luka bakar dan sudah membusuk. Jasadnya nyaris tak dapat lagi dikenali.Diduga korban telah meninggal beberapa hari. Kapolres Tanjungbalai AKBP ML Hutagalo melalui Kasat Reskrim AKP Aris Wibowo didampingi Kasubbag Humas AKP Y Sinulingga mengatakan pihaknya sudah menggelar kasus pembunuhan tersebut. Namun dari hasil penyelidikan belum ditemukan alat bukti yang mengarah kepada tersangka. (a32)

Ada-ada Saja Pengemis Tinggalkan Harta Miliaran Rupiah SIAPA sangka Eisha, seorang perempuan yang seharihari dikenal warga distrik AlBalad, Jeddah, Arab Saudi, sebagai pengemis itu memiliki harta benda yang luar biasa. Lanjut ke hal A2 kol. 1

Serampang - Pesanan kain kuning meningkat - He...he...he...


Harga Eceran Rp 3.000

Tiga Hari Kampanye, Pelanggaran Terbanyak Bawa Anak-Anak

Demi Kebenaran Dan Keadilan

WASPADA

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

RABU, Pahing, 19 Maret 2014/17 Jumadil Awal 1435 H

MEDAN (Waspada): Ketua Badan Pengawas Pemilihan Umum (Bawaslu) Sumatera Utara, Syafrida R. Rasahan mengemukakan, dalam tiga hari pelaksanaan kampanye belum ada mengarah pidana.Namun sesuai informasi dari berbagai daerah, pelanggaran terbanyak adalah membawa anak-anak. Hal itu dikemukakan Syafrida usai membuka rapat koordinasi Sentra Penegakan Hukum Terpadu (Gakkumdu) Pemilu 2014, di Hotel Grand Angkasa Medan, Selasa (18/3). Menurutnya, pelanggaran kampanye seperti membawa anak-anak dilakukan oleh semua Parpol yang berkampanye dalam tiga hari ini. Sedangkan pelanggaran lainnya adalah kampanye di luar jadwal dan pembagian selebaran. ‘’Hampir semua Parpol yang berkampanye mulai hari pertama dan ketiga melakukan pelanggaran, yakni dengan membawa anak-anak,’’katanya. Undang-Undang No. 23, Pasal 87 tentang perlindungan anak, lanjutnya, sudah menyatakan, anak-anak tidak boleh dieksploitasi demi kepentingan politik. Meskipun itu, secara tidak sadar orang tua membawa anaknya dengan alasan

No: 24524 * Tahun Ke-68 Terbit 24 Halaman

20 Maret, ARB Kampanye Di Medan MEDAN (Waspada): Ketua Umum DPP Partai Golkar H.Aburizal Bakrie (ARB), dijadwalkan mengikuti kampanye akbar Partai Golkar Sumut yang akan digelar di Lapangan Merdeka, Kamis (20/3). Diperkirakan 20.000 massa menghadari acara tersebut. Ketua DPD Partai Golkar Sumut H.Ajib Shah, mengatakan itu saat jumpa pers di Sekretariat DPD Partai Golkar Jl. KH.Wahid Hasyim, Selasa (18/3). Saat memberikan keterangan, dia didampingi Sekretaris DPD Partai Golkar Sumut Yasir Ridho Loebis, Bendahara Jimmy Ong, Ketua Angkatan Muda Partai Golkar (AMPG) Sumut Suruhenta S, dan Sekretaris DPD Partai Golkar Medan

Lanjut ke hal A2 kol 1

Sunardi Ali. Ajib Shah, menyebutkan, kedatangan ABR pada kampanye akbar Partai Golkar Sumut merupakan bentuk penghargaan yang tinggi ARB kepada masyarakat Sumut. Sekaligus, ARB ingin menyampaikan secara langsung program-program Partai Golkar kepada kader dan simpatisan partai, untuk diteruskan kepada masyarakat umum. Sekretaris DPD Partai Golkar Sumut Yasir Ridho, menambahkan, pada kampanye nanti ARB, akan menjelaskan kepada masyarakat tentang visi Golkar, yakni Negara Kesejahteraan 2045. Katanya, sampai saat ini, hanya Partai Gokar yang Lanjut ke hal A2 kol 1

Waspada/Ist

KETUA Partai Golkar Sumut H.Ajib Shah, didampingi pengurus lainnya, memberikan penjelasan kepada wartawan tentang persiapan kampanye akbar di Lapangan Merdeka.

Hilangnya MH370

M’sia Tuduh RI Punya Andil Dana Jasa Raharja 7 Pelajar SD Tewas Masih Kabur LABURA (Waspada): Pihak keluarga 7 penumpang truk Colt Diesel BK 9989 FR dikemudikan Viktor Sitorus, Senin (17/3) di Afdeling II kebun PT Torganda, Desa Aek Korsik, Kec. Aek Kuo,Kab. Labuhanbatu Utara (Labura). Akibatnya tujuh orang pelajar Sekolah Dasar (SD) tewas, meninggalkan kesedihan yang mendalam bagi keluarga. Ironisnya, dana Jasa Rahardja korban yang tewas yang bisa dipergunakan keluarga yang ditinggal masih dalam proses menunggu rekomendasi dari Dinas Perhubungan Labura tentang status jalan di lokasi kejadian. Peristiwa laka lantas tersebut terjadi sekira pukul

11:30, truk yang digunakan mengangkut pelajar Sekolah Dasar itu bergerak dari Afdeling 3 kebun PT Torganda menuju Afdeling 2 dengan membawa 45 siswa kelas satu dan dua SD. Diduga terot truk lepas sehingga pengemudi tak bisa mengendalikan stang setir akibatnya truk terguling ke parit bekoan yang berisi air. Akibatnya tiga pelajar meninggal di tempat yakni, Haikal Manurung, Riska Manurung dan Yusup Setiawan Gulo dua meninggal dalam perjalanan menuju klinik kebun PT Torganda yaitu, Angga kurniawan. Dan M. Igbal sedangkan Teritin Telambanua meninggal saat dirawat di klinik kebun. Sementara Julianto Laoly

meninggal saat dirawat disebuah klinik di Desa Kampung Pajak, Kecamatan Na IX - X. Korban meninggal diduga karena terbenam dalam air sehingga tak bisa bernafas. Sementara Kasat Lantas Polres Labuhanbatu AKP Adi Santri melalui Kanit Laka Ipda M..Syafi’ I Lubis mengatakan sampai saat ini supir masih dalam pencarian, ungkapnya sembari menambahkan bahwa para korban yang tewas belum bisa dipastikan apakah bisa memperoleh jasarahardja sebab menunggu surat dari dinas perhubungan Labura tentang status jalan disekitar lokasi kejadian. Lanjut ke hal A2 kol 6

JAKARTA (Waspada): Utusan Malaysia, media terbesar berbahasa Melayu, menuduh Pemerintah Indonesia memiliki andil dalam insiden hilangnya pesawat Malaysia Airlines. Media itu juga menyebut Indonesia memiliki perjanjian global rahasia dengan Amerika Serikat (AS). Sebelumnya Utusan Malaysia mempertanyakan mengapa Indonesia tidak bisa melacak pesawat MH370, dengan radar militer yang dimiliki. Utusan pun menyebutkan pesawat MH370 terbang ke Pangkalan Militer AS di Diego Gracia. Tuduhan yang didasarkan keterangan dari situs Cabal Times itu menyebutkan, radar Indonesia sudah pasti mengetahui keberadaan dari pesawat tersebut. Utusan menyebutkan Indonesia memiliki perjanjian kerja sama rahasia dengan AS, sehingga tidak memberi tahu data radar yang menunjukkan keberadaan pesawat Malaysia Airlines. Namun, tuduhan itu dibantah Deputi VII Menko Polhukam Bidang Koordinasi,Komunikasi, dan Aparatur (Kominfotur) marsda TNI Agus R.Barnas. Lanjut ke hal A2 kol 6

MH370 Tidak Terpantau Dua Radar TNI AU

Dua Hari Kampanye, Bawaslu Temukan Dugaan Politik Uang JAKARTA (Antara): Badan Pengawas Pemilu (Bawaslu) menemukan dugaan praktik politik uang yang dilakukan peserta Pemilu anggota DPR, DPD dan DPRD selama dua hari pertama pelaksanaan kampanye rapat umum terbuka, kata Ketua Bawaslu Muhammad di Jakarta, Selasa (18/3). “Kami menemukan juga adanya politik uang, selain pelibatan anak-anak secara berjamaah pada pelaksanaan kampanye parpol,” kata Muhammad saat jumpa wartawan terkait Peraturan Komisi Informasi tentang Standar Layanan dan Prosedur Penyelesaian Sengketa. Tim hukum Bawaslu ma-

sih melakukan kajian terhadap dugaan tersebut, sehingga belum dapat diumumkan kepada publik parpol mana saja yang melakukan praktik politik uang. “Kami belum bisa mem-publish dimana dan partai apa saja karena hasil pengawasan itu sedang dikaji oleh tim hukum Bawaslu,” kata Muhammad. Sebelumnya, anggota Bawaslu Daniel Zuchron memperingatkan kepada seluruh parpol peserta Pemilu untuk tidak membagikan uang atau barang lain kepada masyarakat selama kampanye. Jika kegiatan bagi-bagi uang tersebut terbukti dilakukan oleh peserta kampanye, maka konsekuensi terberat

adalah parpol atau caleg bersangkutan dapat didiskualifikasi sebagai peserta Pemilu. “Ada tiga hal yang menyebabkan keikutsertaan Pemilu dibatalkan, yaitu politik uang dan barang, pemalsuan dokumen, dan tidak menyerahkan laporan dana kampanye kepada Komisi Pemilihan Umum (KPU),” kata Daniel. Dalam Undang-undang Nomor 8 Tahun 2012 tentang Pemilu Anggota DPR, DPD dan DPRD diatur pada pasal 86 huruf j bahwa pelaksana, peserta dan petugas kampanye dilarang menjanjikan atau memberikan uang atau materi lainnya kepada peserta Lanjut ke hal A2 kol 3

MEDAN (Waspada) : Radar Bukit Rata Lhoseumawe Aceh Utara dan Sabang tidak terpantau pesawat MAS MH-370, yang hilang kontak dalam penerbangan Kuala Lumpur-Beijing, Sabtu dinihari (8/3). Pesawat membawa 239 penumpang termasuk crew dari 14 negara, kalau terpantau nelayan Seunodon Aceh Utara di Perairan Pereulak Aceh Timur, sah-sah saja.Namun, dua radar TNI Angkatan Udara di Aceh tidak terpantau,kata Komandan Lanud (Dan Lanud) Soewondo Kolonel (Pnb). SM. Handoko, saat dikonfirmasi Waspada via telpon selular, Selasa (18/3) malam. Begitupun, kata Handoko, dalam kasus hilangnya pesawat Boeing 777-200 ER milik maskapai penerbangan Malaysia Airlines System (MAS), terus kita pantau perkembangannya. Lanjut ke hal A2 kol 7

China Cari MH370 Di Darat Dan Kerahkan 21 Satelit Dok. Waspada

Petugas menyelidiki jenazah Cicilia Louli yang tidak utuh lagi.

Setelah 4 Tahun, Kuburan Gadis Cilik Dibongkar Untuk Diotopsi TANJUNGBALAI (Waspada): Aparat kepolisian di Tanjungbalai hingga kini belum mampu menangkap pembunuh bocah perempuan berusia 8 tahun,Geni Syalom Cicilia Louli, yang mayatnya ditemukan 4 tahun lalu. Pihak keluarga yang berharap polisi dapat mengungkap kasus itu, ternyata tidak juga. “Cukup sedih dengan keadaan sekarang.Anak saya dibunuh dengan sadis, tidak mungkin terjadi tanpa ada pelakunya.Hendaknya di

waktu yang panjang ini pelakunya sudah ditangkap,” kata paman korban Gerson Louli kepada Waspada di Tanjungbalai Selasa (18/3). Gerson menuturkan, peristiwa itu berawal pada 10 Januari 2010,ketika Gerson mengantar korban bersekolah Minggu di Gereja BNKP Jalan Arteri, Kec. Datukbandar, Tanjungbalai. Selang 90 menit, Gerson kembali ke gereja menjemput Cicilia. Namun, gereja telah kosong dan Cisilia tak berada di

Al Bayan

Bukan Dari Islam Oleh: H. Ameer Hamzah Seburuk-buruk perkara adalah perkara agama yang baru, dan setiap yang baru adalah bid’ah, dan setiap bid’ah adalah sesat dan setiap yang sesat adalah tempatnya neraka. (HR: Muslim, Ahmad dan Ibnu Majah) BANYAK hal yang kita lihat di dunia ini seolah-olah dari Islam. Namun setelah kita selidiki ternyata hal-hal yang baru tersebut tidak ada dalam khazanah Islam. Ia barang baru yang menyusup dalam islam, lalu orangorang awam menganggapnya milik Islam sendiri. Islam yang suci melepaskan diri dari masalah-masalah bid’ah tersebut. Pertama yang bukan dari Islam adalah budaya pacaran antara pemuda dan pemudi berdua-duaan di tempat Lanjut ke hal A2 kol 2

waspadamedan.com Waspada Daily

@Harian_Waspada

BEIJING, China (Waspada): Tim pencari pesawat Malaysia Airlines dari China mulai melakukan penyisiran di daratan negara tersebut. Hal ini menyusul meningkatnya radius kemungkinan pesawat itu berada, di wilayah selatan dan utara Asia. Dua wilayah pencarian yaitu koridor utara yang terbentang dari perbatasan Kazakhstan dan Turkmenistan hingga utara Thailand dan koridor selatan dari Indonesia hingga Samudera India, demikian menurut BBC Selasa (18/3). Lanjut ke hal A2 kol 5

Terkait Pengungsi Sinabung:

KPU Koordinasi Dengan BNPB Guna Pendataan Kembali

sana. Gerson heran karena Cisilia tidak pernah mau dijemput orang lain kecuali pamannya itu. Setelah 13 hari menghilang, terdengar kabar jasad bocah perempuan itu ditemukan warga di tengah perkebunan kelapa tidak jauh dari jalan lintas Airjoman, Dusun I, Desa Airjoman, Kec. Airjoman, Kab. Asahan. “Mayat korban ditemukan warga di kebun sawit,” ujar Lanjut ke hal A2 kol 1

Poldasu Sita 61 Ton Pupuk Palsu MEDAN (Waspada): Aparat Polda Sumut menyita 61 ton pupuk palsu dari sebuah gudang di Kota Tebingtinggi. Pupuk yang diberi label NPK Phoska dan Super Postat Alam SP-3.6 itu kini dititip di salah satu gudang di Medan. Namun, distributornya, LN alias Akiat pemilik CV Karya Tunggal Satu belum diperiksa. “61 Ton pupuk palsu itu sudah disita.Distributornya akan diperiksa Rabu (hari ini),” kata Kasubbid Pengelola Informasi dan Dokumentasi (PID) Humas Polda Sumut AKBP MP Nainggolan kepada wartawan, Selasa (18/3). Dia menyebutkan, dari Lanjut ke hal A2 kol 4

Waspada/Ali Amran

BENDERA GAM BERKIBAR: Aparat TNI dan kepolisian serta masyarakat terlihat menyaksikan dan berjaga-jaga di Desa Bambel Gabungan. Dua helai bendera GAM berkibar di tiang listrik pada hari ketiga kegiatan kampanye terbuka di Aceh Tenggara, Selasa (18/3).

Keluarga penumpang Malaysia Airlines yang hilang menunggu di Beijing.

MEDAN (Waspada): Proses pemulangan pengungsi Gunung Sinabung mengharuskan penyelenggara Pemilu (Komisi Pemilihan Umum) melaksanakan pendataan kembali warga yang menjadi pemilih. Komisioner KPU Sumut Benget Silitonga, Selasa (18/3) kepada wartawan mengungkapkan, terkait pengungsi Gunung Sinabung, KPU telah

berkoordinasi dengan Badan Nasional Penanggulangan Bencana (BNPB). “Kepada BNPB, KPU menyampaikan jika bisa pengembalian para pengungsi tidak lagi dilakukan dua minggu sebelum pemungutan suara. Namun, BNPB mengatakan, hal itu tergantung alam,”kata Benget. Namun, dia mengakui, situasi dan kondisi itu jelas

Lanjut ke hal A2 kol 2

Ada-ada Saja

Pengemis Tinggalkan Harta Miliaran Rupiah

Misteri MH370

Dimarahi, Trauma Jadi Penyebab Pilot Atau Kopilot Bunuh Diri Bersama Ratusan Penumpang MEMANG ngeri-ngeri sedap jika pilot atau kopilot keluar dari ruang kokpit untuk pergi ke toilet atau berjalan di sepanjang kabin pesawat. Sedapnya, tentu perjalanan tetap aman terkendali meskipun pilot atau kopilot sempat ke luar dari kokpit. Ngerinya, saat pilot atau kopilot berada di luar ruangannya, pesawat terjun bebas dan jatuh terhempas di laut akibat perbuatan bunuh diri dari pilot atau kopilot. Salah satu peristiwa bunuh diri itu terjadi pada 31 Oktober 1999 ketika pesawat Mesir EgyptAir Penerbangan 990 jatuh ke Samudera Atlantik dalam perjalanan dari Los Angeles dan New York, AS, ke Kairo, Mesir. Kopilot bunuh diri dengan menjatuhkan pesawat ketika pilot sedang ke toilet, menewaskan semua penumpangnya yang berjumlah 203 penumpang dan 14 awak. Menemukan kotak hitam pun

menjadi persoalan baru bagi KPU. Apalagi KPU telah melakukan pendataan dan pemetaan terhadap pemilih yang mengungsi. ‘’Tapi, KPU tetap siap mengantisipasi kemungkinan terburuk yang terjadi hingga hari H pemungutan suara nanti,’’katanya.

menjadi penting untuk mengetahui penyebab jatuhnya pesawat. Dari perekam suara kokpit di dalam kotak hitam itu, diketahui bahwa kapten ada memberitahukan kepada kopilot bahwa dia akan pergi ke toilet. Lalu, kopilot Al-Batouti berkata “Tawkalt ala Allah” yang berarti “Aku berserah kepada Allah”, ketika itu, autopilot telah dimatikan, lalu ia mengulangi lagi kata “Aku berserah kepada Allah”. Saat elevator dalam posisi turun 3 derajat, dia mengulangi kembali kata “Aku berserah kepada Allah” sampai 7 kali. Sang Kapten, yang baru kembali dari toilet, terkejut. “Apa yang terjadi?”, lalu ia berjuang menaikkan pesawat, sementara Lanjut ke hal A2 kol 2

SIAPA sangka Eisha, seorang perempuan yang seharihari dikenal warga distrik AlBalad, Jeddah, Arab Saudi, sebagai pengemis itu memiliki harta benda yang luar biasa. Setelah lebih dari 50 tahun mengemis di jalanan kota

Lanjut ke hal A2 kol 6

Serampang - Kalau mau bawa anak-anak ke mall - He.... he....he....


Berita Utama

A2

Ibu Dan Anak Tewas Laka Lantas Di T.Morawa

Setelah 4 Tahun ....

KPU Kordinasi ....

Kapolsek Air Joman, Polres Asahan, AKP Abdul Rahman, yang masih menjabat waktu itu. Kasus tersebut kemudian ditindaklanjuti Sat Reskrim Polres Tanjungbalai. Kondisi jenazah sangat memilukan, tubuh mengalami luka bakar dan sudah membusuk. Jasadnya nyaris tak dapat lagi dikenali.Diduga korban telah meninggal beberapa hari. Kapolres Tanjungbalai AKBP ML Hutagalo melalui Kasat Reskrim AKP Aris Wibowo didampingi Kasubbag Humas AKP Y Sinulingga mengatakan pihaknya sudah menggelar kasus pembunuhan tersebut. Namun dari hasil penyelidikan belum ditemukan alat bukti yang mengarah kepada tersangka. (a32)

Menurut dia lagi, rencana kebijakan menyangkut penanganan Pemilu di pengungsian akan diputuskan 2 Pekan sebelum pemungutan suara pada 9 April. “KPU siap menghadapi kemungkinan terburuk. Nanti dua pekan sebelum hari pemungutan akan diputuskan bagaimana skenarionya,”ujar dia. Memang, lanjutnya, peraturan KPU mengatur adanya pemindahan hari pemungutan suara bagi kejadian darurat. Apapun skenar io penanganannya kata Benget, hal yang terpenting adalah pendataan pemilih itu sendiri. Khusus di Tanah Karo, akan ada daftar pemilih tetap (DPT) faktual baru yang berbeda

Tiga Hari ....

tindak pidana Pemilu sudah terang-terangan, namun untuk Sumut sendiri belum ada satupun yang ‘nyangkut’. Ibarat memancing, kita sudah melempar umpan akan tetapi belum ada satupun ikat yang nyangkut,’’ungkapnya. Menjawab pertanyaan bagaimana ‘menjerat’ calon legislatif (Caleg) yang nakal, Syafrida mengatakan, bahwa undang-undangnya sudah jelas. Memberikan dan menjanjikan sesuatu ancamannya sudah jelas, tetapi terbentur pada adanya syarat kumulatif. Syarat kumulatif itu, harus ada ajakan, harus ada visi-misi dan harus ada barang yang memang mereka berikan. Sebelumnya, dalam pembukaan Rakor yang dihadiri unsur Poldasu dan Kejatisu, komisioner KPU Sumut Benget Silitonga, komisioner Bawaslu Aulia Andri dan Herdie Munthe, Sekretaris Bawaslu Iwan Tero serta Panwas kabupaten/kota di Sumut, Syafrida mengemukakan,

diharapkan kepada penyidik, kejaksaan dan Panwas di daerah lebih ser ing berkumpul. Hal ini guna menghindarkan terjadinya koordinasi hanya ketika terjadi masalah. Secara terpisah, Ketua Panwaslu Kota Medan, Teguh Satyawira, yang dihubungi terkait pelanggaran selama tiga hari kampanye di wilayah Medan, menyebutkan, adalah membawa anak-anak dalam kampanye. Seperti rapat umum di Jl. Air Bersih oleh Gerindra, pelanggaran yang kini sedang dikaji oleh Panwas Kecamatan, terkait membawa anak-anak dalam kampanye. ‘’Panwas Medan Kota sedang melakukan kajian, apakah itu pelanggaran administratif atau bukan. Hasil kajian akan diteruskan ke KPU, dan KPU yang memberikan sanksi,’’kata Teguh. Sedangkan pelanggaran lainnya, menurut Teguh belum ada ditemukan. (m34)

kata Ajib Shah. Koordinasi Dengan Polres Karena ingin melaksanakan kampanye yang tertib, kata Ajib Shah, pihaknya juga sudah berkoordinasi dengan pihak Polresta Medan. Pengurus Partai Golkar, Selasa (18/3), bertemu langsung dengan Kapolresta Medan Ko m b e s Po l Ni c o A f i n t a Karokaro. Dalam pertemuan yang juga dihadiri Ketua DPD Partai Golkar Medan H.M. Syaf Lubis, Ka p o l re s t a Ni c o A f i n t a , mengaku siap melakukan koordinasi dengan seluruh Parpol terkait upaya mewujudkan keamanan. Baik saat kampanye berlangsung maupun sesudahnya.

Pada kesempatan itu, Nico mengimbau kepada pimpinan Parpol agar samasama menjaga kekondusifan dan keamanan selama masa kampanye berlangsung. Polisi, kata dia, akan menindak peserta kampanye yang tidak tertib berkendaraan saat menghadiri kampanye. ‘’S esuai aturan, massa kampanye juga dilarang menaiki mobil bak terbuka saat berkampanye. Sedangkan pengendara kereta diwajibkan tetap memakai helm. Kami (kepolisian) beharap semua pihak perlu bersama-sama menjaga agar Pemilu Legislatif ini berjalan aman dan lancar,” katanya. (m12/m39)

keterangan karyawan CV Karya Tunggal Satu yang sudah diperiksa sebagai saksi, pupuk dipasok dari Surabaya, Jawa Timur. “Sudah hampir enam bulan pupuk itu beredar di Sumut, dan dijual kepada petani di Tebingtinggi dan Serdang Bedagai,” kata Nainggolan. Menurutnya, pupuk tersebut sama sekali tidak mempunyai kandungan pupuk, hanya sampah. Keseluruhan pupuk itu, 734 sak pupuk NPK Phoska dan 497 sak pupuk super Postat alam SP-3.6. Kasubdit I/Indag Dit Reskrimsus AKBP Frido Situmorang menambahkan, praktik pemalsuan pupuk telah berlangsung selama 6 bulan. Pupuk dijual kepada petani seharga Rp120 r ibu/sak. Pupuk yang di distribusikan CV Karya Tunggal Satu itu diketahui palsu setelah diteliti laboratorium Sucofindo serta keterangan dari Dinas Pertanian Sumut. D istributor pupuk Akiet, kata dia, bisa dijerat Pasal 60 (1) huruf f UURI No. 12 Tahun 1992 tentang sistem budidaya tanaman jo Pasal 62 UU RI No. 8 Tahun 1998 tentang perlindungan konsumen dengan ancaman hukuman 5 tahun. Frido mengimbau kepada masyarakat yang masih menemukan pupuk palsu merek Phoska dan Super Pospat di pasaran, atau merasa menjadi korban penipuan atas pere-

Dimarahi, ....

buah sumber yang dirahasiakan, berspekulasi bahwa AlBatouti mengalami trauma perang, karena banyak anggota skuadronnya di Angkatan Udara Mesir terbunuh dalam perang tahun 1973. Fakta lain yang ditemukan, ada 33 orang perwira angkatan bersenjata Mesir di pesawat itu yang baru pulang latihan di AS, sehingga menimbulkan spekulasi bahwa ada konspirasi kelompok teroris Muslim ekstrimis melawan Mesir. Sementara, pihak lain menduga bahwa itu adalah rencana pembunuhan oleh Mossad Israel. Hingga kini, penyebab kecelakaan ini masih diperdebatkan. Demikian tulis National Geographic Channel - Air Crash Investigation. Jatuhnya Silk Air Peristiwa lain yang dikaitkan dengan pilot bunuh diri terjadi terhadap pesawat SilkAir Penerbangan 185 pada 19 Desember 1997. Dalam perjalanan dari Bandara Internasional Soekarno-Hatta, Jakarta, Indonesia ke Bandara Changi, Singapura, pesawat jatuh di atas Sungai Musi, Palembang, Sumatera Selatan. Sebanyak 97 penumpang dan 7 awak kabin tewas, termasuk pilot Tsu Way Ming dari Singapura dan kopilot Duncan Ward dari Selandia Baru. Investigasi kecelakaan ini dilakukan oleh Komisi Nasional Keselamatan Transportasi Indonesia bersama dengan tim ahli dari NTSB Amerika, Singapura, dan Australia. Pada

tanggal 14 Desember 2000, KNKT mengeluarkan laporan yang menyatakan bahwa penyebab kecelakaan tidak dapat diketahui (undetermined). Namun, NTSB memiliki pendapat yang berbeda. Menurut mereka, kecelakaan ini disebabkan oleh tindakan Kapten Tsu yang sengaja menjatuhkan pesawatnya ke laut (bunuh diri). Menurut beberapa sumber, kemungkinan penyebab Kapten Tsu melakukan tindakan tersebut antara lain: Masalah keuangan keluarga, dimana ia dilaporkan mengalami kerugian dalam investasi keuangan, dan hutang tagihan kartu kreditnya yang lebih besar dari kemampuannya membayar (terutama diakibatkan dari pengeluaran keluarganya yang lebih besar dari gajinya sebagai pilot). Kapten Tsu membeli polis asuransi beberapa hari sebelum kejadian (pada hari kecelakaan, jaminan perlindungan dari polisnya mulai berlaku), sehingga ia melakukan tindakan menjatuhkan pesawat tersebut untuk mendapatkan uang santunan asuransi sebagai pengganti kerugian investasinya sebelumnya. Ia juga dilaporkan beberapa kali mendapat teguran disiplin dari SilkAir, termasuk satu tindakan yang berkaitan dengan memanipulasi sekring dari perekam suara kokpit (CVR), Laporan lain mengatakan

para penyanyi (biduan) adalah haram (HR: Bukhari). Kata Ibnu Taimiyah; Imam Empat Mzhab, Hanafi, Malaiki, Syafi’Ii dan Hambali sepakat nyanyian itu haram hukumnya. Selain haram alat music juga sangat haram para penyanyi yang membuka auratnya di depan umum. Kontes ratu-ratuan; Ratu cantik, miss lokal, negara, dunia, semua adalah haram dan bukan dari Islam. Setiap lomba yang menampilkan perempuan adalah haram. Allah berfirman: Katakanlah kepada orang lakilaki yang beriman: “Hendaklah mereka menahan pandangannya, dan memelihara kemaluannya; yang demikian itu adalah lebih suci bagi mereka,

sesungguh-nya Allah Maha Mengetahui apa yang mereka perbuat”. Katakanlah kepada wanita yang beriman: “Hendaklah mereka menahan pandangannya, dan memelihara kemaluannya, dan janganlah mereka menampakkan perhiasannya, kecuali yang (biasa) nampak daripadanya. Dan hendaklah mereka menutupkan kain kudung ke dadanya… (QS. An-Nur:30-31). Dalam hadis Rasulullah bersabda: Perempuan tabaruj (yang membuka aurat), tidak dapat mencium bau surga (HR: Ahmad). Olahraga zaman sekarang banyak yang menampakkan aurat dan mengandung kekerasan juga haram bagi umat Islam.

membawa anaknya karena tidak ada yang menjaga di rumah. ‘’Tegasnya, itu tidak boleh sebab kampanye dan politik bukan ranahnya mereka (anak-anak). Bagaimana nanti jika terjadi kekerasan-kekerasan, kemudian penampilan pornografi oleh artis-artis yang ditampilkan. Ini sangat rentan terhadap anak-anak,’’ujar Syafrida. Sedangkan menurut undang-undangnya, kata dia, yang bisa disalahkan adalah orang tuanya maupun Parpol bersangkutan.‘’Makanya kita klasifikasikan supaya pihak penyidik bisa melihat hal itu,’’kata Syafrida. Pemahaman, baik penyidik maupun kejaksaan sebagai penuntut dan Panwas masih terjadi tarik-menarik. Penyidik mengharuskan adanya saksi ahli, sehingga diperlukan adanya sama pemahaman serta satu persepsi. ‘’Kita sama mengetahui

20 Maret .... telah memiliki blueprint (cetak biru) pembangunan nasional hingga tahun 2045. Berkaitan dengan pelaksanaan kampanye dengan pengerahan massa yang begitu banyak, Ajib Shah, mengatakan tujuannya bukan untuk gagah-gagahan. Melainkan sebagai bentuk keseriusan Partai Golkar untuk memenangkan Pemilu Legislatif tahun 2014 ini. Walaupun massa yang dikerahkan terbilang banyak, namun menurut Ajib Shah, Partai Golkar komit untuk tetap mengikuti aturan kampanye yang dibuat KPU. Seperti, tidak membawa anakanak, tidak menggunakan mobil bak terbuka dan tetap menggunakan helm bagi pengendara kereta. ‘’Partai Golkar akan berusaha patuh terhadap peraturan. Benar, kita (Golkar) ingin mengerahkan massa yang banyak, tapi tetap mematuhi aturan. Golkar berusaha menjadi yang terbaik dalam melaksanakan Pemilu. Apa yang dilarang akan kita ikuti. Golkar ingin kampanye ramai, tapi tidak melanggar aturan,’’

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Gc5+, Md6 atau Me7. 2. GxM+mat. Jawaban TTS: TTS

Kesehatan

kopilot tetap mengontrol pesawat turun sampai terhempas ke laut hingga CVR dan FDR (perekam data penerbangan) berhenti merekam setelah pesawat porak poranda di Samudera Atlantik. Penyebab kecelakaan dan spekulasi Menurut pihak berwenang (NTSB), pesawat tersebut jatuh akibat tindakan kopilot Gamal Al-Batouti yang sengaja memanipulasi kontrol pesawat. Al-Batouti memiliki masalah dengan perilakunya, yakni sering menggoda wanita pelayan hotel dimana dia dan rekan-rekannya sesama pilot EgyptAir menginap. Hal ini mengakibatkan beliau sering dimarahi oleh atasannya. Bahkan di pesawat pun dia dimarahi atasannya: “Ini penerbangan kau yang terakhir,” kata sang atasan, lalu dijawab oleh kopilot: “Ya, ini juga penerbangan kau yang terakhir.” Benar ucapannya. Palak dimarahi atasannya itu, kopilot menjatuhkan pesawat yang ditinggalkan pilot. Namun, menurut otoritas penerbangan Mesir, kecelakaan tersebut disebabkan oleh kemacetan sistem kemudi ekor (elevator) pada pesawat jenis 767 tersebut. Hasil investigasi yang berbeda dari kedua negara ini lalu memunculkan perdebatan mengenai penyebab kecelakaan tersebut. Sebuah media Inggris, Sunday Times, mengutip se-

Al Bayan ....

Jawaban Sudoku:

1 4 2 3 5 6 8 7 9

3 5 8 7 2 9 4 1 6

9 6 7 1 4 8 3 5 2

4 7 1 9 8 3 6 2 5

5 2 3 4 6 1 9 8 7

6 8 9 5 7 2 1 3 4

7 1 5 6 3 4 2 9 8

8 9 6 2 1 5 7 4 3

2 3 4 8 9 7 5 6 1

yang sepi. Islam sangat melarang hal yang demkian. Rasulullah bersabda: Jangan berdua-duaan, nanti setan menjadi orang yang ketiga (HR: Bukhari). Dalam hadis lain Rasulullah bersabda: Lebih baik menyentuh kulit babi daripada menyentuh kulit lawan jenis yang bukan mahramnya (HR: Muslim). Di situlah letak tanggungjawab orang tua untuk menjaga putra-putri mereka dari penyakit yang datang dari barat ini. Musik dan nyanyian juga bukan dari Islam. Islam mengharamkan pendapatan yang mereka dapat dari musik dan nyanyian. Dalam hadis Rasulullah bersabda: Pendapatan

dengan DPT yang pernah ditetapkan sebelumnya. Tegasnya, kata Benget , bagi masyarakat yang masih mengungsi, KPU akan memfasilitasinya di pengungsian dengan membangun TPS di pengungsian dengan DPT faktual tersebut. (m34)

Dua Hari .... kampanye untuk memilih atau tidak memilih parpol atau caleg tertentu. Peraturan KPU Nomor 15 Tahun 2013 tentang Pedoman Pelaksanaan Kampanye juga memperkuat peraturan UU tersebut dengan melarang pemberian uang dan barang sebagai iming-iming untuk menarik suara masyarakat selama berkampanye.

TANJUNGMORAWA (Waspada): Seorang ibu dan anaknya tewas akibat kecelakaan lalu lintas (laka lantas) di Jalan Lintas Sumatera (Jalinsum) Medan-Tanjungmorawa, Kilometer 14,4, Desa Bangunsari, Kec. Tanjungmorawa, Kab.Deliserdang, Selasa (18/3). Informasi Waspada peroleh, korban Susilawati, 42, dan dua anaknya Raudhatul Zhara, 10, dan Khairurah Ziqin, 6, warga Kel. Tanjungmorawa Pekan mengendarai kereta Vario BK 6691 AEE, hendak mengantar anaknya ke sekolah. Namun, satu Toyota Yaris BK 47 AR warna putih dikemudikan Kompol SH Boru Bakara, 40, warga Medan Amplas, yang datang dari arah Medan menuju Tebingtinggi berupaya mendahului mobil di depannya. Korban yang membonceng dua anaknya dari arah berlawanan berusaha menghindar. Diduga tidak mampu mengendalikan kendaraannya, korban berbelok ke arah kanan, sehingga mobil yang ada di depan mobil Yaris menabrak korban.Tetapi, sopir mobil tersebut langsung tancap gas meninggalkan lokasi kejadian. Akibat kejadian itu, Susilawati dan anaknya Khairurah Ziqin tewas di tempat. Raudhatul Zhara menderita luka lecet di kepala dan kaki serta tangan. Petugas Sat Lantas Polres Deliserdang yang mendapat informasi turun ke lokasi melakukan olah tempat kejadian perkara (TKP) serta mengamankan kereta korban dan mobil Yaris ke Mapolres Deliserdang. Kapolres AKBP Dicky Patrianegara, SH, SIK melalui Kasat Lantas AKP T Rizal Moelana, SH, SIK membenarkan peristiwa itu. “Mobil yang menabrak dan langsung kabur masih dalam penyelidikan,” jelas Rizal. (c02)

Poldasu Sita ....

darannya agar membuat laporan ke Poldasu. Sementara Kepala Seksi (Kasi) Sarana Dinas Pertanian Sumut Heru Suwondo didampingi stafnya Anita Juli Riska di sela-sela pemeriksaan p e n y i d i k I n d a g Po l d a s u menyebutkan, pupuk merek Phoska dan Super Pospat tidak terdaftar dalam Kementrian Pertanian. ‘’Pupuk palsu itu sama sekali tidak bermanfaat bagi tanaman dan tidak berdampak terhadap tumbuh-tumbuhan atau tanah. Tidak tidak juga merusak karena cuma tanah,” sebutnya.(m27)

China Cari MH370 .... China, Selasa menggiatkan 20 satelit untuk mencari pesawat Malaysia Airlines dengan nomor penerbangan MH370 bersama 239 orang penumpang dan awak, yang hilang, termasuk tujuh warga negara Indonesia. Jurubicara Kementerian Luar Negeri China Hong Lei membuat tanggapan itu pada taklimat harian. China telah mulai pencarian pesawat jet yang hilang di wilayah China yang meliputi koridor utara di mana pesawat bisa itu terbang, kata media pemerintah pada hari sebelumnya. Tidak ada jejak pesawat yang ditemukan setelah lebih dari sepekan lenyap, tetapi para peneliti percaya pesawat tersebut dialihkan oleh seseorang dengan pengetahuan yang mendalam tentang pesaia juga berkonflik dengan Kopilot Ward dan beberapa rekannya yang meragukan kemampuannya memimpin sebagai Kapten Pilot. Hampir sama kasusnya dengan kopilot Egypt Air di atas, Kapten Tsu adalah mantan pilot dan instruktur A-4 Skyhawk Angkatan Udara Singapura, kemungkinan trauma dengan musibah yang menewaskan 4 teman satu skuadronnya ketika latihan terbang rutin, setahun sebelum kecelakaan. Dampak psikologis dari musibah ini diduga mengubah kepribadian Tsu yang berujung pada kecelakaan pesawat SilkAir tersebut. Demikian tulis Wikipedia. Tidak dijelaskan apakah pilot bunuh diri saat kopilot sedang berada di luar kokpit. Setelah kedua peristiwa di atas, kini berkembang spekulasi bahwa hilangnya pesawat Malaysia Airlines MH 370 sejak 8 Maret 2014 kemungkinan akibat bunuh dirinya salah satu pemegang kemudi pesawat itu. Kisahnya tentu ada di dalam kotak hitam pesawat. (m02)

Ada-ada Saja .... Jeddah, Eisha akhirnya meninggal dunia dalam usia 100 tahun, di kamar mandi kediamannya. Para tetangganya mengaku sedih saat melihat ambulans datang ke kediaman Eisha dan mengangkut jasad perempuan tua itu. Namun, para tetangga Eisha kehabisan kata-kata ketika mereka mengetahui Eisha meninggalkan warisan sebesar 3 juta riyal atau Rp 9 miliar, empat buah bangunan di distrik yang sama, dan per h i a s a n b e r n i l a i R p 3 miliar.

M’sia Tuduh RI .... “Indonesia tidak ada perjanjian seperti itu. Justru kita terlibat langsung dengan melibatkan lima KRI dan dua pesawat patroli laut kita,” ujar Deputi VII Menko Polhukam Bidang Koordinasi Komunikasi, Informasi, dan Aparatur (Kominfotur), Marsda TNI Agus R. Barnas, Selasa (18/3). “Kita sudah memberikan (data) radar militer kepada militer Malaysia. Bahkan ada WNI yang ikut dalam pesawat itu. Sekali lagi, tidak ada perjanjian seperti yang dilansir media Malaysia itu,” lanjutnya. Bantahan atas tuduhan itu juga disampaikan oleh Kementerian Luar Negeri RI. Menurut Juru Bicara Kemlu RI Michael Tene, Pemerintah Malaysia tidak menyalahkan siapa-siapa dalam insiden hilangnya Malaysia Airlines MH370.Tene menambahkan, “Mereka justr u meminta bantuan kepada Indonesia dan negara-negara sahabat (untuk mencari Malaysia Airlines). Indonesia pun memberikan bantuan pencarian kepada Malaysia agar pesawat wat dan navigasi komersial. Pilot pendamping (kopilot) pesawat Malaysia yang hilang sempat mengeluarkan katakata terakhir yang terdengar dari ruang kemudi (kokpit), kata kepala eksekutif maskapai penerbangan Malaysia Airlines, Senin. Sementara itu, para penyelidik mempertimbangkan kemungkinan aksi bunuh diri oleh kapten atau petugas utama sebagai salah satu kemungkinan penjelasan hilangnya pesawat tersebut. Tidak ada jejak yang ditemukan sejak pesawat Malaysia Airlines yang mengangkut 239 orang itu lenyap pada 8 Maret lalu. Penyelidik pada saat ini semakin teryakinkan, pesawat dialihkan ribuan mil dari jalurnya oleh seseorang yang sangat paham cara menerbangkan Boeing 777-200ER dan navigasi komersial. Pencarian terhadap pesawat sedang dilakukan dalam skala yang tidak pernah terjadi sebelumnya. Pencarian dilakukan dengan mencakup wilayah yang membentang dari Pantai Laut Kaspia di utara hingga ke wilayah Samudera India bagian selatan. Kepala eksekutif Malaysia Airlines, Ahmad Jauhari Yahya, juga mengatakan dalam jumpa pers bahwa tidak ada kejelasan mengenai kapan salah satu sistem pelacak otomatis pesawat itu dimatikan. Pernyataannya itu tampak bertentangan dengan komentar yang dikeluarkan para menteri pemerintah akhir pekan lalu. Dugaan terjadinya pembajakan atau sabotase telah

Dana Jasa Raharja .... Kita menunggu kepastian dari dinas perhubungan apakah jalan tersebut statusnya jalan umum atau bukan, paparnya. Sementara, Kadis Perhubungan Labura Drs. H. Darwin Yusma ketika dihubungi melalui telepon seluler tidak ada jawaban. (a17)

WASPADA Rabu 19 Maret 2014 Ahmad al-Saedi, yang tumbuh bersama Eisha di distrik yang sama dan menghabiskan banyak waktunya merawat perempuan itu, mengatakan, Eisha tidak memiliki keluarga selain ibu dan saudarinya, yang juga berprofesi sebagai pengemis. Saedi adalah satu dari sedikit orang yang mengetahui kekayaan yang dikumpulkan Eisha. Dia mengatakan berulang kali meminta Eisha untuk berhenti mengemis. Sebelum meninggal, Eisha memberikan semua perhia-

sannya kepada Saedi dan mengatakan agar tetap menyimpan perhiasan itu hingga waktu yang tepat untuk menjualnya. Pesan itu disampaikan Eisha 15 tahun lalu saat koin emas berharga sekitar Rp 750.000 per buah. Namun, kini harga sebuah koin emas mencapai Rp 3 juta. Mer a s a b e r t a n g g u n g jawab, Saedi melaporkan hal ini ke polisi dan pengadilan setempat. Pengadilan menyatakan masalah ini akan diselesaikan sesuai dengan hukum yang berlaku. (k/m09)

jenis Boeing 777-200ER tersebut bisa ditemukan. Kapal Patroli Anis Madu Sisir Perairan Aceh Kapal Patroli Anis Madu Dit Pol Air Baharkam Mabes Polri bersama Satpol Air Polres Langsa melakukan penyisiran untuk mencari pesawat Malaysia Airlinbes MH370 di kawasan laut Selat Malaka sepanjang perairan Aceh Timur-Kota Langsa-Aceh Tamiang - Aceh Utara. Pencarian yang ditujukan di perairan tersebut, menyahuti keterangan nelayan di wilayah itu yang mengaku melihat pesawat berputarputar di kawasan perairan Peureulak, Selasa (18/3). Untuk partisipasi pencarian pesawat Malaysia Airlines MH370 yang hilang kontak tak lama setelah take off dari Bandara Kuala Lumpur menuju Beijing, Sabtu (8/3), Kapal Patroli Anis Madu Dit Pol Air Baharkam, bertolak dari Pelabuhan Kuala Langsa, di mana selama ini kapal tersebut selalu standby untuk memantau perairan di kawasan itu. Komandan Kapal Patroli

Anis Madu Dit Pol Air Baharkam Mabes Polri, Iptu Makmur, didampingi Kasatpol Air Polres Langsa AKP Kasnap mengatakan, pencarian pesawat Malaysia Airlines MH370 difokuskan di kawasan Selat Malaka, antara perairan Aceh Tamiang hingga perairan Aceh Timur dan diperluas hingga ke perairan Aceh Utara. “Hingga kini belum ada tanda-tanda ditemukan atau adanya titik terang keberadaan pesawat asal Malaysia itu. Selama berada di laut sejak Senin - Selasa pagi, pihaknya hanya menemukan sampahsampah bekas kapal laut dan nelayan yang mengapung di tengah laut,” katanya. Namun, terang Makmur, pihaknya berupaya dan melakukan koordinasi kepada semua unsur terkait, baik itu terhadap pemerintah Malaysia maupun informasi-informasi yang beredar di Indonesia, seperti informasi yang diterima dari para nelayan di wilayah kawasan perairan Peureulak, Aceh Timur yang sempat melihat pesawat tersebut berputar-putar. (m43)

kian menyulitkan situasi ketika para pejabat mengatakan, Minggu, bahwa pesan radio terakhir dari pesawat itu -kata-kata informal berupa “baiklah, selamat malam”— terdengar setelah sistem pelacak, yang dikenal sebagai ACARS, dimatikan. Saat itu, komunikasi ke pengendali lalu lintas udara dimatikan pada pukul 01.19 pagi, yaitu ketika pesawat bertujuan ke Beijing tersebut meninggalkan wilayah udara Malaysia. Komunikasi terakhir dari sistem ACARS - komputer pemelihara yang menyambungkan data tentang status pesawat - diterima pada pukul 01.07 pagi ketika pesawat melintasi perairan timur laut Malaysia dan mengarah ke Teluk Thailand. Dutabesar China untuk Malaysia Huang Huikang mengatakan, negaranya mulai melakukan pencarian di daratan koridor utara. Berdasarkan pengecekan latar belakang, katanya, tak ada bukti yang menunjukkan penumpang dari China daratan membajak atau melakukan tindak terorisme di negara itu. Sementara itu Australia mempersempit wilayah pencarian mereka di selatan Samudera India, berdasarkan data satelit dan analisis data kemungkinan pergerakan pesawat. Otoritas Keselamatan

Maritim Australia (AMSA) mengatakan, operasi ini seper t i “mencar i j a r um di tumpukan jerami”. “Analogi yang paling bagus adalah ‘mencari jarum di tumpukan jerami’. Luasnya area pencarian adalah tantangan besar, lebih dar i 600.000 km persegi,” kata manajer AMSA, John Young. AS telah menarik kapal perang USS Kidd mereka dari Laut Andaman karena area pencarian yang luas. Menurut AS, USS Kidd tidak mampu mencakup area seluas itu sehingga akan diganti dengan kapal yang lain, yaitu Poseidon dan Orion. Pesawat penerbangan MH370 diyakini mengubah rute perjalanannya setelah mematikan transponder atau pelacak di kokpit. Pejabat AS seperti dikutip New York Times, perubahan arah pesawat telah diprogram menggunakan sistem navigasi komputer oleh seseorang di kokpit. Jadi, menurut dia, perubahan arah tidak dilakukan secara manual melainkan otomatis setelah dilakukan perubahan di sistem komputer pesawat. Belum diketahui siapa yang melakukannya, apakah pilot, co-pilot atau orang lain di dalam kokpit. (ant/rtr/bbc/m10)

MH370 Tidak ....

m e n d u k u n g ,” k a t a S M . Handoko. Pemberitaan Waspada, Selasa, tiga nelayan asal Seunuddon Aceh Utara mengaku melihat pesawat jatuh, saat sedang melaut di kawasan perairan Peureulak Aceh Timur, Sabtu 8 Maret 2014. Muhammad Adam dan Irham Manyak, kedua nelayan warga Ulee Rubek Barat Kec. Seunuddon dan Sulaiman Yacub, warga Desa Desa Ulee Rubeki Timu, Kecamatan Seunuddon, yakin yang jatuh itu pesawat, namun tidak bisa memastikan jenis pesawatnya. (m32)

“Pihak Lanud Soewondo di Medan terus berupaya mencari jejak-jejak pesawat yang hilang yang mencapai hari ke 10,” kata Handoko. Sekarang sedikitnya ada enam armada jenis F-16 parkir di landasan Lanud Soewondo Medan, kapan diperlukan siap terbang. Namun , dia menjelaskan, selalu memantau perkembangan dan menerima infiormasi akurat. “Kalau tidak naik atau terbang bukan berarti tidak memantau, tapi menunggu informasi akurat, kadang kala cuaca tidak


A2

Berita Utama

WASPADA Rabu 19 Maret 2014

Tiga Hari Kampanye, Pelanggaran Terbanyak Adalah Bawa Anak-anak Waspada/Rudi Arman

KAPOLRESTA Medan Kombes Nico Afinta Karokaro, foto bersama dengan Ketua DPD Partai Golkar Sumut H. Ajib Shah, dan jajaran pengurus Partai Golkar lainnya, Selasa (18/3).

20 Maret, ARB ... kepada masyarakat tentang visi Golkar, yakni Negara Kesejahteraan 2045. Katanya, sampai saat ini, hanya Partai Gokar yang telah memiliki blueprint (cetak biru) pembangunan nasional hingga tahun 2045. Berkaitan dengan pelaksanaan kampanye dengan pengerahan massa yang begitu banyak, Ajib Shah, mengatakan tujuannya bukan untuk

gagah-gagahan. Melainkan sebagai bentuk keseriusan Partai Golkar untuk memenangkan Pemilu Legislatif tahun 2014 ini. Walaupun massa yang dikerahkan terbilang banyak, namun menurut Ajib Shah, Partai Golkar komit untuk tetap mengikuti aturan kampanye yang dibuat KPU. Seperti, tidak membawa anakanak, tidak menggunakan mobil bak terbuka dan tetap menggunakan helm bagi pe-

Dimarahi, Trauma Jadi ... (elevator) pada pesawat jenis 767 tersebut. Hasil investigasi yang berbeda dari kedua negara ini lalu memunculkan perdebatan mengenai penyebab kecelakaan tersebut. Sebuah media Inggris, Sunday Times, mengutip sebuah sumber yang dirahasiakan, berspekulasi bahwa Al-Batouti mengalami trauma perang, karena banyak anggota skuadronnya di Angkatan Udara Mesir terbunuh dalam perang tahun 1973. Fakta lain yang ditemukan, ada 33 orang perwira angkatan bersenjata Mesir di pesawat itu yang baru pulang latihan di AS, sehingga menimbulkan spekulasi bahwa ada konspirasi kelompok teroris Muslim ekstrimis melawan Mesir. Sementara, pihak lain menduga bahwa itu adalah rencana pembunuhan oleh Mossad Israel. Hingga kini, penyebab kecelakaan ini masih diperdebatkan. Demikian tulis National Geographic Channel - Air Crash Investigation. Jatuhnya Silk Air Peristiwa lain yang dikaitkan dengan pilot bunuh diri terjadi terhadap pesawat SilkAir Penerbangan 185 pada 19 Desember 1997. Dalam perjalanan dari Bandara Internasional Soekarno-Hatta, Jakarta, Indonesia ke Bandara Changi, Singapura, pesawat jatuh di atas Sungai Musi, Palembang, Sumatera Selatan. Sebanyak 97 penumpang dan 7 awak kabin tewas, termasuk pilot Tsu Way Ming dari Singapura dan kopilot Duncan Ward dari Selandia Baru. Investigasi kecelakaan ini dilakukan oleh Komisi Nasional Keselamatan Transportasi Indonesia bersama dengan tim ahli dari NTSB Amerika, Singapura, dan Australia. Pada tanggal 14 Desember 2000, KNKT mengeluarkan laporan yang menya-takan bahwa penyebab kecelakaan tidak dapat diketahui (undetermined). Namun, NTSB memiliki pendapat yang berbeda. Menurut mereka, kecelakaan ini disebabkan oleh tindakan Kapten Tsu yang sengaja menjatuhkan pesawatnya ke laut (bunuh diri). Menurut beberapa sumber, kemungkinan penyebab Kapten Tsu melakukan tindakan tersebut antara lain: Masalah keuangan keluarga, dimana ia dilaporkan mengalami kerugian dalam investasi keuangan, dan hutang tagihan kartu kreditnya yang lebih besar dari kemampuannya membayar (terutama diakibatkan dari pengeluaran keluarganya yang lebih besar dari gajinya sebagai pilot). Kapten Tsu membeli polis asuransi beberapa hari sebelum kejadian (pada hari kecelakaan, jaminan perlindungan dari polisnya mulai berlaku), sehingga ia melakukan tindakan menjatuhkan pesawat tersebut untuk mendapatkan uang santunan asuransi sebagai pengganti kerugian investasinya sebelumnya. Ia juga dilaporkan beberapa kali mendapat teguran disiplin dari SilkAir, termasuk satu tindakan yang berkaitan dengan memanipulasi sekring dari perekam suara kokpit (CVR), Laporan lain mengatakan ia juga berkonflik dengan Kopilot Ward dan beberapa rekannya yang meragukan kemampuannya memimpin sebagai Kapten Pilot. Hampir sama kasusnya dengan kopilot Egypt Air di atas, Kapten Tsu adalah mantan pilot dan instruktur A-4 Skyhawk Angkatan Udara Singapura, kemungkinan trauma dengan musibah yang menewaskan 4 teman satu skuadronnya ketika latihan terbang rutin, setahun sebelum kecelakaan. Dampak psikologis dari musibah ini diduga mengubah kepribadian Tsu yang berujung pada kecelakaan pesawat SilkAir tersebut. Demikian tulis Wikipedia. Tidak dijelaskan apakah pilot bunuh diri saat kopilot sedang berada di luar kokpit. Setelah kedua peristiwa di atas, kini berkembang spekulasi bahwa hilangnya pesawat Malaysia Airlines MH 370 sejak 8 Maret 2014 kemungkinan akibat bunuh dirinya salah satu pemegang kemudi pesawat itu. Kisahnya tentu ada di dalam kotak hitam pesawat. (m02)

Ada-ada Saja ... Setelah lebih dari 50 tahun mengemis di jalanan kota Jeddah, Eisha akhirnya meninggal dunia dalam usia 100 tahun, di kamar mandi kediamannya. Para tetangganya mengaku sedih saat melihat ambulans datang ke kediaman Eisha dan mengangkut jasad perempuan tua itu. Namun, para tetangga Eisha kehabisan kata-kata ketika mereka mengetahui Eisha meninggalkan warisan sebesar 3 juta Jawaban Problem Catur, riyal atau Rp 9 miliar, empat buah bangunan di distrik yang TTS Dan Sudoku sama, dan perhiasan bernilai Dari Halaman Sport. Rp 3 miliar. Ahmad al-Saedi, yang tumbuh bersama Eisha di distrik Jawaban Problem Catur: yang sama dan menghabiskan banyak waktunya merawat 1. Gc5+, Md6 perempuan itu, mengatakan, Eisha tidak memiliki keluaratau Me7. ga selain ibu dan saudarinya, yang juga berprofesi sebagai 2. GxM+mat. pengemis. “Mereka dulu menarik simpati para dermawan, terutama Jawaban TTS: pada saat Idul Fitri. Eisha terus mengemis setelah ibu dan TTS Kesehatan saudarinya meninggal dunia. Dia hanya seorang perempuan tua, buta, dan tidak memiliki keluarga di dunia ini,” kata Saedi yang memakamkan Eisha di pemakaman Ummana Hawwa, di kawasan Al-Ammariya. Saedi adalah satu dari sedikit orang yang mengetahui kekayaan yang dikumpulkan Eisha. Dia mengatakan berulang kali meminta Eisha untuk berhenti mengemis. (k/m09)

ngendara kereta. ‘’Partai Golkar akan berusaha patuh terhadap peraturan. Benar, kita (Golkar) ingin mengerahkan massa yang banyak, tapi tetap mematuhi aturan. Golkar berusaha menjadi yang terbaik dalam melaksanakan Pemilu. Apa yang dilarang akan kita ikuti. Golkar ingin kampanye ramai, tapi tidak melanggar aturan,’’ kata Ajib Shah. Koordinasi Dengan Polres Karena ingin melaksanakan kampanye yang tertib, kata Ajib Shah, pihaknya juga sudah berkoordinasi dengan pihak Polresta Medan. Pengurus Partai Golkar, Selasa (18/ 3), bertemu langsung dengan Kapolresta Medan Kombes Pol Nico Afinta Karokaro. Dalam pertemuan yang juga dihadiri Ketua DPD Partai Golkar Medan H.M. Syaf Lubis, Kapolresta Nico Afinta, mengaku siap melakukan koordinasi dengan seluruh Parpol terkait upaya mewujudkan keamanan. Baik saat kampanye berlangsung maupun sesudahnya. Pada kesempatan itu, Nico mengimbau kepada pimpinan Parpol agar sama-sama menjaga kekondusifan dan keamanan selama masa kampanye berlangsung. Polisi, kata dia, akan menindak peserta kampanye yang tidak tertib berkendaraan saat menghadiri kampanye. ‘’S esuai aturan, massa kampanye juga dilarang menaiki mobil bak terbuka saat berkampanye. Sedangkan pengendara kereta diwajibkan tetap memakai helm. Kami (kepolisian) beharap semua pihak perlu bersama-sama menjaga agar Pemilu Legislatif ini berjalan aman dan lancar,” katanya. (m12/m39)

MH370 Tak Terpantau ... “Pihak Lanud Soewondo di Medan terus berupaya mencari jejak-jejak pesawat yang hilang,” kata Handoko. Sekarang sedikitnya ada enam armada jenis F-16 parkir di landasan Lanud Soewondo Medan, kapan diperlukan siap terbang. Namun , dia menjelaskan, selalu memantau perkembangan dan menerima informasi akurat. “Kalau tidak naik atau terbang bukan berarti tidak memantau, tapi menunggu informasi akurat, kadang kala cuaca tidak mendukung,” kata SM. Handoko. Pemberitaan Waspada, Selasa, tiga nelayan asal Seunuddon Aceh Utara mengaku melihat pesawat jatuh, saat sedang melaut di kawasan perairan Peureulak Aceh Timur, Sabtu 8 Maret 2014. Muhammad Adam dan Irham Manyak, kedua nelayan warga Ulee Rubek Barat Kec. Seunuddon dan Sulaiman Yacub, warga Desa Desa Ulee Rubeki Timu, Kecamatan Seunuddon, yakin yang jatuh itu pesawat, namun tidak bisa memastikan jenis pesawatnya. Sisir Perairan Aceh Kapal Patroli Anis Madu Dit Pol Air Baharkam Mabes Polri bersama Satpol Air Polres Langsa melakukan penyisiran untuk mencari pesawat MH370 di kawasan laut Selat Malaka sepanjang perairan Aceh Timur-Kota LangsaAceh Tamiang - Aceh Utara. Pencarian yang ditujukan di perairan tersebut, menyahuti keterangan nelayan di wilayah itu yang mengaku melihat pesawat berputar-putar di kawasan perairan Peureulak, Selasa (18/3). Komandan Kapal Patroli Anis Madu Dit Pol Air Baharkam Mabes Polri, Iptu Makmur, didampingi Kasatpol Air Polres Langsa AKP Kasnap mengatakan, pencarian pesawat Malaysia Airlines MH370 difokuskan di kawasan Selat Malaka, antara perairan Aceh Tamiang hingga perairan Aceh Timur dan diperluas hingga ke perairan Aceh Utara. “Hingga kini belum ada tanda-tanda ditemukan atau adanya titik terang keberadaan pesawat asal Malaysia itu. (m32/m43)

Al Bayan ...

Jawaban Sudoku:

1 4 2 3 5 6 8 7 9

3 5 8 7 2 9 4 1 6

9 6 7 1 4 8 3 5 2

4 7 1 9 8 3 6 2 5

5 2 3 4 6 1 9 8 7

6 8 9 5 7 2 1 3 4

7 1 5 6 3 4 2 9 8

8 9 6 2 1 5 7 4 3

2 3 4 8 9 7 5 6 1

Pertama yang bukan dari Islam adalah budaya pacaran antara pemuda dan pemudi berdua-duaan di tempat yang sepi. Islam sangat melarang hal yang demkian. Rasulullah bersabda: Jangan berdua-duaan, nanti setan menjadi orang yang ketiga (HR: Bukhari). Dalam hadis lain Rasulullah bersabda: Lebih baik menyentuh kulit babi daripada menyentuh kulit lawan jenis yang bukan mahramnya (HR: Muslim). Di situlah letak tanggungjawab orang tua untuk menjaga putra-putri mereka dari penyakit yang datang dari barat ini. Musik dan nyanyian juga bukan dari Islam. Islam mengharamkan pendapatan yang mereka dapat dari musik dan nyanyian. Dalam hadis Rasulullah bersabda: Pendapatan para penyanyi (biduan) adalah haram (HR: Bukhari). Kata Ibnu Taimiyah; Imam Empat Mzhab, Hanafi, Malaiki, Syafi’Ii dan Hambali sepakat nyanyian itu haram hukumnya. Selain haram alat music juga sangat haram para penyanyi yang membuka auratnya di depan

MEDAN (Waspada): Ketua Badan Pengawas Pemilihan Umum (Bawaslu) Sumatera Utara, Syafrida R. Rasahan mengemukakan, dalam tiga hari pelaksanaan kampanye belum ada mengarah pidana. Namun sesuai informasi dari berbagai daerah, pelanggaran terbanyak adalah membawa anak-anak. Hal itu dikemukakan Syafrida usai membuka rapat koordinasi Sentra Penegakan Hukum Terpadu (Gakkumdu) Pemilu 2014, di Hotel Grand Angkasa Medan, Selasa (18/3). Menurutnya, pelanggaran kampanye seperti membawa anak-anak dilakukan oleh semua Parpol yang berkampanye dalam tiga hari ini. Sedangkan pelanggaran lainnya adalah kampanye di luar jadwal dan pembagian selebaran.

‘’Hampir semua Parpol yang berkampanye mulai hari pertama dan ketiga melakukan pelanggaran, yakni dengan membawa anak-anak,’’ katanya. Undang-Undang No. 23, Pasal 87 tentang perlindungan anak, lanjutnya, sudah menyatakan, anak-anak tidak boleh dieksploitasi demi kepentingan politik. Meskipun itu, secara tidak sadar orang tua membawa anaknya dengan alasan membawa anaknya karena tidak ada yang menjaga di rumah. Menjawab pertanyaan bagaimana ‘menjerat’ calon legislatif (Caleg) yang nakal, Syafrida mengatakan, bahwa undang-undangnya sudah jelas. Memberikan dan menjanjikan sesuatu ancamannya sudah jelas, tetapi terbentur pada adanya syarat kumulatif. Syarat kumulatif itu, harus ada ajakan,

harus ada visi-misi dan harus ada barang yang memang mereka berikan. Sebelumnya, dalam pembukaan Rakor yang dihadiri unsur Poldasu dan Kejatisu, komisioner KPU Sumut Benget Silitonga, komisioner Bawaslu Aulia Andri dan Herdie Munthe, Sekretaris Bawaslu Iwan Tero serta Panwas kabupaten/ kota di Sumut, Syafrida mengemukakan, diharapkan kepada penyidik, kejaksaan dan Panwas di daerah lebih sering berkumpul. Hal ini guna menghindarkan terjadinya koordinasi hanya ketika terjadi masalah. Secara terpisah, Ketua Panwaslu Kota Medan, Teguh Satyawira, yang dihubungi terkait pelanggaran selama tiga hari kampanye di wilayah Medan, menyebutkan, adalah membawa anakanak dalam kampanye. (m34)

Terkait Pengungsi Sinabung:

KPU Koordinasi Dengan BNPB Guna Pendataan Kembali MEDAN (Waspada): Proses pemulangan pengungsi Gunung Sinabung mengharuskan penyelenggara Pemilu (Komisi Pemilihan Umum) melaksanakan pendataan kembali warga yang menjadi pemilih. Komisioner KPU Sumut Benget Silitonga, Selasa (18/3) kepada wartawan mengungkapkan, terkait pengungsi Gunung Sinabung, KPU telah berkoordinasi dengan Badan Nasional Penanggulangan Bencana (BNPB).

“Kepada BNPB, KPU menyampaikan jika bisa pengembalian para pengungsi tidak lagi dilakukan dua minggu sebelum pemungutan suara. Namun, BNPB mengatakan, hal itu tergantung alam,”kata Benget. Namun, dia mengakui, situasi dan kondisi itu jelas menjadi persoalan baru bagi KPU. Apalagi KPU telah melakukan pendataan dan pemetaan terhadap pemilih yang mengungsi. ‘’Tapi, KPU

tetap siap mengantisipasi kemungkinan terburuk yang terjadi hingga hari H pemungutan suara nanti,’’katanya. Menurut dia lagi, rencana kebijakan menyangkut penanganan Pemilu di pengungsian akan diputuskan 2 Pekan sebelum pemungutan suara pada 9 April. “KPU siap menghadapi kemungkinan terburuk. Nanti dua pekan sebelum hari pemungutan akan diputuskan bagaimana skenarionya,”ujar dia. (m34)

Laka Lantas Di T. Morawa Tewaskan Ibu Dan Anak TANJUNGMORAWA (Waspada): Seorang ibu dan anaknya tewas akibat kecelakaan lalu lintas (laka lantas) di Jalan Lintas Sumatera (Jalinsum) Medan-Tanjungmorawa, Kilometer 14,4, Desa Bangunsari, Kec. Tanjungmorawa, Kab. Deliserdang, Selasa (18/3).

Informasi Waspada peroleh, korban Susilawati, 42, dan dua anaknya Raudhatul Zhara, 10, dan Khairurah Ziqin, 6, warga Kel. T.Morawa Pekan mengendarai kereta Vario BK 6691 AEE, hendak mengantar anaknya ke sekolah. Namun, satu Toyota Yaris

Kader Partai ...

wa suaminya belum kembali ke rumah selama beberapa hari,” ujar kapolres. Hingga saat ini, belum ada titik terang di mana keberadaan Darmuni. Namun, aparat kepolisian sudah turun mencari korban. Selain itu, Gatot menambahkan, pihak kepolisian masih memeriksa saksi. Kasus ini menambah satu lagi ketegangan di Aceh jelang pemilu. Sebelumnya, Posko Partai NasDem di Matangkuli, Aceh Utara, ditembaki dua pria Minggu lalu. (b.15/vvn)

pemilu. Namun, dia dan kader PNAyanglainmendugaDarmuni diculik karena persoalan politik. Tersirat dari pengurus partai kami bahwa ini ada kaitannya dengan politik,” kata Sofyan. Sementara itu, Kepala KepolisianResor(Kapolres)AcehUtara, AKBP Gatot Sujono saat dikonfirmasi membenarkan adanya laporan hilangnya kader PNA tersebut. “Laporanyangdibuatpelapor (istri Darmuni) menyatakan bah-

Poldasu Sita ... Sementara Kepala Seksi (Kasi) Sarana Dinas Pertanian Sumut Heru Suwondo didampingi stafnya Anita Juli Riska di sela-sela pemeriksaan penyidik Indag Poldasu menyebutkan, pupuk merek Phoska dan Su-

Indonesia Dituduh ... membeberkan hal ini karena punya kesepakatan dengan Amerika. Hal ini ditanggapi santai oleh pemerintah Indonesia. Staf Khusus Kemhan Bidang Luar Negeri Sumardi Brotodiningrat menyatakan dugaan mengenai keterlibatan Indonesia sangat lucu, padahal sudah jelas Pemerintah malah membantu proses pencarian pesawat 227 penumpang tersebut. “Loh kita kan membantu mereka, salah satu dari 25 negara yang bantu mencari, sampai sekarang,” kata Sumardi di ruang Palapa Kemhan, Jl. Medan Merdeka Barat no 13-14,

Pilot Simpatisan ... Anwar menduga spekulasi itu hanya untuk menutupi ketidakmampuan pemerintah dan berusaha mengalihkan perhatian dari krisis hilangnya pesawat MH370. Namun, para pejabat pemerintah Malaysia menolak merespon komentar Anwar. Sementara Selasa (18/3), Menteri Perhubungan Hishammuddin Hussein kepada wartawan mengatakan, spekulasi hilangnya pesawat yang dikaitkan dengan hukuman Anwar datang dari media asing, bukan dari pemerintah. (m10)

umum. Kontes ratu-ratuan; Ratu cantik, miss lokal, negara, dunia, semua adalah haram dan bukan dari Islam. Setiap lomba yang menampilkan perempuan adalah haram. Allah berfirman: Katakanlah kepada orang laki-laki yang beriman: “Hendaklah mereka menahan pandangannya, dan memelihara kemaluannya; yang demikian itu adalah lebih suci bagi mereka, sesungguhnya Allah Maha Mengetahui apa yang mereka perbuat”. Katakanlah kepada wanita yang beriman: “Hendaklah mereka menahan pandangannya, dan memelihara kemaluannya, dan janganlah mereka menampakkan perhiasannya, kecuali yang (biasa) nampak daripadanya. Dan hendaklah mereka menutupkan kain kudung ke dadanya…(QS. An-Nur:30-31). Dalam hadis Rasulullah bersabda: Perempuan tabaruj (yang membuka aurat), tidak dapat mencium bau surga (HR:Ahmad). Olahraga zaman sekarang banyak yang menampakkan aurat dan mengandung kekerasan juga haram bagi umat Islam.

per Pospat tidak terdaftar dalam Kementrian Pertanian. ‘’Pupuk palsu itu sama sekali tidak bermanfaat bagi tanaman dan tidak berdampak terhadap tumbuh-tumbuhan atau tanah. Tidak tidak juga merusak karena cuma tanah,” sebutnya. (m27)

BK 47 AR warna putih dikemudikan Kompol SH Boru Bakara, 40, warga Medan Amplas, yang datang dari arah Medan menuju Tebingtinggi berupaya mendahului mobil di depannya. Korban yang membonceng dua anaknya dari arah berlawanan berusaha menghindar. Diduga tidak mampu mengendalikan kendaraannya, korban berbelok ke arah kanan, sehingga mobil yang ada di depan mobil Yaris menabrak korban. Akibat kejadian itu, Susilawati dan anaknya Khairurah Ziqin tewas di tempat. Raudhatul Zhara menderita luka lecet di kepala dan kaki serta tangan. Petugas Sat Lantas Polres Deliserdang yang mendapat informasi turun ke lokasi melakukan olah tempat kejadian perkara (TKP) serta mengamankan kereta korban dan mobilYaris ke Mapolres Deliserdang. Kapolres AKBP Dicky Patrianegara, SH, SIK melalui Kasat Lantas AKP T Rizal Moelana, SH, SIK membenarkan peristiwa itu. “Mobil yang menabrak dan langsung kabur masih dalam penyelidikan,” jelas Rizal. (c02)

Jakarta Pusat, Senin (17/3). Menurut Sumardi, dirinya malah heran dengan tudingan dari Malaysia tersebut. Tim yang ikut membantu pencarian pesawat yang hilang sejak Sabtu (8/3) lalu, belum ada yang menuai hasil. Lanjut Sumardi, tudingan itu harus dijelaskan secara jelas keterlibatan Indonesianya. “Saya belum tahu apaapa, saya mengamati terus, kita belum tahu pesawatnya di mana,” tandasnya. Lihat Lagi Malaysia meminta Indonesia untuk melihat lagi data satelit dan radar yang dimilikinya guna mencari kemungkinan keberadaan pesawat Malaysia Airlines MH370. Sebelumnya, Menteri Pertahanan Purnomo Yusgiantoro menyatakan tidak ada perkembangan baru dalam upaya pencarian itu. “Saya sudah berbicara dengan Bapak Purnomo (Menteri Pertahanan RI) yang mengatakan tidak ada perkem-

bangan baru. Namun kami meminta untuk dilihat lagi, bukan hanya data satelit namun juga data lain yang mereka miliki,” kata Menteri Pertahanan Malaysia Hishammuddin Hussein dalam jumpa pers di Hotel Sama Sama KLIA, Sepang, Selasa (18/3). Demikian pula kepada sejumlah negara, Pemerintah Malaysia meminta agar mereka melihat lagi data radar militernya. Dalam pencarian pesawat MH370 ini, Indonesia dan Australia memimpin operasi pencarian di koridor Selatan di masing-masing wilayah mereka. Sedangkan China dan Kazakhstan sepakat untuk memimpin pencarian di koridor utara. Sementara itu, operasi pencarian sudah mencakup area seluas 2,24 juta mil laut persegi di kedua koridor itu. “Ini area yang sangat luas dan Malaysia tidak bisa melakukannya sendiri. Kami butuh bantuan internasional,” katanya. (mc/m13)

Waspada/Ist.

GUBSU H Gatot Pujo Nugroho dan Wamen ESDM Susilo Siswoutomo membahas krisis gas da listrik di Sumut dalam kunjungan kerja Wamen di Medan, Selasa (18/3).

Gubsu- Wamen ESDM Bahas Krisis Gas Dan Listrik Sumut MEDAN (Waspada): Pertemuan antara Gubsu H.Gatot Pujo Nugroho dan Wakil Menteri Energi Sumberdaya dan Mineral (ESDM), Susilo Siswoutomo di Medan, Selasa (18/3), menyetujui pembangunan LNG mini untuk mengatasi krisis gas industri di Sumut. Selain itu, juga dibahas masalah krisis listrik. Pada pertemuan itu, Gubsu didampingi Asisten I Perekonomian dan Perencanaan Sabrina, Kepala Dinas Pertambangan dan Energi Sumut Binsar Situmorang, Mega Pratiwi bagian pejualan dan administrasi PT PGN, Kartini Teti serta Romel Manurung Bagian Operasi Pemeliharaan SBU 3 PT PGN. Susilo Siswoutomo menjelaskan, kedatangan untuk melakukan identifikasi masalah energi yang terjadi di Sumut. Sekaligus mengetahui bagaimana soal pasokan gas dan bagaimana distribusinya. Hasilnya, kata dia, akan dibawa ke Jakarta dan dilakukan percepatan serta dicari bagaimana solusinya. Sementara, Gubsu menjelaskan, kebutuhan gas di Sumut saat ini mencapai 220 MMSCFD sementara pasokan yang ada hanya 9 MMSCFD. Menurutnya ketersediaan gas dan kebutuhan gas di Sumut

sangat jomplang (tidak sebanding-red), dari 9 MMSCFD ke 220 MMSCFD sangat jauh. Dia mengandaikan, kalau saja Sumut ada 12 MMSCFD yang diharapkan dari Kab. Langkat sudah lumayan. Sementara di Kab. Labuhanbatu Utara (Labura) gas yang dipasok baru tahap eksplorasi. Belum lagi gas di Arun yang notabene dijanjikan Pertagas rampung akhir 2014. Asisten Ekonomi dan Pembangunan Provsu, Sabrina dalam pertemuan itu mengatakan, Pemprov Sumut meminta agar gas yang ada di Lampung dipulangkan lagi ke Sumut. Namun, hal itu ditolak karena persiapan di Lampung sudah hampir rampung. Padahal, gas terapung itu menghasilkan gas 240 MMSCFD. Selain persoalan gas, katanya, keluhan yang disampaikan soal pemadaman yang dilakukan PLN akibat defisit energi listrik. Dalam pertemuan itu terungkap ada dua hal yang jadi problem soal listrik seperti izin perusahaan swasta untuk mikro hidro yang belum beroperasi. Kendala listrik mikro hidro, ternyata setelah dicari tahu, problemnya karena perusahaan belum menemukan founding yang siap membiayai dan perihal ketidakcocokan harga. (m28)

Pemprovsu Turunkan Pajak Kendaraan Baru 5 % MEDAN (Waspada): Pemerintah melalui Dinas Pendapatan Daerah (Dispenda) Sumut menurunkan pajak bea balik nama kendaraan bermotor untuk penyerahan pertama (BBNKB I) dari 15 persen menjadi 10 persen. “Dengan penurunan tarif pajak hingga 5 persen diharapkan pertumbuhan kendaraan di Sumut meningkat, sehingga pendapatan daerah juga meningkat,” kata Kadispenda Sumut Razali saat membahas penurunan pajak dengan para Ka. UPT Samsat se-Sumut dan para dealer kendaraan di Medan, kemarin. Acara dihadiri Direktur Dit Lantas Poldasu Kombes Pol. Agus Sukamso. Saat ini,katanya, masyarakat cenderung membeli kendaraan baru di luar Sumut yang mengenakan pajak BBNKB I sebesar 10 persen. Mereka kemudian melakukan balik nama (BBNKB II) di Sumut, sehingga Sumut hanya mendapat bagian 1 persen dari pajak kendaraan. ‘’ Bahkan, banyak di antaranya tidak melakukan BBNKB II sehingga Sumut hanya menerima populasi kendaraan saja,’’ katanya dan merinci turunnya market otomotif pada 2011 sebesar 4,2 persen menjadi 3,4 persen pada 2012, dan turun menjadi 3,0 persen pada 2013. ‘’ Hal itu berbanding terbalik dengan provinsi lain yang mengenakan pajak 10 persen,” sebutnya. Menurut Razali, Pemprovsu menargetkan penerimaan pajak 2014 dari sektor BBNKB sebesar Rp1.749.818.556.078, di mana realisasi hingga 13 Maret hanya Rp319.084.808.534 (18.23 %), padahal target yang dicapai seharusnya Rp376.210.989.556 (21,5%). Hal itu menunjukkan masih dibutuhkan penanganan lebih konkrit dari seluruh pemangku kepentingan (stake holder). Sesuai kapasitas Pemda, salah satunya mengevaluasi faktor pajak daerah, khususnya pengenaan tarif melalui Peraturan Gubernur No. 6/2014 tentang pemberian keringanan tarif BBNKB I. Dalam Pergub itu disebutkan pemberian keringanan sesuai pasal I adalah dari tarif 15 persen menjadi 10 persen. Selain itu untuk kendaraan bermotor, alat-alat berat dan besar diberikan keringanan dari tarif 0,75 persen menjadi 0,50 persen. Dengan penurunan itu Pemprovsu kehilangan pendapatan sebesar 33,3 persen, namun tertutup dengan kenaikan penjualan kendaraan, sehingga struktur pendapatan tetap stabil. Lebih murah Direktur Dit Lantas Poldasu Kombes Pol. Agus Sukamso mengatakan, menurunnya pembelian kendaraan di Sumut salah satunya karena tingginya pajak. “Ada selisih penurunan hingga 20 ribu kendaraan, tetapi jumlah kendaraan di Sumut bertambah terus dengan nomor plat luar Sumut,” kata dia. Mewakili pihak dealer, Arista mengatakan dengan keringanan pajak BBNKB I, pertumbuhan penjualan otomotif di Sumut dapat meningkat. (m27)


WASPADA Rabu, 19 Maret 2014

A3


Medan Metropolitan

A4

WASPADA Rabu 19 Maret 2014

Kasus Penipuan Deposito

Oknum Pegawai Bank Sumut Mengaku Terlilit Utang

Waspada/Rudi Arman

KASAT Reskrim Kompol Jean Calvijn Simanjuntak (kiri) menunjukkan barang bukti Surat Deposito Berjangka saat ekspos di Polresta Medan, Selasa (18/3).

