Page 1

WASPADA Demi Kebenaran Dan Keadilan

Petir Ancam Medan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

Suhu 33-34 C 0

RABU, Kliwon, 16 Mei 2012/24 Jumadil Akhir 1433 H

MEDAN ( Waspada) : Seminggu ke depan Badan Meteorologi Klimatologi dan Geofisika (BMKG) Wilayah I, memprediksi suhu udara di kawasan Medan mencapai 34 derajat Celcius.Hal ini menyebabkan suasana panas dan gerah. Suhu tersebut bersumber dari sinar matahari dan efek rumah kaca di Medan yang memiliki gedung tinggi serta panas bersumber dari asap kendaraan. Tetapi, potensi hujan masih terjadi, baik intensitas sedang dan lebat disertai petir dan angin kencang pada sore dan malam hari. Warga diminta mewaspadai pohonpohon dan tower bakal tumbang, kata Hartanto, ST, MM, kepala Bidang Data dan Informasi (Datin) pada BMKG Wilayah I stasiun Bandara Polonia Medan, saat dikonfirmasi di Bandara Polonia, Selasa (15/5). Menurut Hartanto, intensitas curah hujan masih berpeluang sedang dan lebat, bahkan potensi petir dan angin kencang masih terjadi di kawasan Medan dan sekitarnya. Untuk itu, Hartanto mengingatkan warga yang bertempat tinggal di kawasan bantaran sungai agar meningkatkan kewaspadaan banjir kiriman dari hulu sungai pada malam hari. “Biasanya akumulasi dari terjadi panas berhari-hari dengan suhu rata-rata 33 hingga 34 derajat Celcius, terjadi hujan lebat dan berpeluang banjir kiriman,” kata Hartanto. Dia menilai potensi banjir kiriman dari hulu sungai masih bakal terjadi kalau intensitas curah hujan meningkat terutama di kawasan pegunungan dan lereng-lereng pebukitan seperti kawasan Sembahe. Menyinggung kondisi perairan, dia minta kalangan para nelayan agar meningkatkan kewaspadaan mengingat gelombang laut di kawasan Selat Malaka masih tinggi. Tinggi gelombang laut antara 1,5 hingga 2 meter, terutama pada malam hari. (m32)

No: 23866 Tahun Ke-66

Terbit 24 Halaman (A1-12, B1-12) Harga Eceran: Rp2.500,-

Pilgubsu 2013

PDIP Calonkan Enam Nama

Waspada/Surya Efendi

PANGDAM I/BB Mayjen TNI Lodewijk F. Paulus disaksikan Plt Gubsu Gatot Pujo Nugroho, Kapoldasu Irjen Pol Wisjnu Amat Sastro, Wakil Ketua DPRDSU Kamaluddin Harahap, Wali Kota Medan Rahudman Harahap, Kanwil Kemenag Sumut Abdul Rahim, Ketua MUI Sumut Abdullah Syah dan Ketua MUI Medan M. Hatta serta pengurus masjid meletakkan batu pertama pembangunan kembali Masjid Al Ikhlas di Jl. Timor Medan, Selasa (15/5).

MEDAN (Waspada): PDI-Perjuangan khususnya Sumut sudah memiliki sejumlah nama yang bakal muncul dalam Pilgubsu 2013, namun tetap menjalani seleksi maupun fit and proper test serta penetapannya oleh DPP. Hal itu dikemukakan Ketua DPD PDIPerjuangan Sumut Panda Nababan, didampingi unsur DPP Trimedya Panjaitan dan unsur DPD PDI-P Sumut Brilian Moktar, Eddy Rangkuti dan lainnya di sela-sela rapat koordinasi daerah (Rakorda) II DPD PDIP Sumut di Asrama Haji Pangkalan Masyhur, Medan, Selasa (15/5). ‘’Tegasnya kita melakukan penyaringan, namun muara serta keputusannya ada pada DPP. Begitupun, tetap saja DPP akan menerima masukan-masukan,’’kata Panda dan menambahkan, mulai 2 Juli 2012, PDIP melakukan verifikasi 20 Juli 2012, dan pada 10 Juli 2012 sudah berada di DPP. Menurut Panda, ada enam nama yang muncul yakni T. Erry Nuradi, Benny Pasaribu, R.E. Nainggolan, Bintata Hutabarat, Juliari Batubara dan Humala.Namun, katanya, PDI-P bisa melakukan perubahan, yakni tidak ada lagi money politics, termasuk dalam hal berkaitan dengan calon-calon legislatif. ‘’Jadi tidak ada lagi bayar-bayar,’’ucap

Lanjut ke hal A2 kol. 3

Masjid Al Ikhlas Dibangun Kembali MEDAN (Waspada): Pembangunan Masjid Al Ikhlas Jl. Timor Medan dimulai Selasa (15/5) pagi ditandai peletakan batu pertama oleh Pangdam I/BB Mayjen TNI Lodewijk F. Paulus. Pembangunan ini diharapkan dapat menghilangkan ketidakharmonisan antara sebagian umat Islam dengan Kodam I/BB.

“Tidak ada permasalahan yang tidak selesai, kalau kita lakukan dengan bersungguhsungguh. Ini wujud kesungguhan Pangdam I/BB dan diharapkan sedikit ketidakharmonisan selama ini bisa diselesaikan secara arif dan sabar,” kata

Plt Gubsu H Gatot Pujo Nugroho saat menghadiri peletakan batu pertama Masjid Al Ikhlas. Menurut Gatot, apa yang dilakukan Pangdam I/BB dalam menyelesaikan ketidakharmonisan ini, dapat men-

jadi inspirasi bagi kita. “Atas nama Pemprovsu dan warga mengucapkan terimakasih. Penyelesaian ini melalui proses yang tekun, dan komunikasi. Dengan komunikasi dan dialog yang dilakukan Pangdam, persoalan yang pelik dan

rumit bisa diselesaikan,” ujar Gatot, dan mengharapkan dengan dibangunnya Masjid Al Ikhlas bisa menjadi pusat kegiatan para dai untuk menyiarkan agama Islam. “Serta dapat membangun ketaqwaan warga Sumut se-

perti yang diamanatkan UU dan Pancasila bahwa ketaqwaan sangat berkontribusi m e m b a n g u n k e j i w a a n ,” sebutnya. Sementara itu, Pangdam I/BB Mayjen TNI Lodewijk F Paulus mengatakan, Kota

Medan merupakan salah satu contoh kerukunan hidup umat beragama. “Kita harapkan ‘kerikil-kerikil’ yang ada selama ini menjadi tidak ada. Medan ini kan salah satu

Lanjut ke hal A2 kol. 6

Ketua DPRD Binjai Divonis 2 Tahun MEDAN (Waspada) : Ketua DPRD Binjai nonaktif, Haris Harto divonis dua tahun penjara oleh Pengadilan Tipikor pada Pengadilan Negeri Medan, Selasa (15/5). Haris Harto dinyatakan bersalah melakukan korupsi dana operasional Komite Olahraga Nasional Indonesia (KONI) Binjai bersumber dari APBD Tahun Anggaran 2007 senilai Rp 961 juta. Majelis Hakim diketuai Jonny Sitohang juga mengenakan denda kepada Haris Harto sebesar Rp100 juta, subsider dua bulan penjara. Haris Harto juga diperintahkan membayar kerugian negara sebesar Rp490 juta. “Jika tidak diganti, hartanya dilelang untuk menutupi kerugian negara. Jika tidak mencukupi akan dikenakan hukuman penjara selama 3 bulan,” tambah Jonny Sitohang.

Lanjut ke hal A2 kol. 1 Antara

APARAT TNI dan Polri berusaha menghalau warga yang kembali terlibat konflik di Ambon, Maluku, Selasa (15/5) subuh.

Bentrok Di Ambon, 50 Masuk RS AMBON (Antara): Tidak ada korban meninggal akibat bentrok antarwarga saat perayaan hari Pattimura di Ambon, Selasa (15/5) subuh. Korban yang dirawat di Rumah Sakit Bhakti Rahayu berjumlah 11 orang, RSUD Haulussy Ambon 24 orang, RSU Sumber Hidup delapan orang serta Rumah Sakit Alfatah tujuh orang. “Tiga pasien di sini yang cukup kritis dan sedang menjalani operasi,” kata Kepala Humas RSUD Haulussy, dr. Ita

Sabrina di Ambon, Selasa. Gubernur Karel Albert Ralahalu mendatangi RSU Haulussy Ambon setelah selesai mengikuti upacara peringatan Hari Pattimura ke-195 yang berlangsung di Pattimura Park, lokasi patung Pahlawan Pattimura diabadikan. Ralahalu yang mengenakan pakaian kebesaran Upulatu melihat langsung para korban yang sementara ditangani para medis untuk membersihkan dan menjahit luka yang terkena ser-

Al Bayan

pihan bom, panah dan luka bakar. Sementara itu Menko Polhukam Djoko Suyanto mengharapkan pemerintah daerah dan pemuka agama serta tokoh masyarakat di Ambon dapat segera melakukan sejumlah langkah untuk menyelesaikan insiden antarwarga di ibu kota Provinsi Maluku itu yang berlangsung Selasa (15/5) subuh sehingga dampaknya tidak meluas.

Lanjut ke hal A2 kol. 6

Penahanan Angelina Diperpanjang 40 Hari JAKARTA ( Waspada): Komisi Pemberantasan Korupsi memperpanjang masa penahanan Angelina Sondakh, tersangka kasus dugaan suap penganggaran proyek di Kementerian Pemuda dan Olahraga serta di Kementerian Pendidikan Nasional. Masa penahanan Angelina akan diperpanjang hingga 40 hari ke depan terhitung mulai tanggal 16 Mei. “Jadi untuk penahananan tersangka Angelina memang diperpanjang 40 hari, untuk kepentingan penyidikan,” kata Juru Bicara KPK, Johan Budi, di Jakarta, Selasa (15/5). Angelina ditahan di Rumah Tahanan Jakarta Timur Cabang KPK sejak Jumat (27/4). Ia diduga menerima pemberian hadiah atau janji terkait penganggaran proyek di Kemenpora dan Kemendiknas. KPK menemukan 16 aliran dana mencurigakan ke Angelina. Secara terpisah, pengacara Angelina, Teuku Nasrullah mempertanyakan keputusan penahanan kliennya. Mantan pengajar di Universitas Indonesia itu mempertanyakan untuk apa KPK menahan Angelina sementara kliennya itu baru dua kali diperiksa dalam 20 hari ditahan. (j02)

Analisis Kebangkitan Islam

Manasik Haji Oleh Tgk. H. Ameer Hamzah ....mengerjakan haji adalah kewajiban manusia terhadap Allah, yaitu bagi orang-orang yang sanggup mengadakan perjalan ke Baitullah..... (QS Ali Imran:97) RUKUN Islam yang kelima adalah naik haji ke Baitullah. Kewajiban bagi yang mampu menanggung biaya, sehat badan dan punya kesempatan. Tidak wajib bagi yang tidak mampu. Bagi yang mampupun hanya wajib sekali dalam seumur hidupnya, lebih dari sekali hukumnya sunnat. Bila hajinya diterima oleh Allah, seseorang itu akan diampuni dosanya oleh Allah SWT. Lanjut ke hal A2 kol. 6

KANTOR Pusat OKI di Jeddah.

Antara

TIM penyelamat mengangkat kantung jenazah korban jatuhnya pesawat Sukhoi Superjet 100 di Posko Cijeruk, Bogor, Jabar, Selasa (15/5).

Tim SAR Sapu Lokasi Evakuasi BOGOR (Waspada): Tim SAR, Selasa (15/5) “menyapu” lokasi jatuhnya pesawat Sukhoi Superjet-100 di Gunung Salak, Bogor, untuk memastikan tidak ada lagi jenazah korban kecelakaan pesawat yang tertinggal. “Tim SAR bergerak vertikal ke kiri dan ke kanan untuk memastikan tidak ada lagi jenazah yang tidak terevakuasi,” kata Wakil Basarnas Ketut Parwa di Posko kendali evakuasi korban di Cipelang, Bogor. Menurut Ketut, hari ini tim

mengevakuasi dua kantong jenazah dan satu di antaranya berisi material. Ia menambahkan, hingga hari ke tujuh operasi evakuasi tim gabungan sudah mengevakuasi 28 kantong berisi jasad korban kecelakaan pesawat Sukhoi ke Bandara Halim Perdanakusuma Jakarta. Sementara kotak hitam yang merekam data penerbangan, menurut Ketut, masih dalam pencarian. “Kotak hitam sebenarnya bukan menjadi kewajiban Ba-

OKI Di Tengah Tantangan Global Umat

Wanita Gundul Cegah AIDS

Antara

PETUGAS Bea-Cukai dan Pomal menunjukkan sejumlah barang bukti, berupa tiga unit DVD Player yang digunakan untuk menyelundupkan senjata api jenis SigSauer P226 kaliber 9mm, di Kantor Pengawasan dan Pelayanan Bea dan Cukai Juanda, Sidoarjo, Selasa (15/5).

Prof. Dr. Syahrin Harahap, MA dari Jeddah

14 Kasus Kejahatan Bersenpi Dalam 5 Bulan

DIDUGA keras inilah yang diprediksi Jamaluddin alAfghani, tokoh terkemuka pembaharu Islam, bahwa komunitas muslim harus bangkit di abad modern dibawah panji aqidah islamiyah dan persatuan. Meskipun Jamaluddin (Al-Afgani: Al-Urwat al-Wusqa) di akhir abad Lanjut ke hal A3 kol. 1

MEDAN (Waspada): Sepanjang kurun waktu lima bulan sejak Januari hingga Mei 2012, sudah terjadi 14 kasus kejahatan menggunakan senjata api (senpi) di Sumatera Utara. Di antara kasus kejahatan bersenpi itu, bahkan menewaskan korbannya, seperti yang terjadi baru-baru ini di Kec. Silangkitang, Kab. Labuhanbatu. Lanjut ke hal A2 kol. 3

Rahmad Nazilla.

Lanjut ke hal A2 kol. 3

Ada-ada Saja

Mahasiswa Aceh Juara III Duta Mahasiswa 2012, Sumut Favorit JAKARTA (Waspada): Rahmad Nazilla dari Fakultas Ekonomi jurusan akuntansi Universitas Syiah Kuala, Aceh meraih juara ke-3 dalam ajang pemilihan duta mahasiswa 2012 Badan Kependudukan dan Keluarga Berencana (BKKBN). Lanjut ke hal A2 kol. 1

sarnas untuk mencari. Basarnas hanya berkewajiban terhadap korban. Tapi, ini masih akan dirapatkan lagi apa akan dihentikan atau dilanjut sampai beberapa hari,” katanya. Tak ada yang hidup Sementara itu Kepala Basarnas, Marsekal Madya Daryatmo mengatakan, sampai saat ini tidak ada ditemukan korban yang hidup selama evakuasi pesawat Sukhoi Superjet 100 yang jatuh.

AIDS tak dapat dipungkiri adalah penyakit paling menakutkan, karena hingga saat ini belum ada obatnya. Tidak mengkonsumsi narkoba, menjauhi seks bebas, setia berbagai cara lain ditempuh orang untuk menghindari penyakit paling mematikan ini. Namun di sebuah negara

Lanjut ke hal A2 kol. 1

Serampang - Bangunlah dengan ikhlas - He...he...he...


WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) RABU, Kliwon, 16 Mei 2012/24 Jumadil Akhir 1433 H

z zNo: 23866 * Tahun Ke-66

Terbit 24 Halaman (A1-12, B1-12) z zHarga Eceran: Rp 2.500,-

Angelina Sondakh saat berada di KPK.

Masa Penahanan Angelina Sondakh Diperpanjang

Menko Polhukam Harap Insiden Ambon Segera Tuntas

JAKARTA (Waspada): Komisi Pemberantasan Korupsi memperpanjang masa penahanan Angelina Sondakh, tersangka kasus dugaan suap penganggaran proyek di Kementerian Pemuda dan Olahraga serta di Kementerian Pendidikan Nasional. Masa penahanan Angelina akan diperpanjang hingga 40 hari ke depan terhitung mulai tanggal 16 Mei. “Jadi untuk penahananan tersangka Angelina memang diperpanjang 40 hari, untuk kepentingan penyidikan,” kata Juru Bicara KPK, Johan Budi, di Jakarta, Selasa (15/5). Angelina ditahan di Rumah Tahanan Jakarta Timur Cabang KPK sejak Jumat (27/4). Ia diduga menerima pemberian hadiah atau janji terkait penganggaran proyek di Kemenpora dan Kemendiknas. KPK menemukan 16 aliran dana mencurigakan ke Angelina. Secara terpisah, pengacara Angelina, Teuku Nasrullah mempertanyakan keputusan penahanan kliennya. Mantan pengajar di Universitas Indonesia itu mempertanyakan untuk apa KPK menahan Angelina sementara kliennya itu baru dua kali diperiksa dalam 20 hari ditahan. “Angie minta segera diperiksa tapi Lanjut ke hal A2 kol 5

Antara

APARAT TNI dan Polri berusaha menghalau warga yang kembali terlibat konflik di Ambon, Maluku, Selasa subuh (15/5). Konflik yang kembali terjadi bertepatan dengan peringatan Hari Pahlawan Nasional Pattimura ke-195 mengakibatkan belasan sepeda motor terbakar dan 50 orang luka-luka.

JAKARTA (Antara): Menko Polhukam Djoko Suyanto mengharapkan pemerintah daerah dan pemuka agama serta tokoh masyarakat di Ambon dapat segera melakukan sejumlah langkah untuk menyelesaikan insiden antarwarga di ibu kota Provinsi Maluku itu yang berlangsung Selasa subuh (15/5) sehingga dampaknya tidak meluas. Djoko Suyanto di kompleks Istana Presiden Jakarta, Selasa (15/5), usai mendampingi Presiden Susilo Bambang Yudhoyono menerima kunjungan Presiden Republik Demokratik Rakyat Korea atau Korea Utara Kim Yong Nam mengatakan sudah mendapat laporan dari Gubernur Maluku Karel Albert Ralahalu. “Tadi pagi Gubernur telepon saya. Memang itu sebenarnya tiap tahun ada acara itu hari ulang tahun Pattimura. Selalu ada arak-arakan. Mudah-mudahan ditangani dengan baik,” katanya. Menko Polhukam mengatakan telah meminta para tokoh masyarakat dan tokoh agama untuk berkumpul sehingga peristiwa itu tidak meluas. “Tadi saya minta mereka kumpul kembali para tokoh agama, tokoh adat, pimpinan daerah. Sudah tidak berkembang, sudah baikan. Mudah-mudahan tidak berkembang,” katanya. Lanjut ke hal A2 kol 3

7 Kandidat Agara Diumumkan KUTACANE (Waspada): Komisi Independen Pemilihan (KIP) Aceh Tenggara (Agara), Senin (14/5) pagi, melakukan rapat pleno secara marathon hingga Kamis (15/5) pukul 00:05 dini hari, memutuskan tujuh dari delapan kandidat balon Bupati-Wakil Bupati Agara, dinyatakan resmi menjadi pasangan calon Bupati dan Wakil Bupati Agara pada ajang Pilkada 2012.

Armen Desky Lolos, M. Ridho Gagal Demikian bunyi isi surat keputusan KIP Agara Nomor: 270/230/V/2012 yang ditandatangani Ketua KIP Agara Dedi Mulyadi Selian.

Pantauan Waspada, Senin malam, hingga menjelang diumumkan hasil penetapan hingga menjelang Selasa dini hari, Mapolres Agara hingga

sepanjang jalan di depan gedung DPRK setempat dipenuhi mobil dan polisi mempersiapkan pasukan pengamanan untuk mengantisipasi hal yang

tidak diinginkan menjelang diumumkan calon yang lolos dan yang tidak lolos. Bahkan di kantor KIP Agara juga tampak puluhan aparat disiagakan

hingga Selasa dini hari langsung dipantau Waka Polres Agara Kompol Gotman Sugiro, Kabag ops Kompol Sabri dan juga tampak di kantor KIP Agara memantau ketua Panwaslih Junianto Siahaan. Beberapa calon diperta-

nyakan Berselang beberapa menit diumunkan hasil pleno kandidat calon Bupati-Wakil Bupati Agara ini, suasana di halaman depan gedung KIP Lanjut ke hal A2 kol 6

Tim SAR SapuLokasi Evakuasi Sukhoi

Waspada/Surya Efendi

PLT Gubsu Gatot Pujo Nugroho disaksikan Pangdam I/BB Mayjen TNI Lodewijk F. Paulus, Kapoldasu Irjen Pol Wisjnu Amat Sastro, Wakil Ketua DPRDSU Kamaluddin Harahap, Wali Kota Medan Rahudman Harahap, Kanwil Kementerian Agama Sumut, Ketua MUI Sumut dan Ketua MUI Medan serta pengurus masjid meletakkan batu pertama pembangunan kembali Masjid Al IKhlas di Jl. Timor Medan, Selasa (15/5).

Plt Gubsu Dan Pangdam I/BB Letakkan Batu Pertama Masjid Al Ikhlas MEDAN (Waspada): Pembangunan Masjid Al Ikhlas Jl. Timor Medan dimulai, Selasa (15/5) pagi, ditandai peletakan batu pertama oleh Pangdam I/BB Mayjen TNI Lodewijk F. Paulus. Pembangunan ini diharapkan dapat menghilangkan ketidakharmonisan antara sebagian umat Islam dengan Kodam I/BB. “Tidak ada permasalahan

yang tidak selesai, kalau kita lakukan dengan bersungguhsungguh. Ini wujud kesungguhan Pangdam I/BB, dan diharapkan sedikit ketidakharmonisan selama ini bisa diselesaikan secara arif dan sabar,” kata Plt Gubsu H Gatot Pujo Nugroho, saat menghadiri peletakan batu pertama Masjid Al Ikhlas. Menurut Gatot, apa yang dilakukan Pangdam I/BB

dalam menyelesaikan ketidakharmonisan ini, dapat menjadi inspirasi bagi kita. “Atas nama Pemprovsu dan warga mengucapkan terimakasih. Penyelesaian ini melalui proses yang tekun, dan komunikasi. Dengan komunikasi dan dialog yang dilakukan Pangdam, persoalan yang pelik dan Lanjut ke hal A2 kol 6

BOGOR (Antara): Tim SAR, Selasa (15/5) “menyapu” lokasi jatuhnya pesawat Sukhoi Superjet-100 di Gunung Salak, Bogor, untuk memastikan tidak ada lagi jenazah korban kecelakaan pesawat yang tertinggal. “Tim SAR bergerak vertikal ke kiri dan ke kanan untuk memastikan tidak ada lagi jenazah yang tidak terevakuasi,” kata Wakil Basarnas Ketut Parwa di Posko kendali evakuasi korban di Cipelang, Bogor. Menurut Ketut, hari ini tim mengevakuasi dua kantong jenazah dan satu di antaranya berisi material. Ia menambahkan, hingga hari ke tujuh operasi evakuasi tim gabungan sudah mengevakuasi 28 kantong berisi jasad korban kecelakaan pesawat Sukhoi ke Bandara Halim Perdanakusuma Jakarta. Sementara kotak hitam yang merekam data penerbangan, menurut Ketut, masih dalam pencarian. “Kotak hitam sebenarnya bukan menjadi kewajiban Basarnas untuk mencari. Basarnas hanya berkewajiban terhadap korban. Tapi, ini masih akan dirapatkan lagi apa akan dihentikan atau dilanjut sampai beberapa hari,” kata-nya. Lanjut ke hal A2 kol 1

Polri Terima 22 Kantong Jasad Dan 5 Properti JAKARTA (Antara): Rumah Sakit Polri Said Sukanto Kramat Jati Jakarta telah menerima lima kantong properti milik korban kecelakaan pesawat Sukhoi Superjet-100 di Bogor pada Rabu (9/5) lalu. “Sampai hari ini kami menerima 27 kantong jenazah dimana 22 kantong berisi jasad dan lima kantong berisi properti milik korban,” kata Kepala RS Polri Said Sukanto Brigjen Pol Agus Prayitno di Jakarta, Selasa (15/5). Kepolisian, menurut dia, hari ini masih melanjutkan pemeriksaan postmortem—setelah kematian—, pengambilan sampel DNA keluarga korban, dan mencocokkan data antemortem dengan data postmortem. “Hari ini sudah selesai, setelah itu dilakukan identifikasi kemudian lakukan konstruksi,” kata Agus.

Analisis Kebangkitan Islam

Al Bayan

Manasik Haji

DIDUGA keras inilah yang diprediksi Jamaluddin alAfghani, tokoh terkemuka pembaharu Islam, bahwa komunitas muslim harus bangkit di abad modern dibawah panji aqidah islamiyah dan persatuan. Meskipun Jamaluddin (Al-Afgani: Al-Urwat al-Wusqa) di akhir abad

MEDAN (Waspada): Seminggu ke depan Badan Meteorologi Klimatologi dan Geofisika (BMKG) Wilayah I, memprediksi suhu udara di kawasan Medan mencapai 34 derajat celcius.Hal ini menyebabkan suasana panas dan gerah. Suhu tersebut bersumber dari sinar matahari dan efek rumah kaca di Medan yang memiliki gedung tinggi serta panas bersumber dari asap kendaraan. Tetapi, potensi hujan masih terjadi, baik intensitas sedang dan lebat disertai petir dan angin kencang pada sore dan malam hari. Warga diminta mewaspadai pohon-pohon dan tower bakal tumbang, kata Hartanto, ST, MM, kepala Bidang Data dan Informasi

Lanjut ke hal A3 kol 1

Lanjut ke hal A3 kol 1

Oleh: H. Ameer Hamzah ....mengerjakan haji adalah kewajiban manusia terhadap Allah, yaitu bagi orang-orang yang sanggup mengadakan perjalan ke Baitullah..... (QS Ali Imran:97) RUKUN Islam yang kelima adalah naik haji ke Baitullah. Kewajiban bagi yang mampu menanggung biaya, sehat badan dan punya kesempatan. Tidak wajib bagi yang tidak mampu. Bagi yang mampupun hanya

Lanjut ke hal A2 kol 2

Minggu Depan Medan Panas

KANTOR Pusat OKI di Jeddah.

OKI Di Tengah Tantangan Global Umat Laporan Prof Dr Syahrin Harahap MA Dari Jeddah

Waspada/Mahadi Pinem

SELASA (15/5) dini hari, sekira pukul 00:05, hasil rapat pleno anggota komisioner KIP Agara diumukan, hanya pasangan M.Ridho yang dinyatakan tidak lolos, sedangkan tujuh pasangan kandidat lainya ditetapkan dalam pleno memenuhi syarat sebagai pasangan calon Bupati dan Waki Bupati Agara 2012.

SPPBE Lhokseumawe Dilempari Bom Molotov LHOKSEUMAWE (Waspada): Stasiun Pengisian dan Pengangkutan Bulk Elpiji (SPPBE) Kota Lhokseumawe di Gampong Cot Girek, Kemukiman Kandang, Kecamatan Muara Dua, Kota Lhokseumawe, Senin (14/5) malam, dilempari bom molotov. Tidak ada korban jiwa dalam peristiwa itu. Kapolresta Lhokseumawe

melalui Kasat Reskrim AKP Galih Indra Giri, Selasa (15/5), mengatakan, bom molotov yang dilempar oleh seseorang ke SPPBE Lhokseumawe dibuat dari botol kecap. Tiga buah botol bom molotov yang dilempar ke SPPBE. Dua botol di antaranya meledak dan satu botol tidak meledak karena terendam air. Pelaku melempar botol berisi

Mahasiswa Aceh Juara III Duta Mahasiswa 2012, Sumut Favorit JAKARTA ( Waspada): Rahmad Nazilla dari Fakultas Ekonomi jurusan akuntansi Universitas Syah Kuala, Aceh meraih juara ke-3 dalam ajang pemilihan duta mahasiswa 2012 Badan Kependudukan dan Keluarga Berencana (BKKBN). Sedangkan Putri Qintari Ayu Aninditha dari Fakultas Psikologi Universitas Medan Area, Sumatera Utara, berhasil meraih juara favorit. Kepala BKKBN, Sugiri Syarif di acara penobatan Duta Mahasiswa 2012 di Jakarta, Senin (14/5) mengatakan, program pemilihan duta mahasiswa menjadi simbol dari kepedulian pemerintah terhadap keberadaan kaum remaja. Saat ini jumlah remaja di Indonesia mencapai 70 juta orang. Mereka sangat rentan terhadap berbagai perilaku tidak baik seperti penyalahgunaan narkoba dan seks bebas. Lanjut ke hal A2 kol 1

minyak itu melalui pagar belakang sebelah selatan. Bom molotov itu dilempar di dekat tabung gas yang sudah tidak berisi. Sebelum bom dilempar, satpam SPPBE yang bertugas pada malam itu sempat mendengar ada orang yang bergerak di semak-semak, namun setelah dicek tidak ada. Lanjut ke hal A2 kol 1

Ada-ada Saja

Wanita Gundul Cegah AIDS

AIDS tak dapat dipungkiri adalah penyakit paling menakutkan, karena hingga saat ini belum ada obatnya. Tidak mengkonsumsi narkoba, menjauhi seks bebas, setia berbagai cara lain ditempuh orang untuk menghindari peyakit paling mematikan ini. Namun di sebuah negara

Lanjut ke hal A2 kol 5

Serampang - Batu pertama runtuh batu kedua tegak lagi - He.... he....he....


Berita Utama

A2 Mahasiswa Aceh ....

“Karena itu keberadaan duta mahasiswa dapat dijadikan sumber pengetahuan bagi rekan sebayanya, terkait kesehatan reproduksi dan perencanaan keluarga,” kata Sugiri. Dalam kesempatan itu, Sugiri menyematkan gelar Duta Mahasiswa 2012 kepada mahasiswa asal Kalimantan dan Bali. Kepala BKKBN Aceh, Nasrullah lewat pesan singkatnya mengataka, kemenangan mahasiswa Aceh tahun ini adalah prestasi luar biasa. “Saya kira ini diluar dugaan, dari 33 provinsi, masuk 10 besar saja sudah syukur. Apalagi sampai juara ke-3, sangat kami syukuri,” kata Nasrullah. Dikatakan Nasrullah, sebagai duta mahasiswa, dia berharap para pemenang dapat menjadi peer educator dan peer conselor dalam bidang kependudukan dan kesehatan reproduksi untuk teman-teman sebayanya. “Sehingga teman-temannya memperoleh informasi yg benar dari seorang pendidik muda. Semoga wawasan generasi muda akan meningkat dalam pemahaman problema

Minggu Depan ....

(Datin) pada BMKG Wilayah I stasiun Bandara Polonia Medan, saat dikonfirmasi di Bandara Polonia, Selasa (15/5). Menurut Hartanto, intensitas curah hujan masih berpeluang sedang dan lebat, bahkanpotensi petir dan angin kencang masih terjadi di kawasan Medan dan sekitarnya. Untuk itu, Hartanto mengingatkan warga yang bertempat tinggal di kawasan bantaran sungai agar meningkatkan kewaspadaan banjir kiriman dari hulu sungai pada malam hari. “Biasanya akumulasi dari terjadi panas berhari-hari dengan suhu rata-rata 33 hingga 34 derjat celcius, pasti ter-

SPPBE ....

Tidak lama setelah satpam meninggalkan lokasi tersebut, bom dilempar ke SPPBE. Suara ledakan bom molotov tidak begitu besar, namun api yang ditimbulkan sempat menyala di tabung gas yang sudah tidak ada isinya. Api berhasil dipadamkan sehingga tidak menimbulkan ledakan. Galih Indra Giri mengatakan di lokasi kejadian pihaknya mencium adanya bau minyak tanah.

Tim SAR ....

Capai 80 Persen Koordinator misi pencarian (Search Mission Coordinator/SMC) dan evakuasi Sukhoi Superjet 100, Ketut Parwa, menyatakan proses evakuasi korban sudah mencapai sekitar 80 persen. “Sudah sekitar 80 persen, korban Sukhoi yang terevakuasi,” katanya, di Lapangan Pasir Pogor, Cijeruk, Cipelang, Bogor, Jawa Barat, Selasa. Saat ini, katanya, tim operasi SAR tinggal melakukan penyapuan di areal lokasi jatuhnya pesawat yang berpenumpang 45 orang itu. Sementara, personel tim

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. KxKf6+, g7xK. 2. Bd-g4+, Rh8. 3. MxBf7, BxM. 4. Be8+, Bf8. 5. BxBf8+mat. Jawaban TTS: TTS Topik

Kesehatan/ Nama RS

P E R M S A R I M U I I O T I K M H E R N A A A J M A L A A R S U Z A A N R S H A J A L H

M A T E R N A H A P I E

A T A B U N D I Y I A R A U S T S U C M A D A MM A L I N P N A Y A T I S K S U E P L I R N G A D I O U N S L L I S A B E T

Jawaban Sudoku:

6 3 9 1 2 5 4 8 7

7 5 8 4 6 9 3 1 2

2 4 1 3 7 8 5 9 6

9 6 7 5 8 3 1 2 4

4 8 2 6 1 7 9 5 3

5 1 3 2 9 4 6 7 8

1 2 5 8 3 6 7 4 9

3 7 4 9 5 2 8 6 1

8 9 6 7 4 1 2 3 5

A K U S T I K

H

kependudukan di Indonesia,” imbuh Nasrullah.. Kepala Bidang Keluarga Sejahtera dan Pemberdayaan Keluarga BKKBN Sumut, A Sofian Rangkuti mengatakan turut bangga dengan terpilihnya duta mahasiswa Sumut sebagai favorit. Itu artinya penampilan dan pembawaan Putri disukai banyak orang. “Saya menilai ini langkah maju. Ke depan, sebagai duta pilihan, Putri akan lebih banyak memberikan sosialisasi terkait program KB kepada rekan sebayanya,” kata Sofian. Sofian menyampaikan amanat dan harapan dari Plt Gubsu, Gatot Pujonugroho saat audiensi dengan duta mahasiswa dan Kepala BKKBN Sumut, agar program genre dapat menjadi unit kegiatan mahasiswa di perguruan tinggi dan akademi. Sebagai juara ke-3, Rahmad mendapat piagam serta uang senilai Rp 7 juta. Putri mendapat piagam dan uang pembinaan senilai Rp 5 juta. Duta mahasiswa, sudah berlangsung sejak 2009. (dianw) jadi hujan lebat dan berpeluang banjir kiriman,” kata Hartanto. Dia menilai potensi banjir kiriman dari hulu sungai masih bakal terjadi kalau intensitas curah hujan meningkat terutama di kawasan pergunungan dan lereng-lereng perbukitan seperti kawasan Sembahe. Menyinggung kondisi perairan, dia minta kalangan para nelayan agar meningkatkan kewaspadaan mengingat gelombang laut di kawasan Selat Malaka masih tinggi. Tinggi gelombang laut antara 1,5 hingga 2 meter, terutama pada malam hari, berbahaya pada nelayan-nelayan tradisional menangkap ikan di laut lepas. (m32) Sekarang ini, polisi telah memanggil dua orang saksi yakni Satpam di SPPBE. Di tempat kejadian perkara (TKP) polisi mengamankan barang bukti berupa pecahan kaca botol kecap, dan sebuah botol bom molotov yang tidak meledak karena masuk air, dua buah sumbu. “Kita belum bisa memastikan jumlah pelakunya. Tidak ada korban dalam insiden itu,” kata AKP Galih Indra Giri. (b18) SAR gabungan yang berada di lokasi musibah berjumlah 512 orang yang berasal dari TNI, Br imob, dan warga sipil lainnya. “Nanti personel di lokasi akan dikurangi secara bertahap, mengingat hasil evakuasi yang sudah mencapai 80 persen,” katanya.

Al Bayan ....

wajib sekali dalam seumur hidupnya, lebih dari sekali hukumnya sunnat. Bila hajinya diterima oleh Allah, seseorang itu akan diampuni dosanya oleh Allah SWT. Dalam hadis Rasulullah bersabda: Hai manusia, Allah telah mewajibkan haji kepadamu, maka laksanakanlah haji. Seorang lelaki bertanya: Apakah setiap tahunnya ya Rasulullah? Rasul terdiam sehingga lelaki itu bertanya tiga kali. Lalu Nabi menjawab, Andai kukatakan wajib setiap tahun maka ia menjadi wajib

WASPADA Rabu 16 Mei 2012

Tidak Ada Korban Yang Hidup

Antara

PRESIDEN KOREA UTARA. Presiden Susilo Bambang Yudhoyono (kanan) menerima kunjungan kenegaraan Presiden Presidium Majelis Rakyat Tertinggi Korea Utara Kim Yong Nam (kiri) di Istana Merdeka, Jakarta, Selasa (15/5). Kedua pemimpin bersama masing-masing delegasi melakukan pertemuan bilateral untuk meningkatkan kerjasama kedua negara.

PDI-P Punya Sejumlah Nama Bakal Calon Untuk Pilgubsu 2013 MEDAN (Waspada): PDIPerjuangan khususnya Sumut sudah memiliki sejumlah nama yang bakal muncul dalam Pilgubsu 2013, namun tetap menjalani seleksi maupun fit and proper test serta penetapannya oleh DPP. Hal itu dikemukakan Ketua DPD PDI-Perjuangan Sumut Panda Nababan, didampingi unsur DPP Trimedya Panjaitan dan unsur DPD PDI-P Sumut Brilian Moktar, Eddy Rangkuti dan lainnya di sela-sela rapat koordinasi daerah (Rakorda) II DPD PDIP Sumut, di Asrama Haji Pangkalan Masyhur, Medan, Selasa (15/5). ‘’Tegasnya kita melakukan penyaringan, namun muara serta keputusannya ada pada DPP.Begitupun, tetap saja DPP akan menerima masukanmasukan,’’kata Panda dan menambahkan, mulai 2 Juli 2012, PDIP melakukan verifikasi 20 Juli 2012, dan pada 10 Juli 2012 sudah berada di DPP. Menurut Panda, ke-enam nama tersebut T. Erry Nuradi, Benny Pasaribu, R.E. Nainggolan, Bintata Hutabarat, Juliari Batubara dan Humala.

Namun, katanya, PDI-P bisa melakukan perubahan, yakni tidak ada lagi money politics, termasuk dalam hal berkaitan dengan calon-calon legislatif. ‘’Jadi tidak ada lagi bayarbayar,’’ucap Panda blakblakan. Dia menambahkan, PDI-P sudah punya metode dan sistem. Namun khusus untuk Pilgubsu, tetap mengedepankan kader. ‘’Ya, kalau tidak untuk orang nomor satu, nomor dua, tetap kader partai. Hal ini mengingat pengalamanpengalaman lalu,’’ujarnya. Menyinggung pemekaran daerah, baik tingkat provinsi maupun kabupaten/kota di Sumut, dia menyatakan sangat mendukung hal itu.‘’Seperti halnya mewujudkan Kota Berastagi pemekaran Kabupaten Karo, kami sangat mendukung, dan hal itu sudah sampai di Jakarta,’’kata dia. Menurut dia, sudah saatnya Berastagi itu menjadi kota yang dipimpin oleh seorang Wali Kota. Sekaitan dengan itu, PDI-P sudah meminta kepada seluruh kader termasuk di DPRD tetap mendukung pemekaran daerah.

Menko Polhukam ....

Menahan diri Sebelumnya, Gubernur Maluku Karel Albert Ralahalu mengimbau warga kota Ambon khususnya dan Maluku secara umum untuk menahan diri serta tidak terpancing dengan insiden bentrokan antarkelompok warga di kawasan Negeri Batu Merah dan Mardika, Selasa pagi. “Mari kita jaga kondisi dan situasi keamanan tetap kondusif. Untuk itu, saya mengimbau warga kota Ambon dan Maluku pada khususnya menahan diri dan tidak terpancing dengan insiden bentrokan di perbatasan Mardika,” kata Gubernur Ralahalu, usai perayaan HUT Pattimura ke-195, di Ambon, Selasa.

Insiden Mardika mengakibatkan sekitar 50-an orang terluka karena terkena serpihan yang diduga bom yang dilempar OTK, serta terkena lemparan batu dan benda tajam lainnya saat warga sedang menonton arak- arakan obor Pattimura, Selasa subuh. Para korban kebanyakan mengalami luka berat dan ringan di daerah tungkai kaki dan paha, punggung serta bagian wajah, seluruh korban kini sedang menjalani perawatan intensif di sejumlah Rumah Sakit (RS) antara lain Rumah Sakit Umum Daerah (RSUD) Dr Haulussy Ambon, 23 orang, RS Sumber Hidup (8) orang, RS Bhakti Rahayu, 11 orang, RS Al Fatah Ambon tujuh orang serta satu korban dirawat di RS Dr Latumeten.

dan kamu tidak mampu mengerjakannya.(HR:Muslim) Menurut sejarah, haji baru diwajibkan tahun ke delapan hijrah. Setelah Rasulullah menyelesaikan tugas-tugas dakwahnya yang maha berat. Rasulullah sendiri hanya naik haji sekali dalam seumur hidupnya. sejak tahun ke 10 hijriah, mulailah umat Islam berduyun-duyun naik haji ke Baitullah. Mereka datang dari seluruh pelosok dunia sampai sekarang. Semakin makmur sebuah negeri semakin banyak jumlah jamaah hajinya sehingga Negara Arab Saudi

sebagai “tuan rumah” memperluas Masjidil Haram, Masjid Nabawi, membangun torowongan ke Mina, mengaliri air zamzam ke seluruh pelosok arena haji. Sekarang pelatihan manasik haji sudah dibuka di berbagai tempat. Tujuannya juga mulia, yakni untuk melatih calon jamaah haji yang akan menunaikan haji tahun ini. Alhamdulillah calon jamaah haji juga sangat ramai yang memgikuti manasik haji, Ini sangat positif. Selain menambah perbekalan ilmu untuk jamaah, juga menjadi syiar Islam.

Menjawab wartawan perihal pembangunan di Sumut yang dinilai lamban, Panda menyatakan, sebenarnya sudah ada dua atau tiga kali pertemuan Gubsu dengan para anggota DPR RI asal Sumut, yakni 30 orang. ‘’Mereka, para anggota DPR itu sudah kompak dan sepakat, cuma tinggal bagaimana Pemdanya,’’papar Panda. Makanya, kata dia, kita sudah menegaskan, PDI-P berharap Gubsu lebih peduli terhadap pembangunan Sumut. Rakorda , kata Panda untuk menuju 2014. Sementara, Trimedya Panjaitan mengemukakan, Sumut merupakan basis PDIP, sehingga DPP memprioritaskannya. Apalagi jumlah pemilih di Sumut lebih dari 8 juta orang. ‘’Sehingga kami memberikan prioritas, apakah untuk orang nomor satu atau untuk orang nomor duanya,’’ kata dia. Tetapi, lanjutnya, tergantung kepada masyarakatnya. (m34)

Masa Penahanan ....

nggak diperiksa-periksa kayak gini. Ini sudah 20 hari tapi baru dua kali diperiksa, untuk apa ditahan? Kata Angie, ‘saya ingin segera memberi keterangan’” tutur Nasrullah. Sementara menurut Johan, efektivitas pemeriksaan berkas perkara Angelina, tidak tergantung berapa kali KPK memeriksa seorang tersangka. “KPK masih lakukan pemeriksaan saksi, nanti kita akan periksa lagi Angie sebagai t e r s a n g k a ,” u j a r J o h a n . Mengenai jadwal pemeriksaan Angelina, kata Johan, tergantung kebutuhan penyidik KPK. (j02)

Ada-ada Saja ....

Afrika, tepatnya di Zimbabwe, ada kiat baru yang cukup unik agar warga tidak terjangkit penyakit menular ini. Seorang politisi di negara tersebut mengatakan bahwa penyebaran penyakit HIV AIDS dapat dikurangi jika kaum wanita mau mengguduli kepala, plus mereka dilarang mandi. Morgan Femai mengklaim cara ini akan membuat pria “tidak tertarik pada wanita rapi”. Sang senator mendesak agar kebijakan tersebut segera diberlakukan untuk memaksa kaum wanita tampil jelek agar para pria tidak tertarik kepada mereka. Ia mengatakan hal ini dalam sebuah pidato di sebuah seminar pencegahan penyakit AIDS, seperti dilansir Emirates 247, Selasa (15/5). “Yang saya maksud adalah agar pemerintah mengeluarkan kebijakan yang dapat memaksa kaum wanita mencukur kepala mereka hingga botak seperti yang dilakukan sekte Apostolic,” ujarnya. “Mereka (wanita) juga jangan mandi, karena mandi adalah penyebab semua masalah ini,” tambahnya. (rzl)

JAKARTA (Waspada) : Kepala Basar nas, Marsekal Madya Daryatmo mengatakan, sampai saat ini tidak ada ditemukan korban yang hidup selama evakuasi pesawat Sukhoi Superjet 100 yang jatuh di Gunung Salak, Bogor, Jawa Barat, Rabu (9/5). Sebanyak 27 kantong jenazah yang dievakuasi dari lokasi jatuhnya pesawat buatan Rusia itu telah diserahkan pada tim identifikasi RS Polri

Sukamto, Jakarta, merupakan bagian tubuh yang kebanyakan terpotong. “Selama evakuasi korban, Basarnas tidak menemukan korban hidup atau survivor,” kata Dar yatmo di Bandara Halim Perdanakusuma, Selasa (15/5). Menurut Daryatmo, dari kemampuan manusia tidak ada yang bertahan lebih dari 7 hari. “Saya tidak menyim-

pulkan, tapi kemampuan manusia bertahan itu selama 7 hari,” ujarnya. Meski evakuasi tetap dilanjutkan kata Daryatmo, dari aturannya 7 hari proses operasi evakuasi dapat dihentikan. “Tapi, melihat kondisi yang ada saat ini, Basarnas tetap melanjutkan proses evakuasi sampai batas tidak tertentu dan melihat kondisi dilapangan,” katanya. (j02)

Bom Sisa Konflik Di Kolam Warga

LANGKAHAN, Aceh Utara (Waspada): Bom jenis tabung pelontar diduga peninggal masa konflik ditemukan di bekas kolam ikan warga Gampong Simpang Tiga, Langkahan, Aceh Utara, Senin sore. Warga menyerahkan temuan itu kepada anggota Koramil Langkahan, selanjutnya diamankan ke Markas Kodim 0103 Aceh Utara, Selasa (15/5). Menurut warga di lokasi temuan bom, bahan peledak itu ditemukan Samsul, 45, warga Simpang Tiga yang sedang mencari ikan di bekas kolam ikan. Sekitar pukul

16.00, secara tidak sengaja tangannya meraba benda berbentuk aneh. Setelah diperiksa ternyata temuan itu adalah bom jenis tabung pelontar (TP). Bom selanjutnya diserahkan kepada Solihin, salah seorang pekerja bengkel di Simpang Tiga. Karena Solihin kenal dekat dengan anggota Koramil Langkahan. Sementara itu, Komandan Kodim 0103 Aceh Utara Letkol Inf Agus Tri Antoni melalui Pasi Intel Kapten Inf Aris NL mengakui ada temuan bom jenis TP di Langkahan. “Anggota Koramil Langkahan,

Serma Junaidi menerima TP dari seorang pekerja bengkel, Solihin setelah ditemukan oleh warga yang mencari ikan di bekas kolam desa itu,” jelasnya. Menurut dia, saat ini bom TP bernomor seri F 60/1 LOT 21-MCR-93 yang diduga peninggalan masa konflik, diamankan di Makodim Aceh Utara. Aris juga mengharapkan ke depan masyarakat segera melapor kepada pihak keamanan terdekat, jika menemukan benda yang diduga bom agar bisa diamankan. (b15)

7 Kandidat ....

selaku Ketua KIP Agara kepada Waspada mengatakan, semua pihak yang merasa keberatan dipersilakan menggugat. Sejak awal memang diprediksi akan muncul persoalan di antaranya mempertanyakan dukungan PPPI terhadap pasangan M.Ridho karena juga PPPI ini memberikan dukungan pada pasangan Hasanuddin B. Selanjutnya juga soal status kasus hukum Armen Desky. Namun KIP Agara telah bekerja maksimal bahkan berdebat alot hingga detik ditetapkan tujuh pasangan balon yang bakal tampil sebagai pasangan calon. Dipaparkan berdasarkan penelitian ulang kelengkapan dan perbaikan berkas balon bupati Agara yang diverifikasi oleh Pokja pendaftaran, verifikasi administrasi dan faktual KWK yang diplenokan oleh KIP Agara. Diakui rapat pleno berlangsung alot dan banyak menyita waktu ketika membahas kandidat pasangan Hasanuddin B-Ali Basrah dari jalur partai juga memplenokan pasangan Armen Desky –Tgk Appan Husni dari jalur Independen. Sedangkan pasangan M Ridho–Tumpas Simanjuntak tidak terlalu menyita waktu, meskipun pasangan ini

dinyatakan tidak lolos. Pasalnya, rekomendasi dukungan partainya dialihkan pada pasangan kandidat lain. Soal permasalahan Ali Basrah yang menjabat kepala dinas dalam pleno hingga menjelang penetapan calon, kata Mulyadi, tidak melanggar peraturan. Soal pengunduran diri Ali Basrah, suratnya telah dilayangkan kepada Sekda Hasanuddin Darjo tertanggal 4 April 2012. Demikian juga halnya dengan status hukum Armen Desky, setelah dilakukan penelitian ulang berkas, termasuk kelengkapan syarat dari pengadilan negeri, disimpulkan hasil pleno KIP Agara menyatakan Armen Desky berhak maju sebagai calon melalui jalur perseorangan. Dan di dalam penetapan calon ini juga bukanlah semua kandidat disetujui maju melalui kebulatan suara, penetapan hasil pleno beragam, sehingga diputuskan kandidat berhak maju sebagai pasangan calon. Dengan telah ditetapkanya pasangan calon bupati dan wakil bupati Agara, kata Dedi Mulyadi, KIP Agara melakukan penetapan nomor urut pasangan hari ini, Rabu (16/5), di DPRK Agara, pukul 12:00. (b25)

Plt Gubsu ....

Dia mengaku bersyukur diberi kesempatan oleh Allah SWT untuk membangun kembali Masjid Al Ikhlas. “Saya yang muallaf ini diberi kesempatan oleh Allah untuk membangun masjid. Saya menganggap ini adalah karunia Allah SWT. Mudah-mudahan kerukunan hidup umat bera g a m a s e m a k i n b a g u s ,” jelasnya. Pembangunan Masjid Al Ikhlas di atas lahan luas 400 meter persegi ini memakan biaya Rp826 juta dan diperkirakan siap November 2012. Wali Kota Medan Drs H Rahudman Harahap MM, menyampaikan ucapan terima kasih dan apresiasinya kepada Pangdam I/BB yang telah melaksanakan peletakan batu pertama pembangunan Masjid Al Ikhlas. “Kita mendoakan apa yang telah dilakukan Pangdam I/BB menjadi amal baik. Selanjutnya, diharapkan pembangunan ini akan membuat masyarakat semakin memakmurkan masjid,” ujarnya. Terkait pembangunan masjid yang memakan waktu 183 hari kerja, Rahudman mengimbau kepada seluruh umat apabila tidak bisa membantu materi, bantulah

dengan doa sehingga masjid dapat dipergunakan secepatnya. Hadir pada acara itu, Wakil Wali Kota Medan Dzulmi Eldin, Ketua MUI Sumut Abdullah Syah, Ketua MUI Medan Mohd. Hatta, Wakil Ketua DPRD Sumut Sigit Pramono Asri, Ketua Forum Umat Islam Sumatera Utara Ustadz Sudirman Timsar Zubil, Ketua Umum Aliansi Ormas Islam Pembela Masjid Sumatera Utara Drs Leo Imsar Adnans, Sekretaris Aliansi Ormas Islam drg M Sahbana serta ormas-ormas Islam lainnya. Ke t u a Um u m A l i a n s i Ormas Islam Pembela Masjid Drs Leo Imsar Adnans yang dikonfirmasi terkait berkurangnya ukuran dan luas areal Masjid Al Ikhlas belum bisa b e r k o m e n t a r. S e b e l u m diruntuhkan ukuran masjid 22 X25 M2, dan luas lahan 40X40M2. Infor masi diperoleh Waspada, sejumlah pengurus Aliansi Ormas Islam sudah menghubungi Pangdam I/BB untuk bertemu membahas masalah tersebut, namun Pangdam belum bisa ditemui karena masih ada kesibukan dinas. (m50/h02/h04)

seketika berubah disebabkan munculnya M Ridho, salah satu kandidat balon Bupati yang berpasangan dengan Ir H Tumpas Simanjuntak yang maju melalui jalur partai dinyatakan tidak lolos menjadi calon. Pasalnya kurang dukungan. PPPI menarik dukungan pada pasangan ini dan PPPI merekomendasikan dukungan mereka pada pasangan bupati incumbent Hasanuddin B-Ali Basrah. Keputusan KIP yang tidak meloloskan ini, disikapi M Ridho dengan menggelar konferensi pers di halaman KIP Agara. M. Ridho menyatakan akan menggugat KIP Agara. Pasalnya, mereka meragukan kenetralan KIP dengan meloloskan baik secara hukum maupun peraturan KPU. Di antaranya dipersoalkan tentang status Ali Basrah calon Wakil Bupati berpasangan dengan Hasanuddin, B, selaku pejabat Kadis Dikpora tidak melepas jabatan hingga penetapan calon. Selain itu dipermasalahkan tentang status hukum H Armen Desky yang lolos sebagai kandidat calon Bupati Agara priode 2012 2017. Dedi Mulyadi Selian

rumit bisa diselesaikan,” ujar Gatot, dan mengharapkan dengan dibangunnya Masjid Al Ikhlas bisa menjadi pusat kegiatan para dai untuk menyiarkan agama Islam. “Serta dapat membangun ketaqwaan warga Sumut seperti yang diamanatkan UU dan Pancasila bahwa ketaqwaan sangat berkontribusi m e m b a n g u n k e j i w a a n ,” sebutnya. Sementara itu, Pangdam I/BB Mayjen TNI Lodewijk F Paulus mengatakan, Kota Medan merupakan salah satu contoh kerukunan hidup umat beragama. “Kita harapkan ‘kerikil-kerikil’ yang ada selama ini menjadi tidak ada. Medan ini kan salah satu contoh kerukunan hidup umat beragama, jangan kita sesama m u s l i m m a l a h k o n f l i k ,” katanya. Lodewijk berharap, pembangunan masjid tersebut dapat terus meningkatkan ketaqwaan umat Islam di wilayah Medan, karena adanya sarana-sarana ibadah yang dibangun. “Masjid inikan tempat ibadah, tempat para umat Islam berkumpul, berkomunikasi dengan sesama manusia dan Allah,” tuturnya.


Berita Utama

A2

Mahasiswa Aceh ... Sedangkan Putri Qintari Ayu Aninditha dari Fakultas Psikologi Universitas Medan Area, Sumatera Utara berhasil meraih juara favorit, Kamis lalu. Kepala BKKBN, Sugiri Syarif diacara penobatan Duta Mahasiswa 2012 di Jakarta, Senin (14/ 5) mengatakan, program pemilihan duta mahasiswa menjadi simbol dari kepedulian pemerintah terhadap keberadaan kaum remaja. Saat ini jumlah remaja di Indonesia mencapai 70 juta orang. Mereka sangat rentan terhadap berbagai perilaku tidak baik seperti penyalahgunaan narkoba dan seks bebas. “Karena itu keberadaan duta mahasiswa dapat dijadikan sumber pengetahuan bagi rekan sebayanya, terkait kesehatan reproduksi dan perencanaan keluarga,” kata Sugiri. Dalam kesempatan itu, Sugiri menyematkan gelar Duta Mahasiswa 2012 kepada mahasiswa asal Kalimantan dan Bali. Kepala BKKBN Aceh, Nasrullah lewat pesan singkatnya mengataka, kemenangan mahasiswa Aceh tahun ini adalah

prestasi luar biasa. “Saya kira ini diluar dugaan, dari 33 provinsi, masuk 10 besar saja sudah syukur. Apalagi sampai juara ke-3, sangat kami syukuri,” kata Nasrullah. Kepala Bidang Keluarga Sejahtera dan Pemberdayaan Keluarga BKKBN Sumut, A Sofian Rangkuti mengatakan turut bangga dengan terpilihnya duta mahasiswa Sumut sebagai favorit. Itu artinya penampilan dan pembawaan Putri disukai banyak orang. “Saya menilai ini langkah maju. Ke depan, sebagai duta pilihan, Putri akan lebih banyak memberikan sosialisasi terkait program KB kepada rekan sebayanya,” kata Sofian. Sofian menyampaikan amanat dan harapan dari Plt Gubsu, Gatot Pujo Nugroho saat audiensi dengan duta mahasiswa dan Kepala BKKBN Sumut, agar program genre dapat menjadi unit kegiatan mahasiswa di perguruan tinggi dan akademi. Sebagai juara ke-3, Rahmad mendapat piagam serta uang senilai Rp 7 juta. Putri mendapat piagam dan uang pembinaan senilai Rp 5 juta. Duta mahasiswa, sudah berlangsung sejak 2009. (dianw)

Ketua DPRD Binjai ... Vonis hakim lebih ringan dari tuntutan jaksa, dimana mantan Ketua Harian KONI Kota Binjai itu dituntut 3 tahun 6 bulan penjara dengan membayar kerugian negara sebesar Rp900 juta lebih. Jaksa Penuntut Umum (JPU), Iqbal dalam dakwaannya menyebutkan, saat itu terdakwa Haris Harto belum dilantik sebagai pengurus harian KONI Binjai, namun mengajukan dan meminta bantuan dana ke Pemkot Binjai. Kemudian, kata JPU, permohonan bantuan dana untuk KONI Binjai itu disetujui oleh Wali Kota Ali Umri, tanpa melihat suratsurat yang telah diajukan oleh terdakwa tersebut. Padahal, terdakwa belum berhak mengajukan bantuan dana untuk KONI Binjai karena dia belum lagi dilantik secara resmi. Akibat pencairan dana untuk bantuan KONI Binjai itu, negara mengalami kerugian senilai Rp951 juta dari dana yang dicairkan sebesar Rp1.775.000.000. JPU menjelaskan, dalam pengajuan bantuan dana itu, juga dilampirkan rencana penggunaan anggaran, namun ternyata tidak terealisasi. Bantuan dana untuk cabang olahraga panjat tebing dianggarkan Rp15 juta, namun dana tersebut tidak disalurkan. Meski Haris Harto divonis penjara selama dua tahun penjara, namun tidak langsung ditahan. Majelis hakim menolak menjawab wartawan, kenapa Haris Harto tidak ditahan. (m38)

Ada-ada Saja ... Afrika, tepatnya di Zimbabwe, ada kiat baru yang cukup unik agar warga tidak terjangkit penyakit menular ini. Seorang politisi di negara tersebut mengatakan bahwa penyebaran penyakit HIV AIDS dapat dikurangi jika kaum wanita mau mengguduli kepala, plus mereka dilarang mandi.

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. KxKf6+, g7xK. 2. Bd-g4+, Rh8. 3. MxBf7, BxM. 4. Be8+, Bf8. 5. BxBf8+mat.

Jawaban TTS: TTS Topik

Kesehatan/ Nama RS

P E R M S A R I M U I I T O I K M H E R N A A A J M A L A A R S U Z A A N R S H A J A L H

M A T E R N A H A P I E

A T A B U N D I Y I A R A U S T S U C M A D A MM A L I N P N A Y A T I S K S U E P L I R N G A D I O U N S L L I S A B E T

Jawaban Sudoku:

6 3 9 1 2 5 4 8 7

7 5 8 4 6 9 3 1 2

2 4 1 3 7 8 5 9 6

9 6 7 5 8 3 1 2 4

4 8 2 6 1 7 9 5 3

5 1 3 2 9 4 6 7 8

1 2 5 8 3 6 7 4 9

3 7 4 9 5 2 8 6 1

8 9 6 7 4 1 2 3 5

A K U S T I K

H

Morgan Femai mengklaim cara ini akan membuat pria “tidak tertarik pada wanita rapi”. Sang senator mendesak agar kebijakan tersebut segera diberlakukan untuk memaksa kaum wanita tampil jelek agar para pria tidak tertarik kepada mereka. Ia mengatakan hal ini dalam sebuah pidato di sebuah seminar pencegahan penyakit AIDS, seperti dilansir Emirates247, Selasa (15/5). “Yang saya maksud adalah agar pemerintah mengeluarkan kebijakan yang dapat memaksa kaum wanita mencukur kepala mereka hingga botak seperti yang dilakukan sekte Apostolic,” ujarnya. “Mereka (wanita) juga jangan mandi, karena mandi adalah penyebab semua masalah ini,” tambahnya.(rzl)

Rabu 16 Mei 2012

KIP Agara Tetapkan 7 Kandidat, 1 Tak Lolos

Disdikpora D. Serdang Didemo IPK DELISERDANG (Waspada): Puluhan anggota DPD IPK (Ikatan Pemuda Karya) Deliserdang, Selasa(15/5) melakukan aksi demo di kantor Disdikpora (Dinas Pendidikan, Pemuda dan Olahraga) Deliserdang di Lubukpakam. Aksi yang dipimpin langsung Ketua DPD IPK Deliserdang Edi Nababan dalam orasinya meminta tender proyek di dinas tersebut yang telah diumumkan, Senin (14/5) dilakukan secara transparan dengan tidak ada pengawalan-pengawalan dari sekelompok orang yang seolah membatasi para rekanan untuk memasukkan pendaftaran untuk ikut tender. Edi Nababan kepada Waspada mengatakan, selama ini banyak hal yang harus disikapi di dinas tersebut, yang muaranya akan merugikan dunia pendidikan Deliserdang, yang telah susah payah diangkat oleh Bupati H Amri Tambunan melalui Konsep Cerdas. ‘’ Ternyata, baru masalah tender saja mereka tidak transparan.Apalagi masalah yang lain,’’ kata Edi Nababan dan menambahkan, dalam waktu dekat mereka akan berdelegasi kepada Bupati untuk menyampaikan temuan-temuan mereka di lapangan yang mencoreng dunia pendidikan di Deliserdang. Sementara, puluhan anggota IPK setelah melakukan orasi segera membubarkan diri. Namun, mereka minta agar tidak ada lagi kelompok orang yang mengawal proses pendaftaran tender di dinas tersebut. Mereka juga minta polisi tegas mengusir orang-orang yang menghalangi rekanan yang akan mendaftarkan penawaran. (m11)

WASPADA

Antara

PRESIDEN KOREA UTARA: Presiden Susilo Bambang Yudhoyono (kanan) menerima kunjungan kenegaraan Presiden Presidium Majelis Rakyat Tertinggi Korea Utara Kim Yong Nam (kiri) di Istana Merdeka, Jakarta, Selasa (15/5). Kedua pemimpin bersama masing-masing delegasi melakukan pertemuan bilateral untuk meningkatkan kerjasama kedua negara.

Presiden: Selesaikan Masalah Korea Malalui Komunikasi JAKARTA (Antara): Presiden Susilo Bambang Yudhoyono menegaskan perlunya komunikasi yang sangat baik dan terus ditingkatkan kualitasnya sebagai salah satu saluran untuk menyelesaikan masalah di Semenanjung Korea dan juga keinginan kedua Korea untuk reunifikasi. Presiden Yudhoyono saat menerima kunjungan Presiden Republik Demokratik Rakyat Korea atau Korea Utara Kim Yong Nam di Istana Merdeka Jakarta, Selasa (15/5) pagi mengatakan jangan sampai ada salah paham dan salah persepsi dalam setiap masalah di Semenanjung Korea. “PresidenYudhoyono menggarisbawahi apa pun masalah harus hindari kesalahpahaman

dan lakukan dialog dan komunikasi. Kami berkeyakinan perkembangan di kawasan akan dibahas oleh kedua presiden,” kata Menteri Luar Negeri Marty Natalegawa dalam keterangan pers di Kantor Presiden Jakarta, Selasa usai mendampingi Presiden Yudhoyono. Menlu mengatakan, Presiden Yudhoyono dalam pembicaraan dengan Presiden Kim Yong Nam mendapat penjelasan dari Presiden Korea Utara tersebut bahwa dalam peristiwa peluncuran satelit komunikasi tersebut ada informasi yang tidak berimbang sehingga menyudutkan pihak Korea Utara. “Atas informasi yang disampaikan tadi, Presiden Yudhoyono menggarisbawahi pen-

tingnya semua pihak senantiasa berdialog dan komunikasi agar tidak terjadi salah paham,” kata Marty. Menlu juga mengatakan secara umum Indonesia sudah menyampaikan penyesalan atas peluncuran satelit komunikasi tersebut karena memicu rasa tidak tenang dan juga menimbulkan rasa ancaman. “Indonesia berpendapat perlu adanya transparansi dan komunikasi terkait semua masalah di Semenanjung Korea,” katanya. Ketika ditanya apakah kedua presiden mendiskusikan mengenai nuklir dan juga hak asasi manusia, Marty mengatakan secara khusus hal tersebut tidak dibahas.

14 Kasus ...

Labuhanbatu, Simalungun dan Tanah Karo. “Dari keseluruhan wilayah itu Polresta Medan memiliki kasus tertinggi,” katanya, namun tidak merinci berapa jumlah kasus ditangani Polresta Medan. Tetapi, kata dia, baru Polresta Medan yang mengamankan tersangka kasus tindak pidana tersebut. “Sampai saat ini baru satu kasus dengan satu tersangka yang diproses, yaitu di Polresta Medan. Kasus penembakan antarkawan karena persoalan utang. Penyidik masih melakukan pengembangan terkait asal senpi itu karena nomor registernya sudah dihapus,” kata Heru. Sedangkan, Polres lainnya, tambah Heru, sejauh ini masih melakukan penyelidikan atas kasus-kasus tersebut. Mengenai kasus penembakan di Kabupaten Labuhanbatu yang menewaskan toke getah

Lomo Ritonga, 48, warga Desa Aek Goti, Labusel, Heru mengatakan masih dalam penyelidikan polisi. “Dugaan sementara senjata milik pelaku senjata organik, tetapi belum diketahui jenisnya karena penyidik masih mencari selongsongan pelurunya,” kata dia. Tentang senjata organik tersebut, Heru belum bisa memastikan, apakah milik aparat atau bukan.Sebab kata dia, bisa saja senjata itu ilegal dari daerah eks konflik atau hasil selundupan dari luar negeri ke Sumut. “Semua itu masih dalam penyelidikan,” ujarnya. Atas peristiwa penembakan tersebut, Heru menekankan seluruh satuan wilayah (Satwil) sejajaran Polda Sumut lebih meningkatkan pengamanan dengan melakukan razia-razia di daerah dianggap rawan. “Setiap kali evaluasi pimpinan Poldasu tetap mengingatkan seluruh satuan meningkatkan razia. Bahkan dikatakan, tiada hari tanpa razia,” sebut Heru. Dia mengimbau masyarakat lebih berhati-hati jika ke luar rumah, terutama malam hari karena aksi kejahatan sering terjadi pada malam hari. “Kita sudah analisa, kejahatan kerap terjadi pada malam hari pukul 22:00 hingga pukul 06:00, dan pelaku kebanyakan menggunakan sepeda motor memepet korbannya kemudian mengancam dengan menodongkan pistol,” kata dia. (m27)

Kabid Humas Polda Sumut Kombes Pol. Raden Heru Prakoso kepada Waspada, Selasa (15/5) mengatakan, data 14 kasus kejahatan bersenpi itu diperoleh dari laporan analisa dan evaluasi jajaran Polresta, Polres di Sumut. “Dari laporan analisa dan evaluasi seluruh jajaran diperoleh data terjadi 14 kasus tidak pidana yang berkaitan dengan penggunaan senjata api,” kata dia. Heru mengakui, dengan jumlah kasus itu mengisyaratkan pihaknya lebih bekerja keras untuk memberi rasa aman bagi masyarakat di Sumatera Utara. Dikatakan, kasus-kasus kejahatan dan tindak pidana menggunakan senpi terjadi di wilayah Polresta Medan, Polres Belawan, Asahan, Tebingtinggi,

Tim SAR Sapu ... Sebanyak 27 kantong jenazah yang dievakuasi dari lokasi jatuhnya pesawat buatan Rusia itu telah diserahkan pada tim identifikasi RS Polri Sukamto, Jakarta,merupakanbagiantubuh yang kebanyakan terpotong. “Selama evakuasi korban, Basarnas tidak menemukan korban hidup atau survivor,” kata Daryatmo di Bandara Halim Perdanakusuma, Selasa (15/5). Kotak Hitam Ditemui Black box (kotak hitam) pesawat Sukhoi Superjet 100 telah

PDI-P Calonkan ... Panda blak-blakan. Dia menambahkan, PDI-P sudah punya metode dan sistem. Namun khusus untuk Pilgubsu, tetap mengedepankan kader. ‘’Ya, kalau tidak untuk orang nomor satu, nomor dua, tetap kader partai. Hal ini mengingat pengalaman-pengalaman lalu,’’ujarnya. Menyinggung pemekaran daerah, baik tingkat provinsi maupun kabupaten/kota di Sumut, dia menyatakan sangat mendukung hal itu.‘’Seperti halnya mewujudkan Kota Berastagi pemekaran Kabupaten Ka-

ditemukan oleh tim gabungan Kopasus dan Federasi Panjat Tebing Indonesia, Selasa, di lokasi jatuhnya pesawat buatan Rusia tersebut di Gunung Salak. Sudah ditemukannya kotak hitam pesawat Sukhoi Superjet 100 itu disampaikan oleh Komandan Korem 061/Suryakancana Kol Inf AM Putranto, Selasa (15/5) malam. “Setelah dilakukan pemeriksaan oleh KNKT bahwa benar material pesawat yang dibawa oleh tim Kopasus adalah kotak hitam pesawat,” kata AM Putranto. (ant/j02) ro, kami sangat mendukung, dan hal itu sudah sampai di Jakarta,’’kata dia. Menurut dia, sudah saatnya Berastagi itu menjadi kota yang dipimpin oleh seorang Wali Kota. Sekaitan dengan itu, PDI-P sudah meminta kepada seluruh kader termasuk di DPRD tetap mendukung pemekaran daerah. Menjawab wartawan perihal pembangunan di Sumut yang dinilai lamban, Panda menyatakan, sebenarnya sudah ada dua atau tiga kali pertemuan Gubsu dengan para anggota DPR RI asal Sumut, yakni 30 orang.

