Issuu on Google+

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

RABU, Pon, 13 Februari 2013/2 Rabiul Akhir 1434 H

No: 24133 Tahun Ke-67

Terbit 24 Halaman (A1-12, B1-12)

Harga Eceran: Rp2.500,-

Monster Ronaldo Vs Meneer RvP kepada BBC Radio 5 Live, yang dikutip Selasa (12/2). SEMUA pandangan tertuju pada ketajaman Cristiano Ronaldo Neville merupakan senior sekaligus kapten Ronaldo ketika dan Robin van Persie (RvP) jelang bigmatch Real Madrid versus masih membela The Red Devils pada 2003-2009. Selama enam musim Manchester United pada leg pertama babak 16 besar Liga membela MU, sang monster mencetak 117 gol dari 290 partai. Champions. Bintang Portugal berusia 28 tahun itu pindah ke Madrid dengan Meneer RvP dengan sumbangan 19 golnya di Liga Premier nilai transfer 80 juta pounds. Akhir pekan lalu dia mencetak bagi klub anyarnya Setan Merah MU, lebih sering mengundang hatriknya yang ke-20 bagi El Real sekaligus membawa klubnya menggasak respon positif dari kawan maupun lawan. Ronaldo dengan 24 golnya musim ini di La Liga Primera, cenderung Sevilla 4-1 di La Liga. “Anda butuh dua orang untuk menjaganya, tapi sebaliknya menatap laga di Santiago Bernabeu, yang turut ditayangkan tetap saja mereka akan dikalahkannya,” ramal Neville. Mantan striker MU Ole Gunnar Solskjaer pun berpandangan demikian, langsung SCTV dinihari nanti mulai pkl 02:45 WIB. Ada yang memuji, tetapi lebih banyak lagi yang mencaci, terutama bahkan memprediksi monster Ronaldo bakal mencetak hatrik saat buat jika menyangkut karakternya. Bek sayap MU Patrice Evra menudingnya pertama kalinya menghadapi mantan klubnya. Hanya saja Solskjaer yakin, Setan Merah asuhan manajer Sir arogan, legenda United Gary Neville justru menyebutnya sebagai monster Alex Ferguson tetap sebagai pemenang dalam artian positif. Bursa Pegang Madrid berkat ketajaman Meneer RvP. “Saya pikir “Ronaldo merupakan seorang ini hasilnya akan ditentukan dengan sepengintimidasi, khususnya bagi bek William Hill 8/13 3/1 4/1 buah momen genius oleh Van Persie atau terlemah. Dia selalu melakukannya Ladbrokes 1.66 4.00 4.60 Ronaldo,” tuturnya. setiap waktu. Kini dia sudah menjelma BetBrain 1.67 4.50 5.53 jadi seorang monster,” ucap Neville Lanjut ke hal A11 kol. 6

Kampanye Dilarang Konvoi MEDAN (Waspada): Polda Sumut melarang masyarakat melakukan konvoi kendaraan selama masa kampanye calon gubernur dan calon wakil gubernur Sumut yang dijadwalkan dimulai Sabtu (16/2). Larangan konvoi itu untuk menjaga keamanan berlalulintas, karena dapat menyebabkan kemacatan dan kecelakaan lalu lintas.

“Konvoi atau pawai berkeliling melibatkan banyak massa, sudah pasti mengganggu keamanan lalu lintas, jadi tidak diperbolehkan,” kata Kabid Humas Poldasu Kombes Pol. Heru Prakoso kepada wartawan di Mapoldasu, Selasa (12/2).

Dia mengatakan, untuk menjaga keamanan selama berlangsungnya masa kampanye, Polda terus berkoordinasi dengan KPU Sumut, termasuk larangan tidak melakukan konvoi kendaraan pada kampanye terbuka. Sementara untuk mengatur

arus lalu lintas selama masa kampanye, telah disiapkan Polantas di lokasi-lokasi yang digunakan untuk berkampanye. “Tujuannya agar masyarakat pengguna jalan lainnya tidak terganggu,” kata dia. Karo Ops Poldasu Kombes Pol. Iwan Hari Sughiarto me-

ngatakan, pihaknya menyiagakan sekira 8.000 personil kepolisian dibantu TNI dan Linmas untuk pengamanan tahapantahapan Pilgubsu. “Jumlah itu dibutuhkan mengantisipasi berbagai kerawanan, mulai dari terkecil sampai kemungkinan bentrok antarmassa

hingga berakibat gangguan nasional,” kata dia. Terkait surat suara, sekarang ini sudah berada di lokasi penyimpanan dengan penjagaan polisi, dan nantinya akan didistribusikan menggunakan truk yang dikawal dua anggota kepolisian. Polda telah melak-

sanakan simulasi pengamanan unjukrasa, penanganan kasus laka lantas, pengamanan cagubsu termasuk evakuasi jika terjadi upaya penculikan, juga penjagaan Tempat Pemungutan Suara (TPS).

Lanjut ke hal A2 kol. 1

KPK Usut “Sprindik” Anas

1 Ton Ganja Disita, 2 Tersangka Ditembak TAKENGEN (Waspada): Polres Aceh Tengah, Selasa (12/2) siang, menggagalkan pengiriman 1 ton daun yang sudah dipaket setelah petugas menghujani peluru ke arah mobil Suzuki warna silver BK 1996. Mobil itu berhasil dihentikan saat melaju. Hujan peluru membuat kaca belakang mobil hancur, di sisi kiri dan kanan mobil serta bagian depan ditembus peluru. Hujan timah panas itu akhirnya membuat tersangka menghentikan mobilnya di tengah hutan Pedekok/ Burlintang, Kec. Pegasing, Aceh Tengah. Dua tersangka “ terjun” ke jurang yang dipenuhi pepohonan. Lanjut ke hal A2 kol. 4

JAKARTA (Antara): Rapat pimpinan Komisi Pemberantasan Korupsi memutuskan untuk membentuk tim investigasi guna mendalami salinan dokumen yang diduga sebagai surat perintah penyidikan (sprindik) Anas Urbaningrum terkait kasus korupsi proyek Hambalang. “Hasil kesimpulan rapat pimpinan kemarin adalah pimpinan telah memerintahkan untuk membentuk tim

Bupati Asahan Sambut RTD Waspada

Warga Ujungbatu Tewas Dibantai Teman Sekampung

KISARAN (Waspada): Rencana Road To Dakwah (RTD) Harian Waspada yang akan diadakan di Masjid An-Namira, Kelurahan Kedailedang, Kamis (14/2) di Kisaran, disambut Bupati Asahan Taufan Gama Simatupang (foto) karena sesuai dengan program iman dan taqwa di Asahan. Hal itu diungkapkannya di sela-sela kesibukannya mempersiapkan program pembangunan Asahan, saat ditemui Waspada didampingi Wakilnya Surya, Sekdakab M Sofyan, Kabag Humas Zainal Arifin dan tuan rumah RTD, Camat Kisaran Timur Rahmat Hidayat Siregar, Selasa (12/2). Menurutnya, RTD Harian Waspada berkaitan dengan pembinaan Imtaq masyarakat Asahan, yang menjadi bagian penting dari visi misi Kabupaten Asahan, sehingga dirinya akan meluangkan waktu untuk hadir dari kesibukannya Rakorbang dan kegiatan pemerintahan lainnya. “RTD erat kaitannya dengan kemaslahatan umat di dunia dan akhirat,” tuturnya.

Lanjut ke hal A2 kol. 2

Al Bayan



JELANG MISS INDONESIA 2013: Sejumlah finalis Miss Indonesia 2013 dari 33 provinsi di Indonesia saat sesi perkenalan dalam konferensi pers jelang Miss Indonesia 2013 di Jakarta, Selasa (12/2). Malam puncak yang bertemakan” Beauty For The World” diikuti 33 wakil dari 33 provinsi dan akan digelar pada 20 Februari 2013 di JIEXPO PRJ Kemayoran, Jakarta.

Kejatisu Akan Laksanakan Eksekusi 7 Terpidana Mati MEDAN (Waspada) : Kejaksaan Tinggi Sumatera Utara (Kejatisu) akan melaksanakan eksekusi terhadap tujuh terpidana mati diantara sepuluh terpidana mati pada tahun 2013 yang akan dilakukan eksekusi oleh Kejaksaan Agung. 10 Terpidana mati yang akan dilaksanakan pada tahun 2013 merupakan lanjutan dari 103 terpidana mati yang telah dilaksanakan pada tahun 2012. “Diantara sepuluh terpidana mati yang akan dieksekusi tujuh diantaranya di Sumatera

Utara,” ujar Kasi Penkum Kejatisu Marcos Simaremare di Medan, Selasa (12/2). Adapun terpidana mati, lanjutnya, Okonkow Nonsokiingleys warga Nigeria terpidana mati karena melakukan impor narkotika. “Saat ini Kejaksaan Negeri (Kejari) Medan sedang menunggu proses upaya hukum terakhir,” ujarnya. “Kemudian Ronald Sagala dan Nasib Purba, kedua terpidana ini dikarenakan perkara pembunuhan dan saat ini Kejaksaan Negeri Lubuk Pakam

Warga Siantar Terima Bantuan Bedah Rumah Dari Amri Tambunan

Oleh Tgk. H. Ameer Hamzah Hai orang-orang yang beriman, bersabarlah kamu dan kuatkan kesabaranmu, dan tetaplah bersiap siaga, dan bertaqwalah Kepada Allah SWT supaya kamu beruntung. (QS. Ali Imran:200) SALAH satu sifat yang utama bagi orang muslim adalah sabar. Sabar ialah hiasan hidup bagi yang mendapat cobaan seperti kehilangan kekuasaan, anggota keluarga meninggal dunia, kehilangan harta yang kita cintai, menderita kelaparan, ketakutan, dan lain-lain. Sabar terapi jiwa yang mampu mengusir godaan setan. Disebutkan dalam Atsar; Abubakar Siddiq Radhiallahu anhu pernah lapar berhari-hari, supaya perutnya jangan pedih beliau ganjal dengan batu di atas perutnya. Beberapa hari beliau tidak keluar rumah, kecuali waktu shalat jamaah. Rasulullah SAW datang menjenguknya.

Lanjut ke hal A2 kol. 4

sedang menunggu putusan grasi keduanya,” lanjut Marcos. Ketiga, lanjut Marcos, adalah perkara pembunuhan di Kejaksaan Negeri Rantau yang sedang menunggu proses kasasi terhadap Suwandi. “Keempat adalah Fatizan, Yafonaso, Beraati di Kejari Gunung Sitoli yang saat ini juga sedang menunggu proses hukum perkara pembunuhan. “Dalam tahun ini juga proses hukuman mati itu sepertinya akan dilaksanakan,” ujar Marcos kepada wartawan.