MEDAN (Waspada): Tersangka RAN SE, AK, yang ditangkap polisi dalam kasus penipuan dengan membuat bilyet deposito palsu Bank Sumut mengaku menipu korban sebesar Rp600 juta untuk membayar utang kepada tujuh temannya. “Setelah kita periksa tersangka RAN mengaku melakukan aksi ini untuk membayar utang kepada ketujuh orang rekan-rekannya,” ujar Kasat Reskrim Polresta Medan Kompol Jean Calvijn Simanjuntak saat ekspos di Polresta Medan, Selasa (18/3).

Menurut Calvijn, pihaknya belum bisa menyebutkan siapa ketujuh rekan tersangka ini. “Bisa saja ketujuh rekan ini merupakan karyawan dari Bank Sumut,” sebutnya. Kata dia, uang sebesar Rp600 juta yang sudah diperoleh dari pelapor H Abdul Aziz Nasution Rp500 juta dan Mira Afrida Rp100 juta, tersangka RAN mengaku telah menggunakan uang Rp101 juta dan sisa lainnya untuk membayarkan utang kepada tujuh rekannya. “Uang Rp600 juta dari hasil penipuan dan penggelapan ha-

nya Rp101 juta yang diperoleh tersangka. Sisanya untuk membayarkan utang kepada ketujuh rekannya itu,” kata Calvijn. Tersangka RAN, kata dia, dikenakan pasal berlapis tentang penipuan dan penggelapan yakni Pasal 378 Subs Pasal 372 dan Pasal 379 KUHPidana dengan ancaman lima tahun penjara. Ditawari Kompol Jean Calvijn menceritakan kronologis kejadian, bermula ketika tersangka RAN menawarkan kepada kedua korban, apabila menyimpan

dan memasukkan uang ke Bank Sumut sebagai simpanan deposito maka korban akan mendapatkan bunga sebesar 8 persen per tahunnya. Karena tergiur, kedua korban menyerahkan uang kepada tersangka di Kantor Pusat Bank Sumut Jln. Imam Bonjol Medan, pada 3 Februari 2014 sekira pukul 14:00. Setelah itu, kedua korban mendapatkan satu lembar kertas Surat Deposito Berjangka atas nama masingmasing korban. Setelah menerima uang dari korban, tersangka tidak men-

daftarkan simpanan deposito tersebut ke Bank Sumut, sampai kasus ini dilaporkan ke Polresta Medan sesuai LP/344/K/II/ 2014/SPKT Resta Medan, tanggal 8 Februari 2014. “Dari tersangka kita sita barang bukti satu lembar kertas Surat Deposito Berjangka oleh Bank Sumut atas nama Abdul Aziz Sitorus dan satu lembar kertas Surat Deposito Berjangka oleh Bank Sumut atas nama Mira Afrida,” tutur Calvijn. Sementara itu, tersangka RAN kepada wartawan hanya mengatakan soal penangkapan

dirinya yang dilakukan oleh petugas kepolisian. “Saya diundang datang ke rumah makan di kawasan Jln. Wajir oleh pelapor. Setelah datang polisi menangkap saya. Saya dan pelapor masih ada hubungan saudara. Sisa uang Rp101 juta sudah habis buat kebutuhan pribadi,” kata RAN. RAN mengaku tidak ada niat melarikan diri dan siap mengganti uang milik korban yang dipakainya. Bahkan pimpinannya juga mengetahui dan memintanya untuk mengganti uang yang terpakai. (m39)

Peredaran Narkoba Modus Baru Terbongkar Polisi Tangkap Empat Tersangka Dan Sita Sabu Senilai Rp7 Juta MEDAN (Waspada): Tim Khusus Reskrim Polsek Medan Baru berhasil membongkar kasus peredaran narkoba dengan modus baru, Selasa (18/3) dinihari. Dalam menjalankan aksinya, para pelaku menyimpan narkoba jenis sabu di balik plaster pembalut luka. Dalam penggerebekan di dua lokasi terpisah, polisi menangkap tersangka, KS, 42, penduduk Jln. Bahagia, Kel. Titi Rante, Kec. Medan Baru; JFB, 20, penduduk Jln. Jahe, Perumnas Simalingkar, Kel. Mangga, Kec.

Medan Tuntungan; ASL, 25, penduduk Jln. Ngumban Surbakti dan BAP, 24, penduduk Jln. Letjen Jamin Ginting, Kel. Lauci, Kec. Medan Tuntungan. Selain itu, polisi menyita barang bukti enam paket sabu senilai Rp7 juta yang ditempel pada plaster pembalut luka. Kemudian, ratusan plastik kecil untuk kemasan sabu, timbangan elektrik, enam mancis, lima handphone, tiga pipet kaca, pisau, sepedamotor Kawasaki Ninja warna hitam BK 4201 AD dan Supra Fit BK 5462 UQ, uang Rp66.000 dan lainnya. Sedangkan bandar sabu berinisial Kb, kini sudah masuk dalam Daftar

Pencarian Orang (DPO). Informasi yang diperoleh Waspada di lapangan, terbongkarnya kasus tersebut setelah Kanit Reskrim Polsek Medan

Baru Iptu Alexander P, SH bersama Panit I Reskrim Arjuna Bangun, S.Sos dan Panit II Reskrim Ipda Timbul Pakpahan, SH, mendapat informasi dari mas-

yarakat tentang modus baru peredaran narkoba jenis sabu. Setelah itu, Iptu Alexander P, SH berkoordinasi dengan Kapolsek Medan Baru Kompol

Jamin Ginting Medan, tidak jauh dari perumahan Citra Garden. Setelah itu, polisi menangkap tersangka ASL di rumah kosnya Jln. Ngumban Surbakti dengan barang bukti dua paket sabu. Sedangkan tersangka BAP ditangkap di Jln. Letjen Jamin Ginting dengan barang bukti sepedamotor milik bandar narkoba. Kapolsek Medan Baru Kompol Nasrun Pasaribu, SH, SIK, MH mengatakan, dalam men-

jalankan aksinya, para pelaku menyimpan sabu di balik plaster pembalut luka. Plaster tersebut ditempelkan pada tangan, seolah-olah menutupi luka. Setelah bertemu dengan pembeli, pelaku menyerahkan plaster dan sabu tersebut. Mereka menganjurkan agar plaster tersebut ditempel pada tangan sehingga tidak diketahui polisi. “Saat ini, polisi sedang memburu bandar narkoba dengan modusbarutersebut,”ujarnya.(m36)

Tidak Sejalan Pelayanan JKN

Indonesia Kekurangan Dokter

Langgar Lalin

25 Sepedamotor Ditahan MEDAN (Waspada): Direktorat Lalu Lintas Polda Sumut menahan 25 unit sepedamotor karena melakukan pelanggaran lalulintas (lalin) saat melintas di sepanjang Jln. Kapten Sumarsono (Pondok Kelapa) hingga simpang pos Jln. Djamin Ginting, Selasa (18/3). Selain sepedamotor, petugas menyita 8 Surat Izin Mengemudi (SIM) dan 10 Surat Tanda Nomor Kendaraan (STNK). “Penindakan dilakukan secara hunting oleh tim gabungan Subdit Gakkum dan Patroli Jalan Raya Ditlantas, diutamakan bagi pengendara yang tidak memakai helm, melawan arus dan berbonceng tiga. Selain ditilang, sepedamotornya juga ditahan,” ujar Direktur Dit Lantas Poldasu Kombes Pol. Agus Sukamso melalui Kasigar Subdit Gakkum Kompol Siswandi. Dia menyebutkan, penyitaan sepedamotor bila pengendara tidak memakai helm, tidak memiliki SIM atau STNK. “Penyitaan dilakukan selain penerapan pasal Pelanggaran di Undang Undang Nomor 22 tahun 2009, juga diatur dalam Peraturan Pemerintah Nomor 80 tahun 2012 tentang tatacara pemeriksaan kendaraan,” sebutnya. Kata Siswandi, penyitaan kendaraan harus berdasarkan pelaku pelanggaran tidak miliki STNK atau SIM. Kemudian karena teknis dan faktor laik jalan, kendaraan merupakan hasil tindak kejahatan dan digunakan untuk melakukan tindak pidana serta terlibat kecelakaan lalulintas. Seluruh sepedamotor yang disita akan ditahan selama dua minggu dan bisa diambil saat sidang pengadilan. “Ini dilakukan, sebagai upaya menimbulkan efek jera bagi masyarakat yang melanggar lalulintas,” ujarnya. Penindakan sistem hunting digelar sebagai upaya menyikapi maraknya pelanggaran lalulintas yang tidak tersentuh personel Polresta Medan. Dengan demikian diambil kebijakan melakukan penindakan di jalan yang rawan pelanggaran dan berakibat kecelakaan menyebabkan fatalitas korban kecelakaan lalu lintas, seperti melawan arus, tak pakai helm, berbonceng tiga, serta menerobos lampu merah. “Kita akan melakukan penindakan setiap hari. Ke depan diharap masyarakat lebih peduli dan berperilaku tertib, mampu menumbuhkan kesadaran pentingnya tertib dan patuh berlalulintas. Sehingga bisa menjadi pelopor keselamatan berlalulintas dan membudayakan keselamatan berlalulintas sebagai kebutuhan,” tuturnya. Salah seorang pengendara sepedamotor mengaku terkejut ditilang karena tak memakai helm saat melintas di sekitar Pondok Kelapa. “Biasanya disini tidak pernah razia sehingga kami terbiasa melawan arus dan tak mengenakan helm. Makanya heran mengapa tiba-tiba razia,” katanya. Menyikapi itu, Siswandi menjelaskan, tindakan yang dilakukan personel kepolisian untuk menumbuhkan kesadaran bahwa sangat penting memakai helm. “Bayangkan bagaimana jika seandainya jatuh kemudian kepala terhempas ke aspal. Pasti berakibat sangat fatal bahkan tak tertutup kemungkinan terburuk hingga meninggal dunia,” sebutnya.(m27)

Nasrun Pasaribu, SH, SIK, MH. Kemudian Nasrun menginstruksikan jajarannya untuk melakukan penyelidikan. Hasilnya, polisi berhasil menangkap tersangka KS di Jln. Letjen Jamin Ginting depan perumahan Citra Garden. Dari tersangka KS, polisi menyita barang bukti dua paket sabu dan sebilah pisau. Kemudian polisi melakukan pengembangan dan menangkap kurir narkoba JFB Jln. Letjen

Waspada/Ismanto Ismail

KAPOLSEK Medan Baru Kompol Nasrun Pasaribu, SH, SIK, MH (kanan) didampingi Kanit Reskrim Iptu Alexander P, SH (kiri) memperlihatkan barang bukti narkoba jenis sabu yang ditempelkan pada plaster pembalut luka, Selasa (18/3).

Pemkab Madina Dan PT ALN Tidak Bisa Tunjukkan Bukti Asli MEDAN (Waspada): Sidang lanjutan perkara atas lahan di Kecamatan Muara Batang Gadis, Kab. Mandailing Natal yang digelar Pengadilan Tinggi Tata Usaha Negara (PT TUN), Selasa (18/3), memasuki tahap penambahan bukti dan kesimpulan. Dalam sidang pengajuan kesimpulan itu, pihak tergugat Bupati Madina dan tergugat Intervensi PT. ALN belum bisa menunjukkan bukti surat izin lokasi asli atas lahan yang berperkara tersebut. Pada kesempatan itu, KP USU melalui kuasa hukumnya Marlon Tobing, SH meminta majelis hakim mengabulkan gugatan KP USU. Permintaan ini disampaikan dalam kesimpulan yang diajukan kepada majelis hakim. Dalam kesimpulan itu, kuasa hukum KP USU meminta majelis hakim membatalkan surat keputusan Bupati Madina No. 525/575/K/2012 tanggal 26

November 2012 tentang izin lokasi PT ALN di Kec. Muara Batang Gadis, Kab. Madina. Sidang yang dipimpin Ketua Majelis Hakim Herman Baeha, SH, MH dan Hakim Anggota Liza Valianty, SH dan Nasrifal, SH, MH serta Panitera Syamsir Yusfan, SH, MH, beragendakan tentang tambahan bukti dari penggugat dan tergugat serta penyerahan kesimpulan.. Kuasa hukum penggugat Marlon Tobing, SH mengatakan kepada wartawan, pihaknya optimis majelis hakim mengabulkan gugatan. Sebab dari faktafakta persidangan menunjukkan bahwa izin lokasi yang diberikan Pemkab Madina semasa Hidayat Batubara menjadi bupati, tidak sesuai prosedur yang ada. “Kita optimis gugatan ini dikabulkan oleh majelis hakim,” kata Marlon. Usai menyerahkan tambahan alat bukti dan kesimpulan Ketua Majelis Hakim Herman Baeha, SH, MH menunda si-

dang hingga 8 April 2014 untuk mempersiapkan pembacaan putusan dalam perkara tersebut. Sementara itu, kuasa hukum tergugat Pemkab Madina, Refly, SH mengakui kalau surat asli izin lokasi yang diberikan kepada PT ALN tidak bisa dibawa ke persidangan dan diberikan kepada hakim. Namun, dia tetap yakin bahwa izin lokasi yang dikeluarkan tetap prosedural. “Kami tetap menyatakan izin yang diberikan kepada PT ALN tetap prosedural. Sebab, pada saat itu izin KP USU habis dan tidak diperpanjang karena tidak bisa menunjukkan kegiatan pembibitan sekitar 50 persen lebih di lahan tersebut,” ungkapnya. Perkara gugatan antara KP USU dengan Pemkab Madina dan PT ALN terdaftar dalam sidang di PTUN Medan dengan nomor perkara No. 106/G/ 2013/PTUN-Mdn. (h02)

MEDAN ( Waspada): Indonesia masih kekurangan dokter. Data 2011 menunjukkan dari 74 fakultas kedokteran di seluruh tanah air, hanya mampu menghasil 2.000 dokter baru. “Kondisi ini jelas tidak sejalan dengan program pelayanan Jaminan Kesehatan Nasional (JKN),” kata Dudut Tanjung, SKp, MKep, SpKMB, dalam orasi ilmiah di acara Dies Natalis ke-4 Fakultas Keperawatan USU, Sabtu (13/3). Sebab, kata dia, program JKN yang dilaksanakan pemerintah harus didukung dengan kualitas dan ketersediaan tenaga medis di tiaptiap rumah sakit. “Sementara fakultas kedokteran sebagai sumber pencetak dokter masih sedikit hasilkan dokter baru,” ujarnya. Mahasiswa program doktor Universitas Indonesia itu mengatakan, berdasarkan data tersebut memastikan bahwa Indonesia kekurangan dokter, mengingat program JKN akan mendorong masyarakat untuk berobat ke rumah sakit. Namun, dengan keterbatasan dokter, alhasil perawat meskipun tidak punya kewenangan melakukan pelayanan medik sering dijadikan alternatif. Menurutnya, dengan keadaan yang demikian, posisi keperawatan menjadi sangat strategis memenuhi pelayanan kesehatan kepada masyarakat. Untuk itu, regulasi terkait keperawatan perlu segera disahkan oleh pemerintah. “Dengan pengesahan RUU Keperawatan, diharapkan kualitas tenaga keperawatan kian meningkat,” ujarnya sembari menambahkan, tidak saja dari segi ilmu, namun juga kesejahteraan. Pasalnya, saat ini posisi perawat, dari segi kesejahteraan masih kurang terperhatikan Sementara itu, Rektor USU Prof Syahril Pasaribu mengatakan, Fakultas Keperawatan harus memberikan yang terbaik bagi USU. Meningkatkan kualitas dengan memperbanyak

penelitian serta peningkatan pendidikan dosen ke jenjang doktor. Usia empat tahun bagi sebuah fakultas merupakan usia yang masih sangat muda. Namun, bagi Fakultas Keperawatan USU sampai usia empat tahun ini sudah sangat banyak prestasi dihasilkan. Baru empat tahun berjalan, Fakultas Keperawatan sudah mempunyai empat program yaitu Program Diploma III, Program Sarjana S1, Program S2, dan Program Profesi. USU sebagai Perguruan Tinggi Negeri Berbadan Hukum (PTN BH) harusnya lebih baik dari perguruan tinggi lain. Dekan Fakultas Keperawatan USU dr Dedi Ardinata MKes, AIFM mengatakan, saat ini Fakultas Keperawatan dengan dukungan dari Rektor USU Prof Syahril Pasaribu telah membuat beberapa peningkatan fasilitas. “Keperawatan telah memiliki gedung Laboratorium Keterampilan Klinik dan Pusat Uji Kompetensi Tenaga Kesehatan yang tidak hanya dipergunakan untuk fakultas keperawatan, namun juga untuk kedokteran dan kedokteran gigi,” tuturnya. Fakultas Keperawatan sampai tahun ini telah menghasilkan lulusan sebanyak 4.912 orang yang berasal dari berbagai program studi. Dalam melaksanakan tugas pokoknya, kata Dedi, hingga kini Fakultas Keperawatan USU didukung oleh 38 orang tenaga pendidik (dosen). Namun, hanya 20 orang (62,50%) yang telah bersertifikat pendidik. Turut hadir pada acara Dies Natalis Fakultas Keperawatan USU ke-4, antara lain Direktur Utama Rumah Sakit USU, Kepala Dinas Kesehatan Provinsi Sumatera Utara, Ketua Persatuan Perawat Nasional Indonesia Provinsi Sumatera Utara, Dekan Fakultas MIPA, para Pembantu Dekan di lingkungan USU, dan Fakultas ILKOM USU, dosen dan staf pendidikan Fakultas Keperawatan USU, serta para mahasiswa. (m49)

Siswa SIS Medan Kunjungi Waspada MEDAN (Waspada): Sekitar 29 siswa kelas 5 Sekolah Dasar (SD) Singapore International School (SIS) Medan, berkunjung ke Harian Waspada di Jln. Brigjen Katamso Medan, Selasa (18/3). Delfy Siawidjaya, S. Kom, Humas SIS Medan mengatakan, kedatangan mereka bersama para guru ini, merupakan ba-

gian dari program studi ekstra kurikuler. Yaitu meninjau perpustakaan, kantor-kantor penerbitan suratkabar dan tempat-tempat bersejarah. Di samping berkunjung ke Harian Waspada, siswa SIS Medan juga mengunjungi percetakan PT. Prakarsa Abadi Press di Jln. Sidorukun Medan. Mereka ingin menyaksikan secara lang-

sung proses cetak suratkabar Harian Waspada. Sementara itu, Aidi Yursal mewakili pimpinan Harian Waspada menjelaskan tentang sejarah Harian Waspada yang didirikan H. Mohammad Said dan Hj. Ani Idrus. Suratkabar nasional ini terbit di Medan sejak 11 Januari 1947. Berita-berita yang ditampil-

kan Harian Waspada meliputi masalah politik, ekonomi, luar negeri, sosial budaya, hukum dan kriminal serta olahraga. Harian Waspada juga dapat dibaca melalui internet di luar negeri. Sedangkan Delfy menjelaskan, dalam melaksanakan proses belajar-mengajar, SIS Medan menggunakan Bahasa Inggeris sebagai bahasa pengantar.

Waspada/Rizky Rayanda

SISWA kelas 5 SD SIS Medan foto bersama wartawan Waspada Aidi Yursal (tengah) dan guru saat berkunjung ke Harian Waspada.

Persentase penggunaan bahasa di sekolah tersebut yakni Bahasa Indonesia 5 persen, Bahasa Mandarin 15 persen dan Bahasa Inggeris 80 persen. Ada sekitar 15 persen dari jumlah siswa yang berasal dari luar negeri (murid asing). Bahkan guru-guru juga banyak yang berasal dari luar negeri. Sebelumnya, Andrew selaku Wali Kelas 5 SD (primary 5) mengungkapkan kesannya tentang Kota Medan. “Listrik sering padam. Kita menjadi susah karena tidak bisa bekerja apapun termasuk menggunakan komputer,” ujarnya. Saat itu, sejumlah murid sempat mengajukan beberapa pertanyaan. Seperti Zaki, Dextar, Andrea, Emilio dan Joy. Mereka menanyakan tentang keberadaan kantor Harian Waspada, selain di Kota Medan. Aidi Yursal menjelaskan, awalnya Harian Waspada berkantor di kawasan Pusat Pasar. Kemudian Harian Waspada membangun kantor di Jln. Brigjen Katamso. Selain itu, Harian Waspada juga memiliki kantor perwakilandiBandaAceh,Jakarta dan kota-kota lainnya. (m32)

Waspada/Andi Aria Tirtayasa

KAPOLSEK Medan Timur Kompol Juliani Prihartini saat menyampaikan harapannya kepada sejumlah pemuka agama, tokoh masyarakat dan pemuda di aula Kamtibmas Polsek Medan Timur, Selasa (18/3), menjelang pelaksanaan Pemilu.

Kapolsek Medan Timur:

Ciptakan Situasi Kondusif Jelang Pemilu MEDAN (Waspada): Kapolsek Medan Timur Kompol Juliani Prihartini, SIK mengharapkan pemuka agama, tokoh masyarakat dan pemuda agar berpartisipasi dalam menciptakan situasi kondusif menjelang pelaksanaan Pemilihan Umum (Pemilu). Hal itu disampaikan Kompol Juliani pada acara kemitraan pemuka agama, tokoh masyarakat dan pemuda se-Kec Medan Timur dan Medan Perjuangan di aula Kamtibmas Polsek Medan Timur, Selasa (18/3). Menurut Kapolsek, sekecil apapun peran para pemuka agama, tokoh masyarakat dan pemuda dalam menjaga situasi Kamtibmas, akan mempengaruhi kelancaran dan kesuksesan Pemilu

Legislatif maupun Pilpres, di wilayah hukum Polresta Medan, khususnya Polsek Medan Timur. Sebagaimana diketahui, lanjut Juliani, tahun ini merupakan tahun politik yang sangat penting. Sebab, pada tahun ini ada agenda dalam menentukan masa depan bangsa setelah penyelenggaraan Pemilu Legislatif dan Pilpres pada 9 April mendatang. “Menjelang hari H, banyak tahapan yang harus dilalui, mulai dari penyiapan logistik, kampanye, masa tenang, perhitungan suara hingga penetapan hasil Pemilu. Semua tahapan ini akan berpengaruh pada situasi Kamtibmas di masyarakat,” ujar Juliani.(h04)


Medan Metropolitan

WASPADA Rabu 19 Maret 2014

A5

Jadwal Penerbangan Di Bandara KNIA No. Penerbangan Ke Flight

Pukul

GARUDA INDONESIA 1 Jakarta GA-181 2 Jakarta GA-183 3 Jakarta GA-185 4 Jakarta GA-187 5 Jakarta GA-143 6 Jakarta GA-189 7 Jakarta GA-191 8 Jakarta GA-193 9 Jakarta GA-195 10 Banda Aceh GA-142 11 Banda Aceh GA-280 12 Palembang GA-266 13. Palembang GA-268 14. Batam GA-270 15. Penang GA-804 16. Pekanbaru GA-276 17. Tanjungkarang GA-270

05.15 08.55 11.00 12.10 13.20 13.55 16.45 18.30 20.50 09.40 17.10 06.00 17.40 09.25 10.55 06.00 09.25

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Banda Aceh Banda Aceh Palembang Palembang Batam Penang Pekanbaru Tanjungkarang

GA-180 GA-142 GA-182 GA-184 GA-186 GA-188 GA-190 GA-192 GA-196 GA-143 GA-281 GA-267 GA-269 GA-271 GA-805 GA-277 GA-271

08.10 08.55 10.15 11.25 13.10 16.00 17.30 19.30 22.10 12.35 19.45 09.55 21.35 17.00 13.20 08.45 17.00

CITILINK 1. Jakarta 2. Jakarta 3. Jakarta 4. Jakarta 5. Batam

QG-831 QG-837 QG-833 QG-835 QG-882

08:40 09:30 18:50 20:10 14:55

Jakarta Jakarta Jakarta Jakarta Batam

QG-830 QG-832 QG-836 QG-834 QG-883

05:55 06:55 12:15 17:25 16:40

AIR ASIA 1 Kuala Lumpur 2 Kuala Lumpur 3 Kuala Lumpur 4 Kuala Lumpur 5 Penang 6 Penang 7 Kuala Lumpur 8 Bangkok 9 Bandung 10 Surabaya 11 Bandung 12 Penang 13 Pekanbaru 14 Singapura 15 Kuala Lumpur

QZ-8050 06.20 QZ- 8054 17.40 AK- 1351 08.00 AK-1355 17.55 QZ-8072 14.25 AK-1581 18.45 AK-1357 21.20 QZ-8084 14.15 QZ-7987 08.45 QZ-7611 13.15 QZ-7981 17.10 QZ-8078 06.25 QZ-8028 11.30 QZ-664 07.45 QZ-8052 13.30

Kuala Lumpur Kuala Lumpur Kuala Lumpur Kuala Lumpur Penang Penang Kuala Lumpur Bangkok (2,4,6) Bandung Surabaya Bandung Penang Pekanbaru Singapura Kuala Lumpur

QZ-8051 QZ-8055 AK-1350 AK-1354 QZ-8073 AK-1580 AK-1356 QZ-8085 QZ-7986 QZ-7610 QZ-7980 QZ-8079 QZ-8029 QZ-665 QZ-8053

08.30 10.55 07.35 17.00 16.35 18.30 21.05 16.40 11.30 09.55 19.55 08.35 12.50 10.35 15.55

LION AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Jakarta 5 Jakarta 6 Jakarta 7 Jakarta 8. Jakarta 9 Jakarta 10 Jakarta 11 Jakarta 12 Jakarta 13 Jakarta 14 Penang 15 Penang 16 Jakarta 17 Jakarta 18 Jakarta 19 Jakarta 20 Jakarta 21 Surabaya 22 Surabaya 23 Banda Aceh 24 Jakarta

JT- 211 JT- 381 JT- 397 JT-207 JT- 301 JT-395 JT- 303 JT- 215 JT-201 JT- 387 JT-399 JT-383 JT-385 JT-1282 JT-1288 JT-205 JT-203 JT-219 JT-309 JT-209 JT-0970 JT-972 JT-396 JT-305

0545 06.45 07.50 08.40 10.00 11.00 11.50 12.25 12.50 13.50 15.20 15.50 17.40 08.05 13.35 2010 18.00 20.40 19.30 21.00 07.00 12.55 12.15 18.30

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Penang Penang Jakarta Jakarta Jakarta Jakarta Jakarta Surabaya Surabaya Banda Aceh Jakarta

JT-380 JT-300 JT-394 JT-302 JT-214 JT-200 JT-204 JT-398 JT-382 JT-384 JT-202 JT-212 JT-396 JT-1283 JT-1289 JT-206 JT-208 JT-386 JT-308 JT-218 JT-971 JT-973 JT-397 JT-210

08.20 09.20 10.20 11.10 11.40 12.10 13.10 14.40 15.10 16.05 17.20 17.50 19.45 10.25 15.55 09.20 18.25. 21.05 22.20 23.50 12.15 16.00 07.05 07.20

MALAYSIA 1 Kuala Lumpur 2 Kuala Lumpur 3 Kuala Lumpur

MH-861 MH-865 NH-841

09.40 15.45 07.00

Kuala Lumpur Kuala Lumpur Kuala Lumpur

MH-860 MH-864 MH-840

08.50 15.00 06.15

SILK AIR 1 Singapura 2 Singapura 3 Singapura

MI-233 MI-237 MI-235

08.40 20.35 13.15

Singapura Singapura Singapura

MI-234 MI-238 MI-236

07.35 19.50 12.20

VALUAIR 1 Singapura (2.4,7) VF-282 2 Singapura (1,3,6) VF-284 3 Singapura (Jumat)VF-282

10.35 18.30 09.45

Singapura (2.4.7) VF-281 Singapura (1,3,6) VF-283 Singapura (Jumat)VF-281

09.55 17.40 09.05

SRIWIJAYA AIR 1 Jakarta 2 Jakarta 3 Batam 4 Pekanbaru 5 Pekanbaru 6 Banda Aceh 7 Penang 8 Padang 9 Jakarta

SJ-021 SJ-011 SJ-035 SJ-043 SJ-041 SJ-010 SJ-102 SJ-021 SJ-017

13.15 15.55 16.50 10.20 17.20 12.50 07.20 16.00 08.05

Jakarta Jakarta Batam Pekanbaru Pekanbaru Banda Aceh Penang Padang Jakarta

SJ-010 SJ-016 SJ-034 SJ-042 SJ-040 SJ-011 SJ-103 SJ-020 SJ-016

18.10 16.20 14.55 11.50 15.45 14.20 09.50 14.10 17.20

FIRE FLY 1 Subang 2 Penang 3. Penang

FY -3413 FY- 3403 FY- 3407

14.35 10.55 18.20

Subang Penang Penang

FY-3412 FY-3402 FY-3406

14.05 10.35 17.55

10.45

Jakarta

RI-093

08.55

MANDALA AIRLINE 1 Singapura RI-861

Tiba Dari

Flight

Pukul

Jadwal Perjalanan Kereta Api No KA

U28 A U30 A U32 A U34 A U27 A U29 A U31 A U33 A U37 A U38 A U39 A U40 A U41 A U42 A U43 A U44 A U35 A U36 A U45 A U46 A U47 A U48 A U49 A U50 A U51 A U52 A U53 A U54 A U55 A U56 A U57 A U58 A U59 A U60 A

Nama KA

SRI BILAH SRI BILAH SRI BILAH SRI BILAH SRI BILAH SRI BILAH SRI BILAH SRI BILAH SIREKS SIREKS PUTRI DELI PUTRI DELI PUTRI DELI PUTRI DELI PUTRI DELI PUTRI DELI SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA

Kelas

Dari

Tujuan

EKS/BISNIS BISNIS EKS/BISNIS EKS/BISNIS EKS/BISNIS EKS/BISNIS BISNIS EKS/BISNIS EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI

MEDAN MEDAN MEDAN MEDAN RANTAU P RANTAU P RANTAU P RANTAU P SIANTAR MEDAN TANJUNG B MEDAN TANJUNG B MEDAN TANJUNG B MEDAN TEBING T MEDAN BINJAI MEDAN BINJAI MEDAN BINJAI MEDAN BINJAI MEDAN BINJAI MEDAN BINJAI MEDAN BINJAI MEDAN BINJAI MEDAN

Berangkat

RANTAU P RANTAU P RANTAU P RANTAU P MEDAN MEDAN MEDAN MEDAN MEDAN SIANTAR MEDAN TANJUNG MEDAN TANJUNG B MEDAN TANJUNG B MEDAN TEBING TINGGI MEDAN BINJAI MEDAN BINJAI MEDAN BINJAI MEDAN BINJAI MEDAN BINJAI MEDAN BINJAI MEDAN BINJAI MEDAN BINJAI

07.47 10.17 15.44 23.03 07.52 14.58 17.18 23.13 08.08 14.30 07.50 06.49 13.06 13.11 19.36 17.33 05.42 18.44 05.46 05.02 07.14 06.30 09.15 08.30 12.18 10.00 13.53 13.09 16.49 14.37 19.00 18.16 21.40 20.56

Datang

13.56 15.46 22.02 04.38 14.04 10.17 22.55 04.47 11.54 18.24 12.54 11.11 18.01 17.45 00.29 22.24 07.42 20.57 06.15 05.31 07.43 06.59 09.44 08.59 12.47 10.29 14.22 13.38 17.18 15.06 19.29 18.45 22.09 21.25

Jadwal Keberangkatan KA Bandara Medan –Kuala Namu

Kuala Namu- Medan

No. KA

No. KA

Berangkat

Tiba KNIA

Berangkat KNIA Tiba Medan

U62 04:00 04:37 U61 05:05 06:50 U2A 04:50 05:27 U65 07:33 08:15 U4A 06:15 06:52 U1A 08:00 08:46 U6A 07:16 07:53 U3A 09:05 09:49 U8A 08:20 08:57 U5A 09:25 10:10 U10A 09:10 09:47 U7A 10:20 11:07 U12A 10:40 11:17 U9A 11:50 12:37 U14A 11:10 11:47 U11A 12:25 13:09 U16A 12:10 12:47 U13A 13:25 14:12 U18A 13:45 14:22 U15A 14:55 15:42 U20A 14:15 14:52 U17A 15:30 16:14 U22A 15:15 15:52 U19A 16:25 17:12 U24A 16:45 17:22 U21A 17:55 18:42 U26A 17:15 17:52 U23A 18:30 19:14 U66 18:15 18:52 U25A 19:56 20:40 U68 19:17 19:54 U67 20:40 21:17 U70 20:01 20:38 U69 21:15 21:59 U72 21:10 21:57 U71 23:30 00:07 NB: Tiket dapat dibeli di stasiun KA Bandara Medan dan Kuala Namu. Pembayaran dapat menggunakan Kartu Prabayar, Debit dan Kredit Card. Tiket dapat dipesan 7 hari sebelum berangkat. (m32)

Waspada/ Rizky Rayanda

PARKIR BERLAPIS: Sejumlah sopir taksi memarkirkan kendaraannya secara berlapis di Jln. Jawa Medan tepatnya di depan Mapolsek Medan Timur, Selasa (18/3). Kesemrawutan lalulintas ini terkesan sengaja diabaikan oleh petugas Polsek Medan Timur.

Kesemrawutan Lalulintas Diabaikan Masyarakat Minta Kapoldasu Ganti Kapolsek Medan Timur MEDAN (Waspada): Kesemrawutan lalulintas seperti parkir mobil berlapis di Jln. Jawa tepatnya di depan Stasiun KA Bandara dan Mapolsek Medan Timur, terkesan diabaikan sehingga menjadi pemicu kemacatan lalulintas. Masyarakat yang resah

dengan kondisi ini meminta Kapoldasu Irjen Pol Syarief Gunawan dan Kapolresta Medan Kombes Pol Nico Afinta segera mengganti Kapolsek Medan Timur Kompol Juliani Prihartini, SIK. Pantauan Waspada di lapangan, Selasa (18/3), kesemrawutan lalulintas di kawasan Jln. Jawa itu, memang terkesan diabaikan. Buktinya, meski se-

jumlah mobil terlihat parkir berlapis di depan Mapolsek Medan Timur, namun Kompol Juliani Prihartini tidak menginstruksikan jajarannya untuk melakukan penertiban. Bahkan rambu larangan parkir ada di depan Mapolsek Medan Timur, telah hilang. Hal ini mengindikasikan bahwa rambu larangan parkir itu sengaja dihilangkan agar para

Dua Pemain Judi Diringkus MEDAN (Waspada): Petugas Reskrim Polsek Delitua meringkus dua pemain judi dadu atau kopyok dari salah satu warung di Jln. Petunia Raya II Ujung, Kel. Namogajah, Kec. Medan Tuntungan. Kapolsek Delitua Kompol Wahyudi SIK, didampingi Kanit Reskrim Iptu Martualesi Sitepu, Selasa (18/3) mengakatan, kedua tersangka SG alias Sastra, 35, warga Jln. Petunia Raya II, Namo Gajah, Medan Tuntungan, dan RS, 32, warga Jln. Jamin Ginting Km 10,5 Simpang

Selayang, Kec.n Medan Tuntungan, dijebloskan ke dalam sel tahanan. Kedua tersangka ditangkap bersama dua orang lainnya dalam suatu penggerebekan di satu warung, Minggu (16/3) sore. Penggerebekan dilakukan polisi setelah menerima informasi dari warga. Namun, dua di antaranya yakni Anto Bukit dan Hendrik Gunawan Saputra telah dikembalikan kepada keluarganya karena tidak terbukti bermain judi pada saat penggerebekan.

Dalam penggerebekan itu berhasil diamankan barang bukti uang Rp82 ribu, 5 unit mesin jackpot, satu lembar tikar tempat pemasangan taruhan, tiga buah dadu kopyok, satu piring, dan satu tutup dadu. Sedangkan pemilik warung berinisial SS berhasil melarikan diri dan telah ditetapkan sebagai daftar pencarian orang (DPO). “Kedua tersangka dijerat dengan pasal 303 KUHPidana dengan ancaman hukuman 10 tahunpenjaraataudendasebanyak Rp25 juta,” ujarWahyudi. (m40)

Waspada/Rizky Rayanda

SEORANG pengemudi becak bermotor (betor) mengalami kesulitan melintasi Gg. Sumbar akibat keberadaan tiang listrik di tengah badan jalan, Senin (17/3).

PLN Biarkan Tiang Listrik Berdiri Di Tengah Gg. Sumbar MEDAN (Waspada): Warga Jln. Santun, Gg. Sumbar, Kel. Sudirejo I Medan Kota, saat ini merasa tidak nyaman dengan keberadaan tiang listrik milik PLN di tengah badan jalan. Keberadaan tiang listrik itu, menurut Udin, warga setempat, Selasa (18/3), sangat mengganggu aktivitas mereka yang berdomisili di gang tersebut. ‘’Apalagi kalau sudah ada kemalangan. Kami tidak bisa lagi mengangkat keranda mayat karena terhalang tiang listrik yang berdiri persis di tengah gang,’’ katanya.

Persoalan tiang listrik tersebut sudah dilaporkan ke PLN cabang Medan Kota agar segera dipindahkan ke sisi gang. ‘’Laporan tertulisnya juga sudah kami tembuskan ke PLN Sumut, tapi sampai saat ini belum ada tanggapan,’’ jelasnya. Kata Udin, beberapa minggu lalu ada petugas PLN yang mensurvei keberadaan tiang listrik tersebut, setelah itu tidak ada lagi tindaklanjutnya. Pernah juga petugas PLN memberikan saran agar tiang listrik itu digergaji saja. ‘’Tapi itu kan risiko,

karena tiang itu memiliki kabel listrik bertegangan tinggi,’’ katanya. Ketika seorang perwakilan warga hendak mengurus ke kantor PLN agar tiang listrik itu segera dipindahkan, pihak PLN meminta biaya pemindahan tiang itu sebesar Rp 6 juta lebih. Warga Gg. Sumbar berharap pihak PLN segera memindahkan tiang listrik yang menghalangi akses keluar – masuk gang mereka. Apalagi keberadaan tiang listrik itu sudah sangat mengganggu aktivitas warga.(m09)

pengemudi mobil bebas memarkirkan kendaraannya secara berlapis. Sementara, Operasi Mantap Brata yang telah diresmikan Kapoldasu Irjen Pol Syarief Gunawan menjelang pelaksanaan Pemilu, juga tidak ditindaklanjuti Polsek Medan Timur dengan melakukan penertiban terhadap parkir mobil berlapis tersebut. Padahal, salah satu sasaran Operasi Mantap Brata adalah penertiban terhadap pelanggaran peraturan lalulintas. Sementara itu, Kapolsek Medan Timur Kompol Juliani Prihartini, SIK yang dikonfirmasi Waspada mengatakan, pihaknya sudah mengirim surat kepada Plt Wali Kota Medan, namun hingga kini belum ada jawaban.

“Saya sudah kirim surat kepada bapak PltWali Kota Medan untuk meninjau kembali keberadaan lokasi parkir tersebut. Namun, hingga kini belum ada jawaban tertulis,” sebut Kompol Juliani, Selasa (18/3), ketika ditanya Waspada terkait hilangnya rambu larangan parkir di depan Polsek Medan Timur dan parkir mobil berlapis di depan Stasiun KA Bandara. Juliani mengaku sudah mendapat informasi tentang lokasi parkir para penjemput penumpang KA tersebut akan dipindahkan ke seputaran Lapangan Merdeka. Menurut Juliani, pihaknya tidak bisa menertibkan juru parkir tersebut karena keberadaannya dilengkapi dengan surat

mandat. Juliani menambahkan, kemacatan arus lalulintas di kawasan tersebut sifatnya hanya pada saat-saat tertentu. Yakni saat tibanya kereta api yang membawa penumpang dari Bandara Kualanamu menuju Stasiun Kereta Api di Medan. Bahkan, personel Lalulintas Polsek Medan Timur turut mengatur arus lalulintas guna mengurai kemacatan. Mengenai adanya tudingan bahwa Polsek Medan Timur menerima upeti oknum tertentu agar tidak menertibkan mobil-mobil yang parkir di Jln. Jawa, Juliani membantahnya. “Tudingan itu tidak benar. Saya tidak ada menerima upeti dari siapapun,” tegas Juliani. (h04)

Mengaku Jadi Korban Penipuan Arisan Bodong

Puluhan Wanita Minta Perhatian Kapoldasu MEDAN (Waspada): Puluhan wanita di Medan yang mengaku menjadi korban penipuan dengan modus arisan bodong meminta perhatian Kapoldasu Irjen Pol Syarief Gunawan. Pasalnya, pengaduan mereka di Poldasu sejak tahun 2013, belum juga ditindaklanjuti oleh penyidik. Empat korban penipuan arisan bodong itu mendatangi redaksi Harian Waspada, Selasa (18/3). Herbi Manurung, penduduk Jln. Seksama Medan yang turut menjadi korban, mengharapkan pihak kepolisian segera menangkap pelaku penipuan tersebut. Awalnya, kata Herbi, pelaksanaan arisan tersebut berjalan lancar. Namun setelah beberapa kali dilakukan penarikan nomor undian, pimpinan arisan yaitu RU selalu mengatakan bahwa kas sudah kosong karena ada peserta yang melarikan uang mereka.

Akibat penipuan dengan modus arisan bodong tersebut, Herbi mengalami kerugian hingga Rp89 juta. Sementara tiga rekannya Marice Siahaan kehilangan Rp 35 juta, Rauli Siagian Rp 24 juta dan Lince Manulang Rp28 juta. Dari keempat korban, RU telah mengantongi Rp176 juta. “Kalau dihitung-hitung, uang yang terkumpul dari para peserta bisa mencapai Rp1 miliar,” kata Herbi yang dibenarkan Marice dan teman-teman lainnya. Menurut Herbi, pimpinan arisan tidak menjelaskan identitas para peserta yang ikut dalam arisan itu. Namun setiap penarikan, RU selalu dapat nomor pertama, sehingga lolos dari uang buku lebih kurang 5 persen. Dalam pelaksanaannya, arisan bodong seperti tender proyek. Siapa yang berani bayar mahal, dia yang cepat menda-

pat penarikan. Menurut Herbi dan Marice, setelah arisan itu dihentikan, pihaknya sudah menanyakan masalah itu ke RU selaku pimpinan. Namun RU mengatakan bahwa uang arisan sudah dilarikan salah seorang peserta berinisial MT asal P. Siantar. Bahkan, ibu mertua RU berinisial LH yang ikut dalam arisan itu, mengatakan, masalah tersebut akan dibicarakan dengan pihak keluarga. Akhirnya, kasus arisan bodong ini dilaporkan ke Poldasu pada 13 Maret 2013 dengan nomor pengaduan: LP/226/III/ 2013 SKPT I. Kemudian, polisi mengkonfrontir pelapor dan terlapor. Setelah itu, diperoleh kabar bahwa LH sudah membayar uang tersebut lebih kurang Rp119 juta. “Namun tunggakan utang kepada kami tidak pernah dibayar,” kata Herbi dan korban lainnya.(m32)

Mahasiswa UMSU Ditantang Jadi Penyiar MEDAN (Waspada): Program pelatihan jurnalistik bertajuk “RCTI Goes to Campus” di Universitas Muhammadiyah Sumatera Utara (UMSU) berlangsung meriah dan disambut antusias mahasiswa. Wakil Rektor I Dr. Muhyarsyah, SE, MS, mengatakan kepada Waspada, Selasa (18/3), acara digelar di aula kampus UMSU Jln. Mukhtar Basri Medan, Jumat kemarin. “Tampil sebagai narasumber News Presenting and Reporting Senior RCTI, Inne Sudjono dan Bayu Eka Prayudha,” ungkapnya. Acara juga diisi dengan pelatihan dan praktik reportase serta membaca berita. Para mahasiswa yang ikut dalam kegiatan tersebut sangat antusias, karena pihak RCTI melakukan rekrutmen terbuka. Dr. Muhyarsyah mengatakan, dalam kegiatan ini mahasiswa UMSU ditantang bekerja menjadi jurnalis di RCTI. “RCTI Goes to Campus” merupakan kegiatan yang sangat bermanfaat khususnya bagi mahasiswa guna mendapat pengetahuan dan keterampilan jurnalistik. “Selama ini, presenter RCTI hanya bisa dilihat di layar kaca televisi. Maka kesempatan bertatap muka langsung dengan presenter dan news presenting harus dimanfaatkan sebaik-baiknya

oleh para mahasiswa. Muhyarsyah menyambut baik penandatanganan kerjasama FISIP UMSU dengan pihak RCTI. Lewat kerjasama ini, diharapkan kegiatan yang dilaksanakan lebih intensif karena sudah ada payung hukumnya. Kerjasama ditandatangani Dekan FISIP UMSU Rudianto, Sos MSi dan RijantoWidjaksono mewakili RCTI.“Bukan hanya pelatihan jurnalistik dan penyiaran, RCTI juga siap menampung mahasiswa UMSU yang ingin magang,” kata Rijanto. Sedangkan Dekan FISIP UMSU Rudianto, S. Sos, MSi mengatakan, “RCTI Goes to Campus” sangat bermanfaat bagi mahasiswa yang berminat menekuni dunia penyiaran. Materi-materi yang ditampilkan dan diikuti dengan praktik, terasa cukup mendidik sekaligus menghibur. Dia berharap “RCTI Goes to Campus” di UMSU bisa menjadi agenda rutin setiap tahun karena cukup bermanfaat bagi mahasiswa dalam menggali pengetahuan dan pengalaman. “Mudah-mudahan kerjasama antara FISIP UMSU dengan RCTI, bisa lebih meningkatkan kualitas pendidikan melalui berbagai kegiatan pelatihan yang mungkin bisa dilaksanakan,” katanya.(m49)


Medan Metropolitan

A6

WASPADA Rabu 19 Maret 2014

Dugaan Korupsi Alkes

Wali Kota P.Sidempuan Bantah Terima Fee MEDAN (Waspada): Wali Kota Padangsidempuan Andar Harahap dan ayahnya Bachrum Harahap, yang juga Bupati Padang Lawas Utara (Paluta), memenuhi panggilan sidang di Pengadilan Tipikor Medan, Selasa (18/3). Ayah dan anak itu menjadi saksi perkara dugaan korupsi pengadaan alat kesehatan (Alkes) di RSUD Gunung Tua tahun 2012 untuk terdakwa Naga Bakti Harahap selaku Direktur RSUD Gunung Tua, Rahmad Taufik Hasibuan selaku Pejabat Pembuat Komitmen (PPK), Hendry Hamonangan Daulay selaku

Bendahara RSUD Gunung Tua, dan Rizkyvan Tobing selaku rekanan. Dalam persidangan itu, Andar Harahap membantah tuduhan menerima uang Rp620 juta dari pengusaha Ridwan Winata terkait proyek pengadaan Alkes di RSUD Gunung Tua. Andar mengaku tidak mengenal Ridwan Winata, pengusaha yang diduga mengendalikan empat perusahaan yang mengikuti lelang pengadaan Alkes di RSUD Gunung Tua tahun 2012 senilai Rp10 miliar. Kata dia, pada tahun 2012 dirinya belum menjabat sebagai Wali Kota Padangsidempuan. Saat itu, dia masih bertugas di

Tewas Terjatuh Dari Lantai III MEDAN (Waspada): Pekerja konstruksi tewas terjatuh dari lantai III ketika hendak memasang kusen di satu rumah toko (ruko) Komplek Istana Prima Jln. Brigjen Katamso, Kel. Sei Mati, Kec. Medan Maimun, Senin (17/3) siang. Korban Subani, 30, penduduk Jln. Rotan, Perumnas Simalingkar Medan, tewas dengan kondisi kepala pecah dan tangan patah. Informasi diperoleh menyebutkan, saat itu korban bersama rekannya Hermanto, 19, mendapat pekerjaan mengganti kusen di ruko tersebut. Saat bekerja, korban yang tidak dilengkapi alat pengamanan itu tiba-tiba oleng, karena kusen yang hendak dipasangnya nyaris lepas. Diduga saat itu korban berusaha memegang kusen yang hampir lepas, namun tiba-tiba pegangannya terlepas. “Aku tidak tahu dia terjatuh, tetapi sempat kudengar suara menjerit minta tolong,” ujar Hermanto. Ketika dia melihat keluar, ternyata rekannya sudah berada di lantai bawah dalam kondisi tengkurap tak bergerak. Sementara itu dari lokasi kejadian, korban yang mengenakan celana biru selutut dan baju kaos liris-liris terlihat dalam posisi tengkurap. Kepalanya mengalir darah segar, dan petugas Polsek Medan Kota mengevakuasinya ke RS Pirngadi, Medan. “Pemeriksaan sementara dipastikan korban tewas akibat kecelakaan saat bekerja. Tidak ditemukan tanda-tanda penganiayaan di tubuhnya,” ujar Kapolsek Medan Kota Kompol Paulus Hotman Sinaga melalui Kanit Reskrim AKP Faidir Chaniago. Menurut Paulus, pihaknya telah meminta keterangan Hermanto sebagai saksi guna melengkapi berkas. “Korban telah dievakuasi ke RS Pirngadi guna autopsi,” sebutnya.(m27)

Angkatan Muda Tazkira Gelar Zikir Akbar MEDAN (Waspada): Dua ustadz dan ustadzah dari Kota Bandung, Jawa Barat, memberikan tausiyah dalam zikir akbar yang diselenggarakan Majelis Zikir Angkatan Muda Tazkira Sumut, di Masjid Raya Al-Mashun Medan, Minggu (16/3). Zikir akbar tersebut dihadiri ribuan jamaah di antaranya Ketua Umum Majelis Zikir Tazkira Sumut Buya KH Amiruddin MS dan AKBP H Ahmad Sumba. Acara yang dipandu H Muhammad Siddik SAg (Ketua Majelis Zikir Tazkira Binjai) diawali pembacaan ayat suci Alquran oleh Qari H Mat Kasat Lubis SAg, dan Muhammad Syafii, kemudian dilanjutkan tausiyah. Al-Ustadz Drs KH Arman Rachman MA, dalam tausiyahnya mengatakan, kecerdasan dalam Islam hanya ada dua, yakni kecerdasan qalbu (hari) dan IQ. Namun, ada yang namanya “99” yang disebut “Asmaul Husna” sebagai 99 nama Allah. Sehingga, kecerdasan qalbu berasal dari Asmaul Husna. Sedangkan Ustadzah Umi Dra Hj Fathimah Apalpo (Umi Empet) menjelaskan, Serba 4. Di antaranya 4 golongan surge yakni orang yang mencintai masjid, bersedekah secara ikhlas, rajin membaca Alquran, dan rajin shalat Tahajjud. Sementara itu, Buya KH Amiruddin MS dalam sambutannya mengatakan,MajelisZikirTazkiraSumutyangdipimpinnya,berorientasi kepada Thariqat Naqsabandiyah. Sehingga, menginginkan majelis zikir ini sebagai forum suci serta dekat kepada Allah. Ketika berbicara tentang Pemilu Legislatif 9 April 2004, menurut dia, sebagai penduduk terbesar di Indonesia, maka umat Islam wajib memilih calon anggota legislatif yang beriman dan bertakwa kepada Allah. “Jadi, pada 9 April umat Islam wajib pilih wakil rakyat seakidah. Jika kita salah memilih, maka umat Islam akan menyesal di kemudian hari,” sebutnya. Dalam kesempatan itu, KH Amiruddin menuturkan, Rumah Kuliyyah Tasawwuf Baitul Mustaghfirin Al-Amir Jln. Suluh No.139/ 141, Kec. Medan Tembung, akan melaksanakan kuliah tasawuf, Sabtu (22/3) pukul 07:00-10:00. “Kuliah tasawuf terbuka untuk umum dan yang akan memberikan materi kuliah unsur Ketua MUI Sumut Prof Dr H Ramli Abdul Wahid MA,” katanya. (cwan)

Waspada/Ist

BUYA KH Amiruddin M (5 kiri) didampingi Ustadz KH Arman Rachman, AKBP H Ahmad Sumba dan jamaah zikir foto bersama dalam zikir akbar Majelis Zikir Angkatan Muda Tazkira Sumut, di Masjid Raya Al-Mashun.

Pemkab Paluta sebagai Kepala Seksi (Kasi) Mutasi. “Saya tidak ada menerima fee Rp620 juta dan saya tidak kenal Ridwan Winata,” tuturnya. Sementara Bupati Paluta Bachrum Harahap dalam keterangannya, mengaku hanya mengajukan permohonan anggaran untuk pengadaan Alkes di RSUD Gunung Tua ke Pemerintah Provinsi Sumut. Pasalnya, proyek tersebut menggunakan dana BDB-P (Bantuan Daerah BawahanPerubahan)danAPBDP Provinsi Sumut, untuk pengadaan alat kesehatan pada 2012. Setelah anggaran tersebut turun dari Pemprovsu sebesar Rp10 miliar, Bachrum mengaku tidak tahu lagi. Sebab, pelaksanaan proyek tersebut telah dikuasakannya kepada Direktur RSUD Gunung Tua Naga Bakti Harahap. “Saya hanya mengajukan permohonan ke provinsi. Pelaksanaannya saya tidak tahu, karena sudah saya kuasakan seluruhnya kepada Dirktur RSUD

Gunung Tua Naga Bakti Harahap,” katanya. Sebelumnya diberitakan, Wali Kota Padangsidempuan Andar Harahap diduga menerima fee sebesar Rp620 juta dari pengadaan alat kesehatan (Alkes) di RSUD Gunung Tua, Padang Lawas Utara (Paluta). Dugaan itu mencuat karena namanya disebut-sebut dalam d a k w a a n p a r a t e rd a k w a menerima uang Rp620 juta dari pengusaha Ridwan Winata. Selain Andar, terdakwa Naga Bakti Harahap juga menerima fee Rp400 juta, Rahmat Taufik Hasibuan menerima Rp70 juta, dan Henry Hamonangan Daulay Rp89 juta. Andar kebagian fee proyek tersebut diduga karena dia anak kandung Bupati Paluta Bachrum Harahap. Untuk pengadaan Alkes tersebut, RSUD Gunung Tua mendapatkan alokasi dana Rp10 miliar dari BDB-P dan APBD-P Provinsi Sumut pada 2012. Sebagai pengguna anggaran, Naga Bakti Harahap meng-

umumkan lelang proyek pengadaan Alkes itu. Rahmad Taufik Hasibuan yang diangkat sebagai PPK membuat penetapan Harga Perkiraan Sementara (HPS). Namun, HPS ini ternyata tidak didasarkan hasil survei, melainkan disusun Ridwan Winata, pemilik PT Magnum Global Mandiri (MGM), yang telah disepakati sebagai pemenang dalam pengadaan Alkes itu. Ridwan menjanjikan fee dari mark-up harga kepada mereka. Modus yang digunakan, empat perusahaan dengan direktur berbeda-beda ikut tender proyek itu merupakan kepunyaan atau dikendalikan Ridwan Winata. Dari keempatnya, panitia menetapkan PT Aditya Wiguna Kencana sebagai pemenang tender dan PT Winatindo Bratasena sebagai pemenang cadangan. Padahal, tidak satu pun peserta lelang memenuhi persyaratan. Berdasarkan audit BPKP Sumut, para terdakwa telah mer ugikan negara Rp5.463.790.522. (m38)

Pedagang Lantai I Pusat Pasar Tolak Relokasi MEDAN (Waspada): Pedagang pakaian di lantai satu Pusat Pasar Medan, menolak kebijakan Perusahaan Daerah (PD) Pasar Kota Medan, yang akan merelokasi mereka ke lantai III yang baru saja selesai dibangun. Kebijakan itu dilakukan karena zooning (penempatan) pedagang di lantai satu Pusat Pasar dikhususkan untuk pedagang tilam, pedagang sampah juga kerajinan tangan. “Kami mendapat surat edaran dari PD Pasar tertanggal 13 Maret lalu, dan dalam surat itu kami diberikan deadline untuk pindah ke lantai III Pusat Pasar dalam waktu satu minggu. Kami tidak mau,” ujar Rumondang, pedagang kain di Pusat Pasar Medan kepada wartawan, Senin (17/3). Rumondang mengakui, selama 24 tahun berjualan pakaian di lantai I Pusat Pasar Medan tidak pernah ada masalah. “Kami sudah lama berjualan di sini, tak pernah ada masalah. Lagi pula kita juga mau mempertanyakan kategori zooning yang dibuat PD Pasar itu, misalnya pedagang sampah itu seperti apa kategorinya juga tilam dan kerajinan tangan? Ini kan harus jelas juga kategorinya,” sebutnya. Pedagang lainnya, Azwir mengatakan, pedagang sebenarnya suka dengan penegakkan aturan, tapi aturan yang diterapkan itu harusnya dikaji juga, pasalnya sudah 25 tahun aturan itu tidak pernah ditegakkan. “Saya suka ditegakkan aturan, tapi kalau mau ditegakkan aturan kita kan harus siap. Ini tiba-tiba dalam waktu satu minggu diberi tenggat waktu,

sementara kita juga harus menyelesaikan utang kami di bank. Kalau yang ada modal bisalah langsung pindah ke atas, tapi kalau yang tidak ada modalnya bagaimana? Makanya kami minta harus ada solusi jalan keluarnya bagi kami,” tuturnya. Dia meminta agar PD Pasar dapat memutihkan saja sebanyak 190 pedagang kain yang tidak sesuai dengan zooning yang telah ditetapkan PD Pasar di lantai I. “Kalau bisa sudahlah diputihkan saja keberadaan kami, agar kami bisa dapat tetap berdagang di lantai I,” katanya. Sementara itu, Dirut PD Pasar Beny mengatakan, kalau untuk diputihkan hal itu tidak memungkinan. Pihaknya melakukan kebijakan ini agar keberadaan pasar tradisional di Kota Medan dapat tertib dan ditata ulang. “Kami hanya berupaya untuk menerapkan aturan yang ada. Dalam aturannya di lantai 1 itu zooningnya untuk pedagang tilam, kelambu, barang sampah, juga kerajinan tangan seperti ulos. Hal kedua kami lakukan ini karena penataan pasar juga sudah masuk dalam penilaian Adipura, selain itu kami juga mau menindaklanjuti hasil temuan BPK adanya kelebihan kontribusi pedagang di lantai I karena perbedaan jenis dagangan. Padahal kontribusi itu tidak ada masuk ke kantong kami, itu masuk semua ke kas Pemko, tapi BPK mempertanyakan hal itu karena pedagang di lantai I berjualan tidak sesuai dengan zooning,” ujar Beny. Menurut dia, sebelumnya BPK RI Perwakilan Sumut telah menemukan kontribusi peda-

gang di lantai I berbeda-beda, karena memang kontribusi pedagang kain dengan pedagang sampah, tilam dan kerajinan tangan itu berbeda. “Memang kontribusi pedagang kain itu lebih besar, dan zooning nya itu di lantai II, makanya kebijakan kita akan memindahkan mereka ke lantai III,” sebutnya. Kata Beny, aturan zooning itu sudah dibuat oleh direksi PD Pasar Medan sebelumnya sejak tahun 1993, dan dulu saat Kadis Pasar bernama Josen Sinaga, keberadaan pedagang kain di lantai I ini juga sudah pernah ditertibkan. “Aturan ini memang merupakan kebijakan direksi, dan pedagang juga sudah pernah ditertibkan di masa Kadis Pasarnya Josen Sinaga,” ujarnya. Jumlah pedagang kain di lantai I sebanyak 190 orang, sedangkan jumlah pedagang kain di lantai II 1.250 orang. “Kalau kita lepas tanpa ada zooning, bisa jadi pedagang kain yang berada di lantai II pindah ke lantai I, dan lantai II nanti menjadi kosong. Makanya kita sesuaikan ke aturannya,” tuturnya. Wakil Ketua DPRD Medan Ikrimah Hamidy mengatakan, pertemuan itu dilakukannya sesuai dari masukan masyarakat, karena pedagang kain menerima surat edaran dari PD Pasar yang meminta agar dalam waktu satu minggu harus mengosongkan kios dan pindah ke lantai III. “Di sini kita mencari solusi karena tidak mungkin pedagang pindah dalam waktu yang sempit, jadi kita undang pihak PD Pasar dan juga pihak perwakilan pedagang untuk membicarakannya baik-baik,” kata Ikrimah. (m50)

Perampok Modus Gembos Ban Beraksi, Rp5 Juta Lewong MEDAN (Waspada): Aksi perampokan dengan modus gembos ban kembali beraksi. Kali ini korbannya Gustiawan, 44, warga Jln. Karya Jaya Gang Karya, Kel. Pangkalan Mansur, Medan Johor. Tas ransel warna hitam berisikan dokumen penting dan handphone mereka Samsung dibawa kabur pelaku dari dalam mobil Kijang Inova BK 1254 K milik korban yang bannya gembos dan diparkirkan di Jln. Brigjen Hamid, Kel. Titi Kuning, Kec. Medan Johor, Senin (17/3) sekira pukul 15:00.

Peristiwa tersebut berawal saat korban yang mengendarai mobil Kijang Innova berangkat dari kediamannya untuk mengurus surat-surat kendaraannya itu. Ketika melintas di Jln. Brigjen Hamid, ban belakang sebelah kiri mobilnya mengalami kempis ban, sehingga korban menghentikan kendaraannya di pinggir jalan. Selanjutnya, korban meninggalkanmobilnyadanpergikearah Jln. Brigjen Katamso dengan menumpang angkutan umum untuk mencari tukang tambal ban. Selesai dari tukang tambal

ban,korbankembalikemobilnya. Korban terkejut melihat pintu mobilnya telah rusak dan ketika dilakukan pemeriksaan ternyata satu tas ransel berisi dokumen penting dan handphone yang ditinggal dalam mobil sudah hilang. Akibatnya, korban mengalami kerugian berkesar Rp5 juta dan melaporkannya ke Polsek Delitua. Kapolsek Delitua Kompol Wahyudi SIk, melalui Kanit Reskrim Iptu Martualesi Sitepu saat dikonfirmasi membenarkan pihaknya telah menerima laporan pengaduan korban. (m40)

Waspada/Andi Aria Tirtayasa

MASJID Ar Rahman yang berlokasi di Jln. Prof HM Yamin simpang Jln. Sentosa Baru, Kel. Sei Kera Hulu, Kec. Medan Perjuangan, telah rampung pembangunannya dan dijadwalkan akan diresmikan, Jumat (28/3).

Pembangunan Masjid Ar Rahman Rampung MEDAN (Waspada): Setelah hampir dua tahun, pembangunan Masjid Ar Rahman di Jln. Prof HM Yamin simpang Jln. Sentosa Baru, Kel. Sei Kera Hulu, Kec. Medan Perjuangan, telah rampung. Rencananya, panitia pelaksana pembangunan akan menggelar peresmian Masjid Ar Rahman, Jumat (28/3) mendatang. Pengurus Badan Kemakmuran Masjid Ar Rahman Mangpapa Lubis, Senin (17/3) menjelaskan, Masjid Ar Rahman dijadwalkan akan diresmikan oleh salah seorang donatur yakni Prof Dr Ir Hj Darmayanti Lubis dan akan dihadiri Muspika Medan Perjuangan, seluruh donatur dan jamaah masjid tersebut. Pihaknya juga akan mengundang pengurus BKM masjid lainnya termasuk ormas Islam dan pengurus MUI Kota Medan, serta Kepala Kemen-

terian Agama Kota Medan. Menurut Mangpapa, pihaknya sangat bersyukur kepada Allah SWT karena pembangunan masjid yang dilaksanakan selama dua tahun dengan biaya Rp2 miliar lebih itu dapat terlaksana seperti yang diharapkan bersama. Panitia pembangunan juga mengucapkan terimakasih kepada para donatur muslim lainnya. “Alhamdulillah masjid ini dapat berdiri megah dan diharapkan umat Islam dapat semakin khusuk beribadah dan mari sama-sama kita makmurkan masjid ini,” kata Mangpapa didampingi Ketua Panitia pembangunan H Habincaran Lubis, M Syaiful Lubis, Syahrial Effendi Nasution, dan Hendra Kurniawan Hasibuan. Kata dia, pada peresmian Masjid Ar Rahman nantinya akan diisi ceramah dari seorang muallaf Ustadz M Ghazali Pasaribu. (h04)

Terkait Kasus Korupsi Alkes

Polisi Segera Panggil Dirut RSUD Pirngadi MEDAN (Waspada): Polresta Medan dalam waktu dekat ini akan melayangkan surat panggilan kepada Dirut RSUD Pirngadi Medan, terkait kasus korupsi alat kesehatan (Alkes) di RSUD Pirngadi Medan. “Tidak tertutup kemungkinan segera kita panggil, selain ketiga tersangka yang sudah kita tahan, masih ada tersangka lainnya yang terlibat (bersubahat) terkait dugaan kasus korupsi tersebut. Kita juga sudah komit, akan secepatnya menuntaskan kasus ini sehingga seluruh tersangka bisa segera ditahan,” ujar Kasat Reskrim Polresta Medan Kompol Jean Calvijn Simanjuntak, Senin (17/3). Tiga tersangka yang sudah ditahan yakni KA, 45, warga Jln. Setia Budi Medan selaku pemenang tender Alkes yang menggunakan nama perusahaan PT Indofarma Global Medica (IGM), Suk, 50, PNS RSU Pirngadi Medan, warga Jln. Polonia Medan, sebagai pejabat pembuat komitmen (PPK), dan AA, 45, warga Tangerang sebagai pelaksana kontrak. Disinggung mengenai Tim Reskrim Unit Tipikor Polresta Medan yang berangkat ke Jakarta, Calvijn mengaku, sudah kembali ke Medan Minggu (16/3). “Tim Tipikor yang berangkat ke Jakarta sudah kembali ke Medan. Tugas mereka melakukan penggalian informasi atau petunjuk terkait kasus dugaan korupsi Alkes di RSUD Pirngadi Medan sebesar Rp2,5 miliar yang dilaporkan pada bulan Juli 2013 lalu,” katanya,

Calvijn menjelaskan, seluruh data yang dikumpulkan oleh Tim Tipikor tersebut akan dipelajari. Bahkan, pihaknya juga akan melakukan gelar perkara untuk memudahkan penyidikan. “Yang pasti, proses perkembangan kasus ini sudah jelas, mulai dari tahapan penyidikan, audit dan hasil audit kerugian negara hingga penetapan serta penahanan terhadap 3 tersangka,” sebutnya. Modus yang dijalankan ketiga tersangka yakni mengarahkan merek Alkes dari distributor tertentu untuk dijadikan bahan dalam pelelangan. Kemudian, harga Alkes di mark up hingga pembayaran 100 persen kepada rekanan. Alkes yang di mark up antara lain anestesi, kamera PCNL, LMA dan Vigon. Kerugian negara akibat perbuatan tersangka mencapai Rp3 miliar. Peran ketiga orang yang ditahan ini yakni, tersangka KA selaku pemenang tender mendapat keuntungan dari proyek ini sebesar Rp900 juta. Kemudian pejabat RSU Pirngadi berinisial Suk menerima gratifikasi dari KA berupa tiket perjalanan ke luar negeri. Sedangkan tersangka AA menerima keuntungan atau fee sebesar Rp200 juta karena perusahaan miliknya PT IGM digunakan oleh KA untuk mengikuti tender tersebut. Ketiga tersangka dikenakan pasal 2 ayat 1, pasal 3, 5, 12b UU Korupsi No. 20 tahun 2001 tentang perubahan UU No. 31 tahun 1999 tentang Pemberantasan Tindak Pidana Korupsi dengan ancaman hukuman 15 tahun. (m39)


Nusantara

WASPADA Rabu 19 Maret 2014

A7

Perintah Kapolri Pada Seluruh Kapolda:

Petakan Kerawanan Pemilu Di Daerah JAK ARTA ( Waspada): Kapolri Jenderal Polisi Sutarman memerintahkan seluruh Kapolda memetakan kerawanan dan memberikan pengamanan khusus kepada para calon legislatif (caleg) mulai dari kabupaten/kota, provinsi sampai pusat dan khusus untuk pasangan calon presiden dan wakil presiden. “Para Kapolda diminta untuk memetakan potensi rawan Antara

PELANTIKAN KAPOLDA METRO JAYA: Kapolri Jenderal Polisi Sutarman memasang tanda jabatan kepada Irjen Pol Dwi Priyanto (dua kiri) pada acara sertijab Kabaharkam dan 5 Kapolda di Mabes Polri, Jaksel, Selasa (18/3). Irjen Pol Dwi Priyanto resmi menjadi Kapolda Metro jaya menggantikan Irjen Pol Putut Eko Bayuseno yang menjadi Kabaharkam Polri.