‘’Mereka, para anggota DPR itu sudah kompak dan sepakat, cuma tinggal bagaimana Pemdanya,’’papar Panda. Makanya, kata dia, kita sudah menegaskan, PDI-P berharap Gubsu lebih peduli terhadap pembangunan Sumut. Rakorda , kata Panda untuk menuju 2014. Sementara, Trimedya Panjaitan mengemukakan, Sumut merupakan basis PDI-P, sehingga DPP memprioritaskannya. Apalagi jumlah pemilih di Sumut lebih dari 8 juta orang. ‘’Sehingga kami memberikan prioritas, apakah untuk orang nomor satu atau untuk orang nomor duanya,’’kata dia. Tetapi, lanjutnya, tergantung kepada masyarakatnya. Sedangkan unsur DPD PDIP Sumut Budiman Nadapdap dalam paparannya pada Rakorda itu, antara lain setiap anggota DPRD SU dari PDI-P pada saat reses ke daerah wajib menampung serta memperjuangkan masukan dan aspirasi masyarakat. (m34)

KUTACANE (Waspada): Komisi Independen Pemilihan (KIP) Aceh Tenggara (Agara) pada rapat pleno dimulai Senin (14/5) pagi hingga Selasa (15/ 5) dini hari, memutuskan tujuh dari delapan kandidat resmi sebagai balon Bupati-Wakil Bupati Agara pada Pilkada 2012. Hal itu sesuai surat keputusan KIP Agara Nomor : 270/230/V/2012, ditandatangani Ketua KIP Agara Dedi Mulyadi Selian. Pantauan Waspada, Senin malam hingga menjelang diumumkan hasil penetapan kandidat menjelang Selasa dini hari, melihat suasana dari Mapolres Agara hingga sepanjang jalan di depan gedung DPRK setempat cukup ramai.Puluhan mobil parker di sana. Pihak kepolisian terlihat mempersiapkan pasukan pengamanan untuk mengantisipasi hal yang tidak diinginkan menjelang diumumkan calon yang lolos dan yang tidak lolos. Bahkan di kantor KIP Agara, tampak puluhan aparat disiagakan hingga Selasa dini hari dan langsung dipantau Waka

Polres Agara Kompol Gotman Sugiro, Kabag ops Kompol Sabri.Di kantor KIP Agara juga terlihat memantau Ketua Panwaslih Junianto Siahaan. Berselang beberapa menit diumumkan hasil pleno, terlihat hadir M Ridho, salah satu kandidat balon bupati yang berpasangan dengan Ir H Tumpas Simanjuntak yang maju melalui jalur partai dinyatakan tidak lolos menjadi calon. Pasalnya. PPPI menarik dukungan pada pasangan ini dan PPPI merekomendasikan dukungan mereka pada pasangan bupati incumbent Hasanuddin B-Ali Basrah. M Ridho segera menggelar konferensi pers di halaman KIP Agara. M. Ridho menyatakan akan menggugat KIP Agara. Pasalnya, mereka meragukan kenetralan KIP dengan meloloskan baik secara hukum maupun peraturan KPU. Dedi Mulyadi Selian selaku ketua KIP Agara kepada Waspada mengatakan, semua pihak yang merasa keberatan dipersilakan menggugat. Namun, kata Dedi, KIP Agara telah beker-

Amanat UU Pemilu DKPP Segera Di Bentuk JAKARTA (Waspada): Sebagai amanat UU no.15 tahun 2011 tentang Penyelenggara Pemilu, Komisi II DPRRI akan segera membentuk Dewan Kehormatan Penyelenggara Pemilu ( DKPP) . Institusi baru yang bersifat tetap ini didukung 7 orang anggota, 3 orang di antaranya dipilih DPR, 2 dipilih pemerintah, 2 mewakili Komisi Pemilihan Umum ( KPU) dan 2 mewakili Bawaslu. “DKPP dibentuk untuk memeriksa dan memutus pengaduan atau laporan dugaan pelanggaran kode etik yang dilakukan oleh anggota KPU dan Bawaslu. Agar hal-hal yang terjadi pada Pemilu lalu tidak lagi terjadi seperti Tom and Jerry antara KPU dan Bawaslu,” kata Ketua Komisi II Agun Gunanjar dalam konferensi pers di gedung DPR , Jakarta, Selasa (15/5). Menurutnya, Komisi II DPR akan segera memilih anggota DKPP ini, sebab UU juga mengatur pembentukan DKPP harus dilakukan paling lama 2 bulan setelah anggota KPU dan Bawaslu mengucapkan sumpah dan janji. “Itu artinya pada tanggal 11 Juni nanti DKPP sudah

harus terbentuk,” tambahnya. Dijelaskan, dalam Pasal 109 UU no.15/2011, diatur anggota DKPP berasal dari tokoh masyarakat yang kemudian dijabarkan dalam penjelasan adalah seorang akademisi atau tokoh yang memiliki etika penyelenggaraan pemerintahan. “Secara prinsipil kehadirannya di sana mewakili berbagai stake holder yang ada,” tutur Agun didampingi,KetuaKPUdan KetuaBawaslu. Tahapan pembentukan DKPP dijadwalkan dimulai 16 Mei sampai dengan 5 Juni yang akan datang. Adapun mekanisme pemilihan 3 orang anggota usulan DPR akan dilakukan secara bertanggung jawab sesuai dengan Tata Tertib Dewan. Mekanisme dan detail lain mengenai pemilihan anggota DKPP ini akan dibahas dalam rapat kerja dengan Menteri Dalam Negeri (Mendagri), Pimpinan KPU dan Bawaslu, Senin (21/5) mendatang. Politisi Partai Golkar ini berharap akan terpilih anggota DKPP yang memiliki visi, integritas dan memahami etika penyelenggaraan pemilu. (aya)

Masjid Al Ikhlas ...

bali Masjid Al Ikhlas. “Saya yang muallaf ini diberi kesempatan oleh Allah untuk membangun masjid. Saya menganggap ini adalah karunia Allah SWT. Mudah-mudahan kerukunan hidup umat beragama semakin bagus,” jelasnya. Pembangunan Masjid Al Ikhlas di atas lahan luas 400 meter persegi ini memakan biaya Rp826 juta dan diperkirakan siap November 2012. Wali Kota Medan Drs H Rahudman Harahap MM, menyampaikan ucapan terima kasih dan apresiasinya kepada Pangdam I/BB yang telah melaksanakan peletakan batu per-

contoh kerukunan hidup umat beragama, jangan kita sesama muslim malah konflik,” katanya. Lodewijk berharap, pembangunan masjid tersebut dapat terus meningkatkan ketaqwaan umat Islam di wilayah Medan, karena adanya sarana-sarana ibadah yang dibangun. “Masjid inikan tempat ibadah, tempat para umat Islam berkumpul, berkomunikasi dengan sesama manusia dan kepada Allah,” tuturnya. Dia mengaku bersyukur diberi kesempatan oleh Allah SWT untuk membangun kem-

Bentrok Di Ambon ... Djoko Suyanto di kompleks Istana Presiden Jakarta, Selasa (15/5), usai mendampingi Presiden Susilo Bambang Yudhoyono menerima kunjungan Presiden Republik Demokratik Rakyat Korea atau Korea Utara Kim Yong Nam mengatakan sudah mendapatlaporandariGubernur Maluku Karel Albert Ralahalu.

“Tadi pagi Gubernur telefon saya. Memang itu sebenarnya tiap tahun ada acara itu hari ulang tahun Pattimura. Selalu ada arak-arakan. Mudah-mudahan ditangani dengan baik,” katanya. Djoko mengatakan telah meminta para tokoh masyarakat dan tokoh agama untuk berkumpul sehingga peristiwa itu tidak meluas.

Al Bayan ... Dalam hadis Rasulullah bersabda: Hai manusia, Allah telah mewajibkan haji kepadamu, maka laksanakanlah haji. Seorang lelaki bertanya: Apakah setiap tahunnya ya Rasulullah? Rasul terdiam sehingga lelaki itu bertanya tiga kali. Lalu Nabi menjawab, Andai kukatakan wajib setiap tahun maka ia menjadi wajib dan kamu tidak mampu mengerjakannya.(HR:Muslim) Menurut sejarah, haji baru diwajibkan tahun ke delapan hijrah. Setelah Rasulullah menyelesaikan tugas-tugas dakwahnya yang maha berat. Rasulullah sendiri hanya naik haji sekali dalam seumur hidupnya. Sejak tahun ke 10 hijriah, mulailah umat Islam berduyun-du-

ja maksimal. Dipaparkan KIP Agara telah bekerja keras dalam melakukan penelitian ulang kelengkapan dan perbaikan berkas balon bupati Agara yang diverifikasi oleh Pokja pendaftaran, verifikasi administrasi dan faktual KWK yang kemudian diplenokan sehingga berhasil menetapkan pasangan calon. Dengan telah ditetapkannya pasangan calon bupati dan wakil bupati Agara, kata Dedi Mulyadi, KIP Agara melakukan penetapan nomor urut pasangan pada Rabu (16/5), di DPRK Agara, pukul 12:00. (b25)

Pelajar SD Tewas Disambar Petir MEDAN (Waspada): Seorang pelajar SD yang masih duduk di kelasV, tewas disambar petir saat bermain sepeda di lapangan sepak bola Jl. Karya Kasih simpang Jl. Meteorologi, Selasa (15/5) sore. Korban Aditya Prabowo, 12, sempat dilarikan ke RS Mitra Sejati, Titikuning oleh keluarganya, namun jiwanya tidak tertolong. Informasi Waspada peroleh di rumah duka, peristiwa terjadi sekira pukul 16:30. Sore itu korban bersama temannya Rois, bermain sepeda di lapangan tersebut. Teman-temannya Rifki, Adi, Fikri, Dandi, Fauzi dan Rahmad berteduh di rumah warga. Korban sempat diberitahu temannya agar tidak bermain sepeda di lapangan karena sore itu hujan turun dibarengi suara petir. “Kami sempat memberitahukan agar jangan main sepeda, tapi korban mengatakan tidak apa-apa,” kata teman-teman korban yang melayat di rumah duka di Jl. Meteorologi. Saat korban membetulkan lokasi jumping untuk sepedanya dengan posisi membungkuk, petir menyambar punggungnya, dan korban terjatuh. Warga setempat sempat menanam tubuh korban di lokasi kejadian. “Waktu itu korban sempat tersenyum dan ditanam di lokasi kejadian,” katanya. Namun karena kondisi korban mulai kritis, warga membawanya ke RS Mitra Sejati. Sekira pukul 17:00, korban meninggal dunia. (m39) tama pembangunan Masjid Al Ikhlas. “Kita mendoakan apa yang telah dilakukan Pangdam I/BB menjadi amal baik. Selanjutnya, diharapkan pembangunan ini akan membuat masyarakat semakin memakmurkan masjid,” ujarnya. Terkait pembangunan masjid yang memakan waktu 183 hari kerja, Rahudman mengimbau kepada seluruh umat apabila tidak bisa membantu materi, bantulah dengan doa sehingga masjid dapat dipergunakan secepatnya. Hadir pada acara itu, Wakil Wali Kota Medan Dzulmi Eldin, Ketua MUI Sumut Abdullah Syah, Ketua MUI Medan Mohd. Hatta,Wakil Ketua DPRD Sumut Sigit Pramono Asri, Ketua Forum Umat Islam Sumatera Utara Ustadz Sudirman Timsar Zubil, Ketua Umum Aliansi Ormas Islam Pembela Masjid Sumatera Utara Drs Leo Imsar Adnans, Sekretaris Aliansi Ormas Islam drg M Sahbana serta ormas-ormas Islam lainnya. (m50/h02/h04)

yun naik haji ke Baitullah. Mereka datang dari seluruh pelosok dunia sampai sekarang. Semakin makmur sebuah negeri semakin banyak jumlah jamaah hajinya sehingga Negara Arab Saudi sebagai “tuan rumah” memperluas Masjidil Haram, Masjid Nabawi, membangun torowongan ke Mina, mengaliri air zamzam ke seluruh pelosok arena haji. Sekarang pelatihan manasik haji sudah dibuka di berbagai tempat. Tujuannya juga mulia, yakni untuk melatih calon jamaah haji yang akan menunaikan haji tahun ini. Alhamdulillah calon jamaah haji juga sangat ramai yang memgikuti manasik haji, Ini sangat positif. Selain menambah perbekalan ilmu untuk jamaah, juga menjadi syiar Islam.


Info Sumut

A3 Gatot Datang, Pedagang Riang

WASPADA Rabu 16 Mei 2012

Kolom Amir Syarifuddin

Kekuatan Ekonomi Sumut PEMERINTAHAN yang berhasil adalah pemerintahan yang mampu memeratakan pembangunan. Pemprov Sumut di bawah kepemimpinan Plt Gubsu, H Gatot Pujo Nugroho, adalah daerah yang berhasil menciptakan pusat-pusat pertumbuhan ekonomi baru di Sumut. Berdasarkan data Badan Pusat Statistik (BPS) Sumut, sector pertanian memberikan kontribusi 22,41 persen pada Produk Domestik Regional Bruto (PDRB) Sumut di triwulan I 2012. Sedangkan sektor jasa dan manufaktur, masing-masing hanya berkontribusi 7,2 persen dan 22 persen. Laju pertumbuhan sektor pertanian mencapai 6,2 persen jauh lebih tinggi dari jasa dan manufaktur yang justru melambat. Pertumbuhan jasa 10,92 persen dan manufaktur 1,5 persen. Data ini memberikan pengertian, bahwa kekuatan ekonomi Sumut tidak hanya tertumpu di Medan, yang merupakan pusat jasa dan manufaktur, namun juga di daerah kawasan pertanian dan perkebunan, khususnya kelapa sawit, seperti Labuhanbatu, Langkat, Deliserdang, Mandailingnatal, Serdangbedagai dan Tanahkaro. Menurut Ketua Himpunan Pengusaha Muda Indonesia (Hipmi) Firsal Ferial Mutyara, prospek pertumbuhan ekonomi di daerah-daerah dengan potensi pertanian itu juga lebih baik. Indikatornya terlihat dari semakin banyaknya pengusaha muda daerah memiliki bisnis pertanian dan perkebunan yang sukses. Bahkan tidak sedikit di antara mereka mempunyai pendapatan ratusan juta per bulan. Ini tentu saja kabar gembira bagi masyarakat Sumut. Pemprov Sumut selalu mendorong agar setiap daerah menggali dan mengembangkan potensi ekonomi daerahnya dengan maksimal. Daerah yang memiliki potensi daya alam di bidang pertanian, perkebunan dan perikanan, harus sungguh-sungguh mengembangkan pertanian, perkebunan dan perikanan. Begitu juga kawasan yang memiliki potensi lain, harus mengembangkan daerahnya sesuai dengan potensi dimiliki. Sebagai daerah yang memiliki sumber daya alam berlimpah, sebenarnya tidak alasan bila masyarakat Sumut tidak sejahtera. Lihatlah potensi daratan Sumut–baik dataran tinggi maupun dataran rendah. Selain merupakan lahan subur, di dalamnya terkandung pula berbagai bahan tambang. Lalu lihat pula kawasan laut pantai barat dan pantai timur Sumatera Utara. Semua itu adalah harta karun yang bisa dikelola untuk kemakmuran masyarakat Sumut. Pemprov Sumut terus mendorong pengembangan daerah dengan menyiapkan infrastruktur pendukung. Menurut Plt Gubsu, tahun 2012 ini bakal dilakukan peningkatan ruas jalan provinsi yang berada di pantai barat, pantai timur dan dataran tinggi. Ditargetkan akan terbangun jalan provinsi 382, 11 kilometer dan jembatan 400 meter. “Akses jalan menuju daerah parawisata dan sentra produksi juga akan dibangun,” kata Gatot. Untuk mendukung peningkatan produksi padi, tahun ini akan dilakukan pemeliharaan jaringan irigasi seluas 73,326 hektar. Dalam pembangunan energi kelistrikan, antara lain percepatan pembangunan PLTA Asahan III dan PLTA Sarulla III dan pengadaan 300 unit PLTS. Kalau tidak ada aral melintang, peletakan batu pertama PLTA Asahan III akan dilakukan pada Mei 2012. Artinya Pemrov Sumut di bawah kepemimpinan Gatot, terus berupaya meningkatkan kesejahteraan masyarakat Sumut. Hasilnya cukup menggembirakan. Tolok ukur keberhasilan pembangunan Sumut terlihat dari pertumbuhan ekonomi Sumut sebesar 6,58 persen pada 2011. Pada 2012 pertumbuhan ekonomi Sumut diperkirakan akan tetap baik. Pengamat Ekonomi, Faisal Basri, optimis pertumbuhan ekonomi Sumut tahun 2012 tetap menggembirakan.***

OKI Di Tengah... (lanjutan dari halaman A1) ke 19 dan awal abad 20 belum dapat menunjukkan secara konkrit bagaimana bentuk persatuan umat yang digagaskannya melalui tema ‘Pan-Islamisme’. Namun gagasan itu kemudian dikonkritisasikan oleh para pemimpin muslim dengan mendirikan Organisasi Konferensi Islam, kini Organisasi Kerja Sama Islam (OKI), Organization of Islamic Cooperation (OIC) atau Munazhzhamat alTa’awun al- Islamy). Meskipun pendirian organisasi ini pada mulanya merupakan reaksi terhadap pembakaran Masjidil Aqsha oleh Israel pada tanggal 21 Agustus 1969, kini OKI telah merumuskan paradigma baru sebagai organisasi kerja sama Islam yang tidak saja memfokuskan perhatian pada masalah politik tetapi juha ekonomi, ilmu pengetahuan dan kebudayaan. Berbagai bagian dunia Islam memang masih banyak yang tidak puas dengan kinerja organisasi ini. Akan tetapi tidak dapat dipungkiri bahwa organisasi inilah yang diharapkan—jika bukannya satu-satunya—yang berhasil diwujudkan sebagai wadah yang mempersatukan umat Islam untuk bangkit secara bermartabat, betapapun tingginya kekesalan kita terhadap nyalinya yang masih teramat lemah. Organisasi Kerja Sama Islam yang berkantor di Jeddah Arab Saudi ini memperjuangkan kepentingan umat Islam dan dalam paradigma baru yang disepakati pada KTT 10 di Putra Jaya Malaysia 2003. Organisasi ini berusaha memperjuangkan kepentingan umat Islam, memelihara perdamaian, ketentraman dan kesejahteraan dunia, serta memperjuangkan kemerdekaan Palestina, baik dalam kegiatan politik maupun ekonomi dan sosial budaya. Organisasi ini menghadapi berbagai tantangan dalam memperjuangkan kebangkitan Islam di tengah dunia yang semakin mengglobal. Tantangan yang dihadapinya memiliki spektrum yang amat luas baik dari dalam maupun dari luar. Untuk itu OKI tampaknya mencoba bekerja menghadapi tantangan dalam lima hal. Pertama, meminimalisir perbedaan orientasi politik diantara negara-negara anggotanya. Sebab perbedaan orientasi dan kepentingan inilah yang membuat sebagian anggotanya

sering tidak konsisten dalam berbagai kesepakatan demi kemajuan Islam, jika bukannya masih ada yang merundukrunduk akibat sikap imperioriti kepada pihak asing dengan mengabaikan kepentingan umat Islam yang lebih luas. Kedua, umat Islam, dan dengan demikian OKI atau OIC, dituntut untuk meluruskan dan menghapus pengertian dan sikap yang pejoratif terhadap Islam semisal pengaitannya dengan fundamentalisme, terorisme, dan berbagai kekerasan yang melibatkan umat. Ketiga, OKI atau OIC kini dihadapkan pada pekerjaan yang begitu sulit dan berat yaitu meningkatkan rasa persatuan dan solidaritas antarumat yang kian hari semakin mengalami erosi akibat berbagai kepentingann domestik sehingga seringkali memperlihatkan betapa mahalnya persatuan dan ukhuwah islamiyah di kalangan negara-negara Islam. Keempat, meningkatkan kerja sama dalam bidang yang lebih luas untuk kemajuan dan kesejahteraan yang lebih baik. Untuk itu paradigma baru OKI sebagaimana diamanatkan KTT luar biasa di Makkah 7-8 Desember 2005 telah ditetapkan ‘Macca Declaration’ tentang rencana, action plan 10 tahunan mengenai strukturisasi organisasi ini agar lebih mampu menjawab problema dan cita-cita kebangkitan Islam di era global. Dalam kondisi OKI yang demikian kiranya absah untuk dipertanyakan: Dapatkah organisasi ini memprakarsai dan mengadvokasi kebangkitan global umat? Masihkah OKI diperhitungkan dalam berbagai rencana tentang masa depan

SUDAH sejak lama pasar tradisional memegang peran penting dalam menggerakkan ekonomi rakyat di negeri ini. Selain sebagai muara dari produk-produk rakyat, pasar tradisional juga berfungsi sebagai tempat mencari kerja yang sangat berarti bagi masyarakat. Plt Gubernur Sumatera Utara H Gatot Pujo Nugroho, ST paham akan peran strategis pasar tradisional tersebut. Belum lama ini Gatot sengaja meninjau Pasar Inpres Aek Kanopan, Selasa Pagi (1/5) didampingi Bupati Labura H Khairuddinsyah Sitorus , SE dan wakil Bupati Labura H Minan Pasaribu SH. Kunjungannya tersebut dalam rangka melihat langsung keberadaan pasar tradisional daerah dan mendapat berbagai masukan baik dari pedagang, pengelola dan pembeli. Kunjungan mendadak Gatot ini tentunya menimbulkan keterkejutan tersendiri bagi komunitas Pasar Inpres Aek Kanopan. Hampir semua pedagang yang dijumpai merasa kaget dengan kunjungan orang nomor satu di provinsi Sumut ini. Para pedagang heran mendapati kehadiran seorang Gubernur yang mau turun ke pasar tradisional di daerah walaupun identik suasana yang serba belepotan. Gatot tidak menyia-nyiakan kesempatan berdialog dengan masyarakat dan tampak tak hentinya menyungging senyum saat menjumpai para pedagang. “Dari mana kelapa ini? berapa harganya, dapat berapa keuntungannya? tanya Gatot kepada salah satu pedagang Kelapa. Samsir, pedagang kelapa mengatakan dalam satu hari dia bisa menjual 300 gandeng kelapa. “Ya lumayanlah pak, hanya inilah mata pencarian saya untuk menghidupi keluarga,” ujarnya menjawab pertanyaan Gatot. Gatot juga menyempatkan membeli salah satu barang dagangan yakni kerupuk upak upik yang merupakan ciri khas kabupaten Labuhanbatu Utara. Tak hanya pedagang, pembeli pun tak luput dari pertanyaan Plt Gubsu ini. Syahrin Situmorang warga Kisaran yang saat itu berbelanja buah berkesempatan berdialog dengan Plt Gubsu. “Bapak mau beli apa? dari mana? tanya Gatot ramah. Bapak dua anak ini menceritakan bahwa dia lagi menunggu Buah untuk dibawa ke Kisaran. Buah-buah tersebut akan dijual lagi dengan cara perpotong. “Ya kita mau jual lagi pak, kalau perhari paling saya dapat keuntungan Rp40

Waspada/Amir Syarifuddin

SAPA ANAK: Plt Gubsu H Gatot Pujo Nugroho ST, menyapa 2 anak pedagang, ketika mengunjungi Pasar Pagi Inpres Aek Kanopan, Selasa (1/5).

dunia? Mungkin akan banyak jawaban yang mengemuka untuk ini. Namun sejalan dengan pidato Presiden Republik Indonesia para KTT OKI atau OIC ke 14 tanggal 13-14 Maret 2008 0rganisasi ini perlu melakukan enam hal. Pertama, melakukan restrukturisasi dan penekanan terhadap action plan dalam mendukung, jika bukannya, memprakarsai kebangkitan Islam global. Kedua, terus memberikan dukungan yang efektif terhadap kemerdekaan Palestina sebagai penyebab kekacauan di Timur Tengah dan memberikan dukungan terhadap penegakan kebebasan di berbagai bagian dunia Islam. Ketiga, negara-negara anggota OKI perlu terus menerus mendorong agar dapat menemukan peran penting dalam upaya memelihara perdamaian dan keamanan global, pemberantasan kemiskinan, dan percepatan pembangunan. Kempat, Islam perlu terus didorong untuk menegakkan tradisi kemanusiaan sejati, care terhadap kehidupan yang lebih demokratis, menjadi akrab dengan modernitas, dan penegakan HAM Kelima, OKI diharapkan semakin dapat menegaskan kepada dunia bahwa Islam adalah agama perdamaian dan selalu menjunjung tinggi kerukunan di berbagai bagian dunia, baik di kawasan yang berpenduduk mayoritas muslim maupun di kawasan minoritas. Keenam, pembangunan di negara-negara OKI harus didorong untuk selalu memperhatikan aspek lingkungan karena hal ini merupakan sesuatu yang inhern dalam ajaran Islam.Wa Allâhu A’lamu bi al-Shawâb.

Waspada/Amir Syarifuddin

TANYA PEMBELI : Plt Gubsu H Gatot Pujo Nugroho, ST didampingi Bupati Labura H Khairuddinsyah Sitorus, SE berbincang dengan seorang ibu yang hendak membeli kebutuhan bahan pokok di Pasar Pagi Inpres Aek Kanopan, Selasa (1/5). ribu lumayanlah Pak untuk nafkah sehari-hari,” katanya sambil berjabat tangan dengan Gatot. Hampir seluruh pedagang dikunjungi Gatot mulai dari pedagang krupuk, daging, sayur-mayur, cabai dan pedagang sembako dan melayani bagi mereka yang ingin berfoto bersama. “Wah, saya tak menyangka Pak Gubernur mau jabat tangan sama kita, senang betul,” ujar Sukisno pedagang daging sapi berkomentar. Gatot yang ketika itu didampingi oleh Kepala Dinas Pertanian M Roem, Kepala Dinas PU dan Bina marga Kepala Dinas Sosial, Kepala Dinas Pendidikan Provsu dan Kadis Sosial Provsu ini meminta Pemerintah Daerah setempat dapat memperhatikan keberlangsungan dan pengembangan pasar tradisional yang ada. Di tengah semakin pesatnya kemunculan pasar modern, menurutnya pasar tradisional harus terus dipertahankan

Waspada/Amir Syarifuddin

PEDAGANG : Plt Gubsu H Gatot Pujo Nugroho ST, berbincang dengan seorang pedagang pisang di Pasar Pagi Inpres Aek Kanopan, Selasa (1/5).

TK: 100% Mega Tidak Nyapres JAKARTA (Waspada): Ketua Dewan Pertimbangan Partai Demokrasi Indonesia Perjuangan, Taufiq Kiemas menyatakan keyakinannya, Ketua Umum PDI Perjuangan (PDIP) Megawati Soekarnoputri tidak akan maju sebagai calon presiden (Capres) pada pemilihan presiden (Pilpres) tahun 2014. “Saya yakin 100 persen, Bu Mega tidak akan nyapres,” ujar Taufiq Kiemas menjawab wartawan, di Gedung MPR/DPR-RI, Jakarta, Selasa (15/5). Ketua MPR RI ini mengharapkan para politisi senior tidak memaksakan diri , tetapi harus memberi jalan bagi kaum muda untuk maju sebagai capres pada

Pilpres 2014 mendatang. Diakuinya tahun 2014 sangat krusial, karena itu sebaiknya tokoh muda diberi jalan. Kalau pun politis senior sampai menahan, mereka (tokoh muda) juga akan maju terus. “Tahun 1966 begitu, tahun 1997 begitu, lebih baik kita ini sekarang memberi jalan sebaikbaiknya untuk proses demokrasi kita yang baru,” saran Taufiq Kiemas Merujuk pada partainya sendiri, Taufiq Kiemas yakin Megawati Soekarnoputri sebagai Ketua Umum PDI Perjuangan akan memberi kesempatan kepada kader-kader mudanya untuk ikut dalam pemilihan presiden mendatang.

Ani Yudhoyono berpeluang Ketua Dewan Pimpinan Pusat Partai Demokrat Divisi Komunikasi Publik, Andi Nurpati menyatakan, ibu negara Ani Yudhoyono berpeluang menjadi Capres dari Partai Demokrat. “Bu Ani Yudhoyono berpeluang untuk diusulkan menjadi calon presiden Partai Demokrat,” kata Andi Nurpati di Jakarta, Selasa (15/5). “Dengan kualifikasi sebagai kader PD, mantan wakil Ketua Umum PD, pendiri partai, dua periode mendampingi Susilo Bambang Yudhoyono sebagai presiden dan sejumlah kemampuan lainnya yang dimiliki beliau. Beliau adalah politisi yang tangguh,” kata Andi. (aya/ant)

eksistensinya karena penting bagi perekonomian masyarakat lokal. Gatot mengungkapkan keyakinannya, pasar tradisional tidak akan ditinggalkan masyarakat meski pasar modern kian menjamur. Menurutnya banyak fungsi yang diemban pasar tradisional sangat penting untuk dipelihara keberlanjutannya yaitu fungsi ekonomi serta beberapa fungsi sosial lainnya, seperti fungsi pertukaran informasi, fungsi rekreasi, fungsi pemerintahan, fungsi pertemuan sosial, dan lain-lain sebagainya. Lebih jauh lagi, interaksi dan keakraban yang muncul antara pedagang dan pembeli merupakan keunikan tersendiri yang tidak akan dijumpai di pasar modern. Karenanya dia yakin pasar tradisional masih mempunyai masa depan dan memiliki nilai jual tersendiri.(m28)

Waspada/Amir Syarifuddin

SAPA PEDAGANG : Plt Gubsu H Gatot Pujo Nugroho ST, menyalami pedagang sayuran di Pasar Pagi Inpres Aek Kanopan, Selasa (1/5).

Mega: Rahim Ibu Subur Indonesia Lahirkan Pemimpin Perempuan JAKARTA (Waspada) Dari perspektif historis, sepanjang sejarah Indonesia, pemimpin perempuan telah muncul silihberganti. Karena itu, untuk jadi pemimpin di Indonesia bukan persoalan perempuan atau laki-laki, bukan soal gender. Tetapi seorang pemimpin harus mengambil tindakan, karena ditangan seorang pemimpinlah tergenggam masa depan dari sebuah bangsa dan masyarakat. “Rahim Ibu” Indonesia telah membuktikan diri sebagai rahim yang subur, bagi lahirnya para pemimpin perempuan terkemuka”, tegas Ketua Umum Partai Demokrasi Indonesia Perjuangan Megawati Soekarnoputri , yang berbicara dalam seminar bertajuk “The Role of Women in Politics”, di Innsbruck - Austria, Selasa (15/5), dan relisnya dikirim ke Waspada. Bagi cukup banyak orang, kata Mega, kesulitan-kesulitan yang alaminya boleh jadi gambaran dari betapa kerasnya tantangan bagi seorang perempuan dalam dunia politik. Sebaliknya, keberhasilan yang dicatatnya, boleh jadi dipahami sebagai prestasi dari seorang politisi perempuan. Dari sudut politik, struktur sosial dan politik masyarakat Indonesia, tambahnya, secara umum memberikan ruang yang luas dan ramah bagi kaum perempuan untuk berkiprah dalam politik, termasuk menjadi pemimpin. Bahkan kesempatan ini terus diberikan, dan terbukti penetapan kuota 30% perempuan di parlemen melalui UU Pemilu. (aya)


Medan Metropolitan

A4

WASPADA Rabu 16 Mei 2012

Poldasu Nyatakan Wilayah Polsek Medan Timur Paling Rawan DPRDSU: Aksi Kejahatan Tidak Terkendali Lagi MEDAN (Waspada): Kasus kejahatan jalanan (street crime) menggunakan senjata api maupun senjata tajam kembali marak dalam beberapa bulan belakangan. Terakhir, kasus perampokan terhadap seorang nasabah bank di Silangkitang, Labuhanbatu, Senin (14/5). Korban tewas ditembus peluru perampok. Hari yang sama terjadi perampokan di Jln. Prof HM Yamin, SH. Pelaku menggunakan senjata api dan senjata tajam, menggasak kalung milik pengendara sepedamotor. Sabtu (12/5), tujuh perampok bersenjata api membajak truk bermuatan 1 ton cabai di Jalan Binjai Km 12, Kec. Sunggal, Deliserdang. Berbagai kasus perampokan dan penjambretan itu, masih dalam penyelidikan aparat kepolisian. “Sampai hari ini, pelakunya belum berhasil ditangkap. Polisi masih melakukan penyelidikan dengan memeriksa saksi-saksi,” kata Kabid Humas Poldasu Kombes Pol. Raden Heru Prakoso kepada Waspada di Mapolda Sumut, Selasa (15/5). Soal kerawanan wilayah, menurut Heru, berdasarkan analisa dan evaluasi (anev) terhadap seluruh jajaran kepolisian di Sumut,

kejahatan jalanan paling rawan berada di wilayah hukum Polresta Medan, dengan urutan pertama yakni Polsek Medan Timur. Sedangkan urutan kedua wilayah hukum Polsek Percut Seituan. Heru mengimbau masyarakat berhati-hati jika keluar pada malam hari, karena aksi kejahatan jalanan kerap terjadi pada malam hari pukul 22:00 hingga pukul 06:00. “Polisi akan menggelar razia di wilayah yang dianggap rawan kejahatan guna mengantisipasi terjadinya kasus yang sama,” ujarnya. Tidak Terkendali Sementara itu, DPRDSU meminta pihak kepolisian meningkatkan daya cegah, daya tangkal dan daya lawan guna memberantas aksi kejahatan. Saat ini, kasus kejahatan di jajaran Poldasu sudah sangat luar biasa dan tidak terkendali lagi. Ketua Komisi A DPRDSU Isma Padli Pulungan berbicara kepada Waspada, melalui telefon selular, Selasa (15/5). Dia menanggapi maraknya aksi kejahatan yang terjadi akhir-akhir ini. Berita terakhir tentang tindak kejahatan yang terjadi di Kabupaten Labuhanbatu Selatan (Labusel). Senin (14/5), seorang toke

getah berusia 48 tahun, Lomo Ritonga, tewas ditembak dua perampok di jalan besar Dusun Mual Mas, Desa Kampug Dalam, Kecamatan Bilah Hulu. Aksi kejahatan lainnya juga terjadi di sejumlah daerah di Sumut. Di Kota Medan saja, kejahatan semakin merajalela. Kasus perampokan, penodongan, penjambretan dan lainnya setiap hari terjadi. Umumnya, pelaku kejahatan tersebut tidak tertangkap. Pengaduan masyarakat dipastikan menumpuk di setiap kantor polisi di Medan tentang tindak kejahatan ini. Pihak kepolisian sepertinya ‘keteteran’ menghadapi kasus ini. Kecenderungannya, polisi hanya menerima pengaduan tanpa menindaklanjutinya. Berbagai alasan disebutkan pihak kepolisian sebagai kendala mereka mem-follow up kasus yang dilaporkan.Yang utama adalah korban tidak mengenal pelaku. Akibat dari ini, pelaku kejahatan semakin merajalela. Ketua Komisi A DPRDSU Isma Padli Pulungan, juga mengaku banyak menerima keluhan masyarakat tentang kinerja pihak kepolisian ini. Katanya, masyarakat kecewa dengan penanganan

yang dilakukan polisi dalam menangkap pelaku kejahatan. ‘’Benar. Banyak sekali kasus kejahatan yang tidak bisa diungkap polisi. Apalagi kasus-kasus seperti perampokan dan penjambretan. Ini membuat pelaku semakin merajalela,’’ katanya. Fakta di lapangan, kata Isma Padli, polisi hampir tidak berdaya mengantisipasi kejahatan. Kalau tidak tertangkap massa, sangat kecil sekali persentase polisi menangkap penjahat. Tingkat kepercayaan masyarakat kepada polisipun, menurut Isma Padli, semakin rendah. Itu dibuktikan dari sikap keras dari masyarakat bila menangkap penjahat. Masyarakat langsung menghakimi sendiri penjahat yang mereka tangkap. ‘’Itu bentuk ketidakpercayaan masyarakat kepada polisi,’’ katanya. Ke depan, Isma Padli selaku ketua komisi yang membidangi masalah keamanan, meminta polisi lebih memberdayakan peran intelijennya. Katanya,sangattidakmungkinkorbankejahatanmengenalpelakunya. Karena umumnya pelaku melakukan kejahatan kepada orang yangtidakmerekakenal.‘’Kalauperaninteltidakkuat,tidakmungkin penjahat bisa ditangkap,’’ tegasnya. (m12/m27)

Empat Pelaku Kejahatan Dihajar Massa MEDAN (Waspada): Empat pelaku kejahatan babakbelur dihajar massa saat beraksi secara terpisah di wilayah hukum Polresta Medan.

Data yang diperoleh Waspada, Selasa (15/5), pelaku perampokan berinisial DA, 23, warga Jln. Halat, babakbelur dihajar massa setelah tertangkap usai merampok kalung emas milik seorang ibu yang mengendarai sepedamotor. Selanjutnya, pelaku diserahkan ke Polsek Medan Kota. Pria yang sudah dua kali masuk penjara ini mengaku ditangkap massa di Jln. Letjen Suprapto saat berusaha kabur usai merampas kalung emas di Jln. Sudirman, Selasa (15/5) sore. Sedangkan temannya berinisial EP melarikan dengan mengendarai sepedamotor. Saat menjalani pemeriksaan di Mapolsek Medan Kota, DA mengaku sudah berulangkali melakukan perampokan dan dua kali mendekam dalam sel karena kasus yang sama. “Uangnya untuk beli putaw,” katanya

sambil mengusap darah yang mengucur dari hidung dan bibirnya. Dia bersama temannya EP, siang itu sudah berniat melakukan perampokan. Kemudian mereka membuntuti seorang ibu yang mengenakan kalung emas. Setelah mendekati korbannya, pelaku langsung merampas kalung emas tersebut dan berusaha melarikan diri. Namun korban berteriak sehingga warga dan pengendara lainnya melakukan pengejaran. Di Jln. Letjen Suprapto, warga yang mendengar teriakan korban menghadang dan menangkap pelaku yang terjatuh dari sepedamotor. Namun EP lolos dari sergapan massa. Kanit Reskrim Polsek Medan Kota AKP Sangkot Simaremare mengatakan, pihaknya masih memeriksa tersangka. “Masih diperiksa, untuk sementara dia ditahan dalam sel,” sebutnya. Nyaris dibakar Hari yang sama, seorang dari dua pria nyaris dibakar massa, setelah kepergok hendak melakukan pencurian di salah satu rumah warga di Dusun II, Medan Krio, Sunggal. Saksi mata menyebutkan,

peristiwa terjadi Selasa (15/5) dinihari sekira pukul 02:00. Saat itu, pelaku sedang mencongkel jendela rumah warga menggunakan obeng. Sedangkan seorang pelaku lagi menunggu di sepedamotor sambil mengamati situasi. Begitu aksinya diketahui, kedua pelaku langsung kabur menuju semak-semak, tidak jauh dari lokasi kejadian. Warga yang emosi kemudian mengepung semak-semak, sampai kemudian menemukan seorang pelaku. Tanpa dikomando sejumlah menghajarnya hingga babakbelur. “Anehnya, pelaku sempat mengancam akan mempidanakan warga yang melakukan pemukulan. Akibatnya, warga semakin marah dan pelaku nyaris dibakar hiduphidup. Untung aksi tersebut dicegah kepala lingkungan,” sebut seorang saksi. Selanjutnya, pelaku dibawa ke kantor kepala desa setempat dan pukul 07:00 dijemput petugas Polsek Sunggal. Sedangkan, Senin (14/5) sore, dua penjambret juga babakbelur dihajar massa setelah merampok kalung emas milik seorang wanita pejalan kaki di Jln. M Basir. Keduanya, BS, 36,

Siswi SMK 10 Medan Kesurupan MEDAN (Waspada): Sedikitnya 15 siswa SMK Negeri 10 Medan Jalan Cik Ditiro mengalami kesurupan saat sedang belajar di ruang kelasnya, Selasa (15/5) sekira pukul 10:00. Peristiwa tersebut membuat kehebohan di lingkungan sekolah. Penyebabnya diduga adanya gangguan dari mahluk halus ‘penunggu’ sekolah tersebut. Diduga kesurupan itu terjadi karena adanya penunggu mahluk halus di salah satu ruangan dilantai 1 yang dibongkar oleh pihak sekolah. Akibat kesurupan tersebut, pihak sekolah terpaksa menghentikan proses belajar dan mengajar lebih awal. Informasi yang diperoleh di lingkungan sekolah menyebutkan, kesurupan massal tersebut dialami oleh para siswi jurusan Kecantikan dan Tata Boga. Kesurupan yang berlangsung secara tiba-tiba terjadi ketika para siswi yang tengah belajar tiba-tiba digegerkan dengan suara teriakan seorang siswi saat hendak masuk ke ruang praktek 22.

Teriakan itu langsung direspon siswi lain yang mencoba melihat ke lokasi, namun mereka juga langsung kesurupan. Kesurupan berlangsung bersamaan dengan pembongkaran sebuah ruangan di lantai 1 gedung sekolah tersebut. Suasana panik sempat terjadi selama beberapa menit di lokasi, sehingga membuat pihak sekolah menghentikan aktifitas belajar mengajar dan langsung membubarkan para siswanya. Namun, peristiwa kesurupan tersebut dibantah oleh Kepala SMK Negeri 10 Dahlia. Menurut dia, tidak ada siswanya yang kesurupan melainkan karena sakit akibat tubuhnya yang melemah. “Tidak ada siswa-siswi yang kesurupan, apalagi sampai 15 orang yang kesurupan. Informasi itu tidak benar. Yang ada hanya seorang siswi yang sakit saja dan tidak sampai menjerit histeris,” sebut Dahlia saat dikonfirmasi via telefon selulernya. Kata dia, siswi kelas I yang

sakit tersebut, sehari sebelumnya sudah diingatkan agar jangan datang ke sekolah karena masih sakit. “Namun, siswi tersebut tetap masuk sekolah meskipun belum sembuh benar. Tiba-tiba saja, siswi tersebut tubuhnya lemah dan pingsan sehingga orangtua murid langsung dipanggil,” tuturnya. Dijelaskan Dahlia, siswi yang sakit tersebut langsung dibawa pulang oleh orangtuanya untuk dirawat di rumah, sebab kalau masih bertahan di sekolah dikhawatirkan temanteman setia siswi tersebut bisa makin sedih dan histeris bila melihat temannya tiba-tiba pingsan dan sakit saat mengikuti pelajaran. Sementara itu, situasi sekolah terlihat sepi dengan gerbang yang digembok. Tak tampak aktifitas disekitar sekolah, padahal menurut informasi jika di sekolah tersebut memiliki kegiatan ekstrakulikuler yang berlangsung hingga sore hari. (h04)

Cegah Plagiat Skripsi

Unimed Siapkan 55 Jurnal Online MEDAN (Waspada): Universitas Negeri Medan (Unimed) menyiapkan 55 jurnal online dari 38 program studi yang tersedia di kampus tersebut. Langkah Ini untuk menyikapi surat edaran Direktorat Pendidikan Tinggi (Dikti) mengenai lulusan S1, S2 dan S3 yang harus menulis hasil kajian skripsi di jurnal ilmiah. Demikian dikemukakan Pembantu Rektor I Unimed Prof Dr Khairil Ansari, MPd saat

membuka pelatihan pengelolaan jurnal online Unimed di ruang VIP Gedung Serbaguna Unimed, Selasa (15/5). Pembuatan jurnal online ini untuk menyahuti surat edaran Dikti dan mencegah plagiat pembuatan skripsi. “Sesuai edaran Dikti per Oktober, akan diberlakukan bahwa setiap lulusan S1 harus menulis kajian skripsi di Jurnal Ilmiah. Dalam hal ini jurnalnya adalah online. Begitu juga tesis

Poldasu Sosialisasi Perkap Pelayanan Publik MEDAN (Waspada): Polda Sumut, mensosialisasikan Peraturan Kapolri (Perkap) tentang pelayanan publik. Sebanyak 26 Kepala Sub Bagian Hubungan Masyarakat yang bertugas di seluruh satuan wilayah (Satwil) Kepolisian Daerah Sumatera Utara dikumpulkan di Aula Mapoldasu, Selasa (15/5), mendengarkan penjelasan tentang Perkap tersebut. Kabid Humas Poldasu Kombes Pol. Raden Heru Prakoso melalui Kabid Pengelola Informasi dan Data (PID) Humas Poldasu AKBP MP Nainggolan mengatakan, peserta sosialisasi Perkap Nomor 16 Tahun 2008 dan Perkap Nomor 24 Tahun

2011 tentang pelayanan informasi publik, terdiri dari kepala bidang humas di masing-masing satuan wilayah (Polres). “Tujuannya agar para Kasubbag Humas memahami dan dapat bekerja maksimal dalam melayani masyarakat untuk mendapatkan informasi,” katanya. Dalam rapat itu, 26 Kasubbag Humas dan 26 operator diharuskan tetap siaga dan mengisi informasi di website humas polri yang dapat diakses dengan mengklik www.humas.polri. go.id. Harapan Nainggolan, para Kasubag Humas dapat memberikan informasi secara transparan dan akuntabel.(m27)

S2, sedangkan untuk S3 yakni jurnal internasional,”ucapnya. Sejauh ini, katanya, ada beberapa web jurnal online yang telah ada, namun belum diakui pemerintah. Untuk pengakuan itu, harus masuk dalam portal yang telah disiapkan pemerintah yakni Portal Garuda. “Selain memberi keringanan biaya dibandingkan menggunakan jurnal cetak, jurnal online ini juga mencegah terjadinya plagiat dalam pembuatan karya skripsi,” tambahnya. Menurut Khairil, jurnal online Unimed tersebut disiapkan dalam mengantisipasi edaran Dikti, sebelum menjadi Permendiknas. “Sebelum edaran ini menjadi peraturan menteri pendidikan, maka kita harus persiapkan dari sekarang agar tidak kewalahan nantinya. Saat ini kita telah mendaftarkan 55 jurnal online dan diharapkan dalam minggu depan sudah mulai diisi dengan karya skripsi mahasiswa kita yang baru saja di wisuda kemarin,” katanya. Ketua Panitia Dr. I Wayan Dirgayasa, M.Hum mengaku, untuk pengelolaannya, Unimed melakukan pelatihan terlebih dahulu dengan memanfaatkan narasumber dari Universitas Semarang. Sejauh ini, Universitas Semarang telah memiliki dan menerapkan jurnal online sesuai edaran Dikti.(m49)

Waspada/Sugiarto

PULUHAN massa menyaksikan penangkapan pelaku perampokan yang babakbelur di Jln. Letjen Suprapto, Selasa (15/5). warga Jln. Kesehatan, Kel. Binjai, Medan Denai dan RP, 31, warga Jln. Nusa Indah, Asam Kumbang Medan. Keduanya diteriaki maling oleh korban Risma Mahdalena Siregar, 29, warga Jln. Bunga Kemuning, Kel. Ladang Bambu, Medan Tuntungan. Informasi yang diperoleh Waspada di Mapolsek Delitua, Selasa (15/5), menyebutkan, saat itu korban hendak menemui keluarganya di RSU Mitra Sejati. Namun saat berjalan kaki di Jln. M Basir, kedua pelaku mengendarai sepedamotor Suzuki Spin BK 5272 FQ dari arah belakang merampas kalung emas miliknya. Tetapi Risma dengan gerakan refleks memegang baju

salah satu pelaku berinisial RP yang duduk di boncengan sepedamotor. Akibatnya korban sempat terseret hingga lima meter guna mempertahankan kalungnya. Dalam posisi terseret, korban terus berteriak maling sehingga mengundang perhatian warga. Sedangkan kedua pelaku terjatuh bersama sepedamotornya. Massa langsung menangkap keduanya dan menghajarnya hingga babak belur. Kapolsek Deli Tua Kompol SP Sinulingga melalui Kanit Reskrim AKP Semione Sembiring membenarkan kejadian itu. “Kedua pelaku telah kita amankan, saat ini kasusnya sedang diproses,” sebutnya.(m27/m40/ m41)

Pemprovsu Dan DPRDSU Diharapkan Tidak Ragu Dalam Penyertaan Modal MEDAN (Waspada): Pemprovsu dan DPRDSU terutama Komisi C jangan ragu melakukan Memory of Understanding (MoU) penyertaan modal Rp246 miliar di PDAM Tirtanadi, karena prosesnya telah sesuai konstitusi. Hal itu dikemukakan Direktur Sumut Institut Osriel Limbong di Medan, Minggu (13/5), menanggapi pro dan kontra yang masih menyelimuti PDAM Tirtanadi dalam hal penyertaan modal Pemprovsu. Menurut dia, penyertaan modal tersebut ditampung dalam APBD Sumut tahun 2012. Sementara PDAM Tirtanadi sangat membutuhkannya guna mewujudkan kuota permintaan pelanggan baru, peningkatan

pelayanan dan produksi serta kualitas air. ‘’Kita pantas malu jika persoalan itu tidak cepat diselesaikan, sebab PDAM di provinsi lain sangat didukung semua elemen. Harga jual atau tarif air produk PDAM Tirtanadi tergolong murah di Indonesia,’’ katanya. Di sisi lain, PDAM Tirtanadi dituntut menjaga kualitas, kuantitas dan kontinuitas sesuai target pelayanan dari 70 persen menjadi 80 persen. Osriel yang jugaWakil Ketua KNPI SU ini melanjutkan, bagaimana mungkin semua tuntutan perbaikan dan peningkatan kualitas PDAM Tirtanadi terwujud bila tidak mendapat dukungan semua elemen dan pihak.(m34)

Partai Buruh Minta Plt Gubsu Terbitkan SK PAW MEDAN (Waspada): Partai Buruh Provinsi Sumatera Utara mendesak Plt Gubsu Gatot Pujonugroho ST segera menerbitkan surat keputusan (SK) pergantian antar waktu (PAW) anggota DPRD Kota Medan dari Remon Simatupang kepada Juliaman Damanik. “Kalau tidak, kita akan melakukan somasi terbuka. Soalnya, PAW ini sudah tidak ada masalah lagi. Tapi, kenapa masih juga belum dikeluarkan SK-nya. Padahal, menurut aturan 14 hari surat usulan diterima, harus sudah dikeluarkan SK tersebut,” tegas Sekretaris DPD Partai Buruh Sumatera Utara H Ramli J Marpaung, SH, MM, di Medan, Sabtu (12/5). Dia menjelaskan, pemecatan Renold sebagai anggota Partai Buruh sudah sesuai dengan aturan dan mekanisme partai. Bahkan, sudah keluar surat keputusan Mahkamah Agung

No.643 K/Pdt.Sus/2011 tanggal 18 Oktober 2011. “Maka tidak ada alasan bagi Plt Gubsu untuk memperlambat proses penerbitan SK PAW tersebut. Karena hanya tinggal menunggu SK ini proses PAW bisa dilakukan,” ucapnya. Ramli didampingi Kuasa Hukum Liboin Rumapea, SH,menegaskan, jika hal ini diperlambat, tidak saja merugikan masing-masing pihak terkait, tapi juga sebagai bentuk pelecehan terhadap Partai Buruh. Di sisi lain, lanjutnya, wakil yang akan ditempatkan di DPRD tersebut harus segera merealisasikan kinerjanya untuk kepentingan masyarakat yang telah mempercayakan suaranya di legislatif. “Kalau ini diperlambat, bagaimana wakil rakyat bisa bekerja. Padahal, harapan rakyat memilih wakilnya itu untuk membawa aspirasi merekadidewan,”tegasRamli.(m48)

Waspada/Sahrizal

DUA perampok yang dihajar massa diamankan di Mapolsek Delitua.

PLN Siaga Hadapi Cuaca Ekstrim MEDAN (Waspada): Cuaca ekstrim yang melanda Kota Medan beberapa hari ini yang disertai dengan curah hujan tinggi, angin kencang dan petir, menyebabkan terganggunya jaringan listrik dan terjadi pemadaman di hampir seluruh wilayah Medan. Untuk mengantisipasi terjadinya cuaca ekstrim beberapa pekan ke depan, PLN dalam siaga penuh untuk menjaga kehandalan pasokan listrik serta menyiapkan tim di lapangan.”Angin kencang dan banyak pohon tumbang, membuat jaringan PLN terganggu sehingga trafo mengalami kerusakan. Ini yang membuat pemadaman listrik di beberapa wilayah di Kota Medan beberapa hari lalu,” ujar Deputi Manager Komunikasi dan Bina Lingkungan PLN Wilayah Sumut Raidir Sigalingging, baru-baru ini. Raidir menyebutkan, setiap adanya gangguan jaringan listrik akibat trafo yang rusak, pihaknya terus melakukan pekerjaan pemeliharaan jaringan listrik, sehingga pasokan listrik ke pelanggan dalam kondisi aman. Namun, karena memang cuaca yang datang itu sangat ekstrim disertai hujan, angin dan petir membuat jaringan listrik mengalami gangguan. “Cuaca nya memang luar biasa, ini di luar kemampuan kita. Listrik langsung padam karena jaringan rusak diterpa angin dan tumbangnya

banyak pohon di jalanan,” katanya. Begitupun, tambah Galingging, Pihak PLN akan terus semaksimal mungkin memberikan kenyamanan pasokan listrik kepada seluruh pelanggan. Jika ada kerusakan langsung dilakukan pemeliharaan. “Kami meminta maaf atas ketidaknyamanan pemadaman listrik karena adanya cuaca ekstrim itu. Kami juga akan terus melakukan pemeliharaan dan perawatan pada semua pembangkit dan jaringan listrik yang ada,” pungkasnya. Hujan yang disertai petir dan angin kencang, Selasa (8/5-red) terjadi sejak pukul 18:00 hingga malam, mengakibatkan pohon tumbang, baliho dan plank-plank reklame tumbang di sejumlah tempat serta listrik di beberapa kawasan di Medan padam seperti di Medan Polonia, Medan Helvetia, Kelurahan Mabar, Marelan, Medan Kota, Medan Timur, Medan Tembung listrik padam. Raidir Galingging yang didampingi staf niaga Tanto menyebutkan, akibat cuaca ekstrim yang melanda Kota Medan tersebut dan mengganggu jaringan listrik menyebabkan sebanyak 43 penyulang (pembagi arus listrik) dari 106 penyulang yang ada dilepas untuk segera dilakukan perbaikan pada jaringan yang tertimpa pohon maupun kerusakan pada trafo. “Alhamdulillah, pada Kamis malam semua penyulang kembali normal,” sebutnya. (m41)

Rektor : Mahasiswa Harus Jadi “Sparring Partner” MEDAN (Waspada): Kejayaan Universitas Islam Sumatera Utara (UISU) harus diraih karena memang sudah di depan mata. Seluruh elemen UISU harus saling bekerjasama dan mendukung. “Dengan kerjasama, segala pencapaian dicita-citakan akan terwujud,” kata Rektor UISU Almunawwarah Jln. Sisingamangaraja Medan Prof Zulkarnain Lubis, Selasa (15/5), usai pelantikan Pemerintahan Mahasiswa (Pema) dan Badan Aspirasi Mahasiswa (BAM) UISU periode 2012-2013 di kampus itu. Dia berharap Pema dan BAM UISU menjadi ujung tombak membawa UISU ke arah yang lebih baik. Menurut Prof Zulkarnain, Pema merupakan “sparring partner” rektorat dalam menja-

lankan roda kampus. Cita-cita UISU menjadi yang terbaik tidak akan pernah dapat terwujud bila tidak ada harmonisasi antara pihak rektorat dengan mahasiswa yang diwakili Pema. Atas nama rektorat, kata Prof Zulkarnain, meminta Pema dan BAM menganggap rektorat adalah kawan, sahabat sejalan untuk selalu bersama-sama melakukan perubahan yang terbaik. “Mari kita satukan pandangan dan tujuan membesarkan UISU sehingga menjadi universitas unggulan dan bermutu,” katanya. Usai dilantik menjadi Presiden Pema UISU, Fadli Qahfy bersama wakilnya Abdul Rahman mengatakan, akan melakukan kerjasama dengan pihak rektorat dalam mewujudkan UISU menjadi universitas unggulan dan terbaik.(m49)

Waspada/M. Ferdinan Sembiring

REKTOR UISU Prof Zulkarnain Lubis saat menyerahkan SK pengukuhan kepada Presiden dan Wakil Presiden Pema UISU yang baru Fadly Qahfi dan Abdul Rahman di aula UISU Almunawwarah Jln. Sisingamangaraja Medan.


Medan Metropolitan Lapas Kelas 1 Medan Over Kapasitas

A5

WASPADA Rabu 16 Mei 2012

Lima Tahanan Hukuman Mati, 33 Seumur Hidup, 21 Teroris MEDAN (Waspada): Lembaga Pemasyarakatan (Lapas) Kelas I Medan saat ini sudah dalam kondisi over (melebihi) kapasitas. Pengawasan harus lebih diperketat guna menjaga hal-hal yang tidak diinginkan. Sedangkan jumlah petugas juga sangat minim. “Kita perlu melakukan pengawasan secara ketat terutama untuk tahanan narkoba. Hal itu dilakukan guna mengantisipasi sekaligus memproteksi terjadinya peredaran narkoba dalam Lapas Kelas I Medan. Jadi, ada hal-hal yang membuat kita melakukan maximum security, medium security dan minimum security,” kata Kalapas Kelas I Medan Ayub Suratman saat silaturahmi dengan Wali Kota Medan Rahudman Harahap, Selasa (15/5). Seharusnya, menurut Ayub, kapasitas Lapas Kelas I Medan

hanya untuk 1.050 narapidana. Sedangkan jumlah narapidana yang menghuni Lapas saat ini mencapai 2.126 orang. Artinya, telah terjadi over kapasitas 100 persen. Dari jumlah tahanan itu, pihaknya harus melakukan pengawasan maksimal karena ada lima tahanan hukuman mati, 33 tahanan seumur hidup dan 21 teroris. Belum lagi tahanan yang berstatus mantan aparat dan tahanan narkoba. Ayub mengakui jumlah pegawai tidak sebanding untuk mengawasi jumlah tahanan. Bayangkan saja, jumlah pegawai hanya 170 orang. Kondisi itu menyebabkan satu pegawai harus mengawasi lebih dari 200 tahanan. “Tentunya ini tidak efektif lagi. Idealnya, satu pegawai mengawasi 20 tahanan,” ucapnya. Karena itu, kata Ayub, pihaknya berharap agarWali Kota Medan dapat memberikan partisipasi yang bisa dikembangkan dalam upaya pembinaan para narapidana. Dengan demikian, narapidana telah memiliki keterampilan maupun keahlian untuk dijadikan mata pencaha-

Kakanwil Kemenagsu Terima Pimpinan BT/BS Bima MEDAN (Waspada): “Persiapan yang baik adalah kunci keberhasilan,” kata Pimpinan BT/BS Bima dr. Robert Valentino Tarigan, SPd saat melakukan audiensi kepada Kakanwil Kementerian Agama (Kemenag) Sumut Drs. H. Abdurrahim, M.Hum, baru-baru ini. Sejak sepuluh tahun terakhir, kata Valentino, BT/BS Bima telah menggunakan multimedia dalam proses pengajaran peserta didiknya. “Tujuannya untuk mempermudah siswa menyerap pelajaran yang disampaikan tentor (guru pembimbing),” ujarnya didampingi H Amran Rokany SAg. Tujuan audiensi Pimpinan BT/BS Bima kepada Kakanwil Kemenagsu Drs. H. Abdurrahim M.Hum untuk mengucapkan terimakasih atas kerjasama yang telah terjalin. Diharapkan kerjasama ini berlanjut untuk Tahun Ajaran 2012/2013. Pada kesempatan itu Abdurrahim menyambut baik kerjasama yang telah terjalin dengan BT/BS Bima. “Dalam menghadapi UN yang lalu, kita juga bekerjasama dengan BT/BS Bima,” kata Abdurrahim. Begitu juga dengan persiapan menghadapi SNMPTN (Seleksi Nasional Masuk Perguruan Tinggi Negeri) 2012, Kakanwil Kementerian Agama Sumut memberi dukungan penuh. “Untuk Tahun Ajaran 2012/2013, kerjasama yang telah terjalin selama ini akan kita tingkatkan. Bukankah tiap upaya memajukan dunia pendidikan harus disambut baik,” tambahnya. BT/BS Bima pernah ikut andil memeriksa hasil ujian tulis CPNS dan PSB (Penerimaan Siswa Baru) dan lainnya, semua terlaksana dengan profesional. Hasil ujian diperiksa di depan peserta ujian dan diumumkan pada hari itu juga sehingga penyelenggara terhindar dari prasangka buruk. Valentino menambahkan, pada tahun 2009, MTsN3 merupakan salah satu dari enam sekolah yang mewakili Sumut mengikuti PISA (Programme for International Student Assessment). “MTsN 3 sudah lama bekerjasama dengan BT/BS Bima,” tambahnya. Disebutkan, PISA merupakan program studi yang bertujuan untuk mengukur kesiapan siswa usia 15 tahun dalam menghadapi kehidupan nyata di masyarakat. Sementara itu, Amran Rokany, SAg mengaku ketika dirinya menjabat sebagai Kepala Sekolah MTsN 3 di Helvetia, BT/BS Bima banyak memberi bantuan. “Laboratorium bahasa MTsN 3 berasal dari BT/BS Bima, begitu juga buku-buku dan pola pengajaran bahasanya,” ujarnya.(m25)

Waspada/ist

PIMPINAN BT/BS Bima dr. Robert Valentino Tarigan, SPd (kiri) memberikan bingkisan kepada Drs. H. Abdul Rahim, MHum (tengah) yang disaksikan H Amran Rokany, SAg (kanan).

rian setelah mereka bebas nanti. “Banyak potensi yang bisa dikembangkan di Lapas Kelas I Medan untuk kegiatan keterampilan bersifat produktif yang orientasinya profit. Terus terang saja, banyak yang bisa diinvestasikan dalam Lapas jika investor masuk. Apalagi di Lapas telah dilengkapi dengan security, sarana prasarana yang bisa dikerjakan seperti katering, perumahan dan tidak perlu transportasi. Pelatihan ini tentunya bisa menjadi hiburan bagi mereka,” kata Ayub. Karenanya, Ayub berharap Pemko Medan dapat berpartisi-

pasi dengan memberikan bantuan baik menyangkut masalah pendidikan dan kesehatan. Apalagi ada Satuan Kerja Perangkat Daerah (SKPD ) yang bisa didatangkan ke Lapas seperti Dinas Pendidikan, Dinas Kesehatan, Dinas Sosial dan Tenaga Kerja, maupun Dinas Pertanian dan Kelautan. Sementara itu, Wali Kota Medan Rahudman Harahap mengatakan, Pemko Medan akan mengkaji kerjasama antara Pemko Medan dengan Lapas Kelas I Medan, terutama untuk memberikan pembinaan keterampilan kepada para taha-

nan. Pemko akan menjajaki kerjasama dengan pihak ketiga selaku pemilik modal guna memberikan pelatihan keterampilan di Lapas. “Dengan adanya pelatihan keterampilan, maka tahanan yang sudah selesai menjalani masa hukuman akan memiliki keahlian. Karenanya, kita akan menjajaki kerjasama dengan pihak ketiga dan membentuk tim bersama dengan Kalapas. Apa yang kita lakukan ini sebagai bentuk pembinaan sehingga potensi para tahanan bisa dimanfaatkan,” demikian Rahudman. (m50)

Mahasiswa LP3I Terima Klaim Asuransi Jiwa MEDAN (Waspada): Mahasiswa Politeknik LP3I Medan menerima klaim asuransi jiwa dan kecelakaan dari PT Asuransi Bumida Bumiputera 1967 atas nama Asma Fadhilla Pulungan (korban meninggal) sebesar Rp5.500.000 yang diterima ahli waris dan Rotua Artha Uli Sianturi (korban luka-luka) sebesar Rp950.000 sebagai pengganti biaya pengobatan. Penyerahan klaim asuransi tersebut diserahkan secara simbolis oleh Kepala Cabang PT Asuransi Bumida Bumiputera 1967 Sabam Silaen kepada orangtua korban kecelakaan baik yang meninggal maupun luka-luka, di Kampus Politeknik

LP3I Glugur By Pass Medan, Selasa (15/5). Penyerahan tersebut disaksikan Direktur Politeknik LP3I Medan Akhwanul Akmal, Kepala Kampus Farida Amela, para dosen dan mahasiswa. “Kita telah memproses klaim dari pihak LP3I bahwa ada mahasiswanya mengalami risiko kecelakaan dan ada yang meninggal dunia. Saat ini klaim sudah kami laksanakan sebesar Rp5.500.000 dan ditransfer ke rekening ahli waris dalam hal ini orangtua korban meninggal. Selain itu, ada juga klaim asuransi biaya pengobatan di rumah sakit sebesar Rp950.000 sesuai dengan kuitansi biaya

pengobatan,” katanya. Sabam menyebutkan, Polteknik LP3I bekerjasama dengan Asuransi Bumida Bumiputera untuk memberikan asuransi kepada mahasiswanya melalui program Asuransi Mahasiswaku, dengan premi Rp20.000 per mahasiswa selama setahun. Direktur Politeknik LP3I Medan Akhwanul Akmal mengatakan, asuransi yang disediakan LP3I merupakan bagian dari fasilitas yang diberikan kepada mahasiswa, dengan tujuan agar mahasiswa lebih berhati-hati lagi dalam mengendarai kendaraan dan merasa nyaman saat berangkat maupun pulang kuliah. (m41)

Waspada/Sugiarto

ORANGTUA mahasiswa korban meninggal menandatangani surat klaim asuransi disaksikan Direktur Politeknik LP3I Medan Akhwanul Akmal (dua kanan) dan Kepala Kampus Politeknik LP3I Glugur By Pass Medan Farida Amela, Selasa (15/5).

Waspada/Rudi Arman

MOBIL Fortuner BM 1795 HO yang pecah kaca mobil belakang akibat terkena lemparan batu saat berada di Polresta Medan, Selasa (15/5) sore.

Tangkap Perampok, Mobil Polisi Dilempar Batu MEDAN (Waspada): Kaca mobil bagian belakang milik anggota Polresta Medan yang mencoba menangkap pelaku peram-pokan di kawasan Komplek Perumahan Pama, Lorong IX, Kel. Sei Mati, Kec. Medan Labuhan dilempari batu, Selasa (15/5) sore. Akibat terkena lemparan, kaca mobil Fortuner BM 1795 HO pecah dan bolong. Sedangkan seorang yang diduga terlibat perampokan diamankan dari lokasi kejadian dan sampai tadi malam masih menjalani pemeriksaan. Waka Sat Reskrim Polresta AKP Hendra kepada wartawan mengatakan, tersangka yang diamankan berinisial K, 18. “Yang bersangkutan saat ini masih menjalani pemeriksaaan,” katanya. Sedangkan dua orang yang diduga pelaku utama berhasil kabur dan saat ini masih dalam pengejaran. “Dua pelaku utama yang sudah diketahui identitasnya masih kita

kejar,” katanya. Dijelaskan Hendra, peristiwa perampokan yang dilakukan pelaku ini terjadi di rumah Darwis, 50, warga Jalan Ir Juanda Medan. “Kejadiannya 2 Mei 2012 dengan kerugian uang dolar yang diperkirakan mencapai Rp100 juta, handphone BB, dan laptop,” jelasnya. Polisi yang sudah mengetahui keberadaan pelaku kemudian menuju ke lokasi. Namun saat dilakukan penggerebekan mendapat perlawanan dari warga dengan cara melempari mobil anggota Polresta Medan dengan batu. Sementara itu salah seorang warga setempat kepada wartawan mengatakan, aksi massa dengan cara melempari mobil polisi dengan batu memang baru kali ini terjadi di kawasan tersebut. “Massa di sana memang sepertinya tidak senang kalau ada polisi yang mau menangkap pelaku kejahatan dan terus menghalangi dengan berbagai cara,” katanya. (m39/h03)

Sosialisasi Wilayah Bebas Korupsi

81 Pegawai Lapas Anak Tandatangani Pakta Integritas MEDAN ( Waspada): Sebanyak 81 pegawai Lembaga Pemasyarakatan KelasII Anak Medan, menggelar penandatanganan pakta integritas dijajaran Lapas Anak Medan, dipimpin langsung Kepala Lapas Kelas II A Anak Tanjung Gusta Medan Asep Syarifuddin Bc.IP, SH, CN.MH. Penandatanganan itu disaksikan Kakanwil Kemenkum HAM Sumut Baldwin Simatupang BI.IP, SH.MH, Kepala Divisi Administrasi Kemenkum dan HAM Sumut T Daniel Lumbantobing, Kepala Divisi Pelayanan dan Hukum Kemenkum dan HAM Sumut, Kedari Agus Raharjo, di Aula Lapas Anak Kelas II Medan, Senin (14/5). Kakanwil Kemenkum dan HAM Sumut Baldwin Simatupang mengatakan, pakta integritas pada dasarnya hanya untuk mengingatkan para pegawai harus melaksanakan pekerjaan sesuai dengan tugas pokok dan fungsinya (Tupoksi) dan peraturan-peraturan yang harus mereka taati. Menurut Simatupang, Lapas Anak Kelas II Medan yang dipilih dari 48 Satker yang ada di Sumatera Utara, dan harus bangga karena terpilih sebagai yang pertama, karena pada

akhirnya seluruh instansi pemerintahan harus masuk wilayah bebas korupsi (WBK). Kata dia, penandatanganan pakta integritas tersebut merupakan tindak lanjut instruksi Presiden RI. “Selain itu, diakui program ini sangat berat, namun jika kita sama-sama mendukung program ini akan bisa terlaksana dengan baik,” ujarnya. Untuk itu, kepada para pegawai diharapkan agar mempunyai rasa memiliki terhadap tugastugasnya dan rasa bertanggungjawab terhadap keberhasilan Lapas Anak Medan. Simatupang mengimbau seluruh pegawai Lapas Anak Medan, agar pakta integritas yang ditandatangani harus benar-benar diterapkan secara nyata dalam lingkup satuan kerja, sebagai bentuk pertanggungjawaban moral dan komitmen, guna lebih meningkatkan kerja dan pelayanan publik terhadap masyarakat. “Pakta integritas yang ditandatangani hari ini saya harapkan agar jangan hanya menjadi pelengkap ketentuan perundang-undangan yang berlaku secara seremonial, tetapi wajib diterapkan seluruh pimpinan dan seluruh pegawai Lapas Kelas II Anak Medan di lingkungan kerja masing-masing, guna lebih memberikan pelayanan maksimal terhadap masyarakat,” jelasnya. (m38)

PWI Pusat Uji Kompetensi Anggota Di Sumut MEDAN (Waspada): Pengurus Persatuan Wartawan Indonesia (PWI) Pusat melalui tim penguji yang diturunkan ke Sumatera Utara, Kamis (17/5) hingga Jumat (18/5) melakukan serangkaian Uji Kompetensi Wartawan (UKW) terhadap 56 anggota PWI Sumut yang telah dinyatakan lulus seleksi administrasi sebagai peserta. Ketua PWI Cabang Sumut Drs. Muhammad Syahrir didampingi Sekretaris Edward Thahir, S.Sos dan unsur pengurus lainnya, Selasa (15/5), menjelaskan,UKWyangdilaksanakanPWI Pusat ini merupakan angkatan II yang dilaksanakan di Sumut. Sebelumnya, angkatan I dilaksanakanpada27-28Desember2011 dan diikuti 42 peserta. “UKW ini sekaligus menjadi alat ukur apakah seorang wartawan itu kompeten atau tidak

sebagaimana digariskan dalam Peraturan Dewan Pers Nomor 1 tanggal 2 Februari 2010 tentang SKW,” tegas Syahrir. Sebelum pelaksanaan UKW, sebut Syahrir, pada hari Rabu (16/5) di Aula Lantai II Amaliun Food Court Jln. Amaliun (simpang Masjid Raya Medan), PWI Pusat terlebih dahulu melaksanakan Safari Jurnalistik dalam bentuk Pelatihan Jurnalistik dan Pembekalan UKW. Tampil sebagai narasumber pada kegiatan Safari Jurnalistik yang didukung PT Astra International Tbk tersebut, Sekretaris Jenderal PWI Pusat Hendry Ch Bangun dengan paparan “Sertifikasi Wartawan dan UKW”, Kepala Bidang Pendidikan PWI Pusat Marah Sakti Siregar dengan presentasi“Kode Etik Jurnalistik”. Pemeriksaan mata Pada Rabu (16/5), 100 ang-

gota dan keluarga anggota PWI Sumut melakukan pemeriksaan kesehatan mata di Klinik Spesialis Bunda Jln. Sisingamangaraja No.17 (depan Hotel Garuda Plaza) Medan mulai pukul 08:00 hingga 11:30. Usai diperiksa, peserta yang telah dihunjuk akan mengikuti acara ramah-tamah sekaligus penyerahan kacamata baca di Garuda Plaza Hotel mulai pukul 11:30 hingga 13:30. Pemeriksaan kesehatan mata dan penyerahan kacamata tersebut terlaksana atas apresiasi dan kepedulian PT Bank Mandiri (Persero) Tbk, RSU Permata Bunda, Klinik Spesialis Bunda dan Garuda Plaza Hotel Medan. Selain 100 anggota dan keluarga anggota PWI Sumut, 50 warga yang membutuhkan juga ikut dalam program “Peduli Masyarakat” itu. (m08)

Waspada/Ist

KAKANWIL Kemenkum HAM Sumut Baldwin Simatupang (tengah) didampingi Kepala Lapas Kelas II A Anak Tanjung Gusta Medan Asep Syarifuddin (dua kanan) foto bersama dalam acara sosialisasi zona pembangunan integritas menuju wilayah bebas korupsi (WBK).