Waspada/HM Husni Siregar

SEORANG Ibu meneteskan air mata ketika Haji Amri Tambunan memberikan kunci rumah yang selesai dibedah jadi layak huni kepadanya di Kel. Martoba P. Siantar, Senin (11/2).

PEMATANGSIANTAR (Waspada) : Cagubsu Drs Haji Amri Tambunan berkunjung ke Kelurahan Martoba Kec. Pematangsiantar Utara yang merupakan tempat masa-masa kecilnya bermain ketika almarhum orangtuanya H Djamaluddin Tambunan di tahun 1957 menjabat Walikota Pematangsiantar dalam rangkaian peringatan Maulid Nabi Muhammad SAW disambut antusias warga dan tokoh pemuka masyarakat daerah itu, Senin (11/2) sore. Warga yang datang memadati lokasi peringatan Maulid sore itu, terlihat berebutan menyodorkan Lanjut ke hal A2 kol. 6

Sebelumnya, Jaksa Agung Muda Pidana Umum Mahfud Manan menyatakan, sebanyak 60 terpidana mati terkait kasus pembunuhan, 51 orang terkait kasus narkotika, dan 2 orang terkait kasus terorisme. Menurut Mahfud eksekusi sebenarnya direncanakan akhir tahun 2012 terhadap satu terpidana mati. Namun, eksekusi kemungkinkan besar dilaksanakan Januari 2013, sehingga pada tahun 2012 Kejaksaan tidak melakukan eksekusi mati. (m38)

SOSA (Waspada): Darwis Nasution, 60, warga Desa Ujungbatu, Kec. Sosa, Kab. Padanglawas (Palas) ditemukan tewas mengenaskan dengan keadaan leher nyaris terputus. Kejadian itu diketahui setelah pelaku GN, 34, warga desa yang sama melapor kepada kepala desa. Informasi yang dihimpun, Selasa (12/2), menyebutkan, kemungkinan korban dibunuh saat berada di parit pemandian yang berada di sekitar lokasi pertanian milik korban yang berjarak sekitar 100 meter dari gubuk tempat korban menginap. Sedangkan pencarian korban dilakukan setelah adanya pemberitahuan dari Kepala Desa Ujungbatu Hamdani Daulay melalui telepon seluler kepada anak korban Paet Nasution, 25, yang menyebutkan adanya perke-

investigasi agar dapat lebih mendalami apakah salinan dokumen yang beredar di media massa berkaitan dengan dokumen di KPK itu benar milik KPK atau tidak,” kata juru bicara KPK Johan Budi di Jakarta, Selasa (12/2). Sebelumnya, beredar dokumen dengan kepala surat berjudul “Surat Perintah Penyidikan Komisi Pemberantasan

Lanjut ke hal A2 kol. 2

lahian antara korban dengan pelaku. Kemudian, para keluarga korban dan warga lainnya melakukan pencarian. Korban ditemukan karena salah seorang warga tidak sengaja memijak korban yang terbenam dalam air pemandian. Di Puskesmas Ujungbatu, kakak ipar korban Tierlan Lubis, 50, juga warga desa yang sama mengatakan, korban sebelum kejadian bermalam di ladang bersama anaknya Syahrial, 16, namun katanya Syahrial tidak mengetahui kejadian itu karena kemungkinan dia belum bangun saat kejadian. Kaposlantas Polsek Sosa Aiptu Kasija yang turun ke lokasi penjemputan korban saat ditemui di Puskesmas Ujung Batu membenarkan kejadian tersebut.(a34)

Ada-ada Saja Pelayan Monyet Bertopeng JIKA bersantap di restoran biasa anda akan dilayani seorang pelayan, di tempat ini anda akan dilayani oleh monyet bertopeng. Restoran ini bernama Kayabuki Tavern, terletak di kota Tokyo, Jepang.

Lanjut ke hal A2 kol. 7

Serampang - Cinta Persie cinta juga Ronaldo Bingung....? - He...he...he...

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

RABU, Pon, 13 Februari 2013/2 Rabiul Akhir 1434 H

z zNo: 24133 * Tahun Ke-67

Terbit 24 Halaman (A1-12, B1-12) z zHarga Eceran: Rp 2.500,-

5 Pekerja Tewas Di Septic Tank

KPK Periksa Eko Patrio Terkait Hambalang

JAKARTA (Antara): Penyidik Kepolisian Resor Metropolitan (Polrestro) Jakarta Selatan menyelidiki kematian lima pekerja di Gedung Manhattan Square, Cilandak Timur. Polisi menduga kelima pekerja itu meninggal dunia karena kekurangan oksigen saat terjebak di bak pembuangan sedalam enam meter. “Itu septic tank yang sudah lama tidak digunakan. Kasusnya masih dalam penyelidikan,” kata Kepala Polrestro Jakarta Selatan, Komisaris Besar Polisi Wahyu Hadiningrat di Jakarta, Selasa (12/2). Wahyu menjelaskan kejadian itu berawal saat seorang pekerja melakukan pembersihan di lantai dasar dua Gedung Manhattan Square. Pekerja itu menginjak papan tripleks berukuran 40X60 centimeter yang menutupi septic tank berukuran 2X6 meter dan terperosok ke dalam bak pembuangan. Seorang pekerja lain mencoba membantu korban, namun tidak bisa kembali ke atas. Empat orang lainnya langsung membantu kedua orang tersebut, namun bernasib sama. Satu pekerja lain yang memeriksa enam orang yang sudah turun menggunakan tabung oksigen hanya berhasil menyelamatkan satu korban.

JAKARTA (Waspada): Anggota Komisi X DPR Eko Hendro Purnomo atau yang akrab disapa Eko Patrio diperiksa selama lima jam oleh penyidik Komisi Pemberantasan Korupsi (KPK). Eko diperiksa sebagai saksi kasus korupsi proyek Hambalang untuk tersangka Andi Mallarangeng. Politikus Partai Amanat Nasional (PAN) itu dikonfirmasi sejumlah pertanyaan yang berkaitan dengan anggaran proyek Hambalang, pembentukan panja Hambalang, dan alasan menolak anggaran proyek Hambalang. Saat dikonfirmasi mengenai alasannya menolak anggaran proyek Hambalang, Eko menyatakan fraksinya lebih memprioritaskan anggaran kegiatan yang lebih penting seperti Sea Games, PON dan program kepemudaan dan olahraga dibanding proyek Hambalang. Menurutnya, pembangunan pusat pendidikan olah raga belum terlalu mendesak. Sebab pemerintah masih bisa menggunakan Gelora Bung Karno dan Diklat Ragunan. Apalagi Jawa Barat juga sedang membangun GOR yang besar. Eko pun membantah adanya lobi-lobi politik untuk meloloskan anggaran proyek senilai Rp2,5 triliun. “Sejak awal bagaimana anggaran yang Rp400 miliar dan Rp250 milliar itu digunakan untuk tadi, untuk PON, Sea Games, Para SeaGames, dan Asian Games bukan untuk Hambalang.”

Lanjut ke hal A2 kol 1

Waspada/Bahtiar Gayo

KAPOLRES Aceh Tengah AKBP Artanto Sik, saat memperhatikan mobil Suzuki yang dipenuhi paket ganja siap edar. Foto direkam, Selasa (12/2)

1 Ton Dan 5 Ha Ladang Ganja Disita Poldasu Larang Konvoi Kendaraan Selama Kampanye Pilgubsu MEDAN (Waspada): Polda Sumut melarang masyarakat melakukan konvoi kendaraan selama masa kampanye calon gubernur dan calon wakil gubernur Sumut yang dijadwalkan dimulai Sabtu (16/2). Larangan konvoi itu untuk menjaga keamanan berlalulintas, karena dapat menyebabkan kemacatan dan kecelakaan lalu lintas. “Konvoi atau pawai berkeliling melibatkan banyak massa, sudah pasti mengganggu keamanan lalu lintas, jadi tidak diperbolehkan,” kata Kabid Humas Poldasu Kombes Pol. Heru Prakoso kepada wartawan di Mapoldasu, Selasa (12/2). Dia mengatakan, untuk menjaga keamanan selama berlangsungnya masa kampanye, Polda terus berkoordinasi dengan KPU Sumut, termasuk larangan tidak

melakukan konvoi kendaraan pada kampanye terbuka. Sementara untuk mengatur arus lalu lintas selama masa kampanye, telah disiapkan Polantas di lokasilokasi yang digunakan untuk berkampanye. “Tujuannya agar masyarakat pengguna jalan lainnya tidak terganggu,” kata dia. Karo Ops Poldasu Kombes Pol. Iwan Hari Sughiarto mengatakan, pihaknya menyiagakan sekira 8.000 personil kepolisian dibantu TNI dan Linmas untuk pengamanan tahapan-tahapan Pilgubsu. “Jumlah itu dibutuhkan mengantisipasi berbagai kerawanan, mulai dari terkecil sampai kemungkinan bentrok antarmassa hingga berakibat gangguan nasional,” kata dia.

2 Tersangka Luka Tembak Lompat Ke Jurang Aceh Tengah TAKENGEN (Waspada): Polres Aceh Tengah, Selasa (12/2) siang, menggagalkan pengiriman 1 ton daun yang sudah dipaket setelah petugas menghujani peluru ke arah mobil Suzuki warna silver BK 1996. Mobil itu berhasil dihentikan saat melaju.