Perjanjian Batu Tulis Benar Ada, Tapi Tidak Diaktekan Notaris JAKARTA ( Waspada): Anggota Dewan Pembina Partai Gerakan Indonesai Raya (Gerindra) Martin Hutabarat menegaskan bahwa perjanjian Batu Tulis di tahun 2009 antara Gerindra dan PDI Perjuangan benar-benar. Tapi, perjanjian ini bukanlah perjanjian yang diaktekan oleh Notaris. “Perjanjian Batu tulis di tahun 2009 adalah benar-benar ada dan dibuat pada malam terakhir sebelum batas waktu pendaftaran pasangan Capres/ Cawapres, besok Sabtunya. Tapi perjanjian ini bukanlah perjanjian yang diaktekan oleh Notaris, “ujar Martin Hutabarat menjawab Waspada melalui

BBM-nya, Selasa (18/3). Menurut anggota Komisi III DPRRI ini, perjanjian itu adalah perjanjian politik yang dibuat oleh negarawan-negarawan yang menjadi pemimpin dua partai besar, yang memiliki visi dan wawasan politik kebangsaan yang relatif sama. Sesudah Pilpres 2009, meskipun Ibu Megawati dan Pak Prabowo tidak terpilih menjadi Presiden dan Wapres, namun, tambah Martin, hubungan kedua Partai tetap hangat. Bahkan, pernah pula almarhum Taufik Kiemas mewacanakan untuk menjadikan PDIP dan Gerindra menjadi satu Fraksi. Begitu juga dalam menjadikan

Jokowi- Ahok sebagai Gubernur/Wagub DKI, PDIP dan Gerindra tetap solid, meskipun menghadapi banyaknya tantangan dan cobaan. “Melihat latar belakang hubungan kedua partai, perjanjian ini tidak terbayangkan menjadi ramai. Sebab Perjanjian politik ini sebenarnya yang diperlukan adalah ketulusan dari masing-masing partai, dan pimpinan partai, untuk melaksanakannya. Ketulusan dan jiwa besar dari pimpinan-pimpinan partai itulah sebenarnya kunci dari dilaksanakan atau tidak isi perjanjian tersebut,” tukas Martin Hutabarat. (aya)

Akil-Hambit Perang Mulut JAKARTA (Waspada): Mantan Ketua Mahkamah Konstitusi Akil Mochtar beradu mulut dengan Bupati Gunung Mas terpilih Hambit Bintih. Silat lidah keduanya terjadi dalam persidangan di Pengadilan Tindak Pidana Korupsi, Senin (17/3) malam. Perang mulut itu terjadi ketika Akil sebagai terdakwa kasus dugaan suap pengurusan sengketa Pilkada (pemilihan kepala daerah) di MK mendapat kesempatan bertanya kepada Hambit yang menjadi saksi di persidangan. Awalnya, Hambit membantah berinisiatif memberikan suap kepada Akil untuk sengketa Pilkada Gunung Mas, Kalimantan Tengah. Hambit mengaku ditawari oleh politikus Partai Golkar, Chairun Nisa, dan orang dekat Akil bernama Dodi. Menurut Hambit, Nisa dan Dodi menawarkan untuk menghubungkan Hambit dengan Akil. “Ibu Nisa tawarkan saya untuk ketemu terdakwa (Akil). Dodi juga mengaku dekat de-

ngan terdakwa, jadi saya untuk check balance. Saya coba melalui keduanya,” ujar Hambit. Mendengar pengakuan itu, Akil menegaskan, ia tak pernah meminta Nisa atau Dodi mendekati Hambit. Akil juga mengaku pernah menolak Dodi dan Hambit ketika ingin menemuinya. “Ketika Dodi minta pada saya, Saudara mau ketemu saya dengan melas-melas, sebenarnya saya tidak mau terima Saudara. Itu saya sampaikan, saya bilang saya tidak bisa ketemu Saudara,” kata Akil. Namun, akhirnya Hambit bisa bertemu Akil. Menurut Akil, saat itu tidak ada pembicaraan soal uang. Hambit pun membenarkan tidak ada pembicaraan soal uang secara langsung kepada Akil. Namun, menurut Hambit, setelah itu Akil mengatakan untuk urusan uang dapat melalui Nisa. Mendengar pernyataan Hambit ini, Akil kembali naik darah.“Anda yang bilang urusan tadi sama Ibu (Nisa),” kata Akil dengan nada tinggi.“Ya, terserah

Bapak,” jawab Hambit. Akil menuding Hambit berbohong di persidangan. “Saudara berbohong, tapi Tuhan kan tahu. Saudara beriman, kan? Belum budaya juga kan, Saudara nanti disumpah secara adat juga, loh,” kata Akil. “Kita sama-sama beriman. Saya ngomong apa adanya,” timpal Hambit dengan nada santai. Suasana sidang sempat memanas. Jaksa Penuntut Umum Komisi Pemberantasan Korupsi (KPK) berusaha membuka pembicaraan kepada Ketua Majelis Hakim Suwidya. Namun, ucapan jaksa dipotong oleh Akil. “Saya juga punya hak untuk bertanya,” kata Akil dengan raut wajah emosi. “Tapi, jangan maksa kehendak,” timpal jaksa. Ketua Majelis Hakim beberapa kali menengahi perdebatan keduanya. Namun, Akil terus melanjutkan pertanyaan dan adu mulut kembali terjadi hingga akhirnya Majelis menskors sidang hingga minggu depan.(Kc)

Alexander Rusli Ketua ATSI Yang Baru JAKARTA ( Waspada): Alexander Rusli terpilih sebagai Ketua Asosiasi Penyelenggara Telekomunikasi Seluruh Indonesia (ATSI) untuk periode 20142016. Dia yang juga President Director dan CEO PT Indosat, dipilih melalui Rapat Umum Anggota ATSI yang digelar di Bandung, Senin (17/3). Dalam kesempatan yang sama, Alex J. Sinaga, Direktur Utama Telkomsel, terpilih sebagai Ketua Dewan Pengawas ATSI untuk periode yang sama. Rapat dengan agenda utama pemilihan ketua dan kepengurusan baru ATSI untuk periode 2014-2016 itu dihadiri oleh dewan pengawas, pengurus dan seluruh anggota ATSI. Dalam sambutannya, Alexander Rusli mengatakan kepercayaan yang diberikan kepadanya adalah amanah dan tanggung jawab. Tanggung jawab ini, kata Alexander, akan

diwujudkannya dengan berbagai program yang fokus utamanya untuk memperkuat organisasi ATSI, sekaligus berkomitmen meningkatkan peran ATSI untuk memajukan telekomunikasi nasional. Selain itu, Alexander juga berjanji akan memperkuat kerjasama baik dengan regulator maupun antar operator guna mewujudkan kualitas layanan yang semakin baik untuk masyarakat pengguna telekomunikasi. “Layanan yang semakin baik itu, pada akhirnya diharapkan mampu memberikan kontribusi signifikan terhadap pertumbuhan ekonomi Indonesia,” kata Alexander sebagaimana keterangan persnya kepada wartawan di Jakarta, Selasa (18/3). ATSI memiliki peran strategis tidak hanya di dalam industri telekomunikasi sendiri, namun juga turut mendorong pertum-

buhan dan pembangunan ekonomi yang lebih luas. Berbagai peran strategis ATSI dalam industri diantaranya menjadi mitra strategis pemerintah dalam merumuskan berbagai kebijakan dalam industri telekomunikasi. ATSI juga menjadi mediator dalam menyelesaikan berbagai permasalahan di dunia telekomunikasi untuk melindungi kepentingan anggota dan masyarakat. Di sisi lain, organisasi ini secara aktif juga menjalankan tanggung jawabnya untuk menyosialisasikan perkembangan teknologi dan layanan telekomunikasi. Berbagai ajang Indonesia Cellular Show serta berbagai program seperti seminar dan diskusi dilakukan guna mencapai kemajuan teknologi dan layanan telekomunikasi bagi seluruh masyarakat Indonesia. (dianw)

Olah Raga Teratur 15 Menit/Hari Hindarkan Penyakit Berbahaya JAKARTA (Waspada): Olah raga semakin jarang dilakukan para masyarakat, khususnya eksekutif muda. Di tengah kesibukan yang segudang, olah raga seperti sesuatu yang sangat sulit dilakukan. “Padahal olah raga secara teratur 15 menit saja dalam sehari, mampu menghindarkan seseorang dari berbagai risiko penyakit berbahaya,” kata pakar kebugaran dan penggagas acara Indonesia Fitness and Health Expo (Ifex) 2014, Kadek Edy Sastradi, dalam keterangan pers jelang acara Ifex 2014 di Jakarta, Selasa (18/3). Saat ini, penyakit tidak menular terkait gaya hidup seperti kolesterol tinggi, hipertensi,

jantung koroner, diabetes, stroke dan jantung, menjadi pembunuh utama di berbagai negara, termasuk di Indonesia. Penyebabnya, selain gaya hidup tidak sehat seperti merokok, alkohol, makanan berlemak dan kurang istirahat, juga disebabkan kurang olah raga. Ifex 2014 dikatakan Kadek akan mendorong kesadaran masyarakat untuk aktif berolah raga dan menjaga kesehatan. Acara yang digelar 30 Mei sampai 1 Juni 2014 itu akan diikuti sejumlah pengusaha fitness di seluruh tanah air. “Di acara terse-but, selain dipamerkan berbagai alat kebugaran juga diadakan diskusi tentang manfaat fitness dan olah

kebugaran yang terbaik saat ini dari pembicara dalam dan luar negeri,” kata Kadek. Dina Carol, salah satu pengusaha konsultan mengatakan, ada peningkatan signifikan dalam jumlah pengunjung pusat kebugaran di tanah air selama 10 tahun terakhir. Artinya, meski gaya hidup tidak sehat semakin menggoda dan menggerogoti kesehatan masyarakat, tapi masih ada keinginan menjaga kesehatan dengan berolah raga. “Kalangan menengah ke atas mulai menggemari olah raga di pusat kebugaran, dengan harapan tubuh lebih fit dan terhindar dari berbagai penyakit,” kata Dina Carol. (dianw)

pemilu dan berikan pengamanan para caleg mulai dari daerah/kota dan provinsi hingga pusat serta daerahnya yang ada capres dan cawapres,” perintah Kapolri Sutarman saat memimpin serah terima jabatan empat Kapolda di Gedung Rupatama Mabes Polri, Selasa (18/3). Hal tersebut diungkapkan Sutarman sejalan dengan semakin tingginya dinamika suhu politik yang telah memulai masa kampanye pada Minggu

Jawaban Jokowi Dibilang “Presiden Boneka” JAKARTA (Antara): Calon presiden (capres) dari Partai Demokrasi Indonesia Perjuangan (PDI-P) Joko Widodo (Jokowi) menilai masyarakat saat ini sudah pandai memilih, sehingga kampanye dengan cara saling menjelekkan tidak akan efektif. “Masyarakat tidak bodoh. Mereka sudah pintar, sudah bisa memilah-milah,” kata Jokowi usai makan siang di daerah Cipayung, Jakarta Timur, Selasa (18/3). Hal tersebut dikemukakan Jokowi terkait kekhawatiran sejumlah pengamat jika nanti Jokowi terpilih menjadi presiden maka dia akan menjadi “ presiden boneka” yang dikendalikan pihak-pihak lain. Lebih lanjut Jokowi mengatakan dirinya sudah terbiasa menerima kritik dari berbagai pihak termasuk lawan politik saat mengikuti pemilu. “Saya sudah berkali-kali ikut pemilihan. Pilkada Solo, Pilgub di Jakarta, kalau diejek-ejek ya sudah biasa,” katanya. Jokowi menyatakan dirinya tidak ingin terjebak dalam skenario politik saling serang dalam pemilu 2014. “Saya tidak akan menanggapi hal seperti itu. Kalau mau menyerang, silakan. Mau jelek-jelekin silakan, karena masyarakat tidak bodoh, sudah pintar, sudah bisa memilah-milah,” katanya.

IKAHI Tunggu Klarifikasi Sekretaris MA Terkait Suvenir “iPod” JAKARTA (Antara): Pengurus Pusat (PP) Ikatan Hakim Indonesia (IKAHI) belum menentukan sikap terkait pembagian suvenir berupa Ipod (peranti musik) seharga 700 ribuan dalam resepsi pernikahan anak Sekretaris Mahkamah Agung (MA) Nurhadi. “PP IKAHI masih menunggu klarifikasi dari pihak Bapak Nurhadi,” kata Juru Bicara PP IKAHI Syamsul Maarif, saat dikonfirmasi di Jakarta, Selasa (18/3). Sehingga, lanjutnya, pihaknya belum menentukan sikap terkait pembagian “IPod” tersebut. Resepsi pernikahan anak Sekretaris MA Nurhadi yang digelar di Hotel Mulia Senayan, Sabtu (15/ 3) telah menjadi sorotan dari beberapa kalangan karena membagikan suvenir “iPod” kepada undangan. Undangan yang mencapai 2.500 ini dari berbagai kalangan khususnya, hakim/hakim agung turut menerima souvenir itu yang dinilai sebagai bentuk pelanggaran etik dan gratifikasi. Komisioner KY Imam Anshori Saleh menilai pemberian souvenir kepada hakim/agung belum bisa dikatakan sebagai bentuk pelanggaran etik. Namun dia menyarankan agar para hakim dan hakim agung yang menerima Ipod segera mengembalikannya kepada Sekretaris MA, Nurhadi, atau melaporkan ke KPK agar tidak timbul persepsi negatif dari masyarakat. Dalam SKB Ketua MA dan Ketua KY Tahun 2009 tentang Kode Etik dan Pedoman Perilaku Hakim (KEPPH) dan SK KMA No 215/KMA/SK/XIII/2007 tentang Juklak Pedoman Perilaku Hakim, ada ketentuan yang secara tegas melarang hakim menerima hadiah atau pemberian dari siapapun. “Karena Nurhadi bukan hakim, saya tidak bisa komentar. Tetapi, bagi para hakim yang menerima iPod itu untuk mengembalilkan suvenir ke Nurhadi atau lapor ke KPK,” kata Imam.

(16/3). Karena itu Kapolri menegaskan, agar para caleg diberikan pengamanan khusus hal ini merupakan tanggungjawab Polri sebagai pengamanan pemilu bersama dengan pemangku kepentingan lainnya. “Penga-manan pemilu harus dikelola dengan sungguhsungguh, tentu hasilnya optimal dalam bentuk pengamanan terbuka dan tertutup,” ucap Sutarman. Jenderal bintang empat itu menyatakan, untuk mengoptimalkan sentra gerakan penegakan hukum terpadu Pemilu 2014 dengan proses penyelidikan jika ada pelanggaran, sehingga perhelatan politik terbesar di tanah air ini menghasilkan pemimpin yang benarbenar demokratis. “Berdasar evaluasi tahun lalu kasus money politik (politik uang) paling banyak ditemukan,” katanya.

Dikatakannya lagi, tanpa seluruh anggota Polri yang solid dan dibantu oleh masyarakat, pengamanan pemilu tidak berjalan sebagaimana diharapkan. Kapolri melantik dan memimpin serahterima jabatan empat Kapolda yakni, Kapolda Metro Jaya dari Irjen Pol Putut Eko Bayuseno kepada Irjen Pol Dwi Priyatno yang sebelumnya Kapolda Jawa Tengah. Kapolda Jawa Tengah diisi dengan Brigjen Pol Noer Ali yang sebelum Kapolda Sumbar mengantikan Irjen Pol Dwi Priyatno. Sedangkan Kapolda Sumbar diisi oleh Brigjen Pol Bambang Sri Herwanto yang sebelumnya Karosunluhkum Divkum Polri dan Kapolda Bangka Belitung (Babel) Brigjen Pol Budi Hartono Untung dimutasi menjadi Widya Iswara Madya Sespim Polri.

Tindak Tegas Pengacau Pemilu Sementara Kapolda Metro Jaya, Irjen Pol Dwi Priyatno yang baru dilantik menggantikan Irjen Pol Putut Eko Bayuseno menegaskan, pihaknya akan menindak tegas pengacau dalam pelaksanaan Pemilu 2014 yang ada di wilayah Jakarta. “Prinsip kita, kalau ada pidana umum, merusak dan melakukan pe-ngeroyokan akan langsung di-tindak,” kata Dwi kepada warta-wan di Mapolda, Senin (18/3). Menurut mantan Kapolda Jawa Tengah itu, jika ada pelanggaran-pelanggaran dalam pelaksanaan pemilu akan tetap ditangani oleh sentra gabungan penegak hukum pemilu (Sentra Gakumdu) yang telah disiapkan oleh Polda Metro Jaya dengan beberapa instansi terkait.(j02)

KPK Panggil Kakak Ipar Anas JAKARTA (Antara): Komisi Pemberantasan Korupsi memanggil kakak ipar mantan Ketua Umum Partai Demokrat Anas Urbaningrum, Dina Zad, terkait kasus tindak pidana pencucian uang yang diduga dilakukan Anas. “Yang bersangkutan diperiksa untuk tersangka AU (Anas Urbaningrum),” kata Kepala Bagian Pemberitaan dan Informasi KPK Priharsa Nugraha di Jakarta, Selasa (18/3). Dina Zad diketahui menjadi orang yang namanya digunakan sebagai pemilik tiga bidang tanah di desa Panggungharjo - Bantul,Yogyakarta yang sudah disita KPK. KPK juga sudah menyita dua bidang tanah di Kelurahan Mantrijero Yogyakarta seluas

7.670 meter persegi dan 200 meter persegi atas nama mertua Anas, Attabik Ali dan rumah Anas di Jalan Selat Makassar dan Jalan Teluk Langsa C9/22 di Duren Sawit Jakarta Timur yang juga diatasnamakan Atabik Ali. Kyai Haji Atabik Ali adalah mertua Anas Urbaningrum, ayah Atiyyah Laila. KH Atabik Ali adalah anak dari KH Ali bin Maksum bin Ahmad, ulama yang dikenal sebagai orang yang memulai pesantren Al-Quran di Indonesia dan pendiri pondok pesantren Krapyak di Yogyakarta. Pesantren tersebut kemudian menjadi badan hukum dengan nama Yayasan Ali Maksum Pondok Pesantren Krapyak Yogyakarta yang dipimpin KH Atabik Ali.

Anas disangkakan melakukan TPPU sejak 5 Maret dengan ancaman pidana paling lama 20 tahun dan denda paling banyak Rp10 miliar. Sedangkan untuk tindak pidana korupsi, KPK menyangkakan Anas dengan pasal 12 UU no 31 tahun 1999 yang membuat Anas terancam pidana penjara seumur hidup atau pidana penjara paling singkat 4-20 tahun dan pidana denda Rp200Rp1 miliar. Anas dalam surat dakwaan mantan Menpora Andi Mallarangeng mendapat Rp2,21 miliar untuk membantu pencalonan sebagai ketua umum dalam kongres Partai Demokrat tahun 2010 yang diberikan secara bertahap pada 19 April 2010 hingga 6 Desember 2010.

KPK: Ada Pihak Yang Coba Kaburkan Kasus Ratu Atut J A K A RTA ( Wa s p a d a ) : Penyidik Komisi Pemberantasan Korupsi masih melakukan pendalaman terhadap sejumlah kasus yang menjerat Gubernur Banten, Ratu Atut Chosiyah. Wakil Ketua KPK Bambang Widjojanto mengungkapkan, dalam perkembangannya, KPK menemukan sejumlah pihak yang disinyalir mencoba menghalangi proses penyidikan. ”Pengembangan yang lain itu kan ada pihak-pihak lain yang mempunyai peran mengaburkan kasus ini,” kata Bambang di Jakarta, Selasa (18/3).

Dia menuturkan, penyidik kini juga tengah fokus kepada hal itu. Sebab menurutnya, pihak-pihak tertentu sudah bertindak keterlaluan dalam mencoba mengaburkan kasus yang menjerat orang nomor satu di Banten itu. Bambang mengaku institusinya mulai memanggil satu per satu pihak yang diduga mencoba menghalangi proses penegakan hukum tersebut. “Kami ingin konsentrasi karena itu obstruction of justice, karena secara sengaja mengelabui, ingin bermaksud mengelabui ingin mengaburkan proses pene-

gakan hukum,” ujarrnya. Dia memastikan KPK siap bertindak tegas terhadap pihakpihak yang mencoba menghalangi penyidikan. “(Mereka) Bisa kena pasal 21 atau bisa kena pasal 22,” ucap dia. Ratu Atut Chosiyah resmi dijadikan tersangka dalam kasus dalam penyelesaian kasus suap sengketa pilkada Lebak, Banten, di Mahkamah Konstitusi (MK), Selasa 17 Desember 2013. Selain kasus suap ini, KPK juga menjerat Ratu Atut dengan kasus dugaan korupsi pada pengadaan alat kesehatan di Banten. (vn)

TI Di Pemilu 2014 Akan Maskapai Penerbangan Di Indonesia Jadi Perhatian Khusus Tidak Masuk Daftar Paling Aman JAKARTA (Waspada): Partai Demokrasi Indonesia (PDI) Perjuangan menyebutkan bahwa pihaknya masih merasa trauma dengan kejadian di pemilu dan pilpres 2009, karena itu pihaknya akan memberi perhatian khusus kemungkinan terjadinya kecurangan pada sistem teknologi informasi (TI) di pemilu dan pilpres 2014 ini. Menurut Wasekjen PDIP, Hasto Kristiyanto, saat itu TI pemilu menjadi salah satu sumber masalah dan sumber dugaan kecurangan pemilu. Ia mencontohkan kejadian saat proses penghitungan suara oleh KPU di Hotel Borobudur Jakarta di tahun 2009, dimana tiba-tiba listrik di hotel itu mati. Untuk itu, Hasto mengakui PDIP sudah melakukan simulasi sistem IT pemilihan umum. “Ini yang jelas akan diwaspadai,” ujar Hasto di Jakarta, Selasa (18/3). Dia tak merinci bagaimana PDIP bisa memperoleh kalkulasi itu, sekaligus siapa yang berpotensi melakukannya. Menurut Hasto, yang pasti PDIP akan mengawasi dengan ketat proses pemilu. Khususnya saat perhitungan suara, demi menghindarkan kejahatan sejenis. PDIP membangun jaringan saksi dan kader yang akan bekerja memantau suara dari TPS hingga tingkat di atasnya. (aya)

30 Orang Korban Pengobatan Laporkan UGB Ke Mabes Polri JAKARTA (Waspada): Sekitar 30 orang korban penipuan pengobatan Ustad Guntur Bumi (UGB), melapor ke Mabes Polri, Senin (17/3).Hampir seluruh korban dari setiap daerah yang berada di Indonesia berdatangan ke kantor besar kepolisian itu untuk meminta ganti rugi, seperti yang telah dijanjikan UGB. Kuasa hukum korban penipuan UGB, Hudy Yusuf datang ke Mabes Polri beserta 30 orang korban yang berasal dari berbagai daerah yang ada di Indonesia untuk melaporkan UGB meminta ganti rugi selama berobat dengan UGB. Dimana sebelumnya, UGB pernah menjanjikan akan segera mengganti kerugian materil, yang dikeluarkan pasien yang berobat kepadanya. “Ke sini bawa 30 orang, kami laporkan UGB ke Mabes Polri. Pasien yang datang dari Bandung, Bogor, Banten, Lampung bahkan dari Kalimantan juga ada. UGB kan sempat janji mau bayar seluruh kerugian korban,” kata Hudy di Mabes Polri, Senin (17/3). Sejak, keputusan Majelis Ulama Indonesia (MUI) tentang pengobatannya, UGB belum juga melunasi segala kerugian yang dialami korban. Untuk itu, Hudy melaporkan keluhan kliennya itu agar pihak kepolisian segera menindak lanjuti mengenai hal tersebut. “Tapi nyatanya baru beberapa hari dia malah nggak mau bayar. Kami hanya minta komitmen beliau saja. Seperti pernyataan dia kemarin di MUI yaitu bertobat, menutup prakteknya jika mengulangi serta mengganti kerugian,” terang Hudy. Hudy mengatakan, dari 30 pasien yang melapor ke Mabes Polri, mereka baru dibayar setengah ganti ruginya oleh UGB. “Baru 50 persen, sisa tinggal 30 pasien lagi yang belum diganti kerugiannya. sekarang ngelapor Lagi,” kata Hudy.(j02)

JAKARTA (Waspada): Dari sekian maskapai penerbangan yang ada di Indonesia tidak ada satu pun yang masuk dalam daftar maskapai penerbangan paling aman di dunia. Ini bisa dilihat daftar maskapai penerbangan dengan tingkat keamanan paling tinggi di dunia yang dikeluarkan Travel + Leisure (T + L), sebuah situs perjalanan yang berbasis di NewYork, Amerika Serikat. Dari 20 maskapai penerbangan yang masuk dalam daftar maskapai penerbangan paling aman di dunia, tak satupun ada maskapai penerbangan dari Indonesia. T+L mengumpulkan data dari badan peringkat transportasi udara Air Transport Rating Agency (ATRA) dan Jet Airliner Crash Data Evaluation Centre (JACDEC) yang masing-masing memiliki pendekatan berbeda dalam memberikan penilaian. ATRA berfokus pada risiko penerbangan dan analisis data lanjutan, sementara JACDEC menggunakan sejumlah faktor untuk menentukan perhitungan tahunan termasuk insiden dan kecelakaan serius dalam kurun waktu 30 tahun terakhir dan kaitannya dengan poin Revenue Passenger Kilometer (RPK) dalam dalam rentang waktu yang sama. Ditambah dengan penilaian maskapai yang memiliki jejak rekam bersih sejak 1970, lalu dikurangi poin kecelakaan yang dialami masing-masing maskapai selama lima tahun terakhir. Juga memperhitungkan penerbangan dengan armada termuda berdasarkan peringkat Skytrax. Ada 20 maskapai teratas versi ATRA dan 60 maskapai teratas versi JACDEC sejak tahun 2012 yang dinilai. Dan hasilnya, maskapai penerbangan Eropa dan Amerika mendominasi hasi penilaian. Maskapai penerbangan asal Jerman Lufthansa menduduki

peringkat pertama dengan total 34 poin. Lufthansa beroperasi sejak 1920-an dan sempat berhenti padaPerang Dunia II lalu kembali terbang setelah perang berakhir. Saat ini, Lufthansa diperkuat oleh 300 armada yang melayani penerbangan ke 200 destinasi di dunia. British Airways menyusul di urutan ke dua dengan 33 poin. Maskapai penerbangan dari Inggris yang beroperasi sejak 1974 ini juga punya pelatihan kepada masyarakat tentang keselamatan penerbangan. Sementara Maskapai penerbangan dari Autralia, Qantas dan Maskapai Penerbangan asal Amerika Serikat, Southwest masing-masing berada di urutan ke tiga dengan 32 poin. Qantas punya catatan bagus, tidak pernah mengalami kecelakaan fatal sejak tahun 1951. Southwest Airlines kendati maskapai bujet, punya standar keamanan yang tinggi. Para pramugarinya pun terkenal ramah. Sedangkan satu-satunya maskapai perwakilan dari Asia Pasifik, tepatnya Hongkong, Cathay Pacific yang belum lama ini menyabet penghargaan

untuk kategori Best Cabin Crew pada Skytrax’s World Airline Awards, berhasil menempati peringkat lima dan mendapat 30 poin, Maskapai yang punya sejarah panjang ini, awalnya para pilotnya adalah pilot pesawat tempur. Mungkin, hal tersebutlah yang membuat para pilot setelahnya memahami cara membawa pesawat yang baik dan benar. Cathay Pacific juga menjadi yang terbaik pelayanan kepada penumpang, serta layanan in-flight. Keamanan adalah hal yang paling utama diharapkan para penumpang pesawat terbang saat berpergian. Tapi mengapa maskapai penerbangan Indonesia tak masuk daftar tersebut? Entahlah. Padahal Garuda Indonesia pernah terpilih sebagai maskapai terbaik kawasan Asia dan Australasia dalam Ajang Passengers Choice Awards 2013 di Anaheim, Amerika Serikat. Ketika itu garuda berhasil mengungguli lima maskapai penerbangan lain yang di-umumkan sebagai finalis, yaitu Singapore Airlines, Qantas Airways, Cathay Pacific, Air New Zealand, dan Pakistan Airlines. (adji k.)

Berikut daftar lengkap 20 maskapai penerbangan teraman di dunia versi Travel + Leisure: 1. Lufthansa – Jerman dengan 34 poin 2. British Airways – Inggrins 33 poin 3. Southwest – AS 32 poin 3. Qantas – Australia 32 poin 5. Cathay Pacific – Hingkong 30 poin 6. KLM – Belanda 29 poin 7. Emirates – Dubai 26,5 poin 8. United/Continental – AS 26 poin 9. Delta – AS 25 poin 10. US Airways- AS 24 poin 11. Finnair – 23,5 poin 12. Air Canada – Kanada 23 poin 13. Etihad Airways – 22,5 poin 14. Eva Air – 22 poin 15. Air France – Perancis 21 poin 15. Hainan Airways – 21 poin 17. Air New Zealand – Selandia baru 20,5 poin 18. Iberia – 20 poin 19. ANA AII Nippon Airways – 19,5 poin 20. JetBlue dan Virgin Atlantic – 19 poin


A8

22 Pentas

HariLagi

Pemilu 2014

WASPADA Rabu 19 Maret 2014

PR Pemerintah Banyak, Perlu Legislatif Yang Kuat

Delia Pratiwi Silaturahim Ke Desa Di Langkat

MEDAN ( Waspada): Pekerjaan Rumah (PR) pemerintah untuk mensejahterakan masyarakat masih banyak. Untuk itu ke depan dibutuhkan peran anggota dewan yang kuat dan mampu mendorong pemerintah untuk melaksanakan pembangunan secara merata sehingga masyarakat sejahtera. Anggota DPRD Sumut Zulkifli Husein (foto), berbicara kepada Waspada, Selasa (18/3). Pada Pemilu Legislatif tahun ini, dia kembali mencalonkan diri dari daerah pemilihan Sumut 3 (Deliserdang), melalui Partai Amanat Nasional (PAN). Zulkifli Husein menyebutkan setelah berkeliling di Deliserdang hampir lima tahun ini, dia melihat “PR” pemerintah begitu banyak sehingga keberpihakan pemerintah kepada masyarakat minim. Fasilitas yang dibangun pemerintah masih kurang memadai di seluruh sektor. ‘’Kita mau cerita sektor yang mana. Seluruhnya masih jauh dari harapan,’’ katanya. Misalnya di Deliserdang, menurut Zul Husein, infrastruktur untuk membantu nelayan, petani, sampai kepada sarana sosial masih minim. Sektor kelautan, katanya, masyarakat mendambakan sarana jalan ke desa-desa pantai sampai kepada bantuan alat tangkap dan pemasaran hasil perikanan; pertanian masyarakat mengharapkan penyediaan saluran irigasi di Kecamatan Pantailabu. “Di sana ada lebih kurang 300 hektare sawah yang belum memiliki irigasi.” Sektor kesehatan. Masyarakat, kata Zul Husein, masih diberatkan oleh program Badan Penyelenggara Jaminan Sosial (BPJS). Masyarakat mengaku tidak sanggup membayar iurannya dan meminta pemerintah menggratiskannya. Listrik dan sarana air bersih, kata Zul Husein, kekurangan sektor itu mengganggu aktivitas masyarakat. (m12)

STABAT (Waspada): Sejak beberapa bulan belakangan ini, Delia Pratiwi Sitepu kerap menyambangi warga pada beberapa desa di Langkat. Aktivitas seperti ini sudah sejak lama dilakoninya terutama menemani sang ibu yang juga rajin turun ke desa guna menjalin silaturahim bersama masyarakat. Tidak hanya itu sang bunda Hj Nuraida Ngogesa selaku Ketua TP-PKK Kab. Langkat kerap meluangkan waktu turun ke desa, juga menjalin silaturahim bersama kaum ibu, baik warga PKK maupun kelompok-kelompok perwiridan kaum ibu. Karenanya masyarakat Langkat terutama kaum perempuan sudah mengenal sosok putri bungsu dari Bupati Langkat Ngogesa Sitepu tersebut. Delia Pratiwi Sitepu dalam Pemilu 9 April 2014 mendatang maju sebagai calon legislatif untuk DPR RI dengan nomor urut 3 dari Partai Golkar. Delia Pratiwi tercatat mewakili Daerah Pemilihan III Sumatera Utara yang meliputi daerah Langkat, Binjai, Asahan, Simalungun, Pakpak Bharat, Dairi,Tanah Karo, Pematang Siantar, Batubara dan Tanjung Balai.

Hindarkan Anak Dari Akses Situs Porno MEDAN (Waspada): Fenomena pengaksesan situs porno oleh anak-anak melalui internet sudah memasuki taraf mengkhawatirkan. Karenanya anggota DPR RI Meutya Hafid (foto) mengimbau semua pihak untuk mencurahkan perhatiannya agar anak terhindar dari akses situs porno. Berbicara kepada wartawan belum lama ini, Meutya Hafid, anggota dewan yang duduk di Komisi I ini mengatakan rasa prihatinnya melihat fenomena yang terjadi sekarang ini. Kata Meutya, sekalipun menurut penelitian bahwa akses situs porno itu dilakukan anak tanpa sengaja, namun tetap saja hal tersebut merupakan hal yang buruk. ‘’Semua kita harus memperhatikan masalah ini. Termasuk Komisi Penyiaran Indonesia (KPI) dan Kementerian Komunikasi dan Informasi (Kominfo),’’ katanya. Sebagai anggota DPR RI, Meutya, mengaku sangat serius mencermati masalah ini. Karenapersoalan pornografi ini sudah demikian meresahkan, sehingga penanganannya tidak bisa hanya dilakukan oleh satu pihak saja. Meutya Hafid yang pada Pemilu Legislatif tahun ini kembali mencalonkan diri dari derah pemilihan (Dapil) Sumut 1 ini, mengatakan diperlukan sinergitas dari seluruh pihak untuk secara bersama-sama memberantas pornografi hingga ke akarnya. Sebagai anggota legislatif, Meutya, berjanji akan terus mendesak Kementerian Komunikasi dan Informasi melakukan tindak tegas terhadap persebaran situs atau pun media pornografi dan pornoaksi lainnya. Selain itu, mantan jurnalis ini berharap peran guru dan orang tua untuk melindungi anak-anak dari pornografi. (rel/m12)

Pencapresan Jokowi Tumbuhkan Kepercayaan Rakyat JAKARTA (Waspada): Keputusan Ketua Umum PDI Perjuangan Megawati Soekarnoputri untuk mencalonkan Joko Widodo ( Jokowi) sebagai calon presiden ( capres) PDIP merupakan keputusan yang ditunggutunggu dan diinginkan rakyat. “ Pencapresan Jokowi menumbuhkan kepercayaan rakyat dan bahkan pasar menyukai pilihan PDIP karena Jokowi dinilai mempunyai rekam jejak yang bersih, pro-rakyat, dan tegas,” kata politisi Partai Demokrasi Indonesia Perjuangan ( PDIP) yang juga anggota Komisi V DPR RI H. Irmadi Lubis (foto) kepada pers di Jakarta, Selasa (18/3). Irmadi menilai pertumbuhan kepercayaan rakyat dan sambutan positif dari pelaku ekonomi dan pengusaha atas pencapresan Jokowi merupakan sejarah. “Selama 69 tahun merdeka kita hanya berkutat pada masalah perut, pendidikan dan kesehatan. Setiap kita mendeklarasikan capres belum pernah ada sambutan seperti pencapresan Jokowi. Ini sejarah, “ tandasnya. Calon anggota legislatif PDIP untuk daerah pemilihan Sumut 1 ini pun melihat tumbuhnya kepercayaan rakyat, sebab sosok Jokowi dianggap pemimpin yang merakyat dan dekat dengan rakyat. “Cara berkomunikasi Jokowi pun telah mengubah ini cara berkomunikasi elite politik yang tadinya elitis, sekarang kerakyataan,” paparnya. Pada sisi lain Irmadi tidak menepis kemungkinan jika pilpers kali ini sangat spesial dengan kehadiran Jokowi sebagai capres. Kompetisi dalam Pilpres 2014 akan makin berkualitas dengan hadirnya tokoh-tokoh yang memiliki rekam jejak baik.(aya)

Mega Negarawan Sejati MEDAN (Waspada): Sekretaris Badan Pemberdayaan Ekonomi Kerakyatan (BPEK) DPP PDI Perjuangan Hj Siti Mariani, S.Sos, MM menilai penunjukan Jokowi sebagai Capres dari PDIP membuktikan Megawati Soekarnoputri seorang negarawan sejati Dia mengatakan itu, Minggu (16/3) di Medan usai melakukan kunjungan sosial ke beberapa desa di kabupaten/kota yang menjadi daerah pemilihannya. “Bisa saja Bu Mega mencalonkan dirinya dan menjadikan Jokowi cawapres dan kemungkinan menang. Tapi dia tidak melakukan itu, dan memilih mengapresiasi aspirasi rakyat,” ujar caleg DPR RI kelahiran Tanjungbalai ini. Siti Mariani mengaku selama bersosialisasi di 10 kabupaten/ kota di Dapil Sumut III, aspirasi rakyat berharap agar Indonesia dipimpin Jokowi. Mereka orang-orang yang belum akrab dengan media online. “Mereka hanya punya feeling bahwa negara ini akan menjadi lebih baik kalau ditangani Jokowi,” sebut mantan tim pemenangan Jokowi dalam suksesi Gubernur DKI. Selain melihat besarnya harapan rakyat pada Jokowi pada Pilpres, Siti Mariani mengutarakan keprihatinannya atas kondisi masyarakat di Sumut. Dia yakin di tangan Jokowi harapan rakyat dapat terwujud.(m27)

Waspada/Surya Efendi

POSTER CALEG DI POHON: Kendaraan melintas di samping pohon yang dipenuhi alat peraga kampanye (poster) milik sejumlah caleg DPRD Kota, DPRD Provinsi, DPR RI dan DPD di Jl. SMA 2, Karangsari, Polonia, Medan, Senin (17/3). Pemasangan poster di pohon itu selain merusak tanaman, juga merusak estetika dan keindahan kota.

Kampanye Di Paluta Sepi GUNUNGTUA (Waspada): Meski kampanye umum di Kabupaten Padanglawas Utara (Paluta) telah dimulai Minggu (16/3), namun tidak terdapat kampanye partai politik dan calon legislatif. Komisioner KPUD Paluta Arifuddin Muda Harahap, Selasa (18/3), mengatakan belum ada parpol yang memberitahukan kepada KPUD selaku panitia penyelengara tentang adanya pelaksanaan kampanye. “Sejak dimulainya hari pelaksanaan kampanye belum ada parpol yang memberitahukan kalau mereka akan berkampanye,” ujarnya. Padahal, lanjutnya, KPU

Paluta telah mengeluarkan jadwal kampanye serta zona kampanye untuk setiap dapil dan setiap harinya dijadwalkan empat parpol di setiap dapil dengan zona atau daerah kampanye yang telah ditentukan oleh KPUD Paluta. Sesuai dengan pleno yang ditetapkan KPUD, seharusnya partai yang akan berkampanye empat partai perharinya. Misalya hari pertama Minggu (16/3) yang berkampanye Hanura, PPP, PBB dan PKPI tapi pada kenyataannya keempat partai yang bersangkutan tidak ada memberikan surat pemberitahuan ingin berkampanye. “Keempat partai itu tidak ada

memberikan surat pemberitahuan, makanya di hari pertama sampai hari ketiga jadwal kampanye di daerah kita ini kosong,” jelas Arif Adapun daerah yang menjadi lokasi zona kampanye untuk Dapil 1 Kecamatan Padangbolak dan Kecamatan Portibi meliputi Desa Portibi Julu, Lapangan Purba Sinomba, Lapangan Transmigrasi Batang Pane I, II dan III, Lapangan Simanosor, Lapangan Nagasaribu, Lapangan Hutaimbaru 2, Lapangan Siunggam dan Lapangan Batang Baruhar Jae. Dapil 2 Kecamatan Dolok Sigompulon, Kecamatan Dolok dan Kecamatan Halongonan

meliputi Desa Hatiran, Lapangan Parigi, Lapangan Garuda Pasar Sipiongot, Pasar Simundol, Lapangan Siteurat, Pasar Sayur Matinggi Aek Bilah dan Lapangan Siancimun. Dapil 3 Kecamatan Simangambat yang menjadi zona kampanye yaitu Lapangan Desa Aek Raru, Lapangan Sionggoton, Lapangan Desa Marlaung dan Lapangan Simangambat Jae. Sementara itu untuk Dapil 4 Kec. Padang Bolak Julu, Kec. Batang Onang dan Kec. Hulu Sihapas meliputi Lapangan Padang Baruas, Lapangan Sipupus, Lapangan Pasar Aek Godang, Los pasar Matanggor dan Lapangan Batu Gana. (a35)

Anak Muda Suarakan Anti-Golput JAKARTA (Antara): Sekelompok anak muda yang menamakan dirinya komunitas Epicentrum Kebangsaan (CenSa) menyuarakan anti-golput (anti-tidak menggunakan hak suara) kepada kalangan pemuda menjelang Pemilu 2014.

“Golput tidak menyelesaikan masalah. Golput bagaikan bentukprotestanpakonteksyang jelas,” kata koordinator Epicentrum Kebangsaan Andrew melalui siaran pers yang diterima di Jakarta, Selasa (18/3). Andrew mengatakan anak

muda memegang peran penting dalam menentukan calon pemimpin bangsa. Caranya adalah dengan memilih calon pemimpin yang tepat dan mempunyai visi misi jelas. Terlebih, kata dia, jumlah pemilih muda sangat signifikan,

Kader Demokrat Agar Kampanye Tertib JAKARTA (Waspada): Dewan Pembina Partai Demokrat yang juga peserta Konvensi Calon Presiden Partai Demokrat Pramono EdhieWibowo mengimbau seluruh kader dan simpatisan partai Demokrat untuk tetap mematuhi peraturan Pemilu 2014 yang telah ditetapkan Komisi Pemilu (KPU). Hal ini disampaikan Edhie terkait pernyataan Badan Pengawas Pemilu (Bawaslu) bahwa semua partai peserta pemilu melakukan pelanggaran kampanye pada hari pertama (16/3). “Banyaknya keluarga Indonesia yang hadir melihat dan mendengarkan langsung informasi yang disampaikan juru kampanye menunjukkan antusiasme masyarakat untuk berpartisipasi dalam sebuah

gelaran pesta demokrasi,” ujar Edhie dalam siaran persnya yang dikirimkan ke Waspada, kemarin. Menurut mantan Kepala Staf Angkatan Darat (KSAD) ini, dia yakin pelanggaran yang banyak terjadi kemarin bukan sesuatu pelanggaran yang disengajaý. Seluruh kader partai, tambahnya , harus memahami betul peraturan yang ada seperti kehadiran anak-anak tidak diperbolehkan dalam sebuah kampanye terbuka partai politik. Selain itu peraturan Bawaslu menyatakan bahwa kegiatan kampanye di jalanan harus tetap mengindahkan peraturan lalulintas yang berlaku. “Semangat untuk melihat orasi politik sambil menikmati hiburan menjadi terkendala

ketika mereka berhadapan dengan tanggung jawab mereka sebagai orang tua. Kebanyakan orang tua Indonesia enggan meninggalkan anak-anaknya di rumah sendiri tanpa pengawasan,” tukasnya. Edhie sebagai juru kampanye nasioal Demokrat kemarin tampil berbagi panggung dengan Ketua Umum Partai Demokrat Susilo Bambang Yudhoyono di Bantul, Yogyakarta. Terkait kampanye terbuka, dia mengingatkan kadernya untuk tetap patuh pada peraturan kampanye. “Gunakan helm, ikuti aturan keselamatan dan lalulintas yang berlaku. Tinggalkan anak kecil bersama pengawas di rumah, dan ikuti kampanye dengan tertib dan santun,” ujar Edhie. (aya)

Waspada/ist

SUASANA kampanye simpatik DPD PAN Kota Medan.

DPD PAN Medan Gelar Kampanye Simpatik MEDAN (Waspada): Partai Amanat Nasional memulai masa kampanye dengan menggelar kampanye simpatik yang digelar di Kantor DPD PAN Kota Medan di Jalan Brigjen Katamso Kec. Medan Maimun, Senin (17/3) sore. Kampanye simpatik sekaligus konsolidasi antar sesama calon legislatif PAN ini, hadir para calon legislatif untuk DPRD Kota Medan dari lima daerah pemilihan. Selain itu hadir caleg untuk DPRD Sumut dari 2 daerah pemilihan dan caleg untuk DPR RI Abdullah Rasyid yang juga caleg untuk daerah pemilihan Sumut 1. Ketua DPD PAN Kota Medan Ahmad Arif saat dikonfirmasi mengatakan kegiatan ini dilakukan sekaligus konsolidasi dengan para caleg di DPD PAN Kota Medan terkait kegiatan sosialisasi yang telah dilakukan di masyarakat.

“Kampanye simpatik ini kita lakukan dengan upaya untuk mengimbau masyarakat agar mengunakan hak suaranya pada pemilu nanti,” ujarnya. Dikatakan Arif, kampanye simpatik ini dilakukan setelah para caleg PAN menggelar kegiatan dan sosialisasi di daerah pemilihannya masingmasing diharapkan masyarakat berperan aktif pada Pemilu 9 Juli nanti. Menurut Arif yang juga caleg nomor urut 1 untuk Dapil Medan 1 ini, kampanye simpatik ini akan terus dilakukan oleh caleg dan para kader PAN di Kota Medan dengan cara kunjungan langsung ke masyarakat. Arif mengatakan untuk kampanye akbar sendiri, PAN menggelarnya pada 5 Juli 2014. Dalam kampanye akbar nanti, PAN akan menurunkan massa secara maksimal. Ditambahkan Arif, saat ini

Ketua Umum PAN Hatta Rajasa telah mencanangkan perolehan suara 2 digit pada pemilu nanti. Hal tersebut target PAN di seluruh Indonesia. Target suara ini tanggung jawab bersama agar diperjuangkan secara maksimal. Sementara untuk di Kota Medan sendiri, Arif menegaskan target pencapaian PAN di kota Medan adalah menjadi 3 besar di Kota Medan dalam Pemilu legislatif nanti. “Target kita adalah PAN menjadi 3 besar di Kota Medan,” katanya. Seusai membuka kampanye simpatik di Kantor DPD PAN Kota Medan, selanjutnya Ketua DPD PAN Kota Medan, bersama para caleg dan ketua serta pengurus DPC PAN, melakukan kunjungan ke wilayah pinggiran sungai Babura, hal ini dilakukan sekaligus bagian dari kampanye simpatik dan menghimbau masyarakat untuk berperan aktif dalam pemilu.(m25)

sekitar 53 juta suara atau 40 persen dari 170 juta pemilih. Untuk mengajak pemilih muda tidak golput, Andrew mengatakan, pihaknya akan melakukan sosialisasi cara mengenal capres berkualitas, berpengalaman dan berintegritas. Sosialisasi itu dilakukan dengan cara mengajarkan pemuda untuk mencari tahu dan memverifikasi kualitas dan pengalaman calon pemimpin melalui teknologi informasi.

PKS Janji Larang Simpatisan Bawa Anak JAKARTA (Antara): Partai Keadilan Sejahtera (PKS) mengaku sudah berupaya mensosialisasikan peraturan kepada para kader dan simpatisan, mengenai larangan berkampanye yang melibatkan anak-anak. Partai nomor urut tiga itu mengklaim banyaknya anakanak pada rapat akbar kampanye nasional Minggu (16/3) kemarin, merupakan ihwal yang tidak disengaja, dan panitia juga sudah mengantisipasi dengan menyediakan sembilan posko penitipan anak. Kami menilai mungkin hal itu karena banyak kader PKS yang tidak bisa menitipkan anaknya dahulu, atau karena tidak punya pembantu. Namun, kami sudah sosialisasikan mengenai peraturan itu kepada kader,” kata Sekretrais Jenderal DPP PKS Taufik Ridho di Jakarta, kemarin. Untuk kampanye selanjutnya, PKS berjanji akan lebih berusaha keras untuk melarang kader dan simpatisannya melibatkan anak-anak dalam kampanye, sesuai Pasal 15 UU No 23/2002 tentang Perlindungan Anak. Sebelumnya, Komisi Perlindungan Anak Indonesia (KPAI) melaporkan PKS sebagai partai yang melibatkan anakanak paling banyak dalam berkampanye di hari pertama masa kampanye nasional.

Caleg Hanura Jenguk Warga Batubara LABUHANRUKU ( Waspada) Syafril Nasution, caleg DPR RI dari Partai Hanura dapil III Sumut bersama Abdul Halim, caleg DPRD Sumut menjenguk warga pada acara kenduri/doa selamat di rumah Usman, caleg DPRD Batubara di Labuhanruku baru-baru ini. “Saya minta relawan Hanura bekerja maksimal,” katanya. Usman, caleg nomor 1 Hanura di DPRD Kab. Batubara sebagai tuan rumah menyampaikan terima kasih kepada Syafril Nasution dan Abdul Halim karena telah menemui masyarakat Batubara.(a12)

Munculnya politikus muda kalangan perempuan ini, kata warga Langkat, kemarin, diyakini mampu merebut simpati masyarakat, karena sosok Delia termasuk orang yang cerdas, peduli, ramah serta mudah mengulurkan tangan untuk membantu masyarakat kecil. Kunjungan Delia pada beberapa desa mendapat sambutan dan simpati dari masyarakat. “Kami mengenal orangtuanya yang dermawan, karenanya kami meyakini sifatsifat Delia tentunya tidak jauh berbeda dari orangtuanya, beda beda tipislah,” ujar salah seorang ibu memberikan komentarnya seusai menghadiri pertemuan silaturrahim bersama sejumlah perwiritan kaum ibu di Besitang, belum lama ini. Umumnya para ibu khususnya kaum perempuan sudah menyatakan dukungannya agar Delia Pratiwi Sitepu mampu membawa aspirasi masyarakat terutama kaum perempuan, bila terpilih sebagai anggota DPR RI. Sedangkan Delia juga berharap adanya dukungan yang ikhlas, doa dan restu dari seluruh kalangan masyarakat di Dapil Sumut III ini. (a01)

Waspada/Parlin Hutasoit

KETUA Bappilu DPP PDI-P Puan Maharani didampingi Ketua PDIP Sumut Panda Nababan dan pengurus partai itu disambut masyarakat di Lapangan Pacuan Kuda Siborongborong – Taput, Selasa (18/3).

PDIP Merahkan Taput TARUTUNG (Waspada): PDI Perjuangan ‘memerahkan’ Tapanuli Utara, kemarin. Puan Maharani dan sejumlah pengurus DPP PDIP saat menjadi juru kampanye di sana mengajak masyarakat Bonapasogit Tapanuli Utara (Taput) untuk memenangkan partai berlambang banteng moncong putih itu pada 9 April 2014. Puan yang juga ketua DPP Badan Pemenangan Pemilu PDI-P menyebutkan, pada Pilkada Taput yang lalu, betapa beratnya perjuangan masyarakat untuk memenangkan calon bupati/wakil bupati: Nikson Nababan – Mauliate Simorangkir menjadi pemenang. “Saudara Nikson Nababan sudah menjadi bupati. Tugas berat kita lagi untuk memenangkan PDIP pada pileg dan pilpres,” kata Puan dalam orasi politiknya di hadapan massa di Lapangan Pacuan Kuda Siborongborong, Taput, Selasa (18/3). Menurut Puan, sekarang PDIP sudah punya capres yakni Jokowi. Sudah saatnya PDIP memenangkan Pilpres. Puan mengajak simpatisan merebut

kembali presiden dan wakil presiden. “Tentu itu dapat kita yakini jika kita semua bekerja keras untuk sosialisasi dan mengajak seluruh komponen masyarakat daerah ini memenangkan pesta demokrasi tahun ini,’’ kata Puan. Puan yakin masyarakat Taput akan bahu-membahu untuk membawa perubahan, sehingga dapat memenangkan pileg dan pilpres. ‘’Ini amanah dari Ketua Umum PDIP Megawati Soekarnoputri yang harus kita wujudkan bersama. ”Indonesia hebat,”ujar Puan. Puan Maharani tiba di Bandara Silangit sekitar pukul 14.00, didampingi pengurus DPP PDIP di antaranya: Sukur Nababan, Trimedya Panjaitan, Jumiran Girsang, Ketua DPD PDI-P Sumut Panda Nababan dan Bupati Taput terpilih Drs Nikson Nababan beserta para pengurus kader PDI-P lainnya. Usai menyampaikan orasi politiknya, Puan Maharani mengadakan dialog dari podium dengan warga yang hadir memadati lapangan tersebut.(a21)

Waspada/Ist

ISKANDAR ST saat bersosialisasi sekaligus memberikan pemahaman politik kepada masyarakat di Desa Betimus, Kecamatan Sibolangit, Kabupaten Deliserdang.

Iskandar Ajak Masyarakat Jauhi Politik ‘Wani Piro’ MEDAN (Waspada): Calon anggota DPR RI dari Partai NasDem Iskandar mengajak masyarakat agar pada 9 April 2014 menggunakan hak pilih dengan sebaik-baiknya dan tidak salah memilih. Sebab Pemilu 2014 akan sangat menentukan nasib bangsa lima tahun ke depan. “Mari kita pilih caleg-caleg yang baik. Saya pribadi menyatakan tidak harus saya dipilih. Karena negara kita saat ini sangat membutuhkan orang-orang baik untuk melakukan perubahan,” kata caleg nomor urut 2 daerah pemilihan Medan, Deliserdang, Serdangbedagai dan Tebingtinggi ini, kemarin, saat silaturahim ke masyarakat Desa Betimus, Kecamatan Sibolangit, Kabupaten Deliserdang. Iskandar yang datang bersama tim sukses dan kader Partai NasDem lainnya, di hadapan masyarakat Desa Betimus yang berkumpul di salah satu kediaman warga saat itu, juga menyerukan kepada segenap masyarakat agar menghindari dan menjauhi politik berapa bisa bayar (wani piro). “Ini harus saya sampaikan karena sebagian masyarakat kita masih banyak yang terkungkung, terjebak dengan istilah ‘wani piro’, yaitu politik transaksional,” ungkap pemilik sejumlah perusahaan di Medan yang bergerak di bidang media massa, periklanan, otomotif, properti, hingga angkutan becak motor itu. Partai NasDem menurutnya menargetkan bisa meraih posisi tiga besar pada Pemilu 2014 dan tanda-tanda ke arah sana sudah mulai tampak. (rel)


Luar Negeri

WASPADA Rabu 19 Maret 2014

A9

15 Tewas, 20 Cedera Akibat Pengeboman Di Afghanistan MAIMANA, Afghanistan (Antara/Xinhua-OANA): Sebanyak 15 orang tewas dan 20 orang lagi cedera Selasa (18/3) pagi dalam serangan bom bunuhdiri di Maimana, ibukota Provinsi Afghanistan Utara, 425 km di sebelah barat-laut Kabul, ibukota Afghanistan. “Dalam serangan teror pengecut di Maimana pagi ini, 15 warga sipil yang tak berdosa kehilangan nyawa mereka dan 20 orang lagi cedera,” kata Gubernur Provinsi tersebut Mohammad Allah Baktash kepada Xinhua. Serangan itu berlangsung pada pukul 08.45 waktu setempat, Selasa, katanya menambahkan. Prajurit militer pemerintah segera menutup daerah tersebut tak lama setelah ledakan.Polisi dan tim pertolongan sampai di lokasi setelah serangan itu untuk menolong orang yang cedera. Ledakan tersebut juga merusak beberapa toko dan kendaraan di dekatnya, kata gubernur itu. Menurut warga setempat, pengeboman bunuhdiri tersebut terjadi di tengah persiapan oleh warga di kota kecil itu untuk merayakan Nawroz, atauTahun Baru Afghanistan, dalam kalender Persia —yang jatuh Jumat (21/3). Sejauh ini belum ada kelompok yang mengaku beranggung-jawab atas serangan mematikan tersebut. Namun gerilyawan Taliban —yang memerangi pemerintah— telahmencapperayaanNawrozsebagaitidakIslamidanmelarangnya selama kekuasaannya, yang ambruk pada akhir 2001.

4.000 Tablet Steroid Dari Thailand Disita Di Sydney SYDNEY, Australia (Antara/Xinhua-OANA): Bea Cukai Australia dan Layanan Perlindungan Perbatasan (ACBPS) Selasa (18/3) memastikantelahmenyita4.000tabletsteroiddalamkemasan,yang tiba di kantor pos pusat Sydney sepekan lalu dari Thailand. Petugas ACBPS di Pusat Pos Antarbangsa New SouthWales mencegat satu kemasanmencurigakanpadaRabu,12Maret,dandiperiksadengan sinar X, kata Bea Cukai Australia. Di dalamnya, mereka temukan 4.000 tablet biru berbentuk hati yang tersembunyi di dalam botol suplemendisalahgunakan.Pengujianawaldaritabletitudinyatakan positif untuk steroid, kata ACBPS. Manajer Operasi Kargo Nasional ACBPS Jagtej Singh Selasa memperingatkan Australia untuk tidak tertipu oleh iklan online palsu. “Meskipun ada klaim dari beberapa website, impor kinerja dan citra obat terlarang dilarang tanpa izin,” katanya dalam pernya-taan. “Untuk menghindari hukuman berat, ataubahkanpenjara,lihatlahdisituswebBeaCukaidanPerlindungan Perbatasan untuk mempelajari persyaratan impor sesuai untuk obat tersebut,” katanya. Bea Cukai Australia mengingatkan warga Australia untuk memeriksa persyaratan hukum mereka ketika mengimpor barang melalui pos internasional.

Bom Mobil Tewaskan 8 Orang Di Libya BENGHAZI, Libya (Antara/Reuters): Satu serangan bom mobil kuat yang ditargetkan pada akademi militer di kota timur Libya, Benghazi, menewaskan sedikitnya delapan orang dan melukai selusin lainnya, kata para pejabat rumah sakit dan keamanan. Ketidakstabilan di kota timur adalah bagian dari perjuangan pemerintahpusatyanglemahdalammenghadapidanmengendalikan kelompok-kelompok bersenjata, milisi dan brigade mantan pemberontak yang pernah berjuang melawan Moammar Khadafi dan sekarang menolak untuk melucuti senjata. Bom pertama meledak di gerbang depan akademi ketika tentara meninggalkanupacarawisuda,kataparapejabatkeamanan.Beberapa mobilyangdiparkirdiluarmeledak.Satuatauduabomlainnyameledak hampir bersamaan, melukai 18 orang, kata para pejabat keamanan danrumahsakit.BeberapajamkemudianledakanterpisahdiBenghazi, satu orang tewas ketika bom mobil lain meledak di dekat perusahaan minyak negara Brega Petroleum Marketing Co, yang menjual produk bahan bakar di Libya, kata seorang sumber keamanan. Tidak ada kelompok yang mengaku bertanggung jawab atas pemboman di Benghazi, di mana angkatan bersenjata Libya telah memerangi gerilyawan dari kelompok-kelompok Islam garis keras seperti Ansar al Syariah, yang terdaftar sebagai organisasi teroris asing oleh Washington. Pemerintah menyebut pemboman akademi itu sebagai “aksi teroris” dan menyatakan tiga hari berkabung, menurut sebuah pernyataan. Sebagian besar negara telah menutup konsulat mereka diBenghazidanbeberapamaskapaipenerbanganasingtelahberhenti terbang di sana sejak Duta Besar AS dan tiga orang Amerika lainnya tewas dalam serangan militan pada September 2012.

Sao Paulo Terancam Penjatahan Air RIO DE JANEIRO, Brazil (Antara/Xinhua-OANA): Daerah metropolitan Sau Paulo menghadapi penjatahan air sebab air bendungan di wilayah itu mengering, kata suratkabar O Estado de Sao Paulo. SistemCantareira,yangmenyediakanairbuatsebanyaksembilan juta dari 20 juta orang yang tinggal di daerah yang berpenduduk paling padat di dunia tersebut, sekarang menghadapi kapasitas terendah, 15 persen, kondisi yang tak pernah terjadi sebelumnya, kata harian itu. Untuk menghindari penjatahan air di ibukota negara bagian tersebut, Pemerintah Negara Bagian Sao Paulo memutuskan untuk menyalurkan air dari bendungan lain, demikian laporan Xinhua Senin (17/3). Namun kekhawatiran mengenai penjatahan air tetap ada, sebab air yang dialihkan mungkin tidak cukup untuk menutup kehilangan di sistem itu. Satu komite krisis memperkirakan sistem Cantareira mungkin kering paling lambat pada Juni, ketika Sao Paulo menjadi tuan rumah Piala Dunia FIFA. Guna mencegah kondisi semacam itu, perusahaan pembagian air, Sabesp, telah mulai memompa air jauh dari bawah tanah. Sebanyak 400 juta liter air diperkirakan dipompa ke dalam sistem Cantareira paling lambat sampai Mei.

32 Tewas, 3.000 Mengungsi Akibat Banjir Di Afrika Selatan JOHANNESBURG, Afrika Selatan (Antara/Xinhua-OANA): Banjir yang disebabkan oleh hujan lebat yang mengguyur sebagian besar wilayahAfrikaSelatanmenewaskan32orangdanmembuatsebanyak 3.000 meninggalkan rumah mereka, kata pejabat pemerintah. “Disayangkan, peristiwa bencana saat ini telah merenggut 32 korban jiwa. Ini meliputi 25 orang yang tewas-tenggelam. Enam korban jiwa juga disebabkan oleh petir dan satu orang meninggal karena tertimpa tembok roboh,” kata Andries Nel, Wakil Menteri Urusan Tradisional dan Penyelenggaraan Koperasi. “Pada saat ini, laporan dari provinsi menunjukkan 3.000 orang masih meninggalkan rumah mereka di Kota Praja Lokal Lephalale (Kabupaten Limpopo) karena tingginya permukaan air,” kata Nel. Dia menyatakan air mulai surut di beberapa bagian lain negeri itu dan banyak orang kembali ke rumah mereka sebelumnya terendam air. Dia mengatakan pemerintah berusaha membantu mereka yang menjadi korban banjir, demikian laporan Xinhua. “Sejumlah orang telah diselamatkan dari atap kendaraan mereka dan beberapa orangterperangkapdirumahmereka.Upayapertolongandilanjutkan untuk mencari orang yang hilang ini,” katanya. Dia menambahkan pemerintah masih mencari orang yang dilaporkan hilang. Pemerintah menyarankan warga Afrika Selatan agar mengikuti ramalan cuaca dan berhati-hati saat mengemudi. “Pada Senin dan Selasa (18/3), kami menduga banjir terjadi di Mpumalanga dan daerah dataran rendah di Provinsi Limpopo. Kita masih akan terus menghadapi hujan pada Selasa dan hari berikutnya, tapi tidak selebat yang telah kita alami,” kata JohanVermeulen, petugas ramalan cuaca dari Dinas Cuaca Afrika Selatan.

Iran Pimpin Pertemuan GNBDi New York NEW YORK, AS (Antara/IRNA-OANA): Pertemuan bulanan kantor koordinasi Gerakan Non-Blok (GNB) dipimpin oleh Wakil Tetap Iran untuk Perserikatan Bangsa-Bangsa (PBB) GholamHossein Dehqani di New York. Dehqani sebagai kepala Kantor Koordinasi GNB memberi penjelasan kepada para peserta mengenai kegiatannya. Dia juga berbicara dengan para pemimpin negara anggota GNB tentang program-program untuk mengadakan pertemuan menteri luar negeri GNB mendatang di Aljazair. Gerakan Non-Blok adalah kelompok negara yang tidak secara formal selaras dengan atau terhadap blok kekuatan besar apapun. Pada tahun 2012, gerakan itu memiliki 120 anggota dan 17 negara pengamat. Organisasi ini didirikan di Beograd pada tahun 1961, dan sebagian besar dibentuk oleh perdana menteri India pertama Jawaharlal Nehru, presiden pertama Indonesia Soekarno, presiden kedua Mesir Gamal Abdel Nasser, presiden pertama Ghana Kwame Nkrumah, dan presiden Yugoslavia Josip Broz Tito. Kelima pemimpin adalah pendukung terkemuka dari jalan tengah bagi negara-negara Dunia Berkembang antara blok Barat dan Timur dalam Perang Dingin. Ungkapan itu sendiri pertama kali digunakan untuk mewakili ajaran diplomat India VK Krishna Menon pada tahun 1953, di PBB. KTT GNB ke-16 berlangsung di Teheran, Iran, 26-31 Agustus 2012. Perwakilan lebih dari 150 negara dijadwalkan untuk hadir. Kehadiran di tingkat tertinggi meliputi 27 presiden, dua raja dan emir, tujuh perdana menteri, sembilan wakil presiden, dua ketua parlemen dan lima utusan khusus. Di dalam konferensi tingkat tinggi, Iran mengambil alih dari Mesir sebagai Ketua Gerakan Non-Blok untuk periode 2012-2015. KTT ke-17 Gerakan Non Blok akan diadakan di Caracas, Venezuela, pada tahun 2015.

Malaysia Ungkap Sindikat Penjualan Paspor Asli The Associated Press

SEJUMLAH para aktivis Beladiri melakukan latihan militer di satu lapangan pelatihan di luar Kiev, Ukraina, Senin (17/3). Parlemen Ukraina Senin melakukan pemungutan suara untuk melakukan mobilisasi guna menjawab setiap kemungkinan invasi Rusia di wilayah Ukraina.

Ukraina Siap Perang Menghadapi Rusia KIEV, Ukraina (AP): Setelah Rusia secara resmi mengeluarkan dekrit pengakuan atas kedaulatan Krimea, pihak Ukraina langsung bereaksi dan menolak untuk menarik pasukannya dari wilayah Krimea dan siap untuk berperang menghadapi Rusia. Masalah Crimea terus memanas setelah terjadinya pergantian kekuasaan di Ukraina.Wilayah yang mendapatkan otonomi khususdariUkrainaini,mendesak untukmelepaskandiridanbergabung dengan Rusia melalui referendum Minggu (16/3). Namun Ukrainatidakakanmengakuihasil referendum tersebut karena hanya dilakukan di Krimea, bukan di seluruh Ukraina. Selain itu mereka mengecam Rusia yang melakukan intervensi militer ke wilayah Ukraina. “Krimeaakandanselalumen-

jadibagiandariwilayahkami,”ujar Menteri Pertahanan Ukraina Ihor Tenyukh Selasa (18/3). Mantan juara tinju dunia dan pemimpin AliansiDemokratikUkrainauntuk ReformasiVitali Klitschko justru memiliki pandangan keras terkait kondisi yang dialami negaranya. “Pasukan Ukraina akan tetap berada di basis mereka (di Krimea) bahkan setelah 21 Maret, sebagai tenggat waktu perjanjian damai antara Rusia dan Ukraina,” tutur Klitschko.Sebagai bagian dari perjanjian damai yang disepakati 16 Maret 2014 lalu, Ke-

menterian Dalam Negeri Rusia mengizinkan prajurit Ukraina melintas dengan bebas keluar masuk basis militer mereka. Sebelumnya pasukan Rusia sudah mengepung pasukan Ukraina selama dua pekan. Ketika ditanya apakah pasukanUkrainaakanmelakukanperlawanan,MenhanTenyukhmemberikan jawaban dengan tegas. “Angkatan bersenjata kami akan melakukan tugasnya. Pasukan Ukraina akan tetap bertahan di Krimea hingga tugas mereka selesai,” tegas Tenyukh. Sementara itu, Presiden Ukraina OleksandrTurchynov menjelaskan pihaknya akan berbuat apapununtukmencegahperang. Tetapi dirinya menyadari bahwa ancamanperangsudahnyatadan terus memperkuat kemampuan pertahanan,demimempertahankan wilayah Ukraina.

Gerakan untuk mempertahankan usaha Rusia untuk mencaplok Krimea, PresidenVladimir Putin mengatakan Selasa (18/3) Moskowharusmerespon apayang dianggapsebagaisatukomplotan BaratuntukmemasukkanUkraina ke dalam pengaruh mereka. Berbicara di depan parlemen dalam pidato televisinya untuk bangsa Rusia, Putin mengatakan haketnisRusiatelahdisalahgunakan oleh pemerintah baru Ukraina. Dia menyatakan bahwa pemungutan suara Krimea Minggu untuk bergabung dengan Rusia sejalan dengan hukum internasional dan mencerminkan hak untuk menentukan nasib sendiri. Pada saat yang sama, pemimpin Rusia itu mengatakan negaranya tidak ingin bergerak ke kawasan Ukraina dan mengatakan “kami tidak ingin memecahbelah Ukraina.” (bbc/ok/m10)

Inmarsat: Ada Sinyal MH370 Di Jaringan Kerja Satelitnya MALAYSIA Airlines Flight MH370 melakukan perubahan drastis ketinggian dan arah setelah menghilang dari radar sipil, demikian menurut sejumlah pejabat AS kepada CNN Jumat (14/ 3) lalu, sehingga meningkatkan pertanyaan bagi para penyelidik tentang siapa yang berada di kemudi pesawat komersial itu, yang hilang lebih satu minggu lalu bersama 239 orang didalamnya. Makin banyak pelajaran tentang corak penerbangan yang diterima Amerika Serikat makin sulitpulauntukmenghapus‘gagasan’beberapajenisintervensimanusia,katasalahsatupejabatyang akrab dengan penyelidikan. Pengungkapan itu muncul ketika CNN mengetahui bahwa satu analisis yang diklasifikasikan sebagai data elektronik dan satelit menunjukkan pesawat kemungkinanjatuhdiTelukBenggalaatau di tempat lain di Samudera India. Analisis yang dilakukan Amerika Serikat dan pemerintah Malaysia mungkin telah memper sempit daerah pencarian untuk pesawat jet yang hilang dalam perjalanan dari Kuala Lumpur ke Beijing, meninggalkan sedikit jejak di mana pesawat itu pergi dan mengapa. Analisis yang menggunakan data radar dan ping satelit untuk memperkirakan bahwa pesawat telah dialihkan keTeluk Benggala atau ke baratdaya arah ke Samudera India. Teoriitutimbuldaripengungkapan awal oleh para pejabat AS bahwa satu sistem otomatis yang melaporkan mengenai ping satelit MH370 selama lebih dari lima jam setelah kontak terakhirnya denganpengawaslalulintasudara. Inmarsat, satu perusahaan satelit komunikasi, membenarkan kepada CNN bahwa sinyal otomatis tercatat pada jaringan kerjanya. Secarakeseluruhan,datamengarahkespekulasiskenariogelap di mana seseorang menguasai pesawat untuk beberapa tujuan yang tidak diketahui, mungkin terorisme. Teori yang didukung oleh kata dari seorang pejabat senior AS yang akrab dengan penyelidikan bahwa pesawat Malaysia Air-

lines itu membuat beberapa perubahan ketinggian yang signifikan dan mengubah jalurnya lebihdarisekalisetelahkehilangan kontak dengan menara penerbangan. Pesawat jet tersebut terbang “dengan jalur yang aneh,” kata pejabat yang tak ingin disebutkan jatidirinya oleh The New York Times, Jumat. Teori itu ddukung oleh seorang pejabat senior AS lainnya yang dekat dengan penyelidikan pesawat MH370 tersebut bahwa pesawattersebuttelahmengubah ketinggian dan arah lebih dari sekali setelah kehilangan kontak dengan menara pengawas. Pesawat telah menerbangi “satujaluraneh,”katapejabatyang tak ingin disebutkan jatidirinya itu. Rincian mengenai pembacaan radar pertama kali dilaporkan oleh The New York Times Jumat. Radar militer Malaysia menunjukkan pesawat meninggi sampai 45.000 kaki segera setelah menghilang dari layar radar sipil dan kemudian turun pada ketinggian 23.000 kaki sebelum meninggi lagi, kata pejabat tersebut. Pertanyaan tentang apa yang terjadi terhadap MH370 telah berubah menjadi salah satu misteri terbesar dalam sejarah penerbangan, kata sejumlah pejabat pemerintah dan pakar industri. Banyak pendapat berkembang,mulaidaribencanaledakan sampaikesabotasedanpembajakan dan pilot bunuhdiri. Teori sabotase meningkat JumatketikaTheWallStreetJournal, yang melaporkan para penyelidik meningkatkankecurigaanmereka pada isu itu setelah sistem komunikasi pesawat dimatikan secara manual. Para penyelidik berusaha untuk memastikan apakah sistem komunikasisatelityang‘memberi isyarat’ selama beberapa jam berhenti berfungsi karena ‘terjadi suatu bencana atau seseorang telah mematikan’ sistem tersebut, kata laporan suratkabar itu, yang mengacu pada keterangan seorang yang tak ingin disebutkan jatidirinyayangmengetahuiposisi terakhir MH370. Ping itu terhenti sinyalnya

pada satu titik di atas Samudera India, pada saat pesawat terbang pada posisi ketinggian normal, demikian menurut suratkabar itu. Apa yang diketahui dan tidak dari MH370 Kemudianadateoriyangmenyatakan mungkin MH370 mendarat di salah satu rantai kepulauan di Samudera India. Kemungkinan itu didukung oleh pengungkapan para pengamat berdasarkan data radar bahwa pesawat bukan terbang butabutaan ke baratlaut dari Malaysia. Reuters, yang mengacu pada beberapa sumber yang akrab dengan penyelidikan itu melaporkanbahwasiapapunyangmengemudikan pesawat yang hilang itu, dia telah mengikut jalur navigasi penerbangan yang kemudian membawa pesawat melintas di atas Pulau Andaman. Data radar tidak menunjukkan pesawat di atas Pulau Andaman, namun hanya seorang yang tahu jalur yang akan membawanya ke sana, kata Reuters mengacu sumber-sumbernya. Teori plot perfilman tampaknya lebih rumit dan tidak mungkin salah seorang di dalamnya dapat menerbangkan sampai pesawat kehabisan bahan bakar atau menghadapi beberapa problem lain.Tapi itu salah satu agar penegak hukum harus menelitinya,katamantanAsistenDirektur FBI James Kallstrom. Pakar penerbangan mengatakan itu mungkin bahwa seseorang telah membajak dan mendaratkan Boeing 777 raksasa itu tanpa terdeteksi. Bandara internasional di Port Blair, ibukota wilayah kepulauan Andaman dan Nicobar, memiliki landasan pacu yang cukup panjang untuk mengakomodasi Boeing 777, menurut data yang tersedia untuk umum . Tapi wilayah ini sangat militeristis karena kepentingan strategisbagiIndia,parapejabatIndia dengan pengetahuan tentang operasi itu memberitahu CNN bahwakawasanitutidakmungkin bagi bajak laut yang ingin mencobamenyelinapdipesawatterbang besar dengan rentang sayap lebih dari 200 kaki .

Denis Giles, redaktur suratkabar Andaman Chronicle, mengatakan di sana tidak ada tempat mendarat bagi pesawat sebesar MH370 yang dapat luput dari perhatian. “Tidak ada kesempatan, tidak ada peluang bahwa semua pesawat sebesar Boeing 777 itu dapat masuk ke Pulau Andaman dan Nikobar dan mendarat,” katanya. PemerintahMalaysiamengatakanJumatbahwapihaknyatidak dapat mengkonfirmasi laporan itu. Dan seorang pejabat senior AS memberikan perkiraan yang kontradiktif Kamis, mengatakan kepada CNN bahwa “ada kemungkinan yang signifikan” pesawat berada di bagian bawah Samudera India. Di antara hal-hal yang dipertimbangkanadalahapakahbaterai lithium di kargo, yang telah disalahkan dalam kecelakaan sebelumnya, memainkan peran dalam hilangnya pesawat, menurut pejabat AS penjelasan tentang perkembangan terbaru dalam penyelidikan. Para pejabat tersebut yang tidak ingin disebutkan jatidirinya karena mereka tidak berwenang untuk memberikan rinciankepadamedia.(cnn/mujo)

KUALA LUMPUR, Malaysia (Antara): Kementerian Dalam Negeri Malaysia mengungkapkan adanya sindikat penjualan paspor asli melibatkan negara tetangga, termasuk dalam kasus dua warga Iran yang menggunakan paspor curian untuk menaiki pesawat Malaysia Airlines MH370. “Hasil penyelidikan mendapati dua paspor yang dimiliki warga Iran itu bukan palsu tapi asli,” kata Menteri Dalam Negeri Datuk Seri Ahmad Zahid Hamidi. “Dia(dualelakiIran)masukkeMalaysiamenaikikapalterbangQatar AirwaysdariPhuketkeKualaLumpurpada28Februari.(Kitapercaya) mereka membeli atau mendapatkan paspor tersebut di Phuket,” katanya seperti dikutip media-media lokal di Kuala Lumpur, Selasa. Ahmad Zahid mengungkapkan hal tersebut menjawab pertanyaan anggota parlemen Datuk Mahfuz Omar mengenai membanjirnya pelajar asing dan pekerja asing tanpa izin termasuk kasus dua warga Iranitu.Diamengatakan,temuantersebutmerupakanhasilpenyelidikan pihak Kementerian dan Kantor Imigrasi, namun keseluruhan hasil penyelidikan baru akan diungkapkan pada akhir Maret. Ahmad Zahid menegaskan pihaknya serta Kantor Imigrasi tidak akan berkompromi dengan sindikat manapun karena hal tersebut merupakan masalah serius yang melibatkan keselamatan negara.MenurutInterpol,lebihdari40jutapaspordilaporkanhilang di seluruh dunia saat ini. Pesawat MAS MH370 yang membawa 227 penumpang dan 12 kru hilang dalam penerbangan dari Kuala Lumpur menuju Beijing, sekitar satu jam setelah lepas landas dari bandara KLIA pada Sabtu (8/3) pukul 00.41 dinihari.

AS Keluhkan Malaysia Yang Enggan Bagi Informasi MH370 KUALA LUMPUR, Malaysia (Waspada): Malaysia membantah kritik bahwa selama ini enggan untuk berbagi banyak petunjuk dengan negara-negara yang mau membantu pencarian pesawat Malaysia Airlines nomor penerbangan MH370, yang sudah lebih dari sepuluh hari hilang. Kritik itu sudah disampaikan kalangan pejabat AS, yang turut membantu pencarian. MenurutReuters,duapejabatkeamananASSenin(17/3)mengatakan bahwa Malaysia masih belum bersedia undang tim dari Biro InvestigasiFederal(FBI)keKualaLumpuruntukmembantupenyelidikan. Apalagi PM Najib Razak Sabtu pekan lalu sudah mengatakan bahwa pesawatyangmembawa239penumpangdanawakitukemungkinan disabotase sehingga tidak sampai ke tempat tujuan, Beijing, setelah dua jam lepas landas dari Kuala Lumpur. Namun, Menteri Pertahanan merangkap MenteriTransportasi Malaysia, Hishamuddin Hussein, hari ini membantah klaim bahwa pemerintahnya selama ini kurang bekerjasama dengan tim dari AS.“Saya sudah bekerja dengan mereka (FBI),” kata Hishamuddin. Dia menilai ada kesalahpahaman soal bantuan itu. “Terserah kepada FBI untuk menyampaikan kepada kami bila mereka butuh lebih banyak pakar datang membantu, karena bukan urusan kami untuk tahu apa yang mereka punya,” lanjut Hishamuddin. Menurut sumber anonim di pihak AS, polisi khusus Malaysia sebenarnyatelahmemberibeberapainformasikepadapenegakhukum danintelijenAmerika.Namun,kerjasamaFBIdenganotoritasMalaysia selama ini hanya melalui seorang agen, yang diketahui sebagai“atase hukum” yang ditugaskan di Kedutaanbesar AS di Kuala Lumpur. FBI maupun lembaga-lembaga penegak hukum lain Amerika, seperti Departemen Keamanan Dalam Negeri, mengisyaratkan beberapa waktu lalu bahwa mereka ingin mengirim tim ke Kuala Lumpur. Namun pengiriman baru terwujud bila diminta secara resmi oleh Malaysia.

Pemberontak Lakukan Eksekusi Massal Di Syria DAMASKUS, Syria (AP): Penyelidik hak asasi PBB mengatakan mereka memiliki informasi yang menunjukkan bahwa kelompok pemberontakdiSyriamelakukaneksekusimassal.Laporankekerasan diSyriaitudirilisolehpenyelidikPBB,menjelangpembahasantentang konflik di negara tersebut di Badan HAM PBB di Jenewa. TimpenyelidikPBBmerilisbukti-buktiyangmenunjukkankelompok pemberontak di Syria, di antaranya Kelompok jihad Negara Islam IrakdanSyriaatauISIS,melakukaneksekusimassal.Dalamlaporannya, tim PBB menggambarkan ISIS menduduki rumah sakit anak-anak di Aleppo dan menggunakannya untuk menahan orang. Sejumlah di antaranya dibawa keluar dan dibunuh di tempat yang digambarkan para saksi mata sebagai ladang eksekusi. Laporan itu juga menyebutkan beberapa contoh lain eksekusi serupa. Tim PBB juga melaporkan bahwa penggunaan senjata seperti bom untuk oleh pasukan pemerintah juga meningkat, Serangan udara yang dilakukan ke sasaran militer, kata tim PBB, jelas ditujukan untuk menciptakan suasana teror di antara warga sipil. Sementara itu masalah kekurangan pangan, air, obat-obatan dan tidak adanya aliran listrik terjadi di kota-kota yang dikepung. Tim PBB juga mengatakan di tempat-tempat penahanan orang dibiarkan meninggal kelaparan. (m10)

4 Roket Yang Ditembakkan Dari Syria Hantam Lebanon BAALBEK, Lebanon (Antara/ AFP):EmpatroketyangditembakkandariSyriamenghantamLembahBekaayangbanyakdihunipara anggotagerakanHizbullahdiLebanon Timur, menciderai seorang, kata militer Lebanon. Hizbullah, satu gerakan Syria yang berpengaruh di Lebanon, berulang-ulang diserang oleh kelompok garis keras Sunni yang marah atas intervensinya di Syria untuk membantu pemerintah Presiden Bashar Assad, yang sedang memerangi pemberontak. “Sekitar pukul 13.00 waktu setempat (18.30WIB) hari ini (Senin 17/3), satu roket mendarat di desa Labweh dan tiga lainnya menghantam daerah sekitar desa-desa Labweh dan Al-Nabi Othman,” kata militer dan me-

nambahkan sumber tembakan lainnya adalah “dari pihak Syria “ perbatasan itu. Sementara itu, bentrokanbentrokan senjata meletus di kota Tripoliantaraparapendukungdan musuhpemerintahBashar,dengan seorangpriaSyriatewasdiperkampungan Sunni Bab al-Tabbaneh, katasatusumberkeamanan. PendudukJebelMohsen,yangadalah anggota sekte Alawi cabang dari Syiah sering bentrok dengan kelompok-kelompok di Bab al-Tabbaneh, satu pendukung pemberontak Syria. Aksikekerasanituterjadisehari setelah dua anggota Hizbullah termasuk seorang pejabat lokal, tewasdan14lainnyacideraakibat satu serangan bom bunuh diri di Al-Nabi Othman, kata Kantor

BeritaNasionalresmi.”Ledakanitu dilakukan seorang penyerang bunuh diri. Para anggota Hizbullah tahutentangakandilakukanseranganitu,danberusahamenghentikankendaraanitu.Ituterjadiketika penyerangakanmeledakkankendaraan itu,” kata satu sumber keamanan. Serangan itu diklaim oleh kelompokgariskerasFrontAl-Nusra di Lebanon dan oleh satu kelompokyangtidakbanyakdikenal,Liwa Ahrar al-Sunna di Bekaa, sebagai pembalasanatasketerlibatanHizbullahdiSyria.Hizbulahmengirim ribuan petempur untuk mendukung pasukan Bashar dan membantu merebut kotaYabrud, satu pangkalan penting pemberontak Syria dekat perbatasan dengan Lebanon.