A6

Medan Metropolitan

WASPADA Rabu 16 Mei 2012

Korupsi Dana Proyek Swakelola

Bendahara PU Binjai Divonis 1 Tahun Penjara MEDAN (Waspada) : Bendahara Pengeluaran Dinas Pekerjaan Umum (PU) Binjai Zulfansyah dijatuhi hukuman satu tahun penjara pada sidang di Pengadilan Tipikor Medan, Selasa (15/5). Dimana bendahara proyek swakelola tahun 2010 itu dinyatakan terbukti bersalah melakukan tindak pidana korupsi secara bersamasama yang merugikan negara Rp1,3 miliar. Selain hukuman penjara selama satu tahun penjara juga dibebani hukuman denda sebesar Rp50 juta yang dapat diganti dengan pidana kurungan selama tiga bulan penjara. Namun, terdakwa dibebaskan dari hukuman tambahan membayar uang pengganti atas kerugian negara tersebut karena tidak terbukti menerima aliran dana hasil korupsi uang proyek tersebut. Menurut majelis hakim yang diketuai Suhartanto, sebagian dana proyek yang tidak dibayarkan terdakwa kepada masingmasing Pejabat Pembuat Komitmen (PPK) diserahkan kepada Kadis PU Binjai Hj Masniari (DPO) sebesar Rp1,4 miliar. “Majelis sependapat dengan penasihat hukum terdakwa bahwa terdakwa tidak menikmati uang hasil korupsi. Penuntut Umum juga tidak bisa membuktikan terdakwa menerima uang hasil korupsi,” kata hakim. Putusan majelis hakim itu lebih ringan daripada tuntutan satu tahun enam bulan penjara oleh Jaksa Penuntut Umum (JPU) dari Kejari Binjai. Zulfansyah dinyatakan bersalah melanggar Pasal 3 UU No. 31 Tahun 1999 tentang Pemberantasan Tindak Pidana Korupsi Jo Pasal 55 ayat (1) ke-1 KUHP Jo Pasal 65 KUHP. Dia terbukti menyalahgunakan wewenang untuk menguntungkan diri sendiri, orang lain atau suatu kooperasi dan merugikan negara. Selain itu, Zulfansyah selaku bendahara pengeluaran pembantu di Dinas PU Binjai bidang cipta karya dan pengairan telah menandatangani cek bersama Kadis PU Binjai Hj Masniari untuk pencairan dana proyek swakelola Rp2,3 miliar yang bersumber dari APBD Binjai 2010. Sesuai dengan Daftar Isian Penggunaan Anggaran (DIPA), dana itu diperuntukkan untuk rehabilitasi drainase, rehabilitasi tebing dan sungai, serta rehabiltasi sejumlah gedung pemerintahan. Proyek yang dikerjakan secara swakelola itu dibagi dalam 37 paket. Namun, dari 37 paket hanya 17 paket yang dikerjakan. Sedangkan 20 paket senilai Rp1,3 miliar tidak dikerjakan hingga saat ini. “Terdakwa tidak membayarkan kepada masing-masing PPK, tetapi menyerahkan sebagian dana tersebut kepada Kadis PU Binjai Hj Masniari sebesar Rp1,4 miliar,” kata hakim. Karena perbuatan terdakwa tersebut, menurut hakim, negara telah dirugikan sebesar Rp1,3 miliar sesuai hasil audit Badan Pengawasan Keuangan dan Pembangunan (BPKP) Sumut. Terhadap putusan itu, majelis hakim memberikan tujuh hari bagi kedua belah pihak untuk mempertimbangkan putusan itu. Zulfansyah yang divonis tanpa didampingi pengacaranya itu diperintahkan untuk tetap berada di tahanan. (m38)

PTPN II Sampali Gagalkan Pencurian TBS MEDAN (Waspada): PTPN II Kebun Sampali melalui petugas Brimob (BKO) dan security kembali menggagalkan aksi pencurian Tandan Buah Sawit (TBS) dengan menangkap pelakunya, Minggu (13/5) pukull 18:00 Wib. Manajer PTPN II kebun Sampali R Heru Pradoyo didampingi Ketua Serikat Perkebunan (SP) Merdeka Alfian, Senin (14/5) mengatakan, pencurian yang cukup meresahkan masyarakat dan pihak PTPN II sudah berulang kali, namun kali ini berkat kesigapan BKO dibantu security, pencurian dapat digagalkan. Kata Heru, gerombolan pencuri TBS yang diduga dikomandoi tersangka M dkk berhasil diringkus petugas Brimob dan security di Afd II blok C.1 Pasar X Desa Sentis, Kec. Percut Seituan, beserta barang bukti mobil truk BK 9856-LO, Carry BK 8729-CE dan Daihatsu Xenia BK 1519-KM. Selanjutnya truk dan Carry yang berisikan buah kelapa sawit sebanyak 6 ton, beserta tersangka M dan dua rekannya diserahkan ke Polsek Percut Seituan, setelah pihak PTPN II Kebun Sampali membat laporan dengan STPL Nomor : LP.11347/V/2012/PERCUT. Akibat pencurian itu PTPN II mengalami kerugian Rp9 jutaan. “Kami sangat mengapresiasi kepada Brimob dan security yang dinilai tetap komitmen dan memiliki loyalitas dan rasa tanggungjawab yang tinggi. Kami juga mengucapkan terimakasih kepada Polsek Percut Seituan dan jajarannya yang tanggap dalam menyikapi hal ini dengan menurunkan 7 anggotanya ke TKP,” ujar Heru. Ketua SP Merdeka Kebun Sampali Alfian menambahkan, pada hari yang sama juga petugas Brimob dan security serta jajarannya menggagalkan pencurian kayu jati dari kebun di Jln. Meteorologi Desa Sampali. “Barang buktinya mobil L.300 warna hitam BK 8058 CC dan 22 batang pohon jati ditambah satu lembar STNK, buktu speksi, telah diamankan,” sebutnya.(m24)

BKMT Sumut Akan Gelar Pemeriksaan Kesehatan Gratis MEDAN (Waspada): Prof DR Hj Tuti Alawiyah AS, MM akan melantik pengurus Badan Kontak Majelis Taklim Sumatera Utara (BKMT-SU) di Asrama Haji Medan, Selasa (22/5) mendatang. Demikian disampaikan Ketua Umum BKMT Sumut Dra Hj Rosmawati Harahap Psi, bersama pantia penyelenggara diketuai Dra Hj Irawati Situmorang, sekretaris Asliani Harahap dan Hj Ernawati, Isma Tanjung, Senin (14/5). Hj Irawati menyebutkan, selain melantik kepengurusan BKMT masa bakti 2012-2017, Tuti Alawiyah juga menjadi penceramah. “Pelantikan sekaligus kegiatan bazar dan pemeriksaan kesehatan bagi pengunjung stand secara gratis. Ajang ini sekaligus menjadi sarana silaturahim sesama pengurus,” katanya. Menurut dia, BKMT secara garis besar bertujuan untuk meningkatkan kemampuan pengelolaan manajemen organisasi, guna terciptanya organisasi sehat, tangguh, efektif, efesien, dan mandiri. Sedangkan programnya antara lain, peningkatan dan pemantapan kerja sama dengan organisasi lain yang sesuai dengan visi BKMT baik organisasi Islam maupun organisasi perempuan dan profesi lainnya. Sebelumnya Hj Rosmawati Harahap menyatakan, saat ini pihaknya tengah melakukan pendataan terkait jumlah majelis taklim yang ada di Sumatera Utara. Hal itu, kata dia, untuk mengenal lebih banyak lagi majelis taklim dan bisa dijadikan jaringan berdakwah. “Biasanya majelis taklim menyelenggarakan pengajian atau perwiridan saja, kedepan akan diberdayakan untuk pengembangan dakwah, sehingga ilmu yang diperoleh anggotanya lebih banyak dan terarah,” ujarnya sembari menyebutkan kepengurusan BKMT di Sumut sudah ada di 18 kabupaten/kota. (cwan)

Waspada/Ist

PENGURUS dan panitia BKMT Sumut yang akan menggelar acara pelantikan di Asrama Haji Pangkalan Mahsyur Medan.

Waspada/Surya Efendi

SEMRAWUT: Sejumlah kendaraan berusaha saling mendahului dan terjebak macat di persimpangan Jln. Letjen Suprapto – Jln. Multatuli Medan, Selasa (15/5). Kesemrawutan lalu lintas ini disebabkan padamnya traffic light dan tidak ada petugas yang berjaga di persimpangan ini.

Umbar Janji Untuk Cari Simpatik Rakyat Selektif Pilih Juru Kampanye MEDAN (Waspada): Meski tidak semua misi dan visi disampaikan para kandidat calon presiden atau kepala daerah saat kampanye politik menjelang Pemilu terpenuhi, namun cara itu harus tetap dilakukan kontestan untuk mengambil simpatik rakyat. “Mengumbar janji-janji politik di hadapan rakyat jelang Pemilu tidak bisa dihindari, karena dengan cara itulah para kontestan memperkenalkan diri dan memiliki programnya yang baik bagi rakyat bila terpilih,” kata pengamat politik dan tata negara Universitas Sumatera Utara (USU) DR Faisal Akbar

menjawab Waspada, Selasa (15/ 5), saat dihubungi melalui telefon selular. Menurut Faisal, menyampaikan janji saat kampanye, salah satu strategi politik para calon untuk mengambil simpatik rakyat bahwa dirinya layak dipilih sebagai pemimpin masa depan. “Saat itu, diyakini para kandidat juga belum bisa pastikan apakah janjinya nanti itu dapat terpenuhi semuanya atau tidak, sebab di benak mereka hanya satu bagaimana supaya rakyat yakin,” sebutnya. Kata dia, para kontestan Pemilu tidak bisa disalahkan begitu saja, sebab apa yang mereka sampaikan itu merupakan hak politiknya untuk meyakinkan pendukungnya supaya tidak ragu memilih dirinya. “Kalau dia

tidak menyampaikan visi-misinya dari mana rakyat menilai kemampuan sebagai calon yang pantas dipilih,” ujar Faisal. Namun, lanjutnya, rakyat juga kan tidak lantas percaya begitu saja terhadap janji itu, jika rekam jejak si calon itu tidak sesuai dengan yang disampaikan. “Rakyat sudah pintar, mereka sudah banyak belajar, untuk itu mereka tidak langsung percaya dengan janji-janji politik, terlebih yang jauh dari logika menurut mereka. Rakyat melihat kemampuan orang yang menyampaikan janji itu,” tuturnya. Faisal berharap, agar para calon Presiden atau kepala daerah tidak salah kaprah, maka mereka harus selektif memilih juru kampanye (jurkam), sehingga teriakan dan janji politik disampaikan untuk kepenting-

Nasib 500 Nelayan Jaring Gembung Kedah Terancam

BELAWAN ( Waspada): Mata pencarian sekitar 500 nelayan jaring gembung kedah Belawan, terancam punah. Pasalnya, sekitar dua tahun belakangan ini mereka kesulitan mendapat ikan akibat ulah pukat hela dasar dua kapal yang banyak beroperasi di perairan timur dari Pantai Cermin hingga ke barat Kwala Serapu, Berandan. Himpunan Nelayan Seluruh Indonesia (HNSI) Kota Medan menyebutkan ke 500 nelayan jaring gembung kedah itu bermukim di Kel. Belawan Satu dan Bagan Deli, Kec. Medan Belawan, dan Kel. Pekan Labuhan, Kec. Medan Labuhan, serta Kel. Labuhan Deli, Kec. Medan Marelan. Mereka melaut selama satu hari dengan menggunakan mesin dompeng dan mata ja-

ring ukuran 3 sampai 4 inci sebagai alat tangkap. Lokasi penangkapan di zona 1 B atau sekitar 2 sampai 4 mil dari pinggir pantai, pada bulan Apri hingga Desember tiap tahunnya,nelayanyangtergolong masih tradisional ini panen ikan. “Pada bulan sekarang inilah seharusnya mereka mendapat hasil yang lumayan,” kataWakil Ketua HNSI Kota Medan Alfian MY. Namun, akibat banyaknya pukat hela dasar dua kapal (Pair Trawls) yang lazim disebut pukat tarik dua, pukat grandong atau pukat fekbot banyak beroperasi di wilayah tangkap yang sama, maka penghasilan nelayan jaring gembung kedah turun tajam. Sebelum menjamurnya pukat tarik dua, pencarian nelayan

Kejari Belawan Dalami Dugaan Korupsi BKM Bahtera Deli BELAWAN (Waspada): Kejaksaan Negeri (Kejari) Belawan masih terus mendalami kasus dugaan korupsi atau penyimpangan peng-gunaan anggaran pelaksanaan sejumlah proyek pembangunan jalan setapak, kegiatan sosial dan ekonomi yang dilaksanakan Badan Keswadayaan Masyarakat (BKM) Bahtera Deli di daerah itu selama tahun 2008- 2010. Kasi Pidsus Kejari Belawan Haris SH, Senin (14/5) mengatakan, pihaknya telah meminta keterangan dari sejumlah saksi, pengurus dan anggota BKM Bahtera Deli terkait masalah itu. Namun, hingga sekarang belum ada seorangpun yang ditetapkan sebagai tersangka. “Kita tidak mungkin menghentikan perkara ini dan sampai sekarangpun kita masih mencari bukti terkait masalah yang dilaporkan masyarakat tersebut,” katanya. Sebelumnya sebanyak 17 perwakilan warga Kel. Labuhan

Deli, Kec. Medan Marelan, melaporkan BKM Bahtera Deli ke Kejari Belawan, karena diduga melakukan penyimpangan anggaran dalam pelaksanaan sejumlah pekerjaan proyek di kelurahan itu selama tahun 2008- 2010. Dalam surat tertanggal 29 Desember 2011 yang ditandatangani oleh ke-17 perwakilan disebutkan, selain dugaan penyimpangan tersebut, pengurus BKM Bahtera Deli juga telah melakukan pembodohan dan penipuan secara terang-terangan karena laporan pertanggung jawaban yang telah dibuat selama ini dan disebarkan ke warga tidak sesuai dengan yang telah dilaksanakan. Sejumlah pekerjaan proyek yang diduga tidak dilaksanakan dengan baik tersebut, di antaranya pekerjaan bidang fisik berupa pembuatan MCK dan sejumlah jalan setapak, bidang sosial berupa kursus menjahit dan lainnya. (h03)

jaring gembung kedah cukup lumayan, sekitar 100 hingga 150 Kg per boat. Sekarang, jumlah itu tidak mungkin lagi diraih, bahkan hasil tangkapan mereka kosong. Untuk bisa bertahan hidup, nelayan jaring gembung kedah terpasa mencari ikan ke tempat lain seperti di lokasi jangkar kapal dan tuasan. “Itupun hasilnya tidak mencukupi dan kadang terpaksa utang untuk makan sehari- hari,” ucap Abdul Rahman, nelayan warga Belawan I. Dikatakannya, nelayan sudah pernah berunjukrasa di Makolantamal I untuk memprotes keberadaan kapal itu. Hasilnya ada kesepakatan, namun tiga hari kemudian kesepakatan itu dikangkangi. Nelayan sempat menangkap satu unit kapal jaring pukat tarik dari boi Pertamina, dibebaskan oleh oknum petugas Lantamal I dibebaskan dan sampai sekarang tidak pernah ditindak. “Itu sebabnya kami jenuh berunjukrasa karena setelah dilapor hasilnya juga tidak akan ada tindakan,” sebut Rahman. Berdasarkan lampiran Peraturan Menteri Kelautan dan Perikanan RI Nomor PER.02/ MEN/2011 tentang jalur penangkapan ikan dan penempatan alat penangkapan ikan dan bantu penangkapan ikan di wilayah pengelolaan perikanan Negara Republik Indonesia disebutkan, pukat hela dasar dua kapal (Pair Trawls) atau yang lazim disebut nelayan dengan sebutan pukat tarik dua, pukat grandong atau pukat fekboat dilarang beroperasi di semua jalur penangkapan ikan dan semua wilayah pengolahan perairan. Ketika hendak dikonfirmasi kepada Kepala Pengawasan Sumber Daya Kelautan Perikanan (P2SDKP) Stasiun Belawan Muktar, tidak berada di kantornya dan saat dihubungi melalui telepon genggamnya tidak diangkat. (h03)

an kandidat tidak menjadi bumerang.”Salah memilih jurkam, akibat selain tidak dipilih, malah makin dibenci,” tegasnya. Orang–orang yang berada dalam tim sukses, menurut dia, haruslah yang profesional dan solid. Kemampuannya harus sudah teruji di mata rakyat sebagai penentu semuanya. Kata dia, lebih efektif lagi, selain misi-visi atau janji, program politik disampaikan saat kampanye terbuka atau tertutup, para kandidat dan jurkamnya harus membukukan janji dan program itu yang kemudian dibagikan kepada semua rakyat. “Rakyat akan bisa lebih

cerdas membedah visi-misi itu, yang mana mungkin terpenuhi sesuai kemampuan calon dan yang mana yang dikawatirkan tidak akan terpenuhi para kandidat. Lebih cerdas lagi, visi-misi itu akan dibedah dalam sebuah dialog melibakan sejumlah pihak, “ jelasnya. Untuk itu, kata Faisal, kandidat tidak sembarangan memilih jurkam. Melainkan menempatkan sosok yang memiliki kemampuan menyampaikan secara dan baik, disamping dapat mengemas sebuah program atau janji yang bisa dipahami rakyat dan secara logika dapat dilaksanakan.

Menurut dia, kampanye merupakan bagian dari strategi pemenangan yang juga merupakan akses menuju tujuan. Dalam kampanye, hendaknya setiap pasangan calon memberikan beberapa visi dan misi yang jelas terhadap apa yang hendak menjadi prioritas kebijakannya nanti ketika dia menjabat. Selain itu, kampanye juga bagian dari sosialisasi bagi kandidat memperkenalkan diri, menjabarkan program kerja, tujuan utama kemenangan dan apa yang sudah pernah kita lakukan adalah metode yang sangat signifikan terhadap kunci menuju kemenangan. (m49)

Diskusi Politik KAHMI Hadirkan Ketua MK MEDAN (Waspada): Majelis Wilayah Korps Alumni Himpunan Mahasiswa Islam (KAHMI) Sumatera Utara akan menggelar Diskusi Politik Seri III, di Hotel Madani Jln.SM Raja Medan, Kamis (17/5) besok malam mulai pukul 19:30 Wib. Ketua MW KAHMI Sumut Ir Murlan Tamba MM didampingi Husni Nasution SH, MKn, Sekum Muhd. Zahrin Piliang dan Wakilnya Drs Asrul Kidam mengatakan hal itu dalam jumpa pers di Hotel Garuda Plaza Medan, Selasa (15/5). Kata Murlan Tamba, diskusi ketiga kalinya ini menghadirkan Ketua Mahkamah Konstitusi (MK) RI Prof DR Moh Mahfud MD SH, SU dengan topik Paradigma Sistem Presidensial dalam Ketatanegaraan Indonesia. Bertindak sebagai moderator Dr Faisal Akbar SH, MH, dosen hukum Tata Negara Fakultas Hukum USU. Diskusi juga dihadiri sekitar 300an peserta. Diskusi politik yang dinilai sangat penting itu merupakan rangkaian kegiatan MW KAHMI Sumut, sebagai bagian dari kontribusi para alumni HMI dalam memperkuat sistem ketatanegaraan RI, dimana salah satu pilarnya adalah sistem pemerintahan yang menganut azas Presidensial. Dirasakan akhir-akhir ini implementasi sistem Presidensial ini berjalan “agak tersendat” karena bangunan pemerintahan yang

dijalan-kan Presiden SBY didasarkan pada koalisi partai politik yang terkesan tidak efektif. Seakan ada rasa sungkan dari seorang Presiden SBY dalam penataan kepemerintahan di Kabinet Indonesia Bersatu II karena mempertimbangkan berbagai kepentingan partai politik yang tergabung dalam koalisi. “Kasus BBM bersubsidi merupakan salah satu keputusan politik yang sarat dengan agenda tertentu dari masing-masing partai politik koalisi,” tambah Zahrin Piliang. Diskusi politik Seri III sengaja menghadirkan Prof Mahfud MD, seorang ahli hukum tata negara yang juga alumni HMI lulusan Universitas Islam Indonesia (UII), pernah menjabat Menteri Pertahanan RI pada masa Kepresidenan Gus Dur, dan anggota DPR RI dari PKB sebelum akhirnya terpilih menjadi ketua MK. Murlan Tamba menyebutkan lagi, diskusi ini akan dihadiri oleh berbagai utusan Majelis Daerah KAHMI Se-Sumut, para alumni senior HMI, termasuk adik-adik para Pimpinan Cabang dan Komisariat HMI yang ada di sekitar Kota Medan. Karena itu, bagi para alumni HMI yang kebetulan belum mendapat undangan karena kendala teknik penyampaian, maka sisran pers ini merupakan undangan resmi bagi seluruh alumni HMI, dan adik-adik Pimpinan Cabang dan Komisariat HMI. “Majelis KAHMI Sumut mengharapkan kehadiran para alumni HMI tepat waktu sehingga diskusi dapat berjalan efektif dan hasilnya optimal,” kata Murlan Tamba.(m24)

Siswi SMP Diperkosa Ayah Tiri MEDAN (Waspada): Seorang siswi SMP diduga menjadi korban pemerkosaan selama empat tahun yang dilakukan ayah tirinya di kediaman mereka di Jalan Brigjen Katamso Gang Kopi, Lingk. X, Medan Kota, mengadu ke ke Polresta Medan, Selasa (15/5). Bahkan ibu korban yang pernah memergoki anaknya digauli pelaku tidak berani bertindak karena diancam akan dibunuh kalau melaporkan kasus ini. Informasi di Polresta Medan, peristiwa ini terjadi sekitar empat tahun lalu saat korban masih kelas 4 SD. Peristiwa berawal malam itu, pelaku A alias TP kecarian korban karena biasanya anaknya bermain PS di lantai II. Karena tidak melihat anaknya, pelaku mendatangi kamar korban. Dia melihat korban sedang tidur, pelaku yang tergiur dengan bentuk badan anak tirinya ini kemudian mencabulinya. Di kamar itulah, pelaku berulang kali mencabuli anaknya selama empat tahun. Bahkanibukorbanpunpernahmemergokinya.

Namun ibu korban, Syahrinah Daili, 36, tak bisa membela anak kandungnya karena diancam akan dibunuh pelaku kalau menceritakan kasus tersebut kepada orang lain. Karena sudah tidak tahan dengan tindakan suaminya, Syahrinah Daili kemudian menceritakannya kepada warga. Warga yang mendengar cerita itu kemudian mengajak korban dan ibunya membuat pengaduan ke Polresta Medan. Kanit Perlindungan Perempuan dan Anak (PPA) AKP Hariani yang dikonfirmasi Waspada mengatakan, ibu korban sejak kemarin Senin (14/5), mendatangi Polresta Medan didampingi warga. ”Dari semalam sampai saat ini, ibu korban belum mau membuat laporan polisi tentang kasus anaknya yang diperkosa ayah tirinya, dengan alasan nanti ibu korban tidak diberi nafkah lagi oleh pelaku,” katanya. Namun setelah dibujuk dan diberi pengertian, akhirnya ibu korban membuat pengaduan. “Ya setelah kita bujuk akhirnya mau membuat pengaduan. Setelah ini kita akan proses kasusnya,” jelas AKP Hariani. (m39)


Ragam

WASPADA Rabu 16 Mei 2012

A7

Balita Masuk Daftar Larangan Terbang AS INI adalah kisah tentang dampak peraturan berlebihan di pemerintahan Amerika Serikat terhadap orang-orang yang namanya berbau Arab dan Islam. Karena orientasi mereka langsung menyudutkan orang-orang tersebut sebagai teroris.

Kamera Termahal Di Dunia Produksi Tahun 1923

SEBUAH kamera produksi awal merk Leica belum lama ini mencatat rekor penjualan termahal di dunia dengan harga 2,16 juta euro atau sekira Rp22 miliar. Kamera tersebut merupakan satu dari hanya 25 model yang diproduksi pada tahun 1923 sebagai produk awal Leica A, yang merupakan kamera kecil pertama yang laris pertama dengan menggunakan film 35mm. Dijuluki jenis “null-serie” (0-Series), jenis ini hanya ada 12 unit yang masih tersisa di dunia. Identitas pembeli kamera ini masih misterius saat ia mendapatkan barang tersebut dalam sebuah penawaran di Galeri Westlicht, Vienna, Austria. Lelang pada Sabtu (12/5), dimulai dengan harga 300.000 euro, dengan target harga penjualan hanya 600.000 euro. Setelah penawaran berlangsung beberapa saat, harga kamera ini melonjak menjadi 1,8 juta euro. Penjualan kamera kuno dengan harga selangit itu menunjukkan ketertarikan yang meningkat akan produk fotografi awal. Rekor harga kamera tertinggi sebelumnya juga dipegang Leica 0-Series yang terjual dengan harga 1,32 juta euro pada tahun 2007. Saat dilelang ketika itu harga kamera awalnya cuma dibandrol 336.000 euro. Leica pertama kali didirikan tahun 1849, dengan pengkhususan pengembangan pada lensa dan mikroskop. Insinyur optik Oskar Barnack bekerja di divisi mikroskop, sekaligus ia juga merupakan seorang fotografer handal. Penyakit asma yang ia derita membuatnya kesulitan untuk membawa kamera konvensional yang besar. Karenanya, ia pun mendambakan jenis kamera ringan untuk dibawa ke mana-mana. Melihat potensi kamera film 35mm - format yang sama digunakan untuk industri perfeleman Hollywood - Barnack kemudian mendesain kamera Leica prototipe pertama antara tahun 1908-1923. Sejumlah hasil foto dari kamera yang ia kembangkan masih tersimpan hingga kini. Setelah membicarakan idenya dengan pimpinan di tempat ia bekerja, 25 kamera 0-Series kemudian diciptakan untuk uji coba internal. Meski produk baru ini mendapat sambutan berbeda di industri fotografi, perusahaan Leica mengambil spekulasi dengan memproduksi kamera tipe Leica A sebanyak 1,000 unit. Kamera yang terkenal dengan lensa lipatnya ini mulai dipasarkan tahun 1925. Tujuh tahun kemudian, tepatnya tahun 1932, sekira 90.000 kamera Leica digunakan secara luas di seluruh dunia. (bbc/rzl)

Adalah orangtua dari Riyanna, gadis kecil berusia 18 bulan (1,5 tahun) merasa ‘dipermalukan’ setelah mereka dikeluarkan dari pesawat dan diberitahu bahwa nama batita mereka masuk dalam daftar tidak boleh terbang. Setelah naik ke pesawat JetBlue di Ft. Lauderdale, orangtua Riyanna, yang meminta nama mereka tidak disebutkan karena khawatir terhadap dampak pemberitaan, diberitahu bahwa Badan Keamanan Transportasi (TSA) ingin mewawancarai bocah mereka. “Lalu saya mengatakan “Untuk apa?” cerita ibu Riyanna kepada televisi WPBF 25 News, salah satu jaringan ABC. “Dia mengatakan “Ini tidak ada kaitannya dengan Anda atau suami Anda. Tapi, putri Anda masuk daftar tidak boleh terbang.” Saya lalu berkata “Yang benar saja?” Siapapun yang patut disalahkan dalam kasus ini, kata orangtua Riyanna mereka meyakini insiden ini terjadi karena mereka berdua keturunan Timur Tengah dan karena ibu Ri-

RIYANNA, nama bocah menggemaskan ini masuk daftar tidak boleh terbang di AS. yanna mengenakan hijab, pakaian Muslimah. Satu polling Pew Research Center di tahun 2011 mendapati, Muslim Amerika mengatakan mereka diperlakukan secara tidak proporsional oleh petu-gas keamanan di bandara. Memang akhirnya, orangtua Riyanna dipersilahkan untuk naik ke pesawat. Tapi, mereka memutuskan untuk meninggalkan bandara. “Kami telah dipermalukan. Kami disudut-

kan,” kata ayah Riyanna kepada WPBF 25 News. Hebatnya, baik pihak pesawat JetBlue dan TSA mengaku tidak bertanggungjawab terhadap insiden itu. Kepada WPBF 25 News, TSA mengatakan karena kedua orangtua tersebut beserta putrinya diberi boarding pass, semestinya nama Riyanna tidak mungkin masuk daftar tidak boleh terbang. “TSA tidak mencantumkan nama anak ini dalam daftar tidak boleh terbang,” kata badan keamanan tersebut dalam satu pernyataan kepada Konstitusi Jurnal Atlanta.”TSA dipanggil pihak penerbangan dan setelah berbicara dengan orangtua anak tersebut dan memastikan lewat system pemeriksaan kami, TSA memastikan pihak penerbangan telah keliru mengira anak tersebut masuk dalam daftar pengawasan pemerintah.” JetBlue mengatakan kepada WPBF 25 News bahwa pihaknya dan TSA sedang menyelidiki insiden itu. Syafri/Yc

Larangan SMS Sambil Berjalan POLISI di kota Fort Lee, New Jersey, melarang orang mengirim pesan pendek melalui telepon (SMS) sambil berjalan. Siapapun yang ketahuan mengirim SMS sambil berjalan akan didenda karena “jaywalking”, istilah di Amerika Serikat untuk orang yang berjalan di jalanan dan bukan di trotoar. Langkah ini dilakukan demi keselamatan, kata polisi di Fort Lee. Lebih dari 20 pejalan kaki ditabrak mobil tahun ini. Dalam waktu enam minggu, 117 orang dikenai denda. “Sangat mengganggu

(mengirim SMS sambil jalan). Mereka tidak memperhatikan keamanan dan tidak menyadari hal itu,” kata Thomas Ripoli, kepala polisi Fort Lee. Salah Arah Sementara itu, dua profesor di satu universitas di New York melakukan penelitian tentang berjalan dan mengirim SMS. Wajah responden ditutup sehingga mereka hanya bisa melihat telepon genggam mereka dan kemudian mereka diminta untuk berjalan lurus. Hasil penelitian

menunjukkan para pejalan kaki memiliki peluang 60% salah jalan bila mereka berjalan sambil kirim SMS. Saat ini sudah ada aplikasi khusus yang memungkinkan orang berjalan dan mengirim SMS pada waktu yang bersamaan. Aplikasi itu menggunakan kamera di dalam telepon genggam untuk menunjuk arah jalan di layar. Namun penggunaannya sangat terbatas. Jadi untuk sementara ini, lebih baik jangan mengirim SMS sambil berjalan di Fort Lee. (bbc/rzl)

INILAH gedung tertinggi no 1 di dunia saat ini, Burj Khalifa di Dubai, Uni Emirat Arab.

Gedung Tertinggi Dunia BEBERAPA hal penting nasional akan lebih berarti bagi warga Amerika dibanding rampungnya pembangunan OneWorld Trade, gedung pusat untuk mengabadikan kenangn dan membangun kembali puing setelah serangan 11 September. Diakui sebagai gedung tertinggi di NewYork City sampai 30 April lalu, ketinggian OneWorld Trade akan mencapai 1.776 kaki dan menyentuh kaki langit Manhattan, memenuhi referensi tahun 1776, tahun ketika Deklarasi Kemerdekaan Amerika Serikat ditandatangani. Ketika konstruksi tersebut rampung pada tahun 2013 nanti, gedung tersebut akan dikenal sebagai gedung tertinggi ketiga di dunia dan tertinggi di belahan bumi bagian Barat. Namun sampai sekarang, record gedung tertinggi yang rampung dibangun di belahan barat masih dipegang Willis Tower di Chicago, demikian keterangan resmi dari Dewan Gedung Tinggi dan Habitat Urban, yang diukur dari level terendah gedung tersebut, sampai puncak menara, tapi tidak termasuk antena, tiang bendera atau peralatan teknik lainnya. Gedung Tertinggi Untuk 10 gedung tertinggi di atas muka bumi ini, Asia mengklaim seluruhnya (lima di antaranya di China), kecuali Willis Tower, gedung tertinggi kedelapan di dunia. Gedung tertinggi milik negara China adalah ShanghaiWorld Financial Center, yang menjulang di distrik Pudong Shanghai, China. Dirancang oleh perusahaan arsitektur Amerika Kohn Pedersen Fox, gedung itu menjulang sampai 1.614 kaki dan dijadikan sebagai tempat pusat

perbelanjaan, kantor, ruang konferensi, dan hotel. Park Hyatt Shanghai yang terdiri dari 174 ruangan, yang menduduki 35 lantai gedung itu, didapuk sebagai hotel tertinggi kedua di dunia. Dalam hitungan waktu Shanghai World Financial Center akan dibayang-bayangi gedung tertinggi lainnya. Shanghai Tower, yang saat ini tengah dibangun dan dijadwalkan rampung pada tahun 2014, akan menjadi gedung tertinggi kedua di dunia. Ketinggiannya akan mencapai 2.073 kaki. Rencana untuk membangun gedung yang lebih tinggi sedang berlanjut di Jeddah, Arab Saudi. Kingdom Tower telah diijinkan dibangun di tempat di mana seluruh kawasan Laut Merah akan terlihat jelas. Jika gedung ini selesai sesuai rancangannya, Kingdom Tower akan menjadi gedung tertinggi nomor 1 di dunia. Berikut lima gedung tertinggi di dunia saat ini: 1: Burj Khalifa, terletak di Dubai, Uni Emirat Arab, tingginya 2.717 kaki. Digunakan sebagai kantor, apartemen dan hotel. 2: Taipei 101, terletak di Taipei, Taiwan, tingginya 1.667 kaki. Digunakan sebagai kantor. 3: ShanghaiWorld Financial Center, terletak di Shanghai, China, tingginya 1.614 kaki. Digunakan sebagai hotel dan kantor. 4: International Commerce Centre, terletak di Hong Kong, China, tingginya 1.588 kaki. Digunakan sebagai hotel dan kantor. 5: Petronas Towers 1 and 2, terletak di Kuala Lumpur, Malaysia, tingginya 1.483 kaki. Digunakan sebagai kantor dan pusat perbelanjaan. Syafri/Yc

Gus: Generasi Emas Diawali Dari PAUD TELUKDALAM (Waspada): Program Pendidikan Anak Usia Dini (PAUD) merupakan kebijakan pemerintah yang menuntut keseriusan dalam pelaksanaannya. Karena PAUD berperan penting sebagai dasar untuk menyiapkan generasi emas, sebuah generasi berkualitas yang kelak diharapkan mampu bersaing dan berkontribusi memajukan daerahnya. Hal itu dikatakan Ketua KONI Sumatera Utara Gus Irawan Pasaribu dalam acara Pengarahan dan Penyerahan SPT PAUD Kabupaten Nias Selatan di Gereja BNKP Jemaat Yohannes Teluk Dalam, Senin (14/5) siang. Acara tersebut dibuka oleh Bupati Nias Selatan Idealisman Dachi dan dihadiri ratusan guru/ pendamping berserta tutor PAUD. Di desa-desa, kata Gus, banyak pasangan suamiistri yang mencari nafkah sehingga anak-anaknya yang masih usia dini tidak mendapat kesempatan pengasuhan dan bimbingan yang memungkinkan anak usia dini bisa tumbuh dan berkembang sesuai dengan usia dan potensinya. “Republiik ini memerlukan sumber daya manusia yang mampu mengelola sumber daya alam secara optimal, sehingga pendidikan sudah sepatutnya dipersiapkan sejak usia dini. PAUD berperan membantu Pemkab Nias Selatan untuk menyukseskan program pendidikan di desa-desa terpencil, sehingga kelak Nias Selatan memiliki putra-putra generasi masa depan yang dapat diandalkan membangun daerahnya,” ujar Gus Irawan yang juga Dirut Bank Sumut itu. Gus Irawan menekankan agar Pemkab Nias Selatan juga memberikan perhatian khusus dalam pengembangan keolahragaan sebagai bagian yang tak terpisahkan dari pendidikan anak-anak. “Kalau bicara kesehatan, sebuah riset menyebutkan, 1 dolar AS yang dialokasikan untuk olahraga akan menghemat 3,5 dolar AS untuk biaya kesehatan. Dengan terciptanya generasi yang sehat melalui olahraga diharapkan akan lahir pikiran-pikiran kreatif dan inovatif. SDM seperti ini yang diperlukan untuk membangu daerah,” tegasnya. Bupati Nias Selatan Idealisman Dachi mengatakan PAUD merupakan salah satu program prioritas di daerahnya karena Nias Selatan membutuhkan SDM-SDM andal yang harus dipersiapkan sejak usia dini. “Hasilnya tidak bisa kita lihat sekarang, karena mempersiapkan SDM unggul butuh proses dan perjalanan waktu yang panjang. Yang terpenting, pembekalan pendidikan dan pembentukan karekter itu sudah dimulai sejak usia dini,” pungkasnya. (m06)

GUS Irawan saat menjelaskan tentang PAUD di Telukdalam Nias Senin lalu. Menurut dia, PAUD merupakan bibit lahirnya generasi emas.

Waspada/Armin Nasution

GUS Irawan saat berbagai pengalaman dan memotivasi ibu-ibu di Kisaran dalam penyaluran kredit Sumut Sejahtera.

Waspada/Armin Nasution

Waspada/Armin Nasution

SEBAGIAN ibu-ibu yang menjual jamu dengan bersepeda. Mereka mengapresiasi kiprah Gus Irawan memberdayakan ekonomi rakyat.


Luar Negeri

A8

WASPADA Rabu 16 Mei 2012

Israel Dan Napi Palestina Capai Sepakat Hentikan Mogok Makan

Seputar ASEAN

JERUSALEM (AP): Ratusan tahanan Palestina setuju untuk menghentikan mogok makannya selama sepekan dengan tukaran janji pemberian kondisi yang lebih baik. Kesepakatan itu mengakhiri satu kebuntuan yang menyebabkan beberapa orang peserta berada dalam keadaan bahaya dan mengundang ribuan wargba Palestina turun ke jalan untuk menunjukkan solidaritas mereka. Para narapidana Palestina di penjara-penjara Israel itu telah melakukan mogok makan hampir sebulan dan diakhiri setelah tercapai kesepakatan yang ditengahi Mesir dengan Israel, di mana para tahanan Palestina akan menahan diri dari kegiatan teroris di dalam penjara. Dinas Penjara Israel (IPS) menegaskan Senin (14/5) bahwa kesepakatan itu akan mengakhiri aksi mogok makan massal meliputi lebih dari 1.600 tahanan yang dimulai pada 17 April. Komitmen narapidana untuk tidak terlibat dalam terorisme di dalam tembok penjara, sebagaimana pernyataan IPS, terjadi dalampertukaranbeberapahakistimewa yangtelahdiambilsebelum pertukaran tawanan prajurit Israel Gilad Shalit pada Oktober lalu. Israel,untuksebagian,telahsetujuuntukmengembalikantahanan di sel isolasi ke para tahanan lainnya, dan memungkinkan kunjungan keluarga narapidana yang tinggal di Gaza, mengakhiri penahanan administratif dan pengembalian ponsel dan televisi ke sel-sel mereka. Paratahananmogokmakansaatiniberadadibawahpengawasan medis untuk memastikan bahwa mereka tidak akan menderita ketika menyantap makanan lagi, kata pernyataan itu. Para pemimpin tahanan Palestina menandatangani perjanjian atas nama semua narapidana pelaku aksi mogok makan dari semua kelompok dan organisasi termasuk Jihad Islam dan Hamas.(m10)

4.000 Kobra Selundupan Disita Di Thailand Timurlaut BANGKOK (Antara/Xinhua-OANA): Polisi Thailand menyita sekitar 4.300 ular kobra dan 10.000 telur ular tersebut, 350 kadal air dan 35 penyu dari seorang penyelundup di provinsi timurlaut Khon Kaen. Tersangka berumur 55 tahun memarkir truk roda enam yang sarat dengan hewan selundupan di satu jalan pusat kota di Provinsi KhonKaenuntuktidursiangketikapolisibertindakuntukmemeriksa trukitu. Sopir truk yang ditangkap mengaku kepada polisi bahwa ia disewa untuk memberikan binatang-binatang itu kepada pelanggan di provinsi timurlaut Nong Khai. Polisi menuduhnya memiliki secara ilegal satwa-satwa liar dan bangkai mereka selain memperdagangkan satwa liar dan bangkai mereka tanpa izin, yang bertentangan dengan Pelestarian Margasatwa negara dan Undang-undang Perlindungan B.E. 2535.

Ketua Senat Optimis Sengketa China-Filipina Dapat Diselesaikan

Ron Paul Akhiri Perlombaan Menuju Gedung Putih WASHINGTON (Reuters): Bakal calon Presiden Amerika Serikat dari Partai Republik Ron Paul, akhirnya menyerah dalam perlombaan merebut kursi Presiden AS. Paul menegaskan, dia berhenti berkampanye di setiap negara bagian yang belum menggelar pemilu primary. “Kampanye kami akan terus berlanjut di Konvensi Partai Republik.Kamimencobauntukmemberikanpesankepadaparasimpatisan Partai Republik bahwa kebebasan adalah jalan menuju kemajuan,” ujar Paul Senin (14/5), dalam email yang dikirim ke para pendukungnya. PaulyangmerupakanrivalutamaMittRomneydiPartaiRepublik, mendesak para pendukungnya yang tak lain adalah kelompok libertarian republik agar aktif dalam politik. Paul juga masih ingin menyukseskan aspirasinya, meski harus mundur dalam pencalonan. Bakal capres AS tertua ini sempat unggul di Maine dan Nevada. Paul juga sempat meraih dukungan yang banyak di sejumlah distrik AS. Meski demikian, Paul dikabarkan hanya mengantongi 99 suara dari para delegasi, sementara itu Romney mendapatkan 949. Setiap bakal capres AS membutuhkan setidaknya 1.144 suara untuk tampil sebagai kandidat Presiden AS. Dalam kampanyenya, anggota Kongres AS dari Texas itu kerap mendesak agar Pemerintah AS menghapuskan Federal Reserve dan menghentikan penempatan pasukan AS di sejumlah wilayah. Banyak para pendukung Paul yang mengatakan, mereka tidak akan ikut dalam pilpres AS bila Paul tidak tampil sebagai seorang kandidat presiden yang akan bertarung melawan Barack Obama. Kakek berusia 76 tahun itu tampaknya juga tidak berniat untuk menambah masa jabatannya untuk yang kesekian kalinya, sebagai perwakilan dari Texas.(m10)

Sri Lanka Temukan Bom Yang Dapat Ledakkan Satu Kota KOLOMBO (Antara/AFP): Pasukan keamanan Sri Lanka menyatakan telah menemukan sejumlah besar senjata yang disembunyikan oleh separatis Macan Tamil sebelum mereka ditumpas tiga tahun lalu, termasuk bom yang cukup ‘untuk meledakkan satu kota.’ Polisi dan tentara menemukan 6.250 kilogram bom plastik yang dipendam di sebuah daerah hutan tempat gerilyawan Tamil melakukan perlawanan terakhir, kata juru bicara kepolisian Ajith Rohana. “Ini merupakan penemuan terbesar bom (yang pernah tercatat),” katanya Senin (14/5). “Bom-bom itu, yang dikemas dengan rapi dalam kantungkantung kecil, dipendam di dekat sebuah bunker yang digunakan oleh LTTE (Macan Pembebasan Tamil Eelam),” tambahnya. Gerilyawanmungkinmenyembunyikanbomituuntukdigunakan melawan pasukan pemerintah pada tahap-tahap akhir perang padaMei2009,kataRohana,denganmenambahkanbahwamungkin masih ada lagi yang disembunyikan di daerah itu. Seorang pejabat senior yang tidak bersedia disebutkan namanya mengatakan, persenjataan itu ditemukan setelah ada petunjuk dari warga sipil. “Jumlah bom ini cukup untuk meledakkan satu kota secara keseluruhan dan kami terkejut jumlah sebesar itu disimpan di satu tempat,” kata pejabat itu kepada AFP. PencariandilakukanMinggudikawasanhutanbakauNandikadal dimana pemimpin MacanTamilVelupillai Prabhakaran dilaporkan dibunuh oleh pasukan pemerintah pada 18 Mei 2009, dan di daerah berdekatan Puthukkudiriruppu, kata polisi. Penemuan itu mencakup amunisi untuk senapan serang otomatis, granat, bom mortir dan ranjau darat.- Pasukan Sri Lanka meluncurkan ofensif besar-besaran untuk menumpas kelompok pemberontak LTTE pada 2009 yang mengakhiri perang etnik hampir empat dasawarsa di negara tersebut.

Reuters

WARGA PALESTINA DITANGKAP ISRAEL. Seorang warga Palestina yang diduga melempari para petugas kepolisian Israel yang berpakaian sipil di Issawiyah, kawasan di seitar Jerusalem Timur, Selasa (15/5). Pasukan keamanan Israel berada dalam siaga tinggi karena kekerasan yang terjadi Selasa itu, hari ketika warga Palestina memperingati ‘Nakba’ atau bencana atsas pendirian Israel dalam perang tahun 1948, ketika ratusan ribu orang dipaksa meninggalkan rumah mereka.

Korsel Tolak Nuklir AS Dapat Timbulkan Dampak Buruk Bagi Usaha Perlucutan Senjata Korut SEOUL (Waspada): Kementerian Pertahanan Korea Selatan (Korsel) menilai, pengerahan senjata nuklir milik Amerika Serikat (AS) di Semenanjung Korea akan berdampak buruk terhadap upaya pelucutan senjata nuklir Korea Utara (Korut). “BilaASmengerahkansenjata nuklirnya di Semenanjung Korea, AS sama saja mengabaikan Deklarasi Bersama untuk Denuklirisasi Semenanjung Korea. Perjanjian itu sudah ditandatangani

olehduanegaraKoreasejak1991,” ujar militer Korsel, seperti dikutip Chosun Sinbo, Selasa (15/5). Korsel juga menilai, pengerahan senjata pemusnah masal itumerupakanlangkahyangtidak

realistis. Meski demikian, beberapa pensiunan jendral di Korsel menganggap,pengerahansenjata nuklir AS akan semakin memperkuat Korsel dalam menghadapi ancaman Korut. AS dan Korsel sepakat untuk meningkatkan strategi penangkalan serangan untuk menghadapi Korut, setelah AS menarik seluruh senjata nuklirnya di Korsel. Meski demikian, AS dikabarkan berniat untuk menga-

mandemen perjanjian itu dan senjata nuklir pun akan hadir kembali. Negeri Paman Sam itu juga berencana untuk menggunakan bom nuklir B61 yang dibawa oleh jettempurnyadiGuam,sertamisil Tomahawk yang ada di dalam kapal selam nuklirnya. Persenjataan-persenjataanitudinilaiamat sangatkuatdansangatberpotensi untuk menjadi senjata penghancur yang mematikan. (ok)

Penjara Rahasia Masih Terdapat Di Baghdad BAGHDAD (AP):Warga Irak masihditahansecaraillegaldisatu penjaraBaghdadyangseharusnya sudahditutuppemerintahditahun 2011setelahtuduhanmengatakan paratahanandisiksadandilecehkan di sana, kata Pengamat HAM (HRW) Selasa (15/5). Laporan dari kelompok HAMyangbermarkasdiNewYork itu mengungkap laporan terbaru tentang perlakuan pemerintah terhadap para tahanan setelah pihakberwenangIrakmengambil alih sisem penjara negara itu menyusul keluarnya pasukan AS Desember lalu. Kementrian HAM Irak membantah tuduhan HRW tersebut sebagai tidak akurat, dan mengatakan pusat tahanan tersebut dipertanyakan, dikenal sebagai bekas Camp Kehormatan yang didirikan militer AS, telah ditutup lebih dua tahun lalu.

Penjara itu terletak di dalam ZonaHijaudiBaghdadtengah,yang jugamenaungikantorpemerintah dankedutaanasing.LaporanHRW tersebut dibuat berdasarkan wawancaradengan35bekastahanan dan keluarga serta pengacara mereka,begitujugadenganpejabat pemerintahyangmenggambarkan interogasimasihberlanjutdiCamp Kehormatan. “Pasukan keamanan Irak menangkapi orang tanpa proses hukum, tanpa pengadilan atau tuduhan, dan menyembunyikan mereka di tempat-tempat rahasia,” kata Joe Stork,Wakil Direktur HRW di Timur Tengah. Dia meminta penguasa Irak segera mengumumkan namasemua tahanandandimanamerekaditahan, dan membebaskan mereka yang tidak didakwa secara resmi. Jubir Kementrian HAM Irak Kamil Amin mengatakan, Camp

Kehormatan ‘telah ditudup lebih dua tahun lalu’. “Semua tahanan sudah dipindah ke penjara lain,” kata Amin. “Kami yakin Camp Kehormatantidakdigunakanlagi.”

Dia membantah tuduhan pemerintah mengelola penjara rahasia, dan mengatakan semua penangkapan dan penahanan dilakukan sesuai standar hukum.(m23)

Iran Eksekusi Mati Otak Pembunuhan Ilmuwan Nuklir TEHERAN, Iran (Antara News): Iran pada Selasa (15/5) menghukum gantung seorang pria yang didakwa berperan penting dalam pembunuhan seorang ilmuwan nuklir ternama pada 2010, demikian pernyataan dari kantor kejaksaan Teheran. “Majid Jamali Fashi, seorang mata-mata Mossad dan pembunuh ilmuwan nuklir kami Masoud Ali Mohammadi, sudah digantung pada Selasa pagi,” kata pernyataan yang dikutip Kantor Berita IRNA. Media setempat 28 Agustus 2011 melaporkan bahwa Jamali Fashi dijatuhi hukuman mati setelah dinyatakan bersalah karena melawan Tuhan dengan menempatkan sepeda bermuatan bom dan meledakkannya di depan rumah Prof Ali Mohammadi. Profesor Ali Mohammadi adalah seorang ahli fisika partikel di UniversitasTeheran yang tewas dalam serangan bom di luar rumahnya pada Januari 2010. Jamali Fashi juga dituduh bekerja sama dengan agen mata-mata Israel dan telah menerima 120.000 dolar AS (Rp1,1 miliar) untuk menyampaikan misi inteligen kepada Mossad.

MANILA (Antara/PNA-OANA): Ketua Senat Filipina Juan Ponce Enrile Selasa (15/5) menyatakan optimisme bahwa Filipina dan China akan segera dapat menyelesaikan sengketa Beting Panatag (Scarborough). “Iniakansegerateratasi.Tidakadasengketaantarakeduanegara tanpa dapat diselesaikan di dunia ini. Perang Amerika dan Jepang sajadapatdiselesaikandansekarangmerekasalingbantu,”kataEnrile. Presiden Senat juga percaya bahwa pembatalan penerbangan wisatawan China ke Filipina akan berpengaruh sementara bagi industri pariwisata. “Masalah (pembatalan) itu akan dapat segera diselesaikan. Kami memiliki sumber-sumber wisatawan. Kami harus mengembangkan pasar ke India dan Rusia,” kata Enrile. Anggota parlemen veteran itu mengatakan, bahkan keputusan China untuk menghentikan impor pisang dari Filipina tidak akan menciptakan masalah besar.“Mereka (China) juga akan memiliki masalah karena negara kita adalah sumber impor logam mereka, impor mineral, dan magnetit,” kata Enrile. Enrile mengatakan keputusan China melarang penangkapan ikan di sekitar Beting Panatag atau Scaraborough akan mempengaruhi tidak hanya Filipina tetapi negara-negara Asia Tenggara seperti Indonesia, Malaysia dan Vietnam.

Myanmar Berjanji Patuhi Resolusi PBB Soal Korut SEOUL (Antara/AFP): Myanmar berjanji akan mematuhi Resolusi PBB yang menargetkan program senjata Korea Utara (Korut), kata seorang pejabat Seoul Selasa (15/5), menyusul kecurigaan kerja sama militer dalam beberapa tahun terakhir. JurubicarakepresidenanSeoulmengatakanitusetelahpertemuan puncak dengan negara AsiaTenggara antara Presiden Korea Selatan (Korsel) Lee Myung-Bak dan Presiden Myanmar Thein Sein. Myanmar juga telah sepakat untuk membebaskan seorang pengungsiKorutyangmenjalanihukumanpenjaralimatahunsejak 2010karenasecarailegalmemasukinegaraitu,katajurubicaratersebut. Lee adalah pemimpin Korsel pertama yang mengunjungi negara yang dulu dikenal sebagai Burma sejak pendahulunya hampir lolos dari upaya pembunuhan Korut pada tahun 1983. Sebuah bom yang ditanam oleh agen Pyongyang gagal menewaskan presiden Chun Doo-Hwan tetapi menewaskan 17 warga Korsel serta empat penduduk setempat. Myanmar dengan marah memutuskan hubungan dengan Korut setelah kejadian itu, tetapi kemudian mereka pulihkan pada tahun 2007. Laporan kerja sama militer sejak itu telah menjadi penyebab kepedulian terhadap Seoul di masa lalu. TheinSein,SeninmembantahkerjasamanuklirdenganPyongyang, dan mengatakan negaranya akan mematuhi resolusi-resolusi Dewan Keamanan PBB tentang program peluru kendali dan nuklir Korut, kata jurubicara Seoul kepada AFP melalui telefon. Resolusi jugamelarangeksporsenjataolehKorut.PemimpinMyanmarsebelumnya membantah kerja sama nuklir dengan Korut.

Bom Ditemukan Di Pesawat Di Bandara Irlandia Utara ENNISKILLEN (Antara/AFP): Sebuah bahan peledak yang ditemukan di pesawat kecil di bandara di Irlandia Utara telah disingkirkan oleh para pakar penjinak bom militer, kata polisi Selasa (15/5). Bom itu ditemukan di pesawat terdaftar milik Inggris di bandara St Angelo dekat Enniskillen, kota Fermanagh. Polisi mengatakan mereka dipanggil ke bandara wilayah tak lama setelah pukul 20.00 waktu setempat pada Senin dan kemudian menutup jalan utama Enniskillen ke Kesh. Polisi tidak memberikan penjelasan mengenai jenis alat peledak yang ditemukan. Kerusuhan sporadis dan ancaman-ancaman bom terus terjadi di provinsi ini meskipun perjanjian perdamaian 1998 sebagian besar mengakhiri berbagai masalah, kekerasan sektarian tiga dekade antara Protestan dan Katolik yang menewaskan lebih dari 3.000 orang.

Hollande Dilantik Jadi Presiden Prancis

Reuters

UNJUKRASA DI YUNANI. Polisi menangkap seorang pemrotes rasa anti-penghematan selama operasi untuk menghapus sekelompok kecil demonstran Eropa dari Lapangan Syntagma di Athena Pusat, Yunani, Selasa (15/5). Kemarahan terhadap penghematan telah menyebar di seluruh Eropa dan polisiYunani menahan sekitar 10 aktivis anti-penghematan dari Prancis dan negara Eropa lainnya Selasa, yang malam sebelumnya tidur di alun-alun Athena di depan parlemen.

PARIS (AP): Francois Hollandedisumpahsebagaipresiden baru Prancis Selasa (15/5). menjadi pemimpin pertama negeri itu dari Sosialis dalam 17 tahun terakhir. Hollande, 57, mengambil alih kekuasaan setelah pembacaan resmi hasil-hasil dari pemilihan 6 Mei lalu yang memperlihatkan dia mengalahkan tokoh sayap kanan Nicolas Sarkozy dengan 51,6 persen suara. Hollande merupakan salah satu dari dua pemimpin Sosialis yang menjadi presiden Prancis modern setelah masa jabatan Francois Mitterrand pada 19811995 dan berhasil terpilih jadi presiden pada saat berkembang sentimen sayap kiri di tengah krisis utang Eropa dan protes antipasar bebas di seluruh dunia. Hollande terpilih untuk masa bhakti lima tahun awal bulan ini setelah para pemilih menggulingkan Nicolas Sarkozy setelah menduduki Istana Elysee satu priode. Para pemilih kecewa dengan cara penanganan ekonomi Prancis oleh Sarkozy — dengan tingginya pengangguran dan rendahnya pertumbuhan ekonomi. Hollande berencana berangkat tidak lama setelah pelantikannya untuk melakukan misi diplomatik pertamanya — ke Berlin, di mana dia bertemu dengan Kanselir Jerman Angela Merkel untuk melakukan pertemuan penting membahas pertumbuhan di Eropa.

Hollande dinyatakan sebagai presidensetelahkepalapengadilan konstitusionalmembacakanhasil pemilihan umum 6 Mei lalu. Dalam pidato pertamanya sebagai presiden, Hollande menjanjikan untuk memerangi spekulasi keuangan dan ‘membuka satu jalur baru’ di Eropa. Pasar dunia, para pemimpin Eropa lainnya dan masyarakat Prancis akan menyaksikan dengan seksama bagaimana dan apakah Hollande mengikuti janjijanjidalamkampanyenya,seperti menyerukan dilakukannya perundingan ulang perjanjian pengurangan anggaran, pembekuan harga bahan bakar dan peningkatan pajak bagi orang kaya. Sarkozy menyambut Hollande di halaman istana presiden dan setelah berjabat tangan keduanya melakukan pertemuan pribadidimanaserahterimakode nuklir Prancisituharusdilakukan. Upacara itu sendiri relatif sederhana, tanpa kepala negara lain diundang dan Hollande hanya disertai pasangannya, wartawati Valerie Trierweiler. Setelah itu, Hollande dibawa naik mobil Citroen DS5 hibrida beratap terbuka dari Champs Elysees ke Arc de Triomphe, sambil melambailambaikan tangan kepada kerumunan warga. Dalam upacara terpisah, dia akan memberikan penghormatankepadapembaharuJulesFerry tokoh pendidikan abad ke-19 — bapak sistem pendidikan bebas dan sekuler Prancis — dan Marie

Curie, pemenang Hadiah Nobel kimia. Pukul 14:00 GMT Hollande terbang ke Berlin, di mana dia menghadapi ketidakpastian penerimaanKanselirAngelaMerkel.

Hollande telah bersumpah untuk kembali fokus pada kebijakan ekonomi Eropa mengenai pertumbuhandenganmembuka kembali perundingan tentang pakta fiskal yang disetujui Maret

lalu yang bertujuan untuk mengontrol hutang Eropa dengan menerapkan disiplin anggaran yang lebih besar. Kesepakatan itu adalah gagasan Merkel dan dia telah berulang

kali menegaskan sejak di pemilu bahwa perjanjian, yang ditandatangani oleh 25 dari 27 negara Uni Eropa dan sudah diratifikasi oleh sebagiannya, tidak terbuka untuk perundingan ulang. (m10)

The Associated Press

FRANCOIS Hollande dianugerahi Grand Maitre dari Legiun Kehormatan, dari kanselir Order Legiun Kehormatan, Jenderal JeanLouis Georgelin, ketika dia secara resmi ditunjuk sebagai presiden Prancis dalam satu upacara di Istana Presiden Elysee di Paris, Selasa (15/5).


Sport

WASPADA Rabu 16 Mei 2012

A9

Trio Bek Absen Hari Kedua Zulkarnaen Dan Denny Rumba Pulih MEDAN (Waspada): Tiga pemain belakang PSMS Medan absen mengikuti latihan hari kedua Ayam Kinantan di Stadion Kebun Bunga Medan, Selasa (15/5). Ketiga pemain yang absen dalam lanjutan persiapan kompetisi Indonesian Super League (ISL) itu adalah Sasa Zecevic, Wawan Widiantoro, dan Ledi Utomo. Di lain pihak, Zulkarnaen dan Denny Rumba yang sebelumnya mengalami cedera justru sudah ikut berlatihan bersama 16 pemain lainnya. Kehadiran dua pilar PSMS itu pun membuat suasana latihan makin marak di bawah pimpinan Suharto AD dan Sugiar. Menanggapi absennya Wa-

wan dan Ledi Utomo, Suharto mengaku keduanya masih menjalani perawatan di tempat tinggal mereka di Pulau Jawa dan sama-sama telah mendapat izin belum bergabung dengan tim. Begitu halnya dengan Sasa yang tetap berada di mes pemain di Stadion Kebun Bunga. Palang pintu asal Serbia ini tidak ikut latihan karena menjalani terapi atas cedera kakinya. Pelatih Kiper PSMS, Sugiar, pun mengungkapkan tidak ada masalah lain dengan absennya

ketiga pemain tersebut. Dalam latihan hari kedua, Suharto memulai menerapkan strategi yang akan diperagakan skuadnya saat menjamu Persela Lamongan di Stadion Teladan pada 20 Mei dan Arema Malang pada 26 Mei mendatang. Suharto sendiri sangat gembira dengan kembali pulihnya Zulkarnaen dan Denny Rumba. Menanggapi absennya Wawan, Ledi, dan Sasa dalam dua sesi latihan tim, Suharto mengaku tidak resah dan lebih fokus melatih stok pemain yang ada. Kendati begitu, mantan striker PSMS itu yakin Sasa cs sudah bisa merumput pada hari H menghadapi Persela nanti. Latihan kedua pun masih difokuskan pada kebugaran Novi Han-

driawan cs. “Pada Rabu (16/5) ini, kami akan latihan penuh. Jadi pemain yang belum hadir ikut berlatih diharapkannya tetap menjaga kondisi, agar tidak ketinggalan dari pemain lain dan dapat langsung mengikuti program yang telah disiapkan,” ketus Suharto. (m17) PULIHNYA Zulkarnaen (11) menambah marak latihan persiapan PSMS Medan di Stadion Kebun Bunga, Selasa (15/5). -Waspada/Austin Antariksa-

Aliya Bangga Ukir Prestasi Kejurnas DI balik wajahnya yang kalem, Aliya Sabrina (foto), ternyata begitu menyukai olahraga karate yang dikenal keras dengan mengandalkan kekuatan fisik, mental, dan teknik. Gadis cilik ini bahkan sudah mampu mengukir prestasi di kejuaraan nasional. Ya, berkat kegigihannya dalam berlatih di Perguruan Inkanas Sumut, siswa SD Muhammadiyah 18, Jl Pelita II Medan itu sukses meraih

Waspada/ist

PENGURUS dan sejumlah siswa SSB PTPN III Kisaran United diabadikan bersama di Balai Karyawan PTPN III Kebun Sei Dadap, Kisaran, baru-baru ini.

Ingin Lahirkan Pemain Andal SSB PTPN III Diresmikan KISARAN (Waspada): Jumlah Sekolah Sepakbola (SSB) di Kabupaten Asahan kembali bertambah. Itu setelah diresmikannya SSB PTPN III Kisaran United yang siap membina talenta sepakbola muda di daerah itu. Meski peresmian SSB itu belum genap satu pekan, tetapi Kisaran United sudah memiliki sedikitnya 70 siswa. Mereka terdiri atas beberapa kelompok umur mulai U-10, U-12, U-14, U-16, hingga U-18. Di bawah asuhan mantan pelatih PS Madina, Sukimin, SSB PTPN III menggelar latihan rutin mulai Senin hingga Sabtu di Lapangan Kebun Sei Dadap PTPN III Kisaran. Untuk hari Minggu,

akan dimanfaatkan untuk menggelar laga ujicoba. “Tekad kami adalah melahirkan pesepakbola andal lewat pembinaan pemain muda yang berjenjang dan berkesinambungan. Hal ini memang tidak mudah, tetapi dengan semangat seluruh pengurus dan pelatih, kami yakin hal itu akan terwujud,” ujar Ketua Umum SSB PTPN III Kisaran United, Ir Yufti Rizal Nasution QIA, Selasa (15/5). Dikatakan, SSB PTPN III Kisaran United telah diresmikan di Balai Karyawan PTPN III Kebun Sei Dadap yang dihadiri langsung oleh Dewan Pembina, Ir Sumardi MM, Jumat (11/5) lalu. Acara peresmian berlang-

sung sederhana sebagai sarana menyatukan tekad seluruh pengurus untuk melakukan pembinaan secara serius dan profesional. Berikut nama pengurus SSB PTPN III Kisaran United: Ir Yufti Rizal Nasution QIA (Ketum) Abd Hafiz Hasibuan, Drs Marihot MM, Bambang Sugianto (Wakil Ketua), Mukhrin (Sekretaris), Elisabeth Taka Dewa (Bendahara), dan pengurus lainnya Elfi Darwis, Hermawan, Syahrial, Asmaria Nst, Imam Rohadji, Selamat Sembiring, Magin Fralaya, Edy Sulastono, Junaidi,SH, Surya, Hariono, M Yusuf Nst, Sastra Syahputra, Dahri Efendi Sitorus, M Syafii, Zefriansyah, dan Misnan. (a31)

PB Laras Dominasi Bupati Simalungun Cup P. SIANTAR (Waspada): PB Laras berhasil mendominasi perolehan medali pada kejuaraan bulutangkis Bupati Simalungun Cup di Lapangan PB Mawar, Jl Tuan Maja Purba, Senin (14/5) malam. Ketua Panitia, Mayor Caj Drs Prinaldi, mengatakan kejuaraan itu merupakan salah satu program kerja PBSI Simalungun Bidang Pembinaan Atlet di tahun 2012. Dalam hal ini, PBSI Simalungun sekaligus melakukan penjaringan pemain berbakat untuk dibina lebih intensif. “Mereka yang terjaring nantinya akan dipersiapkan mengikuti event-event di tingkat provinsi Sumut, maupun event nasional. Dengan demikian, kita berharap ke depan prestasi bulutangkis Simalungun lebih maju,” ujar Prinaldi. PB Laras mendominasi kejuaraan setelah merebut lima medali emas, masing-masing dipersembahkan Putri Garin Nugroho (tunggal remaja putra), Annisa Chairani (tunggal remaja putri), Annisa Chairani/Reni Andini (ganda taruna putri), Marizal (tunggal dewasa putra),

Waspada/Edoard Sinaga

dan Junita dan Sriwahyuni (ganda dewasa putri). Prestasi PB Laras diikuti PB Medic yang juga meraih lima mendali emas lewat Rendra (tunggal anak putra), Rabdhy Setiawan (tunggal pemula putra), M Yusuf (tunggal taruna putra), Ismail/Mahyudi (ganda dewasa putra), dan satu medali ganda veteran putra. Begitu

7

6

5

4

3

2

1 E

F

G

MEDAN (Waspada): Seri I Kejurda IMI Sumut Road Race 2012 merupakan balapan terbesar di Sumatera Utara dan Indonesia, karena memperlombakan 16 kelas. Event di Sirkuit Multifungsi IMI Sumut Jl. Pancing Medan, 19-20 Mei itu memperebutkan Piala Ketua MPW PP Sumut, Piala Ketua IMI Sumut dan Piala Ketua MPC PP Deli Serdang. Ketua Panpel Syahrul Lubis di Medan, Selasa (15/5) mengatakan, Kejurda IMI Sumut Road Race 2012 bahkan bisa jadi yang terbesar di Tanah Air. “Baru kali ini event balapan di Sumatera Utara yang memperlombakan 16 kelas,” ujarnya. Pihaknya pun menargetkan 200 starter, termasuk para racer ternama di Sumut. Balapan bakal seru, karena juga diramaikan lucky draw yang menyediakan berbagai hadiah menarik. Terpisah, Ketua MPC PP Deli Serdang, Dani Ginting mengatakan, kejurda digelar untuk mengurangi aksi balapan liar di jalan raya. “Sebab, balapan ini merupakan salah satu cara untuk mengurangi aksi balapan liar di jalan raya,” tandasnya. Kelas yang diperlombakan, Bebek 4 tak 110cc Tune-Up Terbuka (MP1), Bebek 4 Tak 125cc Tune-Up terbuka (MP2), Bebek 4 Tak TU 110cc Tune-Up Pemula (MP3), Bebek 4 Tak 125cc Tune-Up Pemula (MP4), Bebek 4 Tak 110cc Standar Pemula (MP5), Bebek 4 Tak Skubek Matic 125-150cc Bore-up Terbuka, Bebek 4 Tak 110cc Standar Pemula Murni, dan kelas Bebek 4 Tak 125cc Standar Pemula Murni. Juga Bebek 4 Tak OMR Honda 110cc TU Pemula, Bebek 4 Tak OMR Honda 125cc TU Pemula, Bebek 4 Tak OMR Honda Blade 110cc Standar Terbuka, Bebek 4 Tak OMR Yamaha 110cc Standar Pemula, Bebek 4 Tak OMR Yamaha 125cc Standar Pemula, Bebek 4 Tak OMR Yamaha Jupiter MX 135 Standar Pemula, Bebek 4 Tak OMR Suzuki Satria FU 150cc Standar Pemula, serta kelas Bebek 4 Tak OMR Suzuki Skubek Matic 125-150cc Bore-Up Pemula. (m47)

Dok.Waspada

Gus Minta Nisel Lahirkan Atlet Top TELUK DALAM (Waspada): Ketua Umum KONI Sumatera Utara, H Gus Irawan Pasaribu, meminta pengurus KONI Nias Selatan di bawah kepemimpinan Aris Agustus Dachi agar mampu melahirkan atlet kelas dunia. “Harus diakui melahirkan seorang atlet berprestasi tidak semudah membalikkan telapak tangan, namun harus dengan ketekunan, kesabaran, disiplin, dan keseriusan. Tentunya hal itu akan terwujud,” ungkap Gus Irawan saat melantik pengurus KONI Nias Selatan periode 20112015 di Wisma Yonas, Teluk Dalam, Nias Selatan, Senin (14/5). Turut hadir Ketua Harian KONI Sumut Jhon Ismadi Lubis, Wakil Ketua II Prof Dr Agung Sunarno, Sekretaris Umum Chairul Azmi, dan unsur pengurus lainnya. Menurut Gus, Nias Selatan memiliki potensi besar dalam melahirkan atlet. Potensi alam berlimpah seperti ombak Pantai Sorake dan Lagundri, serta suasana alam yang mendukung dan besarnya minat masyarakat tentunya akan membantu lahirnya atlet berprestasi. Artinya, potensi ini harus mampu digali

pengurus KONI Nisel. Ketua KONI Nias Selatan, Aris Agustus Dachi, meminta Pemkab Nias Selatan untuk dapat membangun sarana olahraga yang representatif bagi kegiatan olahraga di daerah tersebut. Pasalnya, Nisel belum memiliki sarana olahraga yang memadai untuk ikut berperan menjaring minat anak-anak muda menjadi atlet. Wakil Bupati Nisel, Drs Huku’asa Ndruru, pun mendukung keinginan pembangunan sarana olahraga tersebut. Selain meminta pembangunan sarana, pengurus KONI Nisel diharapkannya dapat kreatif dan inovatif untuk membangun dunia olahraga setempat. Aris Agustus akan dibantu Ismael Danchi SE (Ketua Harian), Yulius Dakhi (Sekretaris), dan Risni Susanti Zagoto (Bendahara) serta pengurus bidang lainnya. Sebelumnya, pelantikan pengurus dimeriahkan laga eksibisi futsal antara KONI Sumut dan KONI Nisel. Laga tersebut dimenangi KONI Sumut 189. Sebelas gol tim tamu dilesakkan Gus Irawan Pasaribu, sedangkan Ketua Harian Jhon Ismadi Lubis mencetak hatrik. (m14)

H

Waspada/ist

BUPATI Batubara H OK Arya Zulkarnain SH MM, Ketua DPRD Batubara, dan Kadisparpora Batubara H Helman Herdady SH MAP foto bersama juara II LPI Batubara yang disandang SMPN 1 Lima Puluh baru-baru ini.