Hujan peluru membuat kaca belakang mobil hancur, di sisi kiri dan kanan mobil serta bagian depan ditembus peluru. Hujan timah panas itu akhirnya membuat tersangka menghentikan mobilnya di tengah hutan Pedekok/ Burlintang, Kec. Pegasing, Aceh Tengah. Dua tersangka “terjun” ke jurang yang dipenuhi pepohonan. Menurut Kapolres Aceh Tengah AKBP Artanto. SiK, saat

menyaksikan mobil yang dipenuhi paket ganja di halaman Mapolres Aceh Tengah, Selasa (12/2), petugas nekat memburu tersangka yang sudah masuk ke dalam hutan. Berbekal petunjuk tetesan darah di antara dedaunan di dalam hutan itu, 10 petugas dibekali dengan pakaian rompi lapis baja. Saat ditemukan kedua tersangka dalam keadaan lemas. “Tersangka kita perkirakan kehabisan darah saat melarikan

diri. Seorang tersangka terkena tembakan pada lutut dan tersangka yang lain pada siku,” tutur Brigadir Iwan Abadi, dengan pakaian penuh lumpur, senjata laras panjang di pundaknya, menambahkan keterangan Kapolres. Menurut Kapolres, peristiwa itu bermula ketika mobil Suzuki ini dari arah Blangkejeren menuju Takengen, Lanjut ke hal A2 kol 1

Lanjut ke hal A2 kol 6

Kejatisu Akan Laksanakan Eksekusi 7 Terpidana Mati MEDAN (Waspada) : Kejaksaan Tinggi Sumatera Utara (Kejatisu) akan melaksanakan eksekusi terhadap tujuh terpidana mati diantara sepuluh terpidana mati pada tahun 2013 yang akan dilakukan eksekusi oleh Kejaksaan Agung. 10 Terpidana mati yang akan dilaksanakan pada tahun 2013 merupakan lanjutan dari 103 terpidana mati yang telah dilaksanakan pada tahun 2012. “Diantara sepuluh terpidana mati yang akan dieksekusi tujuh diantaranya di Sumatera Utara,” ujar Kasi Penkum

Kejatisu Marcos Simaremare di Medan, Selasa (12/2). Adapun terpidana mati, lanjutnya Okonkow Nonsokiingleys warga Nigeria terpidana mati karena melakukan impor narkotika. “Saat ini Kejaksaan Negeri (Kejari) Medan sedang menunggu proses upaya hukum terakhir,” ujarnya. “Kemudian Ronald Sagala dan Nasib Purba, kedua terdakwa ini dikarenakan perkara pembunuhan dan saat ini Kejaksaan Negeri Lubuk Pakam Lanjut ke hal A2 kol 6

Al Bayan

Kesabaran Oleh: H Ameer Hamzah Hai orang-orang yang beriman, bersabarlah kamu dan kuatkan Kesabaranmu, dan tetaplah bersiap siaga, dan bertaqwalah Kepada Allah SWT supaya kamu beruntung. (QS. Ali Imran:200) SALAH satu sifat yang utama bagi orang muslim adalah sabar. Sabar ialah hiasan hidup bagi yang mendapat cobaan seperti kehilangan kekuasaan, anggota keluarga meninggal dunia, kehilangan harta yang kita cintai, menderita kelaparan, ketakutan, dan lain-lain. Sabar terapi jiwa yang mampu mengusir godaan setan. Disebutkan dalam Atsar; Abubakar Siddiq Radhiallahu anhu pernah lapar berhari-hari, supaya perutnya jangan pedih beliau ganjal dengan batu di atas perutnya. Lanjut ke hal A2 kol 2

KPK Bentuk Tim Investigasi Usut “Sprindik” Anas JAKARTA (Antara): Rapat pimpinan Komisi Pemberantasan Korupsi memutuskan untuk membentuk tim investigasi guna mendalami salinan dokumen yang diduga sebagai surat perintah penyidikan (sprindik) Anas Urbaningrum terkait kasus korupsi proyek Hambalang. “Hasil kesimpulan rapat pimpinan kemarin adalah pimpinan telah memerintahkan untuk membentuk tim investigasi agar dapat lebih mendalami apakah salinan dokumen yang beredar di media massa berkaitan dengan dokumen di KPK itu benar milik KPK atau tidak,” kata juru bicara KPK Johan Budi di Jakarta, Selasa (12/2). Sebelumnya, beredar dokumen dengan kepala surat berjudul “Surat Perintah Penyidikan Komisi Pemberan-

tasan Korupsi” yang menetapkan bahwa tersangka Anas Urbaningrum selaku anggota DPR periode 2009-2014 dikenakan pasal 12 huruf a atau huruf b atau pasal 11 Undangundang No 31 tahun 1999 sebagaimana telah diubah dengan UU No 20 tahun 2001 tentang Pemberantasan Tindak Pidana Korupsi. Surat tersebut ditandatangani oleh tiga orang pimpinan KPK yaitu Abraham Samad, Zulkarnain dan Adnan Pandu Pradja. “Hari ini mungkin secara resmi tim akan dibentuk, hasil dari tim ini akan ditindaklanjuti untuk mencari kesimpulan apakah dokumen itu berasal dari KPK atau bukan, jadi kita tunggu hasil kerja tim dalam KPK yang berada di bawah deputi pengawasan internal dan pengaduan masyarakat,” tambah Johan.

Mantan Dirut PDKS Tuding Sejumlah Petinggi Simeulue


JELANG MISS INDONESIA 2013. Sejumlah finalis Miss Indonesia 2013 dari 33 provinsi di Indonesia saat sesi perkenalan dalam konfrensi pers jelang Miss Indonesia 2013 di Jakarta, (12/2). Malam puncak penobatan Miss Indonesia 2013 yang bertemakan” Beauty For The World” yang di ikuti 33 wakil wanita dari 33 provinsi ini akan di gelar pada 20 Febuari 2013 di JIEXPO PRJ Kemayoran.

Warga Ujung Batu Tewas Dibantai Teman Sekampung SOSA (Waspada): Darwis Nasution, 60, warga Desa Ujung Batu, Kec. Sosa, Kab. Padanglawas (Palas) ditemukan tewas mengenaskan dengan keadaan leher nyaris terputus. Kejadian itu diketahui setelah pelaku GN, 34, warga desa yang sama melapor kepada kepala desa. Informasi yang dihimpun, Selasa (12/2), menyebutkan, kemungkinan korban dibunuh saat berada di parit pemandian yang berada di sekitar lokasi lahan pertanian milik korban yang berjarak sekitar 100 meter dari gubuk tempat korban menginap. Sedangkan pencarian korban dilakukan setelah adanya pemberitahuan dari Kepala Desa Ujung Batu Hamdani Daulay melalui

SIMEULUE ( Waspada): Setelah menjalani pemeriksaan dari pagi sampai sore mantan Dirut Perusahaan Daerah Kabupaten Simeulue (PDKS), berinitial AU disebut menuding sejumlah petinggi Simeulue mendapat jatah uang yang dituduhkan dikorupsi AU. Kapolres Simeulue AKBP. Drs. Parluatan Siregar, MH menyatakan hal itu dalam konfirmasi yang disampaikannya sekitar pukul 17:00 WIB, Selasa (12/2). Menurut Kapolres, AU me-

nyatakan keterlibatan beberapa nama pejabat Simeulue termasuk salah seorang oknum pimpinan DPRK Simeulue berinial Ardn. Namun menurut Kapolres hal ini pernah diklarifikasi kepada yang bersangkutan dan yang bersangkutan membantah hal itu. Sementara itu, Kapolres Simeulue AKBP Parluatan Siregar menyatakan pihaknya sudah membawa mantan Dirut PDKS AU ke Mapolres setempat. “Saat ini dia sedang di-BAP,” papar Parluatan. (cb08)

Ada-ada Saja

Pelayan Monyet Bertopeng

JIKA bersantap di restoran biasa anda akan dilayani seorang pelayan, di tempat ini anda akan dilayani oleh monyet bertopeng. Restoran ini bernama Kayabuki Tavern, terletak di kota Tokyo, Jepang. Di restoran sake house ini

Lanjut ke hal A2 kol 5

Waspada/Syarif Ali Usman

KAPOLPOS Polsek Sosa Aiptu Kasija (empat dari kanan) saat menyerahkan korban kepada Kepala Puskesmas Ujung Batu Drg. Ahmad Zarnawi di ruang outopsi Puskesmas setempat. telepon seluler kepada anak Kemudian, para keluarga korban Paet Nasution, 25, yang korban dan warga lainnya menyebutkan adanya perke- melakukan pencarian. Korban lahian antara korban dengan Lanjut ke hal A2 kol 3 pelaku.

Serampang - Hilang uang bensin TS ah.... - He.... he....he....

Berita Utama


Warga Sudirejo I Sambut Meriah Pasangan GanTeng MEDAN (Waspada): Cawagubsu pasangan GanTeng nomor urut 5, Tengku Erry Nuradi menyerahkan bantuan dan perlengkapan sekolah bagi 500 KK dan 200 murid SD warga Kel.Sudirejo I, Kec. Medan Kota di lapangan bola SSB Patriot Jl. Air Bersih Medan, Selasa (12/2). Kehadiran Tengku Erry langsung disambut meriah seribuan kaum ibu dan anak-anak yang sudah lama menunggu kehadiran pasangan GanTeng tersebut. Tiba di lapangan, warga berebut menyalami, berfoto dan tidak sungkan-sungkan mengajak Tengku Erry berjoget bersama. Sejumlah ibu histeris saat menyalami dan memeluk Tengku Erry. Seperti yang dirasakan ibu Mamiek. Dia mengaku mengidolakan pasangan GanTeng (Gatot-Tengku Erry). ‘’Kami mendoakan pada Pilgubsu 7 Maret mendatang pasangan nomor urut 5 ini menang,’’ pintanya. Sementara itu, Tengku Erry dalam sambutannya mengatakan ada 5 kebutuhan hidup yang harus dipenuhi masyarakat. Kebutuhan itu yakni, sandang, pangan, papan, lapangan pekerjaan dan yang kelima adalah olahraga serta hiburan. ‘’Tersedianya lapangan bola di Jl. Air Bersih ini diharapkan dapat dimanfaatkan warga sebagai ajang silaturahmi selain berolahraga,’’ sebut Erry. (m46)

1 Ton Dan 5 Ha ....

melaju dengan kecepatan tinggi. Di kawasan Kemerleng menyerempet bus jenis L 300 sehingga bodi mobil, baik yang dibawa tersangka dan L300 mengalami luka gores yang panjang. Namun mobil ini tidak berhenti dan tetap melaju. Sopir bus L 300 melaporkan kejadian itu ke Polsek Linge. Namun ketika melintasi Polsek Linge, mobil ini tetap melaju dengan kecepatan tinggi. Petugas dari Polsek Linge melakukan pengejaran, sementara petugas Buser dari Mapolres Aceh Tengah menuju Linge untuk memburu mobil. Sesampainya di hutan kawasan pegunungan Pedekok, mobil dihujani peluru diminta untuk berhenti. Dua tersangka yang ada dalam mobil itu tetap menekan gas. Diperkirakan saat itu tersangka sudah terkena tembakan petugas. Pada sebuah tikungan tajam tersangka menghentikan mobilnya dan melompat ke dalam jurang yang dipenuhi pepohonan. Petugas turun memburu tersangka dengan menyisir hutan. Berbekal petunjuk tetesan darah di daunan, kedua tersangka AMS, 40, warga Tanjung Ambalang Payung, Karo dan ABR, 38, warga Medan Tembung ditemukan petugas dalam kondisi lemas,

5 Pekerja Tewas ....

Petugas kemudian turun tangan membantu pekerja yang terjebak di pembuangan dan mengevakuasi korban. Peristiwa tersebut menewaskan lima orang pekerja yang salah satu korbannya diidentifikasi bernama Cecep Cahyana ,29, asal Kampung Copas RT 02/01 Kelurahan Gunung Sari Kecamatan Ciranjang, Cianjur, Jawa Barat. Petugas belum dapat memas-tikan identitas empat orang korban lainnya karena tidak ditemukan kartu tanda pengenal, namun korban diduga bernama Joko, Jimjim, M Saiku dan Ahmad Samsu-din. Jenazah mereka saat ini ada di RS Marinir KKO Cilan-dak. Sementara dua orang yang kritis yakni Masudi ,27, asal Jawa Tengah dan Sutaryo alias Haerudin ,37, asal Jawa Timur menjalani perawatan di RS Mintoharjo.