Sport

A6

WASPADA Rabu 19 Maret 2014

Bangkitlah… Setan Merah… LONDON (Waspada): Striker Wayne Rooney mengharapkan, Manchester United mampu bangkit dari keterpurukan ketika menjamu Olympiakos pada leg kedua babak 16 besar Liga Champions.

Reuters

BEK Villarreal Jose ‘Chechu’ Dorado (R) ditaklukkan bomber Bilbao Aritz Aduriz (L) di El Madrigal Stadium.

“Sungguh mengecewakan, tetapi kami harus segera bangkit karena kami memiliki partai besar pada tengah pekan,” beber Rooney, seperti dilansir The Mirror, Selasa (18/3). Sebelum menjajal Olympiakos dinihari WIB nanti di Stadion Old Trafford, Setan Merah MU memang baru dipermalukan tamunya Liverpool 0-3 akhir pekan lalu pada matchday 29 Liga Premier. Kekalahan memalukan itu melengkapi derita The Red De-

Jalan Bilbao Masih Panjang MADRID ( Wa s p a d a ) : Athletic Bilbao membuang kans mengencangkan genggamannya di zona Liga Champions, Senin (Selasa WIB), setelah ditahan 10 pemain Villarreal 1-1 pada jornada 28 La Liga. “Masih ada jalan panjang untuk dilalui dan kami mesti melakukan setiap hal satu demi satu,” jelas bomber Bilbao Aritz Aduriz, seperti dilansir Reuters, Selasa (18/3). Dengan 10 partai tersisa, Bilbao hanya unggul enam angka di atas rivalnya Real Sociedad, yang berada di peringkat kelima berkat kemenangan 1-0 atas Valencia. Aduriz berpeluang membawa Bilbao lebih dulu memimpin pada babak pertama di El Madrigal Stadium. Menjadi eksekutor penalti menit

39, aksi mantan penyerang Valencia itu mampu digagalkan kiper Sergio Asenjo. Menit 47 Villarreal membuka kran golnya. Pemain remaja Oliver Torres menggulirkan bola kepada Tomas Pina untuk dikonversi menjadi gol bagi tim tuan rumah ke gawang kiper Gorka Iraizoz. Namun alur duel berbalik ketika bek Villarreal, Gabriel Paulista, mendapatkan kartu kuning kedua dan diusir keluar lapangan menit 66. Aduriz membayar lunas kegagalan penaltinya dengan tandukan kepala untuk menyamakan kedudukan tujuh menit sebelum duel usai. “Penalti itu sedikit menyentak, tapi kami mampu bersatu setelah gol mereka dan mendapatkan hasil seri,” jelas Aduriz. “Kami mulai mendomi-

Klasemen La Liga Real Madrid 28 22 4 Atl Madrid 28 21 4 Barcelona 28 21 3 Ath Bilbao 28 15 7 Sociedad 28 13 7 Villarreal 28 13 6 Sevilla 28 12 8 Valencia 28 10 6 Espanyol 28 10 6 Levante 28 9 9 Celta Vigo 28 9 6 Granada 28 9 4 Elche 28 7 9 Malaga 28 7 8 Osasuna 28 8 5 Vallecano 28 9 2 Getafe 28 7 7 Valladolid 28 5 11 Almeria 28 7 5 Real Betis 28 4 7

2 3 4 6 8 9 8 12 12 10 13 15 12 13 15 17 14 12 16 17

77-26 70 64-21 67 81-22 66 51-32 52 49-39 46 48-34 45 51-43 44 39-39 36 32-34 36 26-35 36 33-39 33 27-39 31 24-40 30 26-36 29 24-48 29 32-62 29 26-45 28 30-48 26 27-52 26 23-56 19

nasi menjelang akhir pertandingan, jadi kami kurang lebih merasa puas juga,” katanya lagi. (m15/ant/rtr/espn)

vils, yang sebelumnya juga telah dipecundangi juara Liga Super Yunani itu 0-2 pada leg pertama di Piraeus. “Ini masa sulit, tetapi kami pernah berada di sini sebelumnya. Saatnya karakter para pemain akan ditempa untuk bisa bangkit serta bersinar,” tutur Rooney. “Saya pikir suporter sangat luar biasa, mereka fantastis bagi kami. Sebagai tim, di ruang ganti, kami benar-benar mengapresiasi hal itu,” tambah striker Inggris itu. Winger anyar Juan Mata pun yakin, United segera melupakan tragedi Merah dengan menjadikan Jose Holebas cs sebagai pelampiasan kebangkitan. “Badai pasti berlalu dan matahari akan bersinar lagi, saya tidak ragu itu. Tentu tidak ada yang mengatakan ini mudah, tapi inilah sepakbola,” klaim Mata di blog Grada360. Dukungan fanatis fans Red Devils, menurut Mata, ikut memberi kenangan fantastis serta motivasi tersendiri bagi mereka. “Saya mesti mengatakan bahwa seminggu di tempat latihan berlangsung baik dan kami berharap banyak pada laga nanti,” papar mantan pemain Chelsea tersebut. Kiper David De Gea bahkan menegaskan, Setan Merah mampu menyingkirkan Olympiakos dengan membalikkan defisit dua gol hasil jumpa pertama di Piraeus. “Kami tahu kami tidak ber-

AP

BOMBER MU Wayne Rooney (kiri) kini optimis bakal mengatasi Jose Holebas cs. main dengan baik di Yunani. Mereka lebih baik dari kami dan mereka menang,” ungkap penjaga gawang asal Spanyol itu di laman resmi UEFA. “Tetapi sekarang leg kedua di Old Trafford. Saya pikir dengan suporter di belakang ka-

Michel Mengintip MU LONDON (Waspada): Pelatih Olympiakos Michel Gonzales (foto kanan), hadir langsung di Old Trafford akhir pekan kemarin, saat Manchester United dipermalukan Liverpool 0-3 pada matchday 30 Liga Premier. Michel datang untuk mengintip perkembangan MU asuhan manajer David Moyes (foto kiri), terkait kepentingan taktik dan strategi menghadapi laga leg kedua babak 16 besar Liga Champions.

Pria Spanyol itu sepertinya ingin lebih mengenal lagi permainan Setan Merah, meskipun pasukannya sudah unggul 2-0 hasil leg pertama di Piraeus, 25 Februari silam. Dua gol kemenangan Olympiakos di Stadion Karaiskaki dicetak Alejandro Dominguez dan Joel Campbell. “Jika kami berpikir memiliki keunggulan lebih dari lawan, maka kami akan gagal,” ucap Michel, seperti dikutip dari TribalFootball, Selasa (18/3).

Statistik Laga Leg I Olympiakos MU

AP

Masa mengintip mantan pelatih Sevilla itu lebih lapang serta bermakna, sebab skuadnya telah mengamankan gelar juara Liga Super Yunani ke-41

mi, kami harus pergi ke lapangan dan bertarung serta menyerang sejak menit pertama,” tekad De Gea. Dia yakin, jika Setan Merah asuhan David Moyes menekan dengan baik, otomatis peluang bagus bakal terbuka.

ketika liga masih menyisakan lima partai. “Setelah selebrasi dan kebahagiaan, kami mesti bersiap untuk United. Gelar juara liga

akan membuat laga tandang ini lebih bisa dinikmati. Tetapi kami harus tetap focus,” tegas Michel. Michel pun berharap keka-

40% 2 12 4 1 10 0 0 0 1

Penguasaan Bola 60% 0 Skor Akhir 7 Tembakan Total 1 Tembakan Tepat 4 Tembakan Pojok 10 Pelanggaran 4 Offsides 2 Kartu Kuning 0 Kartu Merah 2 Penyelamatan *Sumber ESPN

lahan MU dari Liverpool dan sukses Olympiakos menjuara liga domestik, membuat Giannis Maniatis cs semakin termotivasi

Liga Champions Dinihari Nanti

Leg I

B Dortmund (Jerman) v Zenit SP (Rusia) Man United (Inggris) v Olympiakos (Yunani) *SCTV live mulai pkl 02:45 WIB

4-2 0-2

“Kami akan memberikan segalanya yang kami milik dan bermain jauh lebih baik dari yang kami lakukan di sana. Dengan atmosfer dan tim yang

kami miliki, kami bisa sukses dan saya harap melaju ke babak berikutnya,” pungkas De Gea. (m15/ant/rtr/mrr/uefa)

untuk meraih kemenangan dinihari WIB nanti Old Trafford Stadium. Jika lolos ke perempatfinal Liga Champions, maka itu menjadi sukses pertama Olympiakos sejak yang terakhir tahun 1999 silam. “Kami telah sangat dekat untuk meraih sesuatu yang hebat,” klaim Joel Campbell. “Tampil bagus di Old Trafford sangat penting. Saya yakin ini impian para pemain kami,” tambah gelandang serang asal Kosta Rika tersebut. Sebaliknya bagi Setan Merah, Liga Champions satu-satunya jalan realistis untuk meng-

gapai prestasi pada musim perdana kepemimpinan Moyes. United telah gagal di Piala Liga dan Piala FA, serta terpuruk di Premiership. “Para pemain kami cukup sadar arti penting pertandingan Rabu ini, juga apa yang harus kami raih,” jelas Moyes. Setan Merah mencatat rekor kemenangan 100 persen di kandang sendiri melawan Olympiakos. Namun MU hanya sekali menang setelah kalah di leg pertama Liga Champions, yakni ketika membantai AS Roma 7-1 untuk membalas kekalahan 1-2 di leg pertama pada 2007. (m15/goal/tf/rtr)

Totti Senang Giallorossi Menang

AP

KAPTEN AS Roma Francesco Totti (2 kanan) merayakan golnya ke gawang Udinese dengan Mattia Destro (kiri), Radja Nainggolan dan Gervinho (kanan) di Stadion Olimpico Roma.

AVB Bos Baru Zenit MOSKOW (Antara/AFP): Zenit Saint Petersburg mencapai kesepahaham dengan Andre Villas-Boas (foto) untuk menjadi pelatih baru mereka. Klub tiga kali juara Rusia itu dalam pernyataannya, Selasa (18/3) menjelaskan, mantan pelatih Porto, ChelReuters sea, dan Tottenham Hotspur itu akan menandatangani kontrak dengan Zenit pada 20 Maret. AVB menggantikan peran pelatih asal Italia Luciano Spalletti, yang dipecat minggu lalu. Pria Portugal itu dengan demikian belum mendampingi Andrei Arshavin cs dalam laga tandang di markas Borussia Dortmund dinihari WIB nanti pada leg kedua babak 16 besar Liga Champions. Kontrak pelatih berusia 36 tahun yang membawa Porto menjuarai Liga Europa 2012 itu mulai berlaku pada 21 Maret dan akan berjalan selama dua musim. AVB akan melakoni tantangan besar di Zenit, setelah kerjanya berakhir tragis di Chelsea dan Tottenham. Dia selama ini dikenal sebagai pelatih paling menjanjikan dalam usia muda.

ROMA (Waspada): Francesco Totti mencetak gol penyemangat AS Roma, Senin (Selasa WIB), saat dia kembali bermain setelah absen lama karena cedera. Aksi sang kapten melengkapi sukses I Giallorossi, yang kemudian menjinakkan Udinese 3-2 pada giornata 28 Liga Seri A untuk memangkas jarak dengan pemimpin klasemen Juventus. “Menyenangkan untuk mencetak gol lagi. Namun yang penting memenangi pertandingan untuk memastikan kami tetap unggul atas Napoli. Kami harus mempertahankan peringkat kedua,” tutur Totti melalui Sky Sports, Selasa (18/3). Totti menikmati impiannya kembali ke Stadion Olimpico. Mendapat bola pantul dari tembakan jarak dekat Gervinho menyusul operan Miralem Pjanic menit 22, Il Capitano mulus melesakkan bola m e l e w a t i k i p e r Si m o n e Scuffet. Gelandang Mattia Destro menambah keunggulan tim tuan rumah menit 30, skor

Roma 56% 3 20 9 5 8 2 1 0 6

Udinese

Penguasaan Bola 44% 2 Skor Akhir 14 Tembakan Total 8 Tembakan Tepat 11 Tembakan Pojok 13 Pelanggaran 1 Offsides 1 Kartu Kuning 0 Kartu Merah 6 Penyelamatan *Sumber ESPN

2-0 untuk Il Lupo bertahan hingga turun minum. Memasuki babak kedua, Udinese berusaha bangkit dengan menekan benteng Serigala Merah. Harapan La Zebrette hidup lagi setelah gelandang veteran Giampiero Pinzi menyarangkan gol balasan menit 51. Laga semakin seru, sebelum Vasilis Torosidis memulihkan keunggulan Roma menit 69. Tim tamu kembali bangkit dengan gol Dusan Basta menit 80, yang sekaligus membuat tensi laga sangat tinggi sampai berakhirnya pertandingan. “Itu laga kandang tersulit dalam 15-16 pertandingan ka-

mi. Kami mendapatkan angka-angka, tetapi kami menyulitkan diri sendiri,” tutur allenatore Roma asal Prancis, Rudi Garcia. Mantan pelatih Lille itu menarik keluar Totti menit 72 untuk digantikan Alessandro Florenzi. “Kami tahu bahwa sang kapten tidak bisa bermain selama 90 menit, tapi dia benar-benar memberikan permainan terbaik,” ujar Garcia. “Saya juga senang dengan cara bermain tim, mengingat kami tanpa Daniele De Rossi, Kevin Strootman dan Douglas Maicon,” katanya menambahkan. Garcia mengaku, semangat bertarung I Friulani telah membuat skuadnya menderita. “Kami telah melakukan banyak hal-hal besar, tetapi kami juga tidak diberikan banyak peluang,” jelasnya. “Kami bisa saja mencetak gol lebih banyak, tapi tanpa kinerja brilian De Sanctis kami juga bisa banyak kebobolan. Kami membuat beberapa kesalahan, tapi kami mendapat tiga poin dan itu penting,” tegas Garcia. (m15/ant/rtr/sky)

Syarat Giroud Dapat Maaf Istri PARIS (Waspada): Masa kerja Olivier Giroud di Arsenal rawan berakhir, setelah dia ketahuan selingkuh dengan model seksi Celia Kay di sebuah hotel di Inggris, Februari silam. Akibat skandal tersebut, pernikahan Giroud dengan istrinya Jennifer (foto), menjadi di ujung tanduk. Hubungan keduanya merenggang, namun Jennifer masih mau memberikan maaf jika Giroud berkenan meninggalkan Inggris untuk kembali ke Prancis. “Dia (Jennifer) setuju untuk kembali kepada Giroud, tetapi hanya dengan syarat mereka meninggalkan London dan Inggris,” beber sumber dekat Jennifer kepada The Sun, yang dikutip Selasa (18/3). Jennifer pantas marah, sebab media sebesar DailyMail sampai merilis foto Giroud yang hanya mengenakan sempak, keluar dari kamar mandi. Momen itu sepertinya diabadikan Kay, saat menghabiskan malam dengan mantan bomber Montepellier tersebut. “Dia (Giroud) bertekad menyelamatkan pernikahannya, karena dia sadar betapa bodohnya apa yang sudah dia lakukan. Saya tahu dia akan menuruti apa yang diinginkan istrinya,” tambah sumber dimaksud Bocoran syarat dari sang istri tersebut,

eurosport

membuat isu bomber berumur 27 tahun itu akan hengkang dari Emirates Stadium pada akhir musim nanti, semakin berhembus kencang. Apalagi beberapa waktu lalu dia sempat menggelar pertemuan dengan agen kawakan, Muzzi Ozcan. Giroud baru dua musim berlaga di Liga Premier, setelah diboyong The Gunners dari Montpellier pada musim panas 2012. Dua musim membela Meriam London, penyerang Prancis itu mampu mengoleksi 23 gol dari 59 partai. (m15/vvn/sun/tf)

AP

BINTANG kemenangan Napoli Gonzalo Higuain membobol gawang Torino yang dikawal kiper Daniele Padelli di Olympic Stadium, Turin, Selasa (18/3) dinihari WIB.

Protes Gol Kontroversial Higuain TURIN, Italia (Waspada): Gol kontroversial Gonzalo Higuain, Senin (Selasa WIB), memastikan sukses Napoli mengatasi Torino 1-0 dalam duel dramatis giornata 28 Liga Seri A. Sebelum menaklukkan kiper Daniele Padelli menit 90 di Olympic Stadium, Turin, Higuain sempat melanggar bek Kamel Glik. Aksinya pun menuai protes keras dari pelatih Torino Giampiero Ventura. “Saya merasa malu kepada para pemain saya. Saya tak ingin membahas ketidakadilan yang kami derita, kami hanya ingin musim ini berakhir sesegera mungkin,” papar Ventura. “Kami semestinya sepuluh poin lebih banyak dari yang kami peroleh,” sindirnya lagi, sebagaimana diberitakan AFP, Selasa (18/3) Higuain membela gol kontroversialnya dengan berkata, “Memang ada kontak dengan Glik, namun dia dan saya sedang berlari kencang. Apa yang bisa saya lakukan hanyalah merayakan kemenangan ini.” “Saya belum pernah berbicara soal wasit sepanjang musim dan saya tak akan memulainya sekarang,” timpal Rafael Benitez, allenatore Napoli asal

Spanyol. Dalam duel tersebut, Il Toro mampu meredam serangan I Partenopei, sebelum akhirnya Higuain memecah kebuntuan. Menurut Benitez, Il Toro bertahan dengan sangat baik dan cukup merepotkan pasukannya ketika melancarkan serangan-serangan balik. “Saya pikir kami menciptakan sejumlah peluang bagus, begitu juga Torino. Itu membuktikan tim ini haus kemenangan,” jelas Benitez, yang segera menyiapkan skuadnya untuk menjamu FC Porto pada leg kedua babak 16 besar Liga Eropa besok malam di San Paolo. “Kami akan bermain melawan Porto pada Kamis dan bermain dua laga tiap pekan. Jadi tak mudah untuk terus menunjukkan ketajaman,” ujarnya lagi. Benitez juga memuji performa Marek Hamsik, yang dinilainya menunjukkan perbaikan dibandingkan laga-laga sebelumnya, setelah bintang Slovakia itu pulih dari cedera. “Dia bermain lebih bagus malam ini dan membantu tim, baik dalam menyerang maupun bertahan. Saya tak pernah berpikir untuk memintanya bermain lebih dalam, karena dia punya kemampuan me-

Torino

Napoli

44% Penguasaan Bola 56% 1 0 Skor Akhir 13 12 Tembakan Total 4 4 Tembakan Tepat 5 5 Tembakan Pojok 8 14 Pelanggaran 1 3 Offsides 2 2 Kartu Kuning 0 0 Kartu Merah 4 3 Penyelamatan *Sumber ESPN

Klasemen Liga Seri A Juventus 28 24 3 AS Roma 27 18 7 Napoli 28 17 7 Fiorentina 28 14 6 Inter Milan28 12 11 Parma 27 12 10 Fiorentina 28 14 6 Lazio 28 11 8 Hellas 28 12 4 Atalanta 28 11 4 Torino 28 9 9 AC Milan 28 9 8 Genoa 28 9 8 Sampdoria 28 9 7 Udinese 28 9 4 Cagliari 28 6 11 Chievo 28 6 6 Livorno 28 6 6 Bologna 28 4 11 Sassuolo 28 5 6 Catania 28 4 8

1 2 4 8 5 5 8 9 12 13 10 11 11 12 15 11 16 16 13 17 16

64-19 52-14 53-29 48-31 46-29 45-31 48-31 36-35 43-46 31-38 39-36 41-42 31-35 33-42 32-42 27-38 23-41 31-51 23-43 28-56 21-49

75 61 58 48 47 46 48 41 40 37 36 35 35 34 31 29 24 24 23 21 20

nuntaskan peluang,” pungkas Benitez. (m15/ant/afp/sky)


Sport

A10

WASPADA Rabu 19 Maret 2014

Bangkitlah… Setan Merah… LONDON (Waspada): Striker Wayne Rooney mengharapkan, Manchester United mampu bangkit dari keterpurukan ketika menjamu Olympiakos pada leg kedua babak 16 besar Liga Champions.

Reuters

BEK Villarreal Jose ‘Chechu’ Dorado (R) ditaklukkan bomber Bilbao Aritz Aduriz (L) di El Madrigal Stadium.

“Sungguh mengecewakan, tetapi kami harus segera bangkit karena kami memiliki partai besar pada tengah pekan,” beber Rooney, seperti dilansir The Mirror, Selasa (18/3). Sebelum menjajal Olympiakos dinihari WIB nanti di Stadion Old Trafford, Setan Merah MU memang baru dipermalukan tamunya Liverpool 0-3 akhir pekan lalu pada matchday 29 Liga Premier. Kekalahan memalukan itu melengkapi derita The Red De-

Jalan Bilbao Masih Panjang MADRID ( Wa s p a d a ) : Athletic Bilbao membuang kans mengencangkan genggamannya di zona Liga Champions, Senin (Selasa WIB), setelah ditahan 10 pemain Villarreal 1-1 pada jornada 28 La Liga. “Masih ada jalan panjang untuk dilalui dan kami mesti melakukan setiap hal satu demi satu,” jelas bomber Bilbao Aritz Aduriz, seperti dilansir Reuters, Selasa (18/3). Dengan 10 partai tersisa, Bilbao hanya unggul enam angka di atas rivalnya Real Sociedad, yang berada di peringkat kelima berkat kemenangan 1-0 atas Valencia. Aduriz berpeluang membawa Bilbao lebih dulu memimpin pada babak pertama di El Madrigal Stadium. Menjadi eksekutor penalti menit

39, aksi mantan penyerang Valencia itu mampu digagalkan kiper Sergio Asenjo. Menit 47 Villarreal membuka kran golnya. Pemain remaja Oliver Torres menggulirkan bola kepada Tomas Pina untuk dikonversi menjadi gol bagi tim tuan rumah ke gawang kiper Gorka Iraizoz. Namun alur duel berbalik ketika bek Villarreal, Gabriel Paulista, mendapatkan kartu kuning kedua dan diusir keluar lapangan menit 66. Aduriz membayar lunas kegagalan penaltinya dengan tandukan kepala untuk menyamakan kedudukan tujuh menit sebelum duel usai. “Penalti itu sedikit menyentak, tapi kami mampu bersatu setelah gol mereka dan mendapatkan hasil seri,” jelas Aduriz. “Kami mulai mendomi-

Klasemen La Liga Real Madrid 28 22 4 Atl Madrid 28 21 4 Barcelona 28 21 3 Ath Bilbao 28 15 7 Sociedad 28 13 7 Villarreal 28 13 6 Sevilla 28 12 8 Valencia 28 10 6 Espanyol 28 10 6 Levante 28 9 9 Celta Vigo 28 9 6 Granada 28 9 4 Elche 28 7 9 Malaga 28 7 8 Osasuna 28 8 5 Vallecano 28 9 2 Getafe 28 7 7 Valladolid 28 5 11 Almeria 28 7 5 Real Betis 28 4 7

2 3 4 6 8 9 8 12 12 10 13 15 12 13 15 17 14 12 16 17

77-26 70 64-21 67 81-22 66 51-32 52 49-39 46 48-34 45 51-43 44 39-39 36 32-34 36 26-35 36 33-39 33 27-39 31 24-40 30 26-36 29 24-48 29 32-62 29 26-45 28 30-48 26 27-52 26 23-56 19

nasi menjelang akhir pertandingan, jadi kami kurang lebih merasa puas juga,” katanya lagi. (m15/ant/rtr/espn)

vils, yang sebelumnya juga telah dipecundangi juara Liga Super Yunani itu 0-2 pada leg pertama di Piraeus. “Ini masa sulit, tetapi kami pernah berada di sini sebelumnya. Saatnya karakter para pemain akan ditempa untuk bisa bangkit serta bersinar,” tutur Rooney. “Saya pikir suporter sangat luar biasa, mereka fantastis bagi kami. Sebagai tim, di ruang ganti, kami benar-benar mengapresiasi hal itu,” tambah striker Inggris itu. Winger anyar Juan Mata pun yakin, United segera melupakan tragedi Merah dengan menjadikan Jose Holebas cs sebagai pelampiasan kebangkitan. “Badai pasti berlalu dan matahari akan bersinar lagi, saya tidak ragu itu. Tentu tidak ada yang mengatakan ini mudah, tapi inilah sepakbola,” klaim Mata di blog Grada360. Dukungan fanatis fans Red Devils, menurut Mata, ikut memberi kenangan fantastis serta motivasi tersendiri bagi mereka. “Saya mesti mengatakan bahwa seminggu di tempat latihan berlangsung baik dan kami berharap banyak pada laga nanti,” papar mantan pemain Chelsea tersebut. Kiper David De Gea bahkan menegaskan, Setan Merah mampu menyingkirkan Olympiakos dengan membalikkan defisit dua gol hasil jumpa pertama di Piraeus. “Kami tahu kami tidak ber-

AP

BOMBER MU Wayne Rooney (kiri) kini optimis bakal mengatasi Jose Holebas cs. main dengan baik di Yunani. Mereka lebih baik dari kami dan mereka menang,” ungkap penjaga gawang asal Spanyol itu di laman resmi UEFA. “Tetapi sekarang leg kedua di Old Trafford. Saya pikir dengan suporter di belakang ka-

Michel Mengintip MU LONDON (Waspada): Pelatih Olympiakos Michel Gonzales (foto kanan), hadir langsung di Old Trafford akhir pekan kemarin, saat Manchester United dipermalukan Liverpool 0-3 pada matchday 30 Liga Premier. Michel datang untuk mengintip perkembangan MU asuhan manajer David Moyes (foto kiri), terkait kepentingan taktik dan strategi menghadapi laga leg kedua babak 16 besar Liga Champions.

Pria Spanyol itu sepertinya ingin lebih mengenal lagi permainan Setan Merah, meskipun pasukannya sudah unggul 2-0 hasil leg pertama di Piraeus, 25 Februari silam. Dua gol kemenangan Olympiakos di Stadion Karaiskaki dicetak Alejandro Dominguez dan Joel Campbell. “Jika kami berpikir memiliki keunggulan lebih dari lawan, maka kami akan gagal,” ucap Michel, seperti dikutip dari TribalFootball, Selasa (18/3).

Statistik Laga Leg I Olympiakos MU

AP

Masa mengintip mantan pelatih Sevilla itu lebih lapang serta bermakna, sebab skuadnya telah mengamankan gelar juara Liga Super Yunani ke-41

mi, kami harus pergi ke lapangan dan bertarung serta menyerang sejak menit pertama,” tekad De Gea. Dia yakin, jika Setan Merah asuhan David Moyes menekan dengan baik, otomatis peluang bagus bakal terbuka.

ketika liga masih menyisakan lima partai. “Setelah selebrasi dan kebahagiaan, kami mesti bersiap untuk United. Gelar juara liga

akan membuat laga tandang ini lebih bisa dinikmati. Tetapi kami harus tetap focus,” tegas Michel. Michel pun berharap keka-

40% 2 12 4 1 10 0 0 0 1

Penguasaan Bola 60% 0 Skor Akhir 7 Tembakan Total 1 Tembakan Tepat 4 Tembakan Pojok 10 Pelanggaran 4 Offsides 2 Kartu Kuning 0 Kartu Merah 2 Penyelamatan *Sumber ESPN

lahan MU dari Liverpool dan sukses Olympiakos menjuara liga domestik, membuat Giannis Maniatis cs semakin termotivasi

Liga Champions Dinihari Nanti

Leg I

B Dortmund (Jerman) v Zenit SP (Rusia) Man United (Inggris) v Olympiakos (Yunani) *SCTV live mulai pkl 02:45 WIB

4-2 0-2

“Kami akan memberikan segalanya yang kami milik dan bermain jauh lebih baik dari yang kami lakukan di sana. Dengan atmosfer dan tim yang

kami miliki, kami bisa sukses dan saya harap melaju ke babak berikutnya,” pungkas De Gea. (m15/ant/rtr/mrr/uefa)

untuk meraih kemenangan dinihari WIB nanti Old Trafford Stadium. Jika lolos ke perempatfinal Liga Champions, maka itu menjadi sukses pertama Olympiakos sejak yang terakhir tahun 1999 silam. “Kami telah sangat dekat untuk meraih sesuatu yang hebat,” klaim Joel Campbell. “Tampil bagus di Old Trafford sangat penting. Saya yakin ini impian para pemain kami,” tambah gelandang serang asal Kosta Rika tersebut. Sebaliknya bagi Setan Merah, Liga Champions satu-satunya jalan realistis untuk meng-

gapai prestasi pada musim perdana kepemimpinan Moyes. United telah gagal di Piala Liga dan Piala FA, serta terpuruk di Premiership. “Para pemain kami cukup sadar arti penting pertandingan Rabu ini, juga apa yang harus kami raih,” jelas Moyes. Setan Merah mencatat rekor kemenangan 100 persen di kandang sendiri melawan Olympiakos. Namun MU hanya sekali menang setelah kalah di leg pertama Liga Champions, yakni ketika membantai AS Roma 7-1 untuk membalas kekalahan 1-2 di leg pertama pada 2007. (m15/goal/tf/rtr)

Totti Senang Giallorossi Menang

AP

KAPTEN AS Roma Francesco Totti (2 kanan) merayakan golnya ke gawang Udinese dengan Mattia Destro (kiri), Radja Nainggolan dan Gervinho (kanan) di Stadion Olimpico Roma.

AVB Bos Baru Zenit MOSKOW (Antara/AFP): Zenit Saint Petersburg mencapai kesepahaham dengan Andre Villas-Boas (foto) untuk menjadi pelatih baru mereka. Klub tiga kali juara Rusia itu dalam pernyataannya, Selasa (18/3) menjelaskan, mantan pelatih Porto, ChelReuters sea, dan Tottenham Hotspur itu akan menandatangani kontrak dengan Zenit pada 20 Maret. AVB menggantikan peran pelatih asal Italia Luciano Spalletti, yang dipecat minggu lalu. Pria Portugal itu dengan demikian belum mendampingi Andrei Arshavin cs dalam laga tandang di markas Borussia Dortmund dinihari WIB nanti pada leg kedua babak 16 besar Liga Champions. Kontrak pelatih berusia 36 tahun yang membawa Porto menjuarai Liga Europa 2012 itu mulai berlaku pada 21 Maret dan akan berjalan selama dua musim. AVB akan melakoni tantangan besar di Zenit, setelah kerjanya berakhir tragis di Chelsea dan Tottenham. Dia selama ini dikenal sebagai pelatih paling menjanjikan dalam usia muda.

ROMA (Waspada): Francesco Totti mencetak gol penyemangat AS Roma, Senin (Selasa WIB), saat dia kembali bermain setelah absen lama karena cedera. Aksi sang kapten melengkapi sukses I Giallorossi, yang kemudian menjinakkan Udinese 3-2 pada giornata 28 Liga Seri A untuk memangkas jarak dengan pemimpin klasemen Juventus. “Menyenangkan untuk mencetak gol lagi. Namun yang penting memenangi pertandingan untuk memastikan kami tetap unggul atas Napoli. Kami harus mempertahankan peringkat kedua,” tutur Totti melalui Sky Sports, Selasa (18/3). Totti menikmati impiannya kembali ke Stadion Olimpico. Mendapat bola pantul dari tembakan jarak dekat Gervinho menyusul operan Miralem Pjanic menit 22, Il Capitano mulus melesakkan bola m e l e w a t i k i p e r Si m o n e Scuffet. Gelandang Mattia Destro menambah keunggulan tim tuan rumah menit 30, skor

Roma 56% 3 20 9 5 8 2 1 0 6

Udinese

Penguasaan Bola 44% 2 Skor Akhir 14 Tembakan Total 8 Tembakan Tepat 11 Tembakan Pojok 13 Pelanggaran 1 Offsides 1 Kartu Kuning 0 Kartu Merah 6 Penyelamatan *Sumber ESPN

2-0 untuk Il Lupo bertahan hingga turun minum. Memasuki babak kedua, Udinese berusaha bangkit dengan menekan benteng Serigala Merah. Harapan La Zebrette hidup lagi setelah gelandang veteran Giampiero Pinzi menyarangkan gol balasan menit 51. Laga semakin seru, sebelum Vasilis Torosidis memulihkan keunggulan Roma menit 69. Tim tamu kembali bangkit dengan gol Dusan Basta menit 80, yang sekaligus membuat tensi laga sangat tinggi sampai berakhirnya pertandingan. “Itu laga kandang tersulit dalam 15-16 pertandingan ka-

mi. Kami mendapatkan angka-angka, tetapi kami menyulitkan diri sendiri,” tutur allenatore Roma asal Prancis, Rudi Garcia. Mantan pelatih Lille itu menarik keluar Totti menit 72 untuk digantikan Alessandro Florenzi. “Kami tahu bahwa sang kapten tidak bisa bermain selama 90 menit, tapi dia benar-benar memberikan permainan terbaik,” ujar Garcia. “Saya juga senang dengan cara bermain tim, mengingat kami tanpa Daniele De Rossi, Kevin Strootman dan Douglas Maicon,” katanya menambahkan. Garcia mengaku, semangat bertarung I Friulani telah membuat skuadnya menderita. “Kami telah melakukan banyak hal-hal besar, tetapi kami juga tidak diberikan banyak peluang,” jelasnya. “Kami bisa saja mencetak gol lebih banyak, tapi tanpa kinerja brilian De Sanctis kami juga bisa banyak kebobolan. Kami membuat beberapa kesalahan, tapi kami mendapat tiga poin dan itu penting,” tegas Garcia. (m15/ant/rtr/sky)

Syarat Giroud Dapat Maaf Istri PARIS (Waspada): Masa kerja Olivier Giroud di Arsenal rawan berakhir, setelah dia ketahuan selingkuh dengan model seksi Celia Kay di sebuah hotel di Inggris, Februari silam. Akibat skandal tersebut, pernikahan Giroud dengan istrinya Jennifer (foto), menjadi di ujung tanduk. Hubungan keduanya merenggang, namun Jennifer masih mau memberikan maaf jika Giroud berkenan meninggalkan Inggris untuk kembali ke Prancis. “Dia (Jennifer) setuju untuk kembali kepada Giroud, tetapi hanya dengan syarat mereka meninggalkan London dan Inggris,” beber sumber dekat Jennifer kepada The Sun, yang dikutip Selasa (18/3). Jennifer pantas marah, sebab media sebesar DailyMail sampai merilis foto Giroud yang hanya mengenakan sempak, keluar dari kamar mandi. Momen itu sepertinya diabadikan Kay, saat menghabiskan malam dengan mantan bomber Montepellier tersebut. “Dia (Giroud) bertekad menyelamatkan pernikahannya, karena dia sadar betapa bodohnya apa yang sudah dia lakukan. Saya tahu dia akan menuruti apa yang diinginkan istrinya,” tambah sumber dimaksud Bocoran syarat dari sang istri tersebut,

eurosport

membuat isu bomber berumur 27 tahun itu akan hengkang dari Emirates Stadium pada akhir musim nanti, semakin berhembus kencang. Apalagi beberapa waktu lalu dia sempat menggelar pertemuan dengan agen kawakan, Muzzi Ozcan. Giroud baru dua musim berlaga di Liga Premier, setelah diboyong The Gunners dari Montpellier pada musim panas 2012. Dua musim membela Meriam London, penyerang Prancis itu mampu mengoleksi 23 gol dari 59 partai. (m15/vvn/sun/tf)

AP

BINTANG kemenangan Napoli Gonzalo Higuain membobol gawang Torino yang dikawal kiper Daniele Padelli di Olympic Stadium, Turin, Selasa (18/3) dinihari WIB.

Protes Gol Kontroversial Higuain TURIN, Italia (Waspada): Gol kontroversial Gonzalo Higuain, Senin (Selasa WIB), memastikan sukses Napoli mengatasi Torino 1-0 dalam duel dramatis giornata 28 Liga Seri A. Sebelum menaklukkan kiper Daniele Padelli menit 90 di Olympic Stadium, Turin, Higuain sempat melanggar bek Kamel Glik. Aksinya pun menuai protes keras dari pelatih Torino Giampiero Ventura. “Saya merasa malu kepada para pemain saya. Saya tak ingin membahas ketidakadilan yang kami derita, kami hanya ingin musim ini berakhir sesegera mungkin,” papar Ventura. “Kami semestinya sepuluh poin lebih banyak dari yang kami peroleh,” sindirnya lagi, sebagaimana diberitakan AFP, Selasa (18/3) Higuain membela gol kontroversialnya dengan berkata, “Memang ada kontak dengan Glik, namun dia dan saya sedang berlari kencang. Apa yang bisa saya lakukan hanyalah merayakan kemenangan ini.” “Saya belum pernah berbicara soal wasit sepanjang musim dan saya tak akan memulainya sekarang,” timpal Rafael Benitez, allenatore Napoli asal

Spanyol. Dalam duel tersebut, Il Toro mampu meredam serangan I Partenopei, sebelum akhirnya Higuain memecah kebuntuan. Menurut Benitez, Il Toro bertahan dengan sangat baik dan cukup merepotkan pasukannya ketika melancarkan serangan-serangan balik. “Saya pikir kami menciptakan sejumlah peluang bagus, begitu juga Torino. Itu membuktikan tim ini haus kemenangan,” jelas Benitez, yang segera menyiapkan skuadnya untuk menjamu FC Porto pada leg kedua babak 16 besar Liga Eropa besok malam di San Paolo. “Kami akan bermain melawan Porto pada Kamis dan bermain dua laga tiap pekan. Jadi tak mudah untuk terus menunjukkan ketajaman,” ujarnya lagi. Benitez juga memuji performa Marek Hamsik, yang dinilainya menunjukkan perbaikan dibandingkan laga-laga sebelumnya, setelah bintang Slovakia itu pulih dari cedera. “Dia bermain lebih bagus malam ini dan membantu tim, baik dalam menyerang maupun bertahan. Saya tak pernah berpikir untuk memintanya bermain lebih dalam, karena dia punya kemampuan me-

Torino

Napoli

44% Penguasaan Bola 56% 1 0 Skor Akhir 13 12 Tembakan Total 4 4 Tembakan Tepat 5 5 Tembakan Pojok 8 14 Pelanggaran 1 3 Offsides 2 2 Kartu Kuning 0 0 Kartu Merah 4 3 Penyelamatan *Sumber ESPN

Klasemen Liga Seri A Juventus 28 24 3 AS Roma 27 18 7 Napoli 28 17 7 Fiorentina 28 14 6 Inter Milan28 12 11 Parma 27 12 10 Fiorentina 28 14 6 Lazio 28 11 8 Hellas 28 12 4 Atalanta 28 11 4 Torino 28 9 9 AC Milan 28 9 8 Genoa 28 9 8 Sampdoria 28 9 7 Udinese 28 9 4 Cagliari 28 6 11 Chievo 28 6 6 Livorno 28 6 6 Bologna 28 4 11 Sassuolo 28 5 6 Catania 28 4 8

1 2 4 8 5 5 8 9 12 13 10 11 11 12 15 11 16 16 13 17 16

64-19 75 52-14 61 53-29 58 48-31 48 46-29 47 45-31 46 48-31 48 36-35 41 43-46 40 31-38 37 39-36 36 41-42 35 31-35 35 33-42 34 32-42 31 27-38 29 23-41 24 31-51 24 23-43 23 28-56 21 21-49 20

nuntaskan peluang,” pungkas Benitez. (m15/ant/afp/sky)


Sport

WASPADA Rabu 19 Maret 2014

A11

Gatot: Jangan Kendur Mengurus Olahraga KEBAHAGIAAN Anda Suhendra Rambe SH dalam mengakhiri masa lajangnya di rumah mempelai wanita Eka Dian Rahmayuni SPd, Sabtu (15/3), semakin lengkap dengan kehadiran Gubsu H Gatot Pujo Nugroho dan Wakil Ketua DPRD Sumut H Sigit Pramono Asri. Anda merupakan Wakil Ketua KONI Asahan. Saat akad nikah, dia didampingi anggota DPR RI H Nasril Bahar, anggota DPRD Sumut Muslim Simbolon, jajaran pengurus KONI, tokoh sejumlah partai, dan kalangan Muhammadiyah Asahan. Anda mempersunting guru Bahasa Inggris Perguruan Diponegoro, Eka Dian Rahmayuni SPd, putri Sarwo Edi/Sri Wahyuni. Usai shalat Magrib di masjid dekat lokasi resepsi Anda/Eka, Gubsu GUBSU H Gatot Pujo Nugroho didampingi Wakil Ketua DPRD Sumut H Sigit Pramono Asri SE, makan malam bersama Wakil Ketua KONI Asahan Anda S Rambe dan Eyang Mertua Anda S Rambe, dalam resepsi pernikahan Anda-Eka, Sabtu (15/3) -Waspada/Sapriadi-

Gatot dan Sigit Pramono tanpa protokoler duduk lesehan bersama Anda Suhendra Rambe untuk santap malam, didahului wejangan Gatot soal hidup berumah tangga. “Apa pun aktivitas dalam mengharungi bahtera rumah tangga sebagai kepala keluarga, jangan lupa berolahraga serta jangan kendur untuk mengurus olahraga,” tukas Gatot di ujung wejangannya kepada Anda. Sedangkan Sigit Pramono Asri mengingatkan Anda agar menjaga keseimbangan rumah tangga. “Bekal pengalaman berorganisasi, khususnya di KONI Asahan bisa dijadikan resep menstabilkan rumah tangga yang dibaluti nilai agama dan budaya,” tambah Sigit yang juga Dewan Penyantun KONI Asahan. Sigit berkelakar menyatakan dirinya dan Ketua Umum KONI Asahan Nurkarim Nehe SE MSP sebagai turut mengundang dalam kartu undangan, sudah menyelesaikan tugas mengantar Gubsu ke resepsi Anda. “Nehe tidak ikut, sibuk sebagai Kepala Biro Waspada Kisaran, sudah dua kali Nehe ditegur pimpinan,” ujar Sigit sambil tertawa lebar. *Sapriadi

Bunus Berlimpah Juara All England JAKARTA (Waspada): Unggulan Indonesia di sektor ganda putra, Mohammad Ahsan/Hendra Setiawan dan ganda campuran Tantowi Ahmad/ Liliyana Natsir, menerima bonus berlimpah berkat prestasinya mengharumkan Indonesia di ajang All England Super Series 2014. Pasangan ganda putra Ahsan/Hendra sukses meraih gelar juara di All England, setelah mengalahkan pasangan asal Jepang, Hiroyuki Endo/ Kenichi Hayakawa, dengan dua set langsung 21-19, 21-19. Sedangkan pasangan Tantowi/Liliyana, gelar juara itu menjadi yang ketiga setelah menumbangkan pasangan nomor satu dunia asal China, Zhang Nan/Zhao Yunlei, dengan dua game langsung 21-13, 21-17.

Berkat prestasi membanggakan tersebut, duo ganda unggulan Indonesia itu berhak menerima bonus total Rp1 Milliar yang dipersembahkan oleh Djarum Foundation dan Yayasan Jaya Raya. Selain dua juara, pelatih pasangan ganda tersebut, Richard Mainaky dan Herry IP, juga mendapat hadiah masing-masing Rp10 juta Bonus ini diberikan secara langsung di Galeri Indonesia Kaya, Grand Indonesia Mall, Selasa (18/3), oleh Program Di-

rector Bakti Olahraga Djarum Foundation, Yoppy Rosmini dan Ketua Yayasan Jaya Raya Bambang Bahagio. “Bonus ini adalah bentuk apresiasi dan komitmen kami dalam mendukung atlet untuk dapat terus meraih prestasi setinggi mungkin,” ujar Yoppy Rosmini dalam acara penyerahan bonus. Tantowi/Liliyana berhak menerima hadiah masingmasing senilai Rp200 juta. Tak sampai di situ, ganda unggulan pertama Indonesia ini juga mendapat hadia tambahan masing-masing Rp100 juta karena berhasil mempertahankan gelar juara sampai tiga kali. Sedangkan untuk Hendra/Ahsan mendapatkan masing-masing bonus senilai Rp200 juta. (m42/okz)

Bonus Atlet SEAG Belum Jelas JAKARTA (Waspada): Pencairan bonus bagi atlet-atlet peraih medali di ajang SEA Games 2013 dan Paragames 2014, hingga kini belum jelas kapan waktunya. Menteri Pemuda dan Olahraga (Menpora), Roy Suryo, menampik keterlambatan bonus atlet SEA Games 2013 dan Paragames 2014 dikarenakan pihaknya. Menurutnya, keterlambatan itu dikarenakan masalah mekanisme dari Kementerian Keuangan. Pemerintah melalui Kemenpora telah menjanjikan bonus kepada para atlet berprestasi di SEA Games dan Paragames akan turun bulan Januari. Namun hingga kini janji cuma janji. Terakhir pihak Kemenpora mengklaim akan mencairkan bulan Maret ini. Awalnya pihak Kemenpora mengatakan bahwa keterlambatan ini terkait Pemilu. Berdalih supaya bonus atlet tidak dianggap sebagai sarana politik (kampanye di bulan Ma-

ret), pemerintah merasa perlu membicarakan hal itu dengan pihak-pihak terkait, termasuk Badan Pengawas Pemilu (Banwaslu). Namun, nyatanya hal itu tak bermasalah. Roy justru menilai mekanisme di Kemenkeu yang prosesnya lama. “Sebenarnya tidak ada masalah dengan Bawaslu, namun semata-mata hanya soal mekanisme di Kemenkeu. Karena kalau proses di sana cepat, seharusnya sudah semenjak awal tahun bisa cair,” kata Roy dalam pesan singkat, Selasa (18/3). “Sejak awal juga sebenarnya tidak ada masalah di Kemenpora. Semua mekanisme ada di Kemenkeu. Karena harihari ini mendekati Pemilu, kami justru yang khawatir kalau ada tuduhan macam-macam, sehingga perlu banyak konsultasi, karena memang tidak ada niat sedikit pun untuk mempolitisasinya,” katanya. Hanya saja, lanjut Menpora, justru pihaknya yang

tidak mau dituduh mempolitisasi jika diserahkan sebelum Pemilu. Tapi kalau sesudah Pemilu atlet-atletnya yang keberatan, padahal keterlambatan ini murni mekanisme di Kemenkeu, bukan di Kemenpora. Kendati begitu, Roy juga tidak bisa menjelaskan mekanisme di Kemenkeu seperti apa, sehingga akhirnya membuat proses penyerahan dana bonus itu menjadi lama. Padahal, dana itu tidak diberi bintang untuk dikaji ulang. Tapi nyatanya, atlet tetap harus menunggur. Deputi IV Bidang Peningkatan Prestasi Kemenpora, Djoko Pekik Irianto, mengatakan bonus dalam tahap “in progress”. “Soal Bawaslu tidak ada masalah, soalnya lokasinya di Jakarta, bukan di Yogyakarta, tempatnya menteri. Yang jelas kita jalankan senormatif mungkin dan tidak melanggar hukum,” kata Djoko. (m42/ini)

Antara

PEMAIN Persipura Jayapura, Imanuel Wanggai (kiri), berusaha menendang bola ke arah gawang tim asal Maladewa, New Radiant SC yang dikawal penjaga gawang Mohamed Imran (kanan) di Stadion Mandala, Jayapura, Papua, Selasa (18/3).

Problem Catur

TTS TOPIK

Putih melangkah, mematikan lawannya dua langkah.

Jawaban di halaman A2. 8

7

6

5

4

3

2

1

A

B

C

D

E

F

G

H

Antara

Australia Unggulan Utama Piala Asia 2015 MELBOURNE (Waspada): Tuan rumah Australia menjadi tim unggulan utama putaran final Piala Asia 2015, menjelang undian pekan depan. Australia yang kalah dari Jepang pada laga final 2011 di Qatar, berada di urutan pertama pot pertama, dari empat pot yang ada. Australia bergabung dengan tim-tim peringkat atas lainnya, yakni Iran, Jepang, dan Uzbekistan. Meski tim unggulan didasarkan peringkat dunia FIFA terbaru, Australia yang berada di peringkat 63 menjadi tim unggulan utama karena perannya sebagai tuan rumah. Iran adalah tim peringkat 42 atau teratas dalam peringkat FIFA di Asia, diikuti Jepang (48) dan Uzbekistan (55). Tim-tim unggulan Asia yang mengikuti undian pekan depan adalah Australia, Iran, Jepang, Uzbekistan (Pot 1), Korea Selatan, UAE, Jordania, Arab Saudi (Pot 2), Oman, China, Qatar, Irak (Pot 3), Bahrain, Kuwait, Korut dan juara Challenge Cup (Pot 4). Undian yang akan berlangsung di Sydney pada 26 Maret itu, menyertakan 15 tim yang sudah dikonfirmasi, ditambah juara AFC Challenge Cup 2014. AFC Challenge Cup 2014 akan berlangsung di Maladewa pada Mei mendatang untuk memainkan laga final. (m42/ant)

GANDA putra Mohammad Ahsan/Hendra Setiawan bersama ganda campuran Tontowi Ahmad/ Liliyana Natsir, menerima bonus juara All England 2014 di Galeri Indonesia Kaya, Mall Grand Indonesia, Jakarta, Selasa (18/3).

DP Cup II Asah Bakat Siswa MEDAN (Waspada): Sebanyak 24 tim dari sembilan sekolah di Kota Medan mengikuti turnamen sepakbola bertajuk DP Cup II/2014 yang digelar SMA Dharma Pancasila di lapangan sekolah tersebut, Jl Dr Mansyur Medan, 16-29 Maret. Ketua Panitia, Egie Dwi Adika Putra didampingi Penanggungjawab Juandi, menjelaskan turnamen tersebut sebagai wadah mengasah bakat sepakbola pelajar tingkat SLTP di Kota Medan dan turnamen ini digelar rutin setiap tahun.

“Saat ini, sepakbola termasuk salah satu kegiatan ekstra kurikuler (ekskul) olahraga paling digemari di sekolah-sekolah di Kota Medan. Makanya kami ingin menyediakan wadah untuk pelajar mengasah bakat mereka,” katanya, Selasa (18/3). Tahun ini, kata Edi, jumlah perserta meningkat. Namun pihak sekolah membatasai jumlah tim peserta, mengingat waktu penyelenggaraanya cukup singkat. “Hal ini berkaitan dengan akan masuknya masa ujian sekolah,” ucapnya. (cat)

Persipura Pimpin Grup E Piala AFC 2014 JAYAPURA (Waspada): Persipura Jayapura berhasil meraih poin penuh atas tamunya New Radiant dalam laga lanjutan Grup E Pial AFC 2014 di Stadion Mandala, Jayapuran, Selasa (18/3) sore. Klub Mutiara Hitam itu meraih kemenangan meyakinkan 3-0 sekaligus memuncaki klasemen Grup E dengan poin tujuh. Persipura yang tampil menyerang sejak laga dimulai, terus menggempur pertahanan klub asal Maladewa tersebut. Namun, kerja keras tim asuhan Jacksen F Tiago baru membuahkan hasil di menit 40. Tim tuan rumah mendapat hadiah penalti setelah Titus Bonai dilanggar pemain New Radiant, Shafiu. Ian Kabes yang menjadi eksekutor menjalankan tugasnya dengan sempurna. Skor 1-0 bertahan hingga babak pertama usai. Di babak kedua, Persipura tetap tampil agresif dan berhasil menambah dua gol lagi yang diborong Imanuel Wanggai menit 62 dan 67. Skor 3-0 bertahan hingga laga berakhir. “Saya tidak perlu memberikan banyak komentar karena semua pemain tampil bagus,” ujar Jacksen, usai laga. “Apa yang mereka lakukan di lapangan sudah sesuai dengan petunjuk. Kemenangan ini berkat doa dan seluruh pendukung Persipura,” katanya. Wanggai yang mengemas dua gol di laga ini mengamini apa yang dikatakan sang pelatih. Menurutnya, semua pemain tampil bagus. “Kami di lapangan hanya bermain dan melaksanakan instruksi pelatih. Bersama teman-teman kami membina kerjasama di lapangan,” ungkapnya. (m42/ini)

Waspada/Arianda Tanjung

PEMAIN SMPN 28 Medan (kanan) berebut bola dengan pemain SMPN 9 dalam turnamen sepakbola DP Cup II/2014 di Lapangan SMA Dharma Pancasila, Jl Dr Mansyur, Selasa (18/3).

KESEHA TAN KESEHAT

Sudoku MENDATAR

MENURUN

1. Penyakit radang hati. 5. Indera untuk melihat (menjadi kuning sebagai ciri utama penyakit hepatitis A). 7. Segala sesuatu yang dapat dimakan (yang tercemar virus menjadi penyebab penyakit hepatitis). 9. Kekuatan dan energi fisik; Daya tahan. 10. Penyakit bengkak pada leher depan. 11. Spesialis Obstetri & Ginekologi. 12. Spesialis Paru. 13. Buah zaitun (Inggris), minyaknya mengandung asam oleat, baik untuk kesehatan jantung. 14. Bulu di dahi di atas mata. 16. Nama bermacam-macam penyakit kulit. 18. Rumah Sakit. 19. Berasa tidak nyaman di tubuh karena menderita sesuatu (demam dsb). 21. Tidak (Inggris), katakan terhadap narkoba. 24. Alat yang digunakan oleh dokter untuk mendengarkan bunyi kerja paru-paru dan jantung. 25. Singkatan pispot. 26. Susu (Inggris), menjaga tulang tetap kuat. 27. Penyakit kerapuhan tulang.

1. Protein sel darah merah yang memungkinkan darah mengangkut oksigen. 2. Kelainan (sering lupa) pada orang tua. 3. Buah surga, banyak khasiatnya untuk kesehatan, menurut hadis dan sejumlah pakar. 4. Spesialis Saraf. 5. Alat mendeteksi kanker payudara dengan menggunakan sinar X. 6. Hasil pembakaran penyebab ISPA. 8. Obat tablet pereda flu bertuliskan Forte di bawahnya. 11. Spesialis Forensik. 12. Severe Acute Respiratory Syndrome (wabah yang menyerang tahun 2003). 15. Radang pada rongga di sekitar hidung. 17. Zat cair buangan dari kandung kemih. 20. Pembuluh nadi tajuk jantung; Salah satu penyakit jantung yang sering ditemui di Indonesia. 22. Larutan untuk merawat diare. 23. Obat tetes mata. 24. Spesialis Kedokteran Olahraga. 25. Penyakit disebar kutu tikus.

Isi dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di kotak 3x3 bergaris tebal. Tingkat kesulitan: sedang (***), bisa diselesaikan kurang dari 10 menit. Jawabannya di halaman A2 kolom 1.

9 4 6 7 7 9 5 8 8 3 6 3 9 5 8 2 4 3 1 6 3 2 7 9 7 4 1 2 3 4 2 5 4 8 ***436


Sport

WASPADA Rabu 19 Maret 2014

A11

Gatot: Jangan Kendur Mengurus Olahraga KEBAHAGIAAN Anda Suhendra Rambe SH dalam mengakhiri masa lajangnya di rumah mempelai wanita Eka Dian Rahmayuni SPd, Sabtu (15/3), semakin lengkap dengan kehadiran Gubsu H Gatot Pujo Nugroho dan Wakil Ketua DPRD Sumut H Sigit Pramono Asri. Anda merupakan Wakil Ketua KONI Asahan. Saat akad nikah, dia didampingi anggota DPR RI H Nasril Bahar, anggota DPRD Sumut Muslim Simbolon, jajaran pengurus KONI, tokoh sejumlah partai, dan kalangan Muhammadiyah Asahan. Anda mempersunting guru Bahasa Inggris Perguruan Diponegoro, Eka Dian Rahmayuni SPd, putri Sarwo Edi/Sri Wahyuni. Usai shalat Magrib di masjid dekat lokasi resepsi Anda/Eka, Gubsu GUBSU H Gatot Pujo Nugroho didampingi Wakil Ketua DPRD Sumut H Sigit Pramono Asri SE, makan malam bersama Wakil Ketua KONI Asahan Anda S Rambe dan Eyang Mertua Anda S Rambe, dalam resepsi pernikahan Anda-Eka, Sabtu (15/3) -Waspada/Sapriadi-

Gatot dan Sigit Pramono tanpa protokoler duduk lesehan bersama Anda Suhendra Rambe untuk santap malam, didahului wejangan Gatot soal hidup berumah tangga. “Apa pun aktivitas dalam mengharungi bahtera rumah tangga sebagai kepala keluarga, jangan lupa berolahraga serta jangan kendur untuk mengurus olahraga,” tukas Gatot di ujung wejangannya kepada Anda. Sedangkan Sigit Pramono Asri mengingatkan Anda agar menjaga keseimbangan rumah tangga. “Bekal pengalaman berorganisasi, khususnya di KONI Asahan bisa dijadikan resep menstabilkan rumah tangga yang dibaluti nilai agama dan budaya,” tambah Sigit yang juga Dewan Penyantun KONI Asahan. Sigit berkelakar menyatakan dirinya dan Ketua Umum KONI Asahan Nurkarim Nehe SE MSP sebagai turut mengundang dalam kartu undangan, sudah menyelesaikan tugas mengantar Gubsu ke resepsi Anda. “Nehe tidak ikut, sibuk sebagai Kepala Biro Waspada Kisaran, sudah dua kali Nehe ditegur pimpinan,” ujar Sigit sambil tertawa lebar. *Sapriadi

Bunus Berlimpah Juara All England JAKARTA (Waspada): Unggulan Indonesia di sektor ganda putra, Mohammad Ahsan/ Hendra Setiawan dan ganda campuran Tantowi Ahmad/Liliyana Natsir, menerima bonus berlimpah berkat prestasinya mengharumkan Indonesia di ajang All England Super Series 2014.

Waspada/Arianda Tanjung

SKUAD PS Kwarta latihan persiapan jelang menghadapi laga ujicoba melawan PSGL Gayo Lues di Stadion Teladan Medan, Rabu (19/3) ini.

PS Kwarta Tidak Remehkan PSGL MEDAN (Waspada): Pelatih PS Kwarta Medan, Slamet Riyadi, mengaku buta dengan kekuatan PSGL Gayo Lues yang akan menjadi lawan tanding dalam laga ujicoba di Stadion Teladan Medan, Rabu (19/3) sore ini pukul 15.30. “Intinya, kami tidak ingin meremehkan lawan, meski PSGL klub amatir yang saat ini akan berkompetisi di Divisi I. Apalagi, PSGL berkomitmen tahun depan promosi ke Divisi Utama, sehingga tentunya mereka punya persiapan matang,” ujar Slamet, Selasa

(18/3). Dikatakan, ujicoba melawan PSGL akan dijadikan tolok ukur sejauhmana kemajuan yang telah dicapai skuad Burung Sumatera untuk mengarungi kompetisi Divisi Utama Liga Indonesia musim ini. “Nantinya tim pelatih meminta pemain tampil serius, tapi tetap tenang. Kami ingin melihat sejauhmana tim mampu mengaplikasikan hasil latihan selama ini. Laga nanti juga bisa dijadikan ajang menentukan siapa saja pemain yang siap masuk tim inti,”

Skuad PS Kwarta Kiper : Jefri Setiawan Belakang : Wiganda Pradita, Imam Z Aritonang, Ronny Fatahhilah, Dicky Yudistyra Tengah : Ahmad Junaedi, M Anthony, Dimas Satria Depan : Ismail, Wisnu, Ryan Pratama katanya. Secara head to head, kata Slamet, tim asuhannya belum pernah bertemu PSGL. Namun pihaknya akan tetap tampil dengan gaya permainan yang biasa, yakni bermain dari kaki ke kaki serta memanfaatkan kedua pemain sayap me-

Bonus Atlet SEAG Belum Jelas JAKARTA (Waspada): Pencairan bonus bagi atlet-atlet peraih medali di ajang SEA Games 2013 dan Paragames 2014, hingga kini belum jelas kapan waktunya. Menter i Pemuda dan Olahraga (Menpora), Roy Suryo, menampik keterlambatan bonus atlet SEA Games 2013 dan Paragames 2014 dikarenakan pihaknya. Menurutnya, keterlambatan itu dikarenakan masalah mekanisme dari Kementerian Keuangan. Pemerintah melalui Kemenpora telah menjanjikan bonus kepada para atlet berprestasi di SEA Games dan Paragames akan turun bulan Januari. Namun hingga kini janji cuma janji. Terakhir pihak Kemenpora mengklaim akan mencairkan bulan Maret ini. Awalnya pihak Kemenpora mengatakan bahwa keterlambatan ini terkait Pemilu. Berdalih supaya bonus atlet tidak dianggap sebagai sarana po-

litik (kampanye di bulan Maret), pemerintah merasa perlu membicarakan hal itu dengan pihak-pihak terkait, termasuk Badan Pengawas Pemilu (Banwaslu). Namun, nyatanya hal itu tak bermasalah. Roy justru menilai mekanisme di Kemenkeu yang prosesnya lama. “Sebenarnya tidak ada masalah dengan Bawaslu, namun semata-mata hanya soal mekanisme di Kemenkeu. Karena kalau proses di sana cepat, seharusnya sudah semenjak awal tahun bisa cair,” kata Roy dalam pesan singkat, Selasa (18/3). “Sejak awal juga sebenarnya tidak ada masalah di Kemenpora. Semua mekanisme ada di Kemenkeu. Karena harihari ini mendekati Pemilu, kami justru yang khawatir kalau ada tuduhan macam-macam, sehingga perlu banyak konsultasi, karena memang tidak ada niat sedikit pun untuk mempolitisasinya,” katanya.

Putih melangkah, mematikan lawannya dua langkah.

Jawaban di halaman A2. 8

7

6

5

4

3

2

1

B

C

D

E

F

G

H

Regenerasi Kunci Sukses Nusantara MEDAN (Waspada): Pelatih tim bola voli putri SMA Nusantara Lubukpakam, Ramses Rajagukguk, mengau puas tim asuhannya berhasil mempertahankan gelar juara turnamen Dharmawangsa Cup XX/ 2014 di Medan, Minggu (16/ 3) lalu. “Sebagai pelatih, saya merasa puas dan bangga bisa membawa tim ini tampil juara untuk kedua kalinya secara berturut-turut. Semoga kami dapat kembali menjuarai Dharmawangsa Cup untuk ketiga kalinya tahun depan,” ujar Ramses Rajagukguk, Selasa (18/3). Dikatakan, kunci sukses timnya tidak terlepas adanya proses regenerasi atlet yang berjalan baik. Terlebih, olahraga bola voli menjadi salah satu kegiatan ekstra kurikuler (ekskul) yang cukup digemari di sekolah.

Waspada/Dedi Riono

TIM bola voli putri SMA Nusantara Lubukpakam menjuarai turnamen Dharmawangsa Cup XX/2014 untuk kedua kalinya, baru-baru ini. Menurut Ramses, antusiasme pelajar SMA Nusantara untuk mengikuti ekskul bola voli cukup tinggi. Hal ini tidak terlepas dukungan pihak yayasan yang menyediakan lapangan yang cukup memadai untuk siswa berlatih. “Selain itu, sukses tim kami juga berkat tiga pemain tahun lalu yang masih memperkuat

tim, yakni Dina, Fani, dan Anum. Pengalaman ketiganya di tahun lalu, cukup berdampak positif dalam membangkitkan kepercayaan diri seluruh pemain,” ucapnya. Seperti diketahui, turnamen Dharmawangsa Cup XX berlangsung di Lapangan Taman Rekreasi dan Olahraga, Jl Gajah Mada Medan setiap

Sabtu dan Minggu selama satu bulan. SMA Nusantara tampil juara setelah menaklukkan SMA Laksamana Martadinana Medan 3-1. Sedangkan pada kategori putra, gelar juara diraih SMA Sinar Husni Helvetia yang menumbangkan SMAN 2 Pematangsiantar 3-2. (m42)

DP Cup II Asah Bakat Siswa MEDAN (Waspada): Sebanyak 24 tim dari sembilan sekolah di Kota Medan mengikuti turnamen sepakbola bertajuk DP Cup II/2014 yang digelar SMA Dharma Pancasila di lapangan sekolah tersebut, Jl Dr Mansyur Medan, 16-29 Maret. Ketua Panitia, Egie Dwi Adika Putra didampingi Penanggungjawab Juandi, men-

Waspada/Arianda Tanjung

PEMAIN SMPN 28 Medan (kanan) berebut bola dengan pemain SMPN 9 dalam turnamen sepakbola DP Cup II/2014 di Lapangan SMA Dharma Pancasila, Jl Dr Mansyur, Selasa (18/3).

TTS TOPIK

Problem Catur

A

Hanya saja, lanjut Menpora, justru pihaknya yang tidak mau dituduh mempolitisasi jika diserahkan sebelum Pemilu. Tapi kalau sesudah Pemilu atlet-atletnya yang keberatan, padahal keterlambatan ini murni mekanisme di Kemenkeu, bukan di Kemenpora. Kendati begitu, Roy juga tidak bisa menjelaskan mekanisme di Kemenkeu seperti apa, sehingga akhirnya membuat proses penyerahan dana bonus itu menjadi lama. Padahal, dana itu tidak diberi bintang untuk dikaji ulang. Tapi nyatanya, atlet tetap harus menunggu. (m42/ini)

nekan pertahanan lawan dengan mengusung formasi 4-3-3. Dikatakan, hampir semua pemain akan diturunkan. Namun, Ikhsan yang dikabarkan bisa tampil, ternyata belum bisa diturunkan karena masih berkutat dengan cedera. “Memang kami masih menunggu Ikhsan, tapi latihan terakhir cedera hamstring-nya belum pulih juga. Untuk itu, kami sudah menyiapkan Ryan untuk menggantikan posisinya,” pungkas Slamet. Sebelumnya, PS Kwarta juga telah melakoni sejumlah laga ujicoba, di antaranya melawan PS Klumpang Putra dengan memetik kemenangan 4-0. (cat)

Pasangan ganda putra Ahsan/Hendra sukses meraih gelar juara di All England, setelah mengalahkan pasangan asal Jepang, Hiroyuki Endo/ Kenichi Hayakawa, dengan dua set langsung 21-19, 21-19. Sedangkan pasangan Tantowi/Liliyana, gelar juara itu menjadi yang ketiga setelah menumbangkan pasangan nomor satu dunia asal China, Zhang Nan/Zhao Yunlei, dengan dua game langsung 21-13, 21-17.

Antara

GANDA putra Mohammad Ahsan/Hendra Setiawan bersama ganda campuran Tontowi Ahmad/ Liliyana Natsir, menerima bonus juara All England 2014 di Galeri Indonesia Kaya, Mall Grand Indonesia, Jakarta, Selasa (18/3). Tantowi/Liliyana berhak Berkat prestasi mem- Kaya, Grand Indonesia Mall, menerima hadiah masingbanggakan tersebut, duo gan- Selasa (18/3), oleh Program Di- masing senilai Rp200 juta. Tak da unggulan Indonesia itu ber- rector Bakti Olahraga Djarum sampai di situ, ganda ungguhak menerima bonus total Rp1 Foundation, Yoppy Rosmini lan pertama Indonesia ini juga Milliar yang dipersembahkan dan Ketua Yayasan Jaya Raya mendapat hadia tambahan masing-masing Rp100 juta oleh Djarum Foundation dan Bambang Bahagio. Yayasan Jaya Raya. Selain dua “Bonus ini adalah bentuk karena berhasil mempertajuara, pelatih pasangan ganda apresiasi dan komitmen kami hankan gelar juara sampai tiga tersebut, Richard Mainaky dan dalam mendukung atlet untuk kali. Sedangkan untuk HenHerry IP, juga mendapat ha- dapat terus meraih prestasi se- dra/Ahsan mendapatkan madiah masing-masing Rp10 juta tinggi mungkin,” ujar Yoppy sing-masing bonus senilai Bonus ini diberikan secara Rosmini dalam acara penye- Rp200 juta. langsung di Galeri Indonesia rahan bonus. (m42/okz)

KESEHA TAN KESEHAT

jelaskan turnamen tersebut sebagai wadah mengasah bakat sepakbola pelajar tingkat SLTP di Kota Medan dan turnamen ini digelar rutin setiap tahun. “Saat ini, sepakbola termasuk salah satu kegiatan ekstra kurikuler (ekskul) olahraga paling digemari di sekolah-sekolah di Kota Medan. Makanya kami ingin menyediakan wa-

dah untuk pelajar mengasah bakat mereka,” kata-nya, Selasa (18/3). Tahun ini, kata Edi, jumlah perserta meningkat. Namun pihak sekolah membatasai jumlah tim peserta, mengingat waktu penyelenggaraanya cukup singkat. “Hal ini berkaitan dengan akan masuknya masa ujian sekolah,” ucapnya. (cat)

Sudoku MENDATAR

MENURUN

1. Penyakit radang hati. 5. Indera untuk melihat (menjadi kuning sebagai ciri utama penyakit hepatitis A). 7. Segala sesuatu yang dapat dimakan (yang tercemar virus menjadi penyebab penyakit hepatitis). 9. Kekuatan dan energi fisik; Daya tahan. 10. Penyakit bengkak pada leher depan. 11. Spesialis Obstetri & Ginekologi. 12. Spesialis Paru. 13. Buah zaitun (Inggris), minyaknya mengandung asam oleat, baik untuk kesehatan jantung. 14. Bulu di dahi di atas mata. 16. Nama bermacam-macam penyakit kulit. 18. Rumah Sakit. 19. Berasa tidak nyaman di tubuh karena menderita sesuatu (demam dsb). 21. Tidak (Inggris), katakan terhadap narkoba. 24. Alat yang digunakan oleh dokter untuk mendengarkan bunyi kerja paru-paru dan jantung. 25. Singkatan pispot. 26. Susu (Inggris), menjaga tulang tetap kuat. 27. Penyakit kerapuhan tulang.

1. Protein sel darah merah yang memungkinkan darah mengangkut oksigen. 2. Kelainan (sering lupa) pada orang tua. 3. Buah surga, banyak khasiatnya untuk kesehatan, menurut hadis dan sejumlah pakar. 4. Spesialis Saraf. 5. Alat mendeteksi kanker payudara dengan menggunakan sinar X. 6. Hasil pembakaran penyebab ISPA. 8. Obat tablet pereda flu bertuliskan Forte di bawahnya. 11. Spesialis Forensik. 12. Severe Acute Respiratory Syndrome (wabah yang menyerang tahun 2003). 15. Radang pada rongga di sekitar hidung. 17. Zat cair buangan dari kandung kemih. 20. Pembuluh nadi tajuk jantung; Salah satu penyakit jantung yang sering ditemui di Indonesia. 22. Larutan untuk merawat diare. 23. Obat tetes mata. 24. Spesialis Kedokteran Olahraga. 25. Penyakit disebar kutu tikus.

Isi dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di kotak 3x3 bergaris tebal. Tingkat kesulitan: sedang (***), bisa diselesaikan kurang dari 10 menit. Jawabannya di halaman A2 kolom 1.

9 4 6 7 5 7 8 9 8 3 6 3 5 9 8 2 4 3 1 2 6 7 3 4 9 7 1 2 3 4 2 5 4 8 ***436


Sport

A12

WASPADA Rabu 19 Maret 2014

Pacer Tambah Derita Sixers INDIANAPOLIS, AS (Waspada) Philadelphia 76ers kembali menelan kekalahan ketika menyambangi markas Indiana Pacers, dalam lanjutan NBA di Indianapolis, AS, Selasa (18/3). Kekalahan itu merupakan yang ke-21 kali secara beruntun diraih oleh Sixers, julukan 76ers.

Pemain Pacers, Lance Stephenson menjadi bintang dengan mencetak 25 poin, tertinggi untuk tim tuan rumah. Sempat mendapatkan perlawanan di awal pertandingan, Pacers berhasil meraih kemenangan 9990 melawan Sixers. Pelatih Sixers, Brett Brown mengaku kecewa dengan pencapaian yang diraih oleh tim-

GRAND Prix F1 Australia yang berlangsung di Melbourne, Minggu (16/3).