Bupati Batubara Harap Tingkatkan Prestasi MEDAN (Waspada): Prestasi yang sudah diukir para atlet Batubara dewasa ini diharapkan menjadi acuan untuk lebih maju ke depan. Namun untuk menggapainya, perlu kerja keras dan kedisiplinan serta tidak cepat berpuas diri terhadap kesuksesannya. Demikian Bupati Batubara, H OK Arya Zulkarnain SH MM, didampingi Kadisbudparpora Batubara, H Helman Herdady SH MAP, saat menutup Pekan Olahraga Pelajar Daerah (Popda) Batubara baru-baru ini. “Selain prestasi, olahraga juga bisa membuahkan generasi yang sehat dan sportif,” ujar OK Arya seraya mengajak para anak didik untuk berjuang dan mengharumkan nama daerah dalam pada Popdasu yang akan digelar di Mandailing Natal (Madina) dalam waktu dekat. Helman Herdady bertekad meningkatkan prestasi olahraga di Batubara. Untuk itu dia meminta peran aktif semua pihak seperti pengurus cabang olahraga dan masyarakat. “Karena tanpa itu harapan-harapan yang

KESEHATAN/NAMA RS MENDATAR

Jawaban di halaman A2

D

pun, gelar juara umum tetap menjadi milik PB Laras yang unggul perolehan medali perak dan perunggu. Medali emas tersisa direbut Ahmad Fauzul (ganda remaja putra/PB Morida), Habibi Insani/Nurzikri Azhari (ganda taruna putra/PB Morida), dan Reza Juwita (tunggal dewasa putri/PB Fashira). (a30/a29)

TTS TOPIK

8

C

MEDAN (Waspada): Babak kualifikasi Nike The Chance 2012 sudah berakhir di tiga kota, yakni Surabaya, Medan, dan Jakarta. Dengan demikian, panelis Nike The Chance sudah mengantongi 50 nama dari ketiga kota dan akan dijaring 30 nama ke babak semifinal. Babak kualifikasi di Jakarta diikuti 1150 peserta yang merupakan terbanyak dari kota Surabaya (700-an), dan Medan (600-an). Bahkan, kualifikasi Jakarta menjaring 20 pemain atau lebih banyak dibanding dari Surabaya dan Medan yang masing-masing hanya 15 pemain. Panelis Pelatih yang dipimpin Widodo C Putro dalam siaran pers, Selasa (15/5), menyebutkan materi pelatihan dan penjaringan pada babak kualifikasi tidak ada yang berbeda dari ketiga kota. Peserta diuji dengan sistem pertandingan 7 lawan 7 dalam waktu 2x10 menit. Peserta yang dinilai berbakat, akan diberi kartu merah yang berarti dapat meneruskan seleksi di hari berikutnya, yaitu tahap kedua kemampuan sepakbola secara lebih detail seperti kontrol, kecepatan, sentuhan, dan akurasi. “Dari 50 pemain yang ada, kami akan menjaring 30 anak yang benar-benar memiliki talenta di atas rata-rata sebagai semifinalis. Mereka nantinya akan mengikuti seleksi akhir Indonesia pada 24-25 Mei nanti,” ujar Widodo. Tahun ini, Indonesia mendapat kesempatan emas menjadi tuan rumah final The Chance se-Asia Tenggara di Jakarta, 1013 Juni mendatang. Ke-15 pemain asal Medan yang lolos adalah Agung Surya, Apri Yono, Adri Permana, Daniel Surung, Jefri Hasan, Ilham Syahputra, Leo Guntara, Moh Hardianto, M Ridwan, M Juanda, Madya Siregar, Rekaa Yogatama, Tomi Habibi, Teguh Maulana, dan Zulfikar Lubis. (m18)

mendapat apresiasi Kepala SD Muhammadiyah 18 Medan, Syamsul Hidayat SPd. Menurutnya, prestasi yang diraih Aliya di ajang Kejurnas Inkanas membuat bangga pihak sekolah. “Prestasi Aliya menjadi kebanggaan tersendiri bagi pihak sekolah dan teman-teman Aliya. Kami memang selalu memberi dukungan penuh terhadap pengembangan bakat siswa, khususnya di bidang olahraga,” ucap Syamsul. (m37)

Balapan Terbesar

KONTINGEN atlet PB Laras diabadikan bersama Plt Sekda Simalungun, Gideon Purba (kaus liris), saat penutupan kejuaraan, Senin (14/5) malam.

Putih melangkah, mematikan lawannya lima langkah.

B

15 Pemain Medan Lolos The Chance

orangtuanya. Termasuk pihak sekolah yang selalu memberikan izin saat dirinya harus tidak masuk sekolah karena mengikuti kejuaraan. “Saya sangat bersyukur dengan perhatian yang diberikan sekolah. Hal itulah yang menambah motivasi saya untuk terus meningkatkan prestasi, termasuk mewujudkan cita-cita menjadi karateka nasional,” pungkas Aliya. Prestasi yang diukir Aliya

IMI Sumut Road Race 2012

Problem Catur

A

medali perunggu nomor kumite (ta-rung) kelas 25 Kg di Kejurnas Institut Karatedo IV/2012 di Bandung, April lalu. “Bisa dipercaya tampil di ajang Kejurna saja sudah bangga sekali, apalagi meraih medali. Walau cuma perunggu, setidaknya itu menjadi prestasi awal aku di ajang Kejurnas,” ucap Aliya di sekolahnya, Selasa (15/5). Dalam menggeluti olahraga karate, Aliya mengaku mendapat dukungan penuh dari kedua

1. Nama rumah sakit (RS) milik keluarga Arbie di Jl SM Raja No.7, Medan (dua kata, tulis tanpa spasi). 6. Nama RS milik keluarga Purba di Jl Kapten Muslim 79, Medan (dua kata tanpa spasi). 8. Nama universitas di Medan (singkatan) yang memiliki RS di Jl Dr. Mansur. 9. Singkatan Rumah Sakit Umum Cut Meutia (di Aceh Utara). 12. Nama RS milik keluarga TD Pardede di Jl. Majapahit 118A, Medan. 13. Nama mantan wakil presiden jadi nama RS pemerintah di Jl Bunga Lau 17, Medan (dua kata tanpa spasi). 16. Nama laksamana wanita Aceh; Nama RS Islam di Jl. Diponegoro 2-4, Medan. 18. Singkatan Rumah Sakit Umum Zainul Abidin (di Banda Aceh). 23. Nama RSUP di Jl. Prof HM Yamin 47, Medan. 25. Nama RS di Medan yang sama dengan nama jalannya (huruf RS, singkatan Rumah Sakit sudah ditulis). 26. Santa_____, nama RS tua di Jl Misbah 7, Medan.

MENURUN

1. Singkatan Palang Merah Indonesia. 2. Nama RS di Jl Teuku Umar 9-11, Medan. 3. Cairan bening dibutuhkan ginjal. 4. Denyut. 5. Berhubungan dengan organ pendengaran di telinga. 6. Nama RS di Jl Djamin Gintings 2, Medan; Nama istri nabi Ibrahim yang melahirkan Ismail (dua kata tanpa spasi). 7. Tumor jinak pada dinding rahim. 10. Rubeola; Penyakit menular menimbulkan bintik-bintik merah pada kulit. 11. Kejang otot. 14. Tes identifikasi keturunan (singkatan deoxyribonucleic acid). 15. Obat suntik penderita diabetes. 17. Singkatan Infeksi Saluran Pernafasan Akut. 19. Nama RS di Jl Baja Raya 8-10, Medan; Nama istri nabi Ibrahim yang melahirkan Ishak. 20. Berkaitan dengan anus atau dubur. 21. Penyebab luka bakar. 22. Luka pada kulit yang sangat dangkal dan mengeluarkan serum. 24. Bahan pemanis: Diabetes atau sakit____.

diinginkan bersama takkan bisa tergapai,” kata Helman didampingi Kabid Olahraga Batubara, Ilyas SPd, Selasa (15/5). Menurut Helman, secara umum perolehan medali pada Popda Batubara merata diraih setiap sekolah. Ilyas menambahkan posisi empat besar perolehan medali diduduki SMPN 2 Tj Tiram (4 emas, 3 perak 1 perunggu) diikuti SMK Amir Hamzah (3-2-5), SMAN 1 Sei Suka (3-0-1), dan MAN Lima Puluh (1-7-6). Disebutkan, juara I-IV LPI Batubara tingkat SLTP masing-masing SMPN 1 Sei Suka, SMPN 1 Lima Puluh, SMPN 1 Air Putih, dan SMP IT Al Ihya Tanjung Gading. Juara I-IV tingkat SLTA direbut MAN 1 Lima Puluh, SMAN 1 Lima Puluh, SMK Budi Dharma, dan SMK Amir Hamzah. “Top skor SLTP direbut M Rizki dari MTS Negeri Lima Puluh, sedangkan gelar SLTA digondol Mazhari Simanjuntak dari SMAN 1 Lima Puluh yang masing-masing memasukkan 19 gol,” tambah Ilyas. (m42/rel)

Sudoku Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tingkat kesulitan: sedang (***), bisa diselesaikan kurang dari sepuluh menit. Jawaban di halaman A2 kolom 1.

3

2

6 1 7

4

1 1 3 5

9

4 6 9 6 7 8 9 3 5 9 7 2 5 1 6 7 7 8 2 3 6 3 9 ***432


Sport

A10

WASPADA Rabu 16 Mei 2012

Portugal Peserta Pertama LISBON (Waspada): Portugal menjadi peserta pertama Euro 2012, yang mengumumkan skuad lengkapnya untuk turnamen empat tahunan tersebut. Paulo Bento, pelatih Seleccao, Senin (Selasa WIB), mengumumkan daftar 23 pemainnya itu dalam acara di Obidos. Bento masih mempertahankan para langganan timnas, kejutan terbesarnya hanyalah pemanggilan bomber belia Nelson Oliveira. “Oliveira pemain muda dengan potensi dan skill bagus. Dia memiliki karakter yang berbeda dengan striker lain. Kami percaya padanya,” beber Bento di Press Sports, Selasa (15/5). Oliveira sejauh ini baru bermain 10 menit bersama tim nasional. Pemanggilannya disinyalir untuk menjadi solusi, setelah tim Samba Eropa itu paceklik gol selama kualifikasi. Kebanyakan gol Portugal lahir dari kaki winger Cristiano Ronaldo dan Luis Nani, bukan dari striker murni. Namun bersama klubnya, SC Benfica, Oliveira kebanyakan tampil sebagai pemain pengganti. Bomber berumur 20 tahun itu menjalankan debut bersama Portugal pada partai persahabatan melawan Polandia, Februari lalu. Karenanya, Oliveira diprediksi bakal kesulitan PELATIH Seleccao, Paulo Bento, pose dengan tim cilik pada acara pengumuman daftar 23 pemainnya untuk Euro 2012 di Obidos, Portugal, Selasa (15/5) dinihari WIB. -AP-

Skuad Portugal Kiper

: Rui Patricio (Sporting Lisbon), Eduardo (Benfica), Beto (Cluj). Belakang : Bruno Alves (Zenit St. Petersburg), Fabio Coentrao (Real Madrid), Joao Pereira (Sporting Lisbon), Pepe (Real Madrid), Rolando (FC Porto), Ricardo Costa (Valencia), Miguel Lopes (Braga). Tengah : Carlos Martins (Granada), Joao Moutinho (FC Porto), Miguel Veloso (Genoa), Raul Meireles (Chelsea), Ruben Micael (Zaragoza), Custodio Castro (Braga). Depan : Cristiano Ronaldo (Real Madrid), Hugo Almeida (Besiktas), Helder Postiga (Zaragoza), Luis Nani (Manchester United), Ricardo Quaresma (Besiktas), Silvestre Varela (FC Porto), Nelson Oliveira (Benfica). untuk menyangi striker senior model Hugo Alemida dan Helder Postiga. Di lini belakang, masuknya bek Miguel Lopes dan gelandang Custodio Castro juga cukup mengejutkan. Kedua pemain Braga itu merupakan debutan bersama A Selecção jika diturunkan di Polandia-Ukraina 2012. Portugal masuk grup maut di Euro 2012, gabung tim tangguh Jerman, Belanda dan Denmark di Grup B. Sebelum turnamen akbar tersebut, Ronaldo cs akan melakoni ujicoba melawan Macedonia pada 26 Mei dan Turki pada 2 Juni. (m15/vvn/ps)

Badai Cedera Landa Les Bleus PARIS (Waspada): Kesempatan striker Loic Remy untuk membela Prancis di Euro 2012 mendapat pukulan, karena dia harus istirahat empat minggu akibat cedera pahanya.

AP

Jelas Sudah Arah Bilic MOSKOW (Antara/Reuters): Pelatih Kroasia Slaven Bilic (foto), yang telah mengumumkan mundur pasca Euro 2012, sudah punya tujuan yang jelas dengan adanya klaim klub Lokomotiv Moscow. “Kami gembira dapat bekerjasama dan menandatangani kontrak dengan pelatih top itu,” klaim Ketua Lokomotiv, Olga Smorodskaya, melalui laman klubnya, www.fclm.ru, Selasa (15/5). “Bilic salah satu pelatih terhebat di Eropa dan kami harus mengalahkan banyak klub, termasuk klub Liga Utama Inggris, untuk mendapatkannya,” tambah Smorodskaya. Pelatih berusia 43 tahun itu menandatangani kontrak tiga tahun, menggantikan posisi Jose Couceiro (Portugal), yang kontraknya tidak diperpanjang menyusul penampilan buruk Lokomotiv. Bilic merupakan pelatih asing dengan profil terbagus kedua yang melatih klub Rusia, setelah dua hari sebelumnya Spartak Moscow mengumumkan telah mengontrak mantan entrenador Valencia, Unai Emery. “Lokomotiv adalah klub besar dan ini merupakan tantangan besar bagi saya. Saya memiliki ambisi untuk mencapai hasil bagus di sini,” ucap Bilic. Setelah menggantung sepatu pada 2001, Bilic melatih Hajduk Split kemudian Timnas Kroasia pada 2006. Dia membawa Luca Modric cs ke perempatfinal Euro 2008, namun kemudian gagal di penyisihan Piala Dunia 2010.

Remy didera cedera ketika membantu kemenangan Olympique Marseille 3-0 atas AJ Auxerre di Ligue 1, hari Minggu lalu. “Dia (Remy) harus istirahat selama tiga sampai empat minggu,” kata Marseille melalui lamannya www.om.net, Selasa (15/5). Peluang Remy untuk masuk skuad Les Bleus pun menipis, karena pelatih Laurent Blanc (foto) segera mengumumkan susunan pemainnya untuk memasuki pemusatan latihan jelang

ke Polandia-Ukraina. “Kita lihat saja, tapi kami harus tahu apakah kami bisa memilikinya tepat waktu untuk kompetisi nanti,” beber Blanc dalam Daily Mail. Badai cedera makin memusingkan Blanc, karena bek Younes Kaboul juga mesti masuk ruang perawatan setelah membela Tottenham Hotspur akhir pekan lalu pada partai pamungkas Liga Premier melawan Fulham. “Kasusnya (Kaboul) paling

AP

Cedera, Chiellini Tetap Yakin ROMA (Waspada): Bek Juventus, Giorgio Chiellini (foto kanan), sudah dipastikan absen pada final Coppa Italia melawan Napoli di Stadion Olimpico Roma, 20 Mei mendatang. Chiellini mengalami cedera paha kanan ketika menghadapi Atalanta pada giornata pamungkas Liga Seri A, akhir pekan lalu, tetapi dia tetap yakin masih bisa membela Italia di Euro 2012. “Saya akan menjalani tes pertama untuk mengetahui seberapa parah cedera saya. Awalnya saya sedikit khawatir, namun malam harinya saya merasa lebih tenang meskiLONDON ( Waspada): Gary Neville (foto) mengaku bangga setelah resmi ditunjuk sebagai asisten pelatih Inggris dengan ikatan kontrak berdurasi empat tahun. Mantan bek The Three Lions dan Manchester United ini gabung manajer baru Roy Hodgson dengan tugas pertama berprestasi bagus di Euro 2012 bulan depan. “Dia telah memperoleh lisensi kepelatihan UEFA dan kehormatan besar bagi para pemain, sebab dia sangat berpengalaman sebagai pemain,” ucap Hodgson dalam laman FA, Selasa (15/5). Setelah pensiun dari sepakbola professional pada musim 2010/2011, semestinya Neville dapat membantu Hodgson dalam membuka hubungan dengan para pemain. Neville memegang lisensi A dan B UEFA, tapi tidak memiliki pengalaman melatih tim senior. Dia 85 kali membela Inggris dan sudah meraih semua gelar domestik bersama Setan Merah MU, serta pernah menjuarai Liga Champions. Abang Phil Neville itu memperkuat Three Lions

pun saya tahu tak bisa tampil di final Coppa Italia,” ungkap Chiellini, Selasa (15/5). Mantan pemain Livorno dan Fiorentina itu masuk dalam daftar 32 anggota skuad sementara Gli Azzurri yang dipanggil Cesare Prandelli. “Saya optimis, saya bisa bermain di Piala Eropa. Kita hanya perlu menunggu beberapa hari lagi untuk mengetahui hasil yang lebih baik,” klaim Chiellini. Di Polandia-Ukraina 2012, Azzurri masuk Grup C, gabung bersama Spanyol, Kroasia dan Republik Irlandia. Untuk mempersiapkan skuadnya, Prandelli merencanakan dua laga eksibisi

melawan pada Luksemburg pada 29 Mei dan Rusia pada 1 Juni. Selain masalah Chiellini, Italia juga mendapat kabar kurang sedap karena penyerang Parma Sebastian Giovinco juga mengalami cedera lutut dan harus absen sekira 10 hari. Gelandang AS Roma, Daniele De Rossi, pun bermasalah pada fraktur fungsi jari telunjuk tangan kanannya. Ada kemungkinan operasi terhadap De Rossi segera dilakukan, supaya bintang berusia 28 tahun itu pulih sepenuhnya saat menjajal Spanyol, 10 Juni mendatang. Prandelli secara mengejutkan telah memanggil beberapa

pemain, yang belum pernah memperkuat Azzurri, seperti striker Siena Mattia Destro, winger Atalanta Ezequiel Schelotto, gelandang Bologna Alessandro Diamanti, dan gelandang Juventus Emanuele Giaccherini. Pemanggilan gelandang serang Marco Verratti yang paling mengejutkan, karena pemain berusia 19 tahun itu hanya membela klub Liga Seri B, Pescara. Masuknya striker Manchester City, Mario Balotelli, pun mengandung risiko. Sebab mantan penyerang Inter Milan itu sering membuat kontroversi. (m15/okz/fi)

Bangga Asisten Hodgson pada tiga Piala Eropa (1996, 2000, 2004), dan dua kali di Piala Dunia (1998, 2006). Namun profesinya sebagai pengamat di Sky Sports, dapat juga memicu konflik kepentingan dalam tim St George Cross. “Pada pertemuan pertama saya dengan FA, saya menjelaskan bahwa Gary orang yang saya inginkan menjadi bagian dari staf saya,” tegas Hodgson. Neville pun segera gabung dengan pelatih Ray Lewington, serta dua pelatih kiper Ray Clemence dan Dave Watson, seba-

gai staf Hodgson dalam kampanye di Polandia-Ukraina 2012. Namun veteran berumur 37 tahun itu masih akan bekerja sebagai kolumnis untuk surat kabar Mail edisi Minggu. “Roy meminta saya menjadi bagian dari stafnya di timnas. Ini bukan hanya merupakan kebanggaan, namun ini merupakan momen yang sangat istimewa bagi saya,” ucap Neville. “Saya tentu saja tidak ragu untuk menerima peran ini. Saya menikmati kesempatan untuk kerja bersama Roy dan timnya

di Euro serta menjalani dua turnamen berikutnya,” ujarnya lagi. Hodgson, mantan manajer West Bromwich Albion, menilai Neville sangat penting bagi timnya, karena memahami suasana kamar ganti dan telah berpengalaman di level internasional. “Dia telah mewakili Inggris sebagai pemain pada lima (putaran) final turnamen besar, yang akan membuat dirinya menjadi anggota staf yang sangat bernilai,” sanjung mantan pelatih Liverpool tersebut. (m15/ant/rtr/afp)

mengkhawatirkan. Itu cedera lama yang dia dapat sejak dua atau tiga tahun lalu. Dia akan menjalani pemeriksaan besok,” ratap Blanc. Florent Malouda pun bermasalah ketika memperkuat Chelsea melawan Blackburn Rovers. Namun Malouda segera ditarik keluar oleh Roberto Di Matteo, caretaker manajer The Blues, sehingga cederanya tidak parah. Blanc sendiri ngotot membawa Malouda, karena pengalaman winger senior berumur 31 tahun itu masih dibutuhkannya untuk ajang sebesar Piala Eropa. “Kita tidak bisa mengandalkan timnas yang hanya berisi pemain muda. Dengan pemain muda saja, kami sering memiliki masalah dan merasa khawatir,” jelas Blanc. “Anda butuh pemain berpengalaman yang sudah banyak bermain di laga internasional untuk menampilkan tim yang

bagus. Malouda punya itu, meski dia tidak terlalu kompetitif di klub,” tambah mantan kapten Pangeran Biru tersebut. Dia juga mengingatkan media Prancis supaya mengurangi kritik terhadap Franck Ribery, bintang Bayern Munich, yang dianggap tidak bisa menampilkan performa terbaik saat membela tim nasional. “Orang harus membiarkannya sendiri, meski itu sulit bagi Anda (pers). Dia (Ribery) butuh melepaskan beban ekstra di pundaknya,” papar Blanc. “Sebab, beban telah membuatnya kehilangan kesederhanaan, efesiensi dalam bermain dan tampil berbeda. Di Munich dia bebas, lingkungannya membuat dia percaya diri. Kita perlu membuatnya percaya diri bukan menekannya,” katanya lagi. Mengenai Karim Benzema, Blanc menegaskan bahwa bomber Real Madrid itu akan menjadi pemimpin di garis serang tim Ayam Jantan. Benzema di-

AP

nilainya punya kemampuan komplet, perilakunya pun semakin dewasa dan kolektif. Pujian juga dia alamatkan kepada bek Arsenal Laurent Koscielny dan gelandang Yohan Cabaye (Newcastle United). Keduanya menunjukkan perkembangan menggembirakan di klub masing-masing.

Pasukan Blanc masuk Grup B di babak penyisihan Euro 2012, gabung bersama Inggris, Swedia dan tuan rumah Ukraina. Les Bleus memulai perjuangannya dengan melawan Inggris di Donetsk, Ukraina, 11 Juni mendatang. (m15/rtr/dm/afp)


Sport

WASPADA Rabu 16 Mei 2012

A11

Bayern Lebih Baik MUNICH, Jerman (Waspada): Bintang Bayern Munich, Franck Ribery (foto kanan), mengklaim suasana dalam timnya kini lebih baik dibanding saat dipukul Inter Milan 0-2 pada final Liga Champions 2009/2010. “Kami lebih baik dibandingkan 2010 silam, karena kami jauh lebih rileks. Kami tidak terlalu khawatir dan bisa kembali menikmati sepakbola,” beber

Ribery kepada Kicker, Selasa (15/5). Ribery tidak tampil saat ditekuk Inter di Santiago Bernabeu, dua tahun lalu, karena ter-

kena hukuman akumulasi kartu kuning. Namun 10 pemain FC Hollywood yang akan menghadapi Chelsea pada final di Allianz Arena, 19 Mei mendatang, mantan pecundang di Madrid. Mereka adalah kapten Philipp Lahm, Daniel van Buyten, Holger Badstuber, Bastian Schweinsteiger, Arjen Robben, Thomas Muller, Ivica Olic, Daniel Pranjic, Anatoliy Tymoshchuk, dan Mario Gomez. Lahm cs diyakini akan menjadikan final 2012 nanti sebagai pelampiasan atas kekalahan dua

Thunder Bergemuruh OKLAHOMA CITY, AS (Waspada): Oklahoma City Thunder memang layak dijadikan sebagai favorit jawara musim ini, setelah menundukkan LA Lakers pada game pertama semifinal NBA Playoff Wilayah Barat di Chesapeake Energy Arena, Selasa (15/5). Keperkasaan Thunder yang solid ditentukan duet Kevin Durant dan Russell Westbrook. Berkat kedua pemain yang total menyumbang 52 poin ini, Lakers dikalahkan tuan rumah 90-119. Dengan demikian, Thunder sementara unggul 1-0 dari Lakers. Game kedua tetap berlangsung di markas Thunder pada Kamis (17/5) besok. Thunder memulai pertandingan dengan gemilang untuk mengakhiri kuarter pertama 30-23. Hal serupa terjadi pada kuarter kedua, di mana Durant cs mendominasi permainan hingga Lakers tertinggal 44-59. Kuarter ketiga praktis menjadi milik runner-upWilayah Barat ini setelah tampil nyaris tanpa catat dan praktis membuat Lakers kewalahan. Kuarter ini berakhir 98-68 untuk Thunder yang tetap mendominasi hingga akhir laga. Westbrook mencetak 27 poin, sembilan assist, dan tujuh rebound, sedangkan Durant mengumpulkan 25 poin. Peraih gelar Sixth Man Award, James Harden, membuktikan kualitasnya dengan sumbangan 17 angka. Di pihak Lakers, Andrew Bynum dan Kobe Bryant masing-masing menyumbang 20 poin. Laga ini kian menarik karena kembali mempertemukan Harden dengan Metta World Peace. Terakhir kali berjumpa, World Peace dikenakan skorsing sembilan game akibat menyikut Harden. Sepanjang laga, kedua pemain tidak terlibat insiden dan tetap fokus pada tanggung jawab masing-masing. Di Wilayah Timur, kekalahan di game pertama resmi dibayar tuntas oleh Philadelphia 76ers. Kalah 91-92 di laga awal, Jrue Holiday cs sukses membalas Boston Celtics dengan kemenangan 82-81 di TD Garden. Celtics sempat memimpin 25-21 di kuarter pertama se-

Chelsea. Mereka akan menampilkan performa yang bagus,” tambah mantan bek Bayern asal Prancis tersebut. Hal senada diungkapkan legenda lainnya, Paul Breitner. “Melihat bagaimana Dortmund memenangi liga dua kali berturut-turut, di satu sisi kami harus menghormati prestasi tersebut. Namun di kompetisi internasional, kami berada satu langkah di depan,” beber mantan bek Jerman itu. “Sekarang semuanya tergantung pada kami. Namun kami berharap bisa membayar kompensasi kegagalan di liga dengan trofi internasional,” katanya lagi melalui Soccerway. Sedangkan kiper legendaris Bayern dan Jerman, Olivier Kahn, mengingatkan mantan klubnya supaya tidak menganggap remeh anak asuh Roberto Di Matteo. “Akan sangat berbahaya jika menganggap remeh Chelsea, namun Bayern juga tidak bodoh dengan menganggap Chel-

AP

sea adalah lawan yang ringan,” kata Kahn dalam Goal. Menurut Kahn, kunci kemenangan FC Hollywood bertumpu pada Heynckes, pelatih berusia 66 tahun yang sudah sarat pengalaman. “Mereka harus benar-benar melupakan kekalahan dan fokus terhadap apa yang akan me-

reka capai sekarang. Memenangkan Liga Champions merupakan penghargaan tertinggi dari prestasi-prestasi lainnya,” saran Kahn. “Saat ini, Chelsea juga tengah terluka. Mereka tidak mampu melalui musim ini dengan baik dan mereka juga pernah kehilangan gelar Liga Champions

melalui adu penalti tahun 2008,” kenang bintang berusia 42 tahun tersebut. Torres memiliki catatan impresif dengan 18 assists musim ini. Dengan demikian, striker internasional Spanyol itu bisa memiliki peran yang penting pada final akhir pekan ini. (m15/vvn/kicker/sw/goal)

Citizens Pantas Parade

AP

KETATNYA pertahanan Oklahoma City Thunder membuat Kobe Bryant sulit memimpin LA Lakers mencuri kemenangan di game pertama semifinal Wilayah Barat di Chesapeake Energy Arena, Selasa (15/5). belum Sixers tampil agresif di kuarter berikutnya dengan menambah 21 poin untuk berbalik unggul 57-49. Meski kembali mengganas di kuarter terakhir dengan cetakan 32 angka, Celtics tetap gagal membendung Sixers. Jrue Holiday menjadi pen-

cetak angka terbanyak untuk Sixers dengan 18 angka, sedangkan Celtics dimotori Ray Allen yang mempersembahkan 17 poin dan Kevin Garnett 15 angka. De-ngan demikian, skor kedua tim imbang 1-1 dari total tujuh game yang dijadwalkan. (m33/ap)

PN Jakpus Menangkan PSSI JAKARTA (Waspada): Direktur Legal PSSI, Finantha Rudy, menegaskan pihaknya baru saja memenangkan perkara atas gugatan dari delapan klub yang berkompetisi di Indonesian Super League (ISL). Itu setelah Pengadilan Negeri Jakarta Pusat menolak meneruskan pemeriksaan terhadap gugatan yang diajukan awal Januari lalu. Alasannya, karena apa yang diperkarakan delapan klub tersebut bukan domain PN Jakarta Pusat, akan tetapi urusan internal PSSI. “Persidangan atas perkara bernomor 524 sudah berjalan sejak Januari lalu. Setelah ada jawaban, replik, dan duplik, hari ini kita mendapat putusan yang intinya menyebut bahwa PN Jakarta Pusat menolak melanjutkan gugatan tersebut,” ujar Rudy kepada wartawan di Lapangan C Senayan, Jakarta, Selasa (15/5). Menurutnya, penolakan itu dilatarbelakangi oleh beberapa hal. Salah satunya adalah karena dugaan PSSI tidak menjalankan hasil Kongres Bali sesuai tudingan yang disaampaikan delapan tim yang menggugat tersebut tidak terbukti. “PN juga mengaku tidak bisa melanjutkan pemeriksaan atas gugatan tersebut karena hal ini merupakan masalah internal organisasi dalam hal ini PSSI. Jadi keputusan akhirnya merupakan domain PSSI, selaku induk organisasi sepakbola nasional yang harus memutuskan sendiri,” beber Rudi. Masih kata Rudy yang juga pengacara, dalam statuta PSSI pasal 69 dan 70, hal itu sendiri sudah diatur. Karena itulah, PN Jakpus menolak melanjutkan pemeriksaan atas gugatan yang

musim silam. Faktor pelatih Jupp Heynckes, yang membawa Madrid menjuarai Liga Champions 1997/1998, pun berdampak positif bagi FC Hollywood. “Pelatih berperan besar dalam perubahan yang kami alami. Para pemain sangat percaya kepadanya. Dia berhasil membuat atmosfer yang sangat menyenangkan,” tutur Ribery. Tetapi, Bayern mengakhiri musim 2011-12 dengan mengecewakan di kompetisi domestik. Die Roten mengakui keunggulan Borussia Dortmund di Bundesliga dan DFB Pokal. Menurut legenda Munich, Willy Sagnol, rentetan kekecewaan itu justru bisa membuat The Bavarians lebih termotivasi saat menjamu The Blues. “Motivasi para pemain berada pada puncak. Mereka dipersiapkan untuk menghasilkan performa hebat,” ungkap Sagnol. “Tak ada perbedaan yang terlalu jauh apakah Bayern menghadapi Barcelona atau

disampaikan 8 klub ISL. “Berdasar statuta PSSI pasal 69 itu pula, PN menyatakan tidak berwenang melanjutkan gugatan klub anggota ke pengadilan negara, karena dalam statuta sengketa administrasi keolahragaan, khususnya sepakbola, mutlak harus diselesaikan di Induk organisasinya, yakni PSSI,” kata Rudy. Seperti diberitakan sebelumnya, delapan klub yang ter-diri atas Persipura Jayapura, Persiba

Balikpapan, Persija Jakarta, Mitra Kukar, PersiwaWamena, Persela Lamongan, Arema, dan PSPS Pekanbaru menggugat PSSI. Gugatan yang diajukan ke PN Jakarta Pusat itu dilatarbelakangi ketidakpuasan terhadap keputusan PSSI yang memplot PT LPIS sebagai operator liga tertinggi di tanah air. Padahal, menurut mereka hal itu tidak sejalan dengan amanah kongres Bali dan sangat merugikan. (yuslan)

MANCHESTER, Inggris (Waspada): Pendukung Manchester City yang dibalut perasaan sukacita, berkumpul di sekitar Balai Kota, Senin (Selasa WIB), sebelum melakukan parade atas sukses Citizens menjuari Liga Premier musim ini. Sekitar 100.000 pendukung parade di jalanan kota, bersama para pemain dan staf pelatih City yang menggunakan bus dengan atap terbuka, setelah Manchester Biru meraih makhkota juara Inggris untuk pertama kalinya sejak 1968. “Ini luar biasa, semua gembira karena kami mendapatkan piala dan pantas parade merayakannya. Ini semua untuk kebahagiaan para pendukung kami,” kata kapten City, Vincent Kompany, seperti dilansir Reuters, Selasa (15/5). Manajer Roberto Mancini menyatakan, pertandingan dramatis saat mengalahkan Queens Park Rangers 3-2 di Etihad Stadium, akhir pekan lalu, sungguh klimaks yang sangat hebat. “Kami memiliki masa hidup mati dalam waktu lima menit. Itu merupakan momen menakjubkan,” ucapnya. Sedangkan Sergio Aguero, yang mencetak gol ketiga sebagai penentu kemenangan, berbicara melalui rekan setim dan senegaranya dari Argentina Pablo Zabaleta, mengatakan perayaan di Manchester luar biasa. “Terima kasih…. Anda semua amat menakjubkan,” katanya kepada para pendukung Citizens yang berkumpul di Alun-Alun Albert, Manchester. Menurut kiper Joe Hart, dirinya sempat amat khawatir karena pluit panjang sudah akan berbunyi. “Saya tidak menyangka kami mendapatkannya. Terus terang, saya sangat cemas,” bebernya. “Saya merasa tempat berpijak seperti bergoyang. Saya merasa badan saya gemetar. Anda pasti kehilangan keseimbangan dalam situasi seperti itu. Ini salah satu situasi paling dramatis dalam hidup saya,” tambah kiper Inggris tersebut. GelandangYaya Toure beda

lagi. Bintang Pantai Gading yang sudah keluar lapangan karena cedera saat City mencetak dua gol ke gawang QPR di masa injury time, mengklaim sukses menjuarai liga musim ini menjadi awal masa keemasan The Eastlands. “Kami luar biasa, namun saya pikir musim depan akan lebih hebat lagi. Saya harap City akan menjadi klub terhebat di dunia. Saya akan berpikir mengenai musim baru, saya harap itu lebih menarik dibanding yang sebelumnya,” tutur Toure. “Saya pikir para pendukung dapat menikmatinya, sebab sekarang kami memiliki pemainpemain fantastis dan terus akan berkembang,” pungkas mantan gelandang Barcelona tersebut. Mantan penyerang City yang kini menjabat sebagai direktur klub, Dennis Tueart, mengaku bahwa mereka hanya memiliki sedikit pilihan jika ingin bersaing dengan tim-tim tradisional model United, Liverpool dan Arsenal. “Kami harus investasi besarbesaran untuk mendapatkannya. Kami memiliki tim muda yang hebat, basis dukungan yang baik dan stadion baru, kami hanya perlu berinvestasi di puncak,” papar Tueart. “Kami beruntung karena punya pemilik yang melakukan hal ini, namun mereka tahu bahwa harus memiliki dasar kuat untuk membangun (tim). Ini hal biasa, di mana kami memiliki

visi untuk strategi jangka panjang,” katanya menambahkan. (m15/ant/rtr/afp)

PARA pemain dan staf pelatih City disambut para pendukungnya ketika konvoi dengan bus atap terbuka di Kota Manchester, Inggris, Senin (Selasa WIB). -AP-


Sport A12 Williams Lega Anggota Pulang CATALUNYA, Spanyol (Waspada): Tim Williams mengonfirmasi bahwa kru mereka yang diizinkan pulang dari rumah sakit bertambah jadi dua orang, Selasa (15/5). Williams juga menyatakan hingga saat ini investigasi atas penyebab kebakaran masih terus dilakukan. Kedua anggota Williams tersebut sudah diperbolehkan pulang ke rumah setelah mendapat perawatan akibat menderita gangguan pernapasan menyusul insiden kebakaran seusai GP Spanyol akhir pekan lalu. Satu orang anggota tim lainnya, yang menderita luka bakar dalam insiden tersebut, masih dirawat di rumah sakit tapi diperkirakan sudah bisa pulang ke Inggris dalam 48 jam ke depan untuk mendapat perawatan lebih lanjut. KetuaTimWilliams, Sir Frank Williams,mengungkapkandirinya lega bisa menerima sebagian

besar anggota tim di markas Williams di Grove, Oxfordshire, Inggris. “Saya sungguh senang bisa menerimakembalisebagianbesar personel di markas pada pagi ini. Salah satu dari anggota kami bertahan di Spanyol untuk perawatan lebih lanjut, tapi kami sudah mempersiapkankepulangannya,” kata Williams, Selasa (15/5). “Semua orang diWilliams F1 sangatlegabahwakerusakanyang ditimbulkan tidak meluas. Mengingat insiden ini terjadi dengan sangat tidak terduga dan sangat tidak diharapkan, semangat kebersamaan dan tolong-meno-

long di paddock F1 sangat membanggakan,” urai Williams yang juga sempat dilarikan ke rumah sakit karena pernafasannya terganggu.

Kebakaran tersebut terjadi usai Pastor Maldonado tampil sebagai pemenang GP Spanyol, Minggu (13/5) malam. Kemenangan itu lantas ditandai dengan

AP

SEORANG anggota kru Williams yang berhasil diselamatkan rekan-rekannya dinyatakan telah meninggalkan rumah sakit pascainsiden kebakaran di paddock Sirkuit Catalunya, Minggu (13/5) malam lalu.

AP

Massa Terancam, Sutil Bersiap MARANELLO, Italia (Waspada): Nasib Felipe Massa (foto) semakin berada di ujung tanduk. Penampilan buruknya dalam lima seri balapan Formula One (F1) 2012 mulai membuat gerah kubu Scuderia Ferrari. Sikapramahyangditunjukkan oleh bos-bos Kuda Jingkrak kepada Massa perlahan berubah. Sebagai contoh, Stefano Domenicali yang tadinya selalu menyatakan dukungan serta keyakinan penuh atas performa pebalap asal Brazil itu, kini justru balik menuntutnya bisa mendulang poin di lintasan. “Massa harus bisa bangkit di GP Monaco nanti. Bagaimanapun,kamimembutuhkanbanyak poin darinya demi meraih gelar konstruktor,” tegas bos tim Ferrari itu, Selasa (15/5). Pernyataan yang bernada mengancam dari Domenicali itu kontan menyulut rumor miring tentang nasib Massa. Disebutsebut pria berusia 31 tahun tersebutakandidepakdariMaranello dan posisinya bakal digantikan pebalap lain. Ada dua skenario soal calon penggantiMassa,dimanakeduanya tetap melibatkan Adrian Sutil. Pertama, Sutil bakal langsung menggantikan Massa di kursi F2012. Kedua, Sutil akan masuk ke Force India menggantikan posisi Paul Di Resta yang nantinya bergabung ke Ferrari. Walaumasihmalu-malu,Sutil mengaku siap jika nanti benarbenarpunyakesempatankembali ke belakang kemudi mobil F1. Kendati menilai hal ini masih terlalu dini, Sutil mengatakan bisa jadi dirinya akan kembali ke kokpit secepatnya. (m33/auto)

Motor Stoner Lebih Mahal MILAN, Italia (Waspada): Dalam sebuah acara lelang di Monaco baru-baru ini, harga motor Ducati milik Casey Stoner ternyata lebih mahal dibandingkan motor milik Valentino Rossi. DilansirdariVisordown,Selasa (15/5), Ducati GP10 yang ditunggangi Stoner pada musim 2010 mampu terjual senilai 138.098 pounds (sekira Rp2,037 miliar). Sementara itu, GP11 milik Rossi musim lalu hanya laku senilai 134.891 pounds (Rp1,9 miliar). Kedua motor Ducati yang dilelang tersebut pun masih bermesin 800cc. Motor Ducati kepunyaan Stoner memang punya raihan lebih baik, yakni merebut tiga kemenangan dan menuntaskan musim di posisi empat klasemen akhir. Sebaliknya, GP11 milik Rossi cuma sekali naik podium ketiga, sebelum akhirnya menuntaskan musim di urutan tujuh. (m33/auto)

Pasang Iklan

Telp. 4528431 HP. 081370328259 Email: iklan_waspada@yahoo.co.id

PENGUMUMAN CALON MAHASISWA BARU LULUS GEL.II – TAHUN AJARAN 2012/2013 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33

A. LULUS Abdul Holik Agung Fauzi Malik Ahmad Iqbal Alfreetdy Situmorang Ananda S Lubis Annisa Nur Intan Ariman Dalimunthe Ariska Sandi Ayu Mandasari Nasution Azrun Harisyah Sinaga Bagues Anggara Bagus Pribadi Batara Tampubolon Boy Herry Fernando Pardede Chandra Septian Daniel Yanrico Pelawi Danu Supitar Dedek Rizky Ramadhani Derra Afriadi Devi Elwina Silalahi Dhian Rachmansyah Dirwan Sitompul Egy Primanta Ginting Fahruddin Arruzi Rambe Feri Cristian Panggabean Fitria Syafriani Hafizh Al Fatoni Hendrik Dharmansyah Hendro Alnurrahman Heri Pratama Ritonga Jefri Jules Rafael Purba Lestari Moralisa Simamora

34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66

Liong Sinaga Louis Frans Marthin Simorangkir M. Iqbal Zakhira Michael Erickson Silaban Muhammad Chairin Nazlan Muhammad Dian Nursalam Muhammad Fadly Syahputra Muhammad Hanafi Rossady Muhammad Hasan Riduan Siregar Muhammad Husein Harahap Muhammad Imanuddin Muhammad Irfan Hidayatullah Muhammad Ridho Baskoro MuhammadTeguh Kurniawan Saputra Muhammad Yusuf Barus Naufal Fadly Rangkuti Nazrul Bari Nurul Huda Ongko Widiyantoro Puji Ferdana Radial Akbar Rahmat Murtaza Rangkuti Refandi Rendi Puja Pranata Rifki Saifinnuha Ronald Octavianus Panjaitan Roni Fransisko Ginting Rowinner Siregar Samuel Reinhard Ignatius Sitorus Sendy Susanto Sibli Surya Putra Syamsurizal Syamita Lubis Syarif Hidayatullah

67 68 69 70 71 72 73 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25

Theo Reksa Rehatta Tony Pranata Manurung Tosuko Utomo Tuah Alfi Syahri Silalahi Utari Aprianti Walden Silalahi Yofi Wiranda B. MENGULANG TES MTK & B. ING Aguslan Rizky Siregar Ahmad Rizki Ramadan Alex Ibrani Panjaitan Algi Utama Andreas Iwadasi Duha Anelu Yairawati Duha Azwan Yunas Dwi Arif Wibowo Eriko Sinaga Friendly Natal Siregar Hafizh Ramadhan Hermawan Ismail Mulyadi Sitompul Jhonson Fernando Simanjuntak Josua Armanda Ginting Luqmanul Hakim Lubis Mega Party Kristina Purba Nizar Prayogi Harahap Putra Pratama Reza Kustanto Rica Sari Ayu Lestari Satria Wibowo Teguh Prabowo Victor Alfianus Nisura Victor Hamonangan Sitorus

Pengambilan Surat Kelulusan dan Daftar Ulang tgl 16 s.d 25 Mei 2012. Informasi Pendaftaran : Kampus STIP-AP Jl. Willem Iskandar Medan arah RS. Haji (LPP Kampus Medan), Telp : (061) 6637060, Sulthon : 0812 6486 1529, Purjianto : 0852 6203 8582, Sunyianto 0812 6444 5883

sesi foto tim di depan garasi Williams di Sirkuit Catalunya. Namun, tiba-tiba asap dan api

menyeruak di garasi mereka. Alhasil,kobaranapikemudian coba dipadamkan oleh staf da-

WASPADA Rabu 16 Mei 2012 ri Williams, Caterham, dan Force India sebelum petugas pemadam kebakaran lintasan tiba di lokasi. Akibat insiden tersebut,

mobilmilikBrunoSennaterbakar dan mobil Maldonado selamat karena tengah dipajang di dekat podiumkemenangan. (m33/auto)


Sumatera Utara

WASPADA Rabu 16 Mei 2012

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:23 12:37 12:24 12:31 12:31 12:27 12:24 12:20 12:26 12:26

‘Ashar 15:47 15:59 15:47 15:54 15:54 15:51 15:47 15:43 15:50 15:49

Magrib 18:33 18:49 18:33 18:43 18:41 18:34 18:33 18:28 18:36 18:37

‘Isya

Imsak

Shubuh Syuruq

Kota

19:45 20:02 19:46 19:56 19:54 19:46 19:45 19:41 19:48 19:49

04:43 05:53 04:43 04:48 04:48 04:50 04:44 04:40 04:46 04:44

04:53 05:03 04:53 04:58 04:58 05:00 04:54 04:50 04:56 04:54

L.Seumawe 12:29 L. Pakam 12:23 Sei Rampah12:22 Meulaboh 12:33 P.Sidimpuan12:21 P. Siantar 12:22 Balige 12:22 R. Prapat 12:19 Sabang 12:36 Pandan 12:23

06:12 06:22 06:13 06:17 06:18 06:19 06:13 06:09 06:15 06:13

Zhuhur ‘Ashar 15:50 15:44 15:43 15:54 15:43 15:43 15:43 15:42 15:59 15:46

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

Zhuhur ‘Ashar

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

18:41 18:32 18:31 18:43 18:27 18:30 18:29 18:26 18:49 18:30

19:54 19:44 19:44 19:56 19:39 19:43 19:42 19:38 20:02 19:42

04:46 04:42 04:41 04:52 04:44 04:42 04:43 04:40 04:52 04:45

04:56 04:52 04:51 05:02 04:54 04:52 04:53 04:50 05:02 04:55

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:23 12:24 12:34 12:27 12:24 12:31 12:19 12:29 12:22 12:21

18:30 18:32 18:46 18:34 18:33 18:41 18:27 18:38 18:29 18:30

19:42 19:45 19:59 19:47 19:46 19:54 19:40 19:51 19:42 19:43

04:45 04:45 04:50 04:48 04:43 04:48 04:39 04:49 04:44 04:41

05:55 05:55 05:00 04:58 04:53 04:58 04:49 04:59 04:54 04:51

Panyabungan 12:20 Teluk Dalam12:27 Salak 12:25 Limapuluh 12:20 Parapat 12:22 GunungTua 12:19 Sibuhuan 12:19 Lhoksukon 12:29 D.Sanggul 12:23 Kotapinang 12:18 AekKanopan 12:19

06:16 06:11 06:10 06:21 06:13 06:11 06:12 06:09 06:22 06:14

15:46 15:48 15:57 15:50 15:47 15:54 15:42 15:53 15:46 15:45

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

Silaturahmi Bersama Ibu-ibu Penyapu Jalan STABAT (Waspada): Ketua TP PKK Langkat Hj. Nuraida Ngogesa melakukan temu silaturahmi bersama ratusan ibu-ibu penyapu jalan yang dikenal dengan sebutan pasukan kuning, di Kolam Pancing Aratunggal Desa Sei Limbat, kemarin. “Utamakan keihklasan dalam melaksanakan tugas dan berikan yang terbaik bagi daerah kita,” kata Ny. Nuraida Ngogesa di hadapan ratusan ibu-ibu yang merupakan tenaga harian lepas pada Dinas Kebersihan dan Pertamanan Langkat itu. Ny. Nuraida mengemukakan kesuksesannya mendampingi suami H. Ngogesa Sitepu, SH sebagai Bupati Langkat yang telah dilakoni hampir empat tahun, tidak terlepas dari peranserta masyarakat di daerah ini dalam berbagai profesi. Selain itu, kata Hj. Nuraida, para ibu yang bertugas menjaga kebersihan di ibu kota Kabupaten Langkat merupakan tugas mulia sehingga Stabat mampu meraih predikat sebagai Kota Adipura. Acara yang juga dihadiri sejumlah pengurus PKK itu diawali dengan pembacaan doa, dilanjutkan dengan pemotongan tumpeng Ulang Tahun ke-46 Hj. Nuraida Ngogesa dan pemberian bingkisan berupa 435 paket beras dan uang santunan masing-masing Rp50 ribu kepada seluruh pasukan kuning yang melimpah ruah menghadiri lokasi acara tersebut. Para ibu juga diberi kebebasan memancing dan membawa pulang ikan hasil tangkapan di kolam.(a01)

Waspada/Ibnu Kasir

Memiliki Sabu Ditangkap Polisi BINJAI (Waspada): Her, 38, penduduk Jalan Printis Kemerdekaan Kelurahan Cengkeh Turi Kecamatan Binjai Utara, Senin (14/5) pukul 23.15 ditangkap anggota Serse Narkoba Polres Binjai di daerah jalan Kenanga Kelurahan Pahlawan, karena memiliki satu paket sabu. Kini tersangka bersama barang bukti diamankan di Polres Binjai guna pengusutan selanjutnya, sedangkan pengedar sabu yang indititasnya sudah diketahui masih dalam buronan. Kasat Narkoba Polres Binjai AKP Achiruddin Hasibuan, SH, M.Hum ketika dikonfirmasi membenarkan penangkapan. Pihaknya sedang melacak dari mana asal sabu tersebut.(a05)

8-9 Juni, Konferensi IV PWI Perwakilan DS LUBUKPAKAM (Waspada): PersatuanWartawan Indonesia (PWI) Perwakilan Deliserdang akan melaksanakan konferensi IV Tahun 2012 di Taman Dewi Sibolangit, 8-9 Juni 2012. Penetapan jadwal dan lokasi pelaksanaan konferensi berdasarkan hasil keputusan rapat pengurus PWI Perwakilan bersama dengan seluruh anggota, di kantor PWI Perwakilan Deliserdang Jalan Inpres Lubukpakam, Jumat (11/5). Konferensi IV PWI Perwakilan Deliserdang yang selain akan melaporkan pertanggungjawaban kepengurusan PWI Perwakilan periode 2009-2012, juga menyusun program kerja serta memilih kepengurusan baru periode 2012-2015. Untuk suksesnya konferensi, pada rapat yang berlangsung akrab terbentuk susunan kepanitiaan terdiri dari Penasehat HM Husni Siregar dan Henri Simon Matondang. Ketua Wagino, Sekretaris Boby Indra Priyoga, Bendahara J. Folala Gea dibantu beberapa seksi beranggotakan seluruh anggota PWI Perwakilan Deliserdang. Selainpenetapanjadwalkonferensi,jugadisepakatijadwalpelantikan kepengurusan PWI Perwakilan 2012-2015 hasil konferensi IV Tahun 2012, direncanakan 16 Juni 2012 di Medan.(a06)

TEBINGTINGGI (Waspada): Lembaga Kebijakan Pengadaan Barang/Jasa Pemerintah, hanya meluluskan sembilan dari 45 pejabat Kota Tebingtinggi yang ikut ujian sertifikasi kelayakan. Sedangkan 36 pejabat lainnya tak lulus pada pendidikan difasilitasi Badan Kepegawaian, Pendidikan dan Pelatihan 4 April itu. Plt. Kaban KPP Fadhlan, SH, kemarin mengatakan, peserta terdiri dari pejabat eselon II dan IIIterdiridarikepala,kepalabagian dan kepala seksi berbagai SKPD. Ujian berlangsung di gedung Hj. SawiyahNasution.Kegiataninilanjutantahunsebelumnya,dimana sebagian besar peserta tak lulus.

Namun, diungkapkan pula, rata-rata peserta yang tak lulus akibat salah dalam mengisi kertas ujian yang menggunakan komputer. “Sekira 60 persen, peserta yang tak lulus karena salah dalam mengisi lembaran soal,” ujar Plt. Kaban PPK itu. Beberapa nama yang lulus

tahun ini, yakni Leo Lopulisa (Kadis Pertanian), Djajardi Rinal (Kadis Perhubungan), Muhammad Nurdin (Kadis PU), Syahnan Hasibuan (Kakan P2T) dan Zahidin (Sekretaris Dinas Pendidikan), ditambah sejumlah nama kepala bagian SKPD. Ditambahkan, kelulusan ujian LKPP menjadi dasar bagi setiap pejabat yang ada, telah memahami proses pengadaan barang/jasa di instansi masingmasing. “Dengan lulusnya mereka, berarti mengetahui prosedur pengadaanbarang/jasadiinstansi masing-masing,”tandasFadhlan, SH.(a09)

LUBUKPAKAM (Waspada): Para ulama serta cendekiawan muslim berasal dari 22 wilayah kecamatan se-Kabupaten Deliserdang, mendeklarasi berdirinya “Majelis Ulama Kabupaten Deliserdang”, yang berfungsi memberi dakwah serta membantu memberi masukan pemeritah terhadap berbagai hal menyangkut pelaksanaan akidah Islam. Deklarasi Majelis Ulama dipimpin Ketua Umum Drs H. Yusuf Ady, MA, Sekretaris Umum H. Syawal Harahap, S.Ag dan Bendahara Umum HM Hanafi, S.Sos dihadiri unsur pengurus terdiri dari Drs. Amin Rasyid Nasution, Drs H. Mujahiduddin, Zulkarnaen, S.Ag dan H. Ibnu Hajar, S.Pd dilakukan pada sarasehan dakwah Islam menampilkannarasumberProfDrAsmurdi, MA, Prof Dr Pagar Hasibuan dan Drs Fakhrurozi, MA, di aula Cadika Pramuka Lubukpakam,

baru-baru ini. Bupati Deliserdang Drs H. AmriTambunan diwakiliWabup H. Zainuddin Mars ketika membuka sarasehan bertema “Dakwah antara harapan dan kenyataan”menegaskan,kitasemua harus menyadari pembangunan sektor keagamaan yang kita lakukanbelummampumemberi jawaban terhadap pembinaan umat dengan beragam masalah yang muncul, sebagai dampak derasnyaarusglobalisasimelanda hampirdiseluruhbangsa-bangsa di dunia dewasa ini. Salah satu yang dirasakan adanya kecenderungan menurunnyaakhlaqdanmoralgenerasi muda, seiring munculnya prilaku yang bertentangan dengan norma-norma ajaran agama seperti tindak kekerasan, tawuran, perampokan, pemerkosaan, pembunuhan,seksbebas,narkobadan sebagainya, yang sudah sampai

kepada titik memprihatinkan. Wabup mengatakan ini tantangan kita ke depan. Sebab itu saya ingin mengajak memanfaatkan momentum penyelenggaraan sarasehan ini untuk menyatukanpersepsidanlangkah kedepansebagaisalahsatuwujud kebersamaan membangun seluruh umat di daerah ini, melalui pengembangankehidupanumat secarautuhyangmemilikikeseimbangan hidup baik lahir maupun batin, untuk ikut berperan memberikontribusidalamupaya melakukan percepatan pembangunan daerah. Sarasehan dakwah Islam yang digagas Forum Silaturahim Ormas Islam dan Perguruan Tinggi Islam di Kab. Deliserdang, berlangsung sehari mendapat perhatian luas dari para ulama, dai, mubaligh dan tokoh serta pemuka agama Islam yang hadir menjadi utusan kecamatan.(a06)

P.BRANDAN (Waspada): Prajurit Korps Marinir Brigif-3 Yonif-8Tangkahan Lagan mengikuti pembekalan flaying psychologist untuk meningkatkan kompetensi pribadi dengan menghadirkantigainstrukturdari Dinas Psikologi TNI-AL Surabaya, Kamis (10/5). Ketiga instruktur, Mayor Laut (KH) Ariyuda Kartika, Mayor Laut (S) RadenYossirizal dan Kapten Laut (KH) Febri Prasetyo. Kegiatan ini juga dihadiri Danyonif8 Letkol Mar Doaniel Kreuta, WadanYon,MayorMarSDManurung, dan Pasi Ops, Mayor Mar. Bambang Irianto.

Pembekalan yang mengambil thema “Melalui Flaying Psykologist 2012 Kita Tingkatkan Kompetensi Pribadi Guna Mendukung Tugas Pokok TNI-AL” ini diikuti ratusan prajurit baret ungu bertempat di gedung Batalyon MarkasYonif-8 Marinir Tangkahan Lagan. Tujuan dasar pembekalan psikologi ini secara internal untuk motivasi tempur prajurit di lapangan termasuk tugas spesial di daerah-daerah dan membantu satuan di lapangan dalam rangka perawatan personel supaya para prajuritdapatlangsungdigerakan di dalam situasi apa pun.

Pembekalan seperti ini dilaksanakan mulai dari Wilayah Indonesia Bagian Barat (Sabang) sampai keWilayah Indonesia Timur, yakni di Lantamal Jayapura hingga seluruh Satgas-satgas pulau terluar dan diYonif-8 Marinir sendiri, kegiatan ini baru pertama sekali dilaksanakan. “Pelatihan ini mulai dari level teritorial tingkat Lantamal dan sekarang sampai ke Lanal bahkan berlanjutketingkatbatalyon,”kata Kapten Laut (KH) Febri Prasetyo, salah seorang instruktur dari Dinas Psikologi TNI-AL Surabaya kepada Waspada di sela jeda pembekalan. (a02)

Prioritas Pembangunan Kepada Rakyat Untukmu Binjai Baktiku Indonesia rumah yang kemudian menjadi bandar (pelabuhan), yang ramai didatangi dengan angkutan tongkang dari Stabat, Tanjung Pura bahkan dari Malaka. Nama pohon Binjai yang buahnya bagai buahembacangmelekatmenjadi nama kota Binjai. Terlepas dari mana nama Binjaidanpenetapanharijadinya, kini Kota Binjai merayakan HUT ke-140. Berbagai kegiatan diramu Pemko Binjai, tetap berorientasi dan melibatkan potensi masyarakat.Wali Kota Binjai HM Idaham, SH, M.Si didampingi Kabag Humas Zulfikar, S.Sos mengemukakan, Senin (14/5), perayaan hari jadi bukan sebagai hura-hura, tapi dijadikan momentum ‘pesta rakyat’. Semua pejabat dan wakil rakyat menyatu, makan bersama di lapangan Merdeka, Rabu (16/5). Pejabat dan rakyat disuguhkan menu yang sama yaitu ikan lele dan jamur tiram. Idaham menyebutkan menu itu sengaja dipilih sejak tahun lalu, mengapresiasi potensi budidaya peternak ikan lele di kota Binjai. Pemeliharaan ikan lele tidak sulit danlama.“Buktinya,pesananikan leledariBinjaisaatinicukuptinggi,” ujar Idaham. Selainmemproduksiikanlele segar untuk rumah makan di Sumatera Utara, pengusaha ikan lele juga diminta kreatif. Pengusaha bisa memproduk ikan lele menjadi ikan sale yang digemari

Zhuhur ‘Ashar 15:43 15:50 15:48 15:44 15:46 15:43 15:43 15:52 15:46 15:41 15:43

Magrib

‘Isya

Imsak

Shubuh Syuruq

18:25 18:32 18:32 18:29 18:30 18:26 18:25 18:40 18:30 18:24 18:27

19:37 19:44 19:45 19:42 19:43 19:38 19:37 19:53 19:43 19:37 19:40

04:43 04:51 04:46 04:40 04:43 04:42 04:42 04:46 04:44 04:40 04:40

04:53 05:01 04:56 04:50 04:53 04:52 04:52 04:56 04:54 04:50 04:50

06:12 06:20 06:15 06:09 06:12 06:11 06:11 06:15 06:14 06:09 06:09

Waspada/Armansyah Th

KETUA STIKes Flora, dr. Muara P. Lubis, SpOG (kanan), membuka kegiatan PMB dalam rangka PBL mahasiswa STIKes Flora, Tahun Ajaran 2011/2012, di Hamparan Perak, kemarin.

STIKes Flora Gelar PKM Di Desa Kota Rantang HAMPARAN PERAK, Deliserdang (Waspada): Sebanyak129mahasiswaAkbiddanAkperSekolah Tinggi Ilmu Kesehatan (STIKes) Flora Medan melakukan kegiatan Pengabdian Kepada Masyarakat (PKM) di Desa Kota Rantang, Kec. Hamparan Perak, Kab. Deliserdang. Kegiatan PKM dalam rangka Praktek Belajar Langsung(PBL)STIKesFlora,MedanTahunAjaran 2011/2012 ini, ditandai dengan kegiatan bakti sosial berupa pemeriksaan dan USG bagi ibu hamil, pengobatan dan pemeriksaan KGB bagi warga lanjuta usia (lansia), serta khitan massal, yangdipusatkandiBalaiDesaKotaRantang,Selasa (15/5). Dalam rangkaian kegiatan PKM ini, sebelumnya para mahasiswa selama tiga pekan telah menjalani kegiatan PBL di tengah-tengah masyarakat, antara lain dengan memberi penyuluhan untukmengetahuimasalahkesehatan di lingkungan masyarakat seperti manfaat pemberian ASI esklusif, pemberian makanan tambahan, dan juga tentang saluran pembuangan air limbah.

Ketua STIKes Flora, dr. Muara P. Lubis SpOG, dalam kata sambutannya sebelum membuka PBL mengatakan, bahwa PBL ini bagian dari program pendidikan kurikulum D3 yang wajib diikuti para mahasiswa. Dalam kesempatan ini, dr. Muara P. Lubis tak lupa mengucapkan terima kasih kepada warga Desa Kota Rantang, atas partisipasinya guna kut menyukseskan kegiatan. Dikatakan, selain atas kerja sama dengan warga desa, kegiatan PKM juga terselenggara atas kerja sama dengan Puskesmas Hamparan Perak. Sementara Paidi, mewakili warga Desa Kota Rantang, juga menyatakan apresiasi dan terima kasih kepada STIKes Flora atas kunjungannya dalam kegiatan pelayanan kesehatan di desanya. Adapun, yang mengikuti PBL terdiri dari 87 mahasiswa D III Kebidanan, dan 42 mahasiswa D III Keperawatan. Sementara warga yang mengikuti kegiatan adalah 25 ibu hamil, 158 lansia serta 27 peserta khitan massal. Kegiatan yang mendapatsambutandariwargaDesaKotaRantang ini dihadiri Camat Hamparan Perak Faisal A. Nasution. (m47)

Prajurit Yonif-8 Marinir Mengikuti Wisata Mangrove Kurangi Dampak Resiko Bencana Pembekalan Flaying Psychologist

Binjai 140 Tahun:

17 MEI, kota Binjai genap berusia 140 tahun. Hari Jadi kota Binjai diperingati setiap tahun,sesuaipenetapanDPRD Kota Binjai pada 1985, dengan Peraturan Daerah (Perda) No.3/DPRD-II/5/85. Dasar penetapan 17 Mei 1872, dari historis perjuangan melawan penjajahan Belanda cukup heroik di kawasan Timbang Langkat. Saat pasukan Belanda bergerak menyeberangi Sungai Bingei, dipertemuan Sungai Mencirim, pasukan Belanda disergap dan ditembaki pejuang. Pasukan kolonial terperangkap dalam parit yang ditanami ranjau oleh pejuang. Pasukan penjajah yang didatangkan dari Riau bertujuan menumpas pemberontakan Datuk-datuk Sunggal dalam perang Timbang Langkat. Historisini,tidakmenabalkan nama Kota Binjai, hanya sebagai penetapan hari jadi. Sedangkan nama Binjai yang dikenal di Indonesia sebagai kota rambutan, diperkirakan berasal dari nama buah Binjai. Sesuainukilan sejarahada pembukaan kampung dengan upacara adat, dilaksanakan di bawah pohon besar bernama pohon Binjai. Pohon itu tumbuh subur di pinggiran Sungai Bingei, kini lokasinya di Kelurahan Binjai. Disekitarpohondibangun

06:14 06:14 06:20 06:17 06:12 06:18 06:09 06:18 06:13 06:10

36 Pejabat T. Tinggi Tak Lulus Ujian LKPP

Deklarasi Majelis Ulama DS

KETUA TP PKK Langkat Hj. Nuraida Ngogesa ketika memberi paket beras dan sejumlah uang tunai kepada ibu-ibu penyapu jalan dalam temu silaturahmi di Kolam Pancing Aratunggal Desa Sei Limbat Kec. Selesai.