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Bxg6+, Rh8. 2. Bxh6+, Rg7. 3. Mg5+, Rf8. 4. Bh8+mat. (Jika 1. ....., Rh7. 2. Mxf7+, Rh8. 3. Mg7+mat). Jawaban TTS: TTS Topik


Jawaban Sudoku:

6 4 7 1 5 8 3 9 2

5 1 9 3 2 7 4 8 6

2 8 3 4 6 9 7 5 1

8 3 2 6 7 1 5 4 9

4 6 5 9 8 2 1 3 7

7 9 1 5 4 3 6 2 8

1 5 6 2 9 4 8 7 3

3 2 8 7 1 5 9 6 4

9 7 4 8 3 6 2 1 5

diperkirakan kekurangan darah akibat terluka tembakan. Kedua tersangka diamankan di RSU Datu Beru Takengen untuk mendapatkan pengobatan. “Kita doakan tersangka cepat sembuh agar dapat kita minta keterangannya, untuk membongkar jaringan ganja ini,” tutur Kapolres Aceh Tengah Artanto. Polisi Temukan 5 Ha Ladang Ganja Petugas dari Mapolresta Lhokseumawe menemukan 5 hektare ladang ganja di Gampong Teupin Reusep, Kecamatan Sawang, Aceh Utara. Barang bukti sebanyak 30 ribu batang ganja siap panen itu langsung dimusnahkan di TKP, Selasa (12/2) pagi. Iptu Poeloeng Arsa Sidanu, Kasat Narkoba Polres Lhokseumawe,, Selasa (12/2), kepada wartawan membenarkan pihaknya menemukan ladang ganja siap panen seluas 5 ha di pedalaman Sawang. Areal tanaman ganja diketahui berkat informasi dari masyarakat dan hasil pengembangan beberapa kasus sebelumnya yang pernah ditangani Polres Lhokseumawe. “Penggerebekan lahan ganja tersebut kita lakukan dalam operasi Antik tahun 2013. Ladang ganja yang kita temukan kemarin berada di beberapa titik. Ada sekitar 30 ribu batang ganja yang langsung kita musnahkan di lokasi,” kata Kasat Narkoba. Poeloeng juga mengatakan, peredaran narkoba jenis ganja paling banyak dipasok dari Provinsi Aceh. Karena itu, petugas dari Mapolresta Lhokseumawe berkomitmen akan membumihanguskan tanaman memabukkan itu dalam wilayah hukumnya. Poeloeng mengatakan, saat petugas menggerebek tidak ditemukan seorang pun di lokasi tersebut. Petugas hanya menemukan gubuk kosong. (b32/cb09/b18)

Albayan ....

Beberapa hari beliau tidak keluar rumah, kecuali waktu shalat jamaah. Rasulullah SAW datang menjenguknya. Beliau melihat shahabatnya itu pucat dan kurus. “Ada apa denganmu wahai Abubakar?”. Tanya baginda. “Saya kelaparan ya Rosulullah! Jawab Abubakar dengan perasaan lemah. Kebetulan kedua manusia utama itu sama-sama dalam kelaparan, “Saya juga sudah tidak makan beberapa waktu!” ujar Nabi. tetapi keduanya bersabar karena malu memintaminta. Tiba-tiba putra Abdurrahman bin Auf (dermawan paling kaya) datang mengundang keduanya agar makan siang. Alhamdulillah! Keduanya makan sampai kenyang. Sabar tentu bukan hanya

Waspada/Surya Efendi

DISAMBUT MERIAH: Cawagubsu pasangan GanTeng nomor urut 5, Tengku Erry Nuradi menggendong seorang anak saat disambut meriah warga di lapangan bola Jl. Air Bersih Medan, Selasa (12/2).

Ratusan Warga Ikuti Pengobatan Gratis Dan Senam Poco-poco ESJA DELISERDANG (Waspada): Masih dalam rangka HUT PDI Perjuangan ke-40, DPD PDI Perjuangan Sumut menggelar acara pengobatan gratis dan perlombaan senam poco-poco untuk ibu-ibu yang berasal dari Kabupaten Deli Serdang, di Lapangan Reformasi Percut Sei Tuan, Selasa (12/2). Acara pengobatan dan lomba senam poco-poco dihadiri sekitar 700-an orang yang berasal dari beberapa tempat di kawasan Percut Sei Tuan, Deli Serdang. Ketua Tim Kampanye Effendi-Jumiran, Ruben Tarigan dalam sambutannya menegaskan bahwa pengobatan gratis yang digelar Tim ESJA sudah berlangsung di beberapa daerah di Sumatera Utara. “Selain pengobatan gratis, kali ini kita juga menggelar acara perlombaan senam poco-poco yang diikuti oleh kaum ibu-ibu PKK serta ke-

Warga Ujungbatu ....

ditemukan karena salah seorang warga tidak sengaja memijak korban yang terbenam dalam air pemandian. Di Puskesmas Ujung Batu, kakak ipar korban Tierlan Lubis, 50, juga warga desa yang sama mengatakan, korban sebelum kejadian bermalam di ladang bersama anaknya Syahrial, 16, namun katanya Syahrial tidak mengaetahui kejadian itu karena kemungkinan dia belum bangun saat kejadian. Sementara Kepala Puskesmas Ujung Batu, Drg. Ahmad Zarnawi Pasaribu mengatakan korban meninggal akibat luka yang diakibatkan dalam masalah menahan lapar. Sabar harus selalu menghiasi ibadah kepada Allah SWT. Misalnya; ada godaan nafsu supaya berbuat maksiat, maka kita harus bersabar untuk tidak memperturutkan hawa nafsu, malah kita harus tetap sabar dalam keistiqamahan dalam berbuat amal kebajikan. Kekurangan harta jangan menghalangi langkah kita untuk berbuat amal shaleh. Orang-orang yang menghiasi dirinya dengan sifat sabar akan diberi kesuksesan dalam usahanya, cita-citanya, bahkan surga di hari pembalasan kelak. Bersabar itu wajib hukumnya sedangkan tergesagesa dari setan. Para Nabi yang mendapat gelar Ulul Azmi karena kesabarannya dalam


PENGOBATAN GRATIS: Masyarakat antusias mengikuti acara pengobatan dan pembagian kaca mata baca gratis di Lapangan Reformasi Percut Sei Tuan,Deli Serdang, Selasa (12/2). tangga. lompok ibu-ibu rumah tang- menggunakan hak pilih pada 7 Maret 2013 nanti dan yang ga,” papar Ruben Tarigan. Pengobatan gratis dan terpenting jangan lupa dengan pembagian kaca mata baca pasangan Effendi-Jumiran. Wakil Bendahara Tim Pegratis, lanjut Ruben merupakan salah satu bentuk perhatian menangan Pasangan ESJA SuEffendi-Jumiran terhadap riani, S.Pd, MAP menegaskan masalah kesehatan masyarakat. bahwa acara tersebut bukan Dia juga minta warga agar hanya untuk sekadar ngumpul ibu-ibu tetapi salah satu ajang benda tajam di leher korban silaturahmi antara ibu-ibu dengan perincian, luka di pengajian dan ibu-ibu PKK bagian leher depan sebelah serta ibu rumah tangga untuk kanan sepanjang 16 cm, lebar m e n a m p i l k a n b a k a t n y a 6 cm, kedalaman 4 cm, se- membawakan senam pocomentara luka bagian leher poco. (rel/m09) belakang sebelah kanan yakni panjang 16 Cm, lebar 6 cm, Ada-ada Saja .... kedalaman 6 cm, sedangkan ada dua ekor monyet yang ditulang leher korban terputus. pekerjakan menjadi pelayan. Kaposlantas Polsek Sosa Keduanya bernama Yat-Chan, Aiptu Kasija yang turun lang- Fuku-Chan. Tak ubahnya sung ke lokasi penjemputan seperti pelayan biasa, monyetkorban saat ditemui di Pus- monyet ini juga mengenakan kesmas Ujung Batu membe- pakaian lengkap dan bahkan narkan kejadian tersebut, menggunakan topeng. namun katanya motif dari Yat-Chan, monyet berusia pembunuhan tersebut belum 16 tahun merupakan yang diketahui sedangkan pelaku tertua dari keduanya. Namun sudah diamankan di Polsek ia selalu bergerak lebih cepat Sosa. (a34) dalam melayani dan membawakan minuman para tamu mengembangkan agama Allah yang datang ke tempat itu. sangat luar biasa. Ibrahim Sementara Fuku-chan biamenghadapi Namruz yang sanya bertugas mengantar kejam, Musa menghadapi handuk hangat kepada tamu Fi ra u n y a n g z a l i m , No h dan membantu mereka memmenghadapi kaumnya yang berihkan tangan sebelum mekeras kepala, Isa dengan nyantap hidangan, sebagaiorang-orang yang durhaka, mana kebiasaan yang berlaku Muhammad menghadapi di Jepang. Percaya atau tidak, kedua Kaum Musyrikin Makkah dan monyet ini mendapat sertifiYahudi Madinah. Rasulullah bersabda: kasi resmi dari pejabat lokal Kesabaran itu cahaya yang untuk bekerja sebagai pelayan. benderang, (HR: Muslim). Ali Para tamu yang puas dengan bin Abi Thalib berkata: Bagi pelayanan kedua monyet ini orang mukmin kesabaran akan memberikan tips berupa adalah suatu nikmat dari- kacang kedelai. Sang pemilik restoran, nikmat Allah, sebaliknya bagi orang munafik kesabaran Kaoru Otsuka, mengatakan sesuatu yang sangat tidak monyet-monyet sebenarnya nikmat. Mudah-mudahan kita adalah binatang peliharaanyang sedang mendapat co- nya dan tidak dilatih untuk baan Allah SWT selalu dalam menjadi pelayan. Namun ia mengaku bahwa monyet itu bersabar. Amin! sering meniru sang pemilik dalam melayani tamu, dan dari situ akhirnya muncul ide untuk mempekerjakan monyet-monyet itu. Menurut undang-undang perlindungan satwa di Jepang, Otsuko diizinkan untuk mempekerjakan monyet-monyet ini di restoran dengan batas waktu 2 jam perhari. (oc/rzl)