AP

Panitia GP Australia Kecewa Mesin F1 Tak Lagi Bising MELBOURNE, Australia (Waspada): Adanya perubahan regulasi pada Formula Satu (F1) 2014 membuat sajian balapan menjadi kurang seksi lagi. Maka dari itu, penyelenggara GP Australia pun mempertimbangkan untuk menggugat FIA. Sepertidiketahui,padamusim ini F1 mengubah regulasi mesin denganmenghentikanpemakaian mesin 2,4 liter konfigurasiV8 dan putaran maksimum 18.000 per menit(rpm)akhirmusimini.Sebagai penggantinya ada mesin 1,6 literV6denganputaran15.000rpm. Ternyata, perubahan tersebut membuat raungan mesin yang keluar dari mobil tak lagi

segarang musim sebelumnya. Chief executive Grand Prix Corporation (AGPC), Andrew Westacott, menilai kurang bisingnya suara mesin membuat balapan tidak seksi lagi. “Satu aspek dari balapan kali ini adalah karena rasanya sedikit kurang seru dibandingkan sebelumnyadanitumerupakanba-gian dariperpaduanyangharusmereka temukan takaran tepatnya,” ujar Westacott dilansir ESPN F1. Para penonton yang hadir langsung ke sirkuit pun tak mendapatkan sajian balapan yang maksimal.GPAustraliapunmenjadi yang pertama merasakan hal tersebut, hingga Chairman AGPC

RonWalke langsung mengadukkannya kepada Bernie Ecclestone selaku bos F1. “Ron bicara (ke Ecclestone) setelah balapan, dan bilang para penggemar di venue tidak menyukainya,” katanya. Westacott menilai ada kontrak yang dilanggar oleh Formula One atas kejadian yang terjadi pada balapan, 16 Maret lalu. Ia pun sangat berharap bahwa musim depan,mobil-mobilF1akankembali bising. “Kami sudah membayar untuk sebuah produk, kami punya kontrak, kami melihat hal ituamatsangatseriuskarenakami menilai mungkin sudah ada pelanggaran-pelanggaran,” paparnya soal kontrak. (esp/m47)

Ferrari Mengaku Masih Berada Di Belakang MELBOURNE, Australia (Waspada):Rasapesimistismesih menggelayuti kubu Ferrari. Situasi itu tak terlepas dari komentar tim prinsipal, Stefano Domenicali (foto), yang menyebutkan bahwa tim berlogo kuda jingkrak itu ada di belakang para unggulan Formula Satu (F1). Pada race perdana, duo driver andalan Ferrari pun tidak bisa berbuat banyak. Pasalnya, Fernando Alonso dan Kimi Raikkonen hanya finis di peringkat lima dan delapan. Kondisi itu berbeda dengan yang dialami oleh rival timMercedes.Bahkan,pembalap

Net

Mercedes, Nico Rosberg tampil sebagai yang tercepat. Tak ayal, Domenicali pun menginginkan perbaikan kinerja yang signifikan agar bisa mendongrak prestasi Ferrari. Hal itu di-

Marquez Bakal Fit Di Losail DOHA (Waspada): Menjelang balapan perdana MotoGP 2014 disirkuit Losail, Qatar pada akhir pekan, sempat keluar ucapan ragu dari mulut juara dunia MarcMarquez(foto),yangsedang dalam tahap penyembuhan cederanya. Namun, pihak Repsol HondamerasayakinMarquezakan telah mendekati 100 persen fit. Diberitakan sebelumnya, pembalap 21 tahun itu dipaksa untuk menyingkir dari dua tes terakhir MotoGP di Sepang dan Phillip Island setelah mengalami patah kaki saat latihan di dirt track di Spanyol, bulan lalu. Marquez ridak mengendarai motor RC213V sejak awal Februari, ketika juara bertahan MotoGP itu mendominasi tes pembuka di Sirkuit Sepang, Malaysia. Sebenarnya, dia berharap dapat membalap pada tes yang diadakan oleh ban Bridgestone di Phillip Island dan Qatar. Namun,Marquezdisarankan untuktidakmengikutitestersebut untuk menghindari cedera yang lebih parah. Namun bos Honda Racing, Livio Suppo sangat yakin pembalapnya tersebut dapat fit menjelang balapan perdana di Doha, Minggu (23/3). “Saya memahami Marquez sangat suka membalap, tapi saya percayahalterbaiknyaadalahuntuk menunggu. Marquez sudah membuktikan pada tes pertama danselalumembalapsangatcepat dandiasudahmemilihmesinyang akan digunakan,” kata Suppo, disadur MCN, Selasa (18/3). “Saya mengerti sulit untuk menghadapi balapan pertama setelah hanya mengikuti tes selama tiga hari, dan hampir dua bulan dia tidak membalap bukan hal yang bagus. Tapi, saya rasa bakatnya sudah sangat bagus untuk mengatasi masalah ini,” lanjutnya. Kamis (20/3), para pebalap MotoGP sudah mulai mengikuti sesi latihan resmi pertama di Doha. Namun, Suppo sangat yakin Marquez masih dapat memperlihatkan performa terbaiknya pada balapan tersebut. “Saya berharap dia dapat mendekati kebugaran yang normal. Balapan di Qatar akan menjadi yang sangat panjang mulai Kamis besok, jadi ini menjadi cara

Net

yang baik untuknya menemukan kembali performa terbaik,” sambungnya. (mcn/m47)

anggapperlujikamasihingintampil kompetitif di F1 musim ini. “Sulit untuk mengatakan dengan pasti di mana posisi kami berada saat ini. Kami memiliki beberapa masalah yang harus kami pecahkan. Saat ini kami berada di belakang dari para unggulan, jadi sesuatu yang harus kami lakukan adalaah bekerja di rumah dan berkonsentrasi dalam usaha pemulihan prestasi,” ungkap Domenicali seperti dilansir Crash, Selasa (18/3). “Iniadalahhasilbalapanyang mengecewakan dan saya bisa mengerti kenyataannya bahwa kami tidak bisa memberikan hasil yangmaksimaldarikinerjakami,” lanjut Domenicali. Domenicali pun tidak lupa untuk memberikan penampilan Kimi yang gagal mengulangi prestasi terbaik di mana tahun lalu bisa menjadi yang tercepat di Australia bersama tim Lotus. Pria yang dirumorkan bakal mengganti posisi Bernie Ecclestone itu juga yakin bahwa Kimi akan merasa nyaman dengan F14T di setiap balapan selanjutnya. “Saya pikir kami perlu membantu Kimi dalam mencoba untuk menemukan keseimbangan yang tepat dengan mobil, karena dia layak mendapatkan hal itu. saya yakin di Malaysia kami akan tampil lebih baik,” papar Domenicali. (crs/m47)

nya. “Ini sangat ebrat karena turnamen ini sangat kompetitif, tapi berkaitan dengan rekor, kami tidak akan memikirkan itu,” kata Brown. “Saya tidak membawa rekor buruk itu ke ruang ganti pemain. Saya tidak memberitahukannyakepadaparapemain.Saya tidak memikirkan menge-nai hal itu, tapi Anda harus mewaspadainya,” lanjutnya, diberitakan ESPN, Selasa (18/3). Pencapaian buruk itu melewati rekor negatif Sixers yang pernah meraih 20 kali kekalahan beruntun pada musim 1972-73. Sixers juga menyamai rekor buruk yang pernah diraih Detroit Pistons untuk kekalahan beruntun terbanyak. Pistons mencatat 21 kali kalah beruntun pada musim 197980 dan 1980-81. Hingga kini, Cleveland Cavaliers masih memegang rekor kekalahan beruntun terbanyak sebanyak 26 kali pada musim 2010-11 season. “Kami akan move on. Kami berada dalam jalan yang berbeda sekarang,” ungkap Brown. Di Houston, pelatih Houston Rockets, Kevin McHale sempat khawatir mental pemain jeb-

Hasil lain Atlanta – Charlotte Phoenix – Brooklyn Oklahoma City – Chicago Utah – Houston Boston – Dallas LA Clippers – Denver lok setelah dikalahkan Miami Heat, kemarin. Tapi, kekhawatiran McHale tidak terlihat ketika menjamu Utah Jazz. Terrence Jones mencetak 30 poin, tertinggi untuk Rockets di pertandingan ini, yang berhasil meluluh-lantahkan Jazz dengan skor 124-86. Kemenangan mengakhiri tiga kekalahan beruntun yang diraih skuad besutan McHale ini. “Ada penekanan bagaimana kami bermain dan meningkatkan permainan. Sangat penting kami terus memperbaiki penampilan dan bermain semakin baik,” ujar McHale, setelah pertandingan. Dalam pertandingan itu, Rockets untuk pertama kalinya tidak diperkuat oleh Dwight Howard yang sedang mengalami cedera pergelangan kaki.

97 – 83 95 – 108 97 – 85 86 – 124 89 – 94 100 – 110 Namun, Rockets masih dapat mengatasi permainan Jazz, yang telah menelan lima kekalahan beruntun. Hasil negatif ini membuat Jazz memiliki rekor terburuk kedua di Wilayah Barat. “Kami hanya ingin bermain agresif. Kami ingin keluar dan bermain penuh semangat. Kami ingin mengembalikan performa terbaiknya,” lanjut Jones. Sementara itu, Chris Paul mengakhiri pertandingan dengan mencatat 29 poin dan tujuh assist untuk Clippers.Tambahan tujuh assist membuat total Paul mengemas 5,996. Dia mencoba untuk bergabung dengan raja assist lainnya, Magic Johnson, John Stockton dan Isiah Thomas, sebagai tim yang meraih lebih dari 6,000 assist selama berkarier di NBA. (esp/m47)

Rossi Masih Ingin Tantang Trio Spanyol GERNO DI LESMO, Spanyol (Waspada): Tiga pebalap dari Spanyol, Marc Marquez, Jorge Lorenzo dan Dani Pedrosa mendominasi balapan MotoGP tahun lalu. Namun, rider Yamaha, Valentino Rossi (foto), tidak akan membiarkan hal itu terjadi lagi pada musim ini. Penampilan bintang Yamaha itu memang boleh dibilang cukup impresif selama tes musim dingin. Semangatnya, semakin meningkat setelah berhasil menjadi pebalap tercepat kedua pada tes di Sepang 1 dan berbagi catatan waktu tercepat bersama Pedrosa, di tes Sepang 2. Rossi sepertinya, sudah mulai melupakan kegagalan selama dua tahun ketika memperkuat Ducati beberapa waktu lalu dan rasa percaya dirinya semakin tinggi bisa lebih bersaing pada musim 2013. Keputusan Rossi untuk kembali memperkuat Yamaha membuahkan hasil. Pembalap asal Italia itu berhasil naik podium sebanyak empat kali dan meraih satu kemenangan di Assen. Tapi, The Doctor tidak dapat bersaing dengan Jorge Lorenzo musim lalu.

Net

Hasil-hasil gemilang selama tes musim dingin membuat Rossi percaya bisa membalap lebih tangguh pada musim 2014, ketimbang balapan tahun lalu, di mana juara dunia sembilan kali ini gagal menantang Marquez dan Lorenzo. “Saya dalam keadaan yang lebih baik dan pada pramusim tahun ini hasilnya lebih positif ketimbang tahun lalu. Saya sangat tangguh di tes Sepang 1 dan 2 serta sangat cepat di Sirkuit Phillip Island. Tahun lalu, saya memang mengalami banyak masalah, tapi sekarang saya merasa

lebih baik dengan motor, di mana kami bisa perbaiki dan saya bisa membalap melewati batas,” kata Rossi. “Target sata adalah untuk mencoba dan lebih kompetitif ketimbang tahun lalu, di mana saya tahu itu sangat sulit karena levelnya sangat tinggi. Tiga pembalap pertama sangat tangguh, tapi saya yakin bisa bertarung melawan mereka,” lanjutnya. (mcn/m47)

Pasang Iklan Telp. 4528431 HP. 081370328259

Email: iklan_waspada@yahoo.co.id waspada.iklan@gmail.com

AP

GUARD Indiana Pacers Lance Stephenson (1) coba dihadang pemain Philadelphia 76ers, Henry Sims (35) di laga lanjutan NBA di Indianapolis, AS, Selasa (18/3). Pacers menang 99-90.


Sport

A12

WASPADA Rabu 19 Maret 2014

motogp

Marquez Mulai Prima DOHA (Waspada): Menjelang seri perdana MotoGP 2014, sempat keluar ucapan ragu dari mulut Marc Marquez (foto) yang sedang dalam tahap penyembuhan cederanya. Namun, pihak Repsol Honda sangat yakin Marquez akan kembali mendekati 100 persen fit.

AP

TERRENCE Jones (6) mampu menutupi lubang yang ditinggal Dwight Howard kala Houston Rocket mengungguli Utah Jazz dalam laga NBA, Selasa (18/3).

Diberitakan sebelumnya, pebalap berusia 21 tahun itu dipaksa untuk menyingkir dari dua tes pramusim MotoGP terakhir di Sepang dan Phillip Island setelah mengalami patah kaki saat latihan dirt track di Spanyol, bulan lalu. Marquez sendiri belum

mengendarai motor RC213V sejak awal Februari lalu, ketika sang juara bertahan itu mendominasi tes pembuka di Sirkuit Sepang, Malaysia. Sebenarnya, dia berharap dapat membalap pada tes yang diadakan oleh ban Bridgestone di Phillip Island dan Qatar.

Namun, Marquez disarankan untuk tidak mengikuti tes tersebut untuk menghindari cedera yang lebih parah. Namun Livio Suppo selaku bos Honda Racing sangat yakin pebalap andalannya tersebut dapat fit menjelang balapan perdana di Doha, Minggu (23/3) nanti. “Saya memahami Marquez sangat suka membalap, tapi saya percaya hal terbaiknya adalah untuk menunggu. Marquez sudah membuktikan pada tes pertama dan selalu membalap sangat cepat dan dia sudah memilih mesin yang akan digunakan,” kata Suppo,

Rockets Mampu Tanpa Superman HOUSTON, AS (Waspada): Pelatih Houston Rockets, Kevin McHale, merasa lega timnya mampu mengatasi kelelahan mental saat menghadapi Utah Jazz dalam lanjutan kompetisi NBA, Selasa (18/3). Kekhawatiran itu disebabkan sebelumnya Rockets kalah dari juara bertahan Miami Heat. Akibatnya, mental pemain jeblok setelah dikalahkan Miami Heat. Namun, kekhawatiran McHale tidak terlihat ketika menjamu Jazz. Terrence Jones mencetak 30 poin, tertinggi untuk Rockets, yang berhasil menghabisi Jazz 124-86. Kemenangan ini sekaligus mengakhiri tiga kekalahan beruntun yang diraih skuad besutan McHale tersebut. “Ada penekanan bagaimana kami bermain dan meningkatkan permainan. Sangat penting kami terus memperbaiki penampilan dan bermain semakin baik,” ujar McHale. Dalam pertandingan itu, Rockets untuk pertama kalinya tidak diperkuat oleh Dwight ‘Superman’ Howard yang cedera pergelangan kaki. Beuntung, Rockets dapat mengatasi permainan Jazz yang telah menelan lima kekalahan beruntun. Hasil negatif ini membuat Jazz memiliki rekor terburuk kedua di Wilayah Barat. Di laga lain, Chris Paul mencatat 29 poin tujuh assist bagi LA Clippers. Tambahan tujuh assist membuat total Paul mengemas 5,996 assist dan mendekati raja operan lainnya, semisal Magic Johnson, John Stockton, dan Isiah Thomas. Ketiga legenda ini sudah meraih lebih dari 6,000 assist selama berkarier di NBA. Sayang rekor impresif Paul tidak dibarengi kegemilangan Clippers yang akhirnya menyerah 100-110 dari Denver Nuggets. Meski di-

Hasil Selasa (18/3) Atlanta Hawks v Charlotte Bobcats

97-83

Indiana Pacers v Philadelphia 76ers

99-90

Brooklyn Nets v Phoenix Suns Oklahoma City Thunder v Chicago Bulls Houston Rockets v Utah Jazz Dallas Mavericks v Boston Celtics Denver Nuggets v LA Clippers

f1live

97-85 124-86 94-89 110-100

bantu 26 poin 12 rebound dari Blake Griffin, Clippers tak kuasa membendung Nuggets yang dipimpin JJ Hickson dengan 21 angka 11 rebound. Pindah ke Wilayah Timur, Philadelphia 76ers lagi-lagi menelan kekalahan ketika menyambangi markas Indiana Pacers. Kekalahan 90-99 yang didapat merupakan ke-21 kali secara beruntun bagi Sixers. Guard Pacers, Lance Stephenson, menjadi bintang dengan mencetak 25 poin. Paul Geogre, jagoan Pacers lainnya, menambah 24 angka. Dari Sixers, poin terbanyak disumbangkan Thaddeus Young (23). Bagi Sixers, pencapaian buruk itu melewati rekor negatif 20 kekalahan beruntun yang terjadi pada musim 1972/1973. Sixers juga menyamai rekor 21 kekalahan beruntun milik Detroit Pistons pada musim 1979/1980 dan 1980-1981. Hingga kini, Cleveland Cavaliers memegang rekor kekalahan beruntun terbanyak sebanyak 26 kali pada musim 20102011. (m33/ap)

Magnussen Kejutan Indah McLaren MELBOURNE, Australia (Waspada): Setelah satu musim tanpa naik podium, kini McLaren telah kembali unjuk gigi di Formula One (F1) musim 2014. Hebatnya, prestasi ini diukir lewat rookie asal Denmark, Kevin Magnussen (foto). Pada seri pembuka GP Australia di Sirkuit Albert Park, Minggu (16/3) lalu, Magnussen berhasil finish di urutan ketiga di belakang driver Red Bull, Daniel Ricciardo. Namun, beberapa jam kemudian FIA mencabut gelar Ricciardo dan otomatis Magnussen menjadi runner-up seri tersebut. Hal ini membuat Direktur McLaren, Eric Boullier senang bukan kepalang dan tak regu melontarkan pujian. Pasalnya, sang debutan berhasil mencuri perhatian di seri pertama F1 dengan start di posisi keempat berhasil melakukan start sempurna kemudian merebut posisi ketiga dari Lewis Hamilton (Mercedes) yang mengalami masalah mesin. Magnussen terus menguntit Ricciardo hingga garis finish dan mematahkan pencapaian buruk tim yang bermarkas di Inggris itu. Bahkan prestasi Magnussen ini melebihi driver paling senior dan rekan setimnya, Jenson Button, yang kemudian menempati peringkat ketiga. “Minggu yang hebat baginya (Magnussen), untuk pengemudi muda seperti dia, ia berhasil mengatasi tekanan dengan sempurna. Seorang yang dewasa untuk ukuran anak-anak muda usia 21 di balapan F1 pertamanya. Dia tidak melakukan kesalahan jadi kami sangat terkesan,” tutur Boullier, Selasa (18/3). (m33/auto)

108-95

motogp

PEBALAP Yamaha Valentino Rossi (kanan) optimis bisa menandingi Marc Marquez (tengah), Jorge Lorenzo (kiri), dan Dani Pedrosa musim ini.

Rossi Incar Trio Matador DOHA (Waspada): Pebalap Yamaha, Valentino Rossi, optimistis bisa lebih memberi ancaman kepada dominasi tiga rider asal Negeri Matador, Marc Marquez, Jorge Lorenzo, dan Dani Pedrosa, di MotoGP 2014. The Doctor berharap bisa meraih lebih banyak kemenangan musim ini. Di musim pertamanya comeback bersama Yamaha setelah melalui mimpi buruk bersama Ducati, Rossi meraih hasil yang cukup positif. Musim lalu, legenda balap asal Italia itu berhasil meraih enam podium, termasuk satu kemenangan di Assen, Belanda.

Musim ini, persiapan Rossi cukup impresif. Juara dunia kelas primer grand prix tujuh kali itu menjadi tercepat kedua di tes pertama Sepang. Di tes kedua Sepang, Rossi bersaing ketat dengan rider Repsol Honda, Dani Pedrosa. Dengan persiapan yang lebih matang daripada musim lalu, Rossi yakin bisa meraih hasil positif di MotoGP 2014. Pebalap humoris berusia 35 tahun itu mengaku semakin nyaman menunggangi motor YZR-M1 milik Yamaha. “Saya dalam kondisi yang lebih bagus, dan pramusim ini lebih positif daripada tahun lalu. Saya tampil kuat di tes Se-

pang pertama dan kedua, begitu juga di Phillip Island. Tahun lalu, saya mengalami banyak masalah. Musim ini, saya merasa lebih nyaman bersama motor. Saya bisa menungganginya lebih kencang,” ujar Rossi, Selasa (18/3). Musim lalu, Rossi kesulitan melewati dominasi tiga pebalap asal Spanyol. Namun, untuk musim ini, mantan joki Honda itu yakin mampu mendobrak dominasi trio Negeri Matador tersebut. “Target saya musim ini adalah berusaha tampil lebih kompetitif, yang saya sadar akan sulit, karena levelnya sangat tinggi. Ketiga pebalap pertama sangatlah kuat, tapi saya yakin bisa bersaing dengan mereka,” kata Rossi jelang seri pembuka di Sirkuit Losail, Qatar, Minggu (23/3) nanti. (m33/mgp)

Selasa (18/3). “Saya mengerti sulit untuk menghadapi balapan pertama setelah hanya mengikuti tes selama tiga hari, dan hampir dua bulan dia tidak membalap bukan hal yang bagus. Tapi, saya rasa bakatnya sudah sangat bagus untuk mengatasi masalah ini,” lanjutnya.

Musim ini, Marquez masih difavoritkan untuk kembali merebut gelar juara dunia. Rider muda asal Spanyol tersebut menjadi fenomena musim lalu kala menjadi pebalap rookie pertama dalam 35 tahun terakhir yang mampu merebut gelar juara dunia kelas primer grand prix. (m33/mgp)


Sumatera Utara

WASPADA Rabu 19 Maret 2014

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:36 12:49 12:36 12:43 12:43 12:40 12:36 12:32 12:39 12:38

‘Ashar 15:45 16:01 15:46 15:55 15:54 15:45 15:45 15:40 15:48 15:49

Magrib 18:39 18:52 18:40 18:47 18:46 18:44 18:40 18:36 18:42 18:42

‘Isya

Imsak

Shubuh Syuruq

Kota

19:47 20:01 19:48 19:55 19:55 19:52 19:48 19:44 19:51 19:50

05:06 05:19 05:06 05:13 05:13 05:10 05:06 05:02 05:09 05:08

05:16 05:29 05:16 05:23 05:23 05:20 05:16 05:12 05:19 05:18

L.Seumawe 12:42 L. Pakam 12:35 Sei Rampah12:34 Meulaboh 12:46 P.Sidimpuan12:33 P. Siantar 12:34 Balige 12:34 R. Prapat 12:31 Sabang 12:49 Pandan 12:35

06:30 06:43 06:30 06:38 06:37 06:34 06:30 06:26 06:33 06:32

Zhuhur ‘Ashar 15:53 15:44 15:43 15:56 15:39 15:42 15:41 15:38 16:01 15:42

B1

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

Zhuhur ‘Ashar

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

Zhuhur

‘Ashar

Magrib

‘Isya

Imsak

Shubuh Syuruq

18:45 18:38 18:38 18:49 18:37 18:38 18:38 18:35 18:52 18:39

19:53 19:47 19:46 19:57 19:45 19:46 19:46 19:43 20:00 19:47

05:12 05:05 05:04 05:16 05:03 05:04 05:04 05:01 05:19 05:05

05:22 05:15 05:14 05:26 05:13 05:14 05:14 05:11 05:29 05:15

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:35 12:37 12:46 12:39 12:36 12:43 12:31 12:42 12:35 12:34

18:39 18:40 18:50 18:43 18:40 18:46 18:35 18:45 18:38 18:37

19:47 19:48 19:58 19:51 19:48 19:55 19:43 19:53 19:46 19:45

05:05 05:06 05:16 05:09 05:06 05:13 05:01 05:11 05:04 05:04

05:15 05:16 05:26 05:19 05:16 05:23 05:11 05:21 05:14 05:14

Panyabungan Teluk Dalam Salak Limapuluh Parapat GunungTua Sibuhuan Lhoksukon D.Sanggul Kotapinang AekKanopan

12:32 12:39 12:37 12:33 12:35 12:32 12:31 12:41 12:35 12:30 12:32

15:37 15:43 15:45 15:41 15:42 15:38 15:37 15:52 15:42 15:36 15:39

18:36 18:43 18:41 18:36 18:38 18:36 18:35 18:45 18:39 18:34 18:35

19:44 19:51 19:49 19:44 19:46 19:44 19:43 19:53 19:47 19:42 19:43

05:02 05:09 05:07 05:03 05:04 05:02 05:01 05:11 05:05 05:00 05:01

05:12 05:19 05:17 05:13 05:14 05:12 05:11 05:21 05:15 05:10 05:11

06:36 06:29 06:28 06:40 06:27 06:28 06:28 06:25 06:43 06:29

15:42 15:45 15:58 15:46 15:46 15:53 15:40 15:50 15:41 15:43

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

06:29 06:31 06:41 06:33 06:30 06:37 06:25 06:36 06:28 06:28

06:26 06:33 06:31 06:27 06:29 06:26 06:25 06:35 06:29 06:24 06:26

Calo Tiket Dan Taksi Gelap Marak Di KNIA KUALANAMU, Deliserdang (Waspada): General Manager PT Angkasa Pura 2 (AP 2) Kualanamu International Airport (KNIA/KNO) HT Said Ridwan, ST, MM, melalui Liaison Officer Kehumasan PT AP 2 HM Wasfan Wahyu Widodo menyesalkan masih ada pengguna jasa bandara yang belum mengetahui konsep bandara pengganti Polonia, yang mengadopsi bandara berkelas dunia tersebut. “Ketidaktahuan ini jelas menjadi makanan empuk bagi para calo yang mencari keuntungan secara tak bertanggungjawab alias terkesan memaksa dan memeras untuk mengeruk rupiahdariparapenggunajasabandara,” jelasWasfan kepada Waspada, Selasa (18/3), meluruskan informasi salah satu pengguna jasa bandara (seorang Tenaga Kerja Indonesia-red) yang me-

ngeluhkan masih maraknya calo di KNIA, termasuk calo tiket dan taksi gelap. Menurut Wasfan, salah seorang calon penumpang mengaku sempat dibuntuti para calo bagi yang belum mengurus atau memiliki kartuTenaga Kerja Luar Negeri (KTKLN) dan dimintai biayaagarbisamelewatitigapintu gerbang security bandara. “Nah, dari sini jelas menjadi

incaran para calo yang memang pandai menyaru dan kita sudah upayakan semaksimal mungkin mengatasinya secara persuasif. Soalnya bandara ini masih baru dan dalam tahap penyempurnaan. Jadi butuh kerjasama antara seluruh pihak terkait dan pengguna jasa bandara sendiri,” imbuh Wasfan, menambahkan pihak PT AP 2 sendiri dengan logo terbarunya telah berikrar akan memberi pelayanan dan kenyamanan yang terbaik bagi pengguna jasa bandara. Untuk itu, lanjutWasfan, dalam waktu dekat pihaknya akan mengedukasicalonpenggunajasa bandara,pengunjungdanumum denganmembuat‘pojokbandara’. “Salah satunya ya peristiwa tadi, jika si calon penumpang lebih pintar jelas dia akan mengetahui,

mana area publik dan mana yang non publik. Jadi para calo tidak dapatmenakut-nakutinya,”sebut Wasfansembarimengakuipelayanan di KNIA, meski sudah mulai membaik namun masih butuh peningkatan guna mengimbangi kemegahan dan kecanggihan infrastruktur serta fasilitasnya. Wasfanmenyarankankhusus untuk TKI, sebaiknya perusahaan yang menanggungjawabi agar memberi bimbingan dan arahan soal keberangkatan ke luar negeri. “Jadi kita semua bertanggungjawab untuk mengedukasinya, sehingga mampu mengimbangi pengetahuan kebandarudaraan berkelas dunia,” ujar Wasfan sembari menambahkan, untuk mengatasi calo tiket pihaknya telah bersinergi dengan pihak terkait agar para pengguna jasa

bandara dapat menunjukkan ID (KTP), baik pada saat chek in mau pun saat menuju pintu pesawat. Terakhir, soal praktek taksi gelap yang mulai meresahkan, Wasfan menegaskan pihak keamanan bandara sudah berulangkalimelakukanpenindakan, namun aksi ilegal tersebut masih jugaterjadi.“Nah,untukyangsatu ini pihak manajemen PT AP 2 sendiri sudah mengupayakan membatasi gerakan mereka dengan membuat koridor taman ditengah-tengahpintukeluarkedatangan.Ternyatainibelummenyurutkan aksi paksa mereka kepada penggunajasa.Untukituperlulagi sinergiantarpihakterkaitmengatasinya.Pokoknya,tidakhanyamenjelangperesmiansajaupayapembersihaninidilakukan,tapiuntukjangka panjang,” tegasWasfan.(m16)

Perampok PT Jamsostek T. Morawa Diringkus Di Agara LUBUKPAKAM (Waspada): Salah seorang dari empat pelaku perampokan Kantor PT Jamsostek (Badan Penyelenggara Jaminan Sosial-red) di Jalan Lintas Sumatera (Jalinsum) Medan-Tanjungmorawa Km 14,5, Kec. Tanjungmorawa, Deliserdang, Senin (10/3) sekira pukul 03:30 berinisial EFS, 30, warga Kab. Aceh Tenggara (Agara) yang sehari-harinya ngontrak di Jalan Garu I Medan, diringkus Sat Reskrim Polres Deliserdang di Kab. Aceh Tenggara, Rabu (12/3) sekira pukul 04:00. Informasi Waspada himpun,

sebelumnya pada Senin (10/3) sekira pukul 03:30, EFS bersama tiga rekannya yang masih buron masing-masing SR, RB dan PS merampok PT Jamsostek menggunakan senjata api dan senjata tajam. Sebelum merampok, para tersangkamelumpuhkanpetugas keamanan (security) yang piket, selanjutnya mematikan kamera pengawas (CCTV) di lantai 2 dan menggondol brankas berisi uang sekira Rp24 juta termasuk surat berharga. Para tersangka mengendarai mobil Daihatsu Xenia warna hitam BK 1256 JQ (nomor polisi

palsu-red) pun kabur menuju areal perkebunan PTPN II di Dusun I, Desa Sugiharjo, Batangkuis,Deliserdang,untukmembagi hasil rampokan. Namun belum sempat berbagi hasil, petugas keamanan kebun melintas dan para tersangka langsung melarikan diri sedangkan uang di brankas dibawa kabur SR. Dari hasil olah tempat kejadian perkara (TKP) di PT Jamsostek, Sat Reskrim Deliserdang dipimpin Kasat Reskrim AKP Arfin Fachreza, SH, S.Ik melakukan pengejaran dan meringkus EFS di kediaman orangtuanya di Jalan AhmadYani, Desa Bunga Melur, Kutacane, Kab. Aceh Tenggara. Berdasarkan keterangan EFS, Kasat Reskrim bersama sejumlah personil juga melakukan pengejaran ke Riau, namun tersangka lainnya sudah terlebih dahulu melarikan diri. Kapolres Deliserdang AKBP

DickyPatrianegara,SH,S.Ikmelalui Kasat Reskrim AKP Arfin Fachreza, SH, S.Ik kepada Waspada, Selasa (18/3) sore membenarkan. “EFS kita ciduk dari kediaman orangtuanya di Jalan AhmadYani, Desa Bunga Melur, Kutacane, Aceh Tenggara,” ujar Arfin. Menurut Arfin, dari keterangan tersangka, EFS berperan menjaga pintu belakang Kantor PT Jamsostek dengan membawa linggis, selanjutnya membawa brankas dari dalam kantor ke mobil setelah dua rekannya berhasil melumpuhkan security danmematikanCCTV.Sedangkan seorang rekannya menunggu di mobil Daihatsu Xenia hitam yang saatitumenggunakannopolpalsu yaitu BK 1256 JQ, sedangkan nopol aslinya BK 1652 IQ. Dikatakan, barang bukti yang diamankanmobilDaihatsuXenia BK 1256 JQ (palsu-red) yang dibaliknyaterdapatnopolBK1652

IQ (asli-red), 4 batang linggis, 1 martil besar, 1 tang besar, 1 senjata replika soft gun warna hitam dan 1 tas berisi 4 kunci L fsn 5 kabel tis. Sedangkan brankas yang digondol berisi uang sekira Rp24 juta, 58 cek billyet giro Bank BNI dan Bank Sumut, 26 buku BPKB, 23 lembar deposito Bank Sumut, Bukopin dan Bank Mandiri, 13 buah kunci mobil, 1 sertifikat tanah hak guna bangunan atas nama PT Jamsostek, 1 berkas surat izin mendirikan bangunan (SIMB), 1 unit server warna hitam,1buahcashboxwarnahitam dan 1 unit video decoder. “Tersangka dikenakan pasal 365ayat1dan2,1e,2edan3edengan ancaman hukuman 12 tahun penjara.Sedangkantigatersangka lain yang masih buron masingmasing SR, RB dan PS alias Antonius alias Pak Leo masuk dalam daftar pencarian orang (DPO),” jelas Arfin.(c02)

Kasek Diganti, Puluhan Pelajar SD Unjukrasa Ke DPRD Binjai Waspada/Andi Nasution

KASAT Reskrim AKP Arfin Fachreza,SH,S.Ik didampingi penyidik menginterogasi sembari memperlihatkan soft gun yang digunakan tersangka merampok Kantor PT Jamsostek Tanjungmorawa.

Dua Pelaku Curanmor Dimassa STABAT(Waspada):DuapemudaasalMedanLabuhanbabakbelur dihajar warga di Jalan Kurnia Kec. Stabat Kab. Langkat, setelah tertangkapmencurisepedamotorSenin(17/3)siang.Setelahbabakbelur, satu di antaranya kembali dihajar warga yang berkerumun di Mapolsek Stabat . Informasi dihimpun, korban Edi sebelumnya memarkir sepedamotor Yamaha Mio BK 6895 RAI di halaman rumahnya. Beberapa saat kemudian dua pelaku, ZA, 34 dan ER, 23, mulai beraksi mendorong sepedamotor tersebut, namun diketahui warga hingga dikejar dan tertangkap. Spontan keduanya dipukuli hingga dijemput polisi. Kepada petugas keduanya mengaku berangkat dari Medan untuk mencari barang rongsokan.(a03)

BINJAI (Waspada): Karena kepalasekolahdigantipihakDinas PdanP,puluhanpelajarSDNegeri 020619 Tanah Seribu Kec. Binjai Selatan terdiri dari siswa kelas IV, VdanVIunjukrasakekantorDPRD Kota Binjai di JalanVeteran, Binjai Kota, Selasa (18/3) siang. Kedatangan puluhan pelajar dengan menumpang mobil pick up dan mobil angkutan umum didampingi sebagian orangtua murid.DikantorDPRDKotaBinjai puluhan pelajar SD dan yang mewakili orangtua murid tersebut, disambut Ketua DPRD ZainuddinPurba,SHdidampingianggota DPRD lainnya termasuk Raiderta Sitepu, Zulkarnain D. Lubis. Kepada Ketua DPRD salah seorang siswa kelasVI bermohon agar kepala sekolah mereka, Suriadi, S.Pd tidak diganti dan

dikembalikan ke posisi semula sebagai kepala sekolah. “Kami tidak mau kepala sekolah kami pak Suriadi diganti dengan pak Sehat Tarigan,” ucap mereka. “Pak tolong kembalikan kepala sekolah kami pak Suriadi, kami tidak mau pak SehatTarigan menjadi kepala sekolah kami, karena pak Suriadi orangnya baik dansangatmembinakami,”sebut mereka. Sementara orangtua murid, Muliani juga bermohon kepada anggota DPRD untuk mengembalikan kepala sekolah anaknya kembali menjadi kepala sekolah di SD 020619, karena sejak SD tersebut dipimpin Suriadi selama lebih kurang satu tahun, anakanakmerekasangatdekatdengan kepala sekolahnya. Begitu juga pengambilan uang BOS, kepala

sekolah mendampingi langsung tanpa ada pemotongan apa pun. Ketua DPRD Kota Binjai, Zainuddin Purba, SH di hadapan orangtua murid dan puluhan pelajar mengatakan, masalah ini akan kami pertanyakan kepada Dinas P dan P Kota Binjai. “Kami akan panggil Kadis P dan P untuk kedua kalinya dalam masalah perpindahan kepala sekolah,” tegas Zainuddin Purba. Dikatakan Ketua DPRD Kota Binjai, pihaknya minta para orangtua murid bila ada keluhan dan persoalan tentang anaknya disekolah,janganmembawaanak mereka ke kantor DPRD Kota Binjai.“Kasihankepadaanak-anak yang masih ingin berlajar dan bukan untuk berpolitik,” ketua DPRD Kota Binjai Zainddin Purba, SH.(a05)

Wali Kota Sediakan Tiket Umroh Qari Dan Qariah Binjai Juara MTQ Sumut

Waspada/Abdul Hakim

BINJAI (Waspada):Wali Kota Binjai HM Idaham, SH, MSi menyediakan bonus tiket umroh bagi qari dan qariah kafilah Binjai yang berhasil menjadi juara di MTQ Prov. Sumut ke 34 di kota Binjai, dan menjadi duta Sumut ke MTQN di Batam. “Kalaubisajangansatuorang,

tapi 10 orang,” ujarnya ketika membukaseleksi,pembinaanqari dan qariah kota Binjai di aula LPTQ Jalan Jambi, Senin (17/3) malam. Idaham mengemukakan motivasi kepada qari dan qariah, agar Quran membumi di kota Binjai. MenurutWali Kota, pelak-

PETUGAS pemadam berusaha memadamkan api dalam kebakaran di Kampung Cina perbatasan Tanjungpura dengan Kec. Hinai, Kab. Langkat, Senin malam.

Tiga Rumah Terbakar Di Hinai STABAT (Waspada): Tiga rumah musnah terbakar di Kampung Cina Dusun 2 Desa Cempa Kec. Hinai Kab. Langkat Senin (17/3) malam sekira pukul 21:30. Api baru dapat dipadamkan petugas pemadam waktu dinihari dibantu masyarakat. Jalan menuju lokasi yang sempit menyulitkan proses pemadaman. Korban Usman dan Aling, 48, kehilangan seluruh harta benda mereka karena tiga rumah termasuk gudang barang rongsokan musnah dilalap api. Dampak kebakaran arus listrik padam karena beberapa kabel turut terbakar. Sebelum petugas pemadam datang, warga telah berusaha memadamkan api karena kobaran yang besar berpeluang menghanguskan rumah lain yang berdekatan. Kapolsek Hinai Resort Langkat AKP Andre Manalu yang dikonfirmasi mengatakan pihaknya masih menyelidiki penyebab kebakaran. Namun dugaan sementara api berasal dari rumah Usman yang memiliki usaha jual beli barang rongsokan. Akibat kejadian tersebut kondisi lalulintas di jalan umum Stabat – Tanjungpura sempat macet oleh warga yang menyaksikan. Tidak ada korban jiwa dalam kejadian, namun kerugian mencapai ratusan juta rupiah.(a03/a02/a01)

Waspada/Riswan Rika

WALI KOTA HM Idaham meresmikan seleksi dan TC qari dan qariah Binjai.

sanaan MTQ Prov. Sumut ke 34 yang diamanahkan kepada kota Binjai, bukan saja tanggungjawab pemerintah, tapi amanah bagi pemerintah dan masyarakat. Wali Kota menyatakan, selain membina qari dan qariah serta kafilah kota Binjai untuk meraih prestasi, Pemko dan masyarakat harus melakukan kerja ikhlas, sehingga pelaksanaan MTQ Sumutke34diBinjaimemperoleh hidayah dari Allah SWT. Sehingga MTQ di Binjai menjadi MTQ terbaik di Sumatera Utara. Qari dan qoriah serta pembimbing harus bekerja dan belajar sungguh-sungguh, jadikan motivasi menambah semangat belajar. “Terpenting pelaksanaan MTQ Prov. Sumut di Binjai sukses dan qari serta qariahnya berprestasi.” Sementara Ketua LPTQ Kota Binjai Drs. H. Amir Hamzah, MAP menjelaskan, LPTQ akan menseleksi qari dan qariah kota Binjai yang dikirim dari setiap kecamatan. Seleksi mulai dilakukan Selasa (18/3),Wali Kota HM Idaham di aula Pemko Binjai langsungmemimpinrapatpanitia dan mencek serta mengevaluasi semua bidang agar MTQ Prov. Sumutke34diBinjaibenar-benar sukses.(a04)

Waspada/Ibnu Kasir

BUPATI Langkat H. Ngogesa Sitepu, SH berbincang dengan anak-anak pengungsi erupsi Sinabung di Desa Telagah, Kec. Sei Bingai.

Pengungsi Erupsi Sinabung Masih Bertahan Di Langkat LANGKAT (Waspada): Pengungsi erupsi gunung Sinabung yang masih berada di Desa Telagah Kec. Sei Bingei, Kab. Langkat masih bertahan di tempat tersebut. Mereka menolak untuk kembali dan ditempatkan pada lokasi pengungsian yang ada di Tanah Karo sesuai imbauanTimSatuanTugasNasionaldiKabanjahe. Menyikapi hal tersebut, Bupati Langkat H. Ngogesa Sitepu, SH mengemukakan itu bukan kapasitas Pemkab Langkat untuk menerima atau menolak, melainkan kewenangan Tim Satuan Tugas Nasional atau BNPB Pusat, Provinsi Sumatera Utara dan Pemerintah Kab. Karo. “Secarakemanusiaan,kewajibankitabersama baik pemerintah maupun masyarakat untuk membantu, melindungi dan memperhatikan saudara-saudara pengungsi korban erupsi gunungSinabung.ApalagiTanahKaromerupakan wilayah yang langsung bertetangga dengan Langkat,” kata Bupati H. Ngogesa seraya menginstruksikan para SKPD terkait dan Camat serta Kepala Desa setempat, untuk secara bergilir selalu memberi perhatian terkait situasi dan kondisi pengungsi. Bahkan, kata Ngogesa, perhatian dan kepedulian yang diberikan untuk pengungsi tidak hanya berupa sandang pangan, melainkan juga

kesehatan dan pendidikan terutama bagi anakanak dengan menempatkan di sekolah-sekolah baik tingkat SD mau pun SMP yang ada di Kec. Sei Bingei. Kepala Badan Penanggulangan Bencana Daerah (BPBD) Langkat, Ir. Herdianul Zally menyebutkan jumlah pengungsi erupsi Sinabung di Desa Telagah, Kec. Sei Bingai, Langkat tercatat 726jiwa,165diantaranyasudahdibenarkanpulang ke kampung halaman yang berada di radius aman. Namun hanya enam orang yang kembali, selebihnya memilih bertahan karena akses jalan ke kampung mereka melintasi zona rawan. Sementara Sekda Pemprovsu Nurdin Lubis didampingi Kepala BPBD Sumut Asren Nasution mengunjungi pengungsi erupsi gunung Sinabung di Desa Telagah, Kec. Sei Bingai, Kab. Langkat, Senin (17/3). Dalam kesempatan itu dilakukan sosialisasi mengenai pemulangan ratusan pengungsi dan rencana digabungkannya ratusan pengungsi di sana ke posko induk di Kabanjahe. Dalam kunjungantersebutjugadibahasmengenairencana perbaikan jalur evakuasi Langkat menuju Tanah Karo sepanjang empat kilometer. Jalan tembus Langkat – Tanah Karo pada beberapa ruas jalan masih butuh perbaikan. (a01/a03)

Amri Bantu Korban Puting Beliung P. Labu PANTAILABU (Waspada): Bupati Deliserdang Drs H. Amri Tambunan bersama Ketua TP PKK Ny. Hj. Anita Amri Tambunan bersama rombongan mengunjungi warga korban yang rumahnya terkena terjangan bencana angin puting beliung di Kec. Pantai Labu, Senin (17/3). Bencana alam terjadi Sabtu (15/3) sekira 22.15, mengakibatkan 27 rumah warga di enam desa masingmasing Desa Pematang Biara rusak sedang 6 unit, rusak total 2 unit. Di Desa Ramunia Kebun rusak ringan 1 unit, rusak sedang 3 unit dan rusak Waspada/Khairul K Siregar total 1 unit, Desa Durian rusak BUPATI Deliserdang Drs. H. Amri Tambunan didampingi Ketua sedang 5 unit, rusak berat 3 TP PKK Hj. Anita Amri Tambunan mengunjungi warga Pantai unitdanrusaktotal1unit,Desa Labu yang terkena musibah angin puting beliung. Kubah Sentang, rusak ringan 2 unit, rusak sedang 1 unit, Desa Rantau Panjang bakal datangnya bencana. Kita harus pasrah rusak sedang 1 unit, dan Desa Pantai Labu Baru dengan kehendak Allah SWT serta tidak usah berkecil hati karena bencana ini adalah cobaan rusak sedang 1 unit. Dalam kunjungan itu, Bupati didampingi bagaimanakekuatanimankitadalammenghadapi Dandim0204/DSLetkolArhSaefulMuktiGinanjar, musibah,” ujar bupati seraya berharap warga SetdakabDrs.H.AsrinNaim,AsistenIH.Syafrullah, untuk saling membantu bergotongroyong, agar S.Sos, MAP, Kadis Infokom Drs. Neken Kataren warga yang terkena musibah dapat kembali ke dan lainnya mendatangi warga yang sudah rumah masing-masing. Pl.CamatPantaiLabuEzwir,NP,S.SosmenjelasberkumpuldikantorKepalaDesaDuriansekaligus menyerahkan bantuan berupa dana perbaikan kanpihaknyabersamaMuspikatelahturunlangsung ke tempat kejadian sekaligus memberi bantuan rumah sesuai kondisi kerusakan. Bupati H. Amri Tambunan mengingatkan sembako untuk meringankan beban warga yang para korban untuk tetap sabar, tabah dan tawaqal, tertimpamusibahsertaberkoordinasidenganpihak karena kejadian ini datangnya tidak disangka. PLN, guna memperbaiki jaringan yang rusak, “Musibahinitidakterjadidinegerikitasaja,bahkan demikianjugadenganpihakkesehatan,memantau negarayangmajusajapuntidakbisamempredeksi kesehatan warga yang terkena musibah.(crul/a06)

Pemkab Labura Operasi Gratis Bibir Sumbing AEKKANOPAN (Waspada): Pemkab Labuhanbatu Utara melalui Dinas Kesehatan bekerjasama dengan lembaga Smile Train melaksanakan kegiatan bakti sosial operasi gratis bibir sumbing. Kegiatandilaksanakanduahari tanggal 16 - 17 Maret di Puskesmas Rawat Inap Gunting Saga, Kualuh Selatan. Bupati Labuhanbatu Utara H. Kharuddin Syah, SE didampingi Sekda Drs. Edi sampurna,M.Simeninjaulangsung kegiatantersebut.Kedatangan Waspada/Syahri ilham Siahaan mereka memastikan pelaksaBUPATI Labura H. Kharuddin Syah berbincang dengan pasien naan kegiatan berjalan lancar dan pelayanan yang diberikan bibir sumbing. ditugaskan untuk menangani 39 pasien bibir ke masyarakat harus maksimal. “Kalau sudah niat membantu maka jangan sumbing, operasi bibir sumbing kali ini tidak hanya setengah-setengah, Saya tidak ingin kegiatan sosial melayani masyarakat Labuhanbatu Utara. “Kita juga menerima pasien dari kabupaten yangharusnyamembantumasyarakatmalahmenjadibebanbagimasyarakat,”tuturH.Buyungseraya lain seperti Labuhanbatu 5 orang, Labuhanbatu mengimbaupihakDinasKesehatanagarmemberi Selatan 3 orang, Asahan 5 orang, Batubara 3 orang, dan dari Kab. Rokan Hilir Riau 9 orang. Kegiatan pelayanan memuaskan kepada masyarakat. Sementara Kepala Bidang Pelayanan Kese- seperti ini akan rutin kita laksanakan dengan smile hatan, Tigor Pasaribu, SKM mengatakan kegiatan train, kita ingin Labuhanbatu Utara bebas bibir operasi bibir sumbing ditangani 20 dokter yang sumbing,” jelas Tigor.(c08)


Sumatera Utara

B2 WASPADA Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu Lusia Damayanti (Jakarta). Redaktur Pelaksana Opini, Artikel & Agama: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: H.Akmal AZ Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: H. Halim Hasan. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Zulkili Harahap. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Efendi (Kabag), Aidi Yursal. Promosi: Edward Thahir (Koordinator). Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: Zultamser. Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); ; T. Junaidi (Hiburan); Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi), Hang Tuah Jasa Said (Potret). Wartawan Kota Medan: Umum: H. Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkili Darwis, H. Abdullah Dadeh, H. Suyono, Hj. Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Efendi, Mursal Alfa Iswara, Andi Aria Tirtayasa. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Efendi, Hamdani, Rizky Rayanda. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Arianda Tanjung, Dio Utama. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra, Agustian Akhmad. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebingtinggi: Muhammad Idris, Abdul Khalik. Pematangsiantar: Mulia Siregar, Edoard Sinaga. Simalungun: Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Tarutung: Parlindungan Hutasoit. Sibolga/Tapanuli Tengah: Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Munawardi Ismail, (Koordinator Liputan) Muhammad Zairin, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies, H. Rusli Ismail, Arman Konadi. Aceh Besar: Iskandarsyah. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanaiah. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar, Dedek Juliadi. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Jasvira Sautisa. Bener Meriah: Khairul Akhyar. Singkil: Tarmizi Ripan, Mansurdin.

Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada yang mengaku wartawan WASPADA tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi 

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: redaksi@waspadamedan.com KANTOR PERWAKILAN DAN BIRO  Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874.  Perwakilan dan Biro Banda Aceh: Jalan Ratu Syaiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385.  Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109.  Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 13.000,-, berwarna Rp. 36.000,Halaman depan: hitam-putih Rp. 39.000,-, berwarna Rp. 108.000,Ukuran kolom: 40,5 mm. E-mail Iklan: iklan@waspadamedan.com Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Satlantas Polres Batubara Terima Kunjungan TK Al Ihya INDRAPURA (Waspada): Kecelakaan lalu lintas masih cukup tinggi di wilayah Kab. Batubara, hal ini umumnya terjadi dikarenakan kelalaian pengendara. Untuk itu semestinya pengendara tidak ugal - ugalan dan memperhatikan rambu - rambu lalu lintas yang ada. Demikian disampaikan Kasat Lantas Polres Batubara AKP Gamal didampingi Kapos Lantas Indrapura, Aiptu J Haloho kepada Waspada dalam kegiatan polisi sahabat anak saat dikunjungi 96 anak TK Al Ihya Tanjunggading, Selasa (18/3). “Peraturan lalu lintas mestinya sejak dini dikenalkan kepada anak- anak, agar mereka dapat memahami bagaimana berlalulintas dengan baik, bila pada saatnya nanti sudah boleh mengemudi. Tingginya korban kecelakaan ini umumnya adalah usia remaja,” terang Gamal. Lebih lanjut dikatakan, jumlah kecelakaan lalu lintas medio Januari sampai Februari 2014 berjumlah 49 kasus, 17 di antaranya meninggal dunia, 23 luka berat sisanya luka ringan. Sementara kerugian materil diperkirakan Rp42 juta. Petugas juga sudah melakukan tilang sebanyak 281 kasus. Guru - guru TK Al Ihya yang mengunjungi Pos Lantas Indrapura ini dalam pertemuan itu mengungkapkan, kegiatan tersebut adalah untuk mengenalkan kepada anak-anak asuhnya tentang profesi. Polisi adalah salah satu profesi yang dekat dengan masyarakat. “Dengan pengenalan ini kita harapkan agar anak - anak tidak perlu takut kepada polisi, karena polisi adalah sahabat anak. Jadi kalau mau menyebrang lihat ada pak polisi, minta tolong saja diseberangkan, pasti polisi mau menolong, tidak perlu takut,” kata guru - guru TK tersebut. (c05)

WASPADA Rabu 19 Maret 2014

Perdagangan Harimau Sumatera Meningkat RANTAUPRAPAT (Waspada): Tingkat perburuan hingga perdagangan Harimau Sumatera di wilayah Kab. Labuhanbatu terus meningkat. Tahun 2012, diketahui ada dua kasus, sementara 2013 tercatat empat kasus. “Kasus Harimau Sumatera yang sengaja dijerat itu terjadi kenaikan dua kasus tahun ini dibanding tahun lalu,” kata penggiat lingkungan MQ Rudy dari Sumateran Panthers Comunication Forum (SPCF) kepada wartawan, Senin (17/3) di Rantauprapat. Dari hasil investigasi yang terkonfirmasi mereka di tingkat penjerat, harga kulit komplit Harimau Sumatera mencapai Rp30 juta, tulang Rp2.5 juta per kilo, kuku per lembar Rp5 jutaan, taring per buah Rp5 jutaan. Sedangkan kumis tidak diketahui nilainya, karena tergantung keperluan yang biasanya untuk keperluan mistis, namun dipercaya harganya juga jutaan rupiah.

“Kasusnya dua di Labuhanbatu Utara (Labura) dan empat di Labuhanbatu perbatasan dengan Riau. Kita punya dokumennya,biasanyaditingkatpengguna mencapai sepuluh kali lipat harganya. Perdagangan satwa dilidungi ini merupakan sindikat yang tersusun rapi,” terang Rudy. Sejalan dengan itu, pihaknya melalui SPCF sudah melakukan penyadaran kepada masyarakat khususnya penjerat, serta memutus mata rantai jaringan perdagangan itu. Dikatakan, perburuan terjadi disebabkan beberapa faktor, di antaranya adanya dugaan keterlibatanoknumaparathukumserta semakinpunahnyahutansehingga Harimau Sumatera sulit men-

cari pangan di tengah huta n yang akhirnyaterlihatolehmasyarakat. Bebasnya perdagangan ilegal tersebut, menurut MQ Rudy, juga akibat lemahnya aparat hukum menindak para pelaku yang telah diketahui permainannya dalam hal jual beli kulit hingga kumis Harimau Sumatera tersebut. “Sebab jika memang aparat hukum terkait, ingin memutus perdagangan, saya kira tidak sulit, karena banyak kasus yang terjadi di masyarakat, tapi sampai sekarang tidak satupun yang mencuat,” tukasnya. Menurut data mereka, jumlahHarimauSumateradiIndonesia berkisar 400-an ekor padahal sebelumnyaspesiesHarimauBali dan Harimau Jawa yang sudah punah. “Jika Harimau Sumatera juga punah, maka Indonesia tercatat negara paling parah dan gagal menjaga keberlangsungan hidup satwa liar dilindungi,” katanya. (a18)

Kecaman Atas Aksi Premanisme Terhadap Camat Torgamba TORGAMBA (Waspada): Aksi premanisme yang dilakukan sekelompok orang terhadap CamatTorgamba,Tommy Harahap baru-baru ini mendapat kecaman dari tokoh pemuda Kec. Torgamba, Syahdian Purba. Dia mendesak pihak Kepolisian mengusut tuntas kasus tersebut dan mengungkap dalangnya. “KamisebagaipemudadiKec. Torgambasangatmenyayangkan aksi premanisme yang dillakukan sekelompok orang tersebut. Tommy Harahap sebagai Kepala Wilayah merupakan bapak kami. Kami tidak sepakat jika beliau diperlakukan demikian,” kata SyahdianPurbakepadaWaspada, Selasa (18/3). Syahdian mengatakan, aksi penyerangan itu tidak mencerminkan masyarakat berbudaya,

terlepasapapunmotifnya.Karena menurutnya, tindakan anarkis dan premanisme tidak dibenarkan secara hukum, apalagi kejadian ini terhadap seorang camat. “Pemuda semestinya menjadi cermin moral dalam kehidupan masyarakat, bukan justru menunjukan sikap premanisme,” katanya. Karenanya, Syahdian mendesak pihak Kepolisian segera mengungkapmotifdibalikpenyerangan tersebut dan menangkap semua pelakunya. Dia juga berharapdalammenyelidikikasus ini, polisi tidak hanya terfokus kepadapelaku,melainkandalang dibelakangorang-orangtersebut. “Tindak tegas dalang dan pelakunya, siapapun dia,” katanya. Terpisah, Kaposek Torgamba, AKP Dony C Samosir menga-

takan,pihaknyamasihmendalami kasuspengerusakanmobilCamat Torgamba tersebut. Saat ini kata dia, belum ada yang ditetapkan sebagaitersangkadalamperistiwa itu.“Kitasudahmintaiketerangan saksikorban.Nama-namapelaku sudah kita ketahui,” katanya. Diberitakan sebelumnya, Camat Torgamba, Tommy Harahap dan istrinya, Uswatun Siregar, Minggu (16/3) sore dicegat oleh puluhan orang tidak dikenal di Simpang Jalan NegaraAek Batu/Sumberjo, Desa Asam Jawa, Kec. Torgamba. Dalam peristiwa itu, pelaku yang kesal karena Tommy tidak bersedia menemui Ketua DPRD Kab. Labusel, Fery Andikha Dalimunthe, merusak mobil Toyota InnovaBK1676YLyangdikendarai Tommy. (c18)

Waspada/Edi Saputra

MASSA dihadang personil Polres Sergai saat akan memaksa masuk untuk menemui Bupati Sergai.

Warga Tuntut Pembangunan Irigasi Dan Jalan SEIRAMPAH (Waspada): Belasan warga tergabung dalam wadah Masyarakat dan Petani Bersatu Menggugat menggelar demo di halaman kantor Bupati Serdang Bedagai di Jl. Negara Desa Firdaus, Kec. Sei Rampah, Senin (17/3). Aksi diwarnai pemblokiran pintu masuk ke kantor bupati. Koordinator Lapangan M. Muaz Munawar SP mendesak Bupati Ir. H. Soekirman padaTahun2014merealisasipembangunanirigasi permanen dari sungai Padang Kota Tebingtinggi yang melintasi jalur Panglong, Parsaroan, Penggatalan,PematangTerang,PematangCermai, Tebingtinggi di Kec. Sei Bamban dan Tanjung Beringin. Selain itu belasan massa juga minta pengas-

palan jalan di sejumlah titik di Kec. Sei Bamban dan Sei Rampah, sebab selama ini irigasi yang belum permanen mengakibatkan menurunnya hasilpertanianyangselaludihadapkangagalpanen. Jalan yang rusak parah saat musim penghujan sulit dilalui sangat berdampak pada terhambatnya arus transportasi. Massa yang bersikeras minta bertemu Bupati Sergai mendapat pengawalan dari personil Polres danSatpolPPPemkabSergaidipimpinWakaPolres Sergai, Kompol Drs. Soepriatmono dan Kabag OPS Kompol Raisya Mustario akhirnya membubarkan diri dengan tertib sekira pukul 12:30, setelah gagal menemui Bupati yang sedang bertugas di kecamatan.(c03)

Kodim 0209/LB Distribusikan Mobil Dan Sepedamotor Dinas RANTAUPRAPAT (Waspada): Sebagai program TNI dalam peningkatan dan pemberdayaan Bintara Pembinaan Masyarakat (Babinsa) di jajaran Koramil se-Labuhanbatu, Kodim 0209/ LB serahkan sebanyak 2 unit mobil Mitsubishi non double cabin dan 52 unit sepedamotor jenis Yamaha Vixion. Penyerahan transportasi dinas itu dilaksanakan di lapangan Makodim setempat, Senin (17/3). Dalam kesempatan tersebut, Dandim 0209/ LB Letkol Infantri Sapta Marwindu Ibraly S.IP menegaskan, 2 unit mobil dan sepedamotor sebanyak 52 unit yang diserahkan kepada 13

KoramildijajaranKodim,merupakanupayapihaknya agar TNI tetap manunggal bersama rakyat. “Sepedamotor ini berguna untuk lebih meningkatkan pelayanan terhadap masyarakat sebagai penunjang tugas Babinsa dalam pembinaan pedesaan,” ujar Dandim. Di samping itu, kata Dandim, sebagai pembinaan teritorial yang diharapkan TNI lebih dewasa dalam menjaga kondusifitas di wilayah tugas masing-masing. Sementara, sebanyak 2 unit mobil Mitsubishi diperuntukkan kepada Koramil 02/Tanjung Ledong dan Koramil 03/ Sei Berombang. (c07)

20 Mobil Parpol Ditindak KISARAN (Waspada): Dalam menegakkandisiplinberlalulintas, sedikitnya 20 mobil Parpol yang merubahwarnaasliditindaktegas Satlantas Polres Asahan. Hal itu diungkapkan Kapolres Asahan AKBP Budi Suherman, melalui Kasat Lantas AKP Anhar Arlia Rangkuti, didampingi Kanit Patroli Iptu Tisna Sunjaya, saat berbincang dengan Waspada, Selasa (18/3). Anhar mengatakan, tindakan

itu dikarenakan pihak Parpol merubahwarnaaslimobildengan warna partai tertentu, dan hal itu tidakmencerminkantidakdisiplin berlalu lintas dan melanggar peraturan. “Sejauh ini kita telah menegur dan menilang sekitar 20 mobil yang melanggar peraturan itu, dan kita menyuruh mengembalikanwarnaaslinya,demitegaknya peraturan yang harus diikuti tanpaadapengeculian,”jelasAnhar. Anhar juga menjelaskan,

kegiatan ini sebagai sarana pendidikan untuk mematuhi paraturan bagi Parpol di saat kampanye untuk bisa tertib, aman dan nyaman. Dan kita berharap saat kampanye mobil dan kendaraan mesin yang digunakan diharapkan tidak merubah warna asli mobil, walaupun meletakkan atribut partai. “Dengan demikian, kertertiban dan kampanye aman dantertibdiAsahanbisatercipta,” jelas Anhar. (a15)

Bupati Asahan: “ Seolah Ada Proyek Fiktif Di Dinas Pertanian...” KISARAN (Waspada): Pembatalan dana Rp6,8 miliar oleh Pemprovsu dalam APBD tahun 2013 mengindikasikan adanya proyek fiktif di Dinas Pertanian Asahan. “Padahal dana dimaksud sudahdiketahuimasyarakat,namun pembatalan oleh Pemprovsu (gagal-red) tidak diketahui masyarakat, sehingga seolah olah adaproyekfiktifdiDinasPertanian Asahan. Tudingan ini sempat memusingkan pikiran. Kita harapkantahuninitidakdipotong bahkan mohon ditambah dari Rp6,8 miliar,” ungkap Bupati Asahan Drs. H.Taufan Gama Simatupang MAP didampingiWabup H. Surya BSc, Selasa (18/3) dalam Musrenbang (RKPD) tahun 2015. Narasumber Musrenbang dari Pemprovsu terdiri dari peja-

bat Dinas Pertanian, Bappeda, Dinas Kesehatan, Dinas PendidikandanKepalaUPTTanjungbalai Dinas Jalan Jembatan Sumut. Bupati Asahan sangat mengharapkan dana Rp6,8 M yang dibatalkan tahun 2013 agar direalisasi, jika memungkinkan ditambah lebih besar dari Rp6,8 M. “Jika dana Rp6,8 M tahun 2013 tidak dibatalkan, sudah direncanakan untuk membangun kilang padi mini, pengembangan budidaya kacang kedele dan tanaman jagung, serta pembangunan jalan usaha tani,” ujar Taufan. Pembukaan Musrenbang Asahan2015dihadiriFKPD,diikuti para SKPD, tokoh masyarakat, agama, para camat, LSM dan stakeholder lainnya, dengan agenda paparan Pemprovsu dan paparan SKPD Pemkab Asahan. Kadis Pertanian Ir.Oktoni

Eryanto MMA mengungkapkan, di 2014 ini program yang mendesak dilakukan dalam konteks Program Peningkatan Ketahanan Pangan adalah intensifikasi atau optimalisasi lahan membutuhkan dana sekitar Rp50 M, di luar dana Rp68 M dari Pemprovsu. Dikatakan,Programituterdiri dari peningkatan debit air sungai Bunut sepanjang 9,5 KM, normalisasi saluran primer dan sekunder dari Pasar 0 sampai Pasar 20 di Desa Pertahanan dan desa Perbangunan Kecamatan Sungai Kepayang,kewenanganDinasPU Asahan. Program kewenangan Dinas PU Asahan itu sangat membantu Dinas Pertanian Asahan menjalankan perbaikan jaringan tersier sepanjang 35.000 meter untuk melayani 10.415.000 hektar. (a10)

SKEMA Indonesia Gelar FGD Mekanisme Partisipasi Masyarakat RANTAUPRAPAT (Waspada):SKEMAIndonesiamenggelar Focus Group Discussion (FGD) Mekanisme Partisipasi Masyarakat Kab. Labuhanbatu, Senin (17/3) di Ruang Data Dinas Kesehatan Labuhanbatu. Kepala Dinas Kesehatan L.Batu Hj. Helifenida, SKM, M.Kes saat membuka kegiatan mengatakan, derajat kesehatan masyarakat ada 4 faktor, yang pertama adalah kesehatan, perilaku masyarakat, fasilitas kesehatan dan keturunan. Hal-hal ini sangat mempengaruhi derajat kesehatan masyarakat.

Katanya, salah satu yang mempengaruhi derajat kesehatan adalah masalah sampah dan sarana air bersih. Karena itu kita sangat setuju program penanggulangan air bersih ini dilaksanakan antara pemerintah dengan USAID IUWASH. Seharusnya kita berfikir bagaimana mendaur ulang sampah. Sehingga, barang bekas itubisamenjadisesuatuyangbaru danbisamenghasilkanuangkalau sampahnya dipilah-pilah, mana yang organik dan mana sampah yang non organik. Direktur SKEMA Indonesia

DR. H. AbdiYanto, SE, MSi dalam kesempatan itu mengatakan, tujuan dari FGD adalah membentuk satu model sanitasi yang berbasis untuk kebutuhan masyarakat dan kalau ada keluhan bisa diekpose. “Kalau program ini berjalan bagus maka pemerintahan akan kuat. Sehingga, tidak akan menimbulkan konflik antara pemerintah dengan masyarakat, dengan harapan diskusi ini akan menghasilkan komunikasi dua arah dalam hal ini PDAM dan SKPD terkait dengan air bersih dan air limbah,” sebutnya. (a18)

Waspada/Armansyah Abdi

DIREKTUR SKEMA Indonesia DR. H. Abdi Yanto, SE, MSi diabadikan dengan sejumlah peserta FGD dari SKPD.

Waspada/Budi Surya Hasibuan

DANDIM 0209/LB Letkol Infantri Sapta Marwindu Ibraly S.IP saat melakukan pemeriksaan terhadap 2 unit mobil dan 52 unit sepedamotor yang akan didistribusikan kepada jajaran Koramil di lapangan Makodim setempat.

Pemko Usul Feri Roro Layani Teluknibung-Malaysia TANJUNGBALAI (Waspada): Pemerintah Kota Tanjungbalai mengusulkan feri roro (roll on-rool off) beroperasi dan melayani rute pelabuhanTeluknibung-Klang Malaysia. Usulan itu diharapdimasukkandiRencanaPembangunanJangka Menengah Daerah (RPJMD) Sumut 2013-2018. “Kita mengusulkan kawasan pengembangan terpadu Simalungun, Batubara, danTanjungbalai sebagai salah satu kawasan strategis ekonomis serta pengembanganTanjungbalai sebagai pintu gerbang pariwisata jalur laut dengan membangun angkutan penyeberangan Ro-Ro TanjungbalaiKlang Malaysia dimasukkan dalam RPJMD SumateraUtara2013-2018,”kataWaliKotaTanjungbalai Rolel Harahap kemarin. Rolelmengaku,usulanitusudahdisampaikannya dalam kunker Pansus RPJMD DPRD Sumut yang dipimpin Wakil Ketua DPRD Sumut Sigit Pramono Asri di kantor Bupati Asahan. Rencana angkutan roro yang menghubungkan Sumut dengan negeri jiran Malaysia, kata dia, pernah digagas Gubsu almarhum T Rizal Nurdin dengan jalur Belawan-Penang, meski terkesankurangfleksibeldisebabkanjaraktempuh. Sementara jarak Tanjungbalai-Port Klang jauh lebihpendekdanhalinisudahpernahdidiskusikan dengan Deputy Country Director Asian Development Bank (ADB), Edimon Ginting, di Medan beberapa waktu lalu. “Pengoperasian feri roro antara Pelabuhan Teluk Nibung – Port Klang Malaysia jauh lebih

menguntungkan, dibanding Pelabuhan BelawanPulau Penang yang sudah dilakukan di 2004 silam dan kini terpaksa dihentikan akibat operasional yang terlalu mahal,” jelasnya. Rolel menuturkan, ada beberapa keuntungan dalam operasional feri roro antara pelabuhan Teluknibung-Klang Malaysia. Dari sisi biaya, pihak pengelola feri roro akan mendapatkan keuntungan yang cukup signifikan, mengingat letak Port Klang berdekatan dengan ibukota Malaysia, Kuala Lumpur. Jarak dari Port Klang ke Kuala Lumpur hanya sekitar 30 menit perjalanan darat. Kondisiinisangatprospektif,karenaadasekitar 500ribuwargaMalaysiayangtinggaldiKualaLumpur yang memiliki marga keturunan dariTanah Batak. “ Jika ingin pulang kampung, tidak memerlukan waktuperjalananyanglamadibandingkanmelalui pelabuhan Penang-Belawan,” ujar Rolel. Disebutkannya, mengenai jarak tempuh, lokasi Pelabuhan Teluk Nibung – Klang, Malaysia yangterpisahsekitar195km,bisaditempuhdengan kapal cepat sekitar 2-3 jam, atau dengan feri roro sekitar 4-5 jam, lebih cepat 4 sampai 3 jam dibandingkan jarak tempuh Belawan-Penang yang memakan waktu minimal 8 jam. “Ini juga untuk memperbanyak jalur konektivitas Asean memasuki era Masyarakat Ekonomi Asean (MEA) atau Asean Economy Community (AEC) yang diketahui adalah bentuk integrasi ekonomi Asean yang direncanakan tercapai di 2015 mendatang,” kata Rolel. (a14)

Panwas Labusel Diminta Perketat Pengawasan Terhadap PNS KOTAPINANG (Waspada): Pegawai Negeri Sipil (PNS) dan kepala desa di Kab. Labusel diingatkanuntuktidakterlibatdalampolitikpraktis pada Pemilu Legislatif 2014 ini, apa lagi bertindak menjadi tim sukses untuk partai tertentu. Untuk memastikan netralitas itu, Panwaslu Kab. Labusel diminta memperketat pengawasan terhadap PNSkhususnyapejabatdijajaranPemkabLabusel. Desakan itu diungkap Dewan Pendiri Ikatan Pemuda Otonom (Ipon) Kab. Labusel, Rizal Sembiring kepada Waspada, Selasa (18/3). Menurutnya, imbauan itu disampaikannya sehubungan dengan banyaknya keluhan

masyarakat kepada dirinya terkait adanya oknumoknum PNS yang menempatkan diri sebagai tim sukses untuk partai tertentu.“Ada sejumlah pejabat yang cenderung berperan sebagai tim sukses,” katanya. Dikatakan, netralitas dibutuhkan agar para PNS tetap prima dalam melayani masyarakat. Jika PNS yang jumlahnya cukup banyak terlibat dalam politik praktis, dikhawatirkan dapat membahayakan pelayanan publik. “PNS itu pelayan masyarakat, jadi berikanlah pelayanan terbaik. Mari kita bersama membangun kedewasaan berpolitik,” katanya. (c18)


Sumatera Utara

WASPADA Rabu 19 Maret 2014

B3

Oknum BK DPRD Paluta Ditangkap Main Judi GUNUNGTUA (Waspada): KS, 44, Ketua Badan Kehormatan (BK) DPRD Kab. Padanglawas Utara (Paluta) ditangkap aparat Kepolisian Polres Tapsel saat asyik bermain judi leng, kemarin. KS, yang juga kader PPP ini dibekuk polisi bersama tiga rekan lainnya, BH, 42, HH, 36, dan HS, 43, penduduk Paluta di salah satu

warung kopi milik Naek warga Desa Janji Manahan, Kec. Batang Onang, Padanglawas Utara. Kasat Reskrim Polres Tapsel,

AKP Edison Siagian, SH, Selasa (18/3) dihubungi via seluler membenarkan penangkapan tersebut. “Kelima tersangka sudahdiamankan.Merekaterjerat melanggarpasal303KUHPidana, dengan ancaman hukuman maksimal5tahunpenjara,”terang Edison Siagian. Dikatakan, penggerebekan

dilakukan setelah mendapat laporan dari warga. “Kelima tersangka diciduk dari meja judi, saat bermain leng di kedai kopi Naek Harahap, sekira pukul 23:00 malam,” tegas Kasat Reskrim. Polisi juga mengamankan barang bukti berupa dua set kartu remi bergambar ikan, satu mangkok warna putih dan uang

taruhan Rp120.000 dari tersangka. Terpisah,KetuaDPRDPaluta, Muclis Harahap, SHi dihubungi mengaku baru mengetahui kejadian setelah menerima kabar dari seorang anggota DPRD. BegitujugadengananggotaDPRD Paluta lainnya saat dihubungi terkejut.(a35)

IMA Madina Surati Kapolda Terkait Illegal Mining PT. M3 PANYABUNGAN(Waspada): Ikatan Mahasiswa Mandailing Natal (IMA Madina) menyurati Kapolda Sumut terkait dugaan Illegal Mining PT. Madinah MadaniMiningdiMadinamelalui surat nomor:111/SEK-DPP IMA MADINA/B/III/2014, tanggal 14 Maret 2014. Suratituberisiperihalpermohonpenerapanundang–undang berlapis terhadap dugaan Illegal Mining PT. Madinah Madani Mining Di Kab. Mandailing Natal. DemikiandisampaikanKetuaIma Madina,AhmadIrwandiNasution

kepada Waspadaviaseluler,Senin (17/3). Irwandi berharap demi penegakan supremasi hukum, penyelamatankerugiankeuangan negara dan memberikan efek jera kepada pelaku, Ima Madina berharap Poldasu menerapkan undang-undang berlapis dalam penanganan kasus itu, berupa undang–undangNo.4tahun2009 Tentang Minerba. UndangundangNo.32tahun2009tentang perlindungan dan pengelolaan lingkungan hidup. Undangundang No. 8 tahun 2010 tentang

Enam Rumah Hangus Dilalap Sijago Merah Di Kutambaru KABANJAHE (Waspada): Sebanyak enam rumah milik warga Desa Kutambaru, Kec. Munte, Kab. Karo hangus dilalap Si jago merah. Sementara tiga rumah warga lainnya dirusak untuk memblokir meluasnya kobaran api, Senin (17/3) siang. Kepala UPT Barisan Pemadam dan Pencegah Kebakaran (BP2K) Kesbang, Pol dan Linmas Kab. Karo, JurisTarigan, SH kepada Waspada mengatakan,dalamperistiwatersebuttidakadakorbanjiwa.Penyebab kebakaran masih dalam penyelidikan pihak yang berwenang, sementara kerugian ditaksir Rp900 juta. Disebutkan, pada saat terjadi kebakaran umumnya warga sedang beraktivitas di ladang. Sejumlah warga yang berada di desa, begitu mengetahui kejadian langsung berusaha memadamkan kobaran api dengan peralatan seadanya. Sejumlah warga lainnya secara bergotongroyong berusaha mengeluarkan barang-barang dan harta benda lainnya yang masih bisa diselamatkan dari dalam rumah yang belum terbakar. Untuk memblokir meluasnya kobaran api yang kian membesar, sejumlah warga berinisiatif meruntuhkan rumah yang bersebelahan dengan rumah yang terbakar. Dalam kebakaran tersebut, dua unit mobil Damkar milik Pemkab Karo diterjunkan ke lokasi kebakaran untu menjinakka si jago merah. Api dapat dipadamkan beberapa saat kemudian. Data yang diperoleh dari kepala UPT BP2K Pemkab Karo Juris Tarigan, SH adapun pemilik/penghuni rumah yang terbakar, Nemi br Ginting, 60, Sodia Perangin-angin, 65, Jem br Tarigan, 80, Malem Bana br Tarigan, 85, Gambat Ginting, 80, Sukarya br Tarigan, 65. Sedangkan pemilik rumah yang dirusak, Litmalem Sembiring, 65, Benar Tarigan Sibero, 65, Kumala br Tarigan, 75. (c09)

Diklat Guru Di Samosir Butuh Rp2,3 M SAMOSIR (Waspada): Diknas Samosir mengalokasikan Rp2,3 miliar dari anggaran APBD tahun 2014 untuk Diklat Guru dalam rangka pelaksanaan Kurikulum 2013. Jumlah guru SD dan SMP yang akan mengikuti Diklat tersebut 700 orang termasuk Tenaga Honor Guru, sementara jumlah keseluruhan Guru SD dan SMP yang aktif berjumlah1.600guru,ujarKabidDikdasDiknasSamosirSautSimbolon SPd kepada Waspada, Kamis (13/3). Diknas Samosir masih menunggu panggilan dari penyelenggara atau Lembaga Pendidik P4TK dan LPMP, dan direncanakan setiap guru akan menerima pendidikan dan latihan 52 jam pelajaran lima hari. Untuk mengefesienkan waktu dan biaya pada kegiatan Diklat Kurikulum 2013, sebaiknya Instruktur dari provinsi bersedia hadir di kabupaten, tambahnya. Untuk kesuksesan Program Kurikulum 2013, para guru dituntut kualitasnya sehingga nantinya mampu menjadi fasiliator, sedangkan bagi murid diharapkan menjadi kreatif. Guru yang akan menjadi fasilitator diharapkan memantapkan Rencana Program Pembelajaran (RPP) sebagai buku panduan guru di k,elas dan anggaran pembuatan RPP itu menjadi tanggungjawab guru sendiri tidak boleh dilakukan melalui Dana BOS, tegasnya. (c11)

Waspada/ Mulia Siregar

KEPALA MAN Pematangsiantar, Drs. Marzuki Saragih,(kiri) saat menerima piagam penghargaan sekolah Islam berbasis Adiwiyata untuk tingkat kota Pematangsiantar dari Sekretaris kota Don ver Panggabean,MSi,Senin (17/3) di lapangan Haji Adam Malik Pematangsiantar.

Pencegahan dan Pemberantasan Tindak Pidana Pencucian Uang (TPPU). Undang-undang No. 31 tahun 1999 tentang Pemberantasan Tindak Pidana Korupsi. “Kita tahu penyelidikan yang dilakukan Tim Tipiter Poldasu di Madina telah berjalan dan bekerja profesional serta tidak akan terpengaruh bujuk rayu dari

oknum-oknumyangterlibatillegal mining,” ucap Irwandi. Irwandi juga menegaskan, dalam pemberantasan dugaan prtaktek illegal mining, Ima Madina telah memenuhi undangan Surat Ditreskrimsus No. K/62/I/2014/Ditreskrimsus tertanggal 22 Januari 2014, perihal undangan verifikasi.

Waspada/Bothaniman Jaya Telaumbanua

RUMAH keluarga mantan Ketua Yayasan Perguruan Pembda Nias di Jl. Pelita, Kelurahan Ilir Gunungsitoli sekira pukul 19:30 terbakar.