B1

konsumen. Selama ini ikan sale dikenal dariPadangsidimpuan.KiniBinjai mampu memproduksi ikan sale, walau masih tahap kecil. Kabag Humas Pemko Binjai Zulfikar, S.Sosmenjelaskan,memperingati hari jadi kota Binjai ke-140 juga dilaksanakan pemeriksaan kesehatan masyarakat, sunat massal dan donor darah. Di sisi lain Pemko Binjai tidak melupakan kegiatan relegi, mendatangkan ustad kondang Jefri Al Buchori yang akrab dipanggil Uje dari Jakarta, akan memimpin zikir dan memberi tausyiah, Kamis (17/5), di lapangan Merdeka. Pesta rakyat juga diisi hiburan dari rakyat, 16 etnis siap menampilkan kesenian masing-masing, Rabu (16/5) malam. Sebelum atraksi seni dan budaya, Rabu (16/5) sore diadakan karnaval

etnis. Sebagai penutup hiburan dihadirkan artis Maha Dewi dari Jakarta. “Semua kegiatan ‘pesta rakyat’terlaksanaberkatkordinasi pemerintah dan masyarakat,” ujar Idaham. Semangat hari jadi sebagai motivasi menjiwai ‘Untukmu Binjai, Baktiku Indonesia’. MenurutWali Kota HM Idaham, “Pemko Binjai tetap mengutamakan kepentingan rakyat”. Bantuan tak langsung tetap diprogram, seperti Jamkesda disediakan Rp1 miliar lebih untuk menyediakan pelayanan kesehatanmasyarakatmiskindiRSUD dr. Djoelham Binjai. Ditambah program Jampersal. Pemko Binjai pada anggaran 2012 juga menyediakan dana Rp16 miliar lebih untuk buku gratiskepadasiswaSMAdanSMK Negeri dan Swasta serta mobilernya. Anggaran itu untuk meringankan beban orangtua membeli buku jika anaknya sekolah di SMA dan SMK. Sarana pendidikanterusdibangun,antara lain gedung Madrasah Tsanawiyah Negeri 2 di Kelurahan Payarobah Kec. Binjai Barat. Idaham mengemukakan, Kota Binjai yang tidak punya sumber daya alam (SDA) harus mampu melakukan inovasi meningkatkan pendapatan daerah. Membangun kota Binjai harus disesuaikan. Seperti membangun sentra industri, perikanan.DisisilainBinjaidiharap

mampu menjadi daerah wisata kuliner. “Perhatikan malam hari, Binjai seperti pasar malam,” ujarnya. Hampir semua sudut kota ramai penjual makanan. Pasar Kaget di Jalan Ahmad Yani, sudah dikenal di nusantara. Sekarang Binjai sudah merupakan kota tak pernah tidur. Di Jalan Jenderal Sudirman terdapat penjual makanan dan minuman, juga dimanfaatkan pedagang sepatu dansandalsertapakaian.Jalan T. Amir Hamzah menuju Aceh,terdapatbarisanpenjual makanan. Begitu juga di Jalan Sutomo. Bahkan kawasan DPR (Daerah Pinggiran Rel) sudah jadi lokasi pedagang makanan. OrangBinjai,dimanapun berada, baik dalam dan luar negeri, selalu ingin ‘pulang kampung’ hanya untuk menikmati makanan. “Kita berusaha melahirkan makanan khasBinjai,sepertirendangyang sudahgointernasional.Adanya makanan khas ini diharapkan Binjai menjadi daerah wisata kuliner,” gagas Idaham. Dan kita lahirkan Untukmu Binjai, Baktiku Indonesia, sesuai dengan motto kota Binjai, ‘Setia Tiada Bertukar, Pantang Surut Biar Selangkah’, dan Binjai adalah Kotaku, Kotamu dan Kota Kita Semua. * Riswan Rika

PERBAUNGAN (Waspada): Keberadaan kawasanhutankhususnyawisata mangrovesangat membantu mengurangi dampak resiko bencana alam, seperti tsunami dan abrasi. Demikian diungkapkan Kepala Badan Penanggulangan Bencana Daerah (BPBD) Kab. Serdang Bedagai, Drs. JoniW. Manik didampingi Kabid Pariwisata Dinas Parbudpora Sergai, Dharma Eka Surbakti, S.Pd, Kabid Kedaruratan BPBD Sergai, Drs. Yansen Sianturi, Ketua Kelompok Konservasi Mangrove Muara Baimbai, Sutrisno kepada Waspada di kawasan wisata mangrove Dusun III, Desa Sei Nagalawan, Kec. Perbaungan, kemarin. Ditambahkan Joni, dewasa ini pemerintah pusat galak-galaknya melaksanakan pengurangan resiko dampak bencana, khususnya tsunami. Salah satunya dengan melaksanakan gerakan penghijauandiwilayahpesisir,sertamelaksanakan

berbagai sosialisasi bahaya tsunami kepada masyarakat melalui instansi terkait. “Nah, hasil peninjauan dilakukan Kelompok Observasi Mangrove Muara Baimbai, sudah cukup membantu pengurangan dampak bahaya bencana di Kab. Sergai. Selain itu kawasan wisata mangrove juga terbukti mampu menyelamatkan berbagai biota laut yang pada akhirnya dapat meningkatkan kesejahteraan masyarakat nelayan sekitar,” ungkap Joni W. Manik. Ketua Kelompok Observasi Mangrove Muara Baimbai, Sutrisno menerangkan luas kawasan wisata mangrove berbasis edukasi dan produksi yang mulai digagas seluas 5 hektare dikelola sejak 2004 dengan 60 anggota kelompok. Sedangkan jenis tanaman yang ada, bakau, api-api, cemara laut, kelapa dan di lokasi selesai dibangun aula, penerangan, sementara pondok wisata, kios dan MCK tahap pekerjaan.(c03)

Kasus Kakek Curi Ayam Belum Ada Yang Ditahan STABAT (Waspada): Aparat Polsek Padangtualang Resort Langkat belum menetapkan tersangka atau menahan pelaku yang terlibat penganiayaan hingga mengakibatkan MA meninggal dunia. ‘’Belum ada yang diamankan, kita masih mengumpulkan barang bukti dengan memeriksa saksi,’’ kata Kanit Reskrim Polsek Padangtualang Iptu Firman Imanuel, Selasa (15/5). Dia mengatakan orang-orang yang diduga

kuat menganiaya MA berjumlah ratusan atau satu kampung, setelah melihat pria berusia 51 tahun itu membawa ayam Senin (14/5) dinihari yang diduga baru dicuri. Kakek tersebut ditemukan masyarakat bersembunyi di salah satu sumur di belakang rumah warga kemudian dipukuli hingga sekarat. Pria bertubuh kurus warga Desa Payaperupuk Kec. Tanjungpura itu tewas dalam perjalanan ke rumah sakit.(a03)

Pembangunan Infrastruktur Pola Swakelola Tingkatkan Perekonomian Warga DS DELISERDANG (Waspada): Sejumlah tokoh masyarakat Deliserdang minta Pemkab Deliserdang melanjutkan program GDSM (Gerakan DeliserdangMembangun).ProgramGDSMuntuk percepatan pembangunan itu terbukti mampu meningkatkan kesejahteraan masyarakat. PolaGDSMdengandukungantigapilarkekuatan, yakni masyarakat, swasta dan pemerintah telah langsung dinikmati masyarakat Deliserdang. Seperti pembangunan infrastruktur jalan dan jembatan yang dibangun melalui pola swakelola telah meningkatkan perekonomian dan kesejahteraan masyarakat Deliserdang. Demikian dikatakan sejumlah tokoh Deliserdang secara terpisah kepada Waspada di Lubukpakam, kemarin. Para tokoh tersebut, Ihya Ulumuddin dari Kec.Pantailabu, Drs H Enda Tarigan dari Kec.Delitua, Mukhlis Mukhtar dari Kec.Tanjungmorawa dan Syarifuddin Nasution dari Kec. Percut Seituan. Menurut Ihya Ulumuddin yang juga Sekretaris Umum DPD HNSI (Himpunan Nelayan Seluruh Indonesia) Sumatera Utara, ini , infrastruktur jalandanjembatanyangdibangunmelalui GDSM dengan pola swakelola oleh Dinas PU Deliserdang, telah dinikmati warga, sehingga mampu meningkatkan pendapatan ekonomi mereka. Sekarang semua badan jalan di Kec.Pantailabu telah dikeraskan dan diaspal. Bahkan, akhir Juni 2012, hubungan Deliserdang- Kab.Serdang Bedagai tidak lagi menggunakan rakit (getek) karena pihak PU Deliserdang telah membangun jembatan sepanjang 245 meter di bentangan SungaiUlaryangmemisahkanDeliserdang-Sergai

di kawasan Desa Denai Lama.’’ Ini satu anugrah bagi kami yang selama ini kami impi-impikan,’’ kata Ihya Ulumuddin. Tidak hanya itu, Dinas PU Deliserdang telah membangun akses penghubung DeliserdangTanah Karo dan Medan- Deliserdang. Hal yang sama dikatakan Drs H .EndaTarigan dan Mukhlis Mukhtar. Tokoh masyarakat Delitua dan Tanjungmorawa itu mengatakan, GDSM melalui pola swakelola telah meningkatkan harga tanah di Delitua dan Tanjungmorawa. ‘’ Harga tanah, baik di Delitua maupun diTanjungmorawa, kini sudah di atas Rp 300 ribu per meter karena akses jalan cukup bagus,’’ kata Enda. Sedangkan, Syarifuddin Nasution tokoh pemuda warga Desa Tembung, Kec.Percut Seituan mengatakan, saat ini warga Kec. Percut seituan telahmerasakanpembangunanaksesjalanmelalui pola swaskelola. ‘’ Semua jalan di Percut sudah terhubung, bahkan sebagian besar sudah diaspal,’’ kataSyarifuddin, danmenambahkan,perekonomian warga Percut juga sudah meningkat signifikan. Dalam kaitan ini, para tokoh tersebut minta GDSM melalui pola swakelola terus dilanjutkan.’’ Kami mendukung pembangunan ini karena tujuannya untuk kesejahteraan masyarakat dan sudah dinikmati masyarakat,’’ ujar Syarifuddin. Data Waspada peroleh, tahun 2005, panjang jalan di Deliserdang hanya 1.430 Km dan pada tahunini(2012)panjangjalanyangdibangunDinas PU Deliserdang melalui pola swakelola sudah mencapai 3.450 Km. Sedangkan akses jalan sudah terhubung antar dusun, antar desa, antar kecamatan bahkan antar kabupaten/kota. (m11)


Sumatera Utara

B2 WASPADA

Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu Lusia Damayanti (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: Edward Thahir. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Armin R. Nasution. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Sinur Manik (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi). Wartawan Kota Medan: Umum: Zulkifli Harahap, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa,. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Dedek Juliadi, Hajrul Azhari Ritonga. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebingtinggi: Muhammad Idris, Abdul Khalik. Pematangsiantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanafiah, Hasanul Hidayat. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Bustanuddin, Wintoni. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan WASPADA dilengkapi dengan kartu pers. Tidak dibenarkan menerima uang dalam bentuk apapun. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan WASPADA tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: redaksi@waspadamedan.com KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan: hitam-putih Rp. 33.000,-, berwarna Rp. 90.000,Ukuran kolom: 40,5 mm. E-mail Iklan: iklan@waspadamedan.com Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Zarhalwi Ajak Kader Demokrat Tetap Solid LIMAPULUH(Waspada): Pelantikan tiga Pengurus Anak Cabang (PAC) Kec. Talawi, Tanjung Tiram dan Sei Balei, Kab. Batubara yang dilakukan di Balei Resto, Minggu (13/5) diisi dengan konsolidasi kader pada kepengurusan PD Demokrat yang baru terpilih. Dalam kesempatan itu ketua DPC Partai Demokrat (PD) Zarhalwi mengatakan selamat bekerja bagi Pimpinan Anak Cabang (PAC) yang baru dilantik. Semoga amanah yang diberikan dilaksanakan hingga ketingkat ranting. Karena, ranting adalah ujung tombak PD. “Kita harus tetap solid, bergandengan tangan dan bekerja sama untuk membesarkan dan memenangkan PD pada pemilu 2014 kelak,” kata Zarhalwi, saat melantik Ketua PAC PD T Tiram Syahril, Ketua PAC Sei Balai Didi Riswan AMd, Ketua PAC Talawi Wahyudi Pradinar SE, saat Musyawarah Anak Cabang (musrancab) DPC Partai Demokrat Batubara. Acara dihadiri Korda Dapil Sumut IV T Dirkhansyah Abu Subhan Ali SE, Ak, Sekretaris Korda IVYudha Johansyah, SH, Wakil Ketua I Korda Mustofawiyah,Wakil Sekretaris II Korda Sumut, Muazzul. SH, MHum (anggota Korda), Anggota DPRD Batubara Syahrial Gucci SH, Sekjen DPC PD Batubara N Manurung dan fungsionaris PD Batubara. Sementara Korda Dapil Sumut IV T Dirkhansyah Abu Subhan ALi SE,Ak dalam orasi politiknya, persoalan politik nasional jangan sampai terpengaruh oleh pengurus demokrat tingkat ranting. Karena, ranting merupakan ujung tombak besarnya partai. Ia juga berharap kedepanagardibulanJuli2012agarPemilihanPACsegerasudahselesai. Dirkhansyah, yang juga Wakil Ketua Komisi B DPRD Sumut berkeyakinan,suatuwaktunantiKab.Batubaralebihbaikdarikabupaten lain di Sumatera Utara. Dia juga berharap kepada kader demokrat agar mendukung kinerja Bupati Batubara. (c05)

WASPADA Rabu 16 Mei 2012

Satu Lagi ABG T. Balai Diduga Dijual Jadi PSK TANJUNGBALAI (Waspada): Satu lagi anak baru gede (ABG) asal Kota Tanjungbalai diduga dijadikan pelayan kafe sekaligus pekerja seks komersial di salah satu kafe Ujungbatu Rokan, Riau. ABG berusia 15 tahun itu, diduga dibawa seorang wanita yang juga masih di bawah umur berinisial Her, warga Kota Tanjungbalai. Informasi diperoleh Waspada dari keluarga salah satu korban yang masih ditahan dan dipaksa melayani tamu di kafe tersebut. “Aku dapat informasi melalui telefon dari teman adikku, Her membawa anak perempuan berusia 15 tahun ke kafe itu semalam,” kata Enti Elsahartati kepada Waspada, Selasa (15/5). Pengakuan Enti, Her jugalah yang diduga membawa adiknya dan dua ABG lainnya ke kafe Ujungbatu Rokan. Satu dari tiga ABG itu, berhasil melarikan diri berkat bantuan teman ayahnya. Enti menjelaskan, keluarganya sudahberulangkalimenghubungi pemilik kafe agar adiknya dipulangkan ke Tanjungbalai. Akan tetapi, lanjut Enti, pemilik kafe

yang pernah tinggal di Tanjungbalai, selalu berdalih bahkan mengancam keselamatan adik kandung Enti. “Entahlah, sudah bingung dan khawatir kami dengan keselamatan adikku yang baru tamat SMP itu, padahal dia mau kami daftarkan ke SMA,” kata Enti sambil menangis. Oleh sebab itu, Enti sangat berharap, pihak kepolisian segera mengusut kasus itu dan membantu memulangkan adiknya ke Tanjungbalai.“Ibukupingsandan kesurupan memikirkan keselamatan adikku. Mudah-mudahan dia belum sempat dijerumuskan pemilik kafe,” harap Enti. Sementara, salah satu korban selamat yang telah kembali ke

keluarganya, mengungkapkan, lokasi kafe tersebut berjarak 24 kilometer dari kawasan perkotaan Ujungbatu Rokan. Selama seminggudisana,katanya,mereka hanyadikasihmakansekalisehari dan tidak diberi gaji, kecuali fee sebesarRp10ribuuntuksatubotol minuman yang dibeli pelanggan. Itulah sebabnya, ketika salah satu pelanggan hendak membooking, mereka mau, karena dikira diajak makan. “Kami kelaparanterusdisana,makanyaketika dibilang mau dibooking, maulah sebab kami kira boking itu ngajak makan. Rupanya dibawa ke kamar, ya berontaklah kami,” ujar wanita berusia 18 tahun itu. Sebelumnya, tiga anak baru gede (ABG) asal Kota Tanjungbalai dipaksa menjadi pelayan kafe sekaligus pekerja seks komersial (PSK) di Ujungbatu Rokan, Riau. Ketiganya dijanjikan bekerja di rumah makan dengan gaji besar. Akan tetapi, satu dari 3 ABG itu, Senin (14/5), berhasil kabur dan pulang ke Tanjungbalai dengan bantuan teman ayahnya. (a14)

Ayah Cabuli Anak Kandung Selama Empat Bulan TANJUNGBALAI (Waspada): NelayandiKotaTanjungbalai,MA alias Ali, dilaporkan istrinya ke Polsek Seitualang Raso karena didugamencabulianakkandungnya yang masih di bawah umur selama 4 bulan berturut-turut. Kendati demikian, tersangka belum ditangkap sebab masih bekerja mencari ikan di laut. KapolresTanjungbalai AKBP EP Sirait melalui Kasubbag Humas AKPYani Sinulingga kepada Waspada, Senin (14/5) mengatakan, nelayan itu diketahui mencabuli anaknya sejak Januari 2012 di rumahnya Kec. Seitualang Raso, Kota Tanjungbalai. “Perbuatan itu berulangulang hingga pertengahan April

2012, dan menurut korban sudah terjadi sebanyak 15 kali,” kata Sinulingga, didampingi Kapolsek SeitualangRasoAKPRuslanLubis dan Kanit Reskrim Aipda Putrahir Siregar. Dijelaskan, kasus itu terungkap ketika korban datang ke rumah tantenya, Fitri. Saat itu, Fitri melihat sikap dan tubuh korban berubah drastis. Oleh sebab itu, Fitri mempertanyakan hal itu, namun korban awalnya berusaha menutupi. Akan tetapi, karena didesak terus menerus, akhirnya korbanmengungkapkan,diatelah dicabuli ayah kandungnya berulang kali di rumah dan tidak diketahui ibu kandungnya. Mendengar pengakuan kor-

ban, Fitri lantas mendatangi ibu korban dan menceritakan kejadian tersebut. Setelah mendengar cerita Fitri dan korban, ibu kandung korban melaporkan kejadian itu ke Polsek Seitualang Raso. “Hasil visum sementara, korban memang tidak hamil, namunsudahtidakperawanlagi,” jelas Sinulingga sambil menambahkan, sejumlah saksi juga telah diambil keterangannya. “Tersangka belum ditangkap karena masih di laut. Nanti begitu dia sampai di darat, langsung kita ciduk dan bawa ke Mapolres Tanjungbalai untuk diperiksa sekaligus mengungkap kasus ini,” kata Sinulingga. (a14)

Hak Angket Terkait Lahan Kantor Bupati Labusel Masih Wacana KOTAPINANG (Waspada): Penggunaan Hak Anket terkait berbagaitemuanyangdilaporkan Panitia Khusus (Pansus) DPRD Labusel untuk LKPj Bupati Labusel tahun 2011. Khususnya, menyangkut dugaan KKN pada pembelian pertapakan kantor Bupati di Jalinsum Besilam Baru, Desa Sosopan, Kec. Kotapinang senilai Rp3 milyar pada 2011 lalu masih sebatas wacana. Wakil Ketua DPRD Labusel, Rahmadikepada Waspada,Senin (14/5) mengatakan, sampai saat ini belum ada tindak lanjut terkait pembahasan persoalan pembelian pertapakan kantor Bupati seluas 10 hektare di internal DPRD. “Memang kemarin saat penyampaian laporan, Pansus meminta anggota DPRD untuk menggunakan hak anket. Tapi sejauh ini belum ada,” katanya.

Politisi Partai Golkar ini mengatakan, penggunaan hak anket dapat dilakukan jika telah ada usulan dari minimal lima orang anggota DPRD. Begitupun kata dia, seluruh hasil temuan Pansus khususnya pembelian pertapakan kantor Bupati telah rekomendasikan ke pihak-pihak yang berwajib untuk dilakukan pengusutan.“Tapisemuatemuan itu sudah kita sampaikan ke instansi terkait,” katanya. Terpisah, Ketua Forum Mahasiswa Labuhanbatu Selatan (Formulabsel), Yusuf mengatakan, DPRD temuan dan rekomendasi yang diberikan Pansus terkait pertapakan kantor Bupati terkesan gertak sambal. Meskipun masalah tersebut telah disampaikan ke instansi terkait, semestinya DPRD juga turut melakukan pembahasan

untukmembuktikanhasiltemuan Pansustersebut.“Masyarakatjuga ingintahuapabenarhasiltemuan Pansus tersebut,” katanya. Secara pribadi Yusuf juga mengaku tidak dapat percaya begitu saja terkait nilai pembelian lahan tersebut. Sebab kata dia, sebagai warga yang juga bermukim di kawasan itu, menurutnya harga pasaran tanah di daerah itutidaksemahalhargapembelian lahan tersebut. “Harga Rp3 M yang dikeluarkan Pemkab sangat tidak masuk akal,” katanya. Karenanya, dia mendesak agar DPRD segera membentuk TimKhususuntukmemintaikejelasan dari Pemkab. Dia juga mendesakaparathukumuntuksegera melakukan penyelidikan, mengingat DPRD secara kelembagaan telah merekomendasikan masalah itu ke pihak berwenang. (c18)

Asahan Disarankan Kerja Sama Dengan Port Klang KISARAN (Waspada): Meningkatkan potensi laut dan wisata, Kab. Asahan disarankan jalin kerjasama dengan Pelabuhan Port Klang, Malaysia. Sehingga, peningkatan sumber daya alam dan kesejahteraan perekonomian masyarakat dapat tercapai. Hal itu diungkapkan anggota DPD RI asal Sumut Dr. Parlindungan Purba, MM saat membuka pertandingancaturtingkatpelajar Asahan di Danau Buatan Kelapa Gading Kisaran, Senin (14/5). Menurut beliau, dalam hal inikitabutuhkanperansertapimpinan daerah, karena Asahan mempunyai potensi laut yang

cukup luas, sehingga kerjasama ini sebaiknya dijalin dan bukan hanya sekedar wacana saja. “Asahanmempunyaipotensi, sehingga untuk meningkatkan potensi itu kerja sama sebaiknya dilakukan dalam bidang kelautan dan wisata, sehingga berdampak langsung dengan kehidupan masyarakat terutama dalam bidang perekonomian yang akan terus berjalan,” ujar Parlindungan, didampingi Ketua KONI Asahan Nurkarim Nehe, dan Camat kisaran Timur, Rahmat Hidayat Siregar. Disinggung dengan keberadaan Tempat Pemberhentian Ikan (TPI) di Asahan Mati, Kec.

Tanjungbalai, Kab. Asahan, yang kini terbengkalai dan masih dikelola oleh Pemprov Sumut, Perlindungan, menjelaskan dirinya akan berkoordinasi langsung dengan instansi terkait dan bahkan sampai ke Kementerian Keluatan RI terkait penggunaan tempat itu dan bisa digunakansebaiknyadanberdasarkan kebutuhan. “Saya akan tinjau ulang siapa sebenarnyayangberhakmengelola TPI. Karena wilayah itu cukup strategis menjadi pusat industri dalam bidang hasil kekayaan laut. Dansiapapunyangberhakmengelola itu, tergantung dengan keputusan,” ujar Parlindungan. (a15)

Waspada/Syahri Ilham Siahaan

BUPATI Labura H. Kharuddin Syah, SE didampingi Kaban PMD Togap Siagian, S.Sos, MSi, Kabid Usaha Ekonomi Masyarakat Mhd Ikhsan SSTP MAP dan Dewi Budiarti menyaksikan alat dan sampah yang dimanfaatkan menjadi barang berguna di gedung DPD KNPI Labura.

Bupati Labura Tutup Diklat Tenaga Teknis Masyarakat AEKKANOPAN (Waspada): Bupati Labuhanbatu Utara (Labura) H. Kharuddin Syah, SE menutup Pendidikan dan Latihan (Diklat)Tenaga Teknis Masyarakat yang diselenggarakan Badan Pemberdayaan Masyarakat dan Pemerintahan Desa (BPMD), Selasa (15/5) yang di gedung KNPI Labura. Dalam sambutannya, Bupati meminta kepada kaum ibu agar lebih kreatif. Karena dengan kreativitas dapat menambah dan membantu perekonomian keluarga. Bupati sangat mengapresiasi pelatihan dan pendidikan pengolahan sampah menjadi barang bernilai ekonomis. “Pada masa sekarang sampah merupakan momok dan masalah yang tidak pernah dapat diselesaikan oleh setiap daerah,” kata pria yang akrab disapa H. Buyung itu, seraya menambahkan,denganpelatihandiharapkandapatmengatasi dan menanggulangi sampah dengan mengolah kembali dan menjadikannya barang bernilai. Bupati juga berharap agar pelatihan itu tidak hanya sampai di situ. Tapi ilmu yang diperoleh diharapkandapatdiaplikasikandidalamlingkungan

dan keluarga dengan memanfaatkan sampah menjadi barang berguna baik bagi diri sendiri maupun masyarakat sekitarnya. “Kita berharap seluruh rumah tangga di Labura dapat mengolah sampahnya sendiri menjadi barang bermanfaat,” ujarnya Sedangkan Ketua Panitia Muhammad Ikhsan SSTP MAP dalam laporannya menyatakan, para peserta terlihat antusias mengikuti diklat yang menghadirkan narasumber dari Medan, yang salah seorang diantaranya adalah Dewi Budiarti Teruna Jasa Said. “Semangat yang ditunjukkan para peserta selama mengikuti pelatihan sangat baik,” kata pria yang juga menjabat sebagai Kabid Usaha Ekonomi Masyarakat pada BPMD Labura itu Ikhsan juga berharap agar ke depan dapat terus melakukan pendidikan dan pelatihan sehingga mampu menghasilkan kader-kader yang pedulidenganlingkungan.“Kedepankitaberharap dapat terus melakukan pendidikan dan pelatihan sehingga melahirkan kader-kader yang peduli lingkungan,” ujarnya. (c08)

Wakil Bupati Dukung Gerakan Labuhanbatu Membaca RANTAUPRAPAT (Waspada): Wakil Bupati Labuhanbatu Suhari Pane SIP membuka secara resmi sekaligus melaunching Gerakan Labuhanbatu Membaca di Gedung Nasional Rantauprapat, Sabtu (12/5). Pada kesempatan itu juga digelar kegiatan Mendongeng dan Workshop Mendongeng bersama Kak Awam dari Kampung Dongeng, untuk para guru, mahasiswa, orangtua murid dan masyarakat umum. Wakil Bupati Suhari Pane SIP mengatakan, bahwa kegiatan seperti itu merupakan yang pertama kali diketahuinya. “Saya sangat terkesan dan menyampaikan salut kepada pantia yang telah membuat acara seperti ini,” ujarnya. Suhari menambahkan, kegiatan seperti ini adalah salah satu langkah kecil yang harus terus menerus dilakukan yang tujuan akhirnya adalah menimbulkan gemar membaca dan cinta kepada buku di kalangan anak-anak. Dengan demikian upaya kita untuk mencerdaskan anak-anak Labuhanbatu akan mudah dicapai. Beliau juga meminta seluruh sekolah di daerah iniagarmengaktifkankembaliperpustakaansekolah yanglamavakum.“Salahsatuupayamencerdaskan anak di sekolah adalah tersedianya perpustakaan di sekolah tersebut,” kata Suhari. Plt Kepala Kantor Arsip, Perpustakaan dan Dokumentasi H. Muhammad Idris Lubis dalam

sambutannya mengatakan, pihaknya membuka tangan bagi siapa saja yang ingin membaca dan meminjam buku atau sekedar berkunjung dan meninjau keberadaan Perpustakaan Daerah Labuhanbatu. Di Perpustakaan Daerah juga tersedia Mobil Perpustakaan Keliling yang dapat menjangkau seluruh Labuhanbatu. Pelayanan dengan perpustakaan keliling ini kami maksudkan untuk melayani daerah-daerah yang belum memiliki perpustakaan desa atau sekolah-sekolah pada saat jam istirahat. “Perpustakaan Keliling yang diperoleh dari bantuan Perpustakaan Nasional itu siap melayani siapa saja yang membutuhkan buku bacaan dari berbagai disiplin ilmu. Semuanya disediakan dengan gratis” katanya. Sebelumnya Koordinator Penyelenggara Tatang Hidayat mengatakan, Gerakan Labuhanbatu Membaca itu merupakan hasil diskusi dari beberapa kalangan yang merasa terusik oleh kurangnya minat baca di kalangan anak-anak dan masyarakat Labuhanbatu. Dari diskusi itu, kata Tatang, timbul ide untuk melahirkan gerakan gemar membaca yang diawali dengan Gerakan Gemar Bercerita/ Mendongeng. “Harapan kami gerakan membaca dan mendongeng ini akan menimbulkan minat baca anak-anak kita,” ujar Tatang. (c07)

Sister City T. Balai-Port Klang Kembali Dibahas TANJUNGBALAI (Waspada): Rencana pembentukan kota kembar atau sister city antara Kota Tanjungbalai, Indonesia dengan Port Klang, Selangor, Malaysia, kembali dijajaki oleh kedua belah pihak bertempat di aula Kantor Wali Kota Tanjungbalai, Senin (/14/5). Acara itu dihadiri pengusaha asal Port Klang, Datok Sahari,WakilWali Kota Tanjungbalai Rolel Harahap dan Ketua DPRD T. Balai Romay Noor. Kemudian pengusaha asal Tanjungbalai H. Rusli Mansyur, Manajer Pelindo I Cab. TanjungbalaiAsahan Edi Agustri dan Kepala Administrator Pelabuhan Arosokhi Nazara dan Anggota Dewan Perwakilan Daerah RI (DPD RI) utusan Sumut, Parlindungan Purba yang juga aktor penggagas pertemuan bersejarah itu. Dalamsambutannya,RolelHarahapmengatakan dengan terwujudnya rencana pembangunan sister city,makahubunganantarakeduadaerahyangsecara geografis dan kultural masih berdekatan itu akan semakin nyata. Terutama dalam hal peningkatan perekonomian penduduk kedua daerah. Dikatakan, cikal bakal pembentukan sister city akan diawali dengan konsep sister port (pelabuhankembar)antaraPelabuhanTeluknibung dengan Port Klang. Namun semua itu masih terkendala dengan peraturan dan undang-undang Pemerintah Pusat. “Untuk itulah kami berharap Parlindungan Purba dapat membantu kami memperjuangkan rencana ini ke Pemerintah Pusat di Jakarta, agar sister city dapat terwujud dalam waktu yang tidak terlalu lama,” harap Rolel. Menanggapi harapan itu, Parlindungan Purba yang juga menjabat Ketua Asosiasi Pengusaha Indonesia (Apindo) Sumut mengatakan, sebagai anggota DPD yang dipilih langsung oleh rakyat,

merupakan kewajiban baginya menyampaikan segala persoalan masyarakat terutama bidang sosial dan ekonomi, hingga ke tingkat menteri. Sehingga, katanya, sister city segera terwujud dan berdampak positif pada sektor pembangunan kedua daerah. Di samping akan berdampak langsung terhadap peningkatan pendapatan (income) penduduk serta mengurangi angka pengangguran dan tingkat kemiskinan. “Saya mendukung penuh rencana ini, sebab dengan terwujudnya hubungan antara kedua daerah yang terletak di Kawasan Selat Malaka, tentu akan berdampak terhadap kemajuan beberapa sektor terutama pembangunan di Tanjungbalai,” papar Parlindungan. Sementara, Datok Sahari berharap kerjasama itu dapat berjalan sesuai rencana. Dikatakan pengusaha yang membangun pelabuhan Port Kelang itu, Pemerintah Kota Tanjungbalai tidak perlu khawatir soal pembiayaan karena semua sudah disiapkan oleh pengusaha. Dalamkesempatanitu,diajugamenaruhharapan besarkepadasahabatkaribnyaParlindunganPurba supaya dapat melobby Pemerintah Pusat. Diterangkan Datok Sahari, Pelabuhan Port Klang, Malaysia dibangun bukan dari dana Kerajaan melainkan dana pribadinya yang telah menelan biaya lebih dari Rp200 miliar. “Inilah yang akan saya perbuat untuk KotaTanjungbalai, karena kota ini sudah saya anggap kampung saya sendiri,” kata Datok Sahari. Hal senada juga diungkapkan H. Rusli sebagai pengusaha asal Kota Tanjungbalai. Menurutnya, cukup banyak potensi yang dapat digali di ‘kota kerang’ itu karenaTanjungbalai merupakan pintu masuk utama dari Malaysia ke Sumut. (a32)

Pembiaran Galian Pasir Kuarsa Akan Memicu Bentrok

Waspada/Sapriadi

ANGGOTA DPD RI Asal Sumut Dr. Parlindungan Purba MM, didampingi Ketua Umum KONI Asahan yang juga Kepala Perwakilan Waspada Kisaran Nurkarim Nehe sedang memperhatikan peta kondisi geografis dan wilayah laut Kab. Asahan dan Kota Tanjungbalai melalui jasa internet.

LIMAPULUH(Waspada): Penggalian pasir kuarsa di Desa Gambus Laut, Kec. Limapuluh, Kab. Batubara yang terkesan dibiarkan oleh aparat pemerintah maupun aparat keamanan, sama dengan membiarkan masyarakat bentrok dengan pengusaha atau pengawalnya. Demikian disampaikan Ketua LSM Komunitas Anak Nelayan (Kail) Batubara Azizi kepada Waspada, Selasa (15/5) usai melihat terus beroperasinya alat berat PT.J, yang hingga siang sedikitnya telah mengeluarkan 70 dump truk pasir, meskipun Senin (14/5) sore unsur Muspika Kec. Limapuluh turun ke lokasi. “Hendaknya aparat penegak hukum segera mengambil tindakan atas pelanggaran UU nomor 41 tahun 1999 tentang kehutanan yang melarang orang memasukkan alat berat kedalam kawasan hutan, juga melarang melakukan eksplorasi bahan tambang,” tukas Azizi.

Menurut warga setempat, Salim A Miko, jarak antaralokasipenggaliandenganbibirpantaitinggal sekitar 800 meter. Dari sekitar 25 hektare lahan yang dikuasai PT.J, 2 hektare diantaranya telah digali untuk mengambil pasir kuarsanya. Pengaruhpenggalianpasirkuarsaberskalabesar ini terhadap sumber air tawar warga, menurutnya, sejumlahsumurkinitelahberairpayau.Begitujuga denganairsungaiyangbiasanyapadapasangbesar tidakberubahrasanya,jugasudahberubahmenjadi payau. Dari data yang diperoleh dari Dishut Batubara, kawasan hutan Batubara sesuai SK Menhut No 44 tahun 2005 yang ditunjuk seluas 19.653 hektare. 16.988,21 Hektar e diusulkan untuk dikeluarkan dari kawasan hutan. Kapolres Asahan AKBP Yustan Alpiani saat dihubungi via pesan singkat menyatakan akan mencek kabar yang berkembang tentang penggalian pasir di Gambus Laut tersebut. (c05)


Sumatera Utara

WASPADA Rabu 16 Mei 2012

B3

Pejabat Impor ‘Serbu’ Tapsel MEDAN (Waspada): Sekarang ini sejumlah aparatur dari luar Tapanuli Selatan (Tapsel) seperti ‘menyerbu’ untuk mendapat jabatan di Pemkab Tapsel. Tak heran, kalau kondisi ini membuat gerah aparatur lokal yang selama ini berusaha menunjukkan kinerja baik. “Wajarsajakalauinimengundang kecemburuan. Bayangkan, sudah bekerja maksimal dan menunjukkan kinerja sebaikbaiknya, tapi yang menduduki posisi tertentu justru harus didatangkan dari luar daerah. Apakah kualitas aparatur lokal di Tapsel kurang memadai sehingga harus‘diimpor’ dari luar daerah,” ujar Ketua Umum Persatuan Anak Rantau Tapanuli Bagian Selatan (PAR-Tabagsel) Mhd Yamin Daulay, SE kepada Waspada di Medan dengan nada bertanya, Selasa (15/5). Dijelaskannya, pada prinsipnya, aparatur memang seharusnya bekerja sesuai tugas pokok

dan fungsinya sebaik-baiknya, tanpa mengharapkan jabatan. “Tapi itu teorinya. Praktiknya kan banyak orang bertanya-tanya, apa sih keunggulan pejabat yang didatangkan dari luar daerah dibandingkan dengan pejabat yang sekarang ada di Tapsel,” ujarnya lagi. Kemudian, Yamin yang juga mantan Presiden Mahasiswa Universitas Pancabudi ini mengungkapkan, sekarang ini di Tapseldikabarkanbanyakpejabat dijadikan pelaksana tugas (Plt). Padahal, tentu saja status Plt tidak sama dengan pejabat defenitif. “Sayakira,inijugaperluditeliti lebihjauh,kenapabanyakpejabat

di PemkabTapsel statusnya terus Plt. Ada apa?,” ujarnya sambil menyampaikan keprihatinannya karenasaatinisudahlebihsatubulan jabatan Sekda Tapsel kosong. Bayangkan, sudah hampir dua tahun kepemimpinan Syahrul M Pasaribu di Tapsel, belum pernah ada pejabat Sekretaris Daerahyangdepenitif.Semuanya Pelaksana Tugas (Plt), bahkan pernah Pelaksana Harian (Plh). Sumber di Tapsel mengungkapkan, sejumlah jabatan pimpinan SKPD yang sejak lama di Pltkan mulai diisi oleh para pegawai dari luar daerah. Sepertinya, PemkabTapsel sekarang menjadi lahan empuk untuk diserbu pegawai luar daerah. Padahal, masih ada pegawai Tapsel yang mampu dan layak untuk menempatinya. “Kepala Bappeda kini ditempati Aswan Hasibuan dari Madina,KadisDukcapilolehParulian Nasution yang juga dari Madina.

TARUTUNG (Waspada): Puluhan petugas dari Satpol PP, DinasKebersihandanDinasPasar Kabupaten Tapanuli Utara (Taput), Selasa (15/5) menertibkan para PKL (pedagang kaki lima) yang berjualan di badan jalan di Kota Siborongborong. Namunparapedangangyang berjualan setiap hari pekan (Selasa) di Siborongborong tersebut, tidak mau digusur karena mereka tidak mau kehilangan manta pencahariandanbahkanmengaku telah membayar retribusi. “Kami tidak mau digusur dari tempat ini. Sudah bertahuntahun berjualan di sini. Ini tidak adil. Apapun ceritanya kami tidak mau masuk untuk berjualan ke

dalam pajak. Para pelanggan sudah tahu di sini tempat kami. Maka jangan paksa kami,” ujar salah seorang PKL yang mengaku bermarga Nababan. Kepada petugas, Nababan menyebut, setiap Selasa mereka selalu dikutip retribusi oleh petugasUPTDinasPasarSibororngborong. Di sinilah sumber mata pencaharian kami. Maka tidak adaalasanSatpolPP,apalagiDinas Pasar untuk mengusir kami supaya tidak berjualan di sini. Apapun itu, kami menolaknya, ujar Nababan dengan suara keras. Namunbegitu,petugasSatpol PP yang diturunkan ke Pasar Siborongborong tetap melakukan penertiban di sekitar terminal

Siborongborong. Sementara salah seorang penduduk Kota Siborongborong, B Sihombing mengaku bangga atas dilakukannya penertiban PKL karena setiap hari pekan di Siborongborong selalu macet total setiap kendaraan yang melintas di Jalinsum Siborongborong. “Kami penduduk Siborongborong menyambut program Dinas Pasar Kabupaten Taput untuk penertiban PKL yang berjualan di badan jalan. Tetapi polanya kurang maksimal karena para pedagang masih tetap berjualan di Jl. Sanif, Jl. Horas, Jl.Damedandibelakangterminal, sementara masih banyak lapak/ kios yang kosong di dalam pajak,”

Asisten III ditempati Hamdan NasutiondariSimalungun,Kabag Pembangunan ditempati Balyan Bonar dari Padangsidimpuan,” jelasnya. Menurut sumber, masih ada lagi jabatan eselon II dan III yang sudah dan akan ditempati pegawai daerah lain seperti Simalungun dan Medan. Informasi diperolehnya, ada pegawai Pemko Medan bernama Mulya Nasution yang kini menjabat Kepala Bidang di Dinas PU, renca awalnya akan diplot menjadi Kadis PU, tapi sampai saat ini belum terealisasi. “Sampai saat ini jabatan yang di Plt-kan antara lain, Kadis PU yang dirangkap Kadis Tarukim. Kadis Perhubungan dirangkap Sekretaris Dewan, Kakan Pelayanan Terpadu Satu Pintu dirangkap Kepala Badan Lingkungan Hidup, dan masih banyak lagi di tingkat eselon III dan IV,” ujar sumber.

Bupati Tapsel, Syahrul M Pasaribu yang dikonfirmasi lewat Kabag Humas, Ahmad Fauzi M Ritonga, via telepon membenarkan masih ada jabatan eselon yang di Plt-kan. Tapi hingga kini semua urusan birokrasi pemerintahan berjalan lancar, aman, dan terkandali. Menurutnya dalam waktu dekat akan ada pendepenitifan pejabat, karena saat ini Bupati bersama Baperjakat masih melakukan analisa tentang siapa pegawai yang tepat dan dianggap mampu untuk menempati jabatan tersebut. Selain jabatan Sekda, semenjakkepemimpinanSyahrulcukup banyak jabatan strategis yang tidak memiliki pejabat, dan selama ini di Plt-kan atau dijabat rangkap oleh salah seorang pimpinanSKPD.“Tentusajawajar kalau banyak orang bertanyatanya, ini kenapa. Ada apa,” ujar Yamin. (ihn/a27)

Tunggak Rekening Rp1,8 M

ujar Sihombing dan menyebutkan, warga di seputar kota sangat sulit untuk pulang ke rumahnya karena pedagang berjualan di badan jalan dan kaki lima. Kakan Satpol PP Taput Rudy Sitorus, S.Sos yang dihubungi Waspada, Selasa (15/5) menegaskan, pihaknya sudah menjadwalkan penertiban PKL di Kota Siborongborong. “Ini masih penertiban awal. Makanya dilakukan hanya diseputar terminal Siborongborong.Pekandepanditempat lainnya sehingga berangsurangsur dapat ditertibkan. Apalagi yang berjualan di badan jalan dan di pinggir Jalinsum Siborongborong. Setiap pekan (hari Selasa) selalu macet jika mau melintas

dari daerah ini. Jika dibiarkan bisa saja memakan korban,” ujar Sitorus. Sementara Kepala UPT Pasar Siborongborong,ISimamorasaat dihubungi seputar hasil penertiban dan pengutipan retribusi dari PKL, tidak mau berkomentar danterlihatsibukberbaurdengan pedagang yang mulai membubarkan diri dan mengangkat barang jualannya. Pantawan Waspada petugas hanya menertibkan pedagang kopi yang berjualan di terminal Siborongborong.Sedangkanyang berjualan di pinggir Jalinsum, di badan Jl. Sanif, belakang terminal, Jl. Baktiar, Jl. Horas dan Jl. Dame, belum ditertibkan. (a21)

KABANJAHE ( Waspada): Pemerintah Kabupaten (Pemkab) Karo menunggak rekening listrik kepada pihak PLN Cabang Kabanjahe. Tunggakan tersebut mencapai Rp1,8 Miliar, terhitung sejak Desember tahun 2011 lalu. Jika tidak dilakukan pembayaran secepatnya, PLN akan segera memutus aliran listrik. “Jika tidak dibayar hingga Juni mendatang, akan dilakukan pemutusan listrik,” ujar Kepala PLN Ranting Kabanjahe, Tetty Tambunan, saat dikonfirmasi melalui ponselnya, Selasa (15/5). Dikatakan, pihaknya telah melayangkan surat pemberitahuan ke Pemkab Karo untuk segera melunasi utangnya.Tetapi, PLN Kabanjahe belum menerima balasan kapan pembayaran tagihan listrik yang meliputi sekretariat kantor Bupati, Lampu Penerangan Jalan Umum (LPJU) dan

Waspada/ Dede Basri Hasibuan

KANTOR Bupati Karo tampak megah yang dibangun dengan uang rakyat Rp1,8 miliar pada 2008, namun saat ini Pemkab Karo menunggak rekening listrik sejak Desember 2011 senilai Rp1,8 miliar.

PKL Siborongborong Tolak Penertiban Satpol PP Listrik Pemkab Karo Terancam Diputus Gedung DPRD itu akan dibayar. Kabid Humas Pemkab Karo, Jhonson Tarigan membenarkan hal tersebut. Ia mengaku pembayaran akan segera dilakukan setelah APBD Karo selesai diasistensi di Provinsi Sumut. “Jika sudah selesai, akan segera dilunasi,” katanya. Salah seorang warga Kabanjahe, J. Sembiring menyesalkankejadianini.Ketikaseorangpelanggan umum yang belum membayarkan tiga bulan berturut-turut, imbuhnya, harus menerima sanksi pemutusan dari perusahaan BUMN yang membidangi kelistrikan tersebut. “Jika masyarakat yang menunggak, langsung diambil kebijakan secara sepihak oleh PLN. Menurut mereka itu merupakan, aturan perusahaan.Tetapi bagaimana dengan tunggakan listrik Pemkab Karo,” tukasnya. (cal/a36/c19)

Sumut Cemerlang Jaring Gubsu 2013 Mulai Dari P. Sidimpuan Belasan Ribu Anak SD Diduga Cacingan P. SIDIMPUAN (Waspada): Sumut Cemerlang, salah satu komunitas sosial, mencoba menjaringfigurcalongubernurSumut 2013 dengan lebih dulu digelar dari Padangsidimpuan, akhir pekan lalu. KetuaSumutCemerlangDaudsyah kepada Waspada mengatakan Sumut Cemerlang bukan partai politik tapi sejenis komunitassosialbiasayangdidalamnya ada pekerja, pegawai, dosen, mahasiwa dan kelompok lain. Sumut Cemerlang, kata dia, lahir dari diskusi kecil di lingkungan FE Universitas Islam Sumut berlanjut ke perguruan tinggi

lainnya. Sumut Cemerlang (SC) kemudian dideklarasikan sebagai organisasi yang menjaring tokoh masyarakatyangmemilikikriteria dan integritas yang cerdas, merakyat, jujur dan visioner. Tujuannya sosok itu mampu membawa Sumut makmur, maju, mandiri dan bermartabat, tuturnya.Mengawalikegiatannya SC menjaring Cagubsu 2013 di Padangsidimpuan dengan menggelar dialog interaktif antar mahasiswa se-Tabagsel. SC mengundang 13 perguruan tinggi yang ada di Tapsel diantaranya UMTS, STAIN, UGN, STKIP, STIE Kampus, Universitas

Mobil Kades Cikaok Tabrakan KABANJAHE (Waspada): Mobil CRV warna hitam BK 555 J yang dikendarai Kepala Desa (Kades) Cikaok Kec. Sitellutali Urang Julu, Kab. Pakpak Bharat, tabrakan dengan pengendara sepedamotor tanpa plat nomor oleh Nando, warga Desa Sumbul Kec. Kabanjahe Kab. Tanah Karo di ruas jalan Djamin Ginting. Supir sempat dipukuli massa. “Mobil yang dikemudikan oleh sopir Eksaudi melaju dengan kecepatan biasa dari arah Medan menuju Kabupaten Pakpak Bharat, namun entah bagaimana tiba-tiba sepedamotor yang dikendarai pria seorang diri datang dari Kabanjahe tersengol kami. Lantas terjadi tabrakan, dan pengendara sepedamotor langsung dilarikan ke Rumah Sakit Umum Efarina Berastagi,” terang Kades, Ernatus Berutu, 52, kepada Waspada, Selasa (15/5) pagi. Dikatakannya, mereka di dalam mobil bertiga, bersama istri, Rispa Simbolon, 50, dan sopir bergerak dari Medan ke Pakpak Bharat. Supir yang sempat dimassa melarikan diri dan Kades menyelamatkan diri ke Kantor Satlantas Kabanjahe. Amatan Waspada di lokasi, sepedamotor yang masih baru sekira satu bulan dikendarai korban tampak ringsek parah pada bagian depan, dengan posisi ban depan lepas, dan terbelah pada bagian lampu. Sementara mobil Kades mengalami ban lepas sebelah kanan. Korban yang luka pada bagian wajah, tangan dan kaki masih mendapatkan perawatan intensif di RSU Efarina. Kasat Lantas AKP Radu Sembiring ketika dikonfirmasi melalui telepon seluler mengatakan, memang benar ada Lakalantas, namun tidak ada korban jiwa dalam kecelakaan tersebut. (c19)

Black Campaign Mulai Di P.Sidimpuan P.SIDIMPUAN (Waspada): Sepekan terakhir ini warga Padangsidimpuan mulai disuguhi isu-isu negatif (black campain) tentang pribadi, tabiat, pekerjaan, dan pergaulan masing-masing kandidat calon wali kota. “Tapi sasarannya justru para calon berusia relatif muda. Muncul opini seolah-olah isu negatif ini datangnya dari para calon yang usianya lebih tua,” kata Asroi Siregar, pemerhati sosial masyarakat Padangsidimpuan, Senin (14/5). Selain dari mulut ke mulut, black campaign juga muncul di jejaring sosial Facebook.Seperti di grup Forum Rakyat Pasid, pengguna akun bernama Jelang Pilkada Sumut memunculkan status yang mengarah pada ‘pembusukan’ balon wali tertentu dan keluarganya. Meski demikian, bukan berarti calon wali kota yang usianya lebih tua dari mereka tidak mendapat serangan. Isu negatif juga menimpa beberapa calon lainnya. Hanya saja, tidak segencar yang dialami para kandidat calon yang berusia relatif lebih muda. “Hingga kini saya belum menemukan fakta apakah pembusukan itu datangnya dari kandidat yang relatif lebih tua, namun opini sudah mengarahkesana.Tapiperlujugadicermati,bisasajaisuinimunculnya dari sesama calon yang berusia muda. Tapi juga bisa muncul dari mana saja,” terangnya. (a27)

Delleng Raja Butuh Penghijauan PAKPAK BHARAT (Waspada): Kawasan Delleng Raja kawasan hutan yang berada di sekitar Kota Salak ibukota Kabupaten Pakpak Bharat, dalam rangka menjaga kelestarian lingkungan membutuhkan perlindungan dan penghijauan. Pasalnya, dalam beberapa tahun terakhir, menurut pengakuan petani di kaki bukit Delleng Raja, aliran air mengalami penurunan Debit. Petani Napatolong sekitar Delleng Raja E. Boangmanalu kepada Waspada, Senin (14/5) mengakui, jika tidak dilakukan upaya penghijauan maka dikhawatirkan persawahan yang ada di sepanjang kaki Delleng Raja akan mengering. “Sejak beberapa tahun terakhir debit air dari Delleng Raja semakin mengecil bahkan pada saat kemarau dua minggu saja air dari Gunung Delleng Raja sudah terhenti,” ujar Boangmanalu. Warga sekitar berharap Pemkab Pakpak Bharat melalui instansi terkait dapat melakukan upaya penghijauan khususnya di daerah aliran sungai yang terdapat di lereng-lereng gunung tersebut. (csb)

Benteng Huraba, Pertinu, Akbid Sentral, Akbid Syuhada dan lainnya yang digelar di SMK-1 Padangsidimpuan. Dalam dialog itu Sumut Cemerlang menghadirkan pembicara Dekan Fakultas Sospol UGN Yusril Harputra Damanik dan Ketua Prodi Bahasa Inggeris FKIP UGN Yuswin. “Hasildialogininantinyamenjadi acuan Sumut Cemerlang menetapkan figur pimpinan ke depan menuju Sumut gemilang,” kata Daudsyah. Yusrildalamdialogitumengatakan Gubsu ke depan harus mempunyai visi dan misi yang jelas. Mencari terobosan baru karena harus mampu mengikuti perkembangan zaman dan teknologi, tuturnya. Kemudian mampu memasyarakatkan nilai-nilai budaya yang harus diangkat dan berkembang di masyarakat sebagai bagian dari kehidupan masyarakat. “Kepemimpinan itu laksana gunung es yang nampak di permukaan. Seorang pemimpin harus mempunyai keterampilan dengan persentase 10 persen skill dansisanya90persenknowledge.”

Waspada/Armin Nasution

PARA pembicara dialog interaktif yang digagas Sumut Cemerlang membahas kriteria Gubsu 2013 akhir pekan lalu. Pemimpinitu,kataYusril,juga harusmemilikisifatasah,asihdan asuhuntukmengayomidanmembimbingrakyatSumut.Sementara ituDaudsyahmenambahkanatas pelaksanaan dialog interaktif itu mengucapkanterimakasihkepada insiatordanpenggagasacarayang telah bersusah payah. DiamenegaskankataCemerlang yang diambil organisasinya merupakan singkatan dari cerdas, merakyat dan jujur sehingga

mampu membawa Sumut yang gemilang. Pantauan wartawan di lokasi dialog yang melibatkan semua unsur mahasiswa Tabagsel itu, mereka mendefinisikan kriteria pemimpin Sumut lima tahun ke depan yang ditawarkan Sumut Cemerlang yang akan disusun dalam bentuk pernyataan sikap yang mengatasnamakan mahasiswa 13 perguruan tinggi tersebut.(m06)

Unpri - Pemkab Nisel Teken MoU

Siswa Berprestasi Nisel Diterima Di FK Unpri MEDAN (Waspada): Pemerintah Kabupaten Nias Selatan (Nisel) mempercayakan putraputri berprestasi untuk kuliah di Fakultas Kedoteran (FK) UniversitasPrimaIndonesia(Unpri).Hal tersebut ditandai dengan adanya kerjasama (MoU) antara Unpri dengan Pemkab Nisel, di kampus tersebut Jalan Belanga Ayahanda Medan, kemarin. Penandatanganan MoU itu dilakukan Kepala Dinas Pendidikan Nias Selatan Dra. Magdalena Bago, SPd, MM, MBA dan Rektor Unpri Prof. Djakobus Tarigan disaksikan KetuaYayasan Perguruan Unpri dr. I Nyoman Ehrich Lister, MKes, AIFM, Ketua BPH Unpri Tommy Leonard, SH, MKn, Wakil Rektor II Ermi Girsang, SKM, MKes, dan Dekan FK Unpri dr. Firman Sitepu, SpA. Magdalena Bago mengatakan, pihaknya mempercayakan anak-anak yang mendapat beasiswa tersebut untuk menimba ilmu di FK Unpri. Program gratis pendidikan di Nisel ini dilakukan untuk anak-anak didik mulai dari tingkat TK, SD, SMP, SMA dan SMK bahkan perguruan tinggi. “Untuk memajukan Nisel, PemkabNiselmembuatprogram mengirimkan putra putri Nisel terbaik yang berprestasi tingkat SMA, untuk kuliah di luar Nisel, terutamadiuniversitas-universitas yang kita anggap cukup baik untuk mendidik anak-anak kita di berbagai fakultas dan salah satunya adalah di FK Unpri. Hal ini, merupakan suatu kebutuhan daerah terutama di Kabupaten Nisel,” katanya. Karena untuk membiayai anak-anak ini memakai uang pemerintah/uang negara dalam bentuk beasiswa, dari segi akademikpihaknyasangatselektif dalam memilih universitas. “Dan pilihan kami adalah Unpri,”

tegasnya seraya mengatakan, FK Unpri sudah terakreditasi. Menurutnya,FakultasKedokteran Unpri sangat tepat untuk anak didik tersebut. Sebab, FK Unpri memiliki Rumah Sakit Pendidikan sendiri dan memiliki Rumah Sakit Gigi dan Mulut sendiri, dan lokasinya pun berada didalamlingkungankampus.Hal ini juga, sangat memudahkan mahasiswa Pihaknya yakin, Unpri mempunyai kemampuan mendidik putra-putri Nisel. Mudah-mudahan kerjasama ini bisa terlaksana dengan baik, dengan lancar dan akan membawa kesejahteraan masyarakat Nisel, bukan hanya di Nisel saja bahkan di seluruh Sumatera Utara. Tahap pertama, katanya, tahun ini dalam penerimaan mahasiswa baru, Pemkab Nisel akan mulai memasukkan anak-

anak dari Nisel tersebut. “Kami berharappeluangataukuotayang diberikan untuk kami di masa yang akan datang lebih banyak dari sebelumnya, karena kami mempunyai alasan semata-mata untuk kebutuhan dasar. Sehubungan dengan ini, pemerintah sudah menyediakan dana untuk 50 orang siswa,” katanya seraya mengatakan, Pemkab Nisel juga sudah melakukan MoU dengan USU dan Unimed. Ketua Yayasan Perguruan Unpri I Nyoman Ehrich Lister menyatakan, pada prinsipnya Unpri menyambut baik kerjasama dalam rangka beasiswa anakanak didik dari Nisel. Karena Nisel kabupaten baru dan sedang berkembang,diperlukanSumberDaya Manusia (SDM) terutama bidang kesehatan. “Kami akan mendidik anak-anakyangdititipkankepada kami,” tegasnya. (m41)

Waspada/Ist

KEPALA Dinas Pendidikan Nias Selatan Dra. Magdalena Bago (kiri) dan Rektor Unpri Prof.Djakobus Tarigan (kanan) menyerahkan berkas MoU, disaksikan Ketua Yayasan Perguruan Unpri dr. I Nyoman Ehrich Lister, Dekan FK Unpri dr. Firman Sitepu dan Wakil Rektor II Ermi Girsang.

P. SIDIMPUAN (Waspada): Diduga menderita cacingan, belasan ribu murid SD di pinggiran Kota Padangsidimpuan mengalami penurunan minat belajar di kelas. Demikian dikeluhkan sejumlah guru SD. Keluhan itu juga yang disampaikan satu guru SDNdipinggirankotaPadangsidimpuan,SitiMarini, 45, ketika ditemui Waspada, Selasa (15/5) pukul 10:00. Dia menjelaskan, sejumlah murid didiknya sering mengantuk dan menggaruk-garuk bagian anusnya ketika belajar berlangsung. ‘’Banyak anak didik saya sering mengantuk di kelas. Juga sering menggaruk-garuk bagian anusnya ketika belajar sedang berlangsung,” ujarnya. Ironisnya, lanjut dia, para murid ini banyak ditemui di kelas empat. Mereka justru belum sanggup membaca,. “Saya kira itu salah satu faktornya karena cacingan dan kurangnya konsentrasi murid menerima ilmu pelajaran yang kami sampaikan,’’ tutur Siti. Diungkapkan, seharusnya Pemko Padangsidimpuan sesegera mungkin menyikapi wabah cacingan yang diduga menjamur bagi sejumlah murid SD di kota pelajarnya Sumut ini, sehingga faktor minat belajar bagi murid SD khususnya

tidak akan menurun dari tahun ke tahun dibandingakan SD swasta favorit. Kadiskes Kota Padangsidimpuan, drg. Hj. Doria Hafni Lubis saat dikonfirmasi terkait belasan ribu murid SD yang diduga mengalami wabah cacingan membenarkan hal tersebut. ‘’Memang jumlah murid SD di pinggiran Kota Padangsidimpuan yang terjangkit cacingan diprediksi tahun 2012 ini mencapai belasan ribu murid. Menurut data 2011 silam, angka murid SD di pinggiran kota mencapai 13 ribu murid SD,’’ujarnya saat ditemui di Puskesmas Sadabuan. Namun, ujar Kadis berjilbab itu, faktor cacingan disebabkan minimnya asupan gizi bagi si anak dan kurangnya menjaga kebersihan tangan ketika hendak mengonsumsi makanan. ‘’Seharusnya sebelum menyantap makanan, telapak tangan harus dicuci memakai sabun. Gunanya agar kuman di telapak tangan mati dari penggunaan sabun setiap kali makan,’’ paparnya. Selain itu terangnya, setiap enam bulan sekali dibeberapaSDyangadadiKotaPadangsidimpuan programpemberantasancacingansudahdigulirkan melalui dinas kesehatan. Program itu dengan memberikanobatcacingkepadasetiapmuridyang dikunjungi di berbagai sekolah SD. (c13)

MAN 1 P. Sidimpuan Ukir Berbagai Prestasi PADANGSIDIMPUAN (Waspada): Madrasah Aliyah Negeri 1 Padangsidimpuan berhasil mengukir prestasi membanggakan di bidang olahraga dan kegiatan lain dalam rangka Hari Pendidikan Nasional yang diserahkan Wali Kota PadangsidimpuanDrs.ZulkarnainNasutiondalam satu acara di Stadion H. M. Nurdin Padangsidimpuan, baru baru ini. Wali kota mengatakan, jika melihat sejarah masa lalu, Kota Padangsidimpuan merupakan gudangnya atlet, yang mampu bertengger di tingkat nasional, ini merupakan kenyataan yang tidak dapat disangkal. “Cukup banyak putra/putri daerah kita ini yang menorehkan sejarah dalam berbagai even nasional, termasuk dalam pekan olah raga nasional. Masih segar dalam ingatan kita petinju Anwar Harahap, pegulat Usman Rangkuti, pelari Marhamah, Zulkarnain Harahap dll. Karena itu generasi muda diminta untuk mengembalikan masa jaya itu, dengan menekuni bidang masingmasing disertai latihan dan disiplin,” ujar wali kota. Dalamkesempatanterpisah,KepalaMadrasah

Aliyah Negeri 1 Padangsidimpuan Syafii Hasibuan didamping Wakil Kepala Sekolah Bidang Kurikulum Mahartua Siregar dan Wakil Kepala Sekolah Bidang Kesiswaan Jannes Sihombing, usai menyerahkan piala kepada siswa, Senin (14/ 5)diAulaMAN1mengatakan,pembinaanberbagai bidang olahraga di sekolah tersebut dilaksanakan secara berkesinambungan. “Sehingga dalam berbagai even olahraga yang dilaksanakan di Kota Salak sebagai julukan Kota Padangsidimpuan, MAN 1 jarang ketinggaalan dantetapmendapatjuara,karenaitukitaberharap, arahanWaliKotaPadangsidimpuan Drs.Zulkarnain Nasution semakin memotivasi siswa ke depan. Kejuaraan yang diraih, turnamen tenis meja simpang 3 Kamcar Cup II, juara I tunggal putri Desy Anggraeni kelas XI IPS I, juara I kategori eksekutif juara I H. Syafi’I Hasibuan/M.Daud Lubis, bola basket juara I putri, juara 3 putra, juara umum putri dengan memperoleh piala bergilir tahun 2012. Juara II cerdas cermat tingkat SMA/MA, Siti Khadijah juara I olimpiade sains bidang studi kebumian, Fadli Akbar juara II olimpiade bidang studi matematika. (a26)

Anggaran Akta Lahir Anak PA Ditampung Di APBD SIMALUNGUN ( Waspada): Pemkab Simalungun akan mengajukan usulan anggaran pembuatan akta kelahiran gratis bagi anak-anak penghuni Panti Asuhan (PA) untuk ditampung pada APBD TA 2013 mendatang. Bupati Simalungun, JR Saragih, mengemukakan hal itu menyikapi saran Ketua DPRD Simalungun, Binton Tindaon, pada acara sidang lapangan untuk penerbitan akta kelahiran, bagi anak-anak penghuni PA yang telah berusia lebih satu tahun, di Panti Asuhan Harapan Jaya, Nagori Laras II, Kec. Siantar. “Saya mengapresiasi usulan Ketua DPRD, yang menyarankan supaya Pemkab Simalungun mengusulkan anggaran untuk penerbitan akta kelahiran bagi anak-anak PA ditampung di APBD, sehingga anak-anak di panti asuhan memiliki dokumen kependudukan yang diperlukan untuk administrasi pendidikan atau mencari pekerjaan nantinya,” ujar bupati. Karenanya, Pemkab Simalungun juga sangat mengharapkan komitmen legislatif supaya anggaran untuk penerbitan akta kelahiran gratis bagi anak-anak PA, dapat ditampung pada APBD TA 2013 mendatang.

SebelumnyaKetuaDPRDSimalungun,Binton Tindaon dalam acara tersebut mengharapkan Pemkab Simalungun terus meningkatkan kepedulianterhadapanak-anakpenghunipantiasuhan, termasuk diantaranya dengan mengalokasikan anggaran untuk penerbitan akta kelahiran bagi mereka. Bintonpadakesempatanitujugamemberikan bantuankepadaenampantiasuhanyanghadirdalam acara tersebut,masing-masing sebesar Rp 1 juta yang diharapkannya bermanfaat untuk mereka. Kepala Dinas Kependudukan dan Catatan Sipil, Albert Sinaga, mengatakan sidang lapangan penerbitan akta kelahiran bagi anak-anak yang berusia di atas satu tahun merupakan kali kedua digelar setelah beberapa waktu lalu juga dilaksanakan di Desa Cingkes Kecamatan Dolok Silou untuk 625 pemohon. Ketua PN Simalungun, Abdul Siboro dalam kesempatan itu mengatakan sidang lapangan untuk penerbitan akta kelahiran bagi anak-anak berusia di atas satu tahun dipanti asuhan merupakan upaya memberikan pelayanan hukum dan hak yang sama bagi anak-anak PA dalam pengurusan akta kelahiran. (a29)


Opini

B4 TAJUK RENCANA

Pembangunan Masjid Al Ikhlas Berkah Perjuangan Dan Doa

M

elelahkan perjuangan sekelompok umat Islam yang membela harkat dan martabat agamanya, tidak rela masjidnya dirubuhkan oleh kelompok pengembang perumahan. Pada akhirnya perjuangan berat itu pun membuahkan hasil menggembirakan seluruh umat Islam dengan dimulainya pembangunan kembali Masjid Al Ikhlas Jalan Timor Medan kemarin. Kiranya, musibah yang sempat menimpa Masjid Al Ikhlas tidak terulang lagi, walaupun saat ini masih banyak kasus serupa, seperti dirubuhkannya Masjid Raudhatul Islam yang berada di Jalan Putri Hijau Gang Peringatan, Kelurahan Silalas, Kecamatan Medan Barat dan sejumlah masjid lainnya di berbagai kawasan. Di Sampali misalnya, kini menggeliat pembangunan perumahan mewah sehingga sebuah masjid besar tempat umat Islam beribadah berpuluh tahun lamanya, tempat masyarakat melaksanakan berbagai kegiatan keagamaan harus rubuh tak lagi berbekas. Kita harapkan, pihak pengembang nanti membangunkan masjid yang lebih megah dan lebih indah sebagai fasilitas umum tempat umat Islam di sekitarnya, termasuk penghuni baru perumahan mewah, saling membaur dapat melaksanakan shalat berjamaah dan berbagai aktivitas keagamaan sehingga tidak menimbulkan gap dengan warga di sekitarnya nanti. Kilas balik perubuhan Masjid Al Ikhlas tahun lalu sungguh memilukan hati. Sebenarnya, kalau saja para ulama di Kota Medan ketika itu kompak, menolak tegas usulan oknum penguasa dan keinginan pengembang dengan iming-iming ganti rugi ini dan itu, dapat dipastikan tidak akan ada yang berani merubuhkan rumah Allah itu sekalipun Panglima Kodam I/BB waktu itu non-Muslim. Sayangnya, sejumlah oknum ulama di Medan, entah atas dasar apa, atau tergoda material apa, bisa karena sungkan akibat selama ini sudah kadung terlalu dekat dengan para pejabat, malah sang oknum ulama pula yang mendukung dan membela pengembang menggusur masjid. Berbagai alasan pun dicari-cari, misalnya di kawasan lama sudah tidak ada atau sudah sedikit penduduknya, boleh merubuhkan masjid Intisari asalkan diganti di tempat lain dll, sehingga Masjid Al Ikhlas yang sesungguhnya sangat banyak jamaahnya pada setiap shalat Jumat atau shalat Kesalahan oknum ulama zuhur itu pun harus rata dengan tanah dibuldozer pengembang dengan pengawasan oknum jangan terulang lagi.Jika oleh petugas dan preman tahun lalu. Permasalahan perubuhan Masjid Al Ikhlas ulama kompak takkan Jl. Timor pun nyaris menimbulkan konflik berani pengembang me- horizontal, menjurus SARA, membuat situasi keamanan menjadi panas. Umat Islam dari rubuhkan masjid kalangan Ormas Islam dan jamaah masjid harus berhadap-hadapan dengan petugas keamanan, sementara sang cukong (pengembang) malah tersenyum. Berulang kali terjadi aksi unjuk rasa yang mengakibatkan kontak fisik. Berulang kali pula terjadi intimidasi, bahkan pelemparan kotoran (najis) saat para jamaah melaksanakan shalat Jumat di jalan umum (Jl. Timor). Tak cukup sampai di situ saja, kasusnya pun berlanjut ke ranah hukum, karena pengelola masjid mempunyai bukti-bukti yang kuat akan keabsahan masjidnya, sejarah awal pembangunannya berasal dari infak berbagai pihak dan jamaah, jelas memiliki historis dan dasar hukum yang kuat berikut surat-surat. Wajar jika perjuangan mereka diapresiasi banyak pihak, apalagi setelah pusat turun tangan. Pengurus masjid dan jamaah dengan bantuan penasihat hukumnya berkirim surat ke Presiden Susilo BambangYudhoyono (SBY). Surat No.08/TPMA/IV/2011 pun disampaikan kepada Ketua MPR, Mahkamah Konstitusi, Wakil Presiden, Ketua DPR, Ketua DPD, Komisi III DPR, Menteri Pertahanan dll. Isinya meminta dan mendesak Presiden dan lembaga terkait lainnya mengembalikan tanah dan bangunan Masjid Al Ikhlas kepada umat Islam dalam keadaan baik, sekaligus memprakarsai agar pihak pengembang membangun kembali Masjid Al Ikhlas demi terciptanya kerukuman antarumat beragama di Medan, selaras dengan motto Kota Medan sebagai kota jasa, pendidikan, industri, beradab, dan religius. Pembangunan kembali Masjid Al Ikhlas merupakan kemenangan umat Islam. Hal ini ini terwujud berkah keikhlasan dan bantuan Pangdam I/BB dan instansi terkait menjembatani konflik yang terjadi selama ini. Kita berharap, pasca pembangunan kembali Masjid Al Ikhlas, tidak terjadi lagi perubuhan masjid dengan alasan apapun juga. Keberadaan masjid tidak akan pernah mengganggu pihak lain, malah menjadikan suatu kota semakin indah karena tidak monoton dengan pembangunan ruko dan sejenisnya. Kasus ini menjadi pelajaran buat oknum MUI Medan yang sepertinya kurang ngotot mempertahankan dan memperjuangkan pembangunan Masjid Al Ikhlas. Sebaliknya MUI Sumut pantas diberikan acungan jempol atas sikap tegasnya dalam memperjuangkan aspirasi umat Islam, tak silau dengan iming-iming. Terhadap oknum MUI, oknum Ormas Islam yang terlibat dan punya andil besar dalam perubuhan masjid kiranya insyaf dan memohon ampun-Nya dan berjanji ke depannya tidak lagi melakukan kompromi dengan pihak-pihak yang ingin merubuhkan masjid dengan alasan apapun. Pengurus dan anggota MUI Medan dan MUI Sumut kiranya berani memberikan sanksi kepada oknum-oknumnya yang menyimpang. Jangan hanya didiamkan begitu saja, karena merasa lebih senior, atau faktor lainnya. Yang salah harus dikatakan salah dan yang benar harus ditegakkan, apalagi kalau bukti-buktinya cukup kuat agar kredibilitas ulama terpelihara, dapat menjadi contoh dan teladan bagi umatnya.+

APA KOMENTAR ANDA SMS 081362240523

Faks 061 4510025

Facebook Smswaspada

+6285765231733 Salam buat WASPADA: trims atas mmuat smua berita2 dr masyarakat yg mnghrpkn keadilan., maju trus WASPADA. +6281260096077 Contoh mesjid raya aceh sepakat medan,bersih,rapi,wangi,aman,tenang,dan tertib.infaqnya jelas.pengurusnya disiplin dan tegas.bisa dicontoh buat mesjid –mesjid yg ada di Medan. +6285370172899 Sebaiknya PT Telkom lebih bijak terhadap telepon rumah dengan meminimkan (mis: Rp seribu) atau meniadakan abodemen. Agar tidak kehabisan pelanggan. Abode? Dari HADI Pengguna telp rumah. +6285296967487 Salam Waspada. Indonesia ternyata adalah Negara yg lambat mengukir kemajuan. Dan kebanyakan hanya mengatakan saja untuk Maju, tapi nyatanya tidak. Malah hanya Ingin diri sendiri saja yg terkenal, tanpa melihat orang lain. (USMANDANI, mahasiswa UNIMAL. Ilmu komunikasi.) +6285360804469 Salam Waspada kepada Lurah Pasar Baru, kepling anda kok kaya preman marah marah ngajak warga bersihkan lingkungan dia bilang dia uda capek,capek. +6281361742985 Buat Bpk Zulkarnain Lbs, tulisan anda sungguh enak dibaca walau disaji kan secara kelakar, mudah2an yg baca arif dan pintar smoga pesan tulisan tsb dpt terdengar agar kita jadi orang yg berlaku baik dan benar, amar makruf nahi mungkar. +6282164986444 Yth. Sdra Arifin Srg. Kalo membahas bid’ah jgn lah separoh2 yo ! Bgmna kalo Taraweh yg di Masjidil Haram sana, bid’ah itu apa tidak sdra ? Dan dari mana dpt mereka itu rujukan nya sdra ? Tolong penjelasan kpd kami yg BODOH dan awam ini, wassalam. +6281269020001 Ass wr wb Waspada yth ! Kepada pembaca Waspada dimana saja berada. Hati hati menumpang Bus Pelangi jurusan Aceh, khususnya bus pelangi BL 7664 A, karena kernetnya paling bandot, jika kita pergi buang air besar atau merokok, isteri kita yang tinggal dibangku kernet datang duduk mencumbui isteri penumpang. +6281264529756 Kpd redaksi Waspada, kenapa kolom inspirasi bisnis yg di tulis pak cahyo pramono skrg ini tsk pernah ada lg? Padahal sy ngefans banget dgn tulisannya, karena beliau tlah menginspirasikan untk kehidupan saya ke arah yg lebih baik.sebaiknya waspada jgn pernah berhenti memuat tulisan pak cahyo pramono SE.dr pelanggan waspada. +6285278662461 Kepada YTH bapak-bapak yg menguasai perbankan(DIRKOM,DIRUT,KEPALA BANK) tahukah anda mengapa terjadi KREDIT MACET? karena anda menghitung berdasarkan DIGIT BERGANDA dlm menetapkan suku buku kredit.cth pinjam 20jt,dlm tempo 1thn dng angsuran 2jt perbulan.ini duit hanya mampu utk 10 bulan! 2 bulan lagi bagaimana? itu 20 jt belum dipotong admistrasi(asuransi,lps,notaris).lalu utk tempo 2-5 thn bagaimana?(penuh dng BUNGA-BUNGA).jadi anda bilang juga BANK KITA mensejahterakan rakyat TAPI rakyatlah mensejaterakan BANK! tak percaya? mari kita BERHITUNG siapa yg UNTUNG! kami2 ini hanya terpaksa hidup dinegara berhati KAPITALIS berjiwa BORJUISSS(iblis)...