WASPADA Rabu 13 Februari 2013

GusMan Semakin Berkibar Di Bursa SCWA MEDAN (Waspada): GusMan semakin berkibar di bursa SCWA (Siapa CagubsuWagubsu Anda). Hari ini rating GusMan naik lagi 1% mengurangi persentase GanTeng 1%. Sementara Amri-RE tetap di posisinya sebagai runner-up. Posisi bursa SCWA hari ini selengkapnya sbb:, GusMan 42%, Amri-RE 32%, GanTeng 26%, CH-Fadly 0%, ESJA 0%. Harian Waspada mengedarkan kupon

SCWA dalam rangka untuk mencari tahu siapa pilihan pembaca pada Pilgubsu 7 Maret 2013 men-datang. Pendu-kung Cagubsu-Wagubsu yang ingin berpartisipasi lewat bursa SCWA dapat mengisi kupon yang tersedia d i h a l a m a n Pe n t a s Pilkada sesuai petunjuk yang ada. Panitia hanya menghitung fisik kupon yang dikirim dan membuat persentasenya. (tim)

Lagi Warga Siantar Terima Bantuan Bedah Rumah Dari Cagubsu Haji Amri Tambunan P E M ATA N G S I A N TA R (Waspada) : Cagubsu Drs Haji Amri Tambunan melakukan kunjungan di Kelurahan Martoba Kecamatan Pematangsiantar Utara yang merupakan tempat masa-masa kecilnya bermain ketika almarhum orang tuanya H Djamaluddin Tambunan di tahun 1957 menjabat Walikota Pematangsiantar dalam rangkaian per ingatan Maulid Nabi Muhammad SAW disambut antusias warga dan tokoh pemuka masyarakat daerah itu, Senin (11/2) sore. Warga yang datang memadati lokasi peringatan Maulid sore itu, terlihat berebutan menyodorkan tangannya untuk menyalami Cagubsu yang berpasangan dengan Cawagubsu Dr RE Nainggolan MM yang akan bertarung menghadapi 4 pasangan Cagubsu/Cawagubsu lainnya pada bursa Pilgubsu 7 Maret 2013. Kehadiran Cagubsu nomor urut 4 Drs Haji Amri Tambunan di peringatan Maulid Nabi Besar Muhammad SAW selain sebagai memenuhi undangan warga Kelurahan Martoba, juga membawa berkah bagi keluarga Alm Bahar serta keluarga Mahadi Purba. Pasalnya, karena keberadaan rumah kedua warga kurang mampu yang selama ini tidak layak huni, mendapat sentuhan melalui gerakan kemanusiaan “bedah rumah” sehingga menjadi rumah sehat dan layak huni serta nyaman untuk ditempati. Ketika Cagubsu Drs Haji Amri Tambunan menyerah-

Waspada/HM Husni Siregar

SEORANG Ibu terharu dan meneteskan air mata ketika Haji Amri Tambunan memberikan kunci rumah yang telah selesai dibedah menjadi layak huni kepadanya, di Kelurahan Martoba Pematang Siantar, Senin (11/2), pada acara Peringatan Maulid Nabi Besar Muhammad SAW. kan kunci rumah, kedua keluarga yang mendapat sentuhan kemanusiaan itu tak dapat menahan rasa harunya. Istri Alm Bahar yang merupakan Veteran begitu juga Mahadi Purba tampak meneteskan air mata saat menerima kunci dari Cagubsu yang diusung Partai Demokrat itu. Selain menyerahkan dua kunci rumah Drs Haji Amri Tambunan juga menyerahkan tali asih kepada 100 anak yatim piatu, tikar plastik kepada 11 kelompok pengajian, 16 orang bilal mayit serta 20 imam dari 4 masjid. Cagubsu Drs Haji Amri Tambunan mengaku Kelurahan Martoba tidaklah asing bagi dirinya.Karena masa-masa kecilnya, ia tinggal di Kelurahan Kampung Melayu yang pada masa itu Kelurahan Martoba merupakan bagian

dari Kampung Melayu sebelum dimekarkan menjadi 3 kelurahan. Dihadapan ratusan warga dan sejumlah tokoh masyarakat diantaranya Drs H Burhanuddin Nasution, H Abdul Kadir Siregar, mantan petinju nasional Syamsul Anwar Harahap, Al-Ustadz Taufiqurrahman yang dikenal dengan sebutan “:Ustadz Pantun” serta Drs H Zulkarnaen Nasution, Cagubsu nomor urut 4 itu mengajak warga Pematangsiantar khususnya Kelurahan Martoba untuk tetap memupuk kebersamaan yang terjalin indah ini. Dengan kebersamaan seperti yang terjalin saat ini semua tantangan yang terbentang dihadapan kita untuk membangun Sumut mudahmudahan akan dapat diatasi. (a06)

Kejatisu Akan ....

banyak 60 terpidana mati terkait kasus pembunuhan, 51 orang terkait kasus narkotika, dan 2 orang terkait kasus terorisme. Menurut Mahfud eksekusi sebenarnya direncanakan akhir tahun 2012 terhadap satu terpidana mati. Namun, eksekusi kemungkinkan besar dilaksanakan Januari 2013, sehingga pada tahun 2012 Kejaksaan tidak melakukan eksekusi mati. “Saya sebenarnya jadwalkan akhir 2012 satu (orang), karena rumit jadi hanya satu, tetapi ini pun terlambat lagi,” terang Mahfud. Dia enggan menjelaskan siapa terpidana tersebut. Mahfud mengatakan, satu orang itu terlibat kasus narko-

tika dan eksekusinya akan dilakukan oleh Kejaksaan Tinggi Banten. Untuk satu orang yang siap dieksekusi ini, Mahfud mengatakan sudah berkoordinasi pada pihak Kajati Banten dan Kemen-kumham. Namun, masih menunggu surat penetapan eksekusi. Begitupula Jaksa Agung Basrief Arief mengatakan, pada tahun 2012 hanya sekitar berkas putusan 8 terpidana yang telah berkekuatan hukum tetap (inkracht). “Hal itu disebabkan banyaknya terpidana yang mengajukan upaya hukum kembali seperti banding, kasasi, hingga Peninjauan Kembali (PK),” ujarnya ketika itu. (m38)

Poldasu Larang ....

dan iring-iringan kendaraan masing-masing tim kampanye pasangan calon Gubsu/Cawagubsu saat peluncuran Pilkada Damai, 16 Februari 2013 dibenarkan KPU Sumut. A n g g o t a / Ko m i s i o n e r Komisi Pemilihan Umum (KPU) Sumut Surya Perdana kepada wartawan, Selasa (12/ 2) di kantor KPU Sumut Jln. Perintis Kemerdekaan mengatakan, Poldasu menganggap arak-arakan tersebut rawan terjadinya gesekan antarpendukung. Sehingga Poldasu menganjurkan konvoi atau iring-iringan kendaraan tim kampanye ditiadakan.

Menurutnya, KPU Sumut didatangi unsur Poldasu yang meminta agar konvoi atau iring-iringan kendaraan roda empat saat arak-arakan Pilkada Damai ditiadakan. “Ada informasi dari intelijen konvoi dianggap berpotensi menimbulkan gesekan antarpendukung pasangan calon,’’ujar Surya mengutip keterangan pihak Poldasu. Namun, katanya, KPU Sumut belum bisa memutuskan apakah permintaan Poldasu itu diakomodir atau tidak, karena harus diputuskan melalui rapat pleno. (m34/m27)

sedang menunggu putusan grasi keduanya,” lanjut Marcos. Ketiga, lanjut Marcos, adalah perkara pembunuhan di Kejaksaan Negeri Rantau yang sedang menunggu proses kasasi terhadap Suwandi. “Keempat adalah Fatizan, Yafonaso, Beraati di Kejaksaan Negeri Gunung Sitoli yang saat ini juga sedang menunggu proses hukum perkara pembunuhan. “Dalam tahun ini juga proses hukuman mati itu sepertinya akan dilaksanakan,” ujar Marcos kepada wartawan ketika itu. Sebelumnya, Jaksa Agung Muda Pidana Umum Mahfud Manan menyatakan bahwa seTerkait surat suara, sekarang ini sudah berada di lokasi penyimpanan dengan penjagaan polisi, dan nantinya akan di distribusikan menggunakan truk yang dikawal dua anggota kepolisian. Polda juga telah melaksanakan simulasi pengamanan unjukrasa, penanganan kasus laka lantas, pengamanan cagubsu termasuk evakuasi jika terjadi upaya penculikan, juga penjagaan Tempat Pemungutan Suara (TPS). Rencana Konvoi Pilkada Damai 16 Februari Terancam Batal Rencana batalnya konvoi

WASPADA Rabu 13 Februari 2013

Info Sumut


Dukungan Adat Buat Gatot-Tengku Erry

Masyarakat Natal Anugerahi Gelar Tuanku Sintan Rajo Babandiang Gatot

Waspada/Surya Efendi

GATOT dan Tengku Erry diupa-upa pemuka adat Natal. Lima suku di kawasan Natal siap mendukung memenangkan Gatot-Tengku Erry dalam Pilkada 7 Maret mendatang.

Waspada/Surya Efendi

SELAIN diarak, Gatot-Tengku Erry juga disambut atraksi pencaksilat khas masyarakat pesisir Barat. Ribuan warga mengelu-elukan pasangan bertagline Merakyat dan Melayani ini.