Pihak Ima Madina juga telah menyerahkan dokumen permasalahan kepada Ditreskrimsus dengan surat DPP IMA MADINA Nomor 110/SEK-DPP IMA MADINA/B/I/2014, tanggal 27 Januari 2014, perihal bahan verifikasi laporan dugaan illegal Mining PT. Madinah Madani Mining.(c14)

Plt. Bupati Madina Diminta Tegas Terhadap Sekdes Bermasalah PANYABUNGAN(Waspada): Pemerintah Kabupaten Mandailing Natal diminta untuk mengevaluasi kembali pengangkatan Sekdes (Sekretaris Desa) jadi Pegawai Negeri Sipil (PNS) yang dinilaisyaratmanipulasidantidak sesuai amanat Undang-Undang. “Pemkab Madina diminta bertindak.Jikaterbuktimelanggar undang-undang serta pengangkatannya penuh rekayasa dan memanipulasi data agar Sekdes yangdiangkatmenjadiPNSdiberhentikan serta oknum-oknum yangterlibatpengangkatandiproses secara hukum,” ujar tokoh masyarakat dan juga Praktisi Hukum Madina, Martua Hamo-

nangon Nasution, SH di Panyabungan, kemarin. Dikatakannya,pengangkatan Sekdes yang penuh dengan rekayasa dan manipulasi data ini mengakibatkan orang yang tidak berhak menjadi Sekdes ternyata menjadi sekdes. Sepengetahuan warga yang bersangkutan tidak pernah jadi Sekdes. Kemudian, mulai tahun 2005 di Madina tidak pernah ada Sekdes perempuan, tapi begitu pengangkatan Sekdes banyakmunculSekdesperempuan. Bahkan sampai sekarang, ada beberapa status Sekdes sudah jadi tersangka dan terpidana, namun status PNS nya tetap tidak diberhentikan. Selain itu banyak

Sekdes yang tidak berdomisili di tempat tugasnya, bahkan jarang sekalimengurusipersoalandidesa. “Kami hanya ingin ketegasan Plt. Bupati Madina. Sebab ketika persoalaninipertamakalimuncul, mantan Bupati Madina, HM Hidayat Batubara, SE pernah membuat surat edaran bagi Sekdes yang bermasalah dengan peraturan dan undang-undang agar diproses secara hukum, dan yang bersangkutan agar diberhentikan.Itusalahsatupointsurat edaran Bupati ke pemerintah kecamatan dan hal ini kita harapkan juga ditinjaklanjuti Plt. BupatiMadinaDrs.DahlanHasan Nasution,” harapnya.(c15)

Operasi Cipta Kondisi, Satlantas Polres Tapteng Tilang 414 Pengendara SIBOLGA (Waspada): Operasi Cipta Kondisi jelang Pemilu yang digelar Satlantas Polres Tapteng dan berakhir 15 Maret lalu, menilang 414 pengendara. Sementara,30pelanggaranmasih berupa teguran. “Di antara seluruh penindakan langsung, yang paling banyak berupa tidak melengkapi suratsurat kendaraan 217, tidak menggunakanSIM173.Selebihnyatidak menggunakan helm dan tak menggunakan kaca spion, serta pelanggaran lainnya,” kata Ka-

polres Tapteng melalui Kasat LantasAKPBSitohangmenjawab Waspada, Selasa (18/3). Sementara itu, masih ada 30 pelanggar lalulintas berupa pelanggaran ringan yang masih diberi teguran. “Jika belum ada perubahan, kita akan menindaknya dengan menilang,” tegas AKP Sitohang. Masih menurut AKP B Sitohang, dibanding Operasi Zebra lalu, penindakan ini menurun. Di mana pada operasi Zebra pihaknyamelakukanpenindakan

sebanyak 575 kasus, sementara saat ini hanya 444 kasus. “Walau begitu dalam tahapan pemilu masa kampanye, kita akan tetap melakukan tindakan tegas. Misalnya dalam kampanye terbuka, kita tidak memperkenankan adanya mobil pick up (bak terbuka) mengangkut orang, mengendarai sepedamotor melebihi 2 orang, dan berbagai pelanggaran lainnya yang pada akhirnya untuk tujuan keselamatandankenyamananpengendara,” katanya.(cpol)

GUNUNGSITOLI (Waspada): Seorang bocah bernama Chelse Zega, 5, meninggal dunia terpanggang pada peristiwa terbakarnya salah satu rumah milik mantan Ketua Yayasan Perguruan Pembda Nias Alm. TM.Zega di Jl. Pelita, Kelurahan Ilir, Kota Gunungsitoli, Senin (17/3) malam. Selain merenggut nyawa Chelse Zega, duaorangkaryawanwarnetmilikorangtuakorban, bernama Jernih Zega dan Elsen Halawa turut menderita luka-luka. Ismet Amazihono yang merupakan ipar Pilu Zega yang ditemui wartawan di lokasi kebakaran menyebutkan, dia baru mengetahui peristiwa ituketikaorangberlariandanberteriakadakebakaran dan langsung mendatangi tempat kejadian yang berjarak sekira 50 meter dari rumahnya. “Melihat api berkobar di rumah mertua sekira pukul 19:30, saya secara spontan menyuruh keluarga untuk mengambil air dan membantu menyiram untuk memadamkan api. Namun, upaya yang kami lakukan sia sia karena api sudah membesar dan menghanguskan rumah mertua saya dan rumah pendeta Agus Warasi yang dijadikan sebagai gereja sidang jemaat allah,” tutur Ismet. Ismet mengakui, akibat kebakaran tersebut,

anak perempuan iparnya yang bernama Chelse Zega umur 5 tahun hangus terbakar karena tidak sempat diselamatkan akibat kobaran api yang membesar dengan cepat. Dua orang karyawan yang tinggal di rumah mertuanya Elsen Halawa dan Jernih Zega juga terluka akibat terbakar dibagian tangan dan kaki, kini keduanya sedang dirawat di RSU Gunungsitoli. Ditanya tentang penyebab kebakaran, Ismet mengatakan jika dia tidak tahu, karena ketika tiba dilokasi kebakaran, api sudah membesar. Kerugian yang dialami akibat kebakaran tersebut menurut Ismet mencapai ratusan juta rupiah. Ditempat yang sama, beberapa warga yang dijumpai wartawan menyebutkan, kebakaran diduga akibat genset yang berada di warnet milik Pilu Zega meledak saat dihidupkan, karena sebelum kebakaran terjadi, listrik di Kota Gunungsitolisedangpadam.Pantauandilapangan, kobaran api yang mulai membesar pada pukul 19:30 baru bisa dijinakkan oleh petugas kebakaran Kota Gunungsitoli dan Kab. Nias dibantu mobil tangki dari Mapolres Nias sekira pukul 23:00. Mayat korban kebakaran Chelse Zega baru bisa dievakuasi dari dalam rumah oleh warga dan petugas kepolisian pada pukul 22:00. (a25)

Illegal Logging Semakin Marak Di Simalungun SIMALUNGUN (Waspada): Anggota DPRD Simalungun, Bernhard Damanik mengatakan, dirinya sangat prihatin melihat kerusakan hutan di sejumlah kecamatan di Kab. Simalungun. “Dinas Kehutanan Simalungun lemah dalam mengawasidanmengantisipasipembalakanhutan liar, sehingga ada kesan membiarkan maraknya aksi illegal logging di sejumlah kawasan hutan di Kab. Simalungun,” tegas Bernhard kepada wartawan, Senin (17/3). MenurutanggotaDPRDSimalungundariFraksi Demokrat ini, lemahnya pengawasan dan tidak adanyatindakantegasdariDinasKehutananSimalungun membuat sejumlah kawasan hutan gundul. Dari pengamatannya, kondisi kawasan hutan diSosorPea,Sitahoan,Kec.GirsangSipanganbolon, Dolok Parmonangan, Kec. Dolok Panribuan, Parit Ganjang, Kec. Jorlang Hataran, Durian Banggal, Kec. Raya Kahean dan Sipolha, Kec. Pematang Sidamanik, sangat memprihatinkan. “Kondisi hutan Simalungun saat ini benar-benar memprihatinkan. Jika kondisi ini dibiarkan, Simalungun dan beberapa daerah tetangga

terancam bencana banjir dan longsor,” ujarnya. Dinas Kehutanan Simalungun, sepertinya tidak mampu melakukan pengawasan dan memberikan tindakan tegas terhadap pelaku illegal logging. Jika Dinas Kehutanan terus menutup mata dengan aksi penebangan liar, dikhawatirkan dalam kurun waktu dua tahun ke depan, kondisi hutan di Kab. Simalungun akan kritis dan sulit direhabilitasi. Ironisnya, tambah dia lagi, beberapa kali sejumlah kalangan baik dari LSM atau organisasi pecinta lingkungan, memberikan bukti adanya penebangan liar, namun Dinas Kehutanan Simalungun tidak mampu untuk menindak pelakunya.“SayaberharapDinasKehutananuntuk tidak menutup mata terhadap aksi penebangan liar di sejumlah kawasan hutan, sehingga tidak menimbulkankesansengajadibiarkanatauadanya kolusi dengan pelaku pembalakan liar,” tandasnya. Kepala Dinas Kehutanan Simalungun, Sudiahman Saragih saat dikonfirmasi wartawan melalui telepon selularnya tidak bersedia memberikan jawaban. (a29)

Pulang Ke Desa, Kondisi Korban Maklumat Soal Makanan Halal Erupsi Sinabung Memprihatinkan Di Kantor KUA Siantar Utara SIMPANG EMPAT (Waspada): Kondisi pengungsi Gunung Sinabungyangtelahdikembalikan ke desanya masih cukup memprihatinkan. Kehidupan mereka hanya bergantung terhadap bantuan donatur yang menyerahkan bantuan di desanya. “Untuk sayurnya setiap hari makanmiinstanyangdibawadari posko pengungsian dulu. Kalau berasnyayangdibawadulusudah habis. Terus ada bantuan beras yangdatangkemari.Ituyangkami makan,” ujar Normina Br Milala, 53, warga Desa Pintumbesi Kecamatan Simpang Empat saat ditemui Waspada di desanya, Senin (17/3). Normina menjelaskan, kondisi di desanya saat ini belum memungkinkan untuk bercocok tanam lantaran debu vulkanik yang masih acapkali menghujani desa tersebut. Paska dikembalikankedesanya,iasudahbeberapa kali mencoba menanam sayursayuran. Namun, tanaman tersebut hancur. “Kalau hanya mengandalkan jaminan hidup yang Rp6 ribu per

jiwa itu nggak cukuplah untuk sehari-hari. Untuk menambah penghasilan, saya kerja di ladang orang di desa seberang. Apalagi bapak masih sakit,” ujar ibu yang tinggal bersama anak dan cucunya ini. Mengenai status Gunung Sinabung yang kini masih berstatus Awas, Normina sudah terbiasa dengan kondisi ini. Ia mengaku sudah tidak terlalu khawatir lagi setiap hari mendengarkangemuruhyangterdengar jelas hingga ke rumahnya, apalagi malamhari.“Sudahterbiasa.Tapi, setiap hari, siang malam kami harus terus berjaga-jaga. Barangbarang penting tetap disusun di dekat pintu. Kalau gemuruh kuat danterlihatapibanyakyangkeluar, kami langsung lari. Pernah terjadi kayakgitu,kamisangattakutsekali, apalagi bapak nggak bisa lari dan kami nggak punya mobil,” katanya. Pantauan Waspada dari kediaman Normina, Gunung Sinabung sangat jelas terlihat. Bahkan, beberapa kali terdengar suara gemuruh dari perut gunung.

Debu vulkanik juga masih tebal, baik dijalanan maupun yang menempelditanaman.Ditambah lagi kondisi desa yang terlihat tandus akibat kemarau yang berlangsung akhir-akhir ini. Hal yang sama juga tampak di Desa Naman Kecamatan Namanteran.Setiapkendaraanyang melintas membuat debu-debu tersebut langsung berterbangan. Sementara, masyarakat di desa, termasuk anak-anak terlihat tidak menggunakan masker. Aktivitas warga di dua desa ini juga belum sepenuhnya pulih. Mereka belum ingin memulai tanaman baru. Kebanyakan di antaranya masih baru melihatlihat tanamannya dan sesekali membersihkannya. Meski kedua desa ini sudah dipulangkan, namun masih ada warga yang belum kembali ke kampung halamannya“Adayangmengontrak rumah di Kabanjahe atau Berastagi. Ada juga yang masih bertahan di Posko pengungsian. Tinggal di sini juga belum bisa kayak dulu lagi,” pungkas Normina. (a36)

MAN P. Siantar Bertekad Raih Prestasi Nasional Adiwiyata PEMATANGSIANTAR (Waspada): Madrasah Aliyah Negeri (MAN) kota Pematangsiantar tercatat satu-satunya sekolah pendidikan IslamselevelnyadikotaPematangsiantaryangmenerimapenghargaan Adiwiyata untuk tingkat kota pada 2014 ini. Penghargaan atas kemampuan sekolah membina kasawan pendidikan berbasis lingkungan itu diserahkan Walikota kepada kepala sekolah MAN, Drs.Marzuki Saragih, dilapangan Haji Adam Malik, Senin (17/3). Saragih, setelah menerima penghargaan piagam Adiwiyata yang diserahkan langsung Sekretaris kota Donver Panggabean,MSi dan disaksikan seluruh pimpinan dan staf unit kerja di lingkungan Pemko Pematangsiantar, setelah usai melaksanakan upacara bendera kepada Waspada mengatakan, akan bertekad meraih prestasi di tingkat nasional. Wawasan lingkungan berbasis Adiwiyata, menurut Saragih sesuai dengantuntutanIslamyangmenyebutkan,kebersihanadalahsebagian dari keimanan.Maka dengan tuntutan itu, dia yakin sekali, obsesinya merebut penghargaan Adiwiyata Nasional akan mendapat dukungan banyak pihak disekolahnya khususnya kalangan siswa . (c16/crap)

Rumah Terbakar Bocah 5 Tahun Meninggal

Waspada/Dickson Pelawi

WARGA saat melintas di Desa Pintumbesi Kec. Simpang Empat.

PEMATANGSIANTAR (Waspada): Kantor Urusan Agama (KUA) Kecamatan Siantar Utara, Kota Pematangsiantar belakangan ini diketahui tertarik untuk mengkampanyekan soal makanan halal yang akan dikonsumsi. Kampanye yang dituangkan dalam papan-papan maklumat tersebut sengaja ditempatkan di tempat-tempat strategis yang mudah terlihat masyarakat di daerahnya. Salah satu tulisan maklumat soal makanan halal itu, tertulis: ‘Pastikan anda telah mengkonsumsi yang halal’. Dan maklumat tersebut sengaja ditempatkan di halaman depan kantor KUA di komplek kantor Camat Siantar Utara Pematangsiantar. Namun sangat mengherankan masyarakat, sejak munculnya papan maklumat soal makanan halal tersebut, ada pihak-pihak tidak bertanggungjawab mengotori lokasi maklumat tersebut dengan menempatkan gerobak-gerobak sampah di tempat itu. Pantauan Waspada, Jumat (14/3), papan maklumat soal makanan halal tersebut terlihat jadi cukup kontras dengan penempatan sejumlah gerobak sampah. “Penempatan gerobak-gerobak

sampah di sekitar tulisan soal makanan halal yang dibuat KAU itukan cukup kontras dan sepertinya sengaja dilecehkan. Ini namanya pekerjaan usil,” sebut H. Abd. Rahman salah seorang tokoh masyarakat di kecamatan itu ketika ditanya tanggapannya soal situasi itu. Menurut dia, aneh dengan kondisi yang cukup kontras itu, tidak ada terlihat upaya dari staf kantor KUA untuk menggusur gerobakgerobak sampah dari lokasi maklumat itu. Demikian juga dari pihak staf kecamatan juga tidak terlihat sadar, kalau penempatan gerobak sampah tersebut sudah menimbulkan masalah bagi masyarakat yang melihatnya. Keterangan yang dihimpun Waspada di kantor Kecamatan Siantar Utara Pematangsiantar, disebutkan, karena tidak ada lagi lokasi, maka gerobak-gerobak sampah yang digunakan petugaskebersihandikecamatanterpaksaditempatkan didekat papan maklumat soal makanan halal itu. “Itu sudah lama, tempatnya gerobak sampah ditempatkan di situ,” sebut salah seorang staf kantor camat, ketika ditanya soal penempatan gerobak sampah yang diketahui ada di depan kantor KUA di daerah itu. (c16)

Pengurus FSP PAR-KSPSI Deliserdang Dikukuhkan MEDAN (Waspada): Pengurus Pimpinan Cabang (PC) Federasi Serikat Pekerja PariwisataKonfederasi Serikat Pekerja Seluruh Indonesia (FSP.PAR-KSPSI) Kabupaten Deliserdang masa bhakti 2013-2016 dikukuhkan. Pengukuhan itu berdasarkan surat keputusan No. KEP : 002/KEP/PD/FSP PAR/V/2013 tertanggal, 23 Mei 2013 yang ditandatangani Ketua PD FSP-KSPSI Provinsi Sumatera Utara (Sumut) Dody Pradipto Ys dan Sekretaris M Azwar SSos. Ketua PD FSP PAR-KSPSI Provinsi Sumut Dody PradiptoYS mengatakan, dikukuhkannya PC FSP PAR-KSPSI Kabupaten Deliserdang masa bakti 2013-2016 adalah sebagai pengembangan efektivitas roda organisasi Serikat Pekerja Anggota (SPA) KSPSI Provinsi Sumut, dalam rangka menjalankan amanat tugas organisasi di bawah kepemimpinan Ketua Umum PP FSP PAR-KSPSI Yorrys Raweyai yang juga Ketua Umum DPP KSPSI. Sementara Ketua PC FSP PAR-KSPSI Deliserdang Sri Hardono menuturkan, kemerdekaan

berserikat, berkumpul, mengeluarkan pikiran baik secara lisan maupun tulisan, memperoleh pekerjaan, dan penghidupan layak bagi kemanusiaan, serta mempunyai kedudukan yang sama dalamhukummerupakanhaksetiapwarganegara. Maka PC FSP PAR-KSPSI Deliserdang siap meningkatkan kesinambungan dalam menjalankan pengembangan roda organisasi sebagai SPA KSPSI di wilayah jajarannya dan akan menjadikan kantor Sekretariat PC FSP PAR-KSPSI Deliserdang di Jalan Besar Batangkuis-Tanjungmorawa No. 18, Desa Telaga Sari, sebagai jati diri organisasi kearahyanglebihbaikdanmenjadikannyasebagai tempat rumah pintar yang akan dapat memberikan wawasan baru kepada setiap pengurus. Susunan kepengurusan PC FSP PAR-KSPSI Deliserdang masa bhakti 2013-2016 yang dikukuhkan adalah: Ketua Sri Hardono, Wakil Ketua Warisman SE, dan Suardianto, Sekretaris Suriono, Wakil Sekretaris Indra Jaya Hasibuan dan Susilawati Nasution, Bendahara Edy Surya, Wakil BendaharaWahyu dan Aswin Shah.(cwan)


B4 1 CM

WASPADA

Rp. 22.000

2 CM

BURSA AUTOMOTIVE Informasi Pembaca

Bursa Automotive AC BR CL ND DB

: Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower

PS PW RT VR EW

: Power Stearing : Power Window : Radio Tape : Velg Racing :Electric Window

BM W 3 1 8 i Hijau Lumut Th 97. 58Jt Nego. Hub 0 8 1 2 6 2 8 1 6 5 8 5 # DAI H AT SU 1 0 0 % BARU # Hubungi Segera Sales Potensi Anda Ini RAH DY / 0 8 1 2 6 2 6 7 3 4 1 6 READY STOCK : XENIA, TERIOS, AYLA, LUXIO GRAN MAX

DAI H AT SU Taft GTS Hitam Th. 88 Sgt Mulus, Siap pakai, Velg Cobra, Ban Cangkul, PS, PW, CL, AC, Hrg. 45Jt. Nego. Hub. 0 8 5 2 6 1 3 4 0 5 3 8

X EN I A M I V V T I 2 0 0 6 Silver, BK panjang, VR, PS, CL, AC Dingin, Harga 87Jt. Nego. Hub. 0853 6142 8458

ASTRA DAIHATSU 0813 6100 7778 All New Xenia DP 20Jtan, Terios DP 30 Jtan Pick Up Gran Max DP 10Jtan, Ayla DP 20Jtan DAIHATSU ROCKY / F78 Independen Thn 1997. Sangat Mulus, BK Medan, Warna Biru Hitam Metalic, Harga Nego. Hubungi 0 8 1 3 7 0 6 3 4 7 7 0

DAIHATSU FEROZA Thn 1994. Hijau Tua Met, Mulus, Siap pakai, 40Jt/nego. Hub 0 8 1 2 6 3 3 2 0 3 8 9

Rp. 33.000

3 CM

Rp. 44.000

4 CM

Rp. 55.000

6 CM

Rp. 121.000

DAI H AT SU TERIOS TX Manual Th’08 Bln 11, Komplit, Mobil istimewa, Cantik Sekali, 1 tangan dr bar, Rp. 141Jt. Jl. Sm Raja No. 200. 0853 6231 2323 / 7851402

SU Z U K I CARRY ALEXANDER Th 86/ 87. W. Merah Metalic, Vr, Br, BK Medan Asli, Sangat mulus sekali, Rp. 16Jta (Nego). Hub 0 8 5 2 9 7 5 0 4 3 1 9

H Y U N D A I AT O Z T H 2 0 0 3 S G T ORISINIL FULL SOUND. Hrg 62Jt Nego Abis. Hub 0 8 2 3 6 4 3 2 0 0 5 2

SUZUKI CARRY 1.5 Pick Up Cargo 09. Htm, Ban Baru, Terawat. Hrg 68Jt. Hub 0812 6224 3825 / 77704024

PROMO JOK MOBIL CICILAN 0% MANDIRI 6 X 12 BULAN

OVER KREDIT SUZUKI CARRY PICK UP 1,5 FD

PROMO I Rp. 700.000 Rp. 800.000 PROMO II Rp. 1.000.000 Rp. 1.100.000 PROMO III Rp. 1.400.000 Rp. 1.600.000

D I J U A L C E PAT / T P Mikrobus Isuzu Elf Th 2008 Akhir. Warna Silver Mulus/VR/BR/Ac Datting/ Jok 15 Seat. Hub RUDY 0812 6542 8688

FORD Focus AT Triptonik Airbag Model Jazz Th. 2006. Over kredit, sudah dibayar 15 x sisa 9x5.500.000. Balik DP. 60Jt. Nego. Hub. 0853 7354 0430

J UAL CEPAT TAN PA PERAN TARA

L 300 Minibus Starwagon Thn 1999. W. Putih, Baru Cat, Surat Lengkap, Nego 48Juta. Hub H .ZUL HARAHAP Jln Rakyat Gang Barumun No. 5 M. Perjuangan

Warna Hitam Tahun 2013, 99% Mulus. Plat BK, Balik Dp 10Juta, Angsuran 2.869.000. Hub 0812 6204 2062 TOYOTA SE SALOON MERAH MANGGIS Th 86. Sgt Orisinil, siap pakai, Hrg 30Jt Nego. Hub 0 8 1 2 6 0 6 3 7 8 2 3

MITSUBISHI L-300 Pick Up Solar Th 1999. Coklat, Pajak Baru di Perpanjang, BK Medan, Nama Sendiri, Harga Damai, TP. Hub 0 8 1 1 6 3 6 2 1 9

TOYOTA KIJANG CAPSUL SSX BENSIN Th 98. Sgt Mulus, S. Pakai, Vr, Br, Ps, Full Sound, Pake TV, Ac Dingin, Hrg 78Jt Nego Abis. Hub 0853 7354 0433

M I T SU BI SH I COLT DIESEL PS 120 Thn 2004. Bak Aceh (Kokoh & Tinggi). Siap pakai. Hub 0 8 5 2 6 2 1 6 5 1 9 8

DI J UAL CEPAT T OY OT A KIJANG JANTAN RAIDER Th’90. W. Abu - Abu Metalic, Sangat Mulus, Rp. 35Juta(Nego). 0 8 5 2 7 7 8 6 8 0 2 9

SU Z U K I Katana GX 2003. W. Putih, Mobil mulus, AC, Tape, VR, BK Mdn. 0812 6410 0363

T OYOTA INNOVA Solar G Manual Th’08. Wrn Silver Metalik, Mobil Cantik Sekali, 1 tangan dr baru, Rp. 184,5Jt. Depan Kampus Uisu Pertanian No. 200. 0821 6767 7000 / 7851402

DI J U AL

SEDAN

FAX.4531010

6x6,6 kolom Rp. 165.000

I nfo Pe m e sa na n I k la n H ub. PI N BB 2 6 2 4 7 F5 E H P. 0 8 7 7 1 7 8 4 4 0 3 5 - 0 8 1 1 6 0 4 6 9 0

HARGA SUDAH TERMASUK PPN 10%

BURSA

BURSA SERVICE/ASSESORIES

Type Promo

8 CM Rp. 137.500

Rabu, 19 Maret 2014

MINI BUS

MULTAZAM UMROH

PENDIDIKAN

& MANASIK HAJI 2014

PON PES SYARI EF

*UMROH REGULER 09 HR ( 3,11, 25 APRIL, 5 & 19 MEI 2014) *UMROH REGULER 11 HR (14, 27 APRIL 2014) *UMROH PLUS TURKY 12 HR (20 APRIL 2014) * UMROH PLUS AQSHA DAN JORDANIA (ISRA’ MIRAJ, 24 MEI 2014) * UMROH 2 MGG AWAL, 2 MGG AKHIR, S/ FULL RAMADHAN 1,435 H LU

TAHFIDZUL QUR’AN MEDAN Menerima Pendaftaran Santri Baru Th ajaran 2014/2015. Cp Ust Aziz 0821 6520 3317. Info www.vicci.org

P

H MANASIK HAJI ON SETIAP HR SABTU : 14.00 - 16.00 WIB HR MINGGU : 09.00 - 11.00 WIB BERTEMPAT : MESJID AGUNG MEDAN JLN. PANGERAN DIPONEGORO

Hub.

ELITE MOTOR Jl. Nibung II No. 114 Medan (Samping Medan Plaza)

Telp. 061- 76224409, 0811608140 dekat Carrefour

K AN T OR PU SAT : JLN. TITI PAPAN / PERTAHANAN NO. 10 SEI SIKAMBING D MEDAN

DO RE MI JOK MOBIL KHUSUS AVANZA/INNOVA/ RU SH /T ERI OS/X EN I A

H P. 0812.6495.8456, 0813.6137.2321 0852.0648.6301, 0823 6252 6008 TELP. 061- 4576116 FAX 061-4512319

MENINGGALKAN RUMAH

Rp. 1.350.000,Jok (model press) + Alas

TERCECER T ERCECER STUK. BK 8472 BG. No uji : MDN 48078. A/N : Silindung. Alamat : Jl. G. Karakatau 24 Medan. Merek : Mitsubishi

T ERCECER

Hubungi:

DO RE M I J OK M OBI L JL. S. PARMAN BLOK DD No. 3-4 (DEPAN ST. THOMAS 2 MEDAN) Telp. 061-4522123, 0812 6550 123, 061-6639123 JL. MAKMUR No. 10 A, MEDAN (MASUK DARI JL. ADAM MALIK / JL. KARYA) TELP. 061-6639123, 6636123, 0812 6550123

STUK. BK 8081 CB. No uji : MDN 11430. A/N : Sibon. Alamat : Jl.Sidang Raya No. 4 Mdn. Merek : Mitsubishi

T ERCECER STUK. BK 9235 CD. No uji : MDN 36594 B. A/N : Parulian Sinaga. Alamat : Jl.Sm Raja No. 3 Medan. Jenis : Pick Up

T ERCECER

BUTUH DANA BANTU TUTUP KARTU KREDIT / KTA Hanya Bayar 30% Hutang Lunas 100% dan Legal. Hub Tinah 0812 8153 9552 DA N A T U N A I S U P E R C E PAT Bunga 1-3%m 5 Jam Cair, Tanpa Usaha. Jaminan : SHM, HGB, SK Camat, Take Over, BPKB Mobil, Spd Mtr, Mobil Kredit, Over Leasing/Bantu Pelunasan BPKB. Hub (Sdr Rinaldi) HP 0853 6100 3453 , 0821 6757 1653

BURSA

BPKB ASLI BK 838 SD. A/N SAIFULLAH S.Sos. Alamat : Jl. Setia Luhur No. 188 B. Kel. Dwi Kora Mdn Helvetia.

TERCECER STUK. BK 8979 CP. No uji : Ab. 01025293. A/N :PT. Usaha Gedung Mandiri Cabang. Alamat :Jl. Imam Bonjol No. 7 Mdn. Merek : Daihatsu

H I LAN G SKT Asli No. 593.83/40/DB/2009 tanggal 20 Oktober 2009, a/n HASBULLAH. Tanah terletak di dusun III Desa Baru Batang kuis seluas 5985,75 M2 T ELAH H I LAN G

FOTO COPY

Mau Menjual Rumah, Tanah, Kendaraan, Barang Kerajinan Tangan atau Barang Dagangan Lain?

BPKB Mitsubishi Colt Diesel BB 8420 HC. N/M : 4D56CH3772. N/R : MMB0NK6406F034726, dan BPKB Pick-Up Mitsubishi L-200. BB 8347 HC. No/M : 4D34T-C22304. N/R : MHMFE74P57K000338. A/N Fahrul Rozi Siregar. Bagi yang menemukan harap kembalikan ke Mara Sutan Siregar Jl. Merak No. 33, Komplek Sopo IndahP. Sidimpuan. Hp 0812 650 7479.

T ELAH H I LAN G BPKB Pick Up Ford Ranger No. C9385431N. No Pol : BM 8665 LM. N/M : W9AT-133075, N/R : MNBBSFE803W348170. A/N : Sahata Nababan. Juga hilang BPKB dan STNK Motor Yamaha Byson. Nopol : BB 2496 FS, A/N : Mara Sutan Siregar. Bagi yangmenemukan harap kembalikan ke Mara Sutan Siregar, Jl. Merak No. 33, Komplek Sopo Indah P. Sidimpuan Hp 0812 6507 479 T ERCECER

Ya Tentu...Pasang Iklan di... Surat Kabar Tercinta:

Harian

WASPADA Untuk informasi lebih lengkap hub

TEL. (061) 4576602 FAX. (061) 4561347 INDAH BERSAMA

CANON -

IR IR IR IR

5000 5020 5570 5055

-

6000 6020 6570 5075

Promo Toner IR 5000 Rp. 70.000/kg Jl. Karya No. 68 A-B Medan

061- 6639308 - 0852 7562 7365

Telah Tercecer 1 (Satu) Berkas surat tanah berupa Surat keterangan tanah No. 14/SK/M/1980 tanggal 16 Januari 1980 yang ditanda tangani Camat Medan Kotamadya Daerah Tingkat II, a/n. MR. DJARIAMAN DAMANIK. Diperkirakan tercecer/hilang disepanjang jalan SM Raja Sekitar Bulan Desember 2013. bagi yang menemukan harap hub 0815 3089 483, akan diberikan imbalan & tidak dituntut

TERCECER 1 IJAZAH ASLI NO 027111397, an. Peri Mauliadi Pohan, Fakultas Sastra Universitas Islam Sumatera Utara, Hilang di Rantau Prapat Sekitar 2 bulan yang lalu TERCECER Surat Jual Beli Tanah Uk. 4,5m x 20m. Atas nama Asmanidar. Jalan Sei Kera Gg. Jawa No. 42. Medan Perjuangan 20233. Bagi yang menemukan Hub. 0819 6060 474

TELAH HILANG/TERCECER Surat Tanah SK. Tanah Bupati KDH Kab. D/S No. 32512/A/ IV/18 Tgl. 26-1-1974 An. Sulaiman sisa tanah ukuran 4,5m x 13m =58,5m yang terletak di Jl. Selam VIII Gg. Budi No. 221 Lingk. V Kel. Tegal Sari Mandala I Kec. Medan Denai. Bagi yg menemukan hubungi alamat diatas akan diberikan hadiah sepantasnya.

BURSA ALAT MUSIK

Nama: SYAFRAN I Tpt/Tgl lahir: Belawan / 27 Des 1979

Meninggalkan rumah pada tgl. 13 Maret 2014 Tinggi : 155 Cm Rambut : Lurus Kulit : Sawo Matang Kami harap bagi saudara kami ini untuk kembali ke rumah keluarga, anak2 pada rindu, dan bagi yang mengenalnya dapat menghubungi kami di

0 8 5 3 6 2 0 1 6 5 0 0 (T ha lib) 0 8 5 2 9 6 1 2 0 3 7 3 (N urm a ila ni) Akan mendapatkan imbalan sepantasnya.

LOWON GAN K ERJ A

LOWONGAN KERJA

Dibutuhkan segera karyawan Laki - Laki untuk ditempatkan sebagai SUPERVISOR / MANAGER di “BARBER POP” Jl. Zainul Arifin No. 179 Medan,dengan minimal pengalaman 2 tahun di bidangnya. Lamaran dapat diantar ke “ Batik Luza” Jl. Zainul Arifin No. 81 Medan, Paling Lambat tanggal 1 April 2014 dengan KODE BBP

Dibutuhkan segera karyawan WANITA untuk ditempatkan sebagai SUPERVISOR/MANAGER di “ BATIK LUZA” Jl. Zainul Arifin No. 81 Medan Sebelah Toko Murano, dengan minimal pengalaman 2 tahun dibidangnya. Lamaran dapat diantar ke “ Batik Luza” Jl. Zainul Arifin No. 81 Medan, Paling lambat 1 April 2014 dengan kode BLZ

KLINIK TERAPY/ ALAT VITAL

MAK EROT YANG TERUJI DAN T ERBU K T I Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041

Dengan H. TEJA SAEFUL Cucu Asli Mak Erot Bersama Ust. M. OTONG Bila anda ingin perkasa ingat jangan sampai salah masuk, carilah yang benar-benar pewaris ilmu mak Erot sejati, karena keahlian H. Teja Saeful sudah tidak diragukan lagi dalam menangani keluhan seputar alat vital bahkan pengobatan H. Teja Saeful sudah terkenal di seluruh Indoneisa dan kota-kota besar di Indonesia, sudah ribuan pasien tertolong dipengobatan Mak Erot ini yang aman tanpa efek samping, bahkan dimanca negara sekalipun pengobatan Mak Erot SUDAH TIDAK DIRAGUKAN LAGI KEBERHASILANNYA, INGAT untuk kaum pria jangan sampai anda terhina kaum wanita karena kondisi alat vital yang kurang sempurna K H U SU S WAN I T A: K H U SU S PRI A: - Ingin punya keturunan - Ejakulasi dini - Memperkencang & - Impotensi memperbesar payudara - Memperpanjang “Alvit” - Keras dan tahan lama, dll - Memperbesar “Alvit” DI J AM I N 100% K ON SU LT ASI U M U M : H AN YA T EM PAT - Buka aura K AM I K LI N I K - Cari jodoh M AK EROT - Pelaris - Mencari orang hilang J L. LAK SAN A N O. 6 2 A M ASU K DARI J L. AM ALI U N Y U K I SI M PAN G RAYA M EDAN (PRAK T EK T ETAP) H P: 0 8 1 2 4 0 3 8 3 3 3 - w w w.t e ra pia lat vit a lm a ke rot .c om

Media yang Tepat untuk Iklan Anda

BURSA

BURSA PERABOT

G R : Garasi LB KM : Kamar Mandi LT KP : Kamar Pembantu RM KT : Kamar Tidur RT SHM: Sertifikat Hak Milik

: Luas Bangunan : Luas Tanah : Ruang Makan : Ruang Tamu

RUMAH DIJUAL Jl. Marelan VII Psr 1 Tengah No 11. Uk 10x24 M, Ada tingkat, Toko, Ada Rumah Sewa, KT 3, Grasi, Toko, Listrik, 1300 Watt, Pam, Rp. 550Jt. Hub 0 8 5 2 6 2 2 4 2 6 1 8 , 0 8 2 3 6 2 5 8 2 1 0 8

T EM PAH AN M U RAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1.750.000 /mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 75107000

SPRING BED DIJUAL MURAH Spring Bed 6 kaki 2 lapis Rp. 1.250.000 Spring Bed 5 kaki 2 lapis Rp. 1.200.000 Spring Bed 4 kaki 2 lapis Rp. 1.100.000 Spring Bed 3 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki Dorong Rp. 1.150.000 Garansi Per 10 tahun Hub Telp. (061) 661.8116 - (061) 661.6802 - 75107000

DIJUAL / OVER KREDIT Rp. 130Jt, Rumah Hook, TP, BU, Arcadia Regency Jl. Setia Budi Gg. Marto No. 19 Kel. Helvetia Timur Kec Medan Helvetia, SHM, LT 98 M2, 2 KT, 2 KM, 2 Pintu Masuk, 1 Kitchen Set, 1 AC, PLN 1300 W, PDAM + 1 Jet Pump, Kredit s/d juni 2021. Cicilan 3,7Jt/bln. Hub 0 8 1 2 1 2 6 1 9 2 7 1

Anda Butuh Perabot Jepara Asli?

MALIOBORO PERABOT Hubungi: Jl. Bilal No. 90 P. Brayan Medan Telephone Toko : 661.6285 Rumah : 661.1540 Fax : 661.6285 (061) Jl. K.L. Yos Sudarso depan SMA Negeri 1 Tebing Tinggi Telp. (0621) 24243

RUKO RING ROAD DISEWAKAN 4,5 X 16/ LT 4,5 X 28. Cocok Utk Kantor, Usaha Kuliner, Baja Ringan Dll. Rp 26Jt/Thn. Hub 7 7 3 8 9 3 6 1 R U M A H DI KM. 12 Mdn-Binjai Blkng Swa.Mandiri, Jl. Pelita II. Ls Tnh 10,4 x 20 M, 3 K. Tdr, R. Tamu & Kel Luas, Rp. 260Jt/Nego. Hub 0 8 1 3 9 6 5 5 7 5 7 1

TANAH TAN AH Uk. 45 x 40 M. Jl. Menteng 7 Gang Melati Ujung. Hrg. 1,1 M/Nego. HP. 0852 7001 2345

DIJUAL CEPAT

SERVICE KONSTRUKSI

Jl. P. BRAYAN MEDAN

WC WC

HP. 0813 7035 7291 0813 6210 8239 Ada Garansi

TUMPAT/ SAL. AIR

8 4 5 .8 9 9 6 0812.631.6631 Bergaransi/ Jl.Kpt. Muslim

Tanah seluas +/- 8000m2 - Sertifikat. Di belakang kantor Camat Bt. Kuis Jl. Jati Desa Tanjung Sari Kec. Bt. Kuis - Deli Serdang. TP. Hub. HP. 0852 0761 0494 TANAH

TANAH SAWAH DIJUAL MURAH Ada +/- 5 Ha / 50.000 M2 Di Pinggir Jalan, Ada Tali Air Di Percut. IM2 Rp 37.000,-. Peminat Hub 061-4570929, HP 0821 6244 3786

SERVICE ELEKTRONIK

AC

KESEHATAN

WASPADA

PROPERTY

Informasi Pembaca Bursa Property

BURSA

Ingin Promosikan Produk Anda Harian

CU CI + B . PASAN G Kulkas, M. Cuci, Dispenser H u b . M a j u Te k n i k - 0 6 1 .7 0 3 0 1 1 8 - 0813 6244 4913

F D

C D

KIRIMKAN... DATA IKLAN MINI ANDA

DALAM BENTUK

DIGITAL Keterangan lebih lengkap silahkan hubungi:

TELPON : 061 - 4576602 FAX : 061 - 4561347 * Format: JPG - TIFF (Photoshop)

BURSA PELUANG USAHA PAWANG PEMILU RI 2014 Mau jadi anggota DPRK, DPRD, DPR RI, Partai Menang Pemilu. Syarat Mudah. Hub 0 8 1 3 9 7 9 9 2 4 1 7 0852 9753 2928

BURSA PERHOTELAN Since 1952

KENANGA CITI HOTEL My Residence in Medan

J l. Sisinga m a nga ra ja N o. 8 2 Medan Te lp. (0 6 1 ) 7 3 4 .2 1 0 6

BURSA JASA KONTRUKSI CV. TAKETAMA CONSTRUCTION Menyediakan Jasa Kontruksi Kantor. Jl Pinus 1 No. 17 Kompleks DPRD Medan Timur. CP Romulus 0 8 1 3 6 2 1 2 6 8 5 8 Josep 0813 9777 6645 Sandy 0 8 1 2 6 5 3 1 8 1 8 9

BURSA MATERIAL


Ekonomi & Bisnis

WASPADA Rabu, 19 Maret 2014

Mata Uang Dolar AS Dolar Singapore Dolar Australia Euro Real Arab Saudi

Jual 11.357 9.046 10.399 15.877 3.141

Beli 11.193 8.802 10.107 15.536 2.880

Mata Uang Dolar AS Dolar Singapore Dolar Australia Euro Real Arab Saudi

Jual 11.340 8.968 10.306 15.782 3.053

Beli 11.300 8.918 10.236 15.702 2.983

Mata Uang Dolar AS Dolar Singapore Dolar Australia Euro Real Arab Saudi

Jual 11.385 9.241 10.506 15.989 3.216

Kasus Deposito Palsu Bank Sumut

KURS BI

KURS BANK BNI

KURS BANK BCA

KURS BANK MANDIRI

Beli 11.235 8.641 10.006 15.489 2.816

Mata Uang Jual Dolar AS 11.338 Dolar Singapore 8.969 Dolar Australia 10.303 Euro 15.797 Real Arab Saudi 3.023

Beli 11.226 8.879 10.199 15.640 2.993

Pedagang bawang merah di pasar induk tanah tinggi, Tangerang, Banten, Selasa (18/03). Pedagang bawang merah mengeluhkan harga bawang merah yang terus merosot hampir 1 bulan ini, lantaran pasokan bawang merah impor membanjiri pasaran. Akibatnya Harga bawang merah menurun dari harga normal berkisar Rp 1.500 - Rp 2.000 per kilogram.

Utang Luar Negeri RI Januari USD269,3 Miliar Utang luar negeri (ULN) Indonesia Januari 2014 tercatat USD269,3 miliar, atau mengalami per tumbuhan 7,1% (yoy), meningkat dibandingkan pertumbuhan Desember 2013 sebesar 4,6% (yoy). “Peningkatan pertumbuhan itu terutama dipengaruhi

kenaikan posisi ULN sektor swasta sebesar 12,2% (yoy) menjadi USD141,4 miliar,” kata Direktur Eksekutif Departemen Komunikasi BI, Tirta Segara di Jakarta, Selasa (117/3). Untuk posisi ULN sektor publik tumbuh sebesar 1,9% (yoy) menjadi USD127,9 miliar. Jika dibandingkan dengan posisi bulan sebelumnya, ULN sektor swasta hanya tumbuh 0,6% dan ULN sektor publik meningkat 1,6%. Berdasarkan jangka waktu, kenaikan pertumbuhan ULN terutama terjadi pada ULN jangka panjang. ULN berjangka

panjang pada Januari 2014 tumbuh 7,1% (yoy), lebih tinggi dari pertumbuhan Desember 2013 sebesar 4,1% (yoy). Sedangkan ULN berjangka pendek tumbuh 7,0% (yoy), sedikit lebih lambat dibandingkan dengan pertumbuhan bulan sebelumnya sebesar 7,1% yoy. Pada Januari 2014, ULN berjangka panjang tercatat sebesar USD222,8 miliar, atau mencapai 82,7% dari total ULN. Dari jumlah tersebut, ULN berjangka panjang sektor publik mencapai USD121,5 miliar (95,0% dari total ULN sektor publik), sementara ULN

Ekspor Udang Sumut Naik 219 Persen MEDAN (Waspada): Ekspor hasil laut udang Sumatera Utara (Sumut) mengalami kenaikan mencapai 219 persen pada Februari 2014, di mana volume mencapai 4.558 ton atau senilai 56.841 juta dolar AS. Ekspor udang ke negara Amerika, Italia, Afrika Selatan dan Jepang mencapai 2.208 ton dengan nilai 17.795 juta dolar AS. “Ekspor udang Sumatera Utara sangat tinggi, naik lebih dari 200 persen dibandingkan tahun lalu. Ini sangat menggembirakan,” kata Kasi Ekspor Hasil Pertanian dan Pertambangan Disperindag Sumut Fitra Kurnia, Selasa (18/3). Fitra menjelaskan, naiknya ekspor udang yang mencapai 219 persen dikarenakan negara utama penghasil udang seperti China danVietnam menghentikan ekspor udang. Sebab,

wilayah kedua negara ini tengah dilanda penyakit udang sehingga hasil udang berkurang sementara kebutuhan dari negara Amerika dan Eropa terus meningkat. “Alhasil, negara Amerika dan Eropa melakukan pengalihan ke Sumatera Utara dan ini berdampak terhadap meningkatnya realisasi ekspor. Negara tujuan ekspor udang juga bertambah, diantaranya negara Amerika, Korea, Italia, Belgia, Kanada dan Puerto Riko,” jelasnya. Menurutnya, kondisi ini dapat dimanfaatkan oleh para ekspotir udang di Sumut untuk dapat lebih menjaga hasil produsen. “Kita berharap, eksportir udang tidak terkena hambatan teknis dan non teksis seperti yang terjadi di negara China dan Vietnam,” ujarnya.

Berdasarkan Surat Keterangan Asal (SKA), Dinas Perindustrian dan Perdagangan (Disperindag) Sumut, nilai ekspor Sumut pada periode Februari 2014 turun 0,59 persen (774.042 juta dolar AS) dan volume ekspor turun 5,81persen (805,450 ton) (yoy). Dimana pada Februari 2013, nilai ekspor Sumut mencapai 778.703 juta dolar AS dengan volume 855.142 ton. “Ekspor udang yang sangat tinggi mendongkrak nilai ekspor di Februari 2014 yang hanya turun 0,59 persen. Harga udang rata-rata naik, harga di Desember 2013 berkisar 8 dolar AS per kg, sementara harga di awal tahun 2014 sekitar 9,5 dolar AS sampai 10 dolar AS per kg. Sementara untuk harga lokal udang, Rp85 ribu per kg sampai 90 ribu per kg,” pungkasnya. (m41)

Hadapi MEA, Pemerintah Didesak Berlakukan Sertifikasi SNI J A K A RTA ( Wa s p a d a ) : Pemerintah didesak segera berlakukan sertifikasi Standar Nasional Indonesia (SNI) bagi sektor perdagangan. Hal ini terkait indikasi membanjirnya barang-barang impor dari kawasan ASEAN dan China dengan harga yang murah. “Pemerintah, dalam hal ini Menteri Perdagangan dan Menteri Perindustrian segera memberlakukan sertifikasi SNI bagi produk-produk dalam negeri” kata Ketua Bidang Perdagangan Himpunan Pengusaha Pribumi Indonesia (HIPPI) Hardini Puspasari dalam keterangannya di Jakarta, Selasa (17/3). Menurutnya, hingga November 2013 pemerintah impor bahan pokok sebanyak 17 juta ton senilai Rp 105 triliun. Padahal, sebagian besar impor itu merupakan bahan pokok yang bisa dipro-duksi pengusaha dalam negeri. Seperti, beras, kentang, jagung, cengkeh, kopi, teh, garam, dan cabai. “Namun rupanya, pemerin-

Bank Harus Bertanggungjawab Bila Terdapat Kelemahan Prosedur MEDAN (Waspada): Otoritas Jasa Keuangan (OJK) Regional 5 Sumatera akan melakukan pembinaan kepada Bank Sumut, bila dalam kasus deposito palsu yang keluarkan pegawai bank tersebut terdapat kesalahan atau kelemahan prosedur bank. “Kasus ini sudah dilaporkan ke polisi, karena itu kita menunggu hasilnya. Kalau ada kelemahan di internal control (pengawasan) bank, tentu akan ada pembinaan dari OJK,” kata Kepala Otoritas Jasa Keuangan (OJK) Regional 5 Sumatera Achmad Fauzie terkait kasus deposito palsu yang dilakukan oknum pegawai Bank Sumut di dalam bank tersebut, kepada Waspada, Selasa (18/3). Achmad Fauzie mengatakan, dalam kasus tersebut, walaupun kejadiannya di dalam Bank Sumut, tetapi dananya tidak disetorkan ke counter atau ke teller bank, sehingga tidak dicatat. “Ini kan suatu penipuan antara oknum dan korban yang sudah saling kenal. Kami sudah minta klarifikasi ke Bank Sumut, tetapi belum disampaikan, karena oknumnya kabur sehingga belum bisa menjelaskan dengan tuntas,” ujarnya. Menjawab pertanyaan terkait pembinaan apa yang akan diberikan OJK bila terdapat kelemahan prosedur di Bank Sumut, Achmad Fauzi mengatakan, hal tersebut masih perlu diberikan klarifikasi. “Kita lihatlah nanti, kan belum tahu juga apa ada kelemahan banknya, karena belum diberikan klarifikasi,” ujarnya. Terkait dengan kasus perbankan secara umum, OJK tentu akan melakukan pengawasan serta pembinaan kepada setiap bank sesuai

HARGA BAWANG MERAH TERUS MEROSOT

JAKARTA (Waspada):

tah lebih memilih untuk mengimpor-nya. Bayangkan jika dana sebesar itu bisa diputar di dalam negeri melalui usaha anggota HIPPI, multiplier effects-nya pasti sangat signifikan mendorong pertumbuhan ekonomi nasional,” jelas Hardini. Kebijakan itu lanjutnya, ditujukan juga memberikan perlindungan terhadap produkproduk yang sama dari dalam negeri. Karena sudah menjadi tugas pemerintah untuk segera memberikan perlindungan terhadap pengusaha pribumi dalam mengembangkan usahanya sebagai upaya meningkatkan daya saing produk dalam negeri. Dengan demikian, kata Hardini, ada filterisasi yang dilakukan pemerintah dalam mengijinkan masuknya produk murah meriah asal China dan negara-negara lain ke dalam negeri. Dia menegaskan, skema pemberlakuan sertifikasi SNI bisa diterapkan pada seluruh pintu masuk perdagangan di Indonesia, baik di pelabuhan,

bandara, maupun lokasi-lokasi perbatasan di seluruh wilayah Indonesia. “Salah satunya, adalah memberlakukan sertifikasi SNI seluruh produk-produk dalam negeri dan produk-produk impor yang masuk ke Indonesia,” tegasnya. Hardini menambahkan, bermodalkan jumlah penduduk yang mencapai 245 juta jiwa, maka potensi pasar besar seperti ini harus dioptimalkan bagi pengusaha pribumi. Artinya, pemerintah harus mengurangi impor sekaligus memperkuat petani dan peternak Indonesia, menangkap momentum pertumbuhan yang tercipta dari permintaan dalam negeri. Saat ini HIPPI memiliki 4 juta anggota dan merupakan organisasi yang mewadahi pengusaha pribumi Indonesia dengan jumlah perwakilan di 33 provinsi yang ada di seluruh Indonesia. Dengan SNI diyakini menolong anggotanya mengembangkan usaha saat MEK berlaku 2015. (J03)

berjangka panjang sektor swasta sebesar USD101,3 miliar (71,7% dari total ULN swasta). ULN sektor swasta terutama terarah pada lima sektor ekonomi, yaitu sektor keuangan (pangsa 26,5% dari total ULN swasta), sektor industri pengolahan (pangsa 20,4%), sektor pertambangan dan penggalian (pangsa 18,1%), sektor listrik, gas, dan air bersih (pangsa 11,6%), serta sektor pengangkutan dan komunikasi (pangsa 7,6%). Dari kelima sektor itu jelasnya, dua sektor yaitu sektor keuangan serta sektor pengangkutan dan komunikasi mencatat kenaikan pertumbuhan pada Januari 2014 masingmasing sebesar 11,1% (yoy) dan 5,8% (yoy), dari bulan sebelumnya sebesar 5,7% (yoy) dan 4,4% (yoy). Sementara itu, pertumbuhan ULN sektor pertambangan dan penggalian dan sektor

B5

industri pengolahan tumbuh sebesar 20,4% (yoy) dan 11,7% (yoy), lebih lambat dari 26,1% (yoy) dan 12,1% (yoy) pada bulan sebelumnya. Di sisi lain, ULN sektor listrik, gas, dan air bersih masih mengalami kontraksi sebesar 1,7% (yoy). Menurutnya, BI memandang perkembangan ULN itu masih cukup sehat dalam menopang ketahanan sektor eksternal tercermin pada posisi ULN Januari 2014 yang cukup terkendali di level 30,8% dari PDB. “Peningkatan pertumbuhan ULN Januari 2014 antara lain tidak terlepas dari kebutuhan kebutuhan pembiayaan ekonomi, termasuk melalui utang luar negeri.” Ke depan, tegasnya, BI akan terus memantau perkembangan ULN Indonesia, terutama ULN jangka pendek swasta, sehingga tetap optimal mendukung perekonomian Indonesia, jelas Tirta. (J03)

dengan tugas dan kewenangan sebagaimana diatur dalam ketentuan yang berlaku. “Kita mengimbau kepada masyarakat agar senantiasa berhati-hati dan segera melaporkan kepada yang berwenang apabila ada hal-hal yang mencurigakan,” jelasnya. Sementara itu, pengamat ekonomi Sumut Gunawan Benjamin mengatakan, dalam kasus deposito palsu di Bank Sumut yang dilakukan oleh oknum pegawainya, tentu akan menurunkan kepercayaan nasabah, namun bila nantinya Bank Sumut dinyatakan tidak bersalah, kepercayaan masyarakat akan kembali membaik. “Wajar, bila kepercayaan masyarakat terhadap suatu bank akan turun akibat ulah salah satu oknum. Tetapi itu akan berbalik naik nantinya bila Bank Sumut dinyatakan tidak bersalah,” ujarnya. Namun, katanya, dalam kasus ini, dia menilai, posisi Bank Sumut lebih kuat, karena SOP-nya tidak diikuti oleh nasabah yang diakibatkan rayuan imbal hasil yang tinggi oleh oknum pegawai tersebut. Terkait dengan pertanggungjawaban bank, Gunawan mengatakan, itu perlu dicari kebenarannya, karena Bank Sumut tidak menerima uang yang disetorkan oleh nasabah yang menjadi korban. “Terkait dengan uang nasabah yang digelapkan oleh oknum karyawan Bank Sumut, saya menilai pertanggungjawaban Bank Sumut tentunya melaporkan oknum pegawai tersebut ke polisi dan bisa memberhentikannya atau menjadi mediasi bagi penyelesaian masalah ini,” ujarnya. (m41)

Pertumbuhan Kredit 17 Persen Sinyal Perlambatan Ekonomi Berlanjut MEDAN (Waspada): Pertumbuhan kredit yang ditargetkan hanya akan tumbuh 17 persen pada tahun ini memberikan sinyal bahwa perlambatan ekonomi terus berlanjut. Kebijakan moneter ketat dengan mempertahankan BI rate di level 7,5 merupakan salah satu faktor melambatnya pertumbuhan kredit perbankan. Hal tersebut juga ditambah dengan prinsip kehati-hatian perbankan dalam menyalurkan kredit akibat potensi memburuknya NPL (kredit macet) yang disebabkan iklim investasi di tahun ini tidak jauh berbeda dari tahun sebelumnya. “Hal ini merupakan hal yang lumrah terjadi, di saat terjadi perlambatan pertumbuhan ekonomi maka di saat itu penurunan permintaan kredit juga akan mengalami penurunan,” kata pengamat ekonomi dari IAIN Sumut Gunawan Benjamin, kemarin. Di sisi lain, katanya, kondisi ini akan mempersulit dunia usaha khususnya pengusahapengusaha kecil yang tidak memiliki posisi tawar dalam permintaan kredit. Bunga yang dibebankan terasa semakin mencekik, ditambah lagi kondisi daya beli masyarakat kita yang memang melemah akibat perlambatan ekonomi nasional secara keseluruhan. “Sehingga bila terjadi kenaikan BI rate akan banyak menyulitkan pengusaha kecil menengah yang memang memiliki beban bunga kredit yang lebih tinggi dibandingkan pengusaha-pengusaha besar (korporasi). Kecuali pengusaha yang dimaksud menerima kredit subsidi sepeti KUR (Kredit Usaha Rakyat),” ujarnya. Namun secara keseluruhan tingginya BI

rate saat ini memang akan memukul para pengusaha. “Penurunan BI rate dalam jangka pendek bagaikan sebuah keniscayaan mengingat kita tengah tertekan di sektor keuangan yang perlu didukung oleh BI rate yang tinggi agar tidak terjadi pembalikan modal,” pungkasnya. Sebelumnya, Kepala Perwakilan BI Wilayah IX Sumut-Aceh Difi A Johansyah mengatakan, target pertumbuhan kredit tahun ini hanya 17 persen. “Ekonomi memang masih melambat. Karena itu, bank harus berhati-hati agar kesehatan bank tetap terjaga. Jangan sampai terjadi NPL melonjak,” katanya. Menurutnya, di Sumut, pertumbuhan penyaluran kredit juga akan ditahan, apalagi tahun 2013, kredit sudah tumbuh cukup tinggi yakni 18,56 persen menjadi Rp156 triliun. “Meski pertumbuhan kredit di 2013 itu sudah menurun dari 2012 yang tumbuh hingga 23,49 persen, tetapi dinilai masih cukup tinggi sehingga perlu di rem juga,” ujarnya. Disebutkannya, perkembangan perbankan biasanya memang selalu mengikuti pertumbuhan ekonomi. “Karena itu, ketika ekonomi melambat, maka bank juga harus mengimbanginya sehingga penyaluran kredit tak akan menimbulkan masalah kredit macet yang akhirnya merugikan bank dan perekonomian,” kata Difi. Menurutnya, penahanan kredit dilakukan ke semua jenis kredit mulai dari kredit modal kerja, kredit investasi, kredit konsumsi dan kredit usaha mikro kecil dan menengah (UMKM). (m41)

PTPN III Bantu 98 UKM Rp 3 Milyar MEDAN (Waspada): Periode triwulan pertama 2014, PTPN III menyalurkan pinjaman modal bergulir melalui dana kemitraan sebesar Rp 3.090.000.000,- belum lama ini di Sei Karang, Galang, Deli Serdang,untuk 98 orang mitra binaan yang tersebar di berbagai kabupaten al. dari Medan, Deli Serdang, Sergei, Tebing Tinggi, Labuhanbatu, Tapanuli Selatan, Karo dan Dairi. Kepala Bagian KBL Irwadi Lubis mengatakan jumlah secara kumulatif penyaluran dana kemitraan sampai dengan saat ini mencapai Rp 187.518.552.113,- dengan jangkauan mitra binaan sebanyak 6.002 orang di seluruh Sumatera Utara. Ia juga menambahkan bahwa dari 98 orang mitra binaan yang dibantu di periode pertama tersebut, 57 orang merupakan mitra binaan yang baru dan 41 orang mitra binaan lanjutan. Direktur SDM PTPN III Harianto berharap mitra binaan benarbenar mampu memanfaatkan pinjaman modal untuk pengembangan usaha, sehingga UKM bisa eksis di tengah-tengah masyarakat. Sofiyan, pengrajin sangkar burung, dari Desa Nagari Bosar, Kec. Panombahan Panei, Simalungun mengucapkan terima kasih kepada PTPN III yang telah memberi kesempatan kali kedua baginya untuk menerima pinjaman lanjutan untuk mengembangkan usahanya yang mulai maju. Sementara Enceng Kardidi, pengusaha bakso tahu goreng dari Desa Cikampak, Aek Batu, Labuhabatu Selatan sebagai mitra binaan awal, sangat senang terpilih menjadi bagian dari UKM untuk dibantu karena bisa mendorong usahanya berkembang. “Terima kasih PTPN III semoga semakin jaya dan maju,” katanya senang. (m05)

Waspada/Ist Direktur Keuangan Pelindo I Farid Lufti menerima cendera mata dari Kantor Pelayanan Pajak.

BPN Simalungun Percepat Terbitkan Sertifikat UKM

Pelindo I Sosialisasikan Pengisian SPT Tahunan PPh

SIMALUNGUN,(Waspada): Kantor Badan Pertanahan Nasional (BPN) Kabupaten Simalungun, melakukan percepatan penyelesaian penerbitan sertifikat tanah milik pelaku Usaha Kecil dan Menengah (UKM). Menurut Kepala kantor (Kakan) BPN Kabupaten Simalungun, Asli Dakhi,SH.MH, melalui kepala seksi Pengendalian dan Pemberdayaan, Yandi Kesuma,BSc, kepada Waspada,Selasa (18/ 3) mengatakan, percepatan penerbitan sertifikat itu, bertujuan untuk mendukung upaya masyarakat pelaku UKMK dalam hal meningkatkan usahanya. Yandi Kesuma mengakui, lancarnya pelaksanaan penyelesaian penerbitan sertifikat tanah milik UKM tersebut juga mendapat dukungan maksimal dari Dinas Koperasi Simalungun yang terus bekerjasama untuk menyelesaian tahapan penerbitan sertifikat. Menurut kepala seksi UKM Dinas Koperasi Simalungun, Janiari Saragih, ketika ditemui di kantor BPN di Simalungun, mengatakan , dengan sertifikat tanah itu nantinya para pelaku UKM dapat memperoleh bantuan modal kerja dari pihak perbankan. Untuk tahun ini, kantor BPN Simalungun akan kembali menerbitkan 100 bidang tanah bagi pelaku UKM.Dan tentang jatah 100 sertifikat itu sendiri, Saragih menyebutkan, masih jauh dari kurang,apalagi jika dilihat dari banyaknya pelaku UKM yang mengajukan permohonan ikut dalam program pemerintah mensertifikatkan tanah tanah pelaku UKM di Simalungun..(crap/ c.16)

MEDAN (Waspada) : PT Pelabuhan Indonesia I (Persero) bekerjasama dengan Tim Kantor Pelayanan Pajak Pratama Medan Belawan mengadakan sosialisasi pengisian SPT Tahunan PPhWajib Pajak Orang Pribadi melalui e-Filing kepada pegawai, Senin (17/2/2014). Direktur Keuangan Pelindo I, Farid Luthfi, dalam sambutannya mengharapkan melalui sosialisasi ini, diharapkan pegawai Pelindo I dapat menyampaikan SPT tahunan melalui media elektronik sehingga lebih mudah, murah dan cepat sesuai ketentuan. Farid Luthfi lebih lanjut menjelaskan, selama ini Pelindo I merupakan perusahaan yang taat pajak. Seluruh pegawai Pelindo I juga taat pajak, mereka membayar pajak yang dipungut perusahaan secara kolektif. Pegawai Pelindo I wajib mempunyai NPWP (Nomor Pokok Wajib Pajak),” kata Farid. “Melalui sosialisasi ini, diharapkan setiap pegawai bisa mengisi e-filing sendiri dan memberikan sosialisasi ke teman-teman yang lain,” harap Farid. Mewakili Tim Kantor Pelayanan Pajak Pratama, Sudjarwo, mengapresiasi peserta

sosialisasi yang telah mengikuti sosialisasi dan atas kepatuhannya membayar pajak. “Pajak adalah untukmu dan bagimu. Membayar pajak merupakan wujud dukungan kita untuk mensukseskan pembangunan bangsa dan Negara,” kata Sudjarwo. Sudjarwo menuturkan, dari APBN Tahun 2014 sebesar Rp 1.842,5 Trilyun, Dirjen Pajak dituntut untuk bisa membantu sebesar Rp 1.110 Trilyun. “Ini tentu menjadi pekerjaan tersendiri bagi Dirjen Pajak karena rasio kepatuhan Wajib Pajak Orang Pribadi (WP OP) di Indonesia masih rendah pada kisaran 14,7 %. Maka, kita sebagai warga Negara Indonesia, dengan membayar pajak kita turut menusukseskan pembangunan bangsa dan negara ,” ungkapnya. Sementara ACS Humas Pelindo I, M. Eriansyah menambahkan sebanyak 100 pejabat struktural dan pegawai dari Kantor Pusat Pelindo I, Cabang Belawan dan Belawan International Container Terminal (BICT) memenuhi ruang Selat Malaka Kantor Pusat untuk mendengarkan pemaparan langsung dari Tim Kantor Pelayanan Pajak Pratama.(m35)


Opini

B6

WASPADA Rabu 19 Maret 2014

TAJUK RENCANA

Koalisi Parpol Islam Bisa Gagalkan Jokowi

B

elum ada satu Capres pun yang pasti tampil di gelanggang Pilpres karena masih menunggu hasil Pemilu 9 April nanti, namun tiga nama sudah santer disebut-sebut bakal memperebutkan kursi RI-1 pada Pilpres Juli 2014. Ketiganya Jokowi (Joko Widodo), Aburizal Bakrie, dan Prabowo Subianto. Siapa lagi? Kemungkinan tersisa satu kursi lagi, dan itu hanya mungkin terwujud bila kelima parpol Islam dan berbasis Islam bersatu: PKB, PPP, PKS, PAN, dan PBB. Bisa disebut koalisi poros tengah jilid-2. Namun kemungkinan poros tengah terbentuk pada Pilpres 2014 terbilang kecil, mengapa? Persyaratan menjadi Capres harus didukung 25 persen suara sah parpol. Sepertinya tidak sulit bagi PDIP untuk mewujudkannya. Tapi, berat dan harus kerja keras buat Aburizal Bakrie (Golkar) dan Prabowo (Gerindra). Keduanya memerlukan bantuan dandukungandariparpollainnya.KalauyangdiambildanmaubergabunghanyaDemokrat, Nasdem, PKPI tak masalah buat poros tengah. Hemat kita, kans terbesar ada di tangan Jokowi. Hampir semua survei menjagokan Gubernur DKI Jakarta itu bakal memenangkan Pilpres. Ini pula yang membuat Ketua Umum DPP PDI Perjuangan Megawati Soekarnoputri akhirnya bersedia melepas Intisari: tradisi trah Soekarno maju dalam Pilpres. Putusan rasional. Sebab, kalaupun dipak‘Islam banyak dalam jum- sakan Mega atau Puan dipastikan kalah. tingkat elektabilitas Megawati dan lah, lemah dan tercerai- Sebab, putrinya saat ini merosot tajam. Mega berai karena sarat kepen- sudah tiga kali gagal merebut kursi RI1 dan Puan Maharani masih hijau di petingan duniawi’ merintahan. Tentu saja berat buat Megawati memberi tiket Capres kepada Jokowi karena mantan Walikota Solo itu bukan titisan atau tidak punya benang merah dengan trah Soekarno. Jadi, putusan mencalonkan Jokowi sangat positif dalam konteks demokrasi, namun bisa merusak sistem kaderisasi dalam kepemimpinan trah Soekarno di jajaran elite partai berlambang banteng gemuk moncong putih. Upaya mempertahankan trah Soekarno pun berakhir pada Pemilu 2014 dan memang tidak ada kader dari anak dan cucu Soekarno yang berkualitas dan menonjol menjadi Capres. Jadi, beruntung PDIP punya Jokowi. Dengan kuatnya popularitas dan elektabilitas Jokowi sepertinya tidak sulit buat tokoh yang dikenal rajin blusukan itu untuk memenangkan Pilpres mendatang. Sifatnya yang sederhana, tidak menjaga imej di hadapan rakyat, cenderung berpihak pada rakyat kecil membuat Jokowi menonjol dibandingkan tokoh-tokoh lainnya. Dibanding Aburizal Bakrie dan Prabowo yang cenderung pemain lama Jokowi disenangi karena tergolong pemimpin muda masih bersih. Sayangnya, Jokowi terlalu patuh dan taat seperti kerbau dicucuk hidung pada Megawati dan PDIP sehingga menimbulkan keraguan di kalangan masyarakat. Jangan-jangan setelah terpilih menjadi Presiden RI periode 2014-2019 Jokowi takluk di bawah intervensi dari elite partai maupun sponsor di belakangnya. Dan kalau melihat gerak-gerik Jokowi selama ini, pakai cium tengan kepada Megawati dan selalu menyatakan siap atas perintah Megawati, bahkan dibawa ke Blitar menziarahi makam Bung Karno pun dia bersedia sekalipun harus meninggalkan tugas dan warganya yang lagi ditimpa musibah banjir besar. Melihat dukungan masyarakat begitu besar pada Jokowi, Pilpres bisa satu putaran, kecuali muncul Capres poros tengah. Sebab, hanya koalisi parpol Islam dan berbasis Islam saja yang diyakini dapat mengalahkan dan merontokkan ambisi besar Jokowi dan tim suksesnya. Sudah menjadi tradisi kalau Islam bersatu menjadi kuat. Kelemahan parpol dan ormas Islam, termasuk umat Islam selama ini tidak mau bersatu, dan selalu mengklaim dirinya paling benar, paling hebat. Mudah-mudahan koalisi parpol Islam atau dikenal dengan sebutan poros tengah –walau sangat berat— bisa terwujud. Lihat saja, PKB sudah menyatakan siap bergabung dengan PDIP, begitu juga dengan PKS dan PAN karena ingin duduk di pemerintahan. Begitulah kondisinya. Umat Islam hanya banyak dalam jumlah, namun lemah dan tercerai-berai dalam memperjuangkan kebenaran dan keadilan karena sarat dengan kepentingan duniawi . Ukhuwah islamiyah hanya lips service alias tameng.+

APA KOMENTAR ANDA SMS 08116141934

Faks 061 4510025

Facebook Smswaspada

+628126501779 Aneh&mengherankan! Parpol2 yg dlm 10 thn terakhir jelas2 jd ‘gudangnya koruptor’ malah diberi ranking teratas! Apa lembaga surveynya yg ngawur apa respdn tolol! +6281376310770 Nampaknya PEMKO MEDAN tidak berdaya menghadapi perobahan yg DINAMIS +6285361724944 Asslkm .. Pak SOEKIRMAN (BUPATI SERGAI) apa tidak ada CONTROL dlm pemberian IZIN terhadap usaha ALFA MART & INDO MARET sehingga menjamur hampir setiap KM disepanjang jalansium SERGAI. seharusnya Bapak memikirkan nasib para UKM lemah dan tidak terlalu membela para KAPITALIS/KONGLOMERAT dg memberi SIUP/ SITU/TDP perusahaan tsb. kami para UKM lemah merasa terpinggir dg kehadiran perusahaan tsb. Tolong kami pak BUPATI krn kami punya tanggung jawab ke BANK. Terima kasih LPPLH SERGAI +6281263504283 PLN skarang ini tak ubah nya seperti momok menakut kan bagi warga sumut...by juna.

Pemilu Dan Penggunaan Uang Oleh Dr Drs H.Ramli Lubis, SH, MM Pemilu dapat berlangsung dengan lebih berkualitas apabila penggunaan uang sesuai dengan aturan yang berlaku.

T

ahapan kampanye dalam Pemilihan Umum (Pemilu) 2014 telah dimulai kemarin. Namun di hari pertama kampanye, di Medan tampaknya tidak ada partai politik yang memanfaatkan jadwal yang ditetapan Komisi Pemilihan Umum (KPU) untuk kampanye model rapat umum. Sepertinya demikian juga dengan di hari kedua masa kampanye, belum ada partai politik yang menggelar kampanye akbar. Kalaupun ada partai politik yang memanfatkanjadwalkampanyeitu,dilakukandengan kegiatan yang cenderung tidak menerahkan massa. Seperti pawai kendaraan ataupun pertemuan-pertemuan terbatas. Adabeberapaalasan,yangmungkinmelatari kondisi ini. Alasan yang juga mungkin adalah bahwa untuk kampanye pengerahan massa dibutuhkan dana yang tidak sedikit, sehingga partai politik merasa “sayang” untuk mengeluarkan uang yang terlalu banyak. Mungkinkan ini menandakan bahwa kecerdasan politik masyarakat juga partai politik sudah meningkat—karenanya tidak merasa perlu dilakukan pengerahan massa yang cenderung hura-hura? Tapi tentu saja tidak serta merta kualitas Pemilu2014menjadimeningkat—meskitidak ada pemanfaatan kampanye rapat akbar. Karena uang yang disebutkan di atas sebagai alasankondisisepinyakampanye,merupakan

+6281264855546 Wahai OKNUM2 BE GUNDAL Perusak Lis trik Negara.Semoga baik secara moriel dan matriel ALLAH SWT tidak MELAKNAT, memberi MALAPETAKA mem beri AZAB kepada ke lian selagi sedang hidup. Sekiranya di LAKNAT,di AZAB dan dapat MALAPETAKA wajar.Karena sudah berapa lama kami golongan RAKYAT BIASA TERANIAYA akibat ULAH kelian selalu mematikan Listrik. Sekiranya di beri ALLAH SWT, ta hankanlah. Trim’s WASPADA. +6283194817681 SYUKRON ‘AL ALLAH , BATUK G . MARAPI di Suma tera Barek kira nya hanya seke jap sajo . “Yaa , ALLAH , ampuni lah sanak-suda ro kami nan ber muqiem di leren g G.Marapi , wa ghfierlana , war khamna ........... wahaiTuhan ka mi nan Maha Pen gampun lagi Mah a Penyayang ! # all moslem solida rity ~ kr.sikame ng # +6282162797556 YTH DPRD KOTA MEDAN DAN GUBSU LAMPU HIDUP CUMA 2 JAM SATU HARI. APA MASARAKAT BAYAR. HAI SAUDARAKU MASARAKAT KOTA MEDAN JGN MAU BAYAR LAMPU. MARI KITA BE RSATU. SELURUH SUMUT. KITA UDH BOSAN DI BODOH2 HIN. MARI KITA BERSATU SEMUA. NYA. Wassalam. UCOK +6283194817681 DI SOEMATER A TIMOER , terse butlah dua Gunu ng yang tersoho r ; G.Sinabung d an G.Sibayak . Perbandinganny a dengan yang d i Sumatera Bare k ; Sinabung ber banding lurus d engan G.Marapi , dan G.Sibayak berbanding luru s dengan G.Sing galang di Sumat er Barek . Sibay ak tenang-tena ng saja , tidak t erpancing oleh force = gaya Sin abung . Demikia n pula dengan Si nggalang , indak tapancing do , d engan aksi G.Ma rapi......! # t.t.d. kr.sikameng # +6285358179045 As kpd Bpk Bupati aceh Tamiang tlg Dinas P U untuk perbaiki jln yg berlobang di jembatan smpg Kapal sdh bnyak mkn korban jln lgsa kwl smpang +62811655150 Pegawai PLN diberhentikan karena tdk bersih lingkungan.Bagaimana kondisi skrg????? +6282166180203 Nyanyian anas urban dri balik jeruji sudah basi,anas contoh manusia munafiq contoh elit politik yg tak memiliki wibawa sama sekali,pernah brjanji bila tek sana colek sini yg katanya kalo gk nyolek gk asyik,dunia politik sama juga dgn main catur kalau gk ngatur tentu gak asyiik +6287869555829 Buat PLN..jangan kau buat bertambah angka musibah kebakaran meningkat karna pemadaman yg kau buat.sebagian besar pelanggan mu hanya mampu beli lilin.bukan genset!!! +6281361593307 Satu kata buat PLN,aq sayang padamu KURANG AJAR +6285923436494 kenapa sih tiap malam mati lampu +6285260464487 Makanya jangan suka korupsi mau enaknya jA gak mikir pelajar n org miskin.katanya kota metro politan tapi kenyataan kok mirip desa pedalaman tanpa listrik ya!!!

persoalan krusial dalam setiap Pemilu. Devi Darmawan(2012)menyebutkanbahwaaspek tindak pidana Pemilu yang berkaitan dengan availability uang menyentuh setiap tahapan. Mulai dari perencanaan program dan anggaran, serta penyusunan peraturan pelaksanaan penyelenggaraan Pemilu hingga pengucapan sumpah/janji anggota para anggota dewan. Untuk menjamin Pemilu yang fair dan kesetaraan dalam pelaksanaannya memang diperlukan aturan main. Pembatasan dana kampanye (limitation/campaign cap) adalah salah satu caranya—sekaligus mengeliminir praktek money politics. Ini tentu saja strategis, karena memang menggunaan uang yang banyakdantakterkendalidalamPemilumerupakan suatu hal yang krusial. Begitu krusialnya masalah uang dalam Pemilu ini sehingga Undang-undang No.8 tahun 2012 tentang Pemilu DPR, DPD, dan DPRDmemuatbanyakhalterkaithaltersebut. UU ini mengatur beberapa bentuk tindak pidana Pemilu. Misalnya dalam Pasal 297 yang menyebutkan setiap orang yang dengan sengaja melakukan perbuatan curang untuk menyesatkan seseorang, dengan memaksa, dengan menjanjikan atau dengan memberikan uang atau materi lainnya untuk memperoleh dukungan bagi pencalonan dalam Pemilu. Pasal ini secara jelas menunjukkan bahwa terlarang secara hukum untuk memengaruhi orang lain dalam Pemilu

dengan cara-cara yang tidak benar. Pasal 301 ayat (1) Setiap pelaksana kampanye Pemilu yang dengan sengaja menjanjikan atau memberikan uang atau materi lainnya sebagai imbalan kepada peserta kampanye Pemilu secara langsung ataupun tidak langsung. Pasal ini mengancam kepada pihak yang memberikan uang ataumateribahkanmenjanjikanmemberikan akan terkenal delik pasal hukum ini. Pasal 301 ayat (2) Setiap pelaksana, peserta, dan/atau petugas kampanye Pemilu yang dengan sengaja pada masa tenang menjanjikan atau memberikan imbalan uang atau materi lainnya kepada pemilih secara langsung ataupun tidak langsung. Pasal ini memberi penekanan pada pemberian uang atau materimasatentangsebagaiwaktuyangbiasanya terjadi “serangan fajar” adalah terlarang dan melawan hukum. Pasal 301 ayat (3) Setiap orang yang dengan sengaja pada hari pemungutan suara menjanjikan atau memberikan uang atau materi lainnya kepada pemilih untuk tidak menggunakan hak pilihnya atau memilih peserta Pemilu. Pasal ini menekankan waktu pemungutan suara juga adalah waktu terlarang untuk memberikan sesuatu baik uang ataupun materi kepada pemilih, baik untuk menggunakan hak pilihnya atau tidakk menggunakan hak pilihnya. Pasal 303 ayat (1) Setiap orang, kelompok, perusahan, dan/atau badan usaha nonpemerintah yang memberikan dana kampanye Pemilu melebihi batas yang ditentukan. Pasal ini mengarah kepada pihak-pihak yang memberikan bantuan kampanye kepada partai politik secara berlebihan. Kondisi yang menjurus money politics dan “politik dagang

sapi” ini diatur pelarangannya dalam pasal ini. Pasal 303 ayat (2) Setiap peserta Pemilu yang menggunakan kelebihan sumbangan, tidak melaporkan kelebihan sumbangan kepada KPU, dan/atau tidak menyerahkan kelebihan sumbangan kepada kas negara paling lambat 14 (empat belas) hari setelah masa kampanye Pemilu berakhir. Untuk menegakkan aturan ini, KPU harus pro aktif menelusuri sumber dan partai politik yang diyakini sebagian kalangan lebih banyak dari yang dilaporkan. Dari aturan UU tersebut jelas terlihat betapa penggunaan uang yang tidak sesuai ketentuan dianggap sebagai hal yang penting untuk ditertibkan. Bahwa Pemilu dapat berlangsung dengan lebih berkualitas apabila penggunaan uang sesuai dengan aturan yang berlaku. Namun nyatanya persoalan uang masih menjadi salah satu persoalan krusial dalam sistempendanaanpartaipolitikdankampanye dalam Pemilu—karena minimnya transparansi. Aturan yang tertera dalam UU yang memungkinkan menjadi pedoman penegakkan hukum—sampai saat ini belum terlihat dipergunakan secara luas dan tidak diimplementasikan dengan tegas. Penutup Tidak adanya pemanfaatan masa kampanye bagi partai politik bukan berarti politik uang (money politics) telah tereduksi. Karena bahkan semakin santer saja pihakpihak tertentu yang tengah bersiap-siap melakukan serangan fajar. Penulis adalah Mantan Wakil Wali Kota Medan.