WASPADA Rabu 16 Mei 2012

Kebijakan Penghematan Energi Oleh Dr Drs H.Ramli Lubis, MM Kali ini sepertinya pemerintah memiliki tekad yang lebih kuat, tidak seperti rencana kenaikan subsidi BBM yang kemarin.

D

alam minggu-minggu terakhir ini masalah krisis energi kembali mengemuka. Pemadaman aliran listrik telah berulang kali terjadi. Bahkan dalam satu hari bisa sampai berkali-kali. Hal ini tidak saja menimbulkan ketidaknyamanan tetapi juga menimbulkan kekhawatiran akan masa depan ketersediaan energi di negeri ini. Belum lagi persoalan bahan bakar minyak (BBM) yang belum lama ini menimbulkan aksi massif penolakan terhadap rencana pemerintah menaikkan harga BBM tersebut. Timbul gejolak di tengah masyarakat karena harga-harga kebutuhan bahan pokok telah naik melambung sebelum naiknya harga BBM. Bahkan harga ini tak kunjung turun lagi meskipun BBM batal dinaikkan. Tidak dapat dipungkiri, bahwa krisis energi ini adalah masalah nasional. Bukan lagi masalah lokal ataupun kedaerahan semata. Presiden Susilo Bambang Yudhoyono telah mengancangancang untuk mengeluarkan kebijakan pembatasan BBM bersubsidi dan penghematan energi. Menteri Energi dan Sumber Daya Mineral (ESDM) Jero Wacik di Istana Negara, Jakarta kemarin mengatakan pengumuman langkah penghematan energi itu akan disampaikan langsung oleh Presiden Susilo Bambang Yudhoyono. Menurut Wacik, pengumuman langsung kebijakan BBM oleh SBY ini bertujuan untuk memberi penekanan yang kuat bahwa keputusan tersebut merupakan keputusan pemerintah tertinggi. Sebelumnya pasca pembatalan rencana pembatasan BBM bersubsidi, seperti diketahui, pemerintah mengeluarkan lima kebijakan baru dalam penggunaan BBM yang didasarkan pada kapasitas mesin kendaraan. Kebijakan tersebut adalah, pertama, melarang pemakaian BBM bersubsidi bagi kendaraan pelat merah atau dinas pemerintah dengan wilayah sasaran Jabodetabek, Jawa, dan Bali. Kedua, mewajibkan kendaraan pertambangan dan perkebunan menggunakan BBM non subsidi. Ketiga, mempercepat program konversi BBM ke Bahan Bakar Gas (BBG) di Pulau Jawa. Keempat, melarang PT Perusahaan Listrik Negara (PLN) membangun pembangkit listrik berbahan bakar minyak dan mendorong pengembangan pembangkit yang berasal dari tenaga air, matahari, panas bumi, dan batu bara. Kelima, menjalankan program penghe-

matan listrik di gedung pemerintah. Program penghematan energi yang menjadi pemerintah ini tengah dikampanyekan melalui pemberlakuan lima program untuk penghematan energi yang dimulai Juni 2012. Kali ini sepertinya pemerintah memiliki tekad yang lebih kuat, tidak seperti rencana kenaikan subsidi BBM yang kemarin. Seperti diungkapkanWacik bahwa pemberlakukan kebijakan tersebut tidak akan mundur lagi. “Dengan segera diberlakukan, maka penghematan terhadap anggaran negara juga bisa lebih besar,” katanya. Rencana kebijakan pemerintah ini ditengarai gelagat “pembangkangan” para kepala daerah di Kalimantan yang mengancam menghentikan produksi pertambangan bila kuota BBM bersubsidi tidak ditambah hingga 31 Mei mendatang. Mereka tergabung dalam Forum Gubernur Se-Kalimantan yang merasa selama ini pasokan BBM ke daerahnya sangat berkurang sehingga rakyat di Kalimantan harus antri untuk mendapatkan BBM. Forum ini telah pula menyurati BP Migas, Kementerian ESDM, dan Komisi VII DPR. Dalam surat itu disebutkan jika penambahan kuota BBM bersubsidi tidak dikabulkan, Kalimantan yang selama ini merupakan penghasil tambang terbesar di Indonesia akan menghentikan produksinya. Ironis. Pemerintah sendiri beralasan bahwa setiap daerah tentunya telah diberikan kuota BBM sesuai kebutuhan dan telah diperihitungkan dengan cermat. Seharusnya para gubernur ini untuk selalu menjaga kuota BBM yang telah diberikan. Bukan sebaliknya malah minta tambahan karena kouta yang diberikan tak mencukupi. Apalagi sampai mengancam untuk mengehentikan produksi pertambang di Kalimantan. Tapi kenyataannya memang pasokan BBM ke daerah Kalimantan selalu terlihat tidak cukup. Pemandangan kelangkaan BBM itu sering terlihat seperti Stasiun Pengisian Bahan Bakar Umum (SPBU) yang tutup karena kehabisan BBM. Atau antrian panjang melingkar di sekitar SPBU serta waktu buka SPBU melayani konsumen yang terjadwal di jam-jam tertentu saja. Hal ini telah berlangsung selama bertahun-tahun. Tentu sangat kontras dengan kondisi di beberapa daerah seperti halnya di Medan yang bahkan banyak SPBU menyediakan layanan selama 24 jam non stop. Jika kondisi ini dikarenakan kurangnya pasokan BBM ke daerah itu, atau

terjadi ketidaksesuaian antara kebutuhan akan BBM dengan besaran pasokan, maka pantaslah jika para forum gubernur Kalimantan menuntut keadilan. Tapi kalau memang rasio jumlah penduduk dan pasokan BBM sudah sesuai atau diberikan seperti halnya daerahdaerah lain di Indonesia, maka sudah pasti ada kesalahan dalam pengelolaan energi terbatas tersebut. Tetapi Staf Ahli Tata Ruang dan Wilayah Sekretariat Kabinet Surat Indrijono menjelaskan masalah ini bahwa saat distribusi BBM bersubsidi dari Depo Pertamina ke titik serah, telah terjadi kebocoran BBM bersubsidi 7-10 persen. Ia mensinyalir, bahwa penggunaan BBM bersubsidi di SPBU-SPBU untuk transportasi darat paling banyak hanya mencapai 30%, sedang sisanya yang 70% tidak jelas entah kemana, bisa dipakai untuk industri baik kecil, menengah, maupun besar. Sehingga, dengan melihat kebocoran penyaluran dan tepat pengunaan BBM bersubsidi yang sesuai dengan peruntukannya, hanya sekitar 27%. Kalau benarlah seperti ini yang terjadi maka ancaman untuk menghentikan produksi tambang adalah ancaman yang salah kaprah atau memang lebih tepat disebut pembangkangan. Hal yang mesti diperhatikan adalah bagaimana mereduksi persoalan bobolnya kuota BBM yang diberikan yang disebabkan banyaknya penyelewengan

BBM bersubsidi khususnya di daerah industri pertambangan maupun perkebunan. Indutri-industri ini tak berhak menggunakan BBM bersubsidi, tetapi nyatanya mereka mempergunakan berbagai cara untuk mendapatkan BBM bersubsidi. Belum lagi kegiatan penyeludupan BBM bersubsidi untuk di kirim keluar negeri karena perbedaan harga yang cukup tinggi . Penutup Pembatasan subsidi atau subsidi selektif sudah seharusnya dilakukan, bahkan semestinya sejak dulu sudah diterapkan. Karena sangatlah tidak pantas untuk memberikan subsidi kepada masyarakat kaya dan berkecukupan, sementara masyarakat miskin semakin terpuruk karena daya belinya semakin melemah. Pemerintah memang sudah seharusnya memiliki tekad yang kuat untuk segera memberikan harga yang pantas untuk konsumsi BBM bagi mereka yang memiliki kendaraan mewah. Akan ada resistensi, itu sudah pasti. Tetapi jangan hendaknya menimbulkan kelemahan di pihak pemerintah sehingga gagal menerapkan kebijakan yang memiliki nilai keberadilan tersebut. Karena ini adalah salah satu langkah strategis agar negeri ini bisa diselamatkan dari keterpurukan. Penulis adalah Mantan Wakil Wali Kota Medan.

Pemerintah Berhemat Mulai Juni Oleh Marihot Siagian Pengawasan adalah yang paling lemah di Indonesia. termasuk pengawasan terhadap diri sendiri.Karena itulah rasa malu pun sudah semakin luntur.

G

una mengatasi kekurangan dana karena disedot subsidi Bahan BakarMinyak(BBM),pemerintah akan melakukan penghematan BBM dan listrik. Direncanakan dimulai 1 Juni 2012 dan sekarang sedang dipersiapkan ketentuannya. Menjelang akhir bulan Mei ini akan diumumkan ketentuannya. Menteri Kordinator Bidang Perekonomian Hatta Rajasa mengatakan, nantinya kantor pemerintah tidak lagi leluasa menggunakan aliran listrik dan penggunaan air demikian juga BBM. Pemerintah Negara tidak sama pemerintahnya. Terkait bentuk negara itu yakni kerajaan, republik parlementer dan republik presidentil. Indonesia, Amerika Serikat, Korea Selatan tentu tidak sama dengan Inggris, Jepang, India, Malaysia. Inggris kerajaan kepalapemerintahadalahPerdanaMenteri serupa dengan Jepang. Negara itu maju perekonomiannya. Amerika Serikat dan Korea Selatan kepala negaranya presiden merangkap kepala pemerintahnya. Juga majudalampolitikdanperekonomiannya. Indonesia serupa juga dengan kedua negara ini, tapi perekonomiannya belum maju. Masih sering buruh unjuk rasa agar nasib mereka yang belum memadai diperhatikan pemerintah dan pengusahanya. Pemerintah mengurusi negara dan bertanggungjawab terhadap kehidupan rakyatnya. Indonesia mencantumkannya dalam Undang Undang Dasar‘45.Tapi apa yang dikatakan dalam UU itu belum menjadikenyataanataudengankatalainmasih berupacita-cita.Rakyatmelaluimahasiswa selalu meminta kepada pemerintah yang dalam hal ini presiden, wakil presiden beserta kabinetnya memperhatikan nasib rakyat. Tapi pejabat negara masih tetap mengeluh kekurangan dana. Alasan disedotsubsidiBBM.Dicobamenaikkanharga BBM mahasiswa, buruh beserta rakyat menolakkenaikanitu.Satusebab,kenaikan BBM itu lebih mempersulit kehidupan rakyat. Semua harga kebutuhan pokok rakyat dan keperluan lainnya pasti naik. Belum jadi naik, harga sudah naik, pemerintah tak mampu menekan supaya harga itu kembali turun. Dinegaramaju,pemerintahmengatur perekonomian di negaranya. Tidak dibolehkan hanya kemauan pedagang. Indonesiapernahmelakukandemikiandengan adanya pengawasan dari pemerintah. Waktu tahun enampuluhan ada yang disebut Kantor Pengendalian Harga. Me-

rekainimengawasihargakeperluanrakyat di pasaran. Pedagang wajib memasang harga setiap barang yang dijual. Jika ternyata dinaikkan dari ketentuan pemerintah ditindak sesuai dengan peraturan yang berlaku. Sering pedagang sampai ke pengadilan untuk proses hukum.Tiga kali masuk pengadilan,pedagang itu dilarang berdagang/berjualan. Begitulah keadaan yang katanya zaman maju.Ternyata semakin meninggalkan kepentingan rakyat di Indonesia. Mengapa di Malaysia tidak demikian hingga sekarang ini? Tidak boleh harga kebutuhan pokok rakyat naik di pasaran sebelum ditetapkan pemerintah. Tidak ada alasan karena puasa, hari raya , tahun baru dan lain sebagainya. Bahkan pada masa ini, ada tempat hiburan menurunkan tiket masuk, untuk memberi kesempatan kepada orang banyak. Penerapannya Pemerintah Indonesia banyak aturan dan peraturannya. Termasuk UU yang menggembirakan hati rakyat. Tapi penerapannya yang sangat kurang. Sama dengan penerapan sumpah jabatan. Apalagi penerapan janji ketika kampanye Pemilu dan Pilkada. Semua untuk rakyat, untuk negara dan pembangunan daerah. Sudahkah diterapkan secara baik, paling tidak 60 persen?Tentu yang harus menjawab ini adalah pejabat negara, anggota DPR,DPRD. Mereka yang banyak bicara mengenai kepentingn negara, rakyat dan bangsa. Dalam hal janji pemerintah untuk melakukan penghematan mulai Juni 2012 ini, tentu akan dilihat dulu apa yang dihemat itu. Apakah harus ganti mobil baru yanghematBBMsepertiyangsudahmulai “dianginkan”—belum tahu karena pemerintah belum secara rinci membuat apa yang dihemat. Jika untuk menggunakan listrik, memang sudah sangat mendesak.Janganhanyasenangmemakaiarus secara leluasa tapi membayarnya kepada PLN tersendat. PLN banyak mengeluh karenatersendatpembayarannya.Tersendat pembayaran, tidak tegas PLN mengumumkan. Pemko, kabupatan mana yang menunggak pembayaran. Aturannya PLN harus berani mengumumkan dan jika perlumemutusaliran.Janganhanyaberani kepada rakyat kecil. Demikian juga pemakaian AC yang terlalu leluasa. Tidaksajalistrik,airjugaharusdihemat. Air mengalir terus di kamar mandi atau tempat lain. Tidak dilaporkan, karena ra-

sanya tidak ada yang bertanggungjawab untuk itu. Belum seperti di negara Jepang rakyatnya sudah punya kesadaran tinggi, mengenai pemborosan itu. Siapapun rela mematikan air yang ada di kamar mandi. demikian juga lampu yang terus nyala tidak ada gunanya. Di kantor swata dan rumah tangga juga demikian, terjadi pemborosan. Bagaimana pula nantinya mengenai penghematan BBM ? Apakah ditetapkan berapa puluh liter satu hari. Jika dinas luar kota, tentu sudah ada dana untuk itu. Dana itulah untuk membeli BBM. Sehingga tidak terjadi dua pengeluaran uang untuk beli BBM. Pengawasannya Pengawasan adalah yang paling lemah di Indonesia. termasuk pengawasan terhadap diri sendiri. Karena itulah rasa malu pun sudah semakin luntur. Berbeda dengan di Korea Selatan. Budaya malu dimasyarakatkanuntukmencegah,memberantaskorupsi.Polri,Jaksaadalahpengawas penerapan undang-undang. Inspektorat untuk mengawasi aturan dan peraturan pemerintah di instansi negara seperti di Kementerian Dalam Negeri, KantorGubernurdanKementerianPendidikan Nasional. Tapi belakangan Inspektorat itu seperti kurang berfungsi. Karena apa? Memang tidak diperlukan lagi supaya boleh melanggar aturan yang berani berbuat salah. Dalam kaitan pengawasan penghematan 1 Juni 2012 ini kata Menteri Energi dan Sumber Daya Mineral (ESDM) Jero Wacik mengatakan pemerintah akan mengatur penghematan listrik di kantor pemerintah melalui keputusan Menteri ESDM.Nantinyaadainspekturyangmencek gedung pemerintah. Akan ada sanksi bagi kantor yang melanggar ketentuan itu. Sanksi akan diberikan kepada Sekretaris Jenderal satu lembaga pemerintah. Mengenai sanksi ini, tentu masyarakat sudah tahu arti dan makna yang sering terjadi. Karena belum keluar aturan penghematan itu dan sanksinya, tentu tidak dapat dinilai sejauh mana ketegasannya. Sanksi bagi kebanyakan orang Indonesia,satuhalyangbiasa-biasasaja.Masuk tahanandandihukumpundianggaptidak apa-apa. Sudah terhukum pun masih dianggap lumrah tidak jadi penghalang untuk kemajuan berikutnya. Jadi wajar nantinya sanksi itu harus tegas dan jika perludicopotdarijabatankarenadianggap tidak mampu menjalankan tugasnya. Untuk apa dipakai yang tidak mampu di negara yang sedang berpacu mengejar kemajuan? Penutup Menghemat setelah sempat boros, agak sulit dilakukan. Makanya kata orang tua masa lalu, jangan biasakan berbuat salah,agarmudahmengubahdirimenjadi

membuat yang benar. Sama tidak serupa dengan korupsi pada mulanya kecil tidak apa-apa, maka terjadilah yang besar dan membahayakan negara. Begitu juga yang sempat boros, disuruh hemat, tentu pada mulanya canggung. Peraturan banyak di Indonesia, termasukUUyangmembanturakyat.Tapi aturan dan peraturan itu hanya menjadi cita-cita enah kapan terwujud. Manusia Indonesia sudah semakin banyak senang melanggaraturan.Bahkanbangga,karena merasa diri orang kuat. Tindakan tegas harus diberlakukan jika terjadi pelanggaran yang berulang. Janganrajinmengatakanrakyattidaksadar hukum dan aturan, padahal pejabat yang digaji rakyat itu, lebih sering melanggar aturan. Jika sudah berhasil penghematan ini,perludilanjutkanpencegahanpenyelewengan uang negara apalagi korupsi di tingkat pimpinan di daerah dan pusat. Jangan hanya mengatakan korupsi membahayakan negara tapi tidak dilakukan upaya pencegahannya. Penulis adalah Anggota PWI Sejak Tahun 1962.

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di Media manapun.Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Chairuman: Visi jauh ke depan bangun Sumut - Nengok ke depan saja bisa tersungkur pak! * Amri Tambunan Kdh pertama terima Government Award - Luar biasa! * Penertiban truk tidak konsisten - Biasa lo, keras-keras kerak!

oel

D Wak


Opini

WASPADA Rabu 16 Mei 2012

Surat Untuk Dirut PTPN III/Dir. Holdin Medan Kepada Yth. Bapak Megananda Daryono Dirut PTPN III/Dir.Holding Di- Medan. Dengan hormat, Dirut PTPN2 yang Bpk puji-puji kehebatan kepemimpinannya, terutama mengenai terobosan-terobosannya yang mempesona itu perlu diuji kebenarannya. Untuk itu kita coba membicarakan salah satu terobosannya yang paling diandalkannya yang dimimpikannya akan mewujudkan zaman keemasan bagi PTPN2 seperti yang Bpk nyatakan sendiri bahwa, 2012 adalah tahun emas bagi PTPN2. Terobosan yang akan kita kaji itu adalah mengenai kerjasama dengan Dapenbun yang ditandatangani tgl 15 Desember 2011 di kantor Meneg BUMN Jakarta itu. Dengan mengandalkan Rumah Sakit Tembakau Deli yang menurut keterangannya sendiri merupakan asset non produktif bekerjasama mengelolanya melalui anak perusahaan yang akan dibentuk sedang PTPN2 punya utang sekitar Rp 800 M sebagai akibat iyuran dana pension yang dikutip dari para karyawan setiap bulannya itu kiranya tidak disetorkan ke Dapenbun. Aneh bin ajaib utang PTPN2 ke Dapenbun sebanyak Rp 800 M, kemudian disodorkan kerjasama mengelola aset yang tidak produktif kok Dapenbun setuju. Tidak dapat diterima akal sehat, ada apa sebenarnya dibalik ini semua. Yang pasti Bhatara Muda Nasution berhasil meyakinkan Dapenbun bahwa kerjasama itu nantinya akan menghasilkan uang yang jauh lebih besar dari utang PTPN2 yang Rp 800 M itu kalau tidak, tidak mungkin Dapenbun setuju dengan kerjasama itu. Apakah benar dengan mengelola Rumah Sakit Tembakau Deli akan menghasilkan uang yang triliunan rupiah dalam waktu singkat. Omong kosong alias tidak mungkin. Mengelola rumah sakit bersama itu tidak akan pernah ada, sebab kalau benar itu untuk mengelola rumah sakit mengapa rumah sakit harus ditutup sejak 1 Januari 2012. Bukankah kerjasama dengan pengusaha Malaysia PT.LNK itu kebon tidak perlu ditutup meski sehari saja. Cukup Dapenbun tambah modal tenaga ahli dan peralatan medis yang serba canggih sehingga orang medan tak perlu lagi berobat ke Penang Malaysia. Rumah sakit tertap berjalan seperti biasa tidak perlu ditutup meski setengah hari saja. Jadi yang sebenarnya rumah sakit itu mau dijual dank arena itulah Dapenbun setuju atas kerjasama yang ditandatangani 15 Desember 2011. Untuk menipu publik dan menghindarkan pajak penjualan dikatakanlah rumah sakit akan dikelola anak perusahaan padahal itu adalah pembeli. Karena itulah selama ini semuanya serba tertutup. Kalau tidak ada yang harus disembunyikan mengapa harus serba tertutup ? Jadi jelas kerjasama PTPN2 dengan Dapenbun itu penuh aroma KKN sekaligus menepis pertanyaan terhadap raibnya uang iyuran dana pension yang dikutip dari karyawan setiap bulannya itu tapi tidak disetorkan ke Danpenbun yang jumlahnya Rp 800 M itu apakah bukan tindakan penipuan, penggelapan atau penyalahgunaan wewenang dan sampai sekarang meski telah kami tanyakan kepada semua instansi terkait tidak pernah dijawab, oleh sebab itu kami mohon kepada semua praktisi hukum dfidaerah ini tolonglah kami, bicaralah melalui Harian ini agar kami tau apakah tindakan Dirut PTPN2 itu dapat dibiarkan begitu saja tanpa ada tindakan hukum sekecil apapun. Bpk Megananda Yang terhormat, Dapat dibayangkan betapa gembiranya Bhatara Muda Nasution atas tercapainya kerjasama dengan Dapenbun itu, matanya pasti berbinar-binar riang gembira melihat utangnya Rp 800 M pada Fapenbun tak perlu dipikirkan lagi, bahkan ada sisa uang triliuanan lagi untuk tutup lobang sana-sini dan masih tersisa dana operasional sekian miliar termasuk barangkali uang pago-pago upah capek. Tapi menurut hemat kami kegembiraan Bhatara Muda Nasution itu akan sirna sebab tgl 9 Mei 2012 kami dapat undangan resmi dari DPR Kota Medan untuk melakukan peninjauan ke lokasi karena adanya indikasi pengrusakan atas bangunan Cagar Budaya Rumah Sakit Tembakau Deli hampir tak percaya kami usap mata kami beberapa kali Allahu Akbar, Alhamdulillah, kiranya doa bisu yang kami tulis di baliho ukuran 3/5 m yang kami pasang pada aksi pemasangan sepanduk keprihatinan 11 Maret 2012 didepan Rumah Sakit Tembakau Deli itu telah terkabul. hHampir dua bulan baliho terpampang dengan gagahnya disitu sampai pada malam kedatangan Bapak Meneg BUMN yang menginap di Hotel JW. Marriot baliho itu diberangus secara paksa oleh oknum Kecamatan Medan Barat dengan alas an kebersihan sehubungan kedatangan Menteri katanya. Pada bailho itu jelas tertulis 1. Tolong selamatkan satu-satunya sisa sejarah tembakau deli ini jangan sampai lenyap ditelan bumi. 2. Tuyul/antek-antek Kapitalis Malaysia itu yang pantas diganyang bukan rumah sakit tembakau deli ini yang mesti dilelang. Nah karena rumah sakit tembakau deli bangunan cagar budaya yang dilindungi Perda No.6 Tahun 1988 maka bangunan tersebut tak mungkin dapat diperjual belikan, bentuk bangunan tak boleh dirubah dan tak mungkin dapat Surat Izin Mendirikan Bangunan (SIMB) dari Walikota Medan untuk mendirikan Pusat Perbelanjaan termegah diatas tanah seluas 32.000 meter persegi disitu. Apalagi tanah dilokasi rumah sakit tembakau deli itu telah berada diluar HGU PTPN2 T.Morawa yang sesuai dengan PP No.40 Tahun 1996 secara de fakto telah menjadi milik Pemda Medan tinggal menunggu penyerahan resmi dari Meneg BUMN saja lagi. Soal nilai bangunan hanya tinggal nilai buku Rp 1.000 (seribu rupiah) persis seperti penyerahan kantor Gubernur Sumut Jl.Diponegoro hanya senilai perangko seribu rupiah dari Gubernur H.Syamsul Arifin,SE kepada Meneg.BUMN Sofyan Jalil pada saat itu. Bagi Pemda Medan yang sedang menggalakkan Medan Berhias kesempatan ini harus dimanfaatkan untuk segera mengambil alih cagar budaya rumah sakit tembakau deli ini dan mengelolanya dengan baik sebagaimana yang telah dilakukan Walikota pendahulunya Bpk Abdillah terhadap Taman Seri Deli yang sempat terjual dan sudah sempat dilakukan penimbunan tapi dapat diselamatkan dan dilola dengan baik yang terkenal dengan Ramadhan Fair itu. Untuk itu kemampuan Bpk Walikota yang sekarang tidak perlu disangsikan lagi. Karena lebih baik satu kelas dari Bpk Abdillah. Horas Pak Wali. Tolong selamatkan cagar budaya rumah sakit tembakau deli. Jadikan rumah sakit yang nyaman berobat dan asri partner pasti banyak di Medan ini, supaya kami askar-askar tak berguna/pensiunan ini dapat berobat kembali seperti semula. Obat generic tak mengapa, turun kelas rawat inap tak masalah yang penting layanan yang sempurna. Bpk Megananda yang terhormat, Adapun hasil peninjauan rombongan DPR Kota Medan disertai Badan Warisan Sumatera (BWS) pihak Direksi PTPN2 T.Morawa, Forum Silaturrahmi Pensiunan Perkebunan eks PTP IX dan Gerakan Penyelamat Bangunan Rumah Sakit Tembakau Deli sekitar 20 orang itu melihat dengan mata kepala masing-masing bahwa memang benar telah terjadi pengrusakan dengan sengaja dan terencana selama rumah sakit itu ditutup untuk tujuan tertentu, bahkan tidak dapat diterima akal sehat manusia normal sanggup berbuat seperti itu terhadap bangunan sebuah rumah sakit. Seluruh inventaris habis, pintu jendela tempat rawat inap VIV dicongkel kaca nakonya habis bahkan tempat cuci tangan washtapelnya dibongkar secara kasar dan biadab. Kamar bedah, ruang dokter bahkan atap jalan penghubung ke blokblok dibongkar, atap dan kayunya lenyap tinggal tunggul-tunggul tiangnya saja lagi. (Semua data-data ini telah direkam oleh rombongan DPR Medan yang segera dimasukkan dalam berita acara. Untung kami memiliki buku inventaris dan yang menarik dalam buku itu ada tertulis MP (Milik Pribadi). Aneh juga di dalam rumah sakit itu banyak Milik Pribadi. Tapi biarlah karena pengrusakan cagar budaya ini akan segera kami serahkan ke Polisi dengan tertuduh utamanya Bhatara Muda Nasution Dirut PTPN2, karena dialah yang menutup rumah sakit sejak 1 Januari 2012 dan kejadian pengrusakan itu selama masa penutupan rumah sakit tersebut. Kalau rumah sakit tidak sampai ditutup berjalan sebagaimana biasa kerusakan itu tidak akan pernah terjadi. Jadi kalau mata Bhatara Muda Nasution sudah sempat berbinar-binar gembira ria mungkin sekarang sebaliknya, mata itu sayu, kesal dan mulutnya bergumam gagal, gagal dan harus cepat-cepat cari tumbal, kalau perlu mainkan PP No. 40/1996 dari kebiri Perda No.6/1988 dan kalau ini yang terjadi Mesuji Lampung pindah ke Sumatera Utara. Forum Rakyat Bersatu Waspadalah. Jadi kalau selama ini Bpk anggap terobosan Bhatara Muda Nasution itu patut dipuji dengan kenyataan ini kami anggap terobosan itu pantas dicaci maki. Terimakasih atas perhatian Bapak. Kami sudahi dengan ungkapan siapa yang menabur buih ia menuai badai. Hormat Kami Forum Silaturrahmi Pensiunan Perkebunan Eks.PTP IX Medan Sumatera Utara. Ketua (HM. Yusuf Sembiring)

Sekretaris (Rostam. E. Nasution).

B5

Penanganan Sampah Di Medan “

Yang perlu dituntaskan justru memperbaiki kinerja agar pengelolaan sampah di Medan bisa dimaksimalkan.

Bekmi Darusman

Pardamean Siregar, SH

Tidak dapat dipungkiri, sampah masih saja menjadi masalah di ibu kota provinsi ini. Lihat saja saluran air, dari mulai parit sampai sungai. Lihat pula tempat-tempat umum, sampah masih berserakan di mana-mana, mengundang penyakit, bau menyengat dan jorok. Harus pula diakui, telah ada upaya pemerintah kota untuk menangani masalah ini. Tapi wujud kota Medan yang asri bebas sampah sepertinya masih jauh dari kondisi yang terjadi sekarang ini. Upaya itu misalnya ketika di Kelurahan Binjai, Kecamatan Medan Denai, didirikan Bank Sampah Mutiara yang baru-baru ini diresmikan Menteri Negara Lingkungan Hidup Prof Dr Balthasar Kambuaya MBA, sampah justru terasa menjadi makin berharga. Secara nasional, kita sudah memiliki 477 bank sampah setelah kehadiran Bank Sampah Mutiara di Medan. Dari 476 bank sampah yang beroperasi sebelumnya mampu menghasilkan pendapatan sekira Rp.1,7 miliar dan menyerap lebih dari 1 juta tenaga kerja. Untuk membahas masalah sampah ini, Irham Hagabean Nasution (IHN) mewawancarai Direktur Pelaksana Lembaga Studi dan Advokasi Kebijakan (Elsaka) Bekmi Darusman (BD) dan Kepala Dinas Kebersihan Medan Pardamean Siregar, SH (PS) di Medan, kemarin. IHN: Bagaimana tanggapan Anda mengenai pendirian bank sampah di Medan? BD: Idenya sih bagus. Namun, menurut saya, yang perlu dituntaskan justru memperbaiki kinerja agar pengelolaan sampah di Medan bisa dimaksimalkan. Selama ini, kan, masyarakat membayar retribusi, tetapi faktnya kita sama-sama tahu, sampah terkadang tidak terkontrol, tidak terkendali. Padahal, sekali lagi, masyarakat dikutip retribusi. Katakanlah untuk rumah yang sangat sederhana dikutip retribusi Rp5 ribu. Tapi kadang-kadang belum tentu diangkut sekali seminggu, sehingga sampah menumpuk. IHN: Jadi, kinerja yang seharusnya ditingkatkan? DB: Saya pikir begitu. Saya pikir Pemko juga harus membangun suatu sistem sehingga Dinas Kebersihan Medan

mampu lebih maksimal melaksanakan pengelolaan sampah secara baik. Kemudian, Pemko Medan melalui Dinas Kebersihan harus terus mensosialisasikan kepada masyarakat untuk memilah sampah. Ya, sampah organik dan anorganik. Sangat perlu menyediakan tempattempat sampah. Faktanya, untuk menampung sampah sendiri sering memakai swadaya masyarakat. Buat bak sampah sendiri, buat ember di depan rumah, buat keranjang sendiri. Kita tidak tahu menempatkan di mana kita tempatkan sampah organik dan anorganik. Itu saya pikir tanggungjawab pertama yang harus dilakukan Pemko dalam hal ini Dinas Kebersihan. Meningkatkan kinerja di internal Dinas Kebersihan, itu sangat diperlukan. Baru kita kemudian bicara mengenai bank sampah yang merupakan bagian dari partisipasi masyarakat.

IHN: Tapi, Bank Sampah Mutiara yang kemarin diresmikan Menteri LH, kabarnya merupakan proyek percontohan untuk mendirikan bank sampah di kecamatan lain di Medan, bahkan di kelurahan. Komentar Anda? BD: Boleh saja, tapi harus dimaksimalkan jangan sampai gagal. Jadi, ini bagus, tapi lebih bagus lagi kalau sekarang dituntaskan pengelolaan sampah di tingkat lingkungan. Tapi, kalaulah bank sampah ini dikelola aktivis lingkungan, tetapi pemerintah tentu tidak boleh dong lepas tangan.

pendapatan masyarakat melalui menabung sampah, menstimulus kepedulian masyarakat terhadap pengelolaan sampah. Bayangkan, begitu banyak manfaat yang bisa diperoleh dari kehadiran bank sampah. Karena itu, kita sangat berharap agar Bank Sampah Mutiara dapat melakukan operasional secara maksimal. Kita juga berharap bank sampah ini menjadi motor untuk untuk mendirikan bank sampah lainnya, kita harapkan tidak saja di kecamatan, tapi juga sampai ke kelurahan.

***

IHN: Bagaimana dengan peranserta masyarakat terhadap lingkungan? PS: Kita mengharapkan Bank Sampah Mutiara menjadi acuan untuk mendirikan bank sampah lainnya di kecamatan lainnya dan terus ke kelurahan, tentu saja berharap peran-serta masyarakat dan aktivis lingkungan. Tentu saja, menciptakan lingkungan yang bersih dan sehat, tidak hanya tugas pemerintah, tapi ini tugas kita bersama. Makanya, kita akan terus melakukan sosialisasi mengenai bank sampah dan pengelolaan sampah sampai tingkat kelurahan. Bagaiamana pengomposan. Tidak membuang sampah sembarangan, tapi justru membuang pada tempatnya atau menabungkan sampah ke bank sampah. Sosialisasi yang terus kita lakukan diharap dapat melahirkan kaderkader bank sampah. Tahun lalu kita fokus melakukan sosialisasi ke sekolah-sekolah, tahun ini antara lain ke kader PKK dan masyarakat di bantaran sungai.

IHN: Sebenarnya, untuk apa ada bank sampah di Medan? PS: Terus terang, pertambahan penduduk dan perubahan pola konsumsi masyarakat menimbulkan bertambahnya volume, jenis dan karakteristik sampah yang semakin beragam. Sampah telah menjadi masalah nasional, sehingga pengelolaannya perlu dilakukan secara komprehensif dan terpadu dari hulu ke hilir agar memberikan manfaat secara ekonomi, sehat bagi masyarakat dan aman bagi lingkungan serta dapat mengubah perilaku masyarakat. IHN: Jadi ini bagian dari upaya pengelolaan sampah yang sistematis? PS: Memang kita berupaya melakukan kegiatan pengelolaan sampah yang sistematis, menyeluruh dan berkesinambungan meliputi pengurangan dan penanganan sampah. Ini sejalan dengan Undang-Undang No 18 tahun 2008 tentang pengelolaan sampah. Padahal, pengelolaan sampah yang masih membakar, menimbun, membuang sampah sembarangan memunculkan paradigma baru dalam pengelolaan sampah sehingga dapat lebih bermanfaat. Paradigma baru yang menjadi salah satu wadah pengelolaan sampah di antaranya bank sampah. IHN: Apa manfaat nyata dari kehadiran bank sampah? PS: Terus terang, ini bisa mereduksi jumlah sampah yang masuk ke Tempat Pembuangan Akhir (TPA), mengurangi dampak negatif yang ditimbulkan sampah terhadap lingkungan, meningkatkan

IHN: Mungkin ada saran Anda? PS: Kita harapkan masyarakat sudah memilah sampah mulai dari rumah. Sampah ditempatkan di wadah sesuai jenisnya. Kalaupun akan disetor ke bank sampah, tidak lagi susah melakukan pemilahan. Kita juga harus bergandengan tangan untuk menciptakan lingkungan yang bersih dan sehat, untuk kemaslahatan bersama. Mari kita jadikan sampah sebagai sahabat, karena kenyataannya memang dapat memberi kontribusi secara finansial. Bisa menjadi mutiara, emas. Bisa menghasilkan rupiah.

Membentengi Sumut Dari Banjir Oleh Onrizal Perlu pembenahan mendasar terhadap perilaku yang bermasalah dari individu, masyarakat dan birokrasi dalam beraktivitas dan bersikap di atas wilayah DAS.

T

ak pelak, ketika musim hujan tiba, ketakutan penduduk dilanda banjir. Mengapa? Sejak tahun 2000 sampai sekarang, di setiap musim hujan hampir selalu diikuti banjir atau banjir bandang. Beberapa bencana banjir seperti tahun 2001, banyak daerah di Sumut dilanda banjir dan banjir bandang, termasuk Kota Medan. Malam hari 2 November 2003 bertepatan hari ke-8 bulan Ramadhan di tahun itu, banjir bandang melanda daerah Bukit Lawang. Kejadian mencekam di malam hari sekitar pukul 20.30 wib itu, seperti dicatat Brahmantyo (2009) telah merenggut 154 jiwa tewas atau hilang dari penduduk asli maupun wisatawan asing dan lokal. Hingga bulan Februari 2004 tercatat 80 orang dinyatakan tidak ditemukan jasadnya. Dini hari 14 September 2009, banjir bandang besar menerpa kecamatan Muara Batanggadis, Mandailingnatal. Setidaknya 25 orang warga dilaporkan tewas. Sepuluh tahun pasca banjir bandang tahun 2001, kota Medan kembali diterjang banjir bandang pada pekan pertama 2011 (tepatnya 6 Januari 2011). Sang Wali Kota Medan, seperti dikutip media saat itu, mengatakan “ini banjir 10 tahunan.” Tak sampai hitungan tahun, menjelang dini hari tanggal 1 April 2011, warga Medan yang bermukim di bantaran sungai Babura terbangun, dikejutkan oleh banjir besar yang telah masuk ke rumah mereka. Pagi dan siang harinya banjir makin membesar, sampai-sampai merendam rumah dinas para pejabat, seperti rumah dinas Gubernur Sumatera Utara, rumah dinas Kapolda Sumatera Utara, dan rumah dinasWali Kota Medan yang belum pernah terendam banjir sebelumnya. Banjir kali ini tercatat sebagai salah satu banjir terbesar dalam sejarah kota Medan. Banjir bandang kembali menerjang Mandailingnatal pada 26 Februari 2012. Banjir akibat meluapnya sungai (Aek) Rantopuran, Mandailingnatal itu setidaknya merendam 5 desa, 11 rumah hanyut, 40 rumah rusak berat, 740 KK mengungsi. Akar Masalah Bencana banjir telah menyebabkan korban nyawa, kehilangan harta benda, rusaknya infrastruktur, terganggunya kegiatan ekonomi sehingga banjir itu berakibat kerugian ekonomi, sosial dan ekologi. Dana APDB terkuras pada masa tanggap darurat dan rehabilitasi. Namun, rentetan banjir bandang di Sumatera Utara khususnya dan negeri ini umumnya, secara substansi belum mengubah pandangan dan sikap sebagian besar aparat pemerintahan, masyarakat

dan swasta. Aparat hanya sibuk saat bencana banjir itu menerjang, dan beritanyapun lenyap seiring dengan surutnya air. Tak tampak dalam kebijakan “pembangunan” seperti tercantum dalam APBD. Faktor risiko bencana belum masuk dalam pertimbangan dan penyusunan APBD itu. Kenapa suatu daerah bisa kena banjir atau banjir bandang? Seringkali kita baca atau dengar pendapat pasca banjir, termasuk dari kebanyakan pejabat eksekutif dan legislatif yang menyatakan hujan sebagai biang keladi, sebagai penyebab terjadinya banjir. Ya, sangat sering kita mendengar hujan menjadi tertuduh sebagai penyebab suatu daerah dilanda banjir. Sepintas terlihat alasan itu benar, namun apakah betul demikian? Benar, hujan merupakan input dalam peristiwa banjir dan kejadian hujan itu di luar kuasa manusia. Lalu, salahkah hujan? Lebih lanjut ada yang mengulas lebih, selain hujan, kerusakan hutan di hulu menjadi penyebab banjir bandang itu.Terlihat alasan ini lebih kuat, hujan ditambah hutan yang rusak menjadi penyebab banjir bandang. Berbagai hasil penelitian menunjukkan bahwa suatu wilayah dengan hutan yang masih baik dan dengan luasan kawasan berhutan yang cukup akan mampu penampung dan penyimpan curah hujan (CH) menjadi air tanah. Hanya sekitar 0,1 – 10% saja dari CH yang akan mengalir langsung ke sungai atau menjadi aliran permukaan (run off), sedangkan 90 – 99,9% dari CH yang terjadi pada DAS yang baik akan diresapkan ke dalam tanah. Sehingga peluang terjadinya banjir pada DAS yang masih baik akan sangat-sangat kecil kalau tidak boleh dibilang tidak ada. Bagaimana dengan kota Medan yang sangat sedikit ruang terbuka hijau dan daerah resapan airnya? Hasil analisa BPDAS Wampu Sei Ulau tahun 2011 terhadap kemampuan wilayah kota Medan dalam meresapkan air ke dalam tanah saat musim hujan rata-rata hanya 45%. Artinya, sebesar 55% curah hujan itu tidak bisa diresapkan ke dalam tanah, sehingga menjadi aliran permukaan saat hujan tersebut. Oleh karena itu, sangat wajar, karena hutannya rusak, maka saat hujan pasti

banjir menerjang. Pertanyaan lebih lanjut, benarkah salahnya hujan dan hutan yang rusak? Saya mencermati, meneliti dan berdiskusi dengan banyak rekan terkait banjir dan banjir bandang ini. Jika seksama benarkah banjir karena hutan/tutupan vegetasi yang jumlahnya sangat sedikit (misalnya pada DAS Deli yang luas ril hutannya hanya sekitar 5% dari luas keseluruhan DAS Deli)? Sehingga kita sering mengatakan bahwa banjir disebabkan oleh tutupan vegetasi (hutan) yang sangat kecil dalam suatu DAS. Ini saya sebut sebagai pernyataan pertama. Jika kita berhenti menganalisa hanya sampai disitu, maka kerusakan hutan di dalam DAS itu adalah sebagai penyebab utama terjadinya banjir. Sekarang coba kita bertanya lebih dalam: apakah keberadaan tutupan bervegetasi yang kecil ini hanya suatu“pertanda/ fenomena /symtom” yang menunjukkan ada “masalah lain” di belakangnya? Sehingga bisa dikatakan bahwa ada permasalahan kelembagaan yang mempengaruhi kinerja kelestarian DAS. Nah, ini saya sebut sebagai pernyataan kedua. Jika kacamata analisis yang kita gunakan adalah pembahasan “non kelembagaan/ non institusional” maka pernyataan pertama “tidak salah”. Namun jika dilihat/dicermati dari sudut pandang “kelembagaan/institusional” atau pernyataan kedua, maka pernyataan pertama kurang begitu tepat, kenapa? Permasalahan rusahnya hutan, kecilnya tutupan vegetasi/hutan dalam suatu unit DAS itu melekat pada “behaviour/perilaku” individu, masyarakat, dan birokrasi. Jadi permasalahan tidak melekat pada benda (hutan ataupun DAS) namun pada perilaku. Karena itu, maka “fenomena banjir” yang merupakan salah satu indikator kinerja pengelolaan DAS disebabkan perilaku yang bermasalah dari individu, masyarakat atau birokrasi yang ada di atas DAS tersebut. Kami menduga, bahwa “perilaku birokrasi” memberi andil paling besar dibanding aktor lainnya. Kenapa? Karena birokrasilah yang punya kewenangan dan kekuasaan untuk menjalankan segala aspek kegiatan yang ada di suatu wilayah DAS. Program yang telah menelan uang miliaran setiap tahun, namun gagal, penyebab utamanya adalah karena kegagalan di birokrasi. Sangat banyak atau sudah umum adanya, aparat birokrasi terperangkap jebakan administrasi (administration trap), hanya semata-mata memenuhi keabsahan administrasi.

Bahkan lebih bahayanya lagi, birokrat takut berinovasi untuk kebaikan yang lebih besar bagi masyarakat dan lingkungan karena takut jika diperiksa “inspektorat” akan ada temuan yang tidak sesuai administrasi. Nah, kalau sudah sampai disini, pertanyaannya adalah apa yang mempengaruhi perilaku individu, masyarakat dan birokrasi itu? Banyak yang mempengaruhi. Bisa Regulasi/UU/PP/Perda dll, bisa norma agama, ideologi atau bahkan kesepakatan bersama dari suatu masyarakat, koalisi tertentu, dan lainnya. Langkah Ke Depan Ingin banjir dan banjir bandang tak berulang di Sumatera Utara? Perlu pembenahan mendasar terhadap perilaku yang bermasalah dari individu, masyarakat dan birokrasi dalam beraktivitas dan bersikap di atas wilayah DAS. Dalam tataran kebijakan perlu disusun pedoman pengelolaan DAS di Sumatera Utara dalam bentuk peraturan daerah (Perda) sebagai payung apa yang boleh dan apa yang tidak boleh di atas suatu unit DAS, apa kewajiban dan hak setiap para pihak yang terlibat. Perda itu juga harus merinci tanggung gugat dan ancaman pidana bagi siapa saja yang menyebabkan rusaknya wilayah DAS. Kerjasama antara kabupaten/kota yang terletak dalam satu hamparan DAS menjadi suatu keharusan/kewajiban. Misalnya antara kota Medan dengan Deliserdang dan Kabupaten Karo. Seluruh DAS yang bagian wilayahnya mencakup kota Medan, bagian hulunya terletak di Kabupaten Deliserdang dan Kabupaten Karo. Karena itu, setelah Perda perlu disusun Rencana Terpadu (RP) setiap unit DAS, misalnya RPDAS Deli yang di dalamnya mengikat pemerintahan kota Medan, Kabupaten Deliserdang dan Kabupaten Karo. Langkah selanjutnya, harus ada edukasi baik berupa pendidikan, sosialisasi kepada segala pihak terkait melalui berbagai media, termasuk dalam aktivitas pendidikan sekolah sejak dini. Ini bukan obat mujarab yang keberhasilannya seperti membalik telapak tangan. Namun perlu keseriusan, nafas panjang dan konsistensi dalam pelaksanaannya dari semua pihak, karena yang dilakukan adalah merubah perilaku. Bila itu kita lakukan, maka kegagalan program tidak akan terulang sehingga lahan kritis akan terus berkurang, pengalihfungsian daerah resapan air menjadi permukiman tidak akan terjadi, dan berbagai perilaku buruk lainnya yang selama ini terjadi. Lebih lanjut, kondisi lingkungan suatu DAS akan pulih, sehingga dapat berfungsi kembali. Dan pada akhirnya bencana banjir bandang tak lagi menghantui penduduk di Sumatera Utara ini. Semoga! Penulis adalah Dosen Dan Peneliti Bidang Ekologi Dan Manajemen Hutan Tropika Pada Program Studi Kehutanan Fakultas Pertanian USU.


B6 1 CM 2 CM

WASPADA

Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000

BURSA

AUTOMOTIVE Informasi Pembaca

AC BR CL ND DB

Bursa Automotive PS PW RT VR EW

: Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower

: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

DAIHATSU Promo Grand Max PU DP 9 Jt Angs. 2 Jt-an, XENIA TERIOS Angs. 2 Jt-an Hub. 0812.653.1129 DAIHATSU Espass MB 96 Rolling door. AC,Tape, VR,Medan, mulus luar dalam. Mbl kaleng2. Warna ungu. HP. 0812 6424 995

DAIHATSU Xenia XI Family Th. 2009. BK Panjang. Mbl sgt mulus, Hrg. 130Jt. Wrn silver, HP. 0813 6212 2339 “PROMO DAIHATSU” JANGAN TUNGGU S/D BLN JUNI Pesan Daihatsu sekarang Hub.HASIBUAN ASTRA 0812 6362 4634 DAIHATSU Hiline 4x4 Pick Up, Th. 92, 96, 97, 00, 02, 04, 06. Biru/Htm, Siap pakai. Bantu Kredit. Hub. Yos Sudarso 42F, Pajak Glugur, 6614976

“DAIHATSU PAKET MURAH”

Gran Max Pick Up DP 7 Jt-an Angs. 2 Jt-an Gran Max Minibus DP 18 Jt-an Angs. 4 Jt-an Luxio D DP 16 Jt-an Angs. 5 Jt-an Xenia M. Deluxe DP 21 Jt-an Angs. 3 Jt-an Terios TS Xtra DP 21 Jt-an Angs. 4 Jt-an Hub. ERWIN HP. 0812 6315 4132 061 77402067 DAIHATSU Espass Th. 96 Dijual. Minibus 1300cc. Warna hijau, mobil mulus, kaleng, siap pakai. Harga Rp.35Juta/Nego. Telp. 0812 6377 6769 DA I H AT S U F e r o z a T h . ‘ 9 4 , B i r u metalik, AC CD/DVD, VR/BR, Ban baru, msh orisinil. Jok kulit. Tidak kecewa Rp. 47,5Jt. HP. 0852 9640 7363. Jl. Jermal IV No. 84 Medan Denai.

“DAIHATSU BARU PAKET HEMAT” All New Xenia DP 17Jt-an / Terios DP 21Jt-an Pick Up DP 7 Jt-an / Minibus DP 12Jt-an Info Hub. 0823 6471 2207 / 0852 9775 6889

DAIHATSU Xenia, VVTi, Th. ‘08. Warna silver met, mobil cantik, seperti baru, 1 tgn dari baru Rp. 108Jt. 0815 3373 3688 / 7851402 *Promo Honda Freed Disc 20Jt-an +BB Onyx DP Ringan, Proses Cepat..! * Telah Hadir All New CRV MMC. Pesan sekarang, stock terbatas...!! Hub. 0853 72888 469

JAZZ NEW HONDA FREED KREDIT TANPA BUNGA (0%) C R - V SELAMA 3 TAHUN ATAU DP 29 JT-AN. TERIMA C I T Y Tukar Tambah 081.370.999.998 / 77.388.33 HYUNDAI Atoz GLS Thn. 2000 Dijual. Warna hijau met, An. Sendiri. Harga 57Jt Nego. Hub. 0813 6135 8065

HONDA Civic Wonder, W. Merah, pajak panjang. Thn. 1986. HP. 0821 6080 2009 HONDA Jazz V-Tec, Sport Th. ‘07, Matic,Km. 50xxx, warna abu metalik, sound system, ban besar, 1 tgn dari baru Rp. 148Jt. Depan Kampus UISU No. 200. 0821 6767 7000 / 785 1402 # ISUZU 100% Baru (Astra) # Panther Pick Up Turbo................DP 20 Jt-an Panther LM, LV, LS, GR Touring... DP 35Jt-an Hub: Suprapto HP. 0813 7507 0088 / 061-77860168

ISUZU Panther Pick Up Thn. 2009. Turbo, Warna hitam. Hub. 0852 6066 1689 ISUZU Panther LDX 91 Biru metalik. P. Steering, P. Window, Jok baru, mobil mulus, mesin sehat, siap pakai. Mobil siap pakai, Harga 45/Nego. Hub. 0812 6568818 / 77305875

NEW NISSAN

New Nissan Evolia, Juke, March, Grand Livina, Novera, Cash/Kredit. Bonus Hub: MILI (0852 7033 7739)

R BREAKER

STYLE D/P RINGAN KREDIT 1 s/d 4 TAHUN

Hadiah TV MOBIL + PARKING SENSOR Cash Back 12 JUTA Ka Sola ca Fi r G lm uard

KREDIT VIA:

Hubungi Daeler SUZUKI

ADA JADI MOBIL

JL. JEND. G. SUBROTO 18-20-22 Depan Air Mancur Petisah Tel. 4522619 - 4146757 MEDAN * Jl. GURU PATIMPUS 11-D Simpang Jl. Kelapa TEL. 4151018 - 4535762 MEDAN

5 CM 6 CM

Rp. 65.000 Rp. 78.000

MITSUBISHI Grandia Th. 2001. W. Hitam metalic, AC DB, Tape, VR, BR, PS, PW, CL. BK Medan. Body Kaleng mulus seperti baru. H. Nego. Hub. 0813 6233 0595

7 CM 8 CM

Rp. 91.000 Rp. 104.000

DANA TUNAI Jaminan BPKB mobil, Pick Up, Truck, Tronton. 0853 59711000

OPEL Blazer Montera Thn. 2001. Warna silver, BR, VR, AC, TV + DVD + Audio, BU. Hub. 0813 7553 6688

SEPEDA MOTOR

- Suzuki Carry 1,5 Pick Up, Htm, th. 08, DP 18 Jt. Angs. 2,2Jt - Daihatsu Espass 1,3 Pick Up Htm, Th. 05, DP 13 Jt, Angs. 1,5Jt - Mitsubishi T120SS 1,3 Pick Up, Htm, Th. 05. DP 13Jt Angs. 1,5Jt Hub. Yos Sudarso 42F, Pajak Glugur 0812 6076 476

DIJUAL HONDA SUPRA FIT W. Merah Silver Thn. 2007, Tgn Pertama, Harga Rp. 5,9Jt/Nego. Hub. 0812 6090025 & 0812 63691450.

SUZUKI Carry Extra 10. Adi Putro. Thn. 90. Minibus, nama sendiri. Tinggal pakai. BK Panjang Harga Nego. 0813 6135 7361 TOYOTA Kijang Capsul Model LGX New Bensin 1.8 Th. 2003. Biru mika, sgt mulus, orisinil, BPKB 1 NM, VR 17, BR, PS, PW, CL RMT, E. Miror, AC DB, Full sound Pake TV 3 Unit. Hrg. 135Jt. Nego. Hub. 0821 6440 6043 TOYOTA Kijang Capsul Model LGX Solar Th. 2000. Hitam met, a/n. Sendiri, sgt mulus, VR, BR, PS, PW, CL RMT, E. Miror, AC DB, full sound, Pake TV, ada 3, Hrg. 120Jt. Nego. Hub. 0812 6949 9450

TOYOTA Kijang Kapsul Thn. 2000 Dijual. 1,8cc. Tape, PS, CL, PW, AC, mobil siap pakai. (bkn mobil rental) tanpa perantara. Hub. HP. 08216321 0383 - 0852 7550 3293

BURSA

BURSA

SERVICE/ASESORIS MOBIL

PROMO SARUNG JOK MOBIL

SPESIALIS ALAS DASAR, DOORTRIM, LANGIT-LANGIT, AUDIO, ASESORIES MOBIL & KACA FILM

TYPE MOBIL TYPE PROMO SEDAN PROMO 1 Rp. 600.000 PROMO II Rp. 900.000 PROMO III Rp. 1.000.000 PROMO IV Rp. 1.400.000

MINI BUS Rp. 700.000 Rp. 1.000.000 Rp. 1.100.000 Rp. 1.600.000

TOYOTA Great Corolla Thn. 94. Warna hitam mulus, body mulus, mesin sehat, lengkap, AC, CL, Power Window, Alarm, DVD, VR 17 BK Mdn 1 nama BPKB. Hub. 0852 5698 7088 - 0812 4276 228

TOYOTA Innova V Thn. 2010, Pajak April 2013, Diesel, Hitam mulus, BK Medan, Tgn I, Manual. Hub. 0821 6855 5550, 0812 6963 5878

Hub. Jl. Nibung II No. 114 Medan (Samping Medan Plaza) Telp. (061) 4566884 (Hunting) dekat Carrefour.

TOYOTA Kijang Super Commando Th. 93 W. Abu2 metalic. AC, Tape, VR, BR, PW, CL, BK Medan, Body lempang. Mulus. Mesin sehat. Terawat. Hub. 0852 7599 6758

Rp. 1.350.000,Jok (model press) + Alas

ELITE MOTOR

DO RE MI JOK MOBIL KHUSUS AVANZA/INNOVA

TOYOTA Kijang Commando Thn. 91 Warna biru abu2 long 5 pintu pajak panjang BK Seri Labuhan Batu. Hrg. Rp. 46,5Jt. Nego. Hub. 0821 604 37457 (TP)

TOYOTA GREAT COROLLA SEG 1995 Hijau metalic, BK Medan asli, Velg Racing 16”, jok kulit. Mulus (siap pakai). Hub. 0813 611 38100 (TP)

TOYOTA YARIS TIPE E 2006 Hitam metalic, BK Medan asli, Velg Racing 17” Full original. Hub. 0812 6071 1172 (TP) TOYOTA Kijang Kapsul LSX Up Th. 2004 Dijual. Sudah model LGX, warna Biru, AC DB, Mobil mulus, siap pakai. Harga 122Juta/Nego. Telp. 0812 6377 6769

TOYOTA Kijang Th. 89 Dijual. Commando. warna merah. AC, Tape, V. Racing, mobil mulus. Siap pakai. Harga 42Juta/Nego. Telp.081263776769

TOYOTA BARU 100%

Innova, Avanza/Veloz, Yariz, Fortuner. Rush. Bunga Ringan. Data dijemput (Ready Stock). Hub. 0812 604 9252 - 061. 76326555

BURSA BUTUH DANA BUTUH DANA Jaminan Apa Saja. Sertifikat Tanah Mobil & Sp. Motor. Segala tahun. Hub. 061.8222 774 HP. 0853.6199.1500-0816 314 1807

PINJAMAN SUPER CEPAT

Jaminan: SHM, SK Camat, SK Lurah, BPKB Spd. Mtr, mobil, Pick Up. Bantu Pelunasan BPKB Pinjaman 1 Juta - 1 Milyar. Proses 3 Jam Cair. Tanpa Usaha. Pinjaman 5 M - 500 Milyar. Jaminan SPBU, Pabrik, Tambang Batu Bara. Rumah Sakit, Hotel. Hub. Family Finc: 0813 7044 6668, 0813 7044 6633

DO RE MI JOK MOBIL

JL.S.PARMANBLOKDDNo.3-4PETIDAH-MEDAN (DEPANSEKOLAHST.THOMAS2MEDAN) Telp. 061-4522123, 77602123 JL.MAKMURNo.10A,MEDAN (MASUKDARIJL.ADAMMALIK/JL.KARYA) TELP. 061-6639123, 76501123

SERVICE

WC WC

KONSTRUKSI Jl. P. Brayan Medan HP.

0813 7035 7291 Ada Garansi

TUMPAT/ SEDOT SETIA BUDI HP. 8442246 0812 631 6631 Ada Garansi

Ingin Promosikan Produk Anda

Harian

WASPADA Media yang Tepat untuk Iklan Anda

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

Pelanggan Yang Terhormat

PT. Harian WASPADA.

Apabila anda mencurigai sesuatu, silahkan hubungi kami di 061-4576602

Terimakasih

TELAH TERCECER

TERCECER

Surat Perjanjian Pelepasan Hak Dan Ganti Rugi No. 593.83/ 34/SPPH - GR / MBRT/1989. Tgl. 16 Maret 1989. Atas Nama: Dame. Lokasi : Jl.Punak Gg. Sakti Luas : 140M2. Yang menemukan Hub: Hendri HP. 0812 3366 8989

TERCECER

1. Surat Pelepasan Hak dengan ganti rugi No. 592.2/753/PTB/V/1995, tanggal 23 Mei 1995 atas nama Samin Pakpahan, terletak di Desa Patumbak Kec. Patumbak Kab. Kabupaten Deli Serdang 2. Akte Jual Beli yang ditandatangani oleh Lurah atas nama Samin Pakpahan, tercecer disekitar Perumnas Simalingkar s/d Patumbak sekitar Jam 7 s/d jam 8 pagi hari Minggu Tgl. 13 Mei 2012, bagi yg menemukan mohon dikembalikan ke: Jl. Karet XV No. 7 P. Simalingkar atau hub. Samin Pakpahan 0812.6305.4825, tidak dituntut dandiberi hadiah sepantasnya.

Ingin Promosikan Produk Anda Harian

WASPADA Media yang Tepat untuk Iklan Anda

TERCECER/ HILANG

1 BPKB No. 5111471-B, No Pol BK 8151 MY, Suzuki Carry Pick Up A/n. Sany Wirawa alamat Jl. Serba Guna Dsn. V Helvetia. Kab. Deliserdang

-

DI BIMBING SAMPAI KE TANAH SUCI Umroh Reguler 9hr = 25 May - 04, 18, 25 Juni, -04, 09, 14 July Umroh Reguler 13hr = 21 May - 10, 22 Juni Umroh Plus Turkey = 15 Juni Umroh Plus Mesir = 10 Juni Umroh Plus Jordan Aqsha (Isra’ Mi’raj) =14 Juni Umroh Ramadhan (awal - Tengah - Akhir) = 21 dan 25 Juli ONH Plus/ Khusus

Jamaah luar kota dapat penginapan/ Hotel, Makan dan Transportasi ke Bandara Gratis !!! Manasik Haji Multazam: Setiap hr Sabtu Pkl. 14.00-16.00 Wib hr Minggu Pkl. 09.00-11.00 Wib Tempat manasik Mesjid Agung Medan Jl. P. Diponegoro DAFTARKAN SEGERA KE: KANTOR PUSAT MULTAZAM MEDAN Jl. Titi Papan/ Pertahanan No. 10 Sei Sikambing Medan Telp. (061) 457.6116 - 7731.3385 HP. 0813.6137.2321 - 0812.6495.8456

TEKNISI MESIN FOTOKOPI

Dengan persyaratan sbb: 1. STM jurusan Listrik/ Elektronika 2. Tamatan 2012, FC Raport kelas III 3. Tamatan 2011, FC Ijazah 4. Pas photo 4x6 = 1 lembar 5. Cantumkan NO. HP

Lamaran ditujukan kepada Iklan Mini Harian Waspada dengan Kode: PERDANA MANDIRI Sebelum Tanggal 23 Mei 2012

AC

REPARASI AC, KULKAS, MESIN CUCI Kompor Gas, Dispenser H & C TV, M. Pompa Air Sanyo

Hub. SURYA TEKNIK SERVICE Telp.66482216 - 0813 7589 8757 Siap Ketempat

BURSA

PHOTO COPY

TERCECER

1 (Satu) BPKB A/n. DINAS PERTANIAN Jl. Jend. Abd. Haris Nst. No. Rangka TCE 71921 No. Mesin: YD25 - 168924 A.

TERCECER Sertifikat Tanah / Rumah alamat Jl. Terompet No. 15 Pasar I Titi Rante Padang Bulan Medan. A/n. Ganti Tarigan bagi yang menemukan hub. Musa Tarigan, SH HP.0852.6061.6273

TELAH TERCECER / HILANG

SERVICE

ELEKTRONIK

KHUSUS REPARASI /SERVICE Kulkas, M. Cuci, Sanyo Air, Dispenser, Bongkar Pasang AC Hub. PRATAMA ELECTRIC GARANSI Telp. 7343789

Penerbangan Via Singapore *Khusus bagi jama’ah dari luar kota nginap di Hotel Madani Gratis DAFTAR SEGERA

Kantor: Gedung Gelora Plaza Lt. 1 Jl. S.M. Raja No. 4/18 Medan

Telp. 061-7326981, 0813 7503 1889, 0852 6213 3488 Website: www.amanahumrohmedan.com

DICARI GURU PESANTREN DARUL ULUM AL-MUHAJIRIN MEMERLUKAN TENAGA PENGAJAR UNTUK BIDANG STUDY B. INGGRIS DAN HAFIZH KIRIMKAN LAMARAN/ INFORMASI KE: JL. TITI PAPAN GG. PERTAHANAN NO. 10 SEI SIKAMBING MEDAN TELP: (061) 457.6116 / 0813.6137.2321 ATAU PESANTREN DARUL ULUM AL-MUHAJIRIN JL. BINJAI - KUALA KM. 12,5 PASAR II SELESAI LANGKAT

BURSA

PENDIDIKAN KHURSUS KOMPUTER LPK PAULINE DAFTAR LANGSUNG BELAJAR, WAKTU BEBAS

Ms. Word + Excel + Internet .....300 Rb (2 minggu) Photoshop (CS4)/ Corel Draw..150 Rb (6 hari) Autocad 2D/3D/3D Max........... 300 Rb (10 hari) Design Grafis (Komplit) ............. 700 Rb (3 bulan) Web Design (Dreamweaver) ... 400 Rb (10 hari) SAP (Teknik Sipil)........................ 500 Rb (10 hari) Visual Basic.................................. 300 Rb (7 hari

LOWONGAN KERJA

Dibutuhkan * Supir/ Operasional * Dengan kriteria sbb: a.Pria max. 35 thn b.Minimum tamatan SMA c.Memiliki SIM A/ SIM B1 d.Jujur, dan bertanggung jawab Lamaran diantar langsung ke: PT. Binatama Sentrafajar Jl. B. Katamso No. 23C Medan Telp. (061) 451.3802

BURSA

BURSA

DIBUTUHKAN Pria Tukang Pangkas Rambut berpengalaman, Kontrak 1 tahun, Rp. 1.500.000, Jaminan Rp. 40.000/hari selama 1 bulan, Hasil dibagi 2 Tarif Rp. 8000/kepala, Persyaratan: Ijazah terakhir (Asli), Photo copy KTP, Photocopy Kartu keluarga, Lokasi Tanjung Selamat-sunggal Peminat serius hubungi: T. Nainggolan HP. 0813.7545.7734

DIBUTUHKAN

Tk. pangkas pria yg berpengalaman diberi jaminan 50 Rb/hari, uang makan 10 Rb/ hari Hub. Citra Pangkas Jl. Bromo No. 90 Medan HP. 0813.6148.7010

DIBUTUHKAN

BURSA

MESIN

DIJUAL MURAH

TERCECER BPKB Asli BK 1148 JV. atas nama Flyfirefly SDN. BHD Jl. Katamso No. 62 D Medan.

REGULER 9 HARI 24, 29 JUNI REGULER 11 HARI 15 JUNI REGULER 14 HARI 20, 23 JUNI AWAL RAMADHAN TENGAH RAMADHAN FULL RAMADHAN

KOMPUTER

LOWONGAN

Satu set berkas mutasi BB 673 RA A/n. RIcky Ramadan Jl. Stella No. 35, Toyota Corolla Thn 1987, No. Rangka EE809032397, No. Mesin 2E 0759083 di Jalan Putri Hijau Medan

BURSA

AMANAH UMROH

DIBUTUHKAN Karyawan/ti minimal D3/ Mahasiswi, Gaji tetap dan komisi Hubungi Eva 0878.6895.7678 (061) 7638.3848

TERCECER

ALAT MUSIK

UMROH UMROH UMROH UMROH UMROH UMROH

Jl. Sei Batang Hari No. 170 Medan Telp. 8442158

TERCECER

AC

Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput

HARGA BELUM TERMASUK PPN 10%

UMROH MULTAZAM

Surat tanah, Alamat Jalan Jamin Ginting Gang Aman Kel. Merdeka, Kec. Medan Baru. Tercecer Tgl. 25 April 2012. Disekitar Jl. Jamin Ginting Padang Bulan Medan dan Dr. Mansyur An. TERTEN PINEM. Hub. 0852 76 33 97 44. Bagi yang menemukan.

TERCECER Surat atas nama Muin Effendi Lubis. Alamat Jl. Perdana No. 30 Medan.

1 Buah Surat Jual beli tanah tertanggal 10 Maret 1973, atas nama Abdul Gani, diduga tercecer antara Jl. G. Martimbang s/d Jl. Merpati, Paya Kapar - T. Tinggi. Barang siapa yang menemukan surat tersebut diatas harap mengembalikannya ke alamat: Jl. Gunung Martimbang II Lk. 05 No. 83 Kel. Rantau Laban Kec. Rambutan - T. Tinggi.

FAX.4561347

DIBUTUHKAN SEGERA

1 Buah tas berisi 11 buah BPKB,dengan Nomor (di daerah Petisah) 1. No. H. 06619143 - B 1883 PKF 2. No. 2790664 B - BK 1650 RI 3. No. 5093131 B - BK 1476 HU 4. No. H-0915 2735 B - BK 6612 CJ 5. No. 5085 030 B - BK 744 RA 6. No. 4940478 B - BK 1116 NN 7. No. 5209516 B - BK 9621 BJ 8. No. 5209521 B - BK 9624 BJ 9. No. 5209 519B - BK 9627 BJ 10. BK 8838 GG 11. BK 8304 BG Dan dokumen Penting berupa cek / Giro Bank UOB Buana, Mestika, BCA, Sumut dan Kesawan. Bagi yang menemukan barang-barang diatas mohon menghubungi No. 081 533362207. Akan diberikan imbalan sepantasnya bagi yang menemukan dan mengembalikan tidak akan dituntut.