RIBUAN warga Natal, Kabupaten Mandailingnatal berkumpul di Rumah Adat mereka, Sabtu (9/2) siang kemarin. Sejak pagi masyarakat sudah berkumpul di kanan kiri jalan juga tanah lapang. Mereka ingin menyaksikan langsung penganugerahan gelar adat kepada Gatot Pujo Nugroho dan Tengku Erry Nuradi. Pemberian gelar dilakukan lima suku di Natal melalui Sidang Majelis Pemangku Adat Budaya Natal. Penganugerahan gelar dilakukan dengan pertimbangan Gatot Pujo Nugroho dinilai banyak mendorong pembangunan dan perubahan di Sumatera Utara selama dua tahun terakhir memimpin provinsi ini. Anugerah ini sekaligus sebagai dukungan warga Natal dan sekitarnya kepada Gatot yang kembali maju untuk menjadi Gubernur pada 7 Maret mendatang. Hasil sidang adat tersebut memutuskan , Pelaksana tugas Gubernur Sumatera Utara Gatot Pujo Nugroho diberi gelar Tuanku Sintan Rajo Babandiang. Gelar ini diharap bisa menjadi ikatan bathin bagi Gatot untuk terus memperhatikan dan memperjuangkan pembangunan di kawasan tersebut. Sebelum ditabalkan oleh pemangku adat yang diketuai oleh Kemal Syarif sebagai Sutan Pangeran, Gatot yang saat itu didampingi Tengktal. Pasangan bersemboyan Merakyat dan Melayani ini kemudian secara adat diarak ribuan warga serta disambut dengan pertunjukan pencak silat. Dengan senyum khas, Plt Gubsu melambaikan tangannya saat melewati barisan warga yang sengaja menunggu arakarakan. Tak henti-hentinya orang nomor satu di Sumatera Utara itu tersenyum dan menyapa para warga.

Waspada/Surya Efendi

GATOT Pujo Nugroho dan Tengku Erry Nuradi melambaikan tangan ke arah warga saat diarak menuju Lapangan Merdeka, Natal. Lima suku di kawasan Natal, Madina menganugerahkan gelar kehormatan kepada Gatot karena dinilai berjasa membawa perubahan dan pembangunan di Sumatera Utara. Ketua Pemangku Adat Kemal Syarif mengatakan, pemberian adat tertinggi tersebut diharapkan bisa memperkenalkan adat istiadat Natal tak hanya di kalangan setempat tapi juga masyarakat Sumatera Utara. “‘Kami dari majelis 5 suku terdiri dari Datuk Putiah sebagai Kepala Adat Suku Barat, Datuk Sutan Pengulu sebagai Kepala Suku Rao, Datuk Sinaro Panjang sebagai Kepala Suku Minangkabau, Datuk Mudo sebagai Kepala Suku Bandar X dan Datuk

Ketek sebagai Kepala Suku Aceh telah sepakat dan menyetujui Gatot diberi gelar tersebut. Gelar ini juga menggambarkan bahwa tuanku sebagai pemimpin seperti intan yang terpendam dan menjadi pembanding bagi warga,” jelas Kemal Syarif. Drs H Syafruddin Nataly selaku ketua pelaksana pemberian gelar berharap agar semangat pertemuan ini terus berkesinambungan. Tak berhenti hanya di hari penobatan saja. Tak hanya sekadar pada tataran kenduri adat dan pulang ba-

samo saja. Banyak warga dan suku yang hadir berharap penganugerahan gelar dapat diteruskan dengan kerja-kerja nyata yang lebih memperhatikan kampung halaman mereka. “Selain itu juga melalui kegiatan ini diharapkan akan terbangun suatu jaringan komunikasi yang baik antara berbagai komponen yang ada di daerah Pantai Barat Mandailing. Dan yang tak kalah pentingnya adalah kita berharap agar kegiatan ini akan menjadi dialog antara

kita dengan Pemerintah Provinsi Sumut untuk mengembangkan dan optimalisasi sumber daya yang dimiliki kawasan ini,” ujarnya. Acara pemberian gelar juga ditandai dengan pemakaian baju adat tertinggi serta penyerahan sajamba ( nasi kunyit) oleh Ketua Pemangku Adat Natal Kemal Syarif kepada Plt Gubsu sekaligus memperkenalkan para Datok Kepala Suku Nan Limo sebagai pemangku adatadat suku suku pesisir Natal.(m28)

Medan Metropolitan


WASPADA Rabu 13 Februari 2013

Waspadalah, Perampok Incar Kaum Perempuan TIDAK sedikit kaum perempuan yang menjadi korban perampokan di jalan raya Kota Medan. Umumnya, mereka dirampok saat mengendarai sepedamotor, menunggu angkutan kota (angkot), menumpang becak bermotor (betor) dan lainnya. Beberapa di antara kaum perempuan tersebut mengalami luka berat setelah terjatuh dari sepedamotor atau betor karena berusaha mempertahankan tas miliknya yang hendak dirampas perampok. Bahkan ada yang tewas setelah terjatuh dari betor dan kepalanya terhempas ke aspal. Kaum perempuan harus meningkatkan kewaspadaan saat berada di jalan raya, baik saat mengendarai sepedamotor, menumpang betor dan angkot atau di pelataran parkir mobil. Sebab, mereka selalu menjadi incaran para penjahat. Mengapa penjahat selalu mengincar kaum perempuan? “Berpenampilan terlalu glamour dan cenderung panik serta dianggap lemah dan tidak mampu melakukan perlawanan, membuat kaum perempuan rentan menjadi korban

perampokan,” kata Psikolog Emi Abbas kepada Waspada di Medan, baru-baru ini. Menurut Emi, seorang perempuan berpenampilan glamour, belum tentu menggunakan perhiasan mahal yang terbuat dari emas atau perak sehingga mudah dijual. Sebaliknya, banyak kaum perempuan menggunakan perhiasan imitasi. Namun mereka selalu membawa tas yang besar saat bepergian, sebagai upaya meningkatkan rasa percaya diri. “Memang, tidak semua kaum perempuan membawa tas yang besar saat keluar rumah. Tapi sebagian besar sering membawa tas yang besar. Isi tasnya hanya alat make-up, selendang pasmina karena takut masuk angin, atau kunci-kunci yang terkadang tidak terlalu penting dibawa saat berpergian. Ini bisa mengundang perhatian orang jahat. Awalnya, mereka tidak punya niat. Tapi saat ada kesempatan dan muncul keinginan untuk menguasai menguasai tas tersebut, maka terjadilah perampokan,” ujarnya. Karena itu, lanjut Emi, perlu membatasi diri agar tidak memba-

wa barang-barang yang tidak perlu saat keluar rumah. Apalagi saat mengendarai sepedamotor, sangat berisiko menggunakan tas sandang. Kemudian, jangan menggunakan telefon genggam saat di jalan raya. “Banyak kasus kejahatan terjadi saat seseorang menggunakan telefon genggamnya di jalan. Jika harus menerima telefon, cari tempat yang aman baru berbicara,” ucapnya. Umumnya, tindak kejahatan terjadi saat seseorang lengah. Karena itu, diharapkan agar mawas diri dan tidak langsung panik saat terjadi kejahatan. Kepanikan hanya membuat seseorang tidak tahu apa yang akan dilakukan. Terkadang dia lupa berteriak minta tolong. “Usahakan jangan panik dan langsung tanggap dengan keadaan agar kita tidak semakin lemah. Upayakan selalu membawa benda atau alat untuk pengaman diri setiap kali bepergian sehingga dapat digunakan untuk membela diri jika kejahatan datang. Setelah itu langsung melaporkan masalah itu kepada pihak berwajib,” ucapnya. Jangan Anggap Enteng Sebelumnya, Ketua Himpunan Wanita Karya (HWK) Sumut

Hj. Tiurnalis Azis Angkat dan penasehat Pengajian Sejuta Umat Ny. Fatimah Habibie mengingatkan kaum perempuan agar jangan anggap enteng terhadap situasi di jalan raya. Pasalnya, kata mereka, tindak kejahatan bisa terjadi di mana saja. Bahkan saat naik kendaraan umum hingga becak bermotor. Karenanya, pesan kedua tokoh perempuan ini, usahakan naik angkutan umum yang penumpangnya tidak sedikit. Jika menumpang becak bermotor, usahakan kenal dengan pengemudinya. Jika tidak kenal, pastikan jalan yang dilewati adalah jalan raya, bukan masuk gang keluar gang. “Pihak kepolisian harus memberikan respon jika ada pengaduan korban perampokan. Atau menambah pos jaga, agar warga bisa langsung melaporkan masalah yang dialaminya. Yang jelas, saat bepergian, tidak perlu membawa barang-barang yang tidak digunakan. Misalnya hanya ingin belanja. Bawa saja uang secukupnya dalam dompet kecil dan tidak membawa tas yang besar,” kata mereka. (m37)

Dirampok, Penumpang Betor Tewas MEDAN (Waspada): Setelah lima hari dirawat di RS Materna, ThingThing alias Tini, 32, warga Jln. Brigjen Katamso Gg. Tangsi, Kec. Medan Maimun tewas, Selasa (12/2), sekira pukul 10:00. Wanita ini sempat koma setelah terjatuh dari becak bermotor (betor) karena berusaha mempertahankan tasnya yang dirampok dua pria mengendarai sepedamotor. Informasi yang diperoleh Waspada di kepolisian, hingga korban meninggal dunia, pihak keluarga belum ada membuat laporan resmi ke Polsek Medan Barat terkait kasus perampokan yang dialaminya di Jln. Ahmad Yani, Kel. Kesawan, Kec. Medan Barat, pada Jumat (8/2) sekira pukul 22:00. Kanit Reskrim Polsek Medan Barat Iptu Syarifur Rahman yang dikonfirmasi terkait kasus perampokan tersebut menje-

laskan, hingga saat ini belum ada pihak keluarga korban yang membuat pengaduan ke Polsek Medan Barat. “Meski belum ada keluarga korban membuat pengaduan, namun polisi sudah melakukan olah TKP dan memeriksa saksi yang mengetahui peristiwa itu,” sebutnya. Menurut Syarifur, dari hasil penyelidikan sementara, korban terjatuh dari atas betor yang ditumpanginya saat berusaha mempertahankan tasnya yang dirampok pelaku mengendarai sepedamotor. Meski tasnya gagal dibawa kabur perampok tersebut, namun korban terjatuh dan kepalanya membentur aspal hingga tak sadarkan diri. Sebagaimana diberitakan sebelumnya, Thing Thing alias Tini bersama ayah kandungnya Long San menjadi korban perampokan di Jln. Ahmad Yani saat menumpang betor menuju Stasiun Kereta Api Besar Medan. Rencananya, korban bersama ayahnya hendak pulang ke