Pil Pahit Golput Oleh Ilham Mirzaya Putra Sangat disayangkan, jika kita masih menjadikan Golput sebagai pilihan. Karena berarti mempertaruhkan masa depan negara.

B

iasanya putih identik dengan suatu yang baik, putih berarti suci atau murni.Dalamduniakesehatanputih berartisteril,sementaradalamdunia bangunan,putihmampumenimbulkankesan minimalis, kenyamanan dan ketentraman. Tapi, semua hal ini tidak berlaku dalam politik. Golongan putih yang sering disebut-sebut dalam dunia politik, justru memberikan ancaman yang berarti bagi negara. Memang benar, golongan putih (Golput) tidakmemilikipengaruhberartibagiPemilihan Umum(Pemilu),bahkansampaimeng-ganggu keabsahan Pemilu. Meskipun jumlah Golput lebih besar dibanding jumlah pemilih, tetap saja Pemilu dinyatakan sah, begitu ujar direktur Sigma, Said Salahuddin.Yang paling penting dari Pemilu, saya kira bukan soal sah atau tidaknya, namun lebih pada hasil yang diperoleh untuk negara. Ada kondisi yang cukup mengherankan. Badan Pengawas Pemilu (Bawaslu) menemukan adanya sekelompok orang yang terang-terangan menyatakan siap menerima serangan fajar. Daripada Golput, lebih baik menerima durian runtuh di tahun politik. Sementara itu Badan Intelijen Negara (BIN) menemukan indikasi adanya kelompok yang mendorong masyarakat untuk Golput. Jelas, keberadaankelompok-kelompokinimerupakan ancaman bagi penyelenggaraan Pemilu yang diharapkan berlangsung aman dan damai. Ancaman ini akan semakin menjadijadi jika dibenturkan dengan banyak pihak yang menyerukan anti Golput. Jika kita melihat sejarah pelaksanaan Pemilu, maka kita akan melihat grafik Golput yang senantiasa meningkat dari tahun ke ta-

hun. Pada Pemilu Legislatif (Pileg) tahun 1999 angka Golput 10,2 persen, 2004 sebesar 23,3 persen, dan pada tahun 2009 menjadi 29 persen. Sungguh, angka yang terbilang cukup fantastis. Bahkan dikabarkan di beberapa media, bahwa Golput-lah pemenang Pemilu 2009. Ironis. Kondisi Masyarakat Kinerja dan citra anggota legislatif serta institusi pemerintahan yang dinilai buruk turut berkontribusi meninggikan angka Golput. Krisis kepercayaan masyarakat kepada anggota legislatif dan pemerintahan sudah semakin meluas. Banyak masyarakat mengatakan hal sama, “hanya janji melulu”. Selain itu, banyak masyarakat yang belum bisa menentukan pilihannya karena begitu banyak pilihan yang muncul. Belum lagi materi yang diberikan berbagai partai juga saling berebut tempat di benak pemilih. Hal ini juga turut menyumbang meningkatnya grafik Golput. Kondisiinisamahalnyasepertimemilihjodoh, mau tidak mau ya harus memilih. Tinggal mana yang memberikan harapan dengan kepastian yang tinggi, karena ini menyangkut masa depan. Tidak hanya itu, konflik Daftar Pemilih Tetap (DPT) yang terjadi setiap kali Pemilu, hingga undangan tidak sampai ke pemilih juga menjadi penyumbang angka Golput. Ditambah lagi golongan pesimis yang menyatakan,”siapapun yang dipilih sama saja, Indonesia terus akan begini, rakyat terus akan sengsara”. Kondisi masyarakat sudah diambang batas keikutsertaan Pemilu, tentu harus adadoronganberbagaipihak,agarmasyarakat mau menggunakan hak suaranya.

Resiko Golput Golput bukan merupakan pilihan, kalaupun merupakan pilihan, maka ia pilihan terburuk. Jika diminta untuk memilih, saya yakin tidak ada satupun di antara kita mau memilih pilihan terburuk. Fatwa Majelis Ulama Indonesia (MUI) telah jelas menyatakan bahwa Golput haram. Artinya, semakin mempertegas kita bahwa ia bukan pilihan. Sangat disayangkan, jika kita masih menjadikan Golput sebagai pilihan. Karena berarti mempertaruhkan masa depan negara. Banyaknya Golput mengharuskan partai politik memperketat penjagaan suara, karena ketiadaan suara masyarakat pemilih berpotensi diselewengkan dalam bentuk penggelembungan suara. Alhasil, mereka yang berkepentingan, akan melakukan money politics atau kecurangan lain demi mendongkrak suara mereka. Golputlebihdekatpadapilihanemosional. Karena mereka yang Golput biasanya kecewa dengan perilaku para pemimpin negera, pesimis terhadap masa depan negara, bahkan mencapai titik apatis. Slogan ‘Pemilih Cerdas, MemilihPemimpinBerkualitas”sudahcukup mewakili hubungan antara pemilih dan yang dipilih. Bahwa pemilih harus lebih mengutamakan rasionalitas untuk memilih. Pemilih harus mampu melihat mana pemimpin berkualitas berdasarkan kepribadian, latar belakang, dan track record. Koruptor beserta pendukungnya menginginkan tingkat Golput yang tinggi. Karena Golput berarti memperbesar peluang mereka untuk duduk sebagai pemimpin negara. Hal ini harus dijadikan refleksi, bahwa setiap kita harus menggunakan hak suara saat Pemilu nanti.Setiapkitaharusmenjadipemilihcerdas agar para koruptor tak lagi duduk sebagai pemimpin negara. Setiap kita harus menjadi pemilih berintegritas, agar para pemimpin negeri benar-benar terseleksi, tidak asal jadi. Pil pahit Golput jangan lagi ditelan oleh negara. Cukuplah pil pahit ini menjadi kenangan pahit yang membelajarkan. Harapan

harus terus dinyalakan, meskipun kenyataan hari ini sudah padam. Tingkat Golput yang biasanyaterjadiharusditekan,hinggamampu mendefenisikan hasil Pemilu 2014 yang sebenar-benarnya dan sebaik-baiknya. Penulis adalah Sekretaris Umum Kesatuan Aksi Mahasiswa Muslim Indonesia (KAMMI) Medan, Alumni S1 Unimed.

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau email: opiniwaspada@yahoo.com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata dan kartu pengenal (KTP) penulis. Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di media manapun. Isi tulisan menjadi tanggung jawab penulis.

SUDUT BATUAH * Mega: Tak perlu berkata menangi Pemilu - Banyak cakap, tambah dosa ya mbak! * ARB: Bangun Indonesia mulai dari desa - Di kota macet! * Prabowo: Ambil uangnya, coblos sesuai hati nurani - Cucok pak, he...he...he Wa

o k D

el


Opini

WASPADA Rabu 19 Maret 2014

B7

Kontroversi Peninjauan Kembali Fenomena “Usman Harun” Sebagai sebuah negara yang memiliki wilayah sangat luas, seharusnya Indonesia memiliki jaringan intelijen yang cukup signifikan baik dari segi jumlah maupun kualitasnya. Hal ini memang sangat diperlukan untuk memantau wilayah NKRI setiap jengkalnya dari infiltrasi asing yang punya maksud tertentu terlebih yang berniat jahat mengkacaukan tatanan keamanan dan ketertiban masyarakat (Kamtibmas). Baru-baru ini kita membaca di media tentang keberatan pemerintah Singapura terhadap penamaan sebuah kapal perang RI dengan nama “KRI Usman-Harun”— dua prajurit KKO TNI-AL di masa era Presiden Soekarno yang ditugaskan menyusup ke Singapura (dahulunya masih bergabung dengan Malaysia) pada masa konfrontasi dengan Malaysia untuk meledakkan bangunan vital di negara itu. Malangnya walaupun berhasil meledakkan sebuah bangunan di Singapura, kedua prajurit tersebut ditangkap tentara Singapura dan akhirnya dihukum gantung sampai mati. Saat ini dari pemberitaan yang kita baca, Singapura telah mengembangkan pertahanannya bekerjasama dengan Isral—merupakan idola bagi Singapura karena dapat eksis di Timur Tengah walaupun dikelilingi musuhmusuhnya negara-negara Arab. Pada awal tahun 1990-an saja dari pemberitaan di surat kabar Straight Times, Singapura telah mengklaim dirinya sebagai negara yang memiliki Angkatan Laut terbaik di ASEAN, yang berarti TNI-AL berada di bawahnya. Memang kita tidak usah terburu-buru mempraduga bahwa meledaknya gudang amunisi Komando Pasukan Katak (Kopaska) TNI-AL di Pondok Dayung, Pelabuhan Tanjung Priok, Jakarta Utara, Rabu (5/3) lalu kemungkinan akibat dari aksi intelijen asing (baca Singapura) sebagai anti aksi yang dilakukan Usman-Harun silam. Namun kita perlu waspada, karena negara jiran kita yang satu ini dipimpin bukan etnis Melayu yang satu rumpun dengan Indonesia. Sekalipun etnis Melayu merupakan warga asli Singapura namun seperti yang pernah dikatakan mantan Presiden Habibie, yang sangat dikecam oleh pihak Singapura, bahwa orang Melayu di Singapura tidak boleh menjadi tentara. Itu memang benar, Habibi tidak mengada-ada. Karena seperti yang dikatakan PM Lee Hsien Loong (anak mantan PM Lee Kwan Yew), orang Melayu tidak boleh jadi tentara karena lebih cinta kepada agama (Islam) ketimbang kepada negaranya (Singapura). Bekerjasama dengan Israel dalam membangun pertahanannya, kini diduga Singapura telah memiliki pesawat jet tempur yang cukup siginfikan jumlahnya dan angkatan laut yang kuat—krena negara mereka tidak memiliki wilayah luas, hanya sebuah pulau yang bernama Tumasik (Temasek) sehingga kurang mementingkan kekuatan angkatan darat. Kemudian ada berita yang kita dengar di Singapura telah dibangun bunker-bunker untuk tempat perlindungan rakyatnya jika ada serangan dari luar. Tapi, cukup menjengkelkan jika mereka menyangsikan Indonesia mau menyerang, yang bisa terjadi nanti malah sebaliknya, mereka yang menyerang Indonesia. Karena itu kita perlu waspada sejak dini terhadap infiltrasi intelijen Singapura yang mungkin saja sudah banyak berkeliaran di negeri ini. Kita harus jaga objekobjek vital pertahanan seperti gudang amunisi, lokasi radar, gudang persenjataan, lapangan terbang dan lain sebagainya. Selain itu pihak imigrasi harus ketat mengawasi orang-orang yang masuk ke Indonesia, khususnya pihak Imigrasi Bandar Udara Kualanamu dan Pelabuhan Belawan. Karena kalau kita lengah, intelijen asing akan bebas datang dan pergi untuk “menyurvei” lokasi pertahanan TNI beserta elemen pendukung pertahanan-keamanan dan satu saat nanti kita bisa terperanjat kalau objek vital pertahanan itu ternyata dilumpuhkan intelijen asing. Satu hal lagi tentang negara jiran Singapura, beberapa tahun silam kita dengar negara itu melatih sejumlah pria muda Indonesia diberi bekal pendidikan kemiliteran. Bisa saja para pria muda itu (diduga etnis China) berasal dari Medan, Riau, Jakarta, Kalimantan Barat dan lainnya di seantero wilayah Indonesia. Ini bukan masalah sepele, karena mereka yang dilatih itu nanti dapat mendukung ambisi Singapura yang memiliki nafsu penjajah serupa Israel untuk mencaplok wilayah Indonesia. Maka kalau tidak mulai dari sekarang, kapan lagi kita harus waspada akan hal-hal yang berbahaya ini. Nama dan alamat ada pada redaksi.

Sekali Lagi Tentang Nama Jl. Soekarno-Hatta Warga kota Medan khususnya dan Masyarakat Sumatera Utara umumnya, selamat pagi buat kita semua. Terkait pemberian atau penganugrahan nama Jalan Soekarno-Hatta di daerah Sumatera Utara, dalam surat saya sebelumnya, meminta supaya usulan anggota DPD Sumut yang mengusulkan Jalan Gagak Hitam dijadikan menjadi Jalan Soekarno-Hatta supaya benar-benar dicermati oleh DPRD dan Wali Kota Kota Medan. Alasan dan pertimbangannya sudah disampaikan. Namun pilihan untuk menggantikan Jalan Balai Kota–sisi Barat lapangan Merdeka—kalau di Jakarta keliling lapangan Monasnya diimbuhi dengan nama jalan; Merdeka Timur, Merdeka Barat, Merdeka Utara dan Merdeka Selatan. Atau pilihannya dibuat mulai dari batas akhir jalan Sisingamangaraja—berbatasan dengan Deliserdang—hingga simpang kayu besar menuju bandara KNIA. Tidak demikian menurut Seniman senior kita Pak Ki Heru Wiryono—selaku ketua Legiun Veteran (angkatan 45) Medan—ketika saya mengunjungi beliau dan mendiskusikan mengenai hal tersebut. Menurut pandangan beliau, setuju dengan alasan untuk kita menolak Jalan Gagak Hitam kalau mau digantikan menjadi jalan Soekarno-Hatta. Tetapi pilihan penggantinya bukan di kedua jalan yang sudah disebukan di atas. Pihannya adalah, supaya untuk Jalan Soekarno-Hatta ditempatkan di sepanjang jalan tol dari Belawan hingga ke tol menuju kota Tebingtinggi. Sedangkan pandangan dari sejarawan Sumut Bapak Ichwan Azhari—akademisi dari Pussis Unimed—melalui percakapan dengan email dan SMS,beliau berpandangan sama, tidak cocok di Jalan Gagak Hitam. Namun mengkritisi supaya pembahasannya tidak seputar tokoh-tokoh nasional saja. Sementara tokoh daerah Sumut terbaikan. Lalu mempertanyakan mana Jalan Mr. Mohd Hasan Pahlawan Nasional pembaca naskah proklamasi di lapangan Merdeka. Mana nama Jalan Mr.SM Amin sebagai gubernur pertama yang memimpin Sumut dalam situasi yang sulit ? Beliau sampaikan lewat SMS-nya kepada saya. Kalau menurutnya, saat ini—kerja sebulan terakhir—bersama tim sudah melakukan audiensi ke Pemkab Deliserdang dan DPRD Sumatera Utara. Mengusulkan supaya nama jalan dari simpang pintu kayu besar hingga ke Bandara KNIA adalah nama Jalan Mr. SM Amin. Alasannya, jalan pintu gerbang masuk ke Sumut harus nama tokoh Sumut ? Sedangkan usulan nama jalan Soekarno-Hatta, menurut Beliau cocoknya di sekitar lapangan Merdeka. Apakah sudah hukumnya, bahwa yang terbaik akan muncul jikalau motivasinya murni? Dalam artian kalaupun sebuah gagasan yang sarat dengan kepentingan; pusat daerah, atau etnis tertentu dan atau agama. Atau motivasinya sarat subjetivitas pribadi atau kelompok atau sebuah profesi dalam arti sempit. Maka dapat dipastikan hasilnya tidak akan maksimal. Dan biasanya punya batas waktu? Karena suatu saat akan digugat oleh generasi berikutnya. Atau bahkan dieliminasi oleh alam jagat sendiri. Mungkin para sejarawan yang lebih tahu ? Salam hormat, Miduk Hutabarat Pegiat Komunitas Taman

Warga Medan Baru Keluhkan Parit Primer Tersumbat Warga Kecamatan Medan Baru khususnya Jl.Dr.Mansyur, Jl.Sei Serayu, Jl.Sei Asahan, Jl.Sei Bengawan, Jl.Sempurna sampai meliwati Jl.G.Subroto mengeluhkan adanya parit primer yang tersumbat. Diketahui parit (got) tersebut sejak zaman pendudukan Jepang bahkan hingga saat ini tidak pernah dikorek (dicuci). Warga sangat prihatin melihat kondisi parit terutama jika turun hujan lebat selama jam saja menyebabkan banjir sehingga menggenangi perumahan sekitarnya termasuk ke Jl.Setiabudi. Warga mengimbau agar Plt.Wali Kota Medan HT Dzulmi c/q jajaran Pemko Medan dapat meninjau lokasi parit primer tersebut untuk segera melakukan pengerukan di musim kemarau sekarang ini. Selain parit menggenang, juga sampah terus menumpuk membuat parit menjadi tersumbat, akhirnya menimbulkan aroma bau busuk yang akan menimbulkan berbagai penyakit. Apalagi ditambah kondisi cuaca di Kota Medan tidak menentu (fluktuasi) ditambah pula dengan bau busuk yang menyengat. Jika Pemko Medan melakukan unsur pembiaran dengan tidak segera mengeruk parit tersebut sekarang, maka dikhawatirkan kondisinya semakin parah. Dan jika musim hujan dikeruk maka tidak efektif dan sia-sia. Hormat Kami, Warga Kec.Medan Baru Nama dan alamat ada pada redaksi

Oleh Andryan, SH Memberikan PK berkali-kali tentu saja menjauhkan kepastian hukum. Terlebih lagi, faktanya pernah dulu di MA, bahwa PK diajukan sampai enam kali.

M

ahkamah Konstitusi (MK) kembali membuat putusan kontroversi, setelah sebelumnya MK memutus secara liar terkait UU Pemilu—yang menghendaki Pemilihan Umum (Pemilu) serentak pada tahun 2019— serta putusan membatalkan UU MK yang sebelumnya sebagai konversi dari Perppu penyelamatan MK. Kini MK kembali menjadi pusat perbincangan publik, hal ini tidak terlepas dengan putusan yang menyatakan bahwa Peninjauan Kembali (PK) dalam perkara pidana dapat diajukan lebih dari satu kali. MK dalam putusannya beralasan agar dapat terwujudnya suatu keadilan di dalam penegakan hukum. Sebagaimana diketahui, MK telah memutuskan PK dapat diajukan lebih dari satu kali tersebut berangkat dari permohonan uji materi Pasal 268 Ayat (3) Kitab Undangundang Hukum Acara Pidana (KUHAP) tentang Peninjauan Kembali (PK) yang diajukan oleh Antasari Azhar. Dengan keluarnya putusan tersebut, kini upaya hukum luar biasa, yakni permohonan PK bisa dilakukan lebih dari sekali atau berkali-kali. AntasariAzharselakupemohonujimateril tentang PK, berdalih bahwa pengajuan PK yang diperkenankan hanya satu kali saja sebagaimana dalam ketentuan KUHAP tidak mencerminkan rasa keadilan. Mantan ketua KPK tersebut menyatakan dirinya adalah salah satu korban dari peradilan sesat di republik ini.Tentu hal ini tidak terlepas dengan sepak terjangnya sebagai ketua KPK dan menjadi korban dari upaya balas dendam para koruptor yang telah banyak dihotel prodeokan Antasari Azhar. Alasan Antasari Azhar yang menduga adanya“permainan” dalam proses peradilan sesat yang menyeretnya memaksanya untuk mengajukan uji materi di MK terkait dibataskannya PK yang tentu saja dapat menghalanginyauntukmendapatkankeadilan.Dalam sejarah peradilan di negeri ini, kasus peradilan sesat Antasari Azhar bukanlah hal yang baru. Bahkan, sebelum jauh kasus ini menguak di permukaan publik, sejarah peradilan kita mengingatkan bagaimana perihnya kisah Sengkon dan Karta. Keduanya harus mendekam di penjara, masing-masing selama tujuh tahun dan 12 tahun penjara karena divonis melakukan kejahatanpembunuhan.Lalusepasangsuami istri di Gorontalo yang dipaksa mendekam dipenjara karena divonis melakukan pembu-

nuhan terhadap putri mereka. Namun belakangan ternyata putri mereka masih hidup. Demikian pula terjadi pada Budi Harjono seorang pemuda di Bekasi yang disangka membunuh ayah dan menganiaya ibu kandungnya, tetapi juga tidak terbukti. Dugaan atas kejadian salah tangkap dan salah vonis terhadap tiga orang terdakwa yang sebagian telah divonis penjara atas kejahatan pembunuhan terhadap Asrori (versi kebun tebu), menambah daftar panjang dosa peradilan di Indonesia. Namun, saat kasus dugaanpembunuhanberantaiyangdilakukan Ryan dan ternyata Ryan mengakui salah satu korbannya adalah Asrori, maka mulailah ada dugaan atas praktik peradilan sesat yang dilakukan aparat penegak hukum. Hilangnya Kepastian Hukum Meskipun putusan MK guna menumbuhkan rasa keadilan, tetapi putusan MK tersebutdisatusisijustruakanmenghilangkan kepastian hukum. Memberikan PK berkalikali kepada para pihak berpekara tentu saja menjauhkan kepastian hukum, karena kita tidakmengetahuisampaikapanakanberakhir kasus tersebut dan menambah daftar panjangmenumpuknyakasusdilembagatertinggi kehakiman tersebut. Terlebih lagi, faktanya pernah dulu di MA, bahwa PK diajukan sampai enam kali. Oleh karenanya, MA lantas mengeluarkan kebijakan dan regulasi pembatasan perkara PK dalam SEMA (Surat Edaran Mahmakah Agung) No.10 Tahun 2009 supaya upaya hukum PK dapat diajukan satu kali saja, kecuali ada dua perkara yang sama tetapi keputusannya bertentangan. Apabila PK dapat berkali-kali diajukan justru menimbulkan ketidakadilan dan waktu yang lama sehingga dapat menimbulkan justice delay dan justice dinied. Tidak adanya kepastian hukum apabila PK dapat diajukan lebih dari satu kali tentu saja juga mengundang celah akan bobroknya penegakan hukum di republik ini. Bahkan, PK berkali-kali bisa dimanfaatkan oleh terpidana kasus narkotika dan kasus koruptor sekalipun. Maka putusan MK tersebut harus segera disikapi oleh DPR dan pemerintah untuk segera merespons dengan mengisi kekosongan norma pada Pasal 268 ayat (3) KUHAP. Apabila diperlukan dengan segera, maka MA bisa menerbitkan Perma (Peraturan MA) berdasarkankewenangannyauntukmengatur

hal-hal yang diperlukan sebagai kekosongan hukum demi kelancaran penyelenggaraan peradilan sebagaimana diatur pada Pasal 79 UU No 3 tahun 2009 perubahan atas UU sebelumnya. Hakim Agung Gayus Lumbun, menyatakan bahwa dengan mengatur pengajuan PK kepada pihak yang berkepentingandariterpidanaatauahliwarisnyamasingmasing sebanyak dua kali sebagai bentuk pembatasan yang bersifat partikulatif atau pembatasan yang penting dan wajar. Kemudian,hallainyangtidakkalahmenjadi persoalan dalam penegakan hukum kita di samping tidak adanya kepastian hukum adalah persoalan pelaksanaan putusan atau eksekusi. PK sebagaimana maksudnya, dapat diajukanterhadapsemuaputusanpengadilan yang telah memperoleh kekuatan hukum tetap (kracht van gewjisde). Selama putusan belum mempunyai kekuatan hukum tetap, upayaPKtidakdapatdipergunakan.Terhadap putusan yang demikian hanya dapat ditempuh upaya hukum biasa berupa banding dan kasasi. Meskipun KUHAP menyatakan bahwa PKtidakmenangguhkanpelaksanaanputusan pengadilan/eksekusi.Tetapi, upaya PK“tidak mutlak” menangguhkan maupun menghentikan pelaksanaan eksekusi. PK tidak merupakan alasan yang menghambat apabila menghapus pelaksanaan putusan. Proses permintaan PK dapat berjalan terus, namun pelaksanaan putusan juga berjalan terus. Apakah ketentuan ini “imperatif” atau tidak? Tentu saja “tidak imperatif” secara kaku. Dapat

ditinjau secara kasuistis, tergantung pada keadaan yang meliputi permintaan PK. SeandainyaberdasarpemeriksaanPengadilan Negeri, alasan yang diajukan terpidana sedemikian rupa sifat dan kualitasnya, benarbenar diyakini dapat melumpuhkan putusan yang dimintakan PK, lebih bijaksana untuk menangguhkan pelaksanaan eksekusi. Benar kita mengakui bahwa upaya PK tidak mulus dan mudah, dan seperti dikatakan, dari sekian banyak permintaan, hanya satu dua yang dibenarkan. Dalam hal-hal yang eksepsional dapat dilakukan penangguhan atau penghentian pelaksanaan putusan, sehingga ketentuan Pasal 268 ayat (1) dapat sedikit diperlunak, bahwa permintaan PK “tidak secara mutlak” menangguhkan atau menghentikan pelasanaan putusan. Hal inilah yang semakin memperkeruhketentuanPKapabiladapatdiajukan lebih dari satu kali atau berkali-kali.Terpidana yang akan mengajukan PK“dapat” saja terhindar dari eksekusi pengadilan yang telah mempunyai kekuatan hukum tetap. Memang, PK yang diajukan lebih dari satu kali dapat sedikit membuka keadilan di negeri ini, tetapi PK yang diputuskan MK tersebutjustrulebihbanyakmempunyaidampak negatif dan terlebih lagi hanya akan melemahkan hukum di negara hukum republik ini. Penulis adalah Mahasiswa Magister Hukum USU, Alumnus FH-UMSU.

Kekerasan Cerminan Budaya Kita? Oleh Kamaruddin Hasan Memang ironi, ketika begitu sering diajar oleh sejarah bahwa penggunaan kekerasan justru menghancurkan cita-cita dan menciptakan ketidakadilan.

D

amai; semoga ini menjadi akhir dari sebuah sejarah kekerasan dengan bahasa lain the end of violence history yang ada di muka bumi. Akhir dari sebuah sejarah, walau dalam bentuk berbeda—bagian dari tesis The end of history Fukuyama. Berakhirnya sebuah sejarah kekerasan mestinya melahirkan kedamaian sebagai pemenangnya. Namun satu hal yang pasti, ada impian banyak manusia terutama yang masih “normal” yang lama terpendam. Kekerasan dalam momen Pemilihan Umum (Pemilu) dengan mengatasnamakan demokrasi atau demokrasi defektif berlangsung terus. Lihat saja penerapan pola budaya monolog, komunikasi top down atau dengan bahasa lain komunikasai gaya totaliterisme, kekerasan simbolik, politik tanpa etika, mobilisasimassayangberingas,mediakekerasan, kekerasan media, ingin menang sendiri, penganiyaan, teror, intimidasi, yang sudah menjadi ciri manusia saat ini. Kekerasan tidak saja meneror hati nurani, tetapi juga semakin mendorong kita pada batas krusial antara zona kehidupan dan kematian peradaban bangsa. Kadang tidak sanggup membayangkan, mengapabumitempatkitaberpijakinisenantiasa dipenuhi hujan air mata, bermandikan darah, penuh dengan nyayian kepedihan, teriakan kesakitan, jeritan minta tolong dan jeritan kematian. Maraknya tindak kekerasan individu maupun kolektif seolah menjadi tradisi baru, tradisi yang keluar atmosfir ketidakpastian dalam banyak hal di berbagai penjuru dunia tidak terkecuali negari ini dan terutama daerah ini. Kekerasan yang dipamerkan dengan banggaolehmanusia,terjadidihampirseluruh belahandunia,mulaidarisudutBalkansampai ke wilayah tanduk Afrika, negara-negara latin; Kolumbia, sampai ke Fasifik seperti Fiji atau daratan Aborijin Australia. Bosnia, tepi Barat jalur gaza, Korea Utara. Dari Asia Selatan seperti Srilangka hingga ke ke Chechnya di kawasan Kaukasus, negara pecahan Uni Soviet. Tetangga kita Thailand, Myanmar, Malaysia,Filipina,IndonesiadariAceh,Lampung, Jakarta sampai ke Papua. Aceh sendiri dari ujung nol kilometer Sabang sampai perbatasanya Aceh – Sumatera Utara. Tidak ada hormat terhadap jiwa manusia dan tidak ada empati untuk menjaga manusia secara manusiawi, ungkap Sulaiman Tripa. Azhari, sastrawan Aceh, menulis “...dan saya sebagai si terkutuk dilahirkan dan tumbuh di tanah yang buruk itu, namun saya begitu mencintai Aceh dengan segala alamnya yang elok dan masyarakat yang ramah untuk menyambung hikayat lama dan menyampaikan kepada dunia!”. Tentu, kekerasan dalam bentuk apapun, salah satunya disebab-

kanrangsanganpemikiran,yangtelahmenjadi ruang efektif untuk menghabiskan atau meminimalisir kuantitas dan kualitas kemanusiaan kita. Kahlil Gibran dalam salah satu bukunya, menggungkapkan kekecewaan peradaban kemanusiaan, ”aku mencari kesunyian, pengasingan dan kesendirian karena aku benci akan istana yang besar dan hebat yang disebut peradaban, karena bangunan dan arsitakturnya yang bagus dan berdiri tegak di atas bukit tengkorak manusia”. Memang begitulah noda hitam dalam sejarah kemanusiaanterusberlaludenganalasankemanusiaan pula, tidak mudah dihapuskan. Paling tidak, segalakekejamansesamamanusiayangterjadi dalam setiap peradaban, menjadi catatan sejarah kelam. Dinno Patti Djalal mengungkapkan, “memang dalam millenium ini, yang paling berbahaya adalah perilaku (destruktif) manusia”. Dialektika Identitas Pertanyaan mengenai makna hidup dan identitas, salah satunya dapat dijawab dengan menengok ke dalam subyektivitas-ke dalam diri, dan dengan memperhatikan kehidupan spiritual batiniah. Subyektivitas, menurut seorang filsuf Perancis Descartes, terletak didalamkemampuanmanusiaberpikirsecara logis, rasional, dan terpilah-pilah. Berawal dari proses dialektika berpikir dan merenung dalammenginterpretasikanrealitas.“Manusia berpikir maka dia ada”, “Aku memilih maka aku ada”. Ketika manusia berhenti berpikir, lambat laun kehilangan identitasnya sebagai manusia.Tugasmembuatpilihaniniadapada setiapmanusia,danberlangsungdalamproses pergulatan batin untuk menentukan sebuah keputusan atau pilihan hidup. Otentisitas manusia hanya dapat diraih dalam keberaniannya membuat keputusan dan pilihan penting dalam hidupnya. Suatu masyarakat manusia adalah usaha pembangunan dunia, bahwa dunia sosial adalah dunia yang dibangun oleh manusia sendiri. Ia merupakan hasil projek manusia membangun dunianya, suatu enterprise of world building. Perspektif ini, memberikan pengertian bahwa dunia (lingkungan sosial, budaya,politik,ekonomi,hukumdll)merupakan hasil konstruksi pemikiran dan aktivitas manusia, melalui apa yang disebut Peter L. Bergersebagaiprosesdialektika,melaluiproses eksternalisasi, objektivasi dan internalisasi. Semua dunia yang dibangun (dikonstruksi) masyarakat manusia, secara inhern adalah rawan, karena terancam fakta kepentingan diri dan kebodohan manusia itu sendiri. Konsepdiriyangcenderungindividualistik, konsumtif dan kapitalis membawa kehancuran pada manusia itu sendiri. Konsep diri terbentuk dari identitas sosial dan identitas

pribadi. Identitas sosial dibentuk dari keanggotaandalamkelompoksosial.Identitaspribadi terbentuk berdasar pengalaman unik yang dialami. Manusia masuk ke arus, kecenderunganselera,konsumtif,pengaburanidentitas, tanda dan makna. Secara bersamaan seperti tiba-tiba merasa kehilangan identitas. Itulah kiranya suatu perjalanan yang penuh paradok. Mengejar identitas sekaligus kehilangan identitas. Mengapa kekerasan Pada tataran praksis kekerasan dipahami sebagai manifestasi akumulasi kekecewaan manusia terhadap berbagai masalah. Kekecewaan terhadap praktek politik, ekonomi, kesenjangan sosial-budaya secara kotor telah membuat manusia kehilangan kontrol diri. Kekerasandankebiringasanmenjadijalan penyelesaian berbagai masalah.Tentu mesti dianalisis secara konfrehensif. Perbedaan pendapat, beda bendera partai, beda pilihan politik dan lain sebagainya dijawab dengan kekerasan oleh manusia. Pertanyaan lanjutan mengapa masyarakat manusia cenderung mudah melakukan aksi kekerasan ketika berhadapan berbagai perbedaan. Ke mana sifat toleran, humanis, sportif dan saling menghargai, mental kesatria. Kecenderungan meluasnya kekerasan dapatdisebutkanbeberapasebabakibatantara lain. Pertama, masyarakat terlalu lama berada pada posisi lemah dan kalah. Bahkan posisi tersebut terus dipelihara agar sama sekali tidak berdaya dan terus kalah. Karena itu ketika ada peluang keluar dari situasi tertekan sarat depresi, yang muncul adalah perasaan permusuhan sehingga terdorong membalas. Dorongan inilah yang yang sering memicu aksi kekerasan. Secara konsep struktural intreraksisosialdapatdipahamisebagaikedudukan komunitas dengan posisi subordinat paling bawah dan lemah yang cenderung rawan akan tindakan atau perilaku kekerasan dalam bentukapapundankondisikapanpunlambat atau cepat mengalaminya. Kedua, bangsa ini sudah lama mengalami krisis keteladanan. Para elit, pemimpin, tokoh agama, tokoh masyarakat jarang muncul sebagai pengemban dasar-dasar moral dan budaya yang kuat. Kondisi politik pun sangat kurang mendukung, elit politik masih dan terussibukmemikirkanperebutankekuasaan, baik melalui ajang politik nasional maupun regional. Ketiga, pendidikan; sejak duduk di bangku TK sudah disodorkan pendidikan mengabaikan unsur karakter seperti nilai agama, moral, etika, budaya/sastra, kepribadian. Sehingga kurang pemahaman tentang eksistensi manusia sebagai khalifah di muka bumi. Keempat, ketika keberanian, semangat, militansi, imajinasi dan idealisme akan digantikan perhitungan ekonomis—tidak ada lagi jiwa tolong menolong. Memasuki dan menjalani hidup dalam abad kekerasan atau the ageofviolence,dimanawajahkekerasanmenemukan bentuknya dalam universium sejarah kemanusiaan. Dalam The End Of Histori, Fukuyama, mengatakan kurun pascasejarah ini tidak ada lagi seni budaya atau filsafat, yang ada hanya pemeliharaan museum seja-

rah secara fisik. Karenanya akhir sejarah akan merupakan saat yang menyedihkan. Kelima, ledakan kekerasan ideologi menjadi salah satu dari sekian wajah masyarakat. Sementara perdebatan ideologis menyangkut strategi ekonomi telah berubah menjadi konfrontasiyangpenuhkekerasan.Padahalsejarah membuktikan, kekerasan itu sekali dipakai, iaakanmemasukkanlingkaranspiral,resistensi dan reaksi yang terus memuncak dari masa ke masa. Keenam, media yang berada dalam genggaman hegemoni kekuasaan totalitarian yang dapat menjadi semacam “tirani terselubung”. Karena eksploitasi pikiran yang dimanipulasi lewat media lambat-laun menjelma menjadi sebuah sistem totaliter yang mengendalikan pikiran, menyuburkan berbagai kekerasan dalam daratan kognitif dan spikologis. Ketujuh, kekerasan struktur, kekerasan yang menyatu dengan struktur sosial yang sesungguhnya lebih banyak mengandung kekerasan. Akar wajah kekerasan yang ada hampir dapat dipastikan bermuara di sini, kerena kebanyakan masyarakat manusia tengah dilanda proses transformasi sosialbudaya, politik, hukum dan ekonomi yang amat mendalam yang merupakan sumber ketidakstabilandalamrelasikekuasaan.Karena itu, budaya kekerasan akan terus mencemarkan semua segi kehidupan. Kedelapan, ada kondisi pseudo-neurotik yang menyebabkan masyarakat manusia terpasung dan tertekan secara sosiokultural bahkan tekanan psikologis. Masih merasa tidak memiliki siapapun dan apapun yang bisamenghilangkankeresahan,menggangkat martabat, harga diri, kepercayaan diri, kebutuhan dan keinginan. Pada puncaknya solusinya adalah kekerasan. Memang ironi, ketika begitu sering diajar oleh sejarah bahwa penggunaan kekerasan justru menghancurkan tujuan dan cita-cita danmenciptakanketidakadilan.Karenaitulah stabilitas di bawah keadaan yang penuh penindasan berarti pelanggengan kekerasan. Sepertinya Soejatmoko benar ketika mengatakan perjuangan tanpa kekerasan seperti digulirkan Gandhi atau pengagumnya telah berubah dari suatu mimpi utopis menjadi suatu kebutuhan praktis. Idi Subandi Ibrahim, bahwa kita juga diingatkan oleh getaran perasaanmendalamyangseringdilupakan,bahwa dunia yang bebas dari kekerasan bukanlah dunia yang bebas konflik. Ini berarti menanggalkan kekerasan tidak berarti menghentikan perjuangan melawan kondisi yang tidak adil dan menindas. Selalu, dialektika proyek kemanusiaan tengah dan terus dipancangkan, saat yang sama di setiap sudut wajah kekerasan terus memoles luka dalam. Sementara masyarakat masih peka terhadap reaksi yang dijumpainya dari manusia lain di sekitarnya. Mungkin saja adamasyarakatmanusiayangtidakbisahidup tenangtanpakekerasan,karenasudahmenjadi teman setia. Penulis adalah Dosen Ilmu Komunikasi, Fisip, Unimal Aceh, Ketua Development for Research and Empowerment (DeRE-Indonesia)


Aceh

WASPADA Rabu 19 Maret 2014

Kampanye Di Bireuen Sepi BIREUEN (Waspada): Komisi Independen Pemilhan (KIP) Bireuen sudah menjadwalkan sejak 16 Maret hingga 5 April 2014 masa kampanye 12 Parnas dan tiga Parlok di Kabupaten Bireuen. Begitupun, kampanye hari pertama Minggu (16/3) tidak satupun Parnas dan Parlok yang melaksanakan kampanye terbuka di lapangan enam Daerah Pemilihan (DP) yang sudah ditentukan. Katua KIP Bireuen Muchtaruddin,SH, MH yang dikonfirmasi Waspada melalui telefon selularnya membenarkan kampanye hari pertama Minggu (16/3) ke 12 parnas dan tiga Parlok tidak melaksanakan kampanye terbuka. Sumber lain yang diperoleh Waspada dari beberapa Parnas dan Parlok di Bireuen mengatakan, kampanye hari pertama tidak mereka laksanakan karena mengalihkan menjadi kampanye dialogis dengan kader dan simpatisan partai. PengamatanWaspada kampanye hari kedua (17/3) di lokasi DP Bireuen-1 Pulo Kiton Bireuen dan lapangan bola kaki Cot Batee juga terlihat sepi. (b12)

PDIP Agara Sambut Pencapresan Jokowi KUTACANE (Waspada): Segenap pengurus, kader dan simpatisan PDIP Aceh Tenggara menyambut hangat langkah Partai Banteng gemuk mencalonkan JokoWidodo menjadi Capres pada Pilres akan datang. Sambutan hangat dan dukungan penuh pengurus, kader dan simpatisan tersebut, disampaikan Nazaruddin Caleg PDIP yang juga Wakil Ketua DPRK Aceh Tenggara, Senin (17/3) usai menggelar sujud sukur atas pencalonan Jokowi menjadi Capres 2014 mendatang. Hal yang sama diakui oleh Ketua Bappilu PDIP Agara, Kasiman Desky, sejak menjadi Walikota Solo, nama Jokowi mulai dikenal dan menjadi buah bibir bagi masyarakat Agara. Diakhir keterangannya, Kasiman Desky,Nazarudin dan Haddin Syawal mengatakan optimis Partai berlambang banteng gemuk, bisameraihsatuFraksidiDPRKAgaradanbisameloloskanwakilnya duduk di DPR Aceh. (b26)

B11 Caleg Lulus Honorer K-2, Menggeramkan TAPAKTUAN(Waspad): Berdasarkan hasil penelusuran Tim Aliansi Honorer Kategori Dua (K-2), di Kabupaten Aceh Selatan, ditemukan banyak paca caleg di sejumlah Parpol, seperti PDA, PKS, Demokrat, Hanura dan PBB. dinyatakan lulus dalam seleksi CPNS hanorer K-2. Kondisi ini membuat geram para honorer yang merasa layak dan pantas menjadi CPNS, karna benar – benar murni sebagai

tenaga honorer terhitung dari 2005danmalahjauhsebelumnya. “Beberapa orang di antaranya, termasuk sopir L-300 trayek Banda Aceh-Tapaktuan,“kata Ismail Ismet (foto), Ketua Tim Aliansi Honorer Katagori II Bersatu Aceh Selatan, dalam release yang dikirim kepada Waspada, Senin (17/3). Hal ini sangat disesalkan. Karena sesuai dengan peraturan KPU dimana seseorang PNS atau CPNSdanlainnya,jikainginmenjadi caleg, harus mengundurkan diri dari dari jabatan atau pekerjaannya. Ini jelas membuktikan, para pihakpenyelenggaraPemilutidak

jeli dalam memverifikasi data caleg pada masa pendaftaran dulu. Padahal jelas aturan KPU tentang syarat - syarat pencaleg-

BIREUEN (Waspada): Bupati Bireuen Ruslan M Daud dipastikan menjadi juru kampanye (Jurkam) Partai Aceh pada Pemilu Legislatif 2014. Izin dan cuti menjadi orator pada kampanye partai lokal ini telah diajukannya ke Gubernur Aceh dan tembusannya diteruskan ke Mendagri pada 5 Maret lalu. “Cutiuntukkampanyesudahkeluar,sayadapat cuti 4 hari kerja dan surat izinnya sudah saya kantongi,” ucap Bupati Bireuen Ruslan M Daud, di Meuligoe (pendopo) setempat, Selasa (18/3). Dia menyebutkan, cuti untuk menjadi juru kampanye ini diberikan oleh gubernur yakni dua harikerjasetiappekanselamakampanyerapatumum pemilu legislatif ini dilaksanakan. “Semua kepala daerah, termasuk gubernur juga hanya diberikan cuti dua hari kerja setiap pekan,” ucap Ruslan. Berdasarkan jadwal yang ada, Ruslan mengatakan, dirinya akan berorasi untuk meme-

DEWANTARA (Waspada): Empat ulama Aceh menepung tawari 23 calon legislatif dari Partai Persatuan Pembangunan (PPP) di rumah Fakhrurrazi, Caleg PPP dari Aceh Utara yang maju untuk calon DPRA di Gampong Geulinggang, Dewantara, Sabtu (15/3) pukul 21:00. Kegiatan itu dihadiri hampir 1000-an warga gampong setempat. Empat ulama tersebut yaitu Abu Hasballah Keutapang,Tengku Nurdin, dari Kecamatan Nisam, Aceh Utara, Tengku Armansyah dari Aceh Utara dan Tengku Mukhtar Ibrahim (Abati Mukhtar) dari Kota Langsa. (b18).

BANDA ACEH (Waspada) : Elit-elit politik di Aceh harus segera melakukan dialog untuk menghasilkan sebuah kesepakatan bersama demi kepentingan rakyat. “Segera akhiri konflik kepentingan. Bagi mereka (elit politik) yang maju dalam Pemilu legislatif jangan mengedepankan sifat egois yang bisa merugikan masyarakat,” ujar pengamat pilitik di Banda Aceh M Yusuf, Selasa (18/3). MYusuf, pengamat politik di Banda Aceh mengatakan, masyarakat sudah bosan dengan kisruh politik di Aceh menyangkut Pemilu legislatif. “Mereka itu tega mengorbankan kenyamanan, ketenangan dan ketentraman rakyat hanya karena kepentingan Pimilu legislatif,” sebutnya. Untuk itu, para elit politik baik secara kelembagaan (partai politik) peserta pemilu legislatif maupun para caleg dan termasuk timsessertapendukungharusmemikirkanbagimanakemaslahatan dan kesejahteraan rakyat Aceh, bukan mengedepankan egoisnya seperti melakukan intimidasi, teror dan tindak kekerasa seperti yang terjadi akhir-akhir ini. (b09)

Jadwal Kampanye Aceh Utara 194 Kali LHOKSEUMAWE (Waspada): Kabupaten Aceh Utara memiliki 194 waktu rapat umum (kampanye) Pemilu 2014 dari jumlah 21 hari jadwal yang berlaku secara umum. Memasuki hari ketiga, baru Partai Nasional Aceh (PNA) dan Partai Aceh (PA) yang melakukannya. Berdasarkan data surat keputusan Komisi Independen Pemilihan (KIP), Aceh Utara memiliki 194 waktu kampanye. Dapil 1 (Sawang, Muara Batu, Dewantara) terdapat 34 kali, Dapil 2 (Nisam Banda Baro Nisam Antara Kuta Makmur Simpang Keuramat Syamtalira Bayu Geureudong Pase) terdapat 31 kali. Kemudian Dapil 3 (Samudera Meurah Mulia Syamtalira Aron Tanah Pasir Lapang) terdapat 30 kali, Dapil 4 (Nibong, Tanah Luas, Matangkuli, Paya Bakong, Pirak Timu) terdapat 31 kali, Dapil 5 (Lhoksukon, Cot Girek, Langkahan) terdapat 34 kali, dan Dapil 6 (Baktiya Barat, Baktiya, Seunuddon, Tanah Jambo Aye) terdapat 34 kali. (cmk)

Pelatihan Manajemen Majelis Taklim BANDA ACEH (Waspada): Pusat Studi Wanita (PSW) UIN Ar-Ranirymelakukanpelatihanmanajemenkepadaparapimpinan Majelis Taklim di Kota Banda Aceh dan Aceh Besar, Selasa dan Rabu (18-19/3), di Takammul Meeting Room Kampus UI ARRaniry Darussalam, Banda Aceh. Rektor UIN Ar-Raniry Farid Wajdi Ibrahim, Selasa (18/3) menyampaikan, kegiatan ini merupakan salah satu dari tiga kewajiban kampus kepada masyarakat, yaitu memberikan pelatihanpelatihan. “Majelis taklim ini telah berkembang pesat terutama di Pulau Jawa. Seiring dengan perkembangan saat ini, majelis taklim telah berkembang seluruh Indonesia termasuk di Aceh. Kelompok seperti ini sangat bagus untuk dikembangkan,” katanya. (b04)

Tiba (light, asal, waktu)

Berangkat (light, tujuan, waktu)

Garuda Indonesia GA 0278 Medan GA 0142 Jakarta/Medan GA 0146 Jakarta/Medan

07:05 10:45 14:50

GA 0279 Medan GA 0143 Medan/Jakarta GA 0147 Medan/Jakarta

07:45 11:3 0 15:45

11:35 15:55 21:30

JT 397 Medan/Jakarta JT 307 Jakarta JT 305 Medan/Jakarta

06:00 12:15 16:35

12:50

SJ 011 Medan/Jakarta

13:35

12:00 11:20

QZ 8022 Medan AK 1306 Kuala Lumpur*

12:25 11:45

14:00

FY 3400 Penang*

14:20

Lion Air JT 304 Jakarta JT 306 Jakarta/Medan JT 396 Jakarta/Medan

Sriwijaya Air SJ 010 Jakarta/Medan

Air Asia QZ 8023 Medan AK 1305 Kuala Lumpur *

Fire Fly FY 3401 Penang* * Setiap Senin, Rabu, Jumat dan Minggu.

“Namun hasilnya hingga saat ini masih mengambang alias belum jelas veriiikasinya, hingga membingungkan para honorer benaran,” tambahnya. Koordinator Komisi A dan B DPRK Aceh Selatan Khaidir Amin yang dihubungi secara terpisahmengakubelummenerima hasil verifikasi Pansus dewan. Ia mengaku Pansus mulai bekerja dan turun ke kecamatan. “Pansus dewan telah mulai melakukanverifikasiulanghonorer K-2 yang lulus tes CPNS. Jika nantinya kami temukan honorer tidak melakukan honor, maka kelulusannya sebagai CPNS kita mintadibatalkan,”sebutnya.(b30)

nangkan Partai Aceh di beberapa lokasi kampanye di wilayah Bireuen. “Saya juga akan berkampanye untuk pemilihan DPRA dan DPRK dari Partai Aceh,” ucap Ruslan. Ruslan merincikan, selama masa kampanye rapat umum ini, Partai Aceh akan melaksanakan kampanye di lima lokasi, yakni Lapangan Upacara di Kecamatan Jeunieb, Lapangan Glumpang Payong di Kec. Jeumpa, Lapangan Bolakaki T Hamzah di Kec. Samalanga, Lapangan Bolakaki Raja Taloe Kutablang, dan Lapangan Bolakaki Blang Asan di Kec. Peusangan. Karenanya, kata Ruslan, dalam melaksanakan tugasnya sebagai juru kampanye dia siap menanggalkan fasilitas milik pemerintah sekaitan dengan jabatannya sebagai kepala daerah. “Mobil dinas juga sudah saya parkir di pendopo, jadi saya pakai mobil plat hitam untuk kegiatan kampanye,” tuturnya. (b17)

Aksi Lempar Mobil Kampanye

PKB Janjikan Kemakmuran

Elit Politik Jangan Egois

Pernyataan Tanggung Jawab mutlak bermaterai,”ucapnya. AktivisHMIitumengingat-kan jikadikemudianhariternyatadata dan dokumen honorernya tidak benar,makaKepalaDinas,instansi, PPKdantenagahonorerK-2yang bersangkutan,harusbertanggung jawabpenuh,baiksecaraadministrasi maupun pidana. Sebelumnya Koordinator Aliansi Honorer Katagori II BersatuAcehSelatan,M.Taslemtelah menyerahkan sebanyak 81 orang honorer siluman yang lulus dalamseleksihonorerkepadaKetua Komisi A DPRK Aceh Selatan dan diterima Ketuanya Subqie, beberapa waktu lalu.

Jadi Jurkam, Bupati Bireuen Cuti

Tiga Ulama Tepung Tawari Caleg PPP

BANDA ACEH (Waspada): Ketua Umum PKB Muhaimin Iskandar menjanjikan kemakmuran untuk Aceh bila PKB mendominasi di parlemen Aceh dari tingkat DPRK, DPRA dan Masyarakat Aceh mengirim minimal 1 Anggota DPR RI ke DPR RI. “Akan kita percepat kemakmuran bagi masyarakat Aceh,” ungkap Muhaimin di Lapangan Islamic Center Lampenurut Aceh Besar, Minggu (16/3). Kampanye yang dihadiri sekitar 12.000 Ribu masyarakat Aceh besar dan masyarakat Banda Aceh itu turut dihibur oleh raja dangdut Rhoma Irama dan Soneta. Muhaimindalamwawancaradisela-selakampanyemenyebutkan ia yakin PKB menang karena menyatunya kekuatan Ahlusunahwaljamaah atau NU di Aceh. (b08)

kan yang mengharuskan setiap yang ikut mendaftar sebagai caleg ,harusmelampirkansuratpengungunduran diri dari instansi terkait, sebagai pengguna anggaran negara. Bayangkan menurut dia, dari 492 orang jumlah honorer K-2 yang dinyatakan lulus, diperkirakan lebih dari 50 persen merupakan honorer siluman. Secara administrasi, persyaratan itu bisa dilengkapi, tetapi di saat uji publik ternyata banyak SK siluman. “Kami mengimbau kepada seluruh kepala instansi, agar jeli dan professional dalam melakukan pemberkasan honorer K-2, dimana wajib menyertakan Surat

Waspada/Zainal Abidin

PETUGASI YPAP sedang menerjemahkan tata cara pencoblosan yang disampaikan Komisioner KIP, Yuswardi Mustafa kepada penyandang tunawicara, Selasa (18/3)

Penyandang Disabilitas Sosialisasi Cara Coblos LHOKSEUMAWE (Waspada): Para penyandang disabilitas mendapat sosialisasi tata cara pencoblosan Pemilu, Selasa (18/ 3). Seribuan warga tunanetra, tunawicaradancacattubuhlainnya mendapathakpilihpadapemilihan legislatif (pileg) mendatang. Direktur Yayasan Permata Aceh Peduli (YPAP), Chaidir mengatakan, penyandang disabilitas di Kota Lhokseumawe sebanyak

1.443 orang. “Mereka juga punya hak untuk berdemokrasi,” jelas Chaidir. Sehingga mereka juga harus mengetahui tata cara pencoblosan yang sah. Sosialisasi tata cara pencoblosan disampaikan Komisioner KIPKotaLhokseumawe,Yuswardi Mustafa. Sementara untuk menyampaikan sosialisasi khusus kepada para tunawicara, dibantu penerjemah dari YPAP.

Yuswardi, dalam penjelasannyamenyebutkantentangkemudahan bagi penyandang disabilitas. Seperti, penyandang cacat tunanetra bisa diwakili setelah pendamping mengisi Formulir A-3. Selain itu, petugas dari Kelompok Penyelenggara Pemungutan Suara (KPPS) juga bisa memprioritas pemilih disabilitas untuk mendahulukan saat pencoblosan. (b15)

Demokrat Dan PNA Didiskualifikasi BANDA ACEH(Waspada): Komisi Independen Pemilihan (KIP) Aceh Singkil mencoret keikutsertaanPartaiDemokratsebagai peserta dalam pemilihan umum di kabupaten itu. Selain Demokrat, kondisi serupa juga menimpa Partai Nasional Aceh (PNA). “Kedua partai ini terlambat menyerahkan laporan awal dana kampanyenya kepada KIP yang batasakhirnyaditetapkan2Maret lalu. Jadi konsekwensinya didiskualifikasidaripeserta,”kataKetua PokjaPencalonanKIPAceh,Junaidi kepada Waspada, Senin (17/3). Menurut Junaidi, Partai Demokrat menyerahkan laporan awal dana kampanyenya kepada

KIPpukul20:40,sedangPNAbaru menyerahkan laporan awal dana kampanye,pukul 22:30, Senin 4 Maret lalu. Padahal lanjut dia, sesuai ketetepan Komisi Pemilihan Umm (KPU) laporan harus diserahkan Senin 2 Maret pukul 18:00. “Saat dikonfirmasi, (Partai demokrat/PNA), mereka menduga pukul 00:00, masih di hari yang sama atau Senin. Padahal saal bimtek kami sudah mensosialisasikannya,” kata Junaidi. Ia mengatakan berita acara pencoretan Partai Demokrat dari peserta pemilu di Aceh Singkil telah telah ditandatangani KPU Pusat, Sabtu 15 Maret kemarin. Adapun Partai Nasional Aceh

(PNA),pencoretan keikutsertaannya telah ditandatangani KIP Aceh, Senin 17 Maret 2014. “Seluruhnya diputuskan dalam rapat pleno baik KPU untuk Partai Nasional dan pleno KIP untuk partai lokal. Terkait kondisi ini mereka dapat melaporkannya (sengketa) ke Bawaslu,” katanya. Junaidi menyebut, selain partai,pembatalansebagaipeserta pemilu juga menimpa dua calon legislatief (caleg) DPD RI, akibat terlambat melaporkan dana kampanye ke KIP Aceh. Keduannya yakni caleg DPD RI dengan nomor urut 35 atasnama, MuhtarAnshari.Selanjutnyacaleg DPD RI nomor urut 36 atasnama Tgk T Abdul Muthalib.(cb06)

Kapolres : Penyelenggara Jangan Jadi Pemain KUTACANE (Waspada) : Kapolres Aceh Tenggara AKBP Trisno Riyanto mengingatkan semua penyelenggara Pemilu dalam berbagai tingkatan agar jangan jadi pemain, namun harus berdiri di tengah-tengah semua kontestan pemilu. Penegasan tersebut disampaikannya ketika memberikan sambutanterkaitmasalahkampanye, daftar pemilih tetap dan tata

cara pemilihan di Sekretariat KIP Agara, Selasa (18/3). Ada beberapa tahapan dan lokasi pemilu yang sangat rawan dan krusial serta potensial melahirkan masalah, mulai dari TPS dan PPK, sebab itu pembekalan danpemahamantentangtatacara pemilihan yang benar seusai aturan yang berlaku, Hal itu sangat penting dilakukan partai politik karena masalah

sengketa dan protes maupun ketidakpuasan , berawal dari TPS dan PPK, sebab itu KPPS, PPS di desa dan PPK di tingkat kecamatan harus sigap menyikapi situasi yang berkembang. Ketua KIP Agara Dedi MulyadiSelianmengatakan,padadasarnya sosialisasi cara memilih yang benar sudah disampaikan pihak penyelenggara kepada partai politik. (b26)

LHOKSEUMAWE (Waspada): Sekelompok tarnyadisampaikanduamantanjurubicaraKomite orang melempar mobil Partai Nasional Aceh (PNA) Peralihan Aceh (KPA) Wilayah Pase. Yaitu Dedi di Simpang Kandang, Muara Dua, Lhokseumawe, Safrizal dan Nasrullah Dahlawi. Orasi politik juga Senin (17/3) pukul 19:15. Aksi kekerasan yang disampaikan mantan Juru Ruding GAM, Amni mengakibatkan seorang kader terluka, dinilai telah Ahmad Marzuki dan mantan petinggi GAM mencederai pemilu damai. Muzakir Daud. Sekretaris PNA Aceh Utara, Sofyan mengataDalamorasinyamenjelaskanalasanPNAmemkan iring-iringan mobil PNA ketika kembali dari bentuk barisan untuk ikut pemilu. Diantaranya, kampanye di Panton Labu, Aceh Utara telah dilem- merekamenilaiselamainikesejahteraanmasyarakat pari batu. “Mereka melempar mobil-mobil kami belum tercapai. Meskipun perdamaian telah beryang melintasi Simpang Kandang dengan meng- langsung lama di Aceh, namun kemiskinan masih gunakan ketapel,” jelas Sofyan. Aksi penyerangan mendera masyarakat di Serambi Mekkah.(b15) mobil partai, menurutnya, telah mencederai kesepakatan pemilu damai. Serangan tiba-tiba, mengenai mobil yang ditumpangi Kafdawin,29, kader PNA asal Gampong Krueng Seunong, Kecamatan Kuta Makmur, Aceh Utara. Batu mengenai bagian belakang mobil. Akibatnya kacabelakangpecahdanmenghantam pelipis kanan korban. Menurut Sofyan, sebelumnya sejumlah orang juga memaki rombongan peserta kampanye ketika melintasi kawasan tersebut. Pada hari kejadian, sekitar 500 kader PNA dan warga Aceh Utara menghadiri kampanye di Lapangan Sepak Bola Rawang Iteik, Kecamatan Tanah Waspada/Zainal Abidin Jambo Aye, Aceh Utara. Kampanye terbuka disam- SEJUMLAH kader PNA sedang mengikuti kampanye perdana di paikan sejumlah tokoh partai Rawang Iteik, Kecamatan Tanah Jambo Aye, Aceh Utara, Senin (17/ dari gerilyawan Gerakan Aceh 3) sore. Ketika kembali dari kampanye, rombongan kader dilempari Merdeka (GAM). Orasi dian- batu di Simpang Kandang, Kecamatan Muara Dua, Lhokseumawe.

Parpol Perlu Ditata Dan Disempurnakan LANGSA (Waspada) : Partai politik (parpol) sebagai pilar demokrasi perlu ditata dan disempurnakan dalam mewujudkan sistem politik yang demokratis guna mendukung sistem presidensil yang efektif. Penataan dan penyempurnaan partai politik diarahkan pada dua hal utama. Pertama, membentuk sikap dan prilaku partai politik yang terpola atau sistemik sehingga terbentukbudayapolitikyangmendukungprinsip-prinsip dasar demokrasi. Hal ini ditunjukkan dengan sikap dan prilaku partai politik yang memiliki sistem seleksidanrekrutmenkeanggotaanyangmemadai serta mengembangkan sistem pengkaderan serta kepemimpinan politik kuat. Kedua, memaksimalkan fungsi partai politik baik fungsi parpol terhadap negara maupun fungsi parpol terhadap rakyat melalui pendidikan politik danpengkaderansertarekrutmenpolitikyangefektiif untuk menghasilkan kader-kader calon pemimpin yangmemilikikemampuandibidangpolitik.Demikian disampaikanWakilWalikotaLangsaMarzukiHamid saatmembukaSosialisasiUndang-UndangTentang PartaiPolitiktahun2014,yangdiselenggarakanBadan Kesbangol dan Linmas, di Hotel Harmoni Langsa,

Selasa (18/3). Lanjutnya, pemilu merupakan instrumen demokrasi yang mengikutsertakan partisipasi masyarakat dalam mewujudkan aspirasi yang disalurkanmelaluiwadahpartaipolitikyangdibawa ke muara pemilihan dan penataan perwakilan politiknyadilembagalegislatif.Pemiludalamsebuah negara yang demokratis menjadi kebutuhan yang tidak terelakan, oleh sebab itu melalui pemilu rakyat yang berdaulat memilih wakil-wakilnya dan diharapkan dapat memperjuangkan aspirasi serta kepentingan dalam suatu pemerintahan yang berkualitas. Kepala Badan Kesbangpol dan Linmas Kota Langsa, Rizal Efendi menyatakan sosialisasi yang dilaksanakan diikuti 45 pengurus partai politik seKota Langsa. Sedangkan pemateri dari Asisten IPemerintahKotaLangsaZainalArifindankomisioner KIP Kota Langsa Marida Fitriani serta Ngatiman. Kegiatan sosialisasi Undang-Undang Partai Politik tahun 2014 ini untuk meningkatkan pengetahuan dan pemahaman anggota dan pengurus parpol tentangUndang-Undangpolitikdalammenghadapi pemilu legislatif 2014. (cms)

Hasil Pilkada Subulussalam Dalam Penantian Panjang? TERLEPAS pro dan kontra prosesi hingga dua putaran hasil Pemilihan Kepala Daerah (Pilkada) Walikota dan Wakil Walikota Subulussalam 2013, masyarakat daerah ini secara umum menantikan pelantikan wali kota dan wakil wali kota periode 2014-2019 terpilih. Persoalannya, pada 5 Maret 2014 telah berakhir masa jabatan walikota dan wakil walikota periode 2008-2014, atas nama Merah Sakti dan Affan Alfian Bintang. Namun fakta yang terjadi pasca 5 Maret itu, Gubernur Aceh menetapkan Sekretaris Daerah (Sekda) Subulussalam, Damhuri sebagai Pelaksana Harian (Plh) Walikota Subulussalam. Meski seolah diabaikan fenomena belum defenitifnya wali kota di bumi ‘Sada Kata Subulussalam’, di sisi lain Mahkamah Konstitusi (MK) telah memutuskan pasangan nomor urut 3 Merah Sakti dan Salmaza (SAZA) adalah pemenang pilkada itu, defenitif diyakini akan lebih efektif karena kewenangan dan kebijakan era Plh sangat terbatas. Maka solusinya, pelantikan walikota dan wakil walikota terpilih jadi alternatif. Namun apapun alasannya, fakta Plh menunjukkan telah terjadi transisi kepemimpinanWalikota Subulussalam hingga waktu yang belum diketahui. Yang diketahui masyarakat secara umum dari keputusan MK itu, jabatanWalikota danWakilWalikota Subulussalam periode 20142019 berada di pundak Merah Sakti dan Salmaza. Bukan persoalan kecil, karena untuk hasil itu dilalui dua putaran, sama halnya dengan perkaranya, dipersengketakan ke MK.

Pilkada wajar, 29 Oktober 2013 diperkarakan oleh dua kandidat pasangan, yakni AMAL dan ASLI dengan sejumlah tuduhan dugaan dan bukti pelanggaran dilakukan pasangan SAZA. Eksesnya, pemungutan ulang suara di dua Tempat Pemungutan Suara (TPS) Desa Namo Buaya, Kec. Sultan Daulat dan penghitungan ulang enam TPS di Kec. Simpang Kiri direstui MK. Pasca keputusan MK itu, gonjang ganjing hasil pilkada dan pungut hingga hitung ulang muncul dengan sejumlah spekulasi. Masyarakat Namo Buaya disebut ‘emas’, peluang warga desa ini untuk mengais rezeki, mereka jadi penentu walikota dan wakil walikota lima tahun ke depan dan spekulasi lain. Sekira selang sebulan, 30 Desember 2013, dua perintah MK itu dilaksanakan KIP Kota dan Provinsi serta Panwaslu dan Bawaslu. Tak kalah sengit dibanding pilkada wajar, prosesi pengamanannya juga cukup ketat. Hasilnya pun tak banyak berubah.Yang diketahui pasti masyarakat umum, pasangan SAZA unggul. Artinya, Merah Sakti sebagai walikota untuk periode kedua akan didampingi Salmaza sebagai wakilnya hingga 2019. 345 Suara untuk SAZA dan 222 untuk AMAL. Anehnya, pasca pungut dan hitung ulang, 30 Desember 2013 itu, nyaris suasana kota ini adem. Aktivitas perkantoran tampak tak seramai sebelum pilkada. Keengganan warga pun seakan muncul membicarakan agenda lima tahunan itu karena informasi hitung dan pungut ulang pun masih diperkarakan pasangan yang sama ke MK.

“Efekpilkadatetapsajaterimbaskemasyarakatkarenakepentingan elit politik, malah sejumlah perkantoran tampak sepi,” kata sumber menambahkan, dari walikota, kepala SKPK hingga jajaran PNS seolah abaikan tugas di daerah ini pasca pilkada. Namun fakta kini, sidang MK memutuskan menolak gugatan perselisihan hasil pilkada yang diajukan AMAL dan ASLI. Hal itu terkuak saat sidang pengucapan putusan perkara Sengketa Pilkada Subulussalam dengan Perkara No.184/PHPU.D-XI/2013 dan 184/PHPU.D-XI/2013 di ruang sidang Pleno MK di Jakarta, pekan kedua Februari 2014. Hasilnya, MK membatalkan Keputusan Komisi Independen Pemilihan (KIP) Subulussalam No.53 tahun 2013 tanggal 4 November tentang penetapan pemilihan walikota dan wakil walikota terpilih. MK mengesahkan putusan hasil penghitungan suara ulang enam TPS dalam Kec. Simpang Kiri serta pemungutan suara ulang di Desa Namo Buaya, Kec. Sultan Daulat, per 30 Desember 2013. Disimpulkan, permohonan yang mendalilkan berbagai pelanggaran pilkada ulang Subulussalam tidak terbukti secara hukum. Termohon telah melaksanakan penghitungan dan pemungutan suara ulang secara jujur dan adil. KIP Subulussalam diperintahkan melaksanakan putusan itu. Fakta kini, kisruh Pilkada Subulussalam telah terjawab. MK memutuskanMerahSaktidanSalmazamerupakanpemenang.Masyarakat pun berharap, pelantikan keduanya tidak menjadi penantian panjang. Khairul Boangmanalu


Agenda

B8 06:00 GO SPOT 07:30 Dahsyat 10:30 INTENS 11:00 SILET 12:00 SEPUTAR INDONESIA SIANG 12:30 BUKA - BUKAAN 14:00 Indonesian Idol 16:00 CEK AND RICEK 16:30 SEPUTAR INDONESIA 17:00 CINTA ANAK CUCU ADAM 19:15 ANAK - ANAK MANUSIA 21:00 TUKANG BUBUR NAIK HAJI THE SERIES 22:30 Box Office Movie

CATATAN

06:30 SL Inbox 08:45 Halo Selebriti 10:00 SCTV FTV Pagi 12:00 SL Liputan 6 Siang 12:30 SCTV FTV Siang 14:30 SL Eat Bulaga Indonesia 16:30 Liputan 6 Petang 17:00 Get Married The Series 2 18:15 Diam-Diam Suka 19:45 Tiba-Tiba Cinta 21:00 Emak Ijah Pengen Ke Mekah 22:30 I Like This

07:00 Animasi Spesial 07:30 Animasi Spesial 08:30 Mister Maker Comes To Town 1 09:00 Pose 09:30 Layar Unggulan 11:00 Diantara Kita 11:30 Lintas Siang 12:00 Layar Kemilau 14:00 Tuntas 14:30 Lintas Petang 15:00 Animasi Spesial 16:30 Animasi Spesial3 17:30 Tendangan Si Madun Returns 18:30 Mnctv Sport Platinum-1 21:00 Raden Kian Santang 22:00 Suka-suka Uya 23:30 Cerita Pilihan 00:30 Midnite Great Sale 01:00 Lintas Malam

08:25 Curious George 08:55 Gon 09:25 Little Krisna 11:25 Topik Siang 11:55 Seputar Obrolan Selebriti 12:55 Mr. Bean 13:25 Tom & Jerry 13:55 Bima Sakti 14:25 Little Krishna 14:55 Bernard Bear 15:25 Curious George 15:55 Gon 16:25 Marsha & The Bear 16:55 Pesbukers 19:25 Campur-Campur 20:25 Pesbukers Best Of The Best 21:55 Sinema Spesial 23:55 Cakrawala

07:30 Semarak Sinema Spesial 08:30 Sinema Pagi 10:30 Live Kiss Pagi 11:30 Live Patroli 12:00 Sinema Pintu Taubat Siang 14:00 Hot Kiss 15:00 Live Fokus 15:30 Trending Topic 16:30 Berani Nekat 17:00 New Famili 100 18:00 Audisi D’Academy 20:00 Sinetron Unggulan : Bara Bere 21:00 Sinetron Unggulan 22:00 Sinema Unggulan

08:05 8 Eleven Show 12:00 Metro Siang 13:00 Wideshot 17:00 Metro Hari Ini 18:00 Prime Time News 19:30 Lebih Dekat 20:05 Mata Najwa 21:30 Otoblitz 22:00 Top 9 News 2 2 : 3 0 St a n d Up Comedy Show 23:05 Realitas 23:30 Metro Sport

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

Andi rif

Rabu 19 Maret 2014

07:30 Saatnya Kita Joged 09:30 Sinema Indonesia Pagi 11:00 Insert 12:00 Bioskop Indonesia Premiere 14:00 Sketsa 14:45 Insert Investigasi 15:15 Show Imah 16:45 Reportase Sore 17:30 Oh Ternyata 18:30 Slide Show 19:30 YKS 22:30 Bioskop TransTV 01:00 Reportase Malam

07:00 Live News Apa Kabar Indonesia Pagi 09:30 Live News Kabar Pasar Pagi 10:00 Coffee Break 11:30 Live News Kabar Siang 13:30 Ruang Kita 14:30 Live News Kabar Pasar 15:30 Live News Kabar PEMILU 16:30 Sorotan Kasus 17:00 Live News Kabar Petang 19:00 Meja Bundar 20:00 Live News Apa Kabar Indonesia Malam 21:00 Live News Kabar Malam 22:00 Menyingkap Tabir 22:30 Kabar Arena

08:00 Kungfu Panda 08:30 Chuggington 09:00 Sketsa Tawa 09:30 Hot Spot 10:00 Obsesi 11:00 Buletin Indonesia Siang 12:00 Siang Seru Sama Sule 14:00 Seleb On Cam 14:30 Spot On 15:00 Fokus Selebriti 15:30 Lawan Tawa 16:30 Ada Ada Aja 17:30 Spongebob Squarepants 19:00 Big Movies 21:00 Big Movies 23:00 Big Movies

07:30 Selebrita Pagi 08:15 Spotlite 09:15 Syafa’at 10:00 Ceplas Ceplos LIVE 11:30 Redaksi Siang 12:00 Selebrita Siang 12:45 Laptop Si Unyil 13:15 Bocah Petualang 13:45 Dunia Binatang 14:15 Tau Gak Sih 14:45 Mancing Mania 15:15 Jejak Petualang 15:45 Orang Pinggiran 16:15 Redaksi Sore 17:00 Opera Van Java 18:30 Hitam Putih 19:30 On The Spot 20:30 CCTV 21:15 ILK (Indonesia Lawak Klub) 22:15 Bukan Empat Mata 23:30 Dua Dunia 01.00 Redaksi Malam **m31/G

Kekasih Mick Jagger Bunuh Diri

Andi /rif Mainkan Datuk Maringgih Andi /rif tidak memungkiri peran Datuk Maringgih lekat dengan nama mendiang HIM Damsyik. HIM Damsyik berperan sebagai Datuk Maringgih pada sinetron Siti Nurbaya ditayangkan TVRI tahun 1992. Andi kini mendapatkan peran yang sama pada drama musikal Siti Nurbaya (Kasih Tak Sampai) arahan Denny Malik. Andi mengaku bahwa sutradara membebaskannya menginterpretasi Datuk Maringgih sesuai dengan pandangannya. “Mereka membebaskan saya cari style saya sendiri selama cocok sama saya,” kata Andi saat jumpa pers di Galeri Indonesia Kaya. “Saya ingin tetap licik, jahat, genit, tapi elegannya ada,” katanya saat ditemui usai jumpa pers. Karakter Datuk Maringgih memegang peranan besar dalam cerita lama tersebut. “Cerita ini nggak ada kan, kalau nggak ada Datuk Maringgih,” cetusnya. Ia ingin begitu melihat sosoknya, penonton tidak lagi memikirkan sosok sebelumnya pernah menjadi Datuk Maringgih. Ia bahkan senang jika nanti ada yang memanggilnya “Datuk Maringgih”. Karena artinya, ia sukses memerankan karakter tersebut. Ini adalah ketiga kalinya Andi ikut dalam lakon teater. Sebelumnya, ia pernah terlibat dalam Rock Opera dan Diana (2010).(ant)

WASPADA

Trio Idol terdiri Karin, Rosa dan Dera

Film Kesurupan Setan :

Horor Remaja Berbumbu Musikal TAK percuma Sutradara Subakti IS memasang tiga bintang utama wanitanya Rosa – Dera Siagian – Karin berlatar belakang penyanyi dalam film horor garapan terbarunya bertajuk “Kesurupan Setan” (KS) menayang di bioskop tanah air mulai 17 April 2014 mendatang. Sebab, berkat keterlibatan penyanyi belia jebolan Indonesian Idol 2012 itu, sineas kawakan sebelumnya sukses besar menggarap sinetron remaja habis tayang RCTI - Pernikahan Dini, siap menyuguhkan film horor remaja berbumbu musikal. “Tak selamanya film horor identik dengan bumbu penye-

dap adegan seks. Lewat film KS saya akan membuktikan dengan formulasi baru – horor remaja berbumbu musikal, tetap menarik ditonton,” papar Subakti IS kepada Waspada di Jakarta, baru-baru ini. Menurutnya, pihaknya sengaja tak menyuguhkan gambar-gambar sensual dan vulgar lantaran penonton utama yang sasar adalah para remaja, “Saya optimis lewat serangkaian adegan menegangkan yang dibangun dari kekuatan skenario film plus bumbu sedikit drama musikal film menampilkan bintang utama Cicio Manassero plus tiga artis debutan berlatar belakang penyanyi – Rosa, Dera

dan Karin, akan menjadi magnet kuat yang menarik remaja penggemar film horor untuk berbondong-bondong ke bioskop” tandas Subakti. Keterlibatan tiga biduan jebolan Indonesian Idol 2012, tampaknya dengan jeli dimanfaatkan secara optimal sang sutradara yang juga sukses menggarap sinetron “Tendangan Dari Langit” The Series ini. Kepiawaian berolahvokal Rosa, Dera dan Karin tak pelak bakal menjadi bumbu penyedap film“Kesurupan Setan” produksi PT. Ganesha Perkasa Film ini. “Trio Rosa – Dera dan Karin akan melantunkan Theme Song film bertajuk Sahabat bernuansa pop . * (AgusT)

Mick Jagger bersama L’Wren Scott/rtr Perancang busana L’Wren Scott, kekasih vokalis band legendaris Rolling Stones Mick Jagger, ditemukan meninggal du-

nia karena bunuh diri di apartemennya di Manhattan, kata polisi setempat seperti dikutip Reuters.