HILANG/TERCECER Hubungi:

11 CM Rp. 165.000 12 CM Rp. 180.000

HA TI-HA TI terhadap penipuan yang HATI-HA TI-HATI mengatas namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk membeli produk anda, TI-HA TI apabila anda ingin dan HA HATI-HA TI-HATI melakukan transaksi jual beli melalui transfer. Segala akibat yang terjadi diluar tanggujawab

BURSA

TOYOTA Kijang LGX Th. 98 W. Merah. Metalic, AC DB, Tape, VR, BR, PS, PW, CL, BK Medan. Body kaleng, jamin mulus, H. Nego. Hub. 0813 7582 3555 TOYOTA Kijang Th. 91 Dijual. 5 pintu. Warna hijau AC, Tape, V. Racing, mobil mulus, siap pakai. Harga 40juta/Nego. Telp. 0812 6377 6769

9 CM Rp. 126.000 10 CM Rp. 140.000

Rabu, 16 Mei 2012

1 (Satu) Set Alat-alat Gilingan Padi Siap Pakai. a. Polish Beras 2 unit N.L 25 b. Ayaan Beras 90 Lubang 1 Unit c.Mesin Nissan Diesel RD8 d.Kupas Kulit 10 Inchi 1 Unit e. Dan Peralatan Lainnya Bagi yang berminat Hub. 0853 7288 8832

Asisten Salon, yg berpengalaman diutamakanwanita,Hub.QUEENSALON, Jl. Rajawali No. Ii Telp. (061) 847.7790 HP. 0852.7742.5743 Medan

DICARI CEPAT GURU TK/ Playgroup, SMU/ D3/S1, Syarat kreatif datang langsung Jl. Karya Wisata No. 23A Johor Ph. 786.2156/ 786.1690 Medan LOWONGAN

BARU BUKA

Dibutuhkan segera P/W 17 - 45 thn sebagai “MITRA KERJA” untuk diposisi di “Kantor” (terbuka bagi Mahasiswa/semua kalangan), NON SALES Syarat: Photo copy KTP + Guntingan koran untuk proses Interview, Penghasilan Rp. 1.200.000 s/d Rp. 2.500.000/bulan HUB: IBU MARNI/ BPK. CHAIRUL HP: 0823.6426.4158 - 0878.7699.2355

Alamat: Jl. Gatot Subroto (simpang Empat Lampu Merah Medan Plaza), seberang Jalan Rumah Makan Simpang Raya Medan NB: Interview pukul 10.00WIB-16.00WIB. Bagi yang baru tamat SMA SKHU menyusul

DIBUTUHKAN

POLITEKNIK UNGGUL LP3M Membutuhkan segera TENAGA KEPUSTAKAAN Kualifikasi: 1. Wanita 2. Min. D III kepustakaan 3. Usia, maksimum 30 tahun 4. M e n g u a s a i c o m p u t e r (Ms. Office) 5. K o m u n i k a t i f , m a m p u berbahasa Inggeris (min. pasif) Kirimkan surat lamaran, CV dan berkas pendukung ke alamat Politeknik Unggul LP3M Medan Jl. Syailendra No. 21 Telp. (061) 453.0701

DIBUTUHKAN SEGERA

Sebuah perusahaan perkebunan kelapa sawit yang sedang berkembang membutuhkan: 1. ASISTEN AFDELING 2. MANDOR I 3. ASISTEN TRAKSI 4. MEKANIK 5. ADMINISTRASI 6. OPERATOR ROAD GRADER Kualifikasi: - Pria, usia maksimal 40 tahun (1, 3), maksimal 35 tahun (2, 4, 5, 6) - Pendidikan minimal S1 Pertanian (1),minimalD3Pertanian(2),minimal DIII/ STM Teknik Mesin/Elektro (3,4) minimal SMA/SMK (5) - Pengalaman kerja minimal 5 tahun pada posisi yang sama di perkebunan swasta (1, 2, 3) - Mampumengoperasikankomputer (Microsoft Word dan Excel) (5) - Jujur, bertanggung jawab, kemampuanadaptasidankemauan belajar yang tinggi (1-6) - Memiliki fisik/ jasmani yang sehat dan prima, jiwa kepemimpinan dan komitmen jangka panjang (1-6) - Bersedia ditempatkan didaerah Aceh Tamiang (1-6) Lamaran beserta CV ditujukan langsung ke:

Jalan Haji Adam Malik No. 16 Medan Telp. (061) 456 3938

LAPTOP

TOSHIBA + Dvd (1,6Jt) hp +DVD (1,7Jt) Acer - Coi5 +VGA +4Gb (3xJt)-Coi3 - Co2 (1xJt)

Lcd acer (499rb)Mb+P4-2.8 (295)Cctv(195rb)kamera (590rb) Butuh dana jaminan-Laptop - kamera - Dslr - bb - (kredit Warnet/ Ps2) PT. 061-91156-358-Jl. Rantang20 (Gatsu)

PAKET CCTV PROMO !!!

GARANSI 1 TAHUN * PAKET 4 CHANNEL + INFRARED + HARD DISK 500GB 4 Bh Camera + DVR 4 Channel + HDD 500 Gb + Power Suply 10 A .................................................................... Rp. 2,8Jt * PAKET 8 CHANEL + INFRARED + HARD DISK 500GB 8 Bh Camera + DVR 8 Chanel + HDD 500 GB + Power Suply 15 A

........................................................................Rp. 4,5Jt NB: Harga belum termasuk Pemasangan dan Kabel KAMI MENYEDIAKAN HARGA GROSIR KHUSUS UNUTK DEALER !! Setiap pembelian Paket dapat memilih Camera Outdoor/Indoor sesuai dengan kebutuhan rumah, Kantor, Pabrik, dll

Toko H . W

JALAN ASIA NO. 1C TELP. 061.7346093 - 75330002

BURSA

MATERIAL


Ekonomi & Bisnis

WASPADA Rabu 16 Mei 2012

B7

DPRDSU Minta Dispenda Kembangkan Potensi Pajak MEDAN (Waspada): Komisi C DPRD Sumut meminta Dinas Pendapatan Daerah (Dispenda) Sumut meningkatkan dan mengembangkan potensi pajak untuk penerimaan daerah.

Waspada / Rusli Ismail

SEJAK lama sudah berlangsung pengalihfungsian peran Tempat Pelelangan Ikan (TPI) Lampulo yang berfungsi sebagai pelelangan ikan grosir alias dalam jumlah banyak. Para konsumen memenuhi pelataran TPI Lampulo guna mendapatkan ikan segar dengan harga murah yang dijual secara eceran, Minggu (13/5).

Perdagangan, Hotel, Restoran Pasar Simalingkar Berbenah Serap Kredit Rp1,75 T M E D A N ( Wa s p a d a ) : Penyaluran kredit perbankan hingga Maret 2012 tercatat sebesar Rp109,74 triliun dan mengalami peningkatan dari bulan sebelumnya. Dimana sektor usaha perdagangan, hotel dan restoran di Sumut pada Maret 2012 menyerap kredit paling tinggi mencapai Rp1,75 triliun, naik 6,95 persen. “Pada Maret 2012, nilai nominal penyaluran kredit sebesar Rp109,74 triliun, meningkat 3,47 persen (mtm) atau 19,92 persen (yoy) dan Share perbankan konvensional sebesar 95,36 persen,” kata Kepala Divisi Ekonomi dan Moneter/Deputi Direktur Kantor Perwakilan Bank Indonesia (BI) Wilayah IX

Sumut-Aceh Mikael Budisatrio, kemarin. Dia menyebutkan, dukungan kredit perbankan terhadap sektor-sektor ekonomi utama di Sumatera Utara masih menunjukkan peningkatan terutama untuk sektor perdagangan, hotel, dan restoran yang mengalami peningkatan tertinggi sebesar 6,95 persen (mtm) dengan nominal sebesar Rp1,75 triliun seiring dengan tingginya aktivitas konsumsi masyarakat. Mikael mengatakan, seiring tren penurunan suku bunga kredit perbankan, penyaluran kredit mengalami peningkatan dibandingkan bulan sebelumnya. Tingkat suku bunga perbankan pada periode ini tercatat sebesar 11,49 persen, lebih

RUKO BARU DIJUAL

BURSA

Informasi Pembaca Bursa Property

G R : Garasi LB KM : Kamar Mandi LT KP : Kamar Pembantu RM KT : Kamar Tidur RT SHM: Sertifikat Hak Milik

: Luas Bangunan : Luas Tanah : Ruang Makan : Ruang Tamu

PERUMAHAN Dijual Citra Menteng Blok D-04, Jl. Menteng VII, KT 2, KM 1 (Conecting dgn KU), Tingkat belakang Hub. 0812.6320.2952 0811.632.073

KIOS PLAZA MEDAN FAIR DIJUAL

Lantai 2 B3 67, 4½x4m, Siap pakai, Include Furnitre HP. 0853.5847.6782 RUKO DIJUAL Jl. Utama simp. Cemara Amaliun No. 228A-B, 2½ Pintu, Ukuran 14x21m, Listrik 4400 Watt HP. 0853.5847.6782

RUMAH DIJUAL

Kompleks Citra Menteng Jl. Menteng VII (Khusus Muslim), Fasilitas: Mushola Lpg. Batminton, Aman, Scurity 24 jam, Dijamin tak mengecewakan Harga 300 Jt/nego Dewi: 0821.6301.9020

BURUAN

Unit Terbatas (Hanya 3 unit lagi) Type 85 (4 KT & 2 KM)

Spring Bed 6 kaki 2 lapis Rp. 1.150.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun

Hub Telp. (061) 661.8116 - (061) 661.6802 - 7653.2188

BANDUNG KAOS U’ CALON AGEN BISA CEK STOCK 24 JAM VIA SMS

ANDA BUTUH

ALAT BANTU DENGAR ? HUB.

MELTRA HEARING AID JL. KEDIRI NO. 36 MEDAN TELP. 451.6161

TANAH DIJUAL Kebun Sawit Luas 13 Ha, Lokasi Duri/ Riau Hub. 0852.6192.1442

KEBUN KARET DIJUAL LUAS 9,6 HA HP: 0812.6341.2232

(±50m dari Simpang Pelangi) Hubungi: 0852.9751.4253 0812.6050.0881

MEDAN (Waspada) : Cuaca buruk yang terjadi selama beberapa waktu belakangan mulai terasa akibatnya di Medan. Karena nelayan yang enggan melaut, pasokan ikan menjadi minim di pasar tradisional di Medan. Akibatnya, harga ikan basah menjadi mahal dengan kenaikan rata-rata hingga Rp5.000 per kg. Pantauan Waspada, Minggu (13/5), para pedagang mengaku penyebab harga menjadi melonjak adalah karena minimnya pasokan ikan dari kalangan nelayan di Belawan dan Tanjung-

balai. Akibatnya, pedagang ikan tak memiliki stok yang cukup, padahal permintaan konsumen cenderung naik. Hal ini seperti yang dikatakan Imron, salah satu pedagang ikan di Pusat Pasar Medan. Dia mengaku hanya mendapat pasokan sebanyak 50 kg, padahal pada hari normal dia bisa mendapat pasokan hingga 150 kg. Ikan yang mengalami kenaikan harga umumnya jenis yang dikonsumsi sehari-hari oleh warga kota, seperti dencis, kakap, gembung, bawal, tongkol, dan sejumlah ikan lainnya.(Cdu)

Ingin Promosikan Produk Anda

Harian WASPADA

MENJUAL PECI TEMPAHAN

Berbagai Model dan Warna Jl. Prof. H.M. Yamin SH. No. 344/Jl. Serdang Depan Gg. Sado Medan, HARI MINGGU TETAP BUKA

BURSA

TRAVEL/ WISATA

TANAH DIJUAL

Dpt Diperoleh di Sumatera - Aceh Hub: (061) 7365429 - 7362887

Ukuran 20x30 alm Jl. Brayan DaratGg.NangkaKec.Medan Brayan dengan Sertifikat SHM (TP) Hub. 08196071491 085760788220

KLINIK TERAPY ALAT VITAL MAK EROT YANG TERUJI DAN TERBUKTI

Dengan H. TEJA SAEFUL Cucu Asli Mak Erot Bersama

A. Ust OTONG

Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041 KHUSUS PRIA: - Ejakulasi dini - Impotensi - Memperbesar “Alvit” - Memperpanjang “Alvit” - Keras dan tahan lama dll KHUSUS WANITA: - Ingin punya keturunan - Memperkencang & memperbesar payudara - Mengobati keputihan dll KONSULTASI UMUM: - Buka Aura - Cari Jodoh - Sesama jenis - Pelaris - Memikat lawan jenis - Besar PYDR

TANAH DIJUAL

Ukuran 742 Ha di Jl. Raya Gunung Tua Desa Janji Lobi 5 Sibuhuan Madina dengan Surat SK Camat (TP) Hub. 08196071491/ 085760788220

Hubungi: Jl. Bilal No. 90 P. Brayan Medan Telephone Toko : 661.6285 Rumah : 661.1540 Fax : 661.6285 (061) Jl. K.L. Yos Sudarso depan SMA Negeri 1 Tebing Tinggi Telp. (0621) 24243

H.G.A. FACHRUDIN

Jl. Brigjend. Katamso No. 683C Medan

Cuaca Buruk, Harga Ikan Naik

NO. POM. TR. 873635522

PECI MAHKOTA

TANAH DIJUAL

MALIOBORO PERABOT

WASIR/ AMBEIEN

kepada pimpinan rapat untuk membuat rekomendasi. Meminta kepada pihak kepolisian untuk menindak tegas kendaraan-kendaraan dinas ber nomor polisi di luar Sumut. Selanjutnya, diminta kepada perusahaan-perusahaan itu memutasikan kendaraannya ke Sumut. Sementara itu, Kadispenda Sumut Sjafaruddin, mengaku sangat merespon masukan yang disampaikan para anggota dewan. Dia juga mengaku sangat ingin meningkatkan penerimaan sektor pajak. Berbagai upaya juga sudah dilakukan pihaknya. Mencari potensi pajak baru, menurut Sjafaruddin, sulit di lakukan, karena sektor-sektor kena pajak sudah diatur dalam undang-undang. Di sana sudah jelas dibagi, jenis pajak apa saja dipungut pemerintah provinsi dan jenis pajak yang dipungut pemerintahkotadankabu-paten. Yang dapat dilakukan Dispenda Sumut dalam meningkatkan penerimaan daerah kemungikan dari kerja sama dengan beberapa pihak. Misalnya dengan Bandara Kualanamu dan perusahaan pertambang-an. ‘’Tapi bentuknya usaha dan investasi,’’ katanya. Tentang kendaraan luar provinsi? Disebutkan Sjafaruddin, itu juga telah menjadi pemikirannya sejak lama. Dia juga melihat, semakin hari jumlah kendaraan luar provinsi semakin banyak beroperasi di daerah ini. ‘’Kita akan berkoordinasi dengan berbagai pihak untuk merealisasikan program ini,’’ katanya. (m12)

MINYAK URUT BOXING

BURSA

BUSANA/ ACCESORIES

Uk. 17,5x80mtr, SHM di Jl. Perjuangan, Tg. Rejo disamping Komplek Setia Budi Indah, ±300mtr dari Ringroad, disebelah Rumah No. 72 Hub. 0812.602.4390, TP Nego

Anda Butuh Perabot Jepara Asli?

KUSUK & LULUR TERAPY MBAK ALIN

BERSEDIA DIPANGGIL HUB. 0813.7739.9508 Garansi 10 Hari Sembuh Tanpa Operasi HUBUNGI: SPECIALIST WASIR

BURSA

DIJAMIN 100%

Hanya Tempat Kami Klinik Mak Erot Jl. Laksana No. 55J masuk dari Jl. Amaliun Yuki Simpang Raya Medan (Praktek Tetap) HP .0812.4038.333

BURSA

Jl. SEROJA RAYA

GRATIS KATALOG

KESEHATAN

DIJUAL 1 unit Rumah Permanen, 4 Kamar, Lokasi disudut, Jl. Sawit 6 No. 16 Perumnas Simalingkar Hub. 0812.603.1644

BALAI PENGOBATAN TRADISIONAL

PERABOT

(DEKAT PAJAK MELATI) HUB: D A V I D : 0852.7773.9100 0812.648.7740 AYU : 0813.7682.9240

BURSA

PELUANG BISNIS

KETIK: DAFTARBK kirim SMS ke 0878.8168.2006 Telp. (022) 8780.2073

TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 7653.2188

ROYAL GALAXY RESIDENCE

MEDAN (Waspada): PD Pasar Kota Medan membenahi seluruh arealPasarSimalingkarsepertidrainase,pengaspalansertapengecoran di setiap loods pasar. Baik Ginting, seorang pedagang kedai kopi kemarin mengungkapkan Pasar Simalingkar yang kini dikomandoi Usman Effendi banyak mengalami kemajuan. “Kepala Pasar Simalingkar sekarang banyak mendengar keluhan pedagang, beliau didampingi stafnya Iskandarmuda Tanjung, S.Sos rela begadang selama empat malam pada saat pengecoran demi mengawasi jalannya pekerjaan,” ujar Ginting. Kepala Pasar Simalingkar Usman Effendi menyebutkan, pembenahan pasar tersebut atas perintah Direktur Utama PD Pasar Benny Harianto Sihotang, SE untuk menjadikan pasar tradisional lebih bersih, rapi dan tertata sehingga pengunjung merasa nyaman serta bertambah ramai. “Sekarang tak ada lagi kesan kumuh di pasar tradisonal Simalingkar,” ujar Usman. Para pedagang Pasar Simalingkar mengucapkan terima kasih atas perhatian Walikota Medan melalui Dirut PD Pasar dalam membenahi pasar. “Mudah-mudahan omset bisa naik karena masyarakat tak lagi segan ke pasar tradisional”, ujar mereka. Sedangkan Fatmawati, 49, warga Jl Coklat menyatakan rasa sukacitanya dengan pembenahan Pasar Simalingkar tersebut. “Nyaman rasanya belanja di Pasar Simalingkar sekarang ini karena tak ada lagi becek dan tidak terasa kumuh,” ujarnya. (m05)

SPRING BED DIJUAL MURAH

5 (lima unit) 2 lantai di Jl. Tjut Nyak Dhien No. 125 (dekat Stasiun Kereta Api/ Stasiun (Bus) Binjai, Sumatra Utara, Lokasi strategis, Harga Rp. 450 Jt, Dapat diangsur sampai 15 tahun Yang berminat hubungi : Hj. Ida HP. 081330545797 081937177431 PROPERTY

rendah dibandingkan dengan rata-rata tingkat suku bunga pada kurun waktu dua tahun terakhir yang tercatat sebesar 11,56 persen. Selain itu, tambahnya, fungsi intermediasi perbankan syariah tercatat tumbuh sebesar 10,41 persen (yoy). Kualitas kre-dit perbankan masih terjaga dengan baik yang terlihat dari rasio gross non performing loans (NPLs) pada Maret 2012 tercatat hanya sebesar 2,37 persen. Seiring dengan peningkatan kredit, aktivitas perbankan di Sumut juga menunjukkan peningkatan. Aset perbankan Sumut pada Maret 2012 tercatat sebesar Rp163,67 triliun, meningkat 2,16 persen dibandingkan bulan sebelumnya. (m41)

Dewan juga meminta kepolisian untuk menindak kendaraan ber nomor polisi di luar Provinsi Sumut, karena merugikan daerah ini. Selasa (15/5), Komisi C melakukan rapat dengar pendapat dengan Dispenda Sumut. Rapat dipimpin Ketua Komisi C Marasal Hutasoit. Hadir Kadispenda Sumut Sjafaruddin didampingi sejumlah staf Dispenda. Pada pertemuan itu, umumnya anggota Komisi C, mendorong Dispenda Sumut untuk meningkatkan pajak daerah. Itu dilakukan sejalan dengan proyeksi peningkatan APBD pada tahun 2013. Dari hitungan Komisi C, APBD Sumut tahun 2013 diperkirakan meningkat menjadi Rp7-8 triliun, dari APBD tahun 2012 Rp6,1 triliun. Sejumlah anggota dewan, seperti Muslim Simbolon, Mulkan Ritonga, Pasiruddin Daulay, Hardi Mulyono dan lainnya, menyebutkan peningkatan proyeksi APBD tersebut sangat berkaitan dengan penerimaan pajak daerah. Tahun 2011, Pendapatan Asli Daerah (PAD) Sumut Rp3,5 triliun lebih. Sementaratargetpadatahun2012 Rp4 triliun lebih. Disebutkan anggota dewan MulkanRitonga,sejauhinikinerja Dispenda Sumut dalam memungutpajakmemangsudah baik. Itu terbukti dari pencapaian yang melebihi target.Tahun 2011 capaiantargetPADolehDispenda 103,26 persen. Namun demikian, para anggota DPRD Sumut menilai Dispendasu masih harus meningkatkan perolehan pajaknya lagi. Baik dengan melakukan optimalisasi penarikan pajak, maupun dengan meng-gali potensi pajak baru. ‘’Karena beban Dispenda pada tahun depan akan lebih besar lagi,’’ kata Mulkan Ritonga. Saat ini sumber pemerimaan pajak terbesar Sumut berasal dari kendaraan bermotor. Baik itu merupakan Pajak Kendaraan

Bermotor (PKB), Bea Balik Nama Kendaraan Bermotor (BBNKB), Pajak Bahan Bakar Kendaraan Bermotor (PBBKB). Sementara penerimaan pajak lainnya dari Pajak Air Permu-kaan (APU). Anggota dewan lainnya, Pasiruddin Daulay, mengatakan, ke depan Dispenda Sumut harus melakukan diversifikasi penerimaan pajak. Dispeda tidak bisa hanya mengandalkan dari pejak kendaraan bermotor semata. Dewan melihat Dispenda masih dapat memaksimalkan pendapatan dari pajak APU. Sedangkan potensi pajak lainnya ada di sektor pertambangan. Kendaraan luar Pada rapat dengar pendapat KomisiCdenganDispendaSumut hari itu, anggota dewan juga mempermasalahkanba-nyaknya kendaraan luar pro-vinsi yang beroperasi di Sumut. Terutama mobil dengan plat B (Jakarta). Anggota Komisi C, Muslim Simbolon, menyebut-kan ribuan kendaraan berplat B, beroperasi di Sumut. Mereka merupakan kendaraan dinas berbagai perusahaan. Mulai dari perusahaan perkebunan, perbankan, telefon selular, asuransi, leasing dan lain sebagainya. Kata Muslim Simbolon, keberadaan mobil dinas luar provinsi itu sangat merugikan Sumut. Bukan saja dari ru-saknya jalan, tapi juga kesem-rautan lalulintas, dan kera-wanankerawanan lainnya. ‘’Yang jelas mobil-mobil itu tidak terdata dan tidak mem-bayar pajak. Sumut rugi puluh-an miliar setahun,’’ katanya. Lewat pertemuan hari itu, Muslim Simbolon, meminta

ALAT VITAL

DITANGANI OLEH AHLINYA: M. SUHERDI

DARI PELABUHAN RATU SUKABUMI JABAR

Terapi keperkasaan seksualitas Pria hasil permanen tanpa efek samping, alami, bebas pantangan, untuk semua usia Hasil langsung reaksi ditempat, cukup satu kali berobat

MENANGANI KELUHAN: MENAMBAH UKURAN -

Panjang: 13, 14, 15, 16, 17, 18, 19, 20 cm Besar: 3,5. 4,5. 5. 5,5. 6 diameter Memperkeras, Tahan lama Ejakulasi dini, Mani encer Impotensi, Lemah syahwat Diabetes, kencing manis/ batu

Juga melayani problem asmara, mempercepat jodoh, pengasihan, penglaris, buka aura, pasang susuk, dll ALAMAT KELINIK TETAP: Jl. SM. Raja Masuk ke Jl. Utama No. 18 Medan Dari Toko Roti Majestik ±100meter Izin Kejaksaan: B/DSP.5/12/2008 Izin Dinkes: No. 448/0649/I/2008 HP. 0812.6388.7999 Buka setiap hari

KLINIK TRAPI ALAT VITAL MAK HJ. ICOT Ditangani langsung

H. UST. YUSUF/ H. ABIDIN

Setelah sukses di propinsi di Papua, kini hadir di kota Medan, pengobatan nyata luar biasa, bila anda ingin perkasa, ingat jangan salah informasi disini yang pasi ±30 menit kami akan buktikan alat vital menjadi besar dan perkasa. Dengan metode pengurutan disekitar alat vital melalui totok urat-urat kejantanan. Kami tidak mengumbar janji belaka. Tdk ada efek samping, bebas utk semua agama. Bukan janji tapi bukti ditempat Penanganan khusus pria: - Memperbesar, panjang, keras, kuat dan tahan lama - Kencing manis, diabetes, L. syahwat - Ejakulasi dini/ impotensi Khusus Wanita: - Memperbesar/ kencang payudara - Ingin punya keturunan/ gurah vagina - Ingin kembali perawan/ keputihan Konsultasi umum - Ajian semar mesem/ buka aura - Penglaris/ penghasihan/ cari jodoh - Pasang susuk, karir/ jabatan DIJAMIN 100% Alamat Jl. Halat / Masuk Jl. Senam No. 19C. Belakang Makam Pahlawan HP. 0821.6655.3222

DIREKTUR Utama Sidomuncul Irwan Hidayat saat ikut dalam sarasehan budaya.

Waspada/Ist

Sidomuncul Gelar Sarasehan Budaya JAKARTA (Waspada): Pariwisata dan budaya Indonesia adalah salah satu aset bangsa yang harus dijaga, dipelihara, dan dilestarikan, kata Direktur Utama Sidomuncul Irwan Hidayat. Banyak daerah wisata yang indah di Indonesia, namun belum menjadi tujuan favorit bagi masyarakat kita untuk berlibur. Selain itu hanya sedikit tempat wisata yang dikenal di dunia bahkan masyarakat Indonesia itu sendiri yaitu Pulau Bali, Bunaken, Danau Toba, Yogyakarta dan beberapa tempat lainnya. Padahal Indonesia merupakan negara yang kaya raya akan kekayaan alam dan budaya serta ragam bahasanya. Untuk itu guna mengangkat pariwisata di daerah-daerah yang belum terangkat dan dikenal dunia serta masyarakat Indonesia, Sidomuncul melalui produk unggulan Kuku Bima Energi kembali meluncurkan iklan terbaru dengan tema eksotisme Kalimantan. Tema itu diangkat untuk mengkampanyekan budaya, pariwisata dan kerukunan antar

suku di Kalimantan. Iklan ini mengambil lokasi di Kalimantan Timur, Kalimantan Tengah, dan Kalimantan Selatan dengan menggandeng para bintang seperti Olga Lydia, Denada, Donny Kesuma, Ade Rai, dan Rieke Diah Pitaloka. Bertempat di XXI Club Djakarta Theater, Jumat lalu, peluncuran iklan diawali dengan acara sarasehan budaya yang mengangkat tema “Mari Berwisata di Negeri Sendiri”. Pada sarasehan ini hadir sebagai pembicara adalah Ketua Pusat PPPI Harris Thajeb, Penulis Bloger Nila Riwut (puteri mantan Gubernur Kalimantan Tengah Tjilik Riwut), dan Direktur Utama PT Sidomuncul Irwan Hidayat. Iklan dengan versi ini bermula dari pemikiran Direktur Utama PT SidoMuncul Irwan Hidayat untuk memper-kenalkan daerah wisata di Indonesia yang belum dikenal oleh masyarakat. Dengan adanya iklan seperti ini masyarakat melihat dan tahu bahwa di Indonesia banyak sekali daerah pariwisata yang indah sehingga mereka akan peduli dan bangga dengan

keindahan alam yang dimiliki. “Pariwisata di Indonesia memang harus dipromosikan, karena pariwisata adalah sesuatu yang berkelanjutan yang dapat mempengaruhi semua bidang dan juga tidak akan habis, tetapi dapat menambah Pendapatan Asli Daerah (PAD) serta meningkatkan perekonomian masyarakat sekitar (ekonomi kreatif ). Apalagi Kalimantan ini merupakan daerah yang kaya akan tambangnya, dan wisata alam yang belum terpromosikan,” kata dia. Iklan Kuku Bima Energi dengan tema pariwisata dan budaya, sebelumnya telah diluncurkan dengan berbagai versi yaitu versi Batik, Tari Pendet, Papua (Tari sajojo), Pesona NTT, Ayo ke Labuan Bajo I, Maluku, Sumatera Utara, Labuan Bajo II, Pencak Silat dan Ayo Wisata Ke Semarang. Diharapkan dengan diluncurkannya iklan ini dapat meningkatkan jumlah wisatawan yang berkunjung ke daerah tersebut dan Kuku Bima Energi minuman energi yang memiliki berbagai rasa semakin dicintai para konsumennya.(rel)


Ekonomi & Bisnis

B8

WASPADA Rabu 16 Mei 2012

Kisah Perajin Ulekan Dari Cirebon Di Tanah Jambo Aye PRIA ini sempat dituduh teroris dan mata-mata ketika Aceh masih didera konflik. Namun semangat usahanya tak pernah lentur. Dia tetap setia menapaki hingga pelosok kampung demi nafkah halal. Namanya Hasan Haria. Dia lahir di Cirebon, Jawa Barat 28 tahun lalu. Sejak 2005, Hasan muda merantau dan menetap di Desa Samakurok, Kec. Tanah Jambo Aye, Kabupaten Aceh Utara. Di desa ini pula, Hasan mempersunting, Aida, 23, dan menekuni usaha sebagai perajin ulekan dan lesung batu. Seiring waktu berjalan, usaha Hasan kian berkembang. Omsetnya kini mencapai Rp2 juta per bulan. Namun, sama seperti kebanyakan usaha kecil di daerah lainnya, Hasan mengaku sulit memperluas wilayah pemasaran lantaran kurang modal. “Kalau saja ada tambahan modal sekitar lima juta saja,

PERAJIN ULEKAN DARI CIREBON

Waspada/Musyawir

HASAN memasukkan adonan semen dalam cetak ulekan, di samping rumahnya, Desa Samakurok, Kec. Tanah Jambo Aye, Selasa (15/5). Setelah mengeras, adonan ini dipahat dan dihaluskan dengan sabut kelapa. Proses ini memakan waktu paling cepat dua pekan. Sementara harga jualnya berkisar antara Rp10.000-Rp15.000 per set.

Tata Niaga Karet Miskinkan Petani MEDAN (Waspada): Gabungan Pengusaha Karet Indonesia (Gapkindo) Sumatera Utara meminta pemerintah segera mengintervensi sistem tata niaga perdagangan di industri karet dalam negeri. Selama ini sistem tata niaga yang ada masih memungkinkan munculnya pedagang perantara, dan memperpanjang tata niaga perdagangan karet. Aksi para pedagang perantara dalam menentukan harga jual karet basah petani cenderung telah memiskinkan petani, marjin harga yang dibeli dari petani dan dijual ke pabrik yang

terlalu besar dinikmati pedagang perantara. “Petani kita kan minim sumber daya, sementara pedagang perantara biasanya cukup pengalaman untuk mengetahui kadar air dalam karet basah. Ke petani mereka bilang kadar air karetnya lebih tinggi dari yang seharusnya, jadi harganya lebih murah. Marginnya itu lah yang

dinikmati pedagang perantara. Dan biasanya jumlahnya besar,” kata Sekretaris Gapkindo Sumatera Utara Edy Irwansyah, Selasa (15/5). Edy menambahkan, jika pemerintah memberdayakan secara optimal peraturan menteri pertanian nomor 38 tahun 2008 tentang pedoman pengolahan dan pemasaran bahan olahan karet, tentunya pendapatan petani dapat didorong untuk lebih tinggi. Karena dalam peraturan tersebut, ada kewajiban untuk memproduksi karet basah untuk menjadi bahan olahan karet (bokar) dengan kualitas yang baik. Sehingga harga jual

di tingkat petani semakin baik. “Kalau permentan nomor 38 tahun 2008 itu diberdayakan, idealnya pendapatan petani bisa ditingkatkan. Namun perlu adanya penyuluhan yang berkelanjutan pada petani, agar dapat memproduksi karet basah dengan baik. Pabrik juga tentunya diuntungkan, karena kualitas karet mentahnya, produksi bokarnya juga lebih berkualitas,” jelasnya. Adapun untuk mengeliminasi peran pedagang perantara, dan memperpendek tata niaga perdagangan di industri karet, maka pemerintah juga harus membangun infrastruktur

khususnya jalan. Saat ini, diakui petani kesulitan membawa hasil karetnya ke pabrik, akibat buruknya infrastruktur. Petani pun harus menanggung ongkos transportasi yang dipotong dari harga karet basahnya. “Keberadaan pedagang perantara sulit dihilangkan jika infrastruktur juga tetap buruk. Pedagang perantara kan biasanya memiliki fasilitas dan pengetahuan. Petani tentunya tak mau repot. Selagi masih untung mereka tetap menjual. Padahal banyak biaya yang tidak penting dikeluarkan petani, justru dinikmati pedagang perantara,” ungkapnya. (okz)

mungkin wilayah pemasaran bisa kita perluas hingga ke luar Aceh Utara. Sekarang, ulekan dan lesung kita hanya beredar dalam wilayah Aceh Utara saja,” kata Hasan, saat ditemui Waspada di rumahnya, Selasa (15/ 5). Meski demikian, bukan berarti Hasan tidak mensyukuri kemajuan usaha yang dicapainya saat ini. Lebih-lebih usaha itu sudah dirintis sejak masa konflik. Dan yang membuat hati Hasan kian lega, harga jual ulekan dan lesung produksinya kini mulai membaik dibanding harga jual beberapa tahun lalu. “Dulu, harga paling mahal hanya Rp5000 per set, baik itu ulekan maupun lesung batu. Sekarang, Alhamdulillah, untuk ulekan kecil dan besar laku Rp10.000-Rp15.000 per set. Sedangkan lesung terjual hingga Rp20.000 per set,”rinci Hasan. Hasan juga mengaku tak terlalu ambil pusing soal ulekan dan lesung produksinya yang masih sulit menembus pasar moderen. Bagi Hasan, yang terpenting situasi Aceh aman, sehingga ia leluasa berjualan

hingga ke pelosok kampung, dengan sistem door to door dan berjalan kaki. “Kalau Aceh ribut, itu yang ribet. Kita sulit mencari nafkah kalau Aceh tak aman. Apalagi bagi perantau seperti saya. Salah-salah, pergi sehat wal afiat, pulang tinggal nama,” tutur Hasan. Ketika Aceh masih didera konflik, awal 2005, Hasan punya pengalaman menegangkan. Ketika itu dia berjualan di pedalaman Aceh Utara. Saat melewati sebuah pos keamanan, Hasan distop. Dia diperiksa atas sangkaan separatis dan teroris. Nasib baik, sangkaan itu tak terbukti dan Hasan pun segera diizinkan pulang. “Beberapa pekan kemudian, saya sempat pula diperiksa sejumlah pria sipil bersenjata, juga di pedalaman Aceh Utara. Mereka mengira saya matamata. Mereka menyebutnya cua’k. Namun setelah saya jelaskan saya tinggal dan kawin di Samakurok, perkara selesai. Bahkan, sebelum pulang, saya sempat dijamu makan,” kenangnya. � Musyawir

Pemko Diminta Tertibkan Pedagang Ikan Lampulo Ilegal BANDA ACEH (Waspada): Pedagang Ikan Eceran Makmue Beusare (PIEMB) Peunayong, mendesak Pemerintah Kota (Pemko) Banda Aceh, segera menertibkan para pedagang ikan eceran ilegal, yang berjualan di Tempat Pelelangan Ikan (TPI) Lampulo. “Sejak beroperasinya pasar ikan eceran dadakan dan ilegal di Lampulo, omset para pedagang ikan Pasar Peunayong, turun drastis hingga 70 persen setiap hari, “ kata pedagang ikan eceran Pasar Peunayong, kepada Waspada, Selasa (15/5). Pernyataan itu disampaikan pedagang ikan tergabung dalam organisasi PIEMB, setelah melihat aksi penjualan ikan

secara eceran di tempat pelelangan ikan Lampulo. Padahal, di Lampulo itu hanya dibenarkan menjual (melelang) ikan hasil tangkapan nelayan dalam jumlah banyak kepada para muge atau pedagang ikan eceran lainnya termasuk berjualan di Pasar Ikan Peunayong, kata Muhammad. Keluhan sama sebelumnya juga pernah disampaikan Amiruddin Luthan kepada wartawan, setelah ia terpilih sebagai Ketua PIEMB, digelar di lantai II Pasar Peunayong. Dalam pemilihan itu, ke 215 pedagang ikan eceran mempercayakan Amiruddin memimpin PIEMB. Amiruddin menyebutkan, TPI Lampulo merupakan

tempat pelelangan ikan grosir, bukan lokasi para pedagang eceran seperti dilakukan selama ini. Namun, karena ada kesan pembiaran, TPI telah melenceng dari fungsinya, yang juga menjual ikan secara eceran. Menurut dia, kondisi dan praktek semacam ini yakni menjual ikan secara eceran di TPI Lampulo telah berimbas dan dinilai sangat merugikan 300 lebih pedagang ikan di Pasar Peunayong. Karenanya, Amiruddin berharap persoalan pengalihan fungsi TPI Lampulo, segera ditertibkan, tanpa ada kesan pembiaran lagi terhadap mereka.(b09)

Hotrod 3G Itu Seperti Hotel Bintang Lima TAK bisa dipungkiri, kini operator selular mengubah haluan besar-besaran. Kalau dua tahun lalu mereka masih ‘berperang’ di tarif bicara dan SMS, dan tahun lalu adu murah di internet unlimited sekarang berbeda jauh. Silakan cermati apa yang disajikan operator selular. Mereka tak lagi mengkonsentrasikan diri membenahi jaringan atau memberikan ribuan SMS gratis serta menawarkan tarif telefon malam-malam. Semua berubah. Para pemegang handset kini, terutama di perkotaan tak lagi memanfaatkan ponsel di genggamannya untuk SMS atau bicara. Fungsinya sudah semakin berkembang. Layanan internet. Itulah yang kini dijadikan operator selular lahan ‘pertempuran’ utama. Semua operator selular berlomba memberi layanan internet murah dan berkecepatan tinggi. Bahkan menjalar ke layanan CDMA. Menjamurnya ponsel android, pangsa pasar BlackBerry yang tetap tinggi serta iPhone dengan kemapanannya setidaknya menjadi faktor utama perubahan mindset itu. Layanan android misalnya hanya bisa berlaku maksimal saat jaringan sudah 3G atau masuk ke HSPA. Begitupula dengan iPhone. Memang di EDGE setidaknya ada beberapa layanan yang bisa dibuka, namun baru bisa maksimal saat ponsel mendapatkan jaringan 3G. Atas fenomena yang terjadi maka kini hampir di berbagai tempat terlihat ada tulisan yang diprakarsai XL Axiata yang disebut hotrod 3G. Atau lihat promo yang mendesak pelanggan agar mencoba layanan ini. Misalnya tulisan “yuk

Waspada/Armin Nasution

SWADI Tjia saat menunjukkan kecepatan akses XL hotrod 3G di kantornya kemarin. Akses Youtube yang dibukanya tanpa buffering. Begitupula ketika salah satu kartu XL yang disediakan Swandi dipasang ke iPad-2. Kecepatan akses hanya dalam hitungan kedipan mata bukan menunggu rokok habis sebatang. ngegame di hotrod 3G plus” serta tawaran-tawaran lain. Selasa (15/5) pagi Swandi Tjia, GM Sales Operation Nothern West XL, mengatakan saat ini mereka memang maksimal mensosialisasikan hotrod 3G plus. “Apa artinya ini hotrod 3G plus. Ini sama dengan akses internet kecepatan tinggi. Ketika kita masuk ke hotrod, kecepatan akses bisa mencapai 3.6 Mbps.” Apa alasan XL berani membuat hotrod? Menurut dia, itu karena sekarang jaringan XL sudah cukup kuat di 3G. Sepanjang 2011, BTS yang ada itu hampir one on one antara basis 2G dan 3G. “Dari hal kekuatan jaringan, jumlah 3G kita sudah hampir 500 node B (BTS 3G). Kita ingin mempengaruhi orang. Mari enjoy di network 3G,” kata dia.

Tujuannya adalah memberi kenyamanan kepada pemilik handset untuk menggunakan secara maksimal jaringan 3G. Sebab, kata Swandi, banyak pelanggan memiliki handset yang sudah kapasitasnya 3G tapi masih ‘bergelimang’ dengan service EDGE saja. “Jadi XL menyiapkan l a y a n a n h o t r od i t u a g a r pengguna ponsel 3G maksimal menggunakan handset mereka.” Ibaratnya, kata Swandi, XL ingin mengatakan bahwa saat ini hotrod ibarat hotel bintang lima. “Kita sudah punya hotel bintang lima lho. Jangan lagi tidur di hotel melati. Makanya salah satu program tambahan hotrod 3G itu adalah freedays.” Jadi pelanggan boleh mencobanya secara gratis pada hari

tertentu untuk memakai hotrod gratis selama satu hari dengan menghubungi *123*33#. “Ketika masuk ke situ pelanggan akan mendapatkan layanan gratis dan langsung menentukan hari apa yang mau gratis.” Tapi kalau kemudian mau ganti hari baru dikenakan bayaran, jelasnya. “Misal setelah masuk di layanan pelanggan pilih hari Sabtu. Maka dia akan gratis hotrod di hari tersebut. Kalau kemudian meminta pindah ke hari Senin baru dikenakan bayaran,” tuturnya. Swandi mengatakan sekarang XL menyesuaikan produk dengan kebutuhan masyarakat. “Mana ada lagi internet unlimited yang kita jual. Kalau pun ada di pasar ditemukan yang unlimited itu sisa bundling,” jelasnya.

Dia mengatakan XL sudah mengubah barang dagangannya dari paket unlimited ke volume base. “Dulu kalau paket unlimited misalnya dengan Rp49 ribu pelanggan bisa mengakses hingga 500 megabyte. Saat batas terlampaui tidak dikenakan charge tapi kecepatan melambat,” tuturnya. Sekarang berbeda, kata Swandi. XL akan memberikan akses internet cepat dengan pembelian Rp49 ribu itu. Tapi kecepatan tidak akan pernah turun. Begitupula ketika kuota terlampaui kecepatan tetap stabil tapi bedanya sekarang dikenakan charge kalau melebihi batas, tuturnya. “Dengan volume base kita garansi kecepatan,” tuturnya. Ketika terlampaui itu sama artinya kena biaya tambahan, jelas Swandi. Saat ini paket hotrod 3G dimulai dengan harga Rp2 ribu per hari dengan kapasitas 5 mb, Rp49 ribu per bulan, Rp99 ribu per bulan, Rp199 ribu per bulan. Kapasitas masing-masing pasti berbeda. Bagaimana antisipasi ketika nanti pelanggan semakin banyak bermain internet? Dia menjawab sampai semester I 2012, mereka menargetkan antara BTS 2G dan 3G akan dibuat one on one. Apalagi Medan itu salah satu kota hotrod area selain Jakarta dan Denpasar. Buktinya, kata dia, sekarang warga Medan sudah lebih banyak menikmati layanan hotrod seharga Rp99 ribu daripada yang Rp49 ribu. Dalam survei yang dilakukan sebenarnya pengguna ideal itu menghabiskan 1 gb (gigabyte) hingga 1,5 gb per bulan, tuturnya. Jadi apa yang ditawarkan XL dengan paket hotrod ditambah jaringan yang terus meningkat membuat konsumen sudah bisa menentukan pilihan, tutur Swandi. Dalam persepsinya untuk apa hotel bintang melati kalau ada bintang lima. Apalagi harga nya tidak beda-beda jauh.(m06)

Waspada/Abdul Mukthi Hasan

Seorang ibu berbaju medis melihat cabai di karung yang dijual dipinggir jalan memasuki pasar Bireuen, Selasa (15/5) yang sekarang harganya mulai naik.

Harga Cabai Merah Merangkak Naik BIREUEN (Waspada): Harga cabai merah di pasar Bireuen dalam dua hari belakangan ini mulai merangkak naik dari harga beberapa pekan lalu. Sedangkan barang kebutuhan lainnya masih normal. “Ya harga cabai merah mulai naik sekarang ini, kalau sebelumnya kita beli sekilo Rp10 ribu-Rp15 ribu hari ini (kemarin-red) harganya sudah Rp25

ribu-Rp27 ribu per kg,” kata Jamilah, seorang ibu rumah tangga kepada Waspada Selasa (15/5) di sela-sela belanja di pasar Bireuen. Mulai naiknya harga cabai sekarang ini, sambung Jamilah, karena pasokannya sudah berkurang dari sebelumnya. Sedangkan permintaan masih tetap stabil. “Barangnya yang agak ber-

kurang sehingga harganyapun berangsur-angsur naik,” tambahnya. Ilyas seorang pedagang membenarkan, harga cabai merah berangsur-angsur naik semenjak sepekan lalu. Namun, naiknya harganya itu masih dalam kategori wajar dan belum sampai pada terlalu tinggi. “Permintaannya masih stabil sekarang ini,” katanya. (cb02)

Ayam Potong Masih Tinggi BIREUEN (Waspada): Harga ayam potong di pasar Bireuen masih tinggi bila dibandingkan beberapa waktu sebelumnya. Sedangkan harga ayam ras agak menurun harganya dari sebelumnya. “Setelah naik beberapa waktu lalu ayam potong jenis broiler ini belum turun-turun, yaitu Rp33 ribu-Rp35 ribu per ekor yang beratnya sekitar satu kg lebih,” kata Sulaiman seorang

pedagang. Wati seorang ibu rumah tangga mengiyakan harga ayam potong setelah dinaikkan beberapa bulan lalu tidak turun, sehingga harga itu dianggap masih tinggi. “Memang benar harga ayam potong jenis broiler ini sering terkesan sengaja dipermainkan, kalau ayamnya banyak di Aceh dipasok dari luar dengan harga murah, kalau lagi tidak ada di Aceh harganyapun

mahal, makanya kasihan juga pengusaha ayam dan masyarakat Aceh kalau permainan harganya masih terjadi,” katanya. Sementara itu, harga ayam kampung menurut pengakuan para pedagang masih normal. “Harga ayam kampung ini tergantung besar dan kecilnya, kalau agak besar di atas Rp30 ribu per ekor,” kata seorang pedagang diiyakan sejumlah rekannya. (cb02)


Agenda

WASPADA Rabu 16 Mei 2012

07:00 Kartun 09.00 Dahsyat 11:00 Intens 12:00 Seputar Indonesia Siang 12:30 Sinema Siang 14:30 Cek & Ricek 15:15 Silet 16.45 Tom & Jerry 17:00 Seputar Indonesia 17:30 Target Operasi 18:00 Sinetron : Yusra Dan Yumna 19:00 Sinetron : Asmara 21:00 Sinetron : Karunia 22:30 Mega Sinema

CATATAN

07.00 Inbox 09:00 Halo Selebriti 10:00 SCTV FTV Pagi 11:00 SL Liputan 6 Terkini 12:00 SL Liputan 6 Siang 12:30 SCTV FTV 14.30 Status Selebriti 15.00 Uya Emang Kuya 16.00 Liputan 6 Terkini 16.03 Cookies 17.00 Liputan 6 Petang 17.30 FTV Istimewa 19.30 SCTV Sinetron Putih Abu Abu 20.00 Liputan 6 Terkini 20.30 Cinta Salsabilla 22.30 Liputan 6 Terkini 22.33 SCTV FTV Utama

07:00 Disney Club : Handy Manny 08:00 Kisah Unggulan 10:30 Diantara Kita 11:00 Sidik 11:30 Lintas Siang 12:00 Layar Speesial Bollywood 15:00 Starlite 15:30 Lintas Petang 16:00 Animasi Spesial 17:30 Animasi Spesial : Shaun The Sheep 18:30 Dewi Bintari 19:30 Aladdin 20:30 Tendangan Si Madun 21:30 Putri Nabila 23:00 Dewi Dewi Show 00:00 Sport Mania 00:30 Lintas Malam

07:30 Fresh & Fun 08:00 Friends 09:00 Fenomania 09:30 Seleb @ Seleb 10:00 Bread Love & Dreams 11:30 Topik Siang 12:00 Klik ! 13:00 Tom & Jerry 14:00 Woody Wood Pecker 17:30 Topik Petang 18:00 Pesbukers 19:00 Chibi Chibi Burger 20:00 Glory Jane 21:00 Pilih-Pilih Mantu 22:00 Triangels 23:00 Jakarta Belum Tidur 24:00 Sunting

07:00 KISS Pagi 08:00 Sinema Pagi 09:30 Hitzteria 11:30 Patroli 12:00 DRama Asia: Naughty Kiss 13:30 Drama Asia: The Princess Man 15:00 KISS Sore 16:00 Fokus 16:30 Drama Asia (Korea): Skip Beat 18:00 Drama Asia (Mandarin): To Liong To (Golok Pembunuh Naga) 19:00 Sinetron Unggulan 20:00 Tutur Tinular 22:00 Buaya Show 23:30 Mega Sinema:

07.05 Editorial Media Indonesia 08.05 Eleven Show 09.05 8 Eleven Show 10.05 8 Eleven Show 11.05 8 Eleven Show 12.00 Metro Siang 13.00 Headline News 13.30JWideshot 14.04 Headline News 14.30 Wideshot 15.30 Wideshot 16.05 Wideshot 16.30 Wideshot 17.05 Metro Hari Ini 18.05 Metro Hari Ini 19.05 Suara Anda 20.05 Suara Anda 20.30 Otoblitz 21.05 Top Nine News 21.30 Mata Najwa 22.30 Stand Up Comedy 23.00 Metro Sports

B9

07:30 Ranking 1 08:30 Semangat Pagi 09:30 Fun Cooking 10:00 Sepenggal Sejarah 10:30 Insert 11:30 Jelang Siang 12:00 Reportase Siang 12:30 Jika Aku Menjadi 13:15 Jail 14:00 Magic Comedy 14:30 Digital Clip 15:00 Sketsa 16:00 Show Imah 17:00 Reportase Sore 17:30 Inside 18:15 Comedy Project 19:15 Tahan Tawa 20:15 Bioskop TRANSTV Spesial 22:15 Bioskop TransTV : 00:15 Kakek-Kakek Narsis 01:15 Reportase Malam

06:30 Apa Kabar Indonesia Pagi 09:30 Kabar Pasar 10:00 Coffee Break 11:30 Kabar Siang 13:30 Apa Kabar Indonesia Siang 15:30 Kabar Pasar 16:00 Kabar Petang 19:00 Kabar Utama 20:00 Apa Kabar Indonesia Malam 21:00 Kabar Malam 22:00 Kabar Arena 22:30 Radio Show

08:00 Naruto Shippuden III 09:00 Doo Bee Doo 10:00 Obsesi 11:00 Dapoer Cobek 11:30 Hot Spot 12:00 Global Siang 12:30 Awas Ada Sule 13:30 Masih... Main Kata 14:30 Petualangan Panji 15:00 100% Ampuh 16:30 Fokus Selebriti 17:30 Spongebob Squarepants 18:30 Odong Odong 19:00 Untung Ada Sule 20:00 Sketsa Tawa 21:00 Siege 2: Dark Territory 23:00 Game Of Death

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

07:30 Selebrita Pagi 08:00 Ups Salah 08:30 Karaoke Keliling 09:00 Pelangi 09:30 Spotlite 10:30 Warna 11:30 Redaksi Siang 12:00 Selebrita Siang 12:30 Si Bolang 13:00 Laptop Si Unyil 13:30 Cita-Citaku 14:00 Dunia Binatang 14:30 Koki Cilik 15:00 Brownies 15:30 Tau Gak Sih 16:00 Jejak Petualang 16:30 Redaksi Sore 17:00 Indonesiaku 17:30 Orang Pinggiran 18:00 Hitam Putih 19:00 On The Spot 20:00 Opera Van Java 22:00 Bukan Empat Mata **m31/G

Polda Metro Jaya Larang Konser Lady Gaga Kepolisian Daerah Metropolitan Jakarta Raya (Polda Metro Jaya) tidak merekomendasikan perizinan konser penyanyi asal Amerika Serikat (AS), Lady Gaga, karena mempertimbangkan soal dampak sosial dan budaya di Indonesia. “Yang pertama adanya masukan dari berbagai pihak bahwa atraksi Lady Gaga tidak pantas ditonton orang banyak,” kata Kepala Bidang Hubungan Masyarakat Polda Metro Jaya, Komisaris Besar Polisi Rikwanto, di Jakarta, Selasa. Ia mengatakan, Majelis Ulama Indonesia (MUI) mengharamkan pertunjukan Lady Gaga, karena mengumbar sensualitas, sehingga berdampak terhadap moral bangsa. “Busana dikenakan terlalu seksi mengumbar aurat dan gerakan erotis,” ujar Rikwanto. Beberapa fraksi partai politik

di DPR juga menyarankan pihak polisi tidak menerbitkan izin konser Lady Gaga, karena tidak sesuai norma agama dan budaya di tanah air, serta bertentangan dengan undang-undang antipornografi. Rikwanto menyebutkan, Polda Metro Jaya telah mengirimkan surat ke Mabes Polri berisi tidak merekomendasikan izin konser Lady Gaga. Ia mengemukakan, kepolisian telah menjelaskan alasan tidak merekomendasikan izin konser Lady Gaga kepada panitia penyelenggara. Pihak kepolisian menjelaskan kepada panitia penyelenggara bahwa penampilan Lady Gaga menunjukkan hal tidak sesuai dengan budaya ketimuran. “Kita sudah sampaikan kepada pihak penyelenggara, dan bisa memakluminya,” ujar Rikwanto. Gaga, pelantun lagu Poker Face, awalnya dijadwalkan manggung di Stadion Utama Gelora Bung Karno, Senayan, Jakarta Pusat, pada 3 Juni 2012. Ini merupakan rangkaian tur dunianya. (ant)

Lady Gaga

MNCTV Gelar Festival Medan Dian Sastro/blogspot.com

Dian Sastro Wakil Asia Tenggara di Cannes 2012 Dian Sastrowardoyo sebagai Brand Ambassador L’Oreal Paris akan mewakili Indonesia sekaligus sebagai Brand Ambassador pertama berangkat dari wilayah Asia Tenggara di Festival Film Cannes 2012 di Cannes, Prancis,25-27 Mei. Kehadiran Dian pada salah satu festival film paling prestisius di dunia itu juga menandai pengakuan kecantikan Indonesia di mata dunia untuk berkiprah di ajang bergengsi bersama International Brand Ambassador L’Oreal Paris serta insan film internasional lainnya, seperti Gwen Stefani, Freida Pinto, Gong Li, Eva Longoria, Jane Fonda, Aishwarya Rai, dan lainnya. “Dian diajukan untuk mewakili Indonesia setelah proses pemilihan dilakukan sebelumnya. Akhirnya Dian dipilih selain dilihat dari profilnya juga karena negara Indonesia penting bagi dunia. Dan kita punya Dian untuk memperlihatkan Indonesia ke dunia,” kata Manajer Marketing L’Oreal Paris, Monika Sugiharso, saat jumpa pers di Jakarta, Senin. Menurut Monika, Dian tidak hanya cantik namun memiliki prestasi dan pribadi yang terus bersinar. Selain mengembangkan talentanya sebagai seorang pekerja seni di layar lebar, layar kaca serta panggung teater, Dian juga menunjukkan kepeduliannya terhadap dunia pendidikan dengan mendirikan Yayasan Dian Sastrowradoyo yang bergerak pada bidang pemberdayaan perempuan, pendidikan dasar, dan kebudayaan. “Karenanya, keberangkatan Dian ke Cannes mewakili kecantikan luar dalam L’Oreal Paris dan Indonesia. Dian bisa membawa slogan “Karena Wanita Begitu Berharga” untuk Indonesia,” tambahnya.

Pada kesempatan yang sama, Dian hadir dengan gaun putih dan rambut digerai itu mengaku bangga mendapat kesempatan menghadiri festival film yang digelar sejak 1946. “Saya senang sekali, bersyukur dan merasa beruntung.Yang pasti saya tidak mau malumaluin dan akan tampil bagus karena membawa nama Indonesia,” kata Dian. “Saya takut agak-agak norak sih nanti minta foto bareng artis-artis,” canda dian seraya tertawa. Dian akan berada di Festival Film Cannes mulai 25 Mei 2012 dan akan berpartisipasi di “red carpet” pada 27 Mei 2012, bersanding dengan bintang-bintang dunia. Ia akan mengikuti serangkaian kegiatan lain seperti wawancara dengan wartawan, pemotretan, dan pesta cocktail bersama para selebritis dunia. Sejak Diberitahu akan dikirim ke Festival Flm Cannes,

Dian mengaku terus mempersiapkan dirinya baik dari segi fisik, mental, maupun wawasan. Selain itu, Dian bersama tim juga mencoba memprediksi hal-hal apa saja yang akan ditanya oleh wartawan. “Kaya mau cerdas cermat gitu karena saya harus siap kalau mereka tanya-tanya soal Indonesia,” katanya. Selama di Cannes nanti, Dian akan dibalut dengan gaun rancangan tiga desainer ternama Indonesia, yaitu Sebastian Gunawan, Eddy Betty, dan Didit Hediprasetyo. Untuk menyempurnakannya, Dian akan dipercantik dengan riasan khusus MakeUp Artist kelas dunia, Billy B, sering mendandani banyak artis papan atas seperti Lady Gaga, Mariah Carey, Beyonce, dan lainnya. Begitu pula rambut Dian akan ditata hairdresser ternama, John Nollet.(ant)

John Travolta/blogspot.com

John Travolta Dituduh Lakukan Tindakan Cabul Aktor John Travolta dituduh melakukan perbuatan tidak senonoh. Michael Caputo bekerja di Peninsula Hotel di NewYork mengklaim bahwa bintang film ‘Pulp Fiction’ itu dilarang mengunjungi hotel karena pegawai melaporkan mendapat tindakan tidak senonoh dari Travolta. Menurut laporan dari The Mirror, keempat pegawai hotel mengklaim Travolta melakukan perbuatan cabul dan para pegawai tidak bisa berbuat banyak, kecuali melarang Travolta mengunjungi tempat itu lagi. Namun Marty Singer, pengacara Travolta menolak tuduhan dan mengatakan bahwa berita itu fitnah belaka dan Caputo memiliki masalah pribadi dengan kliennya. Pegawai hotel juga merasa tidak puas dengan pihak hotel. Sementara, John sendiri membuat statemen untuk menanggapi tuduhan dan aktor kini berusia 58 tahun menolak tuduhan Caputo. Nur/contactmusic.com

MNCTV menggelar Festival Medan selama tiga hari mulai Rabu (16/5) menampilkan Campust Fest di Auditorium Unimed menghadirkan news presenter Dinna Sabrina dan Ratu Nabila. Kemudian Sabtu (19/5) acara berlanjut ke Grebek Nusantara di Lapangan sepakbola Pasar V Marelan mulai pukul 09.00 diisi artisartis seperti Saipul Jamil, Super Emak, Palu Butung, Adinda Band, Ricky Likoer, Elvy Z, Ghivri Mozanie, Monica KDI, Band Repuvlik, Dody, Ernie AB, Rere Reina, Yoga Pluto dan Shamila. Saat berbincang dengan wartawan Selasa (15/5) di Garuda Plaza Hotel, Wijaya

Kusuma-Secretary Coorporate didampingi Ray Wijaya-Pemred MNCNews serta Rames KDI, dan lainnya disebutkan, Roadshow “MNCTV Festival” ke berbagai daerah salah satu wujud komitmen MNCTV mendekatkan diri kepada pemirsa selama ini senantiasa menyaksikan program-program MNCTV. Selain di Marelan, Grebek Nusantara juga diadakan di lapangan sepakbola Tembung Minggu (20/5) menampilkan artis Kristina, Nelly Agustine, 3 Macan, Agung Hercules, Rames KDI, Max 5, Ine Chintya, Benigno, Jagad Aryani, Seruni Bahar dan Wulan KDI serta Saipul

Jamil, Super Emak bersama Palu Butung. Sebelum acara Grebek Nusantara di Tembung, Minggu (20/5) pagi juga diadakan acara Jago Sehat di Lapangan Merdeka Medan diharapkan dihadiri Walikota Medan Rahudman Harahap serta artis dangdut lainnya. Keunikan dan antusiasme masyarakat Medan juga menjadi alasan khusus MNCTV Festival Medan kembali digelar. Medan terkenal dengan kue bika Ambon menjadi kota kelima setelah di tahun 2012 MNCTV Festival diselenggarakan di Surabaya, Palembang, Bandung dan Semarang.(m19)

Kevin Costner Tertolong Pengadilan PENGADILAN Tinggi South Dakota menetapkan bahwa aktor Kevin Costner tidak melanggar kontrak dengan seorang seniman ditunjuknya menghasilkan patung perunggu bison dan sekelompok Indian Amerika. Costner membayar Peggy Detmers AS$300.000 untuk membuat patung tersebut pada tahun 1990an untuk satu kawasan wisata direncanakannya di Black Hills, South Dakota. Daerah wisata itu sampai kini tak pernah terwujud dan dia sebaliknya patung tersebut ditempatkannya untuk menjadi daya tarik di Tatanka dekat Deadwood. Pengadilan Kamis (10/5) memperkuat keputusan pengadilan rendah yang menetapkan bahwa penempatan alternatif tidak melanggar kontrak. Costner membuat filmnya yang memenangkan Oscar, Dances with Wolves kebanyakan di South Dakota. (ap/m10)

Wijaya Kusuma-Secretary Coorporate didampingi Ray Wijaya-Pemred MNCNews, Rames KDI, news presenter Dinna Sabrina dan Ratu Nabila saat memberikan penjelasannya seputar penyelenggaraan MNCTV Festival Medan di Garuda Plaza Hotel Selasa (15/5)


Aceh

B10 LHOKSEUMAWE (Waspada): TKPRT dan FOR-Trust Aceh mendesak Menteri Kehutanan Zulkifli Hasan segera menuntaskan persoalan Rawa Tripa yang berada di ambang kehancuran. Tim Koalisi Penyelamatan Rawa Tripa (TKPRT) dan Forum Tata Ruang Sumatera (FOR-Trust) memandang, pemerintah perlu segera mengambil tindak lanjut penyelamatan hutan dan ekosistem yang ada di wilayah itu. “Menteri telah melihat sendiri bagaimana kehancuran ekosistem Rawa Tripa akibat pembukaan perkebunan sawit oleh perusahaan-perusahaan di Nagan Raya dan Aceh Barat Daya, kata Juru Bicara TKPRT, Irsadi Aristora melalui realisenya, Selasa (15/5). Ditegaskan Menteri Kehutanan tidak dapat lepas tanggungjawab begitu saja terhadap persoalan yang terjadi di Tripa, meskipun perizinan perkebunan sawit diberikan pemerintah provinsi dan kabupaten di Aceh. Menteri Kehutanan juga harus bertanggungjawab atas persoalan habitat orangutan yang hilang, dan juga pelanggaran instruksi Presiden Nomor 10 Tahun 2011 tentang Penundaan Pemberian Izin Baru dan Penyempurnaan Tata Kelola Hutan Alam Primer dan Hutan Gambut, lanjut Irsadi. (b14)

Waspada/Zainal Abidin

TPS Sebarkan Bau Menyengat BIREUEN (Waspada): Tempat Pembuangan Sampah (TPS) di ujung Jalan Mayjend T Hamzah Bendahara yang berdekatan dengan RSUD Fauziah, Bireuen semakin hari kian menebar bau menyengat. Yani, warga Bireuen, Selasa (15/5) mengatakan, keberadaan tempat penampungan sampah sementara itu sudah sangat menganggu. Pasalnya, tumpukan sampah di sana mulai menebarkan bau tak sedap. Dia mengaku, tiap hari melintasi jalan tersebut untuk mengantar dan menjemput anaknya sekolah. Kepala Kantor Lingkungan Hidup, Kebersihan dan Pertamanan Kabupaten Bireuen, Edwar Djufri baru-baru ini mengatakan, jumlah bahan bakar yang disediakan untuk truk pengangkut sampah lebih kecil dari tahun sebelumnya. Karenanya, truk hanya dapat mengangkut sampah satu kali sehari, sedangkan tahun sebelumnya sampah diangkut dua kali sehari. (b17)

Jalan Nasional Di Sejumlah Kawasan Depan Sekolah Rawan Lakalantas BIREUEN (Waspada): Sejumlah tempat ruas jalan nnasioanl di kawasan Bireuen dinilai rawan terjadinya kecelakaan lalulintas. Pasalnya, pada waktu-waktu tertentu kondisinya pada kendaraan dan banyak siswa yang menyeberang jalan terutama pagi dan siang hari. Selain itu lokasi sekolahnya juga dekat atau berada di pinggir jalan negara. Jalan lintas nasional yang sering rawan tersebut di antaranya, di kawasan MAN Peudada, depan SMA N 1 Peulimbang dan SMPN 1 Peulimbang, depan SMPN 1 Peudada, depan SMPN 1 Jeunieb. Keenam sekolah Selain itu di kawasan depan SMAN I, MTsN Model Gandapura, depan lapangan Raja Taloe Kutablang, karena di kawasan tersebut ada beberapa sekolah. “Kawasan-kawasan itu sering kali terjadinya lalulintas terutama pagi dan saat siswa pulang sekolah,” kata Muhammad, warga Gandapura, kepada Waspada, Selasa (15/5). Kadis Perhubungan Parawisata Komunikasi dan Informatika (Dishubparkominfo) Bireuen, MuhammadYusuf yang dikonfirmasi mengatakan, pihaknya akan segera mengupayakan membangun zebra cross atau pita kejut di jalan nasional yang dekat sekolah-sekolah sesuai dengan tingkat kerawananannya. (cb02)

Polisi Ciduk Bandar Ganja LHOKSUKON (Waspada): Satuan Reserse Narkoba Polres Aceh Utara, Senin (14/5) sekitar pukul 22:30, menangkap seorang tersangka bandar ganja di Desa Matang Baloy, Kec. Tanah Luas, Aceh Utara. M alias Apa Bin, 45, petani warga Matang Baloy, kini mendekam di bui Mapolres Aceh Utara, di Lhoksukon. Bersamanya turut disita barang bukti 3 kilogram daun ganja kering siap edar. Kapolres Aceh Utara, AKBP Farid BE melalui Kasat Narkoba, AKP Syafran, Selasa (15/5) menjelaskan, Apa Bin ditangkap atas dasar informasi warga yang menyebut tersangka kerap mengedar ganja, terutama di wilayah Matang Baloy dan sekitarnya. “Kasusnya masih kita kembangkan. Bisa jadi tersangka terkait dengan jaringan narkoba antar kabupaten, atau bahkan antar provinsi. Sebab, barang bukti yang kita amankan lumayan banyak,”duga AKP Syafran. (b19)

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu) Garuda Indonesia

Berangkat (flight, tujuan, waktu)

GA 142 Jakarta/Medan GA 146 Jakarta/Medan

10:40 15:50

GA 143 Medan/Jakarta GA 147 Medan/Jakarta

11:25 16:45

Y6 555 Jakarta * Y6 537 Jakarta/Medan

19:05 12:30

Y6 556 Jakarta** Y6 538 Medan/Jakarta

07:05 12:30

JT 304 Jakarta JT 396 Jakarta/Medan

11:35 20:00

JT 397 Medan/Jakarta JT 307 Jakarta

06:40 12:15

SJ 010 Jakarta/Medan

12:55

SJ 011 Medan/Jakarta

13:25

Batavia Air Lion Air

Sriwijaya Air Air Asia

AK 305 Kuala Lumpur *** 12:20

AK 306 Kuala Lumpur*** 12:45

FY 3401 Penang ****

FY3400 Penang ****

Fire Fly

14:10

* Setiap Selasa, Kamis, Minggu. ** Setiap Senin, Rabu, Jumat. *** Setiap Senin, Rabu , Jumat dan Minggu. **** Setiap Selasa, Kamis dan Minggu.

LHOKSEUMAWE (Waspada): Temuan bom dan pelemparan granat yang kerap terjadi di Aceh, telah meningkatkan kewaspadaan petugas keamanan terhadap barang-barang mencurigakan di lokasi tertentu. Salah satunya, tas kulit dan bungkusan milik seorang kakek misterius yang diletakkan di gerbang pendopo Bupati Aceh Utara telah merepotkan petugas Kepolisian dan Satuan Polisi Pamong Praja (Satpol PP) setempat. Gerbang pendopo Bupati Aceh Utara yang berdampingan dengan pintu gerbang Bank Rakyat Indonesia (BRI) menjadi perhatian petugas keamanan dan warga yang melintasi Jalan Merdeka, Selasa (15/5). Pasalnya, bungkusan mencurigakan milik kakek misterius ditinggalkan di lokasi itu selama dua jam. “Tadi pukul 08:30 dia meletakkan tas di depan gerbang,” jelas M Isa, anggota Satpol PP Aceh Utara yang bertugas di pendopo. Karena lama ditinggalkan, sehingga menimbulkan kecurigaan petugas keamanan pendopo KAKEK misterius sedang menuju ke lokasi tasnya yang ditinggalkan selama dua jam di depan pendopo Bupati Aceh Utara, Selasa (15/5). Sementara mobil patroli Shabara Polres Lhokseumawe juga tiba di tempat itu dalam waktu bersamaan.