Dua Pencuri Dihajar Massa MEDAN (Waspada): Dipergoki membawa mesin grenda dan mesin bor hasil kejahatan, dua pencuri berinisial Ro, 35, dan Ar, 30, keduanya warga Jalan Gurilla Gang Sidik, Kec. Medan Perjuangan, dihajar massa hingga babak belur, Selasa (12/2) sekira pukul 16:00. Kedua pelaku selanjutnya diserahkan ke Polsek Percut Seituan. Informasi yang diperoleh di kepolisian, tertangkapnya kedua pelaku berawal ketika korban Ely, 40, baru pulang ke rumahnya di Jln. Mandala Bypass. Kec. Medan Tembung. Saat hendak keluar dari mobilnya, wanita itu melihat dua pria keluar dari rumahnya dengan membawa mesin grenda dan mesin bor miliknya. Korban langsung meneriaki kedua pelaku. Warga sekitar yang mendengar teriakan korban melakukan pengejaran dan menangkap kedua pelaku. Selanjutnya kedua pelaku dihajar massa. Petugas Polsek Percut Seituan yang mendapat informasi langsung ke lokasi mengamankan keduanya dari amuk massa. “Saya baru saja sampai ke rumah, belum lagi turun dari mobil, saya lihat kedua pelaku bawa kabur mesin saya. Saya teriakilah, ya udah dikejar dengan pemuda-pemuda situ,” sebut Ely. Sementara itu, Kanit Reskrim Percutseituan AKP Faidir Chaniago membenarkan atas peristiwa tersebut. “Pelakunya dua orang dan saat ini masih dalam pemeriksaan,” ujarnya. (h04)

Tukar Emas Asli Dengan Imitasi Ditangkap MEDAN (Waspada): Karena menukar emas asli dengan emas imitasi, seorang wanita asal Tanah Merah, Kota Binjai, ditangkap oleh pemilik toko emas di Jalan Besar Tembung, Kec. Percut Seituan, Selasa (12/2) sekira pukul 14:00. Tersangka berinisial Ir, 45, kini meringkuk dalam sel Polsek Percut Seituan. Informasi yang diperoleh di kepolisian, siang itu tersangka Ir masuk ke dalam toko emas milikWati, 45, di jalan besar Tembung dan berpura-pura menanyakan cincin emas sambil menunjukkan cincin emas sebagai contoh barang. Korban lalu mengeluarkan cincin emas dari dalam stelling dan memberikannya kepada tersangka. Setelah dilihat-lihat, ternyata Ir menukar cincin emas yang asli dengan imitasi contoh barang yang dimilikinya, dan cincin emas yang asli dijatuhkan ke lantai. Melihat cincin yang diberikan tersangka, korban curiga karena sudah berubah menjadi cincin imitasi. Korban langsung menanyakannya kepada tersangka yang ketakutan dan langsung kabur menyetop becak bermotor. Karena korban berteriak maling, penarik betor tidak berani membawa tersangka. Kemudian tersangka dibawa masuk kembali ke dalam toko untuk ditanyai dan ternyata di dalam tasnya banyak tersimpan barang-barang imitasi berbentuk kalung dan cincin. Tidak berselang lama, polisi kemudian datang ke lokasi mengamankan Ir dan membawanya ke Polsek Percut Seituan. Kepada petugas, korban Wati mengatakan, kalau sebelumnya pelaku berpura-pura menanyakan cincin emas, dan kemudian menukarnya dengan imitasi. Sedangkan, tersangka Ir yang ditanyai wartawa hanya menunduk sembari menutup wajahnya dengan tangan tanpa mau bicara. Kanit Reskrim Polsek Percut Seituan AKP Faidir Chan saat dikonfirmasi mengatakan, pelaku penipuan emas tersebut masih dalam pemeriksaan.”Bentar lah, masih dalam pemeriksaan ini korban sama pelakunya. Sabar ya bos,” tuturnya. (h04)

Rantauprapat guna merayakan Imlek di kampungnya. Saat kejadian, tas yang dibawa Tini dirampas pengendara sepedamotor. Korban berusaha mempertahankan tasnya. Akibatnya, terjadi tarik-menarik antara korban dengan pelaku. Namun korban terjatuh dari betor dan kepalanya terhempas ke aspal. Ditangkap Sementara itu, Seorang perampok HP dan uang Rp1 juta berinisial Sar alias Jeri, 29, warga Martubung, Kel. Besar, Kec. Medan Labuhan, ditangkap petugas Polsek Belawan saat melintas di Jln. Pelabuhan Raya kawasan Bundaran, Kel. Belawan Satu, Kec. Medan Belawan, Senin (11/2). Sedangkan dua temannya berinisial Rom dan IMS alias Ipang, warga Belawan, masih buron. Dari tersanga Jeri disita sepedamotor Honda Scoopy BK 4768 ACE sebagai barang bukti. Penangkapan tersangka atas laporan korban Lamsihar Prianto Khondro alias Isar, warga Kel. Canang, yang kehilangan satu HP dan uang Rp1 juta, yang dirampok tersangka Jeri bersama temannya pada 26 Januari 2013. “Tersangka sudah lama kita cari karena ciri- cirinya telah diberitahu korban,” kata Kanit Reskrim Polsek Belawan AKP B Pakpahan, Selasa (12/2). Kepada polisi, tersangka mengaku sudah satu tahun be-

lakangan ini melakukan perampokan atau “bajing loncat” di kawasan persimpangan tiga Kampung Salam, Belawan. Setiap beraksi, tersangka selalu didampingi dua temannya yang memiliki peran berbeda- beda. “Aku yang boceng dan Ipang yang merampok korban. Sedangkan Rom, menjual hasil rampokan kami kepada seorang penadah bermarga Sinaga di Belawan,” katanya. AKP B Pakpahan didampingi Kepala Bidang Operasional (Ka-BO) Polres Pelabuhan Belawan Iptu JH Tarigan mengatakan, tersangka bersama kelompoknya selama ini sering melakukan perampokan terhadap sejumlah pengendara mobil dan sepedamotor yang melintas di Jalan Pelabuhan Raya kawasan Kampung Salam, Belawan. “Komplotan ini sulit ditangkap karena diduga mendapat dukungan dari oknum petugas samping. Selain itu korbannya banyakyangtidakmelapor,”ujarnya. Menurut Pakpahan, tersangka dikenakan pasal 365 ayat 1 dan 2 KUHP dengan ancaman hukuman maksimal 12 tahun. Sebelumnya, sejumlah sopir dan pengguna jalan mengaku seling dirampok saat melintas di Pelabuhan Raya persimpangan tiga kawasan Kampung Salam, Belawan. Mereka dirampok saat kendaraan melaju pelan dengan ancaman senjata tajam.(h04/h03)

Wajib Bangun Under Pass Atau Fly Over Untuk KA MEDAN(Waspada): Rencana pengoperasian kereta api Medan - KNIA yang semula dijadwalkan pada Maret mendatang, akhirnya diundur hingga Agustus 2013. Salah satu alasannya, PT Kereta Api Indonesia (KAI) dan PT Railink dianggap belum siap serta tidak memikirkan dampak kemacatan lalulintas pasca penambahan frekuensi perjalanan kereta api. “Kemacatan lalulintas akan terjadi di sejumlah ruas jalan yang terdapat perpotongan lintasan kereta api jika tidak dibangun under pass (jalan bawah tanah) dan fly over (jalan layang) untuk kereta api,” kata Anggota DPD RI asal Sumut Parlindungan Purba dalam rapat yang digelar di Kantor Bappeda Sumut, Senin (11/2). Hadir dalam rapat tersebut Ketua DPRD Medan H. Amirud-

din, Bappeda, Kasat Lantas Polresta Medan Kompol Risya Mustario, Dishub Medan, Masyarakat Transportasi Indonesia (MTI),Yayasan Lembaga Konsumen Indonesia (YLKI), PT/ KAI dan PT Railink. Dalam rapat itu, rencana PT. KAI dan PT. Railink mengoperasikan KA Medan – KNIA menuai ketidaksetujuan dari sejumlah kalangan. Pasalnya, penambahan frekuensi perjalanan kereta api tersebut tidak memperhitungkan dampak kemacatan lalulintas di jalan raya sehingga dapat merugikan masyarakat. Parlindungan mengatakan, DPD RI akan mendorong permohonan pembangunan fly over dan under pass untuk lintasan kereta api. Dalam waktu dekat, DPD RI segera menyampaikannya ke Menteri Pekerjaan Umum (PU) terkait pemba-

ngunan fly over dan under pass. Beberapa waktu lalu, kata Parlindungan, PT. KAI mengaku pernah menyampaikannya ke Sekretaris Wakil Presiden. Namun setelah dicek, tidak ada permohonan tertulis tentang rencana pembangunan under pass atau fly over, sehingga belum ada tindaklanjutnya. “Saya segera menyurati pemerintah agar merealisasikan pembangunan fly over atau under pass demi kepentingan masyarakat. Jadi, under pass atau fly over ini wajib dibangun agar tidak menyebabkan kemacatan lalulintas yang sangat parah di Kota Medan, jika KA Medan - KNIA dioperasikan,” kata Parlindungan. Dalambeberapabulankedepan hingga Agustus 2013, pemerintah harus bekerja keras untuk mencari solusi mengatasi kemacatan lalulintas atau segera mem-

20 Pemain Judi Samkwan Ditangkap MEDAN (Waspada): Polda Sumut menggerebek salah satu villa di Bukit Indah I/3 Berastagi, Tanah Karo, sekaligus meringkus 20 orang yang kedapatan bermain judi samkwan atau dadu. “Mereka (para tersangka judi) ditangkap dari vila itu Senin (11/2) malam sekira pukul 21:30,” kata KanitV Subdit III Direktorat Reserse Kriminal Umum Polda Sumut Kompol

Saptono kepada wartawan, Selasa (12/2). Lokasi perjudian tersebut digerebek setelah petugas mendapatkan informasi dari masyarakat. Saat digerebek 20 tersangka termasuk 2 ceker tidak berkutik. Sedangkan empat di antaranya perempuan. Tersangka yang ditangkap terdiri dari dua ceker yaitu TH alias A Huat dan KG alias A Guan dan 18 pemain yaitu, GG alias

MUI Medan Helvetia Akan Peringati Maulid MEDAN (Waspada): Majelis Ulama Indonesia Kecamatan Medan Helvetria, akan mengadakan peringatan Maulid Nabi Besar Muhammad SAW 1434 H di halaman Sekrektariat MUI Jln. Kamboja Raya Perumnas Helvetia Medan, Sabtu (15/2) pukul 20:00. Ketua Komisi Infokom MUI Kecamatan Medan Helvetia Drs Syafruddin Haris dalam prees release yang diterima Waspada, Senin (11/2) menyebutkan, pada peringatan Maulid Nabi Muhammad SAW kali ini sebagai ketua panitia Drs H Syahron Sulaiman Rokan dan Sekretaris Damri Tambunan SHI, SPdI. Sedangkan sebagai penceramah Al Ustadz Drs H Muhammad Nur Wahabi SPdI, dan pembacaan ayat-ayat suci Alquran oleh Qori M Ridwan SPd, serta dimeriahkan dengan Marhaban dari pengajian Al Hidayah yang dikoordinir Hj Nurhayati Daulay. Menurut Ketua MUI Medan Helvetia Drs H Najamuddin Lubis, peringatan Maulid ini sebagai syiar Islam agar lebih mencintai dan manjadikanakhlak RasulullahMuhammad SAW sebagai suri tauladan. Selain itu, sebagai momentum menyampaikan informasi kepada masyarakat tentang keberadaan MUI, sebagai wadah musyawarah para ulama dan cendikiawan Muslim menampung dan mengatasi berbagai permasalahan umat baik dibidang hukum, agama, dan sosial kemasyarakatan di wilayan Medan Helvetia.(m35)

Waspada/Rustam Effendi

KANIT Reskrim Polsek Belawan AKP B Pakpahan didampingi Ka-BO Polres Pelabuhan Belawan, Iptu JH Tarigan menginterogasi tersangka perampokan, di Mapolres Pelabuhan Belawan, Selasa (12/2).