Scott, mantan model busana rancangannya menjadi favorit para bintang Hollywood kelas atas seperti Nicole Kidman, Amy Adams dan Penelope Cruz, ditemukan gantung diri dengan menggunakan sebuah syal. “Kami menginvestigasinya sebagai bunuh diri,” katra detektif polisi New York Kelly Ort. Polisi mengaku mendapatkan informasi awal bahwa Scott berusia 49 tahun namun belum dikonfirmasi keluarganya. Jagger,70 melalui juru bicaranya, mengaku sangat terkejut dan terguncang, sedangkan keluarga Scott mengeluarkan pernyataan permintaan privasi. Pasangan glamor ini berkencan sejak 2001 dan sering terlihat pada berbagai acara selebritis. Perempuan bertubuh tinggi menjulang melewati tinggi tubuh Jagger. Kabar ini mengguncang Nicole Kidman yang menjadi temannya selama 25 tahun dan tak bisa mengatakan apa-apa, sebut juru bicara Kidman. Kematiannya menyusul rangkaian kematian dua raksasa dunia fesyen diketahui mati bunuh diri, yaitu perancang Inggris Alexander McQueen yang depresi lalu bunuh diri di London pada Februari 2010 dalam usia 40 tahun, sedangkan teman dekatnya, editor fesyen Inggris Isabella Blow meninggal dunia pada 2007 pada usia 48 tahun. Scott menjadi salah satu perancang paling terkenal NewYork dalam dekade terakhir.(ant)

Super Junior M Rilis Album Baru Di China

Super Junior-M/wordpress.com

Kelompok boyband K-pop Super Junior-M kembali dengan merilis album baru di negara-negara berbahasa China pekan ini. Super Junior-M akan mengunggah mini album ketiga berjudul Swing ke berbagai layanan musik daring di China pada Jumat, kata SM Entertainment, Selasa, seperti dikutip kantor beritaYonhap. Kelompok itu adalah subkelompok ketiga dan paling sukses dari boy-band 13-anggota Super Junior terdiri dari Siwon, Donghae, Ryeowook, Kyuhyun, Eunhyuk, Henry dan Zhou Mi. Swing adalah album pertama akan dirilis kelompok itu sejak album Break Down Januari tahun lalu. Pendapatan Break Down berada di posisi nomor satu Tangga Album Dunia Billboard Amerika Serikat sejak dirilis. Menjelang rilis album baru, sebuah teaser berjudul sepotong album dengan nama yang sama akan diunggah di YouTube serta jejaring sosial dan laman berbagia video China pada Selasa.(ant)

Sandro Tobing Ultah Ke-51

Trio Libels Konser Di Medan Merayakan Ultah ke-51, Sandro Tobing sengaja mengundang teman-teman dekatnya semasa taman kanan-kanak Immanuel Medan serta kerabatnya setelah penyanyi era 80an ini tumbuh dewasa. Suasana heboh penuh canda mewarnai aksinya saat ia meniup lilin di Dr Koffie Senin (17/3) malam. Kerabat showbiz nya sekarang di Medan Mercy Panggabean serta Melina Efi Zahra, SS berada disampingnya turut membantunya meniup lilin. Sandro Tobing sendiri malam itu tampak ceria, ia mengenalkan satu persatu teman sekolahnya mulai orang pertama yang dikenalnya saat masuk TK Immanuel sampai rekannya sekarang banyak membantu karirnya termasuk show-biz mulai dirintisnya di Medan. Biasanya, kata orang tua, ujar Sandro, perayaan Ultah diperingati harus ada angka satunya. Misalnya 11 tahun terus berlanjut ke 21,31,41,51 dan sete-

rusnya, disambut geer para tamunya yang sengaja datang memenuhi undangannya. Tak cuma meniup lilin, Sandro pun menyumbangkan suara emasnya sambil mengajak kerabatnya berduet menyanyikan sebuah lagu khas Ambon. suasana tambah seru dan heboh, apalagi pembawa acara Dewa yang notabene teman dekat Sandro cukup sukses menghidupkan suasana hingga menu makanan pun terpaksa bertambah terus. Datangkan Trio Libels Sandro Tobing lahir di Medan, 17 Maret 1963 pernah menjuarai Bintang Radio dan Televisi pada era 1980-an. Di samping menyanyi ia juga membintangi beberapa judul sinetron serta film diantaranya Perkawinan 83 (1982), Pengantin Pantai Biru (1983) dan Cinta di Balik Noda (1984). Sementara albumnya meliputi Menggapai Cita (1981), Aisyah

duet bersama Maya Rumatir, 1983, Nuansa Kasih (1989) dan Biarlah (1994). Kepada wartawan yang turut diundangnya merayakan Ultahnya ke-51, Sandro Tobing bersama mitra show-biznya Mercy Panggabean serta Melina Efi Zahra, SS merencanakan mendatangkan trio Libels ke Medan 26 April mendatang. Konser Trio Libels merupakan kelanjutan program yang sukses mereka gelar di malam Valentine kemarin. Kedatangan Trio Libels ke Medan memang diprakarsai ketiga orang tersebut yang berada di bawah naungan DMC Production. Trio Libels kata Sandro, merupakan kebanggaan bangsa ini, karena mereka adalah pelopor lahirnya boyband di Indonesia. Sekarang Trio Libels terdiriYani, Ronny Sianturi dan Edwin Manansang lagi mempersiapkan album terbarunya Senandung Cinta. Konser Trio Libels sendiri bakal dilaksanakan di Wesley

Mercy Panggabean, Sandro Tobing dan Melina Efi Zahra SS saat merayakan HUT Sandro Tobing ke-51 Senin (17/3) malam Cafe Jl Sei Sira Medan. Dengan kedatangan Trio Libels nantinya menjadi awal DMC menggelar panggung musik nostalgia secara berkala di Medan dengan ko-

nsep cafe. Artinya mereka mencoba meramu sebuah pertunjukan musik tanpa batas atau jarak antara artis dengan fansnya.

“Fans bisa menyaksikan idolanya bernyanyi dengan jarak yang dekat sekali, tidak seperti biasanya harus ada garis pemisah”, ujar Mercy Panggabean.(m19)

Para bintang Hollywood Star Wars

Hollywood StarWars, Serunya Penata Gaya Selebrita Amerika Kagum dan jatuh cinta dengan gaya berbusana selebritis Hollywood? Tahukah bahwa penampilan super keren para selebritis yang acap membuat lidah berdecak itu ternyata tidak mereka lakukan sendiri, pastinya ada sosok ahli di balik itu semua, yaitu mereka berprofesi sebagai penata gaya. Hollywood Style Wars, sebuah program ditayangkan di beTV mulai 19 Maret, tiap hari Rabu, Kamis dan Jumat pukul 19.30 dapat disaksikan di Indovision ch. 155, Telkomvision ch. 126, First Media ch. 53, Big TV ch. 271, dan Aora ch. 416 memperlihatkan pekerjaan dan kehidupan penata para gaya selebrita dan sosialita, menampilkan penata gaya para pesohor yaitu Taylor Jacobson, Brett Alan Nelson dan duo Sammy & Judy Taylor Jacobson, penata gaya mulai dikenal publik ketika ia bekerja untuk Rachel Zoe. Melalui reality show dibawakan Rachel yaitu The Rachel Zoe Project, reputasi Taylor pun masuk dalam perhitungan sehingga ia berpikir memulai karirnya secara mandiri. Bersama sahabat-sahabatnya seprofesi yaitu Brett Alan Nelson seorang penata gaya dari sebuah agensi ternama telah menjadi langganan selebriti seperti Kat Graham hingga Jennifer Lopez, duo “The Kids” digawangi Sammy dan Judy, serta Ashely Zohar mereka merancang sebuah program TV tentang seluk-beluk dunia para penata gaya kaum selebrita dan sosialita Hollywood. Sempat tercipta sebuah program namun mengalami perubahan juga karena hengkangnya Ashley, akhirnya lahir program nan unik Hollywood Style Wars, sebuah acara mengikuti bagaimana lika-liku, sepak terjang, kehebohan juga keseruan pekerjaan dan kehidupan para penata gaya di balik layar gemerlapnya Hollywood. “Orang sudah terbiasa melihat penampilan selebrita dan kehidupan realitanya, jadi konsep kehidupan penata gaya kaum selebrita aku rasa akan terlihat sangat menarik di mata penggemar fesyen juga fans para selebrita itu sendiri,” kataTaylor yang berambut pirang keperakan ini menerangkan tentang Hollywood Style Wars. Memang benar bahwa banyak sekali acara realita di TV mengenai kaum selebrita dan sosialita, namun tidak ada acara menayangkan tentang kehidupan sehari-hari penata gaya. “Kehidupan penata gaya itu sangatlah dinamis. Menurutku penonton bisa belajar banyak tentang seluk-beluk menata gaya, juga menambah wawasan mereka dalam berbusana,” .(m19)


Aceh

B10

WASPADA Rabu 19 Maret 2014

Honorer K-2 Kembali Datangi Kantor Bupati IDI (Waspada): Seratusan massa yang mengatasnamakan dari Pemuda dan Mahasiswa serta Forum Honorer Katagori II (FHK-II) kembali mendatangi Kantor Bupati Aceh Timur yang berada di Komplek Pusat Pemkab Aceh Timur, Senin (17/3). Meskipun kedatangan massa disambutSekdaAcehTimurM.IkhsanAhyat,S.STP,M.AP, namunmassatetapmenungguBupatiAcehTimur Hasballah HM.Thaib hingga sore. Massa dalam orasinya antara lain menuntut pembatalan SK Menpan RB atas kelulusan CPNS Formasi Honorer K-II, karena massa menganggap peserta tes CPNS yang lulus adalah para tenaga

honorer yang tidak mengabdi dan berbakti. Massa juga meminta Inspektorat setempat untuk melakukan verifikasi ulang terhadap seluruh honorer yang masuk dalam database K-II. “K-II itu milik kami dan formasi yang tersedia melebihi dari jumlah kami yang sisa dari K-I, bukan milik orangorang tidak mengabdi tapi mereka lulus,” teriak salah seorang massa. Sekda AcehTimur M. Ikhsan Ahyat,S.STP,M.AP dihadapanmassahonorerK-IImengaku,sisahonorer K-II yang tidak lulus berdasarkan pengumuman KemenpanRBsudahdidataulangdanakandikirim ke Jakarta untuk mencari solusi terbaik. (b19)

Seminar Nasional Biotik 2014

Waspada/Musyawir

MASSA dari honorer K-II yang tidak lulus CPNS kembali mendatangi Kantor Setdakab Aceh Timur di Komplek Pusat Pemkab Aceh Timur di Idi, Senin (17/3).

150.246 Peserta UN 2014 Di Aceh BANDA ACEH (Waspada): Dinas Pendidikan Aceh gelar sosialisasi Ujian Nasional (UN) tahun 2014 yang akan diikuti peserta jenjang SMA/ MA/SMK/SMALB sebanyak 57.759 orang, dan Paket C sejumlah 3.959 orang serta SMP/MTs/SMPLB 85.748 orang, Paket B 2.780 orang. “Sosialisasi ini dimaksudkan untuk memberikan penjelasan tentang pelaksanaan Ujian Nas-

sional Tahun 2014 kepada pemangku kepentingan pada Dinas PendidikanProvinsi,DinasKabupaten/Kotadanlembaga/instansi terkait,” ujar Bahrum Yacob. Ketua UN Aceh 2014 ini pada pembukaan sosialisasi tersebut, Senin (17/3) di Banda Aceh menambahkan tujuan sosialisasi itu agar pelaksanaan Ujian Nasional di Aceh dapat berjalan baik dan sukses. “Sukses pelaksanaan juga sukses hasil,” cetusnya. Peserta sosialisasi itu, selain diikuti 23 Kepala Dinais Pendidikan kabupaten/kota juga Ketua dan Bendahara UN kabupaten/

UN SMP, MTS Bireuen Diikuti 7.514 Peserta BIREUEN (Waspada): Ujian Nasional SMP, MTS Negeri dan Swasta Kabupaten Bireuen yang akan berlangsung 5 Mei 2014 diikuti 7.514 peserta terdiri dari 3.702 siswa dan 3.812 siswi. Peserta UN berasal dari 59 SMPN, 8 SMP Swasta, 10 MTsN dan 13 MTS Swasta yang tersebar di 17 Kecamatan dalam Kabupaten Bireuen Kadis P dan K Bireuen Drs Nasrul Yulianyah M Pd, melalui Kabid Dikmenjur Drs T Syukri M Pd (foto) menjelaskan hal itu menjawab pertanyaanWaspada di ruang kerjanya Senin (17/3). Dikatakan, dari 59 peserta UN SMPN, SMPN-2 Bireuen mendominasi peserta UN tertinggi mencapai 309 peserta, disusul SMPN-3 Bireuen 276, SMPN-1 Peusangan 253, SMPN-1 Bireuen 233, SMPN-4 Bireuen 231, SMPN-1 Samalanga 206, SMPN-1 Juli 186, SMPN-1 Jeunieb 176. SMPN-1 Gandapura 144, SMPN-2 Peusangan 143, SMPN3 Peusangan 130, Peserta UN SMPS tertinggi, SMPS Ummul Aiman Samalanga 342 peserta dan SMPS Muslimat Samalanga 131 peserta. SementarapesertaUNMTSNtertinggi,MTsNModelGandapura 292 peserta, MTsN Matang Glumpang Dua 275, MTsN Bireuen 238, MTsN Kuta Blang 138, MTsN Samalanga 130, MTsN Peudada 130, MTsN Jeunieb 126, MTsN Peusangan 120, MTsN Ulee Glee Kecamatan Makmur 100 peserta. Peserta UN MTS Swasta tertinggi, MTSS Al Zahrah Juli Teupin Mane, Sedangkan peserta UN SMPN, SMPS, MTsN dan MTsS lainnya masih dibawah 100 peserta, ujar T Syukri. (b12)

Pejabat Eselon III Dilantik BLANGKEJEREN (Waspada): Bupati Gayo Lues H. Ibnu Hasim melalui Kepala Dinas Pengairan Kabupaten Gayo Lues, Maliki SE, melantik satu pejabat eselon III di lingkungan Kantor Dinas Pengairan, Selasa (18/3). Pejabat eselon III itu, adalah Purnama Jaya, ST sebagai Kabid Bina Program dan Pelaporan. Maliki mengatakan pejabat yang dilantik berdasarkan keputusan Badan Pertimbangan Jabatan dan Kepangkatan (Baperjakat) dalam bentuk promosi dan mutasi. “Promosi dan rotasi jabatan PNS adalah hal biasa dan untuk pembinaankarir.JabatanbukanlahhakPNStapimerupakanamanah dari pimpinan yang dipercayakan kepadanya,” ucapnya menambahkan. (cjs)

kota sebanyak 26 orang, serta petugas monitoring dari Disdik Aceh sebanyak 46 orang. Pelaksanaan Ujian Nasional (UN) untuk tingkat SMA/MA, SMALB, SMK, Paket C akan dilangsungkan pada 14–16 April 2014, disusul tingkat SMP/MTs, SMPLB dan Paket B yang akan

mengikuti Ujian Nasional serentak pada tanggal 5-8 Mei 2014. Sedangkanujiansekolahbagi siswaSD/MI,danSDLBsebanyak 95.880 orang serta Paket A/Ula sebanyak320orangakanberlangsung pada 19-21 Mei 2014. “Berbagai komponen yang terkait dengan pelaksanaan UN tentunya

telahdipersiapkanuntukkesuksesan pelaksanaan dan hasil ujian tersebut,” cetusnya. Begitupun, imbuhnya, guru dan siswa merupakan komponen inti dan menjadi sasaran utama dalam mempersiapkan diri agar siswa mereka sukses dalam menghadapi Ujian Nasional. (b06)

APBK Aceh Utara 2015 Diperkirakan Rp1,68 T ACEH UTARA (Waspada): Pada acara Musyawarah Pembangunan (Musrembang) di Balai Desa Kecamatan Baktya, Senin (17/3) pagi, Zulkifli, Kepala Badan PerencanaanPembangunanDaerah (Bappeda) di hadapan masyarakatmengatakan,padatahun 2015 APBK Aceh Utara diperkirakan mencapai Rp1,68 T. Jumlah anggaran sebanyak itu difokuskan untuk pembangunan peningkatan sarana dan prasarana pertanian, irigasi, kesehatan, pendidikan dan pembangunan rumah dhuafa. “Para mukim, para geusyik perlu mengetahuirencanaanggaranuntuk tahun2015untukKecamatanBak-

tya sebesar Rp3 miliar,” kata Ir. Zulkifli, MTP, Kepala Bappeda Aceh Utara. Wakil Bupati Aceh Utara Muhammad Jamil, M.Kes mengatakan jumlah jembatan gantung di Kabupaten Aceh Utara 42 unit sudah selesai dibangun pada tahun 2014, begitupun jika masih ada jembatan gantung yang belum direhab diminta untuk diusulkan melalui Musrembang. Pada tahun 2015 sebut M. Jamil, Pemerintah Kabupaten Aceh Utara menuntaskan pembangunan jalan Matang LinyaKeude Alue Ie Puteh, Baktya. Kemudian, persoalan pendidikan di Kabupaten Aceh Utara harus

menjadi prioritas, pengurangan pengangguran dan pengurangan kemiskinan. M. Jamil pada kesempatan itu juga menyebutkan, Pemerintah Aceh Utara sudah menambah biaya makan anak yatim yang dibinadiPantidariRp4ribumenjadi Rp8 ribu. Kemudian dia menyebutkan, arah kebijakan umum infrastruktur tahun 2015 adalah pembangunandanpemeliharaan infrastruktur irigasi, pembangunan infrastruktur jalan dan jembatan, penyediaan perumahan layak huni bagi keluarga miskin danpenyediaansaranadanprasarana air bersih, serta sanitasi lingkungan. (b18)

bermanfaat bagi mahasiswa yang telah melakukan observasi untuk menuliskan laporan ilmiahnya, hasilnya dapat dipertanggungjawabkan kepada publik, peserta seminal mencapai 500 orang lebih, dan mengahadirkan sejumlah narasumber yang ahli di bidangnya. “Yang menjadi Keynote Speaker pada seminar ini di antaranya, Prof Dr Tati Suryati Syamsudin Subahar, (Guru Besar ITB), Dr Djufri (Dekan FKIP Unsyiah) Dr Ian Sigelton, Asril Abdullah dan beberapa narasumber lainnya,” ujar Dekan. Sementara Rektor Prof Dr FaridWajdi Ibrahim dalam sambutannya menyampaikan, sejak UIN diresmikan banyak aktivitas dosen dan mahasiswa telah dilaksanakan, baik sifatnya internal maupun tingkat nasional, dan pimpinan memberikan penghargaan yang tinggi. (b04)

Jepang Akan Jual Hasil Nuklir PLTN Pada Indonesia LHOKSEUMAWE (Waspada ): Pasca tragedi gempa dan tsunami yang meluluh lantak negeri sakura, kini Jepang akan menjual hasil reaktor nuklir untuk kebutuhan PLTN Indonesia atau negara Asia lainnya. Hal itu diungkapkan Profesor Sasaki Hiroshi dari Universitas Niigata Japan Senin (17/3) di hadapan ribuan mahasiswa dan pelajar dalam forum diskusi international terbuka yang berlangsung kemarin di aula lantai tiga Universitas Al – Muslim Matang Geulumpang, Kecamatan Peusangan, Kabupaten Bireuen. Sasaki mengatakan pasca musibah tsunami ternyata bukan hanya menyisakan rasa trauma yang mendalam bagi korbannya dan masih terasa dalam jangka waktu yang lama. Bahkan juga meninggalkan dampak buruk bagi masyarakatnya atas kerusakan lingkungan dan kesehatan fisik yang ditimbulkan oleh kebocoran radio aktif dari reaktor nuklir setelah diterjang tsunami. Masyarakatnya pun telah merasakan jera serta kesulitan dalam menghadapi bahayanya nuklir. “ Negara Japan akan menjual nuklirnya kepada negara Indonesia, negaraVietnam atau negara Asia lainnya bila dibutuhkan,” ujarnya dalam bahasa Japan yang diterjemahkan oleh Sekretaris General NINDJA Saeki Natsuko. Rencana penjualan nuklir ini muncul lantaran masyarakat Japan pada umumnya tidak setuju lagi dengan penggunaan nuklir PLTN. Dimana

pasca tsunami kebocoran radio aktif dari reaktor telah menimbulkan efek buruk yang luar biasa. Antara lain telah merusak kesehatan fisik dengan timbulnya penyakit dan cacat fisik, lahan pertanian sudah tidak bisa lagi dimanfaatkan lagi secara sehat,ikan hasil tangkapan nelayan tidak bisa dikonsumsi sampai hari ini. Karena telah mengandung atau terkontaminasi oleh radio aktif. Akan tetapi, lanjut Sasaki, sedangkan kalangan pengusaha bisnis di Jepang justru ingin mempertahankan pemanfaatan nuklir PLTN demi keuntungan perusahaan agar tidak mengalami kerugian. Sehingga alasan tersebut menjadi latar belakang bagi Japan untuk menjual nuklirnya kepada negera tetangga yang membutuhkan. Rektor Universitas Al- Muslim Amiruddin Idris melalui Kabag Humasnya Zulkifli kepada Waspada mengatakan pada kesempatan itu pihaknya menerima kunjungan Profesor Sasaki Hiroshi beserta sebelas mahasiswi dari NIIGATA University Of International and Information Studies Jepang. Dijelaskannya,kedatanganmerekajugadijembatani oleh sebuah Lembaga NINDJA (Network for Indonesian democracy,Japan) yang berkedudukan di Tokyo. Menurutnya, kehadiran mereka bertujuan mempelajaribudayaAceh,belajartariantradisional Aceh dan politik yang mewarnai kehidupannya. “Merekasaatiniditempatkandirumahmasyarakat di Desa Kyotamba. (b16)

Dishub Bireuen Belum Mampu Tertibkan Parkir BIREUEN(Waspada):Kondisi parkir mobil dalam kota Bireuen masih amburadul sehingga sangat menggangu keselamatan bagi pengguna jalan. Dinas Perhubungan Bireuen terkesan banci dalam menertibkan parkir kenderaan di beberapa ruas jalan dalam kota Bireuen yang sudah dipasang rambu-lalu lintas dilarang parkir. Mobil masih parkir seenaknya tanpa mengindahkan peraturan lalu lintas. AmatanWaspada ruas jalan yang masih amburadul parkirnya yaitu jalan keluar terminal bus Bireuen setiap hari sudah dijadikan tempat parkir mini bus penumpang L-300, mini bus pe-

numpang lainnya menaikkan dan menurunkan penumpang di ruas jalan terlarang. Ironis lagi setiap mini bus penumpang berhenti menurunkan penumpang di badan jalan, berdatanganlah penarik betor dan RBTmencaripenumpangsehingga suasana menjadi semrawut. Ruasjalanlainnyayangmasih amburadul Simpang IV hingga Simpang Telkom lintas Jalinsum yang setiap saat padat arus lalu lintas. Begitu pula depan Pendopo menuju jalan Rumah Sakit Umum dr Fauziah setiap hari masih padat parkir kenderaan pribadi, mobil pick up, truk ba-

rang yang mengangkut sayur mayur ke pasar pagi. Selain itu setiap pagi masih kedapatan mobil pick up barang pedagang berjualan durian dan buah-buahan lainnya di sepanjang jalan terlarang depan Rumah Sakit Umum dr Fauziah. Kadishub Bireuen RadenYus Rusmadi ST yang ditemui Waspada di kantornya mengatakan, akan menurunkan tim gabungan untukmenindaktegas pengemudi yang masih membandel dengan parkir di tempat terlarang. Entah kapan tim akan turun namun dalamkenyataannyaparkirdalam kota Bireuen masih amburadul. (b12)

Disperindag Aceh Jajaki Ekspor Kopi Ke Nigeria BANDA ACEH (Waspada): Dinas Perindustrian dan Perdagangan (Disperindag) Aceh jajaki ekspor kopi ke pasar Nigeria dan sembilan negara Afrika lainnya. Hal ini disampaikan Kepala Disperindag Aceh Safwan usai pertemuan dengan Kepala Indonesia Trade Promotion Centre (ITPC) Lagos-Nigeria, Pontas Tobing dan sejumlah produsen dan eksportir kopi di Banda Aceh. Dalam pertemuan tersebut, Kepala ITPC Lagos-Nigeria Pontas Tobing mengungkapkan, negara-negara Afrika pada umumnya sangat menyukai kopi. “Kalau warga Nigeria, kebanyakan dari merekakonsumsikopidalambentukkemasanatausachet,”katanya. Dijelaskannya, dengan jumlah penduduk yang mencapai 180 juta jiwa, Nigeria adalah pasar potensial saat ini. Ia menyebutkan, kebutuhan kopi dalam kemasan di negeri Afrika tersebut, naik 12 persen tiap tahunnya, dengan total impor kopi Nigeria saat ini mencapai 12,43 juta dolar pertahun. Karenanya,sambungPontas,sebagaipenghasilprodukkopiterbaik didunia,AcehharusberperandanmenjajakipeluangpasardiNigeria. “Kami siap fasilitasi pengusaha atau eksportir kopi dari Aceh yang ingin mencoba jajaki pasar kopi di Nigeria,” tukasnya. Menyahuti hal tersebut, Kadis Perindag Aceh Safwan menerangkan, dalam beberapa pekan ke depan dirinya akan mengirimkan contoh produk kopi Aceh dalam kemasan ke Nigeria. “Aceh juga punya produk kopi dalam kemasan, seperti kopi ulee kareng, dan tengku Aceh,” ujarnya. Selain kopi, tambah Safwan, pihaknya juga akan menjajaki pasar fish product, atau ikan dalam kemasan ke Nigeria. “Informasi dari ITPC warga di sana juga menyukai produk ikan kemasan, dan Aceh punya produk tersebut, yakni ikan keumamah,” paparnya. Kedepan, lanjut Safwan, pasar Afrika akan menjadi perhatian pihaknyadalammeningkatkaneksporprodukunggulanAceh.(cb01)

BANDA ACEH (Waspada): Program Studi Pendidikan Biologi Fakultas Ilmu Tarbiyah dan Keguruan (Prodi Biologi FITK) Universitas Islam Negeri (UIN) Ar-Raniry Banda Aceh menggelar Seminar Nasional Biotik 2014. Seminaryangmengangkattema“PeranBiodiversitassebagaiMediaPembelajaranBiologidalam Implementasi Kurikulum 2013” itu berlangsung 17 hingga 18 Maret 2014 di Auditorium Prof Ali Hasjmy. Dekan FITK UIN Ar-Raniry Dr Mujiburrahman, MA, mengatakan, Seminar Biotik ini sangat dibutuhkan oleh mahasiswa jurusan biologi UIN Ar-Raniry, mengingat di UIN harus dilakukan integrasi ilmu antara teori-teori umum dan keIslaman. Dia menambahkan, seminar ini juga dapat

Waspada/H.AR Djuli

RAMBU LARANGAN: Sejumlah kendaraan pribadi dan minibus penumpang masih membandel parkir di tempat terlarang, pada hal jalan itu menuju keluar terminal bus Bireuen.

Waspada / Zainuddin Abdullah

TARIAN JAPAN: Sebelas mahasiswi dari NIIGATA University Of International and Information Studies Jepang menampilkan tarian kreasi budaya Aceh yang berlangsung di aula lantai tiga Universitas Al - Muslim Peusangan Kabupaten BIreuen, Senin (17/3).

Islam Berkontribusi Bagi Peradaban Umat LANGSA (Waspada): Islam berarti selamat, damaidanteduh.Perjalananpanjangmembingkai Islam sebagai sebuah agama yang rahmatan lil‘alamin. Itu artinya Islam bukan hanya rahmat, damai dan teduh buat orang-orang Islam semata, tetapi juga buat semua makhluk ciptaan Allah yang ada di semesta alam. Demikian dikatakan Wakil Ketua I Majelis Permusyawaratan Ulama (MPU) Kota Langsa, Al Ustadz Dr H Zulkarnain, MA saat ditemui wartawan, Senin (17/3). Menurutnya, dengan bingkai berfikir seperti itu, Islam tersebar ke seluruh penjuru ufuk, terbentang dari timur ke barat, dan dari utara ke selatan sehingga hari ini jumlahnya mencapai 22,43 persen dari 7.021.836.029 jiwa penduduk dunia. Penyebaran Islam dengan nuansa keteduhan dan mengedepankan sentuhan hati serta diiringi langkah-langkah strategis yang sistematis dan logis, diyakini akan lebih bisa diterima dan akan mampu bertahan secara perenialis (mengabadi) pada diri umat Islam itu sendiri. Dosen Hadits dan ‘Ulumul Hadits STAIN Zawiyah Cot Kala Langsa itu melanjutkan, syariat Islam beserta peradabannya yang besar tidak lahirsepertimembaliktelapaktangan,didalamnya ada proses, ada kearifan-kearifan, lokal maupun universal, ada dinamika, ada sentuhan-sentuhan spesifik yang membuatnya menjadi peradaban

besar yang kemudian berkontribusi besar bagi peradaban umat dan dunia. DalammenegakkanSyariatIslam,janganterjebak hanya kepada simbol-simbol, seremonial dan taktik mercu suar serta pencitraan bernuansa politis, melainkan harus dapat menyentuh halhal yang lebih substantif (mendasar) terutama menyangkut atha’amahum min ju’ (memberi makan orang yang lapar) wa amanahum min khauf(memberirasaamanbagiorangyangketakutan),membukapangsakerjabaru,membangkitkan umatdariketidakberdayaanekonomi,sertamenjamin rasa aman bagi kehidupan mereka dalam beraktivitas adalah sisi lain dari Syariat Islam yang belum ditegakkan dan masih diabaikan. Maka,sudahsaatnyaumatIslamdisembuhkan dari penyakit hubud dunya wa kahriyatul maut (cinta dunia dan takut mati). Lalu, sudah saatnya pula umat Islam memulai tegaknya Syariat Islam dengan menegakkan value (nilai-nilai) yang crucial (penting), seperti akhlak yang mulia, berbudi bahasa, menyayangi sesama, memahami makna perbedaan, dan persamaan, menyadarihakikatbahwamanusiaadalahmanusia bukan malaikat dan bukan pula iblis sehingga kehidupan umat tidak penuh dengan warnawarni wajah yang berhiaskan topeng, lipstik, gincu, hipokrit (kemunafikan) dan serba kepura-puraan. (m43)

Stok Obat Filariasis Kosong, Penderita Kaki Gajah Di Pidie Tinggi SIGLI (Waspada): Dinas Kesehatan Kabupaten Pidie, Selasa (18/3), melaporkan stok obat filariasis jenis DEC 100 mg bentuk tablet, telah kosong. Padahal jumlah penderita penyakit Kaki Gajah (filariasis-red) katagori kasus kronis tinggi, capai 96 orang, tersebar di sejumlah kecamatan. “ Kita selalu mengusulkan obat, namun saat dikirim jumlahnyatidaksesuaiyangkitainginkan, sehingga stoknya minus.” Demikian disampaikan Sekretaris Dinkes Pidie, Samsul. Dia, mengungkapkan pada

Juni 2013, stok obat jenis DEC 100 mgtersimpandiIFK,Pidiesejumlah 393.900. Sedangkan kebutuhansebanyak1.095.500.Selanjutnya, kita memohon penambahan jumlah obat tersebut sebanyak 701.600, dan pada Juni 2013 sampai Maret 2014, permintaan obat tersebut diterima pihaknya hanya sejumlah 106.600. “Selanjutnyakondisiobatuntuk POMP F 2013 minus capai 595.000,dansampaisekarangstok obat jenis DEC 100 mg kosong” paparnya. Samsul, menyebutkan seba-

nyak 96 penderita peyakit filariasis itu, mereka sudah tergolong dalam kasus kronis,yang sulit disembuhkan. Namun pihaknya terus melakukan pemantauan terhadap penderita tersebut melalui petugas-petugas Puskesmas di daerah masing-masing. Katadia,jumlahtertinggipendiritapenyakitfilariasiskatagorikronis banyak terdapat di Keca-matan Delimasebanyak17pa-sien,Padang Tiji, 14 orang, Indra-jaya, 14 penderita, Kecamatan Pidie, 13 orang,SimpangTiga,sembilanorang pasien dan Ke-camatan Peukan

Baro,enamorangpasien.“Namun adajugadikecamatankecamatan lain, ada yang jumlahnya lebih sedikit” katanya. Samsul, menjelaskan tinginya jumlah penderita penyakit Kaki Gajah itu, disebabkan mobilitas masyarakat di daerah itu tinggi dan identik dengan kekumuhan. Ia menyebutkan, jumlah penderitapenyakitkakigajahakut sampai sekarang tercatat 96 orang dan yang sudah terjangkit tapi masih bisa disembuhkan jumlah-nya puluhan ribu orang.

Saatinipopulasiserangankaki gajah jumlahnya sudah sangat banyak. Untuk mengantisipasi makin merebaknya dan maraknyapenjangkitankakigajah.Dinas KesehatanKabupatenPidie,terus melakukan pengobatan massal filariasis di seluruh desa endemis. Target sasaran pengobatan gratiskakigajahitusemuamasyarakat. Baik yang belum terjangkit maupun yang baru terjangkit. “ Sedangkan yang kondisinya sudahkronis,kitalakukanpemantauan dan perawatan” tandas Samsul. (b10)

Sekretaris Dinkes Pidie, Samsul.


Aceh

WASPADA Rabu 19 Maret 2014

B9

Tipu Jamaah Umroh, Caleg Dipolisikan BANDA ACEH (Waspada) : Enam warga Banda Aceh melaporkan Q, calon anggota legislatif DPRK Lhokseumawe ke Polresta Banda Aceh.

Caleg Daerah Pemilihan I Kec.Banda Sakti dari salah satu parpol itu dilapor terkait dugaan penggelapanbiayakeberangkatan ibadah umrah yang batal diberangkatkan PT Borgo Kelana Indonesiayangdibawahinyapada 26 April 2013 lalu.

Muhajir, 27, salah seorang pelapor yang telah menyetor biayakeberangkatanRp48jutauntuk tiga calon jamaah mengatakan, Q adalah penanggungjawab PT Borgo Kelana Indonesia danTravel cabang Banda Aceh. Menurutnya, laporan terpaksa dilayangkan pihaknya karena pelaku dinilai tidak beritikad baik mengembalikan biaya keberangkatan yang telah disetor. “Sudah hampir setahun ongkos umrah saya setor langsung melaluiQ,tapitidakdikembalikan. Sebelumnya,Qberjanjimengembalikan pada Desember 2013 dan

awal Maret 2014, tapi tidak ditepati. Makanya saya lapor polisi,” kata Muhajir, Senin (17/3). Senada disampaikan Indiani, 48, warga Setui, Banda Aceh yang turutmelaporbersamaduakeponakannya. Dia mengatakan terpaksamelaporkarenabelummenerima uang pengembalian dari Q senilai Rp60 juta. “Awalnya dijanjikan berangkat 26 April 2013, pertama hanya memberikan uang muka senilai Rp1 juta, yang kemudian disusul Rp48 juta, untuk tiga orang. Semalam sempat kontak dia tanya kepastian pengembalian, tapi ti-

dak jelas juga,” kata dia. MenurutIndiani,saatpembatalan pertama sejumlah calon jamaahsempatdijanjikanberangkat Juni 2013. Saat itu, pihak BKTT meminta biaya tambahan hingga Rp20 juta lebih kepada ketiganya. Meski caleg ini sudah menggelapkan uangnya, Indiani tidak menginginkan Q dipenjara. Dia mengaku hanya ingin uangnya dikembalikan. Ketua DPW salah satu parpol Aceh, mengaku pernah menerima laporan adanya caleg partainya yang terbelit kasus jamaah umroh. (cb06)

Tiga Terdakwa Korupsi Pengadaan Kapal Wisata Sabang Disidangkan

Waspada/Arman Konadi

INDIANI dan Muhajir melaporkan caleg PAN ke Polresta Banda Aceh setelah batal diberangkatkan umroh, Selasa (18/3)

Pelajar Ditangkap Kasus Curanmor PANTONLABU (Waspada): SWN Bin AR, 18, pelajar asal Desa Pantee Labu, Kec. Pantee Bidari, Aceh Timur, terpaksa menghabiskan sebagian masa remajanya di penjara karena kesandung kasus pencurian kenderaan bermotor atau curanmor. Remaja ini ditangkap massa di DesaTanjong Minjei, Kec.Tanah Jambo Aye—Pantonlabu, Aceh Utara, karena nekat mencuri satu unit sepedamotor jenis staria F, di Jalan Asia Pantonlabu, Sabtu (15/3) malam. Informasi dihimpun Waspada, Senin (17/3), sepedamotor satria F biru putih BL 6185 QT itu milik Saifuddin, 25, warga Desa Tanjong Ceungai, Kec. Tanah Jambo Aye. Pelaku membuka kunci kontak dengan kunciT, lalu tancap gas ke arah DesaTanjong Minjei. Beruntung, korban sempat melihat aksi SWN dan langsung berteriak maling. Korban bersama beberapa warga lain dibantu polisi dan TNI, lalu melakukan pengejaran hingga akhirnya pelaku berhasil dibekuk di Desa Tanjong Minjei, sekitar pukul 23:30. (b19)

2 Hari Tenggelam, Jasad Ditemukan Nelayan KRUENG GEUKUEH (Waspada) : Ahman Suhelmi, 19, korban tenggelam di pesisir Bangka Jaya di Kecamatan Dewantara, Aceh Utara, yang hilang sejak dua hari lalu, kemudian ditemukan nelayan dalam keadaan tak bernyawa, mengapung di pinggir pantai dekat TKP, Selasa (18/3). “Setelah dua hari tiga malam dari Minggu, nelayan menemukan korban tenggelam tersebut sudah meninggal,” kata pedagang di pantai itu, Darsi. Dia menjelaskan sesuai pengakuan nelayan kepadanya, korban ditemukan oleh seorang nelayan yang baru pulang melaut. Tibatiba mesin boat nelayan tersebut mati, pas di samping korban. Nelayan itu melihat benda berwarna putih terapung di samping boatnya. Kondisi itu menimbulkan kecurigaan terhadap korban tenggelam yang belum ditemukan dua hari ini. Lanjutnya Darsi, selanjutnya nelayan itu mengevakuasi jasad korban ke darat dan memberitahukan pihak keluarga. Kemudian jasad dibawa pulang ke rumah duka di Gampong Paloh Gadeng, Kecamatan Dewantara. (cmk)

Kodam IM Tindak Lanjut Keterlibatan Oknum TNI BANDA ACEH (Waspada): Kodam Iskandar Muda langsung meresponpernyataanKapolriyangmenyatakanadanyaketerlibatan oknum TNI dalam kasus penembakan posko NasDem di Aceh Utara. Kepala Penerangan Kodam IM Kolonel Arh Subagio Irianto, Selasa (18/3) mengatakan, Kodam saat ini belum mendapatkan informasi resmi dari kepolisian, setelah mendapat informasi dari media, Kodam IM langsung merespon dan membentuk tim khusus untuk menyelidiki kebenaran keterlibatan oknum TNI. Tim dari Kodam yang terdiri dari Waasintel dan Pomdam sudah melakukan koordinasi dengan pihak kepolisian Polda Aceh untuk mendapatkan informasi langsung tentang hasil pemeriksaan oknum TNI yang sudah ditangkap. “Kita akan pastikan apakah tersangka merupakan oknum TNI, apabila benar terbukti maka kasus keterlibatan oknum tersebut akan ditangani oleh POM TNI,” ujar kapendam. Selanjutnya POM TNI akan menyelidiki lebih lanjut keterlibatan oknum TNI tersebut yang menyewakan senjata laras panjang kepada dua pelaku penembakan posko NasDem di Aceh Utara yang telah ditangkap tim Mabes Polri bersama Polda Aceh, pada Senin kemarin. Pelaku yang ditangkap berinisial AU dan RI, warga Aceh Utara. (cb01)

Majelis Tanfidzi DPC-FPI Kota Juang Dilantik BIREUEN (Waspada): Sekretaris Jendral Dewan Pimpinan Daerah-Front Pembela Islam (Sekjen DPD-FPI) Aceh Jalaluddin H Mukhtar belum lama ini telah mendeklarasikan serta melantik Majelis Tanfidzi Dewan Pimpinan Cabang Front Pembela Islam (DPC-FPI) Kota Juang, Bireuen, di Alun-alun Meunasah Kuta, kecamatan setempat. Ketua DPW-FPI, Bireuen Zainuddin MZ Albiruny, Selasa (18/ 3), mengatakan, acara yang berlangsung Minggu (15/3) malam, dihadiri seribuan warga dan ikut disaksikan Wakil Ketua DPWFPI Bireuen Azhari Basyah Zainuddin mengatakan, program yang telah dilaksanakan FPI Bireuen ikut mengungkap aliran sesat Millata Abraham di Bireuen sehingga ikut terungkap di seluruh Aceh. (cb02)

Maulid Di SMPN 1 Darul Aman IDI CUT (Waspada): Peringatan Maulid Nabi Muhammad SAW 1435 Hijriyah di SMPN 1 Darul Aman, Kabupaten Aceh Timur diwarnai penyantunan puluhan anak yatim – piatu. Kegiatan juga diwarnai dengan bacaan Albarzanji yang dikumandangkan grup zikir. Kepala SMPN 1 Darul Aman, Azhari, Senin (17/3) mengatakan, peringatan maulid kali ini tergolong lebih meriah dibanding tahun lalu. Penyantunan anak yatim menjadi kegiatan utama, karena anak yatim piatu dinilai mutlak perlu disantuni, apalagi sudah rutin setiap setahun sekali. Azhari mengatakan, peringatan maulid kali ini di sekolahnya sukses karena kekompakan dan kerjasama seluruh komunitas sekolah, baik siswa, guru, komite dan wali siswa. (b24)

BANDA ACEH (Waspada): Tiga terdakwa kasus dugaan korupsipengadaankapalwisataKota Sabangdaridanaotonomikhusus (otsus) Pemprov Aceh tahun anggaran 2010 senilai Rp2 miliar, disidangkan di Pengadilan Tipikor Banda Aceh. Ketigaterdakwayangditahan Kejari Sabang sejak 26 November 2013 lalu, itu masing-masing, terdakwa MUZ, 38, selaku Direktur PT Istana Lautsa, terdakwa TAR, 40,selakuKuasaDirekturPTIstana Lautsa dan terdakwa DjSS, DirekturPTMegaOceanyangjugaselakupengawaspadapekerjaanproyek tersebut. Majelis hakim diketuai Ainal MardhiahdibantuanggotaSyaiful Asy’ari dan Zulfan Effendi telah memeriksa enam saksi memberatkan yang dihadirkan jaksa penuntut umum. Pada persidangan,Senin(17/3),jaksamengha-

dirkan saksi Rajudin selaku pemeriksa barang. Rajudin dalam keterangannya di bawah sumpah, yang juga dihadirkan saksi Mariani (PPTK), antara lain mengaku telah terjadi ketimpangan dan tidak sesuai spesifikasi dalam hal pengadaan mesin kapal wisata Sabang tersebut. Jaksa penuntut umum Andri HendriansyahdanPengkiSumardi dari Kejari Sabang dalam dakwaannya menyebutkan, tahun 2010 Pemprov Aceh telah mengalokasikananggarandalam(DPASKPA) Dinas Kebudayaan dan Pariwisata Aceh senilai Rp2 miliar, daridanaOtsusuntukpengadaan kapal wisata di Kota Sabang. Dana sebesar Rp2 miliar, itu diperuntukan bagi konstruksi pengadaankapalwisatasenilaiRp1,9 miliar, untuk pekerjaan pengawasan pengadaan kapal wisata

tersebut Rp56 juta dan untuk pengelola teknis sebesar Rp44 juta. Menurut jaksa, dari hasil penyidikan yang telah dilakukan, ada item pekerjaan berupa mesin kapal dan genset tidak sesuai spesifikasisehinggatelahterjadikerugian negara dengan selisih harga antara nilai item pekerjaan yang dibayarkan (sesuai kontrak) dengan item pekerjaan yang dilaksanakan (riil) sebesar Rp317. 724.000,-sesuai perhitungan ahli dari BPKP Aceh. Menurut jaksa, para terdakwa telah melanggar pasal 2 ayat (1) jo.pasal 18 UU No.31 tahun 1999 tentang pemberantasan tindak pidana korupsi sebagaimana telah diubah dengan UU no.20 tahun 2001 jo. pasal 55 ayat (1) ke-1 KUHP. Untuk mendengarkanketerangansaksilainnya, majelis hakim menunda sidang hingga, Rabu (26/3).(b02)

Warga Rutan Idi Pengobatan Gratis IDI (Waspada): Sebanyak 305 warga binaa RumahTahanan (Rutan) Cabang Idi, Kabupaten AcehTimur, mendapat pemeriksaan dan pengobatan gratis yang dilakukan Rutan Idi bekerjasama dengan Puskesmas Idi Rayeuk. Kepala Rutan Cabang IdiYusnaidi, Selasa (18/3) mengatakan, program tersebut merupakan agendarutintiapbulanyangdiajukan pihaknya kepada Pemkab Aceh Timur. Menurutnya, adapun kegiatan ini bertujuan untuk tetap memastikankondisikesehatanwarga binaan, antisipasi siklus penyakit musim panca roba, sekaligus Rutan Idi berusaha memberikan pelayanan prima terhadap warga binaan. (cri)

Waspada/Yusri

WARGA binaan Rumah Tahanan (Rutan) Cabang Idi saat dilakukan pemeriksaan kesehatan oleh tim medis dari Puskesmas Idi Rayeuk, Selasa (18/3)

yanan publik dewasa ini. “Perencanaanyangtidaktransparandan tidak akuntabel akan menimbulkan pencitraan yang negatif terhadap kualitas pelayanan aparatur pemerintah,” ucap Syafruddin. Syafruddinmengingatkansemua peserta Musrenbang mampu mengelompokkan mana program yang harus prioritas dengan program atau kegiatan yang masih dapat ditunda pelaksanaannya. Syafruddin mengakui bahwa usulan program yang disampaikan masyarakat melalui kegiatan Musrenbang mulai tingkat desa, tingkat kecamatan hingga Musrenbang Kabupaten Bireuen ini

tidak semuanya akan dapat dilaksanakan pada 2015 karena kemampuan anggaran yang terbatas. Wakil Bupati Bireuen Mukhtar pada kegiatan ini antara lain mengatakan, Musrenbang yang dilaksanakan ini merupakan cara untuk menjaring aspirasi masyarakat yang dimulai dari tingkat desa. Hasil dari kegiatan musyawarah ini akan dijadikan sebagai prioritas pembangunan di Kabupaten Bireuen. “Perbedaan pendapat dalam musyawarah itu biasa, dan tidak perlu ada yang saling menyalahkan,” ucap Mukhtar. (b17)

Banyak PTAIS Di Aceh Masih Akreditasi C BANDA ACEH (Waspada): Perguruan Tinggi di Aceh masih banyak yang nilai akreditasi kampusnya‘C’, Kondisi ini berpengaruhpadalulusankarenaakanmelahirkan lulusan yang tidak berkualitas. Hal itu diungkapkan Koordinator KopertaisWilayahV Aceh FaridWajdiIbrahimpadapembukaanPenyusunanBorangAkreditasi bagi pimpinan dan pengelola data PTAIS dalam lingkungan KopertaisWilayahVAceh,Selasa(18/ 3)diHotelKualaRadjaBandaAceh.

“Kondisi pendidikan di Aceh berada pada peringkat bawah, itu merupakan faktor kualitas guru yang mengajar di sekolahsekolah, banyak perguruan tinggi yang melahirkan calon-calon guru dan dosen yang tidak berkualitas,” kata Rektor UIN ArRaniry. Diamenambahkan,akreditasi adalah tolok ukur bagi perguruan tinggi. Di Aceh dari 24 Perguruan TinggiAgamaIslamSwasta(PTAIS), hanya sekitar 30 persen yang memperoleh nilai“B”, selebihnya

BANDA ACEH (Waspada): Sekitar 1000-an pencari kerja menyerbu arena pameran bursa kerja “Unsyiah Career Day” yang digelar Career Development Centre (CDC) Universitas Syiah Kuala, Selasa (18/3), yang dibuka TM Iqbalsyah selaku Ketua CDC Unsyiah. Bursa kerja yang berlangsung selama dua hari hingga Rabu (19/3) ini merupakan salah satu bentuk tanggungjawab Unsyiah untuk mendekatkan para alumni dengan dunia kerja. “Selain bermanfaat untuk membuka peluang mendaftarkan diri secara langsung pada berbagai perusahaan, kegiatan ini juga menjadi sarana informasi dan edukasi bagi para mahasiswa ataupun masyarakatumumtentangbidangkerja,”kataIqbal.

Dia menjelaskan, perusahaan yang langsung melakukan tes pada bursa kerja kali ini adalah PT Bank Mandiri dan PT Makin Group. “Sedangkan perusahaan lain akan melakukan seleksi CV terlebih dahulu,” imbuhnya. Beberapa perusahaan tersebut di antaranya Bank Mandiri, Bank Niaga, BTPN, MAKIN Group, Paragon Technology and Innovation (Wardah), FIF, Wings, Adira, Providen Agro, Asian Agri, TAP Group dan lainnya. Sementara Ketua Divisi Program dan Pelatihan CDC Unsyiah, Rahmat Fadhil mengatakan, ini adalah kesempatan yang berharga untuk langsung dapat bertemu dengan perusahaan-perusahaan yang hadir di pameran tersebut. (b04)

Narkoba Menjauhkan Diri Dari Allah BLANGKEJEREN (Waspada ): Bangga menjadi anak bangsa tanpa Narkoba, dengan mengusung tema Narkoba dalam pandangan Islam, demikian yang disampaikan Drs. Nya’Mat, Asisten III Setdakab Gayo Lues, Selasa (18/3) di Ruang Mushalla SMA Negeri 1 Blangkejeren, dalam penyuluhan bahayanya Narkoba. Agar, terhindar dari narkoba harus menanamkan dalam diri keyakinan bahwa Allah selalu mengawasi kita semua, dan pertanyaannya mengapa setiap orang tetap sebagai pemakai Narkoba, karena dirinya telah dikuasai oleh Nafsu sehingga menghilangkan akal sehatnya. “Untuk itu, jadikanlah diri anda semua para siswa sebagai panutan yang baik, tentu saja baik di rumah, di lingkungan, di sekolah dan di kelom-

pok anda sendiri, “ tutur Asisten III. Dalam wacana Islam, ada beberapa ayat alQur’an dan hadits yang melarang manusia untuk mengkonsumsi narkoba dan hal-hal yang memabukkan. Seperti minum khamar, sama dengan menghisap candu, dan menimbulkan ketagihan. Seseorang yang telah ketagihan narkoba dan sejenisnya seperti minum khamr, baginya tak ada nilai harta benda, berapa saja harganya itu akan dibelinya. Khamar(narkoba)danjudisangatdekatdengan dunia kejahatan dan kekerasan, maka menurut al-Qur’an khamar (narkoba) dan judi potensial memicu permusuhan dan kebencian antar sesama manusia. Khamar dan judi juga bisa memalingkan seseorang dari Allah dan shalat. (cjs)

nyaris berlangsung di setiap hari, terutama pada jam kantor serta menjelang petang. Mereka berharap pihak terkait tanggap atas persoalan macetnya sejumlah ruas jalan di seputar kota Gayo Lut ini. “Beberapa tahun belakangan, hampir setiap hari, terutama ketika pagi dan sore, jalan utama di sini (Uning) kerap macet,” kata Syaiful, seorang pengguna jalan, warga Pegasing Selasa (18/ 3) di Uning. Sementaraberdasarkanketerangan warga setempat (Uning),

SIGLI (Waspada): Kantor Bank Rakyat Indonesia (BRI) Unit Indrajaya, Kabupaten Pidie, Selasa (18/3) sekira pukul 10:30, nyaris terbakar setelah Kilo Watt Hour (KWH) milik PTPLN(Persero)yangberfungsi mencatat pemakaian energi listerik per bulan itu terbakar. Insidenitusontakmembuat panik para karyawan dan nasabah BRI yang sedang melakukan transaksi keuangan di Bank unit milik negara tersebut. Para pemilik ruko juga sempat resah karena letak kantor BRI itu pada deretan ruko. Waspada/Muhammad Riza “Peristiwa ini terjadi tibatiba saat kami sedang melayani SEORANG petugas PT PLN (Persero) Sigli, sedang memperlihatkan beberapa nasabah. Tapi tidak KWH meteran BRI Indrajaya yang terbakar, Selasa (18/3). terjadi apa-apa, sebab tidak lama kemudian petugas dari PT PLN langsung tiba kepada Waspada, menjelaskan kebakaran KWH ke lokasi,” kata Azhari, kepala Unit BRI Indrajaya. BRIUnitIndrajayatersebutdisebabkanpenggunaan Salah seorang petugas instalasi dari PT PLN arus listerik yang disuplai PLN berlebihan dan tidak (Persero) Sigli, yang namanya enggan disebutkan seimbang dengan cable yang digunakan.(b10)

Kantor Pustaka Atim Gelar Bimtek PEUREULAK (Waspada): Dalam upaya meningkatkan pengetahuan pengelola perpustakaan sekolah agar memberikan dampak yang positif dan membawa perubahan terhadap dunia pendidikan di sekolah, Kantor Perpustakaan Aceh Timur menggelar Bimbingan Teknis (Bimtek) bagi para petugas pengelolaan perpustakaan sekolah tingkat SMP, SMA dan sederajat Se-Kabupaten Aceh Timur. Asisten I Bidang Pemerintahan Pemkab Aceh Timur, Adlinsyah, Selasa (18/3) mengatakan, pembinaan pengelola perpustakaan ini merupakan tanggungjawab pemerintah guna mencerdaskan

kehidupan bangsa. “Apa yang dilaksanakan merupakan suatu kegiatan dalam upaya untuk meningkatkan keterampilan dan pengetahuan para pengelola perpustakaan yang handal dan profesional, terutama dalam mengelola perpustakaan di sekolah,” ungkapnya. Kepala Kantor Perpustakaan dan Arsip Daerah AcehTimurZainalAbidinmenjelaskan,dasarpelaksanaan Bimtek pengelola perpustakaan sekolah adalah hasil evaluasi, sosialisasi dan pembinaan ke perpustakaan sekolah yang dilaksanakan dalam Tahun 2012 dan 2013 lalu. (cri)

masihharusdilakukanpembenahan yang serius,” ujar dia. Kata dia, kondisi itu membawa efek sangat besar, sebab akan melahirkan alumni atau sarjanasarjana yang tidak sedikit setiap tahun dan mereka tidak dapat melamar kerja, karena status kampusnya yang akreditasi C. “Belum lagi kualitas mereka, di mana jika dikontrak pada sekolah-sekolah yang akan mengajaranak-anak,danyangdikhawatirkan ini akan terus terjadi,” ujar Farid. (b07)

Jalan Utama Di Aceh Tengah ‘Dihantui’ Macet TAKENGEN(Waspada):Ruas jalan utama di sebagian titik di seputaran KotaTakengen, Kabupaten Aceh Tengah, ‘dihantui’ kemacetan. Dampaknya, pengguna jalan yang melintas resah lantaran antrean kendaraan bermotor yang kerap memanjang. Khususnya dijalanTakengon-Isaq,Kampung Uning (merupakan area pusat pasar di Pegasing), maupun di Jalan Lintang (per kotaan), Kec. Kebayakan. Menurut pengakuan warga, macet di kedua area dimaksud

Pencari Kerja Serbu Job Fair

KWH Meteran Listrik BRI Terbakar

Perencanaan Pembangunan Harus Berkualitas BIREUEN (Waspada):Wakil Ketua Dewan Perwakilan Rakyat Kabupaten (DPRK) Bireuen, Tgk Syafruddin mengingatkan agar perencanaanpembangunanyang digagas melalui Musyawarah Perencanaan Pembangunan (Musrenbang) harus berkualitas dan akuntabel. Hal ini dikatakannya saat memberikan sambutan pada acara pembukaan Musrenbang tahun 2014, Rencana Kerja Pembangunan Kabupaten (RKPK) Bireuentahun2015diaulaSekdakab Lama Bireuen, Selasa (18/3). Menurutnya, perencanaan yang akuntabel, berkualitas, dan transparan adalah tolok ukur tingkat profesionalisme dan pela-

Waspada/Zafrullah

PAMERAN bursa kerja Unsyiah Career Day yang digelar CDC Unsyiah mendapat perhatian dari para pencari kerja. Tampak dalam gambar, pengunjung yang membludak untuk mencari pekerjaan memenuhi arena bursa kerja tersebut.

penyebab kemacetan bukan saja karena ramainya pengguna jalan melintas,namunsebagiankonsumenyangdatangberbelanjakerap parkir kendaraan di sembarang tempat. Sementara petugas pengatur(penertiban)lalulintasdari Dishub hanya bertugas di pagi hari. Kadis Perhubungan Aceh Tengah Syahrial Afri mengatakan, penyebab utama terjadinya kemacetan terutama di Kp. Uning akibat adanya parkir kendaraan yang tidak teratur. (cb09)

Waspada/Yusri

ASISTEN I Bidang PemerintahanAceh Timur Adlinsyah menyematkan tanda pengenal kepada peserta Bimtek Pengelola Perpustakaan Sekolah, Selasa (18/3)

STIKes CND Gelar Pelatihan CWCCA LANGSA (Waspada) : Sekolah Tinggi Ilmu Kesehatan(STIKes)CutNyakDhienLangsabekerja sama dengan WOCARE Center Indonesia menggelar pelatihan perawatan luka Certified WoundCareClinicianAsociated(CWCCA)Angkatan II untuk Daerah Provinsi Aceh, di aula kampus setemat, Selasa (18/3). “Kegiatan ini berlangsung selama empat hari sejak, tanggal 18 hingga 21 Maret 2014, yang mana nantinya seluruh peserta dibekali tentang ilmu perawatan luka dengan konsep modern dressing

dan seluruh peserta juga akan diuji competency dengan merawat luka langsung ke pasien,” kata Direktur Klinik EdWCare, Ns Edy Mulyadi, M.Kep, RN, WOC (ET) N, kepada wartawan, di Langsa. Sedangkaan, peserta pelatihan perawatan luka CertifiedWound Care Clinician Asociated (CWCCA) berjumlah 61 orang yang berasal dari Provinsi Aceh dan Sumutera Utara. Adapun syarat peserta yang mengikuti pelatihan CWCCA telah menyelesaikan pendidikan keperawatan minimal Diploma III Keperawatan. (cms)


Otomotif

B12

WASPADA RABU 19 Maret 2014

Kurangi Polusi, Paris Terapkan Ganjil Genap

Koenigsegg One:1 (kiri) dan reka rupa net Lamborghini Huracan. - net

Koenigsegg One:1 Lengkapi Kepolisian Dubai, Lamborghini Huracan Menyusul Kepolisian Dubai terkenal dengan jajaran mobil patroli super mewah. Kini mereka siap menambah koleksi mobil patrolinya berupa supercar

yang baru saja dirilis di ajang Geneva Motor Show 2014. Kepolisian Dubai telah memiliki super car untuk mobil patrolinya, berupa Bugatti Vey-

ron, Ferrari FF, Bentley Continental GT, Aston Martin One77, McLaren 12C, Mustang, dan Mercedes-Benz G63 Brabus. Kini korps berkelir hijau itu pun

bakal kedatangan prima-dona baru di jajaran koleksi mereka, yaitu Koenigsegg One:1. Supercar buatan Swedia yang baru saja diungkap kehadi-

VW T-Roc Concept, Urban Crossover Tangguh Kehadiran Audi Q3 dan Mercedes-Benz GLA rupanya memancing VW untuk segera memunculkan model di kelas ini. Melalui model konsep TRoc, VW menyiapkan crossover ketiganya di Geneva Motor Show beberapa waktu lalu.

Crossover urban yang masih sebatas konsep ini dibangun dengan platform baru MBG yang digunakan VW untuk model kompak dan mid-size. Sebagai model konsep, tentu ada beberapa sentuhan desain yang futuristik. Mulai dari bentuk dua

net

pintu, atap yang bisa dilepas, serta dua panel pintu bagasi. Dengan penggerak all-wheel drive racikan Haldex, T-Roc memiliki bobot 1.421 kg dengan panjang 4.178 mm, lebar 1.831 mm, tinggi 1.501 mm. Mesinnya mirip dengan VW Golf GTD yakni mesin direct-injection 4silinder berkapasitas 2.0-liter turbodiesel yang bertenaga 182 hp ditemani transmisi dualclutch 7-speed dan sistem allwheel-drive. Crossover yang memiliki jarak sumbu roda sepanjang 2.595 mm itu dilengkapi fitur hill-descent dan hillstart assist untuk membantu pengemudi saat bergerak di tanjakan dan turunan terjal. Performanya juga mengagumkan dengan akselerasi dari 0-100 km/jam dalam waktu 6,9 detik. VW T-Roc juga dibekali mode pengaturan berkendara

menyesuaikan kondisi jalan. Mulai dari mode Street yang agresif di jalan mulus, mode Snow yang membantu pembagian torsi dan stabilitas serta kontrol slip di jalanan bersalju, kemudian mode Offroad untuk melintasi medan offroad. Kamera terdapat di depan dan belakang. Sedangkan velg 19 inci dibalut ban ukuran 245/45. PenampilanVW T-Roc konsep ini dimodali grille bermotif sarang lebah, lampu dengan teknologi LED, trim dan fender yang kokoh serta atap berwarna black matte. Interior VW T-Roc memuat empat orang yang dilengkapi layar TFT untuk panel meter ukuran 12,3 inci. Tablet di konsoltengahmembuatpe-numpang bisa mengontrol kamera di luar serta layar di kaca spion dalam yang terhubung dengan kamera belakang. (mkc/m47)

rannya pada gelaran Geneva Motor Show 2014 di Jenewa, Swiss, awal Maret ini hanya dibuat sebanyak enam unit. Dan satu unit di antaranya sudah dipesan oleh kepolisian Dubai. Mengutip Carbuzz, Koenigsegg One:1 memiliki mesin V8 berkapasitas 5,0 liter yang mampu menyemburkan daya hingga 1.341 hp dengan torsi maksimal 1.371 Nm pada putaran mesin 6.000 rpm. Pihak produsennya mengklaim supercar ini mampu mencapai kecepatan tertinggi hingga 450 km/jam.

Spek Dahsyat GT-R 2016 Data spesifik mengenai generasi selanjutnya dari super car Nissan GT-R sedang ramai dibicarakan di negara asalnya Jepang. Data yang berkembang saat ini, pembunuh supercar tersebut memiliki kekuatan massif, dengan penggunaan teknologi hybrid. Executive Vice Presiden Nissan, Andy Palmer, sudah menegaskan sejak tahun lalu bahwa generasi penerus GT-R

Nissan Smart Rear-View Mirror Pantau Kondisi Belakang Lebih Baik Di tengah perkembangan teknologi dalam dunia kendaraan, Nissan pun memperkenalkan teknologi baru dinamai “smart rear-view mirror,” yang memanfaatkan kaca spion dalam untuk meningkatkan pandangan ke belakang yang disorot melalui kamera belakang. Alhasil, unsur keselamatan pun semakin meningkat. Selama ini, pandangan belakang yang disorot kamera tersalurkan melalui layar di tengah dahsboard yang juga berfungsi sebagai navigasi dan infotainment. Pandangan ke belakang melalui kaca spion dalam pun cukup terbatas. Sementara dengan teknologi “smart rearview mirror”, pandangan ke belakang menjadi lebih luas dan aman bagi pengemudi. Teknologi “smart rear-view mirror” menerapkan kamera belakang menempel di kaca belakang bagian atas. Hasil pantauannya terhubung dengan layar LCD di kaca spion dalam. Menurut Nissan, teknologi ini memberikan pandangan lebih baik ketimbang dengan kamera

ditempatkan di bumper belakang. Kamera beresolusi 1,3 juta pixel dengan sudut sempit dikembangkan secara spesifik oleh Nissan untuk menyesuaikan aplikasi teknologi ini. Nissan beranggapan kalau kamera dengan sudut lebar menghasil-

kan kualitas gambar yang kurang bagus jika digabungkan dengan kaca spion dalam berlayar LCD. Teknologi mart rear-view mirror mulai diperkenalkan pada mobil balap hybrid, Nissan ZEOD RC yang berpartisipasi

di ajang balap 24 Jam Le Mans pada bulan Juni mendatang. Nissan meyakini kalao teknologi ini akan meningkatkan visibilitas bagi pengemudi dan membuat mobil lebih aerodinamis. Kabar baiknya, sistem ini akan digunakan pada model produksinya

di tahun depan. Mungkin nantinya bisa dijumpai pada modelmodel keluaran Nissan kelas premium maupun Infiniti. Setidaknya pandangan pengemudi ke belakang kendaraannya menjadi lebih baik dengan teknologi ini. (mkc/m47)

net

Ekspedisi Nusantara Honda Bukukan Rekor Baru Honda berhasil menorehkan rekor baru touring motor injeksi dengan jarak tempuh terjauh setelah menuntaskan Ekspedisi Nusantara Satu Hati untuk Negeri dengan total jarak 8.233 km. Pencapaian ini sekaligus membuktikan ketangguhan,keiritan, serta performa hebat 3 model sport injeksi terbaru Honda yang digunakan dalam touring 3 pulau ini. Museum Rekor-Dunia In-

donesia (MURI) mencatat rekor baru yang dibuat oleh tim Ekspedisi Nusantara Satu Hati untuk Negeri AHM yang menggunakan 3 tipe motor sport Honda berteknologi PGM-FI, yakni Honda Verza 150, Honda CB150R StreetFire, dan New Honda MegaPro FI. Rekor tersebut adalah Touring Terjauh Motor Berteknologi Injeksi dengan Jarak 8.233 Km. Sebanyak 12 rider terbaik yang diseleksi

dari berbagai klub Honda di Indonesia berhasil menguji performa dan ketangguhan mesin injeksi dan fitur ketiga model motor sport Honda tersebut, melintasi tiga pulau, SumateraJawa-Kalimantan selama 23 hari. Dengan 12 motor dari tiga tipe motor sport Honda, 12 rider Ekspedisi Nusantara Satu Hati untuk Negeri mengawali perjalanan dari titik nol terbarat

Waspada/Ist

Direktur Pemasaran AHM Margono Tanuwijaya (tengah kiri) menerima penghargaan MURI untuk pencapaian rekor baru touring motor injeksi dengan jarak tempuh terjauh setelah menuntaskan Ekspedisi Nusantara Satu Hati untuk Negeri dengan total jarak 8.233 km.

Indonesia di pulauWeh, Sabang, Aceh. Beragam kondisi cuaca dan jalan dapat dituntaskan dengan zero accident dan tanpa kendala berarti. Jimmy, Pendiri Honda Megapro Club Medan yang turut menjadi salah satu rider dalam tim Ekspedisi Nusantara Honda mengungkapkan berkat semangat kebersamaan, tiga tipe motor sport injeksi Honda berhasil diuji tuntas di jalanan penuh kelok, naik turun hingga kondisi jalan yang belum selesai diperbaiki setelah tergerus hujan di Sumatera. Di pulau Jawa, 12 rider berhasil beragam karakter jalan, dari yang macet, bergelombang, hingga terjal dan curam di pegunungan Bromo. Mereka mengakhiri touringnya dengan menaklukkan jalanan berbukit dan lurus panjang dan menyusuri pedalaman Kalimantan sebelum akhirnya finish di titik nol Katulistiwa di Kota Pontianak, Kalbar. Meskipun menghadapi beragam tantangan kondisi jalan dan cuaca, ketiga model motor sport injeksi Honda berhasil membuktikan performanya yang luar biasa. Di pulau Jawa, Honda Verza 150 sempat mencatatkan rekor konsumsi BBM teririt sebesar

Dikabarkan, kepolisian Dubai juga bakal memesan Lamborghini Huracan, varian teranyar yang baru saja diumumkan Lamborghini. Supercar baru Lamborghini tersebut yang juga telah diluncurkan di hadapan publik pada Geneva Motor Show 2014, sehingga kepolisian Dubai sudah bisa memiliki Huracan di garasinya pada akhir tahun ini. Kepolisan Dubai memang lebih menekankan mobil polisi mereka sebagai daya tarik untuk wisatawan di negeri super kaya tersebut. (cbz/m47)

84,5 km/liter pada rute Bekasi – Purwokerto dalam kondisi jalan macet dan rusak. Sementara mesin DOHC Honda CB150R StreetFire juga sempat diuji para rider dan menghasilkan akselerasi hingga 8 detik pada sebuah trek lurus 200 meter di wilayah perbatasan Kalimantan Selatan. Bahkan di Palangkaraya, salah satu rider dari Bogor StreetFire Club mampu menikmati mesin DOHC 6 percepatan Honda CB150R StreetFire dengan membukukan top speed 151km/jam. Rekor ini dicatatkan saat rider melintasi jalanan sepi dan beraspal mulus sebelum memasuki Palangkaraya. Sepanjang perjalanan di tiga pulau, rombongan Ekspedisi Nusantara Honda juga melakukan beragam kegiatan sosial dan budaya sebagai bagian dari langkah nyata berbagi untuk negeri. Aksi untuk negeri ini dimulai dengan memberikan donasi untuk korban letusan Gunung Sinabung di Kab. Karo, Sumatera Utara berupa bantuan bahan makanan pokok, alas tidur, selimut, serta menghadirkan artis Nasional untuk menghibur langsung warga di lokasi pengungsian. (adv/m47)

ini akan menggunakan teknologi hybrid. Dijelaskannya, sistem listrik dapat mengisi kesenjangan dalam kurva torsi, dengan menawarkan performa lebih dari mesin utama, serta menurunkan emisi. “Ini adalah win-win solution, dan saya berharap bisa melihat beberapa bentuk hibridai pada generasi berikutnya dari Nissan GT-R,” tegas Andy Palmer seperti dikutip worldcarfans, Senin (17/3). Sebuah majalah Jepang mengupas soal spesifikasi New GT-R. Mesin V6 twin-turbo dengan kapasitas 3,8 liter, akan dikombinasikan dengan gaya KERS (Kinetic Energy Recovery System) ala mobil balap Formula Satu.(wcf/m47)

Ribuan mobil bernomor polisi genap dilarang melintas di jalanan kota Paris, Perancis, pada Senin (17/3). Penyebabnya, karena hanya mobil dengan nomor polisi ganjil yang dapat melewati kota Paris pada Senin, dan akan bergantian tiap hari. Ini adalah hari pertama pemerintah kota Paris menerapkan kebijakan nomor polisi ganjil-genap sebagai upaya mengurangi tingkat polusi udara yang membahayakan bagi kesehatan. Meski demikian, masih diberikan pengecualian dalam kebijakan ini. Pengecualian diberikan kepada mobil yang mengangkut tiga orang penumpang atau lebih (3 in 1), dan juga mobil listrik serta mobil bermesin hybrid. Mengutip BBC, sekitar 700 personel polisi berjaga di sekitar 60 pos titik untuk mencegah kendaraan bermotor bernomor genap masuk ke ibukota Perancis, Senin (17/3). Peraturan ini akan berlaku di seluruh Paris dan 22 wilayah di sekitarnya mulai pukul 5.30 pagi waktu setempat. Kebijakan nomor polisi ganjil-genap ini diumumkan pemerintah pada Sabtu (15/3), setelah tingkat polusi udara di Paris melebihi ambang batas aman. Sementara, seluruh transportasi publik digratiskan untuk mendorong warga tidak menggunakan kendaraan pribadi mereka selama akhir pekan. (bbc/m47)

BMW i8 Siap Produksi Mobil sport hybrid dari BMW i8, yang telah diperkenalkan di Frankfurt Auto Show tahun lalu bakal mulai diproduksi dalam beberapa minggu mendatang setelah BMW melakukan berbagai pengujian sebelumnya. Kehadiran BMW i8 pun semakin memeriahkan pasar mobil sport hybrid yang makin popular belakangan ini. Berdasarkan pengujian yang dilakukan, BMW i8 mampu berakselerasi 0-100 km/jam dalam tempo 4,4 detik dan mencapai kecepatan maksimum hingga 248 km/jam. Konsumsi bahan bakar mobil sport hybrid ini melintasi rute kombinasinya di jalanan Eropa pun amat irit, menyentuh sekitar 47 km/liter. Pada mode elektrik, i8 mampu berlari hingga 120 km/jam dan punya jarak tempuh mencapai 36,8 km. Untuk mengisi ulang baterai lithiumion 5,2-kWh dibutuhkan kurang dari tiga jam. Sebagai model hybrid, BMW mengusung mesin 1,5-liter turbo berbahan bakar bensin yang memiliki tenaga 231 hp dan torsi 320 Nm. Sementara motor listriknya bertenaga 131 hp dan torsi 250 Nm. Kombinasi dua sumber tenaga itu menghasilkan 362 hp. Mesin bensin menggerakkan roda belakang, sedangkan motor listrik menggerakkan roda depan sehingga menjadi mobil hybrid berpenggerak all-wheel-drive. Walau bodinya agak besar, namun bobotnya kurang dari 1,5 ton dengan nilai koefisien drag yang rendah, hanya 0,26. BMW i8 pertama kali akan dijual di Eropa pada Juni tahun ini, lalu menyusul di Amerika Serikat sebagai model tahun 2015. Harganya mencapai AS$135.925 dan siap berkompetisi dengan mobil sport hybrid lainnya yang sudah dijual dari keluaran Porsche, McLaren dan Ferrari. (mkc/m47)

net

BMW i8

Honda Sudah Punya Kartu As Untuk Berlaga Di F1 Honda Motor Co rencananya, tahun depan kembali ke balap Formula Satu (F1) setelah absen selama tujuh tahun. Kembalinya Honda ke balap tersebut setelah mereka memiliki “kartu as” yaitu teknologi yang membuat kendaraan jadi lebih “mumpuni” sekaligus ramah lingkungan”. Seperti dilaporkan Reuters, Honda akan menggunakan teknologi mengubah gas buang dari kendaraan F-1 menjadi energi. Teknologi ini juga akan diterapkan pada kendaraan konvensional. Menurut pemimpin F-1 Honda,Yasuhisa Arai, teknologi itu akan membuat Honda unggul dalam pasar otomotif. Kalangan yang sinis dengan Honda mengemukakan merek Jepang itu cuma ingin memperbaiki reputasinya karena tak menang di balap F-1 dari tahun 2000 hingga 2008. Mereka tidak percaya dengan pernyataan bahwa Honda ingin menggunakan balap F-1 sebagai inkubator teknologi. Arai memang mengatakan Honda ingin meraih sukses F1 seperti akhir dasawarsa 80 ketika kendaraan McLarenHonda memenangi 15 dari 16 balap Grand Prix. Pebalap F-1 McLaren-Honda ketika itu adalah mendiang

Ayrton Senna dan Alain Prost. “Tidak ada gunanya balap kalau tidak menang,” kata Arai. Dia mengatakan Honda pada 2015 akan kembali bekerja sama dengan McLaren di balap F-1. Laboratorium beroda Kembali ikut Formula 1 menurut Honda bukan cuma soal balap. Mereka juga ingin menjadikan ajang balap bergengsi itu sebagai laboratorium untuk menjajal teknologi terbaru. Kendaraan F-1 kini diharuskan memiliki teknologi hybrid bensin-listrik. Honda memandang hal itu sebagai peluang untuk membuat lompatan teknologi. Peraturan baru F-1 mengharuskan pemasok mesin saat ini, seperti Renault, Ferrari, dan Mercedes - Benz menggunakan mesin yang lebih kecil dengan teknologi turbocharging. Peraturan baru juga mengharuskan teknologi untuk mengubah energi dari pengereman dan gas buang, yang selama ini terbuang, agar diubah kembali menjadi energi (regenerate). Tim F-1 juga akan dikurangi sepertiga jatah BBM-nya. Peraturan itu mulai berlaku pada balap F-1 pertama tahun ini di Melbourne Australia. Honda sangat tertarik dengan persyaratan baru untuk

menggunakan “exhaust-energy recovery” (pemulihan energi dari knalpot). Mereka antara lain berencana menggunakan gas buang untuk memutar turbin di sistem knalpot yang menghasilkan listrik ke baterai. CEO Honda Takanobu Ito menyebut F-1 adalah “laboratorium beroda”, persis seperti yang dibayangkan oleh pendiri perusahaan Soichiro Honda pada dasawarsa 60. Arai mengatakan, teknologi pemulihan energi dari knalpot itu akan menambah “efisiensi termal” pada kendaraan F-1 mereka hingga sepertiganya. Hingga saat ini, teknologi paling canggihpun baru 30 persen menggunakan energi termal hasil pembakaran bahan bakar. Sebagian besar energi termal terbuang saat pengereman dan lewat pipa knalpot sebagai panas. Arai ingin meningkatkan efisiensi termal menjadi 40 persen. “Saat ini belum ada teknologi seperti demikian,” kata Arai, insinyur berusia 57 tahun itu. Arai juga menjabat senior managing director pada litbang Honda. “Ini sangat menantang, tapi jika hal tersebut tercapai, maka teknologinya bisa diterapkan ke mobil konvensional.” (ant/rtr/m47)

net

Penampilan Honda di ajang balap Formula Satu.

Waspada, rabu 19 maret 2014  
Read more
Read more
Similar to
Popular now
Just for you