LHOKSEUMAWE (Waspada): Balai Bahasa Banda Aceh memberikan penyuluhan bahasa Indonesia bagi guru tingkatan SD, SMP, dan SMA di Lhokseumawe. Kegiatan penyuluhan itu berlangsung selama tiga hari penuh, bertempat di wisma Kuta Karang Baru Lhokseumawe sejak 14-16 Mei. “Adapun pesertanya 25 guru dari 25 sekolah yang terpilih,” ungkap DR Rajab Bahry, Kepala Balai Bahasa Banda Aceh di Lhokseumawe, Selasa (15/5). Lebih lanjut dikatakan, sejumlah guru yang mengikuti kegiatan ini adalah mereka yang punya kepentingan untuk membuat karya tulis dan tulisan ilmiah. Kepada mereka perlu diberikan bimbingan menulis untuk menunjang profesi dan peningkatan kemampuan menulis yang baik. Rajab yang juga salah seorang dari tiga pemateri mengatakan, seorang guru yang baik haruslah dapat menguasai cara menulis, terlebih guru bahasa Indonesia yang diwajibkan mampu memberikan pelajaran mengarang sastra bagi para murid dan siswanya. Adapun materi yang akan disampaikan Rajab adalah keterampilan berbahasa, menyangkut pengertian kalimat, unsur-unsur kalimat, pola kalimat dasar, kalimat tunggal dan majemuk, kalimat efektif, dan analisis kesalahan kalimat. (b14)

14:30

Rabu 16 Mei 2012

Tas Kakek Misterius Di Gerbang Pendopo Bupati Aceh Utara Hebohkan Warga

LSM Desak Menhut Tuntaskan Persoalan Rawa Tripa

Balai Bahasa Berikan Penyuluhan Kepada Guru

WASPADA

Tim Pansus DPRK Aceh Utara Temukan Rp223 M Dana APBK Bermasalah LHOKSEUMAWE (Waspada): Pansus DPRK Aceh Utara menemukan dana APBK Aceh Utara bermasalah senilai Rp223 Miliar. Anggaran selama periode 2007-2012 yang juga menjadi temuan BPK belum ditindak lanjuti SKPK terkait. Anggota Pansus DPRK Aceh Utara, Azhari kepada Waspada, Selasa (15/5) menjelaskan, di

antara dana APBK yang menjadi temua Badan Pemeriksa Keuangan (BPK), penyertaan modal untuk Bank Perkreditan Rakyat (BPR) Sabe Meusampe. Bank milik Pemkab Aceh Utara tersebut mendapat dana penyertaan modal puluhan miliar rupia. “Jumlah danannya sekitar Rp25 miliar, tetapi nilai pasti bisa kita lihat kembali,” jelas Azhari yang juga politisi Partai Aceh (PA). Sebelumnya, Tgk Junaidi yang juga anggota Pansus dalam rapat paripurna beberapa wak-

tu lalu mengatakan, kemauan kepala daerah dan Satuan Kerja Perangkat Kabupaten (SKPK) dalam menindaklanjuti temua audit inspektorat masih rendah. “Komitmen terhadap kepemerintahan yang baik dan pemerintahan yang bersih, masih sebatas wacana,” tegasnya. Junaidi juga menjelaskan, nilai dana APBK yang menjadi temua BPK mencapai Rp223.847.040.369,50. Temuan secara umum belum ditindak lanjuti pihak SKPK.(b15)

Masih Gratis, Warga Diimbau Urus e-KTP LHOKSEUMAWE (Waspada): Mumpung masih gratis, masyarakat Kabupaten Aceh Utara dan Kota Lhokseumawe yang belum membuat e-KTP diminta untuk segera mengurus ke Dinas Kependudukan dan Pencatatan Sipil. Jika kuota gratis telah penuh, masyarakat dibebankan untuk membayar. Dari 110 ribu orang warga wajib KTP di Kota Lhokseumawe, sebanyak 12 ribu warga belum melakukan perekaman eKTP ke kantor kecamatan atau ke Dinas Kependudukan dan Pencatatan Sipil. Jumlah kuota e-KTP gratis yang diberikan pemerintah sebanyak 76 juta lembar. “Kuota KTP gratis 76 juta lembar, hingga kini belum penuh. Kesempatan ini harus dimanfaatkan oleh warga, karena jika kuotanya telah penuh, war-

ga diwajibkan untuk membayar,” kata Kepala Dinas Kependudukan dan Pencatatan Sipil Lhokseumawe, T. Adnan kepadaWaspada, Selasa (15/5). Adnan mengatakan, ke 12 ribu jiwa warga yang belum membuat e-KTP diperkirakan telah meninggal dunia, merantau, anak sekolah, kuliah di luar kota, pindahan atau pendatang yang menetap di perkotaan. Kondisi itu membuat mereka enggan mengurus e-KTP. Untuk mempercepat proses perekaman, semua geusyik di 68 gampong diminta untuk mendata ulang, agar semua warganya memiliki e-KTP. Pendataan ulang perlu dilakukan untuk mencocokkan data yang ada di dinas dengan yang ada di gampong masing-masing. “Data yang ada di kita sudah kita serahkan ke geusyik ma-

sing-masing. Data tersebut telah kita masukkan dalam CD. Ini cara terakhir. Mudah-mudahan dengan cara seperti ini, tidak ada lagi yang tercecer,” katanya. Hal itu juga disampaikan, Nurhayati, AY, Kepala Dinas Kependudukan dan Pencatatan Sipil Kabupaten Aceh Utara. Kata dia, hingga kini jumlah warga yang belum melaksanakan perekaman e-KTP tersisa sebanyak 7 persen dari jumlah warga yang wajib KTP. Karena itu, kepada warga yang belum mengurus indentitas diri itu diminta untuk segera mengurus ke dinas bersangkutan. “Mumpung masih gratis. Nanti kalau sudah diperintahkan untuk bayar, maka warga wajib membayar. Berapa biayanya belum kita ketahui, karena belum ada instruksi,” kata Nurhayati. (b18)

Kasdam-IM

Anggota TNI Terlibat Narkoba Dan Illegal Logging Akan Dipecat BIREUEN (Waspada) : Segenap anggota TNI harus mampu mmberikan kenyamanan kepada rakyat secara hakiki. Jika ada anggota TNI yang melibatkan diri dalam pengedaran narkoba, membaking illegal logging laporkan kepada saya, Kodim atau Korem akan ditindak tegas selain akan dihukum sesuai hukum militer juga diberikan hukuman tambahan dipecat dari dinas kemiliteran. Kasdam-IM Brigjen TNI Iskandar M Shalil menegaskan hal itu dalam kunjungan kerjanya pada acara temu ramah dengan Bupati Bireuen, Nurdin Abdul Rahman, Ketua DPRK Rifwan Muhammad,SE, unsur Muspida, sejumlah perwira Kodim0111/Bireuen,Yonif-113/JS para pejabat di, lingkungan Pemkab Bireuen di pendopo Bupati setempat Senin (14/5) malam. Dikatakan, kedatangan ke Bireuen untuk memberi kenyamanan kepada rakyat Bireuen. Kehidupan masyarakat Bireuen sangat baik dan maju. Kendati dihuni oleh berbagai etnis dan berbeda agama kerukunan masyarakat tidak ada masalah. Kasdam-IM Brigjen TNI Iskandar M Shahil mantan Dan Yonif-113/JS Juli tahun 1996 stok lama di Bireuen dan wajah baru di Kodam-IM, mengatakan, sangat bangga setelah mendapat laporam yang disampaikan dalam sambutan Bupati Nurdin Abdul Rahman atas kebersamaan Pemkab, Kodim-0111, Polres Bireuen, beserta jajarannya, tokoh Agama, tokoh adat dan segenap elemen masyarakat dalam menjaga kedamaian dan keamanan di Kabupaten Bireuen masih sangat kondusif.

dan pihak bank. Apalagi sebelumnya kakek pemilik tas itu tidak mau menyebutkan identitasnya kepada petugas Satpol PP yang memintai keterangan. “Dia memang masuk ke pos, tetapi tidak mau menyebutkan nama dan identitasnya,” tambah M.Isa. Pria tua itu hanya mengaku, dulu sering menginap di pendopo ketika masa bupati sebelumnya. Sekitar dua jam kemudian, tim Shabara Polres Lhokseumawe tiba di lokasi. Namun pihak kepolisian tidak sempat mengamankan barang, karena dalam waktu hampir bersamaan pemiliknya juga tiba di depan gerbang. “Saya mau ke Darussalam,” ungkap kakek itu singkat. Dia juga tidak mau menyebutkan identitasnya, namun mengaku punya hubungan dengan Gubernur Aceh. Selain tim Shabara, petugas Reskrin Polres juga turun ke lokasi. Namun setelah mengetahui barang tersebut sudah diambil pemiliknya, mereka meninggalkan pendopo Bupati Aceh Utara. (b15)

Pertanian Unimal Terima 510 Mahaiswa Baru LHOKSEUMAWE (Waspada): Fakultas Pertanian Universitas Malikussaleh (Unimal) Aceh Utara menerima 510 mahasiswa baru di tahun 2012. Penambahan kuota itu, karena komposisi mahasiswa di fakultas itu semakin heterogen (tidak dari Aceh saja-red). Ketua posko Setia Budi kepada Waspada, Selasa (15/ 5) menuturkan, semakin tahun jumlah mahasiswa mengambil ke Fakultas Pertanian Unimal semakin meningkat, beberapa tahun ini sudah ada mahasiswa dari Sumatera Utara, Sumatera Waspada/Mustafa Kamal Barat, Riau dan Jambi. “Un- BEBERAPA mahasiswa memandu calon mahasiswa saat mengisi tuk level provinsi, Aceh ba- formulir SNMPTN online di Posko Fakultas Pertanian, tepatnya gian tengah banyak memilih pekarangan Bank Mandiri Lhokseumawe. Foto direkam, Selasa ke sini,” ucapnya. (15/5). Disebutkan, tahun ini Fakultas Petanian akan menerima 510 maha- mahasiswa tidak lengkap data, makanya kami siswa baru. Rinciannya, Program Studi Agri- mencoba membantu,” ucapnya. bisnis akan menerima 150 mahasiswa, Budidaya Selain tak lengkap data, masih ada calon Perairan 150 mahasiswa dan Agroekoteknologi mahasiswa yang belum bisa mengakses internet 210 mahaiswa. aktif. “Mungkin keberadaan posko ini sangat Dari itu, ujian melalui jalur Seleksi Nasional membantu siswa-siswa itu, dan kami pun tidak Masuk Perguruan Tinggi Negeri (SNMPTN) memungkut biaya bagi mereka yang mendaftar akan meluluskan 70 persen. Sisa itu akan dite- itu,” tandas Pembantu Dekan II Fakultas Pertarima melaui jalur Ujian Masuk Bersama (UMB) nian itu. dan jalur SBMB lokal. “Khusus Pertanian, SPMB Tambahnya, pendaftaran SNMPTN secara lokal belum tentu dibuka,” ujarnya di Posko nasional dibuka mulai 10-31 Mei, begitu juga SNMPTN Fakultas Pertanian di Bank Mandiri Unimal. Syaratnya, calon mahasiswa cukup Lhokseumawe. membawa ijazah bagi lulusan tahun 2010-2011, Lanjutnya, pembukaan posko ini inisiatif dan surat tanda kelulusan bagi bagi tamatan dari pimpinan fakultas untuk membantu calon 2012. Selanjutya file pas foto warna ukuran 4x6 mahasiswa yang mendaftar SNMPTN online. dalam bentuk CD dan bukti pembayaran dari “Dari dua hari yang kami buka, rata-rata calon Bank Mandiri. (cmk)

Cabup/Cawabup Bireuen Asal PA Dapat No.Urut 5 BIREUEN (Waspada) : Suasana riuh dari ratusan simpatisan Partai Aceh (PA) membahana di ruang sidang DPRK Bireuen, saat kandidat Bupati/Wakil Bupati Bireuen H Ruslan M Daud-Mukhtar yang mendapat kesempatan pertama mencabut nomor urut calon mendapat nomor urut 5. Suasana riuh diiringi tepukan tangan dari ratusan sumpatisan Partai Aceh memadati ruang sidang pleno KIP Bireuen, Rabu (9/5) baru lalu. Beberapa kalangan PA yang hadir menyaksikan penarikan nomor urut mengatakan, keributan sejenak tak terbendung sebagai meluapkan rasa kegembiraan dan kebahagiaan Partai PA yang mengusung pasangan Ruslan M DaudMuchtar sebagai calon Bupati/Wakil Bupati periode 2012-2017 kebetulan mendapat nomor urut yang didambakan. Dikatakan, nomor urut 5 sudah teruji keberkahannya dalam pemilihan Gubernur/Wakil Gubernur Aceh telah mengantarkan pasangan Zaini Abdullah–Muzakkir Manaf ke tampuk kekuasaan tertinggi sebagai Gubernur/Wakil Gubernur Aceh pilihan rakyat Aceh periode 2012-2017 mendatang. Para simpatisan Partai AcehWilayah Bireuen

optimis Calon Bupati/Wakil Bupati Bireuen Ruslan M Daud-Mukhtar akan kembali meraih kemenangan dalam Pilkada Bireuen. Mukhtar, Calon Wakil Bupati Bireuen yang mantan Kabid Dinas Pertanian ketika ditanyakan wartawan usai penarikan dan penetapan nomor urut 5 sama dengan nomor urut Cagub/Cawagub terpilih mengatakan suatu rahmat dari Allah dan mudah-mudahan membawa berkah kemenangan. Kalangan masyarakat yang hadir menyaksikan penarikan nomor urut delapan pasangan Cabup/Cawabup Biruen mengatakan, soal nomor urut jangan sampai ada anggapan nomor keramat atau tidak, yang penting para kandidat dalam pilkada berlangsung damai dan bertarung secara demokratis, tanpa ada teror dan intimdasi. Para kandidat yang mendapat nomor urut calon, Azhari, nomor urut 1, Saifuddin MH – Dra Hj Rosnany Bahruny A Pt nomor urut 2, Hamdani Raden-Murdanu Yusuf, nomor urut 3, Husaini Ilyas– Razuardi MT nomor urut 4, Nurdin Abdul Tahman–Zakwan Usman nomor urut 6, Munawar Yusuf-Hasan Basri A Djalil nomor urut 7 dan Amiruddin Idris, nomor urut penutup 8. (b12)

Mantan Bupati Bireuen Gugat KIP Ke MK

Waspada/H.AR Djuli

KASDAM IM Brigjen Iskandar M Shahil bersama istri didampingi Bupati Bireuen Nurdin Abdul Rahman, Ketua DPRK Ridwan Muhammad,SE dan rombongan setiba di Pendopo disambut dengan tarian Aceh, Tari Ranub Lampuan dibawakan pelajar SDN-18 Bireuen Senin (14/5) petang. Kasdam-IM didampingi sejumlah Perwira Kodam-IM antara lain Dan Pomdam-IM Kolonel CPM Bambang Sucoko, Asren Kolonel ARH Migroho Djati Waluyo, Danrem-011/LW Kolonel Inf A Ramchim Siregar disambut Bupati Bireuen Nurdin Abdul Rahman bersama unsur Muspida dan sejumlah pejabat dil ingkungan Pemkab Bireuen. Kunjungan kerja Kasdam diawali ke Kodim-0111/Bireuen disambut secara militer Dandim-0111/Bireuen Letkol Inf Muhammad Arfah, Danrem011/LW Kolonel Ind A Rachim Siregar dan Dan Yonif-113/JS Mayof Inf Ariful Mutaqin sedangkan penyambutan di Pendopo, Kasdam bersama istri dan rombongan disambut unsur Muspida dengan tari Ranub Lampuan dibawakan murid

SDN-18 Bireuen. Usai acara tatap muka Bupati Bireuen Nurdin Abdul Rahman menyerahkan Bungung Jartoe” plakat Pemkab Bireuen kepada Kasdam kemudian dilanutkan dengan acara hiburan, Bupati Nurdin Abdul Rahman meyampaikan sebuah lagu Aceh Cheng-Cheng, U siblah jikap le tupe, jiba uncong rambot jipeugrob ucong bak mane. Sementara Kasdam membawakan sebuah daerah Palembang yang tak kalah menarik dari Lagi yang dbawakan Bupati Nurdin Abdul Rahman. Selasa pagi Kasdam dan rombongan melanjutkan kunker ke Takengen, Aceh Tengah dan Bener Meriah dan Selasa petang menurut rencana akan berkunjung keYonif-113/JS Juli. (b12)

BANDAACEH (Waspada) : Calon Bupati dan Wakil Bupati Bireuen Mustafa A Glanggang dan Anwar menggugat KIP Bireuen ke Mahkamah Konstitusi (MK) Jakarta. Pasalnya, pasangan yang maju dari jalur independen itu dinilai KIP Bireuen tidak memenuhi persyaratan untuk maju sebagai Calon Bupati dan Wakil Bupati Bireuen tahun 2012. “Kita telah mendaftarkan gugatan permohonan itu ke MK, Senin (14/5) dan MK telah menerbitkan tanda terima berkas No.538/ PAN.MK/2012,” ungkap kuasa hukum Pemohon Ansharullah Ida dalam siaran pers diterima Waspada dari Jakarta, Senin (14/5). Kata dia, saat melakukan pendaftaran ke MK, pihaknya turut menyerahkan 28 bukti surat mendukung dalil-dalil hukum. Dikatakan, Pemohon telah mendaftar/ mencalonkan diri sebagai calon Bupati/Wakil Bupati Bireuen untuk tahun 2012 melalui jalur independen (perseorangan) serta telah memenuhi semua persyaratan yang ditentukan KIP Bireuen (Termohon). Hal ini, kata Ansharullah, sesuai Berita Acara Verifikasi dan Rekapitulasi terhadap jumlah Dukungan Bakal Pasangan Calon. Kemudian pada 11 dan 14 April 2012, Pemohon telah mengikuti tes kemampuan baca Alquran dan menyetor biaya mengikuti pemeriksaan kesehatan. Selanjutnya, Termohon menerbitkan surat keterangan hasil Uji Mampu Membaca Alquran dan surat keterangan Hasil Pemeriksaan Kemampuan Rohani dan Jasmani, pada 23 April 2012 yang menyatakan mampu secara rohani dan jasmani melaksanakan tugas dan kewajiban sebagai Bupati/Wakil Bupati Bireuen. Setelah Termohon melaksanakan tahapan demi tahapan yang harus dilaksanakan dan dinyatakan lulus dan atau mampu, tapi anehnya pada 4 Mei 2012 Termohon (KIP Bireuen) menerbitkan Berita Acara Rapat Pleno Nomor: 351/

BA/KIP/V/2012 tentang Penetapan Hasil Penelitian (Verifikasi) Ulang Kelengkapan Persyaratan Pasangan Bakal Calon Bupati/Wakil Bupati Bireuen tahun 2012 Jo Surat No.355/ 2012 tanggal 5 Mei 2012 yang dikirimkan kepada Pemohon, perihal Hasil Penelitian Ulang Kelengkapan/Syarat-syarat Pasangan Bakal Calon Bupati/Wakil Bupati Bireuen yang menyatakan Pemohon “tidak memenuhi persyaratan”. (b02)

Sejumlah Baliho Dan Atribut Pasangan PA Dilaporkan Dirusak OTK BIREUEN (Waspada): Sejumlah baliho dan atribut pasangan calon Bupati/wakil bupati Bireuen dari Partai Aceh (PA) H Ruslan DaudIr H Muktar Abda, MSi yang dipasang di beberpa lokasi dilaporkan di rusak Orang Tak Dikenal (OTK). Aksi itu sangat disesalkan pengurus PA maupun para simpatisannya, karena merusak baliho atau atribut pasangan calon maupun partai merupakan satu hal yang dapat merusak demokrasi yang sedang dibangun di Aceh. “Kami sudah mendapat laporan telah banyak baliho pasangan PA yang dirusak OTK, namun bagi kami masalah ini kita serahkan kepada pihak terkait dan kami akan melaporkan kepada pihak panwascam, mudah-mudahan tidak lagi terjadi nanti,” kata Sekretaris PA, Muzakkir kepada Waspada, Selasa (15/5). Muzakkir menyebutkan, beradasarkan laporan yang diterima pihaknya, baliho yang dipasang dibeberapa lokasi telah dirusak OTK, diantaranya, di kawasan Desa Tanjong Siron, tiga lembar, di kawasan Desa Buket Dalam 1 lembar, Paya Rangkuleuh satu lembar, Balng Me 2 lembar, spanduk dan baliho posko masing-masing dua. (cb02)


Aceh

WASPADA Rabu 16 Mei 2012

Di Nagan, Baru Diparkir Sepedamotor PNS Hilang NAGAN RAYA (Waspada) : Hati-hati parkir sepedamotor sembarangan bisa- bisa anda rugi. Seperti yang dialami PNS Dinas PK Rohana warga Desa Paya Undan, Kecamatan Seunagan, Kabupaten Nagan Raya. Sepedamotornya BL 6456 JI hilang sekira pukul 11:00 saat itu dia hendak ke luar. Rohana kepada Waspada Senin (14/5) mengatakan hilangnya sepedamotor matik di kantor membuatnya resah. ‘’Saya sudah lama parkir di tempat biasa bahkan kadang- kadang selalu saya pantau namun tidak terjadi yang saya alami sekarang ini,’’katanya. Sementara Kabag Umum Dinas PK Banta Lidan saat dikonfirmasi belum bisa memberi keterangan terkait hilangnya motor matik mio milik Rohana. (cb07)

Kepala Dusun Ikut Pelatihan Dasar Data Keluarga PENANGGALAN (Waspada): Jajaran Kepala Dusun (Kadus) dalam Kec. Penanggalan dan Simpang Kiri, Subulussalam mengikuti sosialisasi Pedoman Penyusunan dan Pendayagunaan Data Profil Desa dan Pendataan Dasar Keluarga, Senin (14/5) di Gedung Pertemuan Lae Kombih, Penanggalan. Seperti surat Kepala Badan Pemberdayan Masyarakat (BPM) Kota Subulussalam, Bicar Sinaga per 7 Mei 2012, pelatihan serupa juga digelar di Gedung Pertemuan Kec. Sultan Daulat pada waktu yang sama. Sementara untuk para Kadus di Kec. Rundeng dan Kec. Longkib digelar, Rabu (16/5) hari ini dan, Senin (21/5) lusa. Pada pelatihan di aula Gedung Pertemuan Lae Kombih Penanggalan, tampil Rano Sartono Saraan, unsur BPM Subulussalam sebagai narasumber. (b28)

Puluhan Besi Penutup Drainase Di Banda Dicuri BANDA ACEH (Waspada) : Kasus pencurian besi penutup drainase di Kota Banda Aceh, akhir-akhir ini semakin meningkat. Banyak besi penutup itu yang raib dan hilang dibawa tangan jahil yang selama ini terpasang di atas got (drainase) supatran Kota Banda Aceh. Hal itu seperti terjadi di sepanjang Jalan Teuku Nyak Rief hingga Jalan Teuku HM.Daud Beureueh, tidak kurang dari 18 besi penutup drainase yang selama ini terpasang sebagai pengaman bagi pejalan kaki, hilang tanpa bekas diduga akibat dicuri OTK. Hal sama juga terjadi di sepanjang Jalan Nyak Adam Kamil, kawasan Simpang Taman Putroe Phang menuju Pendopo Gubernur Aceh, belasan besi penutup draise hilang dicuri tangantangan jahil. Kini sebagai penutup lubang yang menganga petugas menggantikan besi itu dengan kayu (papan) untuk menghindari kecelakaan para pejalan kaki. Berbagai sumber yang diperoleh Waspada, Selasa (15/5) menyebutkan kasus kehilangan besi penutup drainase tidak hanya terjadi di sepanjang Jalan Teuku HM.Daud Beureueh hingga Jalan Teuku Nyak Arief. Teuku HM.Daud Beureueh hingga Jalan Teuku Nyak Arief dan Jalan Nyak Adam Kamil. Tapi juga terjadi di hampir semua drainase dalam Kota Banda Aceh lainnya. (b09)

Pj Bupati Simeulue Bawa Tim Pusat Ke Alafan SIMEULUE (Waspada): Pejabat Bupati Simeulue Ir H Nurman DS, MM Selasa (15/5) membawa turun ke lapangan staf ahli pembangunan Kementerian PU, Ismanto dan sejumlah petinggi dari BNPB. Nurman selain membawa tim kementerian ke Sibigo, juga mengunjungi Desa Mitem dengan menaiki rakit. Pada pertemuan di pendopo Nurman meminta Kementerian PU dan BNPB agar membantu proses pembangunan infrastruktur di pulau itu yang belum sempat terbangun sebelumnya karena keterbatasan anggaran. Paling urgen, menurut Nurman, yakni penerobosan 14 KM lagi jalan lingkar Simeulue yang belum tembus. Juga pengerasan dan pengaspalan jalan lingkar Simeulue yang sebagian memperihatinkan. “Karena jalan adalah urat nadi,” jelasnya. Di sisi lain kementerian PU dan juga BNPB agar membantu penyegeraan pembangunan perkantoran di Simeulue yang masih terbuat dari dinding triplek. Tak kalah penting dia juga meminta prioritas perhatian saranah ibadah dan pendidikan. Pada kesempatan itu mantan Bupati Simeulue Drs. Darmili yang pada kesempatan temu ramah dipendopo selain meminta bantuan kepada Kementerian PU dan BNPB untuk menuntaskan sejumlah programnya yang telah diusul ke Pemerintah pusat selama ini dia juga meminta untuk membantu membangun tugu NKRI. Menyahuti penyampaian Pj Bupati Nurman dan mantan nupati Darmili, Staf Ahli Kementerian PU, Ismanto dan Direktur BNPBYolak Dalimunthe menyatakan mereka turun ke Simeulue bersama tim terkait perintah kementerian PU.(cb04)

B11

Keluarga Korban Konflik Berharap KKR Terbentuk SIGLI (Waspada) : Keluarga korban konflik Pidie yang tergabung dalam Solidaritas Persaudaraan Korban Pelanggaran (SPKP) HAM berharap, Komisi Kebenaran dan Rekonsiliasi (KKR) dapat terbentuk di Aceh, di bawah kepemimpinan ZainiMuzakir. “Harapan kami sangat besar kepada pemimpin Aceh yang baru ini, apalagi mereka bagian dari konflik itu sendiri,”kata Zulkifli, salah seorang anggota SPKP HAM Pidie kepada Waspada, Selasa (15/5). Hal ini disampaikan Zulkifli seusai diskusi publik bertajuk “Kampanye Melawan Lupa” yang diprakarsai PB Ham Aceh dan Pidie. Diskusi bertempat di Aula Kantor Badan Keluarga Sejahtera dan Pemberdayaan Perempuan Pidie menghadirkan pemateri dari PB Ham Aceh, Akademis Unigha, Mahdi, Ketua

SPKP Ham Pidie, Hajjah Nurma. Zulkifli mengatakan, meski telah berjuang puluhan tahun untuk terbentuknya KKR di Aceh keluarga korban tidak akan pernah berhenti mencari keadilan bagi keluarga mereka yang telah menjadi korban. Saat ini kata Zulkifli, keluarga tidak berharap ganti rugi materi dari pembentukan KKR. “KKR bukan dalam artian kami diberi uang, tanpa mengetahui siapa pelaku. Tapi prosesnya. Jika sudah ada korban, ada pelaku ini yang perlu diajukan ke pengadilan,” kata Zulkifli yang telah berjuang untuk pembentukan KKR selama 12 tahun. Menurut warga Desa Blang Dot, Kec. Tangse itu, memberi rasa keadilan bagi keluarga korban adalah tanggung jawab negara. “Mungkin secara pribadi, saya telah memaafkan perlakuan yang saya terima saat konflik. Tapi bagaimana dengan anak yang bapaknya dibunuh,” tanya Zulkifli. Lambatnya pembentukan KKR dinilai karena rasa takut pe-

merintah karena berbagai pelanggaran HAM semasa konflik itu dilakukan secara sistematis.”Kalau bersabar rasanya keluarga korban sudah cukup untuk itu. Semasa pemerintahan Irwandi dan Nazar kami juga diminta untuk bersabar. Memang untuk lima tahun pertama kita masih pesimis terbentuk tapi kali ini harus,”kata kakak Muhammad Nasir, korban hilang saat konflik itu. Kordinator PB HAM Pidie, Heri Syahputra mengatakan acara dimaksud merupakan upaya advokasi yang dilakukan pihaknya untuk keluarga korban. Dikatakan, acara yang dihadiri sejumlah mahasiswa di Pidie itu bertujuan mengingatkan kembali mahasiswa tentang peristiwa masa lalu. Menurut Heri, saat ini rancangan qanun pembentukan KKR telah masuk dalam program legislasi (prolega) 2012. ”Kita berharap ini segera diba-has dan disahkan jangan hanya masuk skala prioritas tapi bisa di implementasikan,”pungkasnya. (cb06)

Polres Pidie Akan Mediasi 13 Pengikut Ustadz T Iriawan Dengan MPU SIGLI (Waspada): Sebanyak 13 pengikut Ustadz T Iriawan akan depertemukan dengan sejumlah pimpinan pesantren yang tergabung dalam Majelis Permusyawaratan Ulama (MPU) Pidie untuk menyelesaikan beda pendapat dalam ajaran Islam. Kegiatan itu dimediasi Satuan Intelkam Polres Pidie, Rabu ( 16/5). Kapolres Pidie AKBP Duma-

di, SStmk melalui Kapolsek Peukan Baro Ipda Samsul Bahri, kepada Waspada, Selasa (15/5) mengatakan semua pengikut Ustadz T Iriawan yang melakukan pengajian di Desa Cot Mulu, Kecamatan Peukan Baro, Pidie diundang ke Mapolres Pidie bersama sejumlah pemimpin pesantren dan MPU untuk membahas tentang ajaran Islam yang selama ini diduga sesat dan

telah menimbulkan keresahan di tengah-tengah masyarakat setempat. “ Kami hanya melakukan mediasi antara pengikut Ustadz T Iriawan dengan beberapa tokoh agama, pimpinan pesantren dan MPU setempat. Hal ini kita lakukan supaya tidak menimbulkan keresahan di tengah-tengah masyarakat kita” ujar Samsul Bahri. (b10)

Proyek Tanggul Masjid Dialihkan BLANGPIDIE (Waspada) : Warga Desa Alue Jeurjak, Kecamatan Babahrot kepada wartawan di Balai PWI Abdya, Selasa (15/5), mengeluhkan pengalihan pembangunan tanggul yang semula dijanjikan dibangun tanggul bronjong di kawasan komplek masjid dialihkan. “Kini kenyataannya pembangunan tanggul itu malah mereka alihkan di lokasi lain diluar permintaan dan permohonan yang telah kita ajukan. Padahal komplek masjid yang juga ada TPA di lokasi sudah sangat rawan dan telah berada di pinggiran tebing sungai. Kami meminta agar persoalan ini segera ditindak lanjuti dan pembangunan tanggul tersebut dikembalikan ke posisi yang telah ditentukan semula,”

ungkap Rusli yang juga Kepala Dusun Alue Jeurjak yang ikut didampingi sejumlah aparatur desa lainnya seperti anggota Tuha Peut, Imam Masjid dan pengurus organisasi wanita desa setempat. Pihak desa menuding pengalihan lokasi pembangunan tanggul lebih karena faktor pribadi dan berbau politis. “Dulu proyek itu memang permintaan kami masyarakat secara langsung ke Bapak Akmal yang saat itu turun ke desa. Tapi setelah beliau kalah ternyata proyek itu malah dialihkan oleh anggota timnya yang ada di lapangan,” sebut Zainal Abidin yang ikut mendampingi Kepala Dusun Rusli bersama aparatur desa lainnya seperti Hamzah, Zainun, Imam Chik Tgk.Hasan

Abbas, Jawahir dan Cut Megawati. Kepala Dinas PU Abdya Ir Much Tavip,MM yang dihubungi Waspada mengaku proyek tersebut di luar dinas yang dipegangnya. Dia menyarankan agar Waspada menghubungi Kepala Badan Penanggulangan Bencana Daerah (BPBD) selaku pengelola proyek. Sedangkan Kepala BPBD Abdya Rahwadi,ST yang dikonfirmasi mengakui sudah mengetahui dan mendapatkan laporan tersebut, pihaknya akan segera turun ke lapangan dan melakukan penghentian pembangunan tanggul sepanjang 60 meter tersebut yang sekarang sedang dibangun di lokasi yang tidak sesuai dengan perencanaan awal. (cb05)

Terlanjur Intervensi Yayasan Sukma Bangsa, Surya Paloh Mohon Maaf SIGLI (Waspada): Pembina Yayasan Sukma Bangsa H Surya Paloh meminta maaf kepada direktur dan dewan guru SMA Sukma Bangsa, Caleu, Kecamatan Indrajaya, Pidie karena terlanjur melakukan intervensi atas keputusan sekolah itu yang menskorsing 10 siswanya karena ketahuan mencotek saat Ujian Nasional (UN) berlangsung beberapa waktu lalu. “ Atas kebijakan yg telah menskorsing anak-anak, saya

memohon maaf kepada direktur dan dewan sekolah ini. Apabila ada perasaan sedih karena interpensi saya. Tapi itu sematamata karena saya kurang paham. Dan saya ingin sekolah ini menjadi hebat atas dasar kejujuran dan keiklasan” kata H Surya Paloh di hadapan dewan guru dan tokoh masyarakat Pidie saat menghadiri acara Graduation Day siswa SMA Sukma Bangsa Caleu, Kecamatan Indrajaya, Pidie 2011/2012. Selasa

(15/5). Menurut dia, terkait dengan persoalan itu ia mengaku mengikutinya. Dan apa yang telah dilakukan oleh pihak sekolah semestinya itu benar, namun menimbulkan masalah. Jujur saja katanya misi yang diembankan sekolahYayasan Sukma Bangsa sangat suci, karena mendidik anak bermoral dan jujur. Sebab dengan modal kejujuran anak-anak akan menjadi penerus bangsa yang hebat. (b10)

Waspada/Zafrullah

DUA utusan Aceh ke Paskibraka Nasional 2012, Senin (14/5) berfoto bersama dengan ketua dewan pelatih dan Sekretaris Dispora Aceh. Kiri ke kanan: Asta Zaini, Fajrika, Ria Agustina dan Bustamam.

Pemko Banda Aceh Sudah Empat Kali Peroleh Predikat WTP Dari BPK-RI

BANDAACEH (Waspada): Badan Pemeriksa Keuangan (BPK) RI Perwakilan Aceh kembali memberikan opini Wajar Tanpa Pengecualian (WTP) terhadap laporan keuangan tahun 2011 Pemerintah Kota (Pemko) Banda Aceh sesuai hasil audit yang dilakukan BPKRI selama kurang lebih Dua bulan.Dengan demikian, Pemko Banda Aceh telah berturut-turut empat kali memperoleh opiniWTP dari BPK-RI. Predikat WTP diserahWaspada/T Mansursyah kan oleh Pelaksana Harian PLH KEPALA BKP RI Perwakilan Aceh, Nurmiftahul menyerahkan (Plh) Kepala Badan Penga- opiniWajar Tanpa Pengecualian (WTP) kepada PjWali Kota Banda was Keuangan Republik In- Aceh, T Saifuddin TA, disaksikan Ketua DPRK Banda Aceh,Yudi donesia (BPK-RI) Perwaki- Kurnia, di Aula BPK RI Aceh, Selasa (15/5). lan Aceh Nurmiftahul Lahil kepada Penjabat (Pj) Walikota Banda Aceh Drs yang ke empat kalinya. T Saifuddin TA MSi, di Gedung BPK-RI PerwaTerkait dengan temuan pengelolaan Pasar kilan Banda Aceh, Selasa (15/3). Aceh, Wali Kota menjelaskan masalah ini akan Hadir juga dalam penyerahan opini WTP, segera diatasi dengan terbentuknya Pasar Aceh Ketua DPRK Banda AcehYudi Kurnia,SE, Kasub sebagai BLUD, namun persoalan ini butuh wakAuditorat I Samsuddin, kasub Auditorat II Joni tu karena pasar Aceh masih berada pada masa Indra Kencana, Kadis DPKAD Kota Banda Aceh transisi pengelolaan dari Satker ke BLUD. Mairul Hazami, SE, M.Si, Sekwan Kota Banda “Kita akan segera mempercepat lahirnya Aceh Drs. Ansharullah serta puluhan staf Pem- regulasi yang akan mengatur operasional Pasar ko Banda Aceh. Aceh serta penetapan gaji para pekerja” ujar Miftahul Lahil, pada kesempatan itu me- Saifuddin. ngatakan, predikat WTP yang diberikan BPKKetua DPRKYudi Kurnia SE mengaku bangRI kepada Pemko Banda Aceh merupakan se- ga atas prestasi Pemko Banda Aceh tersebut. buah penilaian yang sesuai dengan peraturan Menurutnya, hal ini menunjukkan penyelengperundang-undangan yang berlaku. garaan pemerintahan terutama terkait pengeSementara itu, Pj Wali Kota Drs T Saifuddin lolaan keuangan negara yang dilakukan Pemko TA, MSi mengatakan, rasa terimakasih dan Banda Aceh telah sesuai dengan aturan perunapresiasi tinggi kepada segenap jajaran eksekutif dang-undangan yang berlaku. dalam hal ini PNS Pemko dan pihak Legistatif “Sesuai dengan tugas legislasi, saya berjanji Kota Banda Aceh yang selama ini telah beker- akan melakukan tugas pengawasan yang lebih jasama dengan memainkan peran mereka baik lagi kedepan dalam meningkatkan kerjamasing-masing sehingga Pemerintah Kota Ban- sama dengan eksekutif agar mampu memperda Aceh kembali mampu meraih opini WTP tahankan prestasi ini ke depan,” ujar Yudi. (b02)

Warga Ie Meudama Minta Pemilihan Geucik Definitif TAPAKTUAN(Wapada):Karena telah dua tahun lowong, warga Ie Meudama, Kecamatan Trumon, meminta Bupati Aceh Selatan, segera merealisir pemilihan geucik (Kades) definitif secara demokratis. Dengan lowongnya jabatan geucik, telah menyebabkan laju pembangunan di desa mereka berjalan lamban. Karena jabatannya diPj-kan kepada seorang pegawai kantor camat Said Saleh, dinilai kurang fokus terhadap pembangunan gampong serta tidak sesuai dengan Pasal 16 PP 72.2006. Sejumlah tokoh masyarakat Ie Meudama kepada Waspada di Tapaktuan, Selasa (15/5) kemarin menyebutkan, permintaan pemilihan geucik definitif ini, telah disampaikan kepada bupati melalui Bagian Pemerintahan Setdakab Aceh Selatan dan mendapat respon positif dari pejabat Pemkab di sana. “Karenanya kami meminta pemilihan geu-

cik definitif ini, hendaknya segera direalisasikan”,sebut Muhammad Ruf,72, Tuha Peut Ie Meudama seraya memperlihatkan suratnya kepada bupati bernomor 01/MIM/IV/2012, tertangggal 17 April 2012, dengan tembusan, Ketua DPRK, Kepala BPM dan Camat Trumon. Didampingi tokoh masyarakat lainnya Muzakir AT, Mukhtar Aziz, Ibrahim dan Sayuti, Muhammad Ruf mengatakan usulan dan permintaan pemilihan geucik tersebut, berdasarkan hasil musyawarah masyarakat setempat. “Desa kami terus tertinggal jika tidak memiliki aparatnya yang definitif,”tambahnya. Camat Trumon, Isa Ansari yang dihubungi Waspada mengaku telah menerima tembusan surat permintaan masyarakat menyangkut pemilihan geucik definitif dan pihaknya sama sekali tidak keberatan demi kemajuan pembangunan Desa Ie Meudama. (b30)

Taji Parnas Tumpul Di Aceh Waspada/Muhammad Rapyan

DUA dari kiri Pj Bupati Simeulue Nurman didampingi Kadis PU Simeulue memberikan penjelasan kepada staf Ahli PU, Ismanto paling kiri di atas rakit saat menuju Desa Amabaan Simeulue Barat, Selasa (15/5).

Cut Is, Ketua KPA Sabang SABANG (Waspada): Ketua Komite Peralihan Aceh (KPA) Pusat, Muzakir Manaf atau Mualem beberapa waktu lalu mengangkat Iswardi Lemsyeh (Cut IS) sebagai Ketua KPA Wilayah Pulo Aceh-Sabang menggantikan Abdurrahman Husen. Pengangkatan Iswardi Lemsyeh sebagai Ketua KPA Wilayah Pulo Aceh-Sabang tertuang dalam surat Keputusan KPA Pusat Nomor 096/KPA/IV/2012 tanggal 7 April 2012, dalam lampiran surat itu Mualem juga mengucapkan terima kasih yang tak terhing-ga kepada Abdurrahman Husaen sesuai surat KPA Pusat Nomor 095/KPA/IV/2012 yang telah memimpin organisasi KPA dan menjalankan tugas dengan baik sekaligus surat pemberhentian Abdurrahman Husain Nomor 092/KPA/IV/2012. Menurut Iswardi, pengangkatanya sebagai Ketua KPAWilayah Pulo Aceh-Sabang yang baru merupakan amanah yang harus dijalankan dengan sebaik- baiknya demi memajukan organisasi mantan kombatan itu dan memperbaiki seluruh komponen yang terlibat didalamnya. “Ini bukanlah hal yang harus dibanggakan, tapi ini merupakan amanah yang harus kami jalankan dengan baik,” tukas Iswardi dalam komperensi Pers yang digelar Sabtu (12/5) siang. Secara khusus sebagai Ketua KPA yang baru Iswardi menyebutkan bahwa pihaknya secara penuh akan mendukung dan mengawal proses pemilukada Kota Sabang yang damai,aman dan demokrasi pada putaran kedua yang akan berlangsung pada 14 Juni 2012 mendatang. “Kita bersama-sama masyarakat Sabang akan menjaga proses Pemilukada Putaran kedua di Kota Sabang dapat berjalan dengan sukses,aman dan damai,” tambahnya. (b31)

HIRUK pikuk Pilkada Aceh telah reda. Partai Aceh yang hampir batal sebagai kontestan membuat catatan manis. Tujuh kabupaten/kota termasuk Pilkada Gubernur/Wakil Gubernur dimenangi oleh calon yang diusung PA. Dominasi PA bakal sulit dihempang. Dari lima daerah yang masuk pilkada putaran kedua, ada tiga daerah yang besar kemungkinan dimenangi calon dari PA, yakni Abdya, Sabang dan Kota Langsa. Sedangkan partai nasional, seperti Demokrat dan Golkar ke bagian tiga daerah. Itupun harus berkoalisi bersama partai lain. Lalu bagaimana kiprah Parnas di tengah dominasi PA di Aceh? Apakah ‘taji’ parnas telah “tumpul di provinsi ini? Konon, dua tahun ke depan ada agenda politik yang tidak kalah menarik dan sangat urgen, yaitu Pemilu legislatif dan Pilpres 2014. Untuk mengetahui perkembangan parnas paska pilkada Aceh dan strategi apa yang harus dilakukan menghadapi agenda 2014, terutama beban Demokrat yang elitnya di Jakarta ‘berselemak’ korupsi, Waspada melayangkan pertanyaan tertulis kepada pengamat politik dan hukum Universitas Syah

Kuala Saifuddin Bantasyam. Berikut petikannya: Waspada (W): Bagaimana Anda melihat partai politik nasional pasca pilkada Aceh? Saifuddin Bantasyam (SB): Kita tahu calon yang parnas usung sebagai kepala daerah banyak gagal jika pemilu legislatif 2009 dijadikan patokan. Maka parnas memang sudah kehilangan greget dalam persaingan memperebutkan kursi untuk tingkat provinsi dan kabupaten/ kota di Aceh. Memang mereka tetap dapat meraih kursi, namun tak mampu mengalahkan partai lokal yaitu Partai Aceh dalam hal jumlah kursi yang diraih. PA sendiri juga tak unggul di seluruh 23 kabupaten/kota di Aceh, namun sebagai pendatang baru, PA menjadi kompetitor hebat bagi parnas dan juga bagi parlok-parlok lain di Aceh. Dalam pilkada kemarin, saya menilai parnas memang sama sekali tidak berdaya dalam berbagai aspek. Dengan jumlah kursi yang sangat sedikit, parnas tak memiliki pilihan lain kecuali berkoalisi dengan parnas lain atau dengan PA dalam mengusung calon untuk kepala daerah

dan wakil kepala daerah. Kandidat yang dimunculkan dalam koalisi sedikit yang berasal dari tokoh partai dari parnas. Artinya, mereka tak hanya kehilangan dukungan dari konsituen, melainkan juga kekurangan sumber daya manusia, atau kader-kader partai. Ini artinya, aspek pengkaderan untuk memunculkan calon pemimpin yang dikenal hebat, gagal dilakukan oleh parnas. Secara logistik, parnas juga sudah habis, ini karena kurangnya sifat militan di kalangan anggota parnas dalam memperjuangkan kepentingan partai. Hanya sedikit parnas yang merespon berbagai persoalan genting dan penting yang terjadi di masyarakat. Mereka berpikir bahwa karena sedikit wakil mereka di legislatif, atau bahkan tak memiliki wakil sama sekali, maka mereka tak perlu responsif atas problem kemasyarakatan, suatu pikiran yang menurut saya sangat salah. Partai sebagai sebuah institusi tetap ada, ada pengurus dan kantornya, meskipun tak ada wakil di legislatif. Jadi, mestinya mereka aktif bicara, memberi pandangan atau kritik, namun kenyataannya ba-

Saifuddin Bantasyam, Pengamat Politik Dan Hukum Unsyiah

nyak di antara mereka yang diam. W: Apakah hasil pilkada kemarin semakin membuat PA makin jaya di Aceh? SB: Dalam pilkada kemarin, PA sebenarnya tak memenangi seluruh daerah pemilihan. Dengan kata lain, ada beberapa daerah yang kepala daerah dan wakil kepala daerahnya bukan yang diusung oleh PA. Mungkin

karena telat mendaftar, pasangan calon yang diusung PA ada yang “dicomot paksa,” atau belum mengakar dan tidak laku di tengah rakyat. Namun dengan capaian di tingkat kabupaten/kota, dan PA unggul mutlak di pemilihan gubernur dan wakil gubernur, maka PA memang menunjukkan superioritas. Karena legislatif dan eksekutif dikuasai PA, tentu kejayaan mereka akan semakin lengkap dan saya berharap kejayaan itu memberi pengaruh positif kepada peningkatan keadilan dan kesejahteraan rakyat, dan roda pemerintahan dapat dijalankan secara efisien, efektif, transparan dan akuntabel. W: Apakah dengan banyaknya elit Demokrat di Jakarta yang terlibat korupsi akan mempengaruhi kadernya di Aceh? SB: Peliputan media massa atas kasus-kasus korupsi oleh parpol tentu memberi pengaruh negatif yang sangat besar kepada parpol-parpol tersebut. Konsituen akan berpaling kepada parpol lain saat tahu bahwa parpol yang didukung selama ini berselemak dengan korupsi. Kita tahu sekarang pemilih yang pragmatis semakin banyak dibanding pemilih ideologis, ka-

rena itu orang mendukung partai tertentu atas alasan-alasan misalnya apakah partai itu layak dipercaya atau tidak, bukan lagi pada apakah partai itu nasionalis, sosialis, agamis dan sebagainya. Saya kira konsituen Partai Demokrat di Aceh yang memilih partai itu pada 2009 tentu akan berpikir ulang untuk memilih pada 2014. Situasi yang ada saat ini bukan tidak mungkin juga mempengaruhi semangat juang para pengurus Demokrat di Aceh. Mungkin mereka berpikir, “setelah berjuang dengan sungguh-sungguh, eh Jakartanya malah seperti itu, bikin malu partai, ngapaian dukungan PD lagi di Aceh?” W: Apakah respon rakyat terutama pemilih di Aceh terhadap elit di Jakarta akan berimbas di daerah seperti Demokrat tadi?. SB: Saya kira akan memiliki imbas sampai ke bawah, apalagi jika performance Demokrat tidak membaik pada akhir 2012 dan 2013 ini. Saya menduga, kejayaan Demokrat di Aceh akan meredup pada 2014, jika tak melakukan langkah-langkah antisipatif. (cb01/b01)


Aceh

B12 LANGSA (Waspada): Penjabat Bupati Aceh Timur diwakili Sekretaris Daerah (Sekda) , Syaifannur, SH.MM mengajak segenap mahasiswa menghargai keberagaman, yakni syariat Islam, budaya/adat istiadat dan sosial kemasyarakatan. Hal ini disampaikan Sekda saat saat menerima 300 mahasiswa/i Sekolah Tinggi Agama Islam (STAI) Gajah Putih, Tekengen, Aceh Tengah yang akan melaksanakan Kuliah Pengabdian Masyarakat (KPM) di halaman Pendopo Meuligo Aceh Timur di Langsa, Selasa(15/5) Sekda mengharapkan kepada para mahasiswa mampu mengendalikan dan beradaptasi diri dengan masyarakat tiga kecamatan yaitu Simpang Jernih, Serbajadi dan Peunaron yang merupakan wilayah tempat para mahasiswa akan melaksanakan KPM yang notabene juga memiliki kesamaan adat istiadat dengan daerah asal mereka yakni Aceh Tengah. Ketua STAI Gajah Putih, Drs Al Misry ,MA dalam amanatnya mengatakan, kehadiran mereka ke Aceh Timur untuk Kuliah Pengabdian Masyarakat (KPM) ini adalah sebagai kado terindah atas penegerian STAI Gajah Putih sebagaimana Keputusan Presiden RI tentang penegrian STAI Gajah Putih Takengen tanggal 25 April 2012 lalu. “Kami sangat berterimakasih atas penerimaan Pemkab Aceh Timur kepada mahasiswa kami yang ber KPM di wilayah ini serta sekaligus sebagai wujud silaturahmi serta proses belajar hidup bermasyarakat bagi para mahasiswa khususnya,” tambahnya. (b22)

Stok Darah Langsa Belum Cukup

Pembangunan Kesehatan Di Aceh Timur Membaik IDI (Waspada): Pembangunan kesehatan di Aceh Timur dalam lima tahun terakhir diklaim kian membaik. Saat ini, Aceh Timur memiliki 26 Puskesmas, termasuk lima unit di kawasan terpencil, 108 dokter PTT dan PNS dan 400-an bidan desa. “Ini semua berkat dukungan semua pihak, termasuk masyarakat,” lapor Kepala Dinas Kesehatan Aceh Timur, H. Aiyub SKM saat menerima kunjungan silaturahmi Pj Bupati Aceh Timur, Ir Nasrullah Muhammad, MSi.MT, Sekda Syaifannur, SH.MM beserta rombongan, di kantor Dinas Kesehatan Aceh Timur, di Idi, baru-baru ini. Dengan kondisi kemajuan pembangunan kesehatan yang cukup signifikan ini, sambung H Aiyub, pihaknya optimis pelayanan kesehatan dan taraf kesehatan masyarakat Aceh Timur ke depan, akan semakin baik. “Harapan kami, Pemerintah Aceh Timur terus memprioritaskan pembangunan sektor kesehatan, disamping sektor pendidikan, Syariat Islam dan pemberdayaan ekonomi. Sebab, tanpa kesehatan, mustahil berbagai program pembangunan berhasil dengan baik,” tutur H Aiyub.(b19/b22)

2013, Operasional Pemerintahan Aceh Timur Total Di Idi IDI (Waspada): Pj Bupati Aceh Timur, Ir Nasrullah Muhammad, MSi.MT, optimis operasional dan aktivitas kantor pusat pemerintahan Aceh Timur, berjalan maksimal di Idi Rayeuk mulai 2013. “Seiring kesiapan sarana pendukung, Insya Allah, 2013 mendatang, aktivitas PNS Aceh Timur bisa total di ibukota yang baru, Idi Rayeuk,” kata Nasrullah saat menyambut rombongan Pj Gubernur Aceh, Tarmizi A Karim, di Meuligo Aceh Timur, Senin (14/5). Nasrullah juga menyebut, selain soal pusat pemerintahan, saat ini Pemkab Aceh Timur juga tengah berupaya meningkatkan SDM aparatur serta peningkatan kedisiplinan PNS, termasuk dengan menggelar razia PNS yang rencananya digelar mulai pekan depan. (b19/b22)

Kondisi Pendopo Bupati Aceh Timur Di Langsa Memprihatinkan LANGSA (Waspada): Kondisi fisik pendopo Bupati Aceh Timur yang berada di Kota Langsa sekarang ini sangat memprihatinkan. Seperti bangunan tidak terawat, loteng yang rusak di berbagai tempat dan rumput yang tumbuh di atas atap menandakan tidak ada lagi orang yang peduli. Fakta itu terlihat, ketika kedatangan Penjabat Gubernur Aceh Tarmizi A Karim untuk bersilaturahmi dengan jajaran pemerintah dan masyarakat Kabupaten Aceh Timur, Kabupaten Aceh Tamiang serta Kota Langsa yang dipusatkan di tempat itu,Senin (14/5). Salah seorang warga Kota Langsa, Edy Sahputra yang ikut dalam silaturahmi itu kepada Waspada mengatakan, sangat disayangkan hal itu sampai terjadi. Alangkah naifnya, kata dia, bila gedung yang masih digunakan pejabat tinggi daerah ini dibiarkan terlihat suram. “Bila tidak sanggup dirawat lagi oleh Pemkab Aceh Timur lebih baik diserahkan saja ke Pemko Langsa, dan untuk kediaman Bupati Aceh Timur bisa menempati Pendopo Peureulak bahkan nantinya pemimpinnya lebih dekat dengan rakyat Aceh Timur,” sebut Edy. (b20)

Waspada /Ibnu Sa’dan

LOTENG bocor dan tanaman rumput di atas atap terlihat dibiarkan saja pada Pendopo Bupati Aceh Timur di Kota Langsa.

Rabu 16 Mei 2012

BNN Harapkan Indonesia Bebas Narkoba

Bupati Ajak Mahasiswa Menghargai Keberagaman

LANGSA (Waspada): Ketua Bidang Sumber Daya Palang Merah Indonesia (PMI) Kota Langsa, Syukur, SPd menegaskan, stok darah masih belum mencukupi untuk memenuhi permintaan darah dari berbagai rumah sakit di Kota Langsa, terutama bagi pasien Jaminan Kesehatan Aceh (JKA). Hal itu dikemukakan Syukur ketika mengikuti latihan gabungan PMR se Kota Langsa dan Aceh Timur di Pantai Peudawa, Aceh Timur, Minggu (13/5). Menurut Syukur, kekurangan stok darah ini karena masih kurangnya kesadaran masyarakat yang mau mendonorkan darahnya. Di samping itu juga, karena masih kurangnya kesadarna masyarakat untuk mau mendonorkan darahnya masih rendah. Sebenarnya ini perlu kesadaran sendiri, pernahkan kita mendonorkan darah atau keluarga kita, sehingga darah itu mencukupi kepada pasien-pasien yang membutuhkan darah, sebutnya lagi. Program rutin yang dilakukan kegiatan donor darah setiap tiga bulan sekali dengan memberikan program dan dukungan kepada instansi pemerintah maupun non pemerintah untuk aktif atau tetap mendukung kegiatan donor darah. Untuk sekali pelaksanaan donor darah kita bisa menghasilkan 40-60 kantong darah dari berbagai golongan darah. Kemudian diserahkan ke Unit Donor Darah PMI. “Nah jika rumah sakit memerlukan darah, nantinya mereka meminta kepada unit itu,” demikian Syukur. (m43)

WASPADA

Waspada /Ibnu Sa’dan

KEPALA BNN RI Irjen Pol Bambang Abimanyu (baju batik) di dampingi Penjabat Wali Kota Langsa Bustami Usman (pakai peci) dan Kepala Kantor BNN Langsa Kompol Navri Yuleni (berjilbab) ketika memberi keterangan pers kepada wartawan, Selasa (15/5) tentang bahaya narkoba.

Warga Diminta Padamkan TV Dua Jam Setelah Magrib LANGSA (Waspada): Untuk menurunkan tingkat kenakalan remaja yang akhir-akhir ini makin memprihatinkan terutama berkaitan dengan penggunaan narkoba, Penjabat Wali Kota Langsa Bustami Usman mengajak seluruh lapisan masyarakat ikut melakukan pencegahannya. Salah satu solusi, kata dia, dengan menghidupkan kembali pengajian di meunasahmeunasah dan rumah-rumah, serta mematikan teleivisi di seluruh tempat selama dua jam setelah shalat magrib, agar anak-anak dan para remaja bisa fokus. Wacana yang seiring dengan program pelaksanaan Sya-

riat Islam di Aceh dan sesaui dengan imbauan Mentri Agama RI itu disampaikanWali Kota Langsa Bustami Usman saat memberi sambutan pada acara peresmian Kantor BNN Langsa dan BNN Lhokseumawe yang dipusatkan di kantor BNN Langsa, Selasa (15/5). Ikut hadir Sekretaris Utama Badan Narkotika Nasional (BNN) RI, Irjen Pol Drs Bambang Abimanyu beserta rombongannya, Pj Wali Kota Lhokseumawe, para Muspida tiga wilayah Kabupaten Aceh Timur, Aceh Tamiang dan Langsa, serta sejumlah undangan lain dari berbagai kalangan masyarakat Kota Langsa dan Aceh Timur. Menurut Bustami Usman, kasus penggunaan narkotika melibatkan banyak komponen, maka itu untuk memberan-tasnya juga harus melibatkan berbagai komponen pula. Dan salah satu komponenen penting

adalah keterlibatan para orang tua dalam mengawasi anakanak dan anggota keluarganya. Sekretaris Utama BNN RI Irjen Pol Bambang Abimanyu juga sangat menyetujui ide Penjabat Wali Kota Langsa. Menurutnya, untuk sekarang ini di seluruh Indonesia ada sekitar 3,8 juta orang yang sudah kecanduan terhadap narkoba. “Yang baru bisa diobati baru sekitar 18 ribu orang,” katanya. Maka itu untuk mengurangi jumlah orang-orang yang ketergantungan dengan narkotika itu tidak bisa dilakukan hanya oleh BNN, melainkan harus terlibat seluruh lapisan masyarakat. Khususnya kepada wartawan, Abimanyu mengimbau untuk selalu menginformasikan kepada masyarakat terutama kalangan kaum muda tentang bahaya-bahaya narkoba, agar mereka tidak tertarik menggunakannya.(b20)

LANGSA (Waspada): Kehadiran Badan Narkotika Nasional (BNN) di daerah akan semakin memberi arti bagi upaya Pencegahan dan Pemberantasan Penyalahgunaan dan Peredaran Gelap Narkoba (P4GN) di daerah- daerah. Demikian Sekretaris Utama BNN RI, Irjen Pol. Drs. Bambang Abimanyu, pada peresmian gedung BNN Kota Langsa dan BNN Lhokseumawe, di Kota langsa, Selasa,(15/5) Ditambahkan indikator keberhasilan BNN itu akan terlihat dari turunnya angka prevalensi para penguna dan peredaran Narkoba, “. Oleh karena itu, peran dan tugas Kepala BNN di daerah tidak ringan haruss dapat bekerja secara profesional dan mampu menyatukan serta menggerakan komponen masyarakat, bangsa dan negara bersama melaksanakan P4GN,” ujarnya. Dikatakan, kerawanan penyalahgunaan dan peredaran gelap narkoba di masing-masing daerah sangat bervariasi. Berbagai faktor yang mempengaruhi meningkatnya penyalahgunaan dan peredaran narkoba. Karenanya, dengan mengesampingkan segala kelemahan dan kekurangan, maka melalui instruksi Presiden Nomor 12 tahun 2011 diharapkan mampu menyatukan seluruh komponen masyarakat, bangsa dan negara bersama mewujudkan Indo-

nesia bebas narkoba 2015. Kepala BNN Langsa, Kompol Navri Yuleni, SH.MH, dalam laporannya menyampaikan, pembangunan gedung BNN Kota Langsa dan BNN Kota Lhokseumawe kedua pemerintah ini memberikan dukungan berupa penyediaan lahan melalui mekanisme hibah kepada BNN. Dan, pembangunan gedung BNN Kota Langsa dan Lhokseumawe direncanakan oleh PT Tejacipta Reka Sarana Surabaya serta diawasi pelaksanaannya oleh konsultan manajemen kontruksi PT Yodya Karya Jakarta. Pada saat ini gedung telah siap diresmikan dan digunakan untuk program kegiatan P4GN di Provinsi Aceh dan khususnya Kota Langsa dan Lhokseumawe. Pembangunan gedung ini berdasarkan Undang-undang Nomor 35 tahun 2009 tentang Narkotika yang mengamanatkan, BNN merupakan instansi vertikal yang memiliki perwakilan di daerah yang disebut BNNP dan BNNKota. Acara dihadiri Pj Wali Kota Langsa, Bustami Usman, Pj Bupati Aceh Timur, Nasrullah Muhammad, Pj Wali Kota Lhokseumawe, Syarifudin Saleh, Kapolres Langsa, AKBP Hariadi, Kapolres Aceh Timur, AKBP Iwan Eka Putra, Kajari Langsa, Adonis,SH dan sejumlah pejabat lainnya. (b22)

Siswa SMP Kota Langsa Siap Ikuti O2SN Dan FLS2N Tingkat Provinsi LANGSA (Waspada): Siswa SMP se Kota Langsa siap mengikuti Olimpiade Olahraga Siswa Nasional (O2SN) dan Festival dan Lomba Seni Siswa Nasional (FLS2N) tingkat Provinsi Aceh yang digelar 27-30 Mei mendatang. Demikian Kabid Pendidikan Luar Sekolah M Syarif Thaib, SPd, mewakili Kepala Dinas Pendidikan Kota Langsa Drs Mustafa MPd, ketika menutupO2SNdanFLS2NtingkatKotaLangsatahun 2012 di SMP Negeri 6 Langsa, Selasa (15/5). Hadir pada kesempatan itu, Kasi Dikdas Drs Muzzakir, Kepala SMPN 6 Langsa Hamdani, SPd, para kepala sekolah, guru dan siswa. Menurut Syarif, dengan terpilihnya siswa yang meraih juara di O2SN dan FLS2N ini, kita berharap bisa membawa dan mengharumkan nama Kota Langsa di tingkat Provinsi Aceh. “Maka dari itu kepada siswa atau sekolah yang terpilih dalam even ini, agar terus mempersiapkan diri dan berlatih, sehingga bisa meraih prestasi,” katanya. Syarif juga mengajak seluruh peserta yang meriah Olimpiade Olahraga Siswa Nasional (O2SN) dan Festival Lomba Seni Siswa Nasional (FLS2N) agar dapat bertanding dengan penuh semangat, jujur dan sportif. Syarif menjelaskan, O2SN dan kegiatan rutin tahunan yang digelar Dinas Pendidikan ini dimaksudkan untuk memberikan pembinaan kepada generasi muda, khususnya pelajar SMP di seluruh Kota Langsa. Namun, Syarif juga menyayangkan masih ada sekolah-sekolah

di Kota Langsa yang tidak dan belum mau mengikuti even ini setiap tahunnya untuk memberdayakan para siswanya. Ketua Pelaksana Fathonah, AmPd. OR menjelaskan, adapun sekolah atau siswa yang mengikuti FLS2N tingkat provinsi, untuk lomba vokal grup diwakili SMPN 2 Langsa, Festival kreativitas seni tari diwakili SMP Negeri 10 Langsa, Seni baca Alquran putra/i diwakili T Yudha Ramadhan dari SMPN 2 Langsa dan Rika Maharani dari SMPN 10 Langsa, Cipta Cerpen diwakili Sri Wahyuni dari SMPN 2 Langsa, Story Telling Cut Putri Shafira dari SMPN 3 Langsa dan lomba menyanyi tunggal (solo) diwakili Mauliza Nazla Pasha dari SMPN 3 Langsa. Sementara untuk O2SN cabang atletik putra/i Riko Oktami dari SMPN 10 Langsa, Feri Nandani dari SMPN 5 Langsa, Kasturi dari SMPN 7 Langsa, dan Tria Lestari dari SMPN 11 Langsa. Cabang bulutangkis putra/i diwakili Muhammad Aidil dari SMPN 3 Langsa, AdeWira Chintya dari SMPN 5 Langsa. Cabang Catur putra/i diwakili Dilla Aryanto dari SMPN 5 Langsa dan Dina Firma Diana dari SMPN 10 Langsa. Cabang voli putra/i dari SMPN Negeri 5 Langsa dan SMP Negeri 10 Langsa. Cabang Karate putra/i diwakili Miftahul Arifin dari SMPN 3 Langsa dan Muhugayanti Putri dari SMPN 3 Langsa. Cabang Pencak Silat putra/i diwakili M. Ruliadi dari SMPN 9 Langsa dan Izan Maiyesi dari SMPN 9 Langsa. (m43)

17 Bulan Honor MPU Tak Dibayar IDI (Waspada): Pengurus Majelis Permusyawaratan Ulama (MPU) dalam 24 kecamatan se Kabupaten Aceh Timur tidak menerima honorarium selama 17 bulan terhitung sejak Januari 2011 hingga Mei 2012. Sektretaris MPU Darul Aman, Tgk Ibrahim saat ditanyai Waspada Selasa (15/5) mengungkapkan, pihaknya tidak mengetahui persis alasan pemerintah yang tidak mencairkan honor terhadap pengurus MPU kecamatan se Aceh Timur. Seingatnya, pengurus MPU kecamatan menerima honor terakhir adalah pada bulan Desember 2010. Saat disinggung jumlah pengurus MPU kecamatan, Ibrahim menyebutkan dalam setiap kecamatan pengurus MPU memiliki empat pengurus terdiri dari Ketua MPU, Wakil Ketua MPU, Sektaris MPU dan Anggota. “Meski ada aturan yang mengatur tidak boleh mencair-

kan honor ke MPU kecamatan tetapi harapan kita ada kebijakan dari pemerintah karena sesungguhnya kerja yang pikul MPU kecamatan tidak ringan,” kata Ibrahim. Wakil Ketua MPU Aceh Timur Tgk H Azhar BTM, S.Pd.I ketika dikonfirmasi Waspada membenarkan pengurus MPU kecamatan 17 bulan tak menerima honor. Dia menjelaskan, tidak dicairkannya honor pengurus MPU kecamatan akibat perubahan qanun di tuhun MPU, dimana terhitung sejak tahun 2011 MPU telah memiliki sekretariatnya sendiri yang sama administrasinya de-ngan Dewan Perwakilan Rakyat Kabupaten (DPRK). “Karena terjadi perubahan Qanun MPU, sehingga Pemda membuat penyesuaian. Termasuk dalam proses pembayaran juga akan disesuai dengan aturan yang ada,” jelas H Azhar seraya menambahkan, namun

demikian berdasarkan masukan dari MPU kecamatan pihaknya baru-baru ini telah meminta eksekutif dan legislatif untuk melakukan perubahan pada Qanun MPU Aceh Timur, sehingga di tahun 2013 bisa dilakukan pembayaran honor pengurus MPU kecamatan. H Azhar juga tidak sepakat dengan Qanun MPU yang tidak mengatur tentang honorarium pengurus MPU kecamatan, sebab beban dan tanggungjawab para ulama di kecamatan justru lebih besar dibandingkan dengan pengurus MPU kabupaten. “Persoalan sekretariat itu sudah baik diatur berdasarkan qanun MPU, bahkan MAA dan MPD juga kini sudah memiliki sekretariat. Tapi penghapusan honor pengurus MPU di kecamatan ini tidak wajar,” kata H.Azhar BTM seraya meminta nantinya honorarium pengurus MPU kecamatan harus ditingkatkan. (b24)

Jalan Amir Husein Al Muejahid Perlu Pengaspalan IDI (Waspada): Sepanjang 1.017 meter Jalan Amir Husein Al Muehajid Kecamatan Idi Rayeuk, Kabupaten Aceh Timur perlu pengaspalan. Pasalnya, kerusakan jalan badan jalan sudah tergolong parah dan kondisinya kini memprihatinkan. Amatan Waspada, salah satu sarana transportasi utama warga yang berdomisili di kawasan Stasiun Kereta Api Idi itu tampak sibuk dengan berbagai kendaraan yang melintas, khususnya roda dua beca mesin. Adanya Sekolah Menengah Atas (SMA) Bungong Jeumpa dan Taman Kanak-kanak (TK) Bungong Jeumpa Idi serta SDN 1 Idi membuat jalan tersebut menjadi super sibuk disaat pagi dan siang hari. Iskandar, tokoh masyarakat Idi kepada Waspada, Selasa (15/ 5) meminta Pemkab Aceh Timur segera melakukan pengaspalan. Hal itu dinilai mendesak mengingat Jalan Amin Husen Al Muejahid tidak pernah diaspla sejak 30 tahun yang silam. “Aneh sekali kita melihat jalan di pusat ibukota kondisinya tidak layak pakai dan sangat berantakan sekali,” katanya. Pj Bupati Aceh Timur Nas-

Waspada/Dede

KABID Pendidikan Luar Sekolah M Syarif Thaib, SPd, mewakili Kepala Dinas Pendidikan Kota Langsa Drs Mustafa, MPd menyerahkan tropy kepada siswa yang berhasil menang dalam Festival dan Lomba Seni Siswa Nasional (FLS2N) tingkat Kota Langsa, Selasa (15/5).

Kebijakan Bapekopas Kangkangi Keputusan Wali Kota LANGSA (Waspada): luar 1 April 2011 dan Kebijakan Badan Pengeloditandatangani Wali Kota laan Pembangunan KomLangsa Zulkifli Zainon dengan plek Pasar dan Perbelanjaan nomor suratnya 511 / 836 / 2011 (Bapekopas) Kota Langsa menyebutkan, seluruh mengenai peruntukan tempedagang termasuk menyewa pat jualan bagi para pedakios pemda tidak akan dipungut gang ternyata sangat bertenbayaran, kecuali biaya sewa tangan dengan Keputusan yang sesuai dengan Qanun Kota Wali Kota yang dikeluarkan Langsa nomor 17 Tahun 2010. sebelumnya. Atas kebijakan Bapekopas Kebiajakan Bapekopas yang mengangkangi Keputusan yang tertuang dalam suratWali Kota tersebut, membuat nya bernomor 002 / BapeCut Lem ,Gubernur masyarakat kecil khususnya pakopas / IV / 2012 mewajibLIRA Aceh ra pedagang penyewa kios menkan para pedagang yang dujadi resah dan meminta kepada lunya sebagai penyewa kios, sekarang harus Penjabat Wali Kota Bustami Usman supaya membeli dengan harga senilai Rp145 juta – menertibkannya. Rp250 juta untuk memperoleh kembali tempat Gubernur LIRA Aceh Cut Lem yang mengadjualannya itu. vokasi para pedagang kepada Waspada, Selasa Surat yang mewajibkan para pedagang (15/5), menunjukkan dua kopi surat. Dia juga membeli kios itu ditandatangi Sekda Kota La- tidak habis pikir kenapa dua surat yang mengatur ngsa Muhammad Syahril selaku Ktua Bapeko- hal yang sama bisa berbeda kebijakannya. pas dan Kadis Perindagkop dan UKM Syahril Yang lebih ironis, katanya, Bapekopas sehaHasballah selaku Sekretaris Bapekopas. Surat rusnya berada di bawah walikota justru berani tertanggal 23 April 2012. mengeluarkan kebijakannya bertentangan Sementara Keputusan Wali Kota yang ke dengan keputusan wali kota. (b20)

43 Jam Tenggelam, Bocah Ditemukan Jadi Mayat Waspada/Muhammad H. Ishak

PENGGUNA jalan mengelak lubang yang sudah lama diberikan tanda di Jalan Amir Husen Al Muejahid, Kecamatan Idi Rayeuk, Kab. Aceh Timur Senin (15/5). Warga meminta kerusakan jalan tersebut segera diperbaiki. rullah Muhammad melalui Camat Idi Rayeuk Zulkhaidir, SH saat dikonfirmasi Waspada kemarin mengatakan, bahwa pengaspalan jalan di Kota Idi akan dilakukan di tahun 2013 dengan

menggunakan dana Otsus.“Kita sudah usulkan jalan Amir Husen Al Muehajid. InsyaAllah tahun depan akan dibangun jalan kota sepanang 1.017 meter,” tandasnya. (b24)

PEUREULAK (Waspada): Setelah 43 jam tenggelam dan dilakukan pencarian siang dan malam, akhirnya bocah SD yang tenggelam di Daerah Aliran Sungai (DAS) Peureulak persisnya di Desa Beuringin, Kecamatan Peureulak Barat, Kabupaten Aceh Timur kini ditemukan mengapung sudah menjadi mayat di sungai yang sama Selasa (15/5) sekira pukul 07:00. Kepala Bagian Operasi TAGANA Aceh Timur Burhanuddin kepada Waspada menjelaskan, pihaknya bersama dua tim lainya dari Badan Penanggulangan Bencana Daerah (BPBD) Aceh Timur dan Palang Merah Indonesia (PMI) terus melakukan pencarian sejak tenggelamnya korban di DAS Peureulak Minggu (13/5) sekira pukul 12:00. “Namun karena arus sungai yang deras membuat pencarian sedikit terhambat,”

katanya. Pj Bupati Aceh Timur Ir Nasrullah Muhammad, MSi.MT melalui Kepala BPBD Aceh Timur Muhammad Ikbal kepada Waspada mengatakan, korban tenggelam di sungai Peureulak sudah ditemukan oleh tim gabungan yang melakukan pencarian di lapangan dengan radius sekitar 3 kilometer ke arah utara titik awal korban jatuh. “Saat ditemukan, korban mengapung di semak-semak pinggiran sungai. Tapi kondisi korban sudah tidak bernyawa,” kata Ikbal. Sebagaimana diketahui, Khairul Ihsan Bin Usman, 8, asal Desa Beuringin, Kecamatan Peureulak Barat. Dia tenggelam ketika mencuci tangan dan kakinya yang kotor setelah mandi di sungai bersama dua rekannya. Tenggelamnya korban diseret arus sungai yang deras sempat dilihat oleh dua rekannya. (b24)

Waspada, Rabu 16 Mei 2012  

waspada daily

Read more
Read more
Similar to
Popular now
Just for you