Waspada/gito ap

KANIT V Subdit III Dit Reskrimum Poldasu Kompol Saptono memperlihatkan barang bukti judi samkwan dan para pemainnya di Mapoldasu, Selasa (12/2).

Win Win, TS alias A Seng, THT alias A Guan, MS, TH alias Jimmy, KI, MH, Su, Je, GC alias A Cin, Er, Ha alias Anto, AT alias Husen, Su alias A Pin, FL, JL alias A Lek. “Namun disaat penggerebekan itu penggoncang dadu berinisial KY, warga Medan, langsung kabur dan masih kita buru,” ujar Saptono. Selain para tersangka, petugas juga mengamakan barang bukti 25 mata dadu, dua lapak dadu, satu mangkuk, dua set kartu joker, 15 lembar kartu dom i n o, p l u s u a n g t u n a i Rp3.023.000. Hasil pemeriksaan sementara, polisi menduga KY sebagai bandar perjudian itu. Soalnya dia yang menyewa villa. “Omset perjudian ini puluhan juta sehari, mereka sudah beroperasi sekitar satu bulan, tapi mereka berpindah-pindah. Untuk kasusnya masih kita kembangkan, dan sementara para tersangka dikenakan pasal 303 ayat 1 KUHP dengan ancaman maksimal 10 tahun penjara,” tutur Saptono. Sementara, TH ditanyai wartawan mengaku baru sekali terlibat perjudian itu. Dia berkilah hanya iseng saja memanfaat waktu libur Imlek. “Baru pertama ini, kebetulan libur Imlek bawa anak-anak kesana, saya sehari-hari jual durian,” sebutnya.(m27)

bangun fly over dan under pass. Namun, pembangunan fly over dan under pass untuk lintasan kereta api tidak memungkinkan karena membutuhkan waktu cukup lama yakni minimal satu tahun. Jadi, pemerintah harus mencari solusinya, antara lain menyediakan shuttle bus (bus khusus penumpang pesawat) dari Medan ke KNIA. Sementara itu, Kasat Lantas Polresta Medan Kompol Risya Mustario mengharapkan, jad-

wal perjalanan KA Medan KNIA tidak bersamaan dengan waktu kepadatan arus lalulintas, seperti pagi, siang, dan sore. Saat ini, arus lalulintas sangat padat, apalagi jika KA Medan - KNIA beroperasi, otomatis kemacatan akan se-makin parah. Selain itu, lanjut Risya, kendaraan bermotor yang selama ini parkir di Bandara Polonia akan berpindah ke seputaran Stasiun Besar Kereta Api. Hal ini akan menambah kemacatan

lalulintas karena terjadi penumpukan kendaraan di kawasan Lapangan Merdeka. Seharusnya, PT KAI menyediakan lahan parkir sendiri di Jln. Jawa, dengan memanfaatkan aset sendiri. “Mungkin untuk pengantar penumpang tidak ada masalah. Tetapi bagi yang menunggu penumpang hingga berjam-jam karena pesawat mengalami delay, maka terjadi penumpukan kendaraan,” demikian Risya. (cay)

Oknum Anggota DPRDSU Diduga Caplok Tanah Warga MEDAN (Waspada): Oknum anggota DPRDSU berinisial TS diduga mencaplok tanah warga di Jln. Pasar I Desa Tanjung Selamat, Kec. Percut Seituan, Kab. Delisedang. Karena “pencaplokan” itu, HM Syarif, pemilik tanah mengadukan kasusnya ke Polresta Medan. Kepada Waspada, Selasa (12/2), HM Syarif mengatakan, tanah seluas 4.872 meter2 yang dicaplok TS merupakan tanah miliknya berdasarkan SK Bupati Deliserdang No. 120768/A/VI/ 11 tahun 1976. Juga berdasarkan surat keterangan kepemilikan tanah No. 140/654/TS/V/2011 ditandatangani Kepala Desa Tanjung Selamat, Herman. Tanah itu berada tepat di persimpangan Jln. Tengah. Warga setempat dikonfirmasi juga mengakui tanah itu milik HM Syarif, penduduk Jln. Pasar Melintang, Tanjung Selamat, Deliserdang. Namun kini tanah itu terpasang plang bertuliskan “Tanah Ini Milik Ir. Tagor Simangunsong, Anggota DPRD TK SU Partai PDIP”. “Bukan tanah saya saja yang “dicaplok”, tetapi tanah yang berada di sebelah tanah saya bernamaTris juga ikut dibentengi dengan batubata,” ujar Syarief. Dikatakannya, “pencaplokan” tanah dilakukan TS dengan memasang tembok di tanah itu setinggi sekira 30 cm. Padahal, selama ini tanah tersebut dijaga dan ditanami jagung oleh warga setempat yang dipercayai Syarief. Pembentengan tanah, sebut dia, dilakukan akhir Januari 2013 oleh dua suruhanTS, berinisialKdanSy.“Sayadapatinformasi itu dari kepala dusun,” tuturnya. Sementara Kepala Dusun V

Desa Tanjung Selamat Julfan ditemui wartawan, kemarin, mengatakan tanah itu milik Syarief. “Bahkan PBB tanah itu saya yang mengantar setiap tahun kepada Pak Syarief,” katanya. Menurut dia, mengetahui tanah itu ditembok dari warganya, kemudian memberitahukannya kepada Syarief. “Memang saya yang memberitahukan kepada Pak Syarief melalui telefon,” ujarnya. Kata Julfan, terkait “pencaplokan” itu, sebelumnya Herman selaku Kepala Desa Tanjung Selamat sudah mempertanyakan kepada K, mengapa membentengi tanah itu dan apa dasarnya. “Tetapi K mengatakan, kalau mau melihat suratnya datang saja ke kantor menemui Pak Tagor,” tuturnya. Padahal sebelumnya, kepala desa sudah menghubungi K untuk mengundang kedua pihak ke kantor Kades agar Ta-

gor dan Syarief dapat menunjukan surat hak kepemilikan atas tanah itu agar tidak terjadi sengketa yang berkelanjutan. “Namun K tidak datang memperlihatkan surat kepemilikannya,” sebut Julfan. Syarief menyesalkan pemagaran tanahnya dengan mendirikan plang kepemilikan itu. “Apa memang begini para wakil rakyat, seenaknya memasang plang di atas tanah milik orang lain,” ujarnya sembari mengatakan telah melaporkan kasus itu ke Polresta Medan dengan bukti lapor No. STTPL/257/I/ 2013/Resta Medan. Tagor Simangunsong dikonfirmasi Waspada belum berhasil. Dihubungi via telefon seluler tidak aktif. Namun anggota DPRDSU Fraksi PDIP Syamsul Hilal ditanya Waspada mengakui Tagor Simangunsong anggota dewan dari Fraksi PDIP. “Ya, beliau dari PDIP,” katanya.(m27)

Waspada/gito ap

PLANG atasnama anggota DPRDSU terpasang di lahan seluas 4.874 meter2 di Jln.Pasar I Desa Tanjung Selamat,Kec. Percut Seituan. Akibat pemasangan plang itu, pemilik tanah HM Syarif melaporkan kasus tersebut ke Polresta Medan.

Medan Metropolitan Panglima Geng Kereta Canabis Terancam Lima Tahun Penjara A6

MEDAN (Waspada): Setelah sekian lama DPO petugas kepolisian, terdakwa Donal Ricardo Tampubolon, 23, selaku Panglima Geng Kereta Canabis (Cara Anak Nekat Bikin Asik) dan Skandal Anak Medan (SKM), dibekuk saat tengah mengikuti pelantikan Satuan Mahasiswa salah satu OKP, pada Oktober 2012 silam. Terdakwa dijerat Pasal 140 Jo 460 KUHPidana dengan ancaman penjara minimal 5 tahun. Bahkan, pada persidangan lanjutan yang digelar di ruang Cakra V Pengadilan Negeri (PN) Medan, Selasa (12/2), majelis hakim ketua Sherliwaty menegur terdakwa, lantaran nama-

nya kerap disebut-sebut sejumlah anggota genk kereta pada setiap persidangan. “Berarti kamu yang namanya Donal Ricardo. Selama ini setiap persidangan kasus genk

Jadwal Penerbangan Di Bandara Polonia No. Penerbangan Ke Flight


Tiba Dari


GARUDA INDONESIA 1 Jakarta GA-181 2 Jakarta GA-183 3 Jakarta GA-185 4 Jakarta GA-187 5 Jakarta GA-189 6 Jakarta GA-191 7 Jakarta GA-193 8 Jakarta GA-147 9 Jakarta GA-195 10 Banda Aceh GA-142 11 Banda Aceh GA-14.6

05.20 08.45 10.30 11.55 14.10 15.55 17.55 18.45 19.55 09.45 14.50

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Banda Aceh Banda Aceh

GA-180 GA-182 GA-184 GA-186 GA-146 GA-188 GA-190 GA-192 GA-196 GA-143 GA-147

08.00 09.45 11.10 13.20 14.20 15.10 17.10 19.10 22.00 12.25 17.55

CITILINK 1 Jakarta 2 Jakarta 3 Jakarta 4 Batam 5 Batam

8.40 18.50 20.05 10.00 14.20

Jakarta Jakarta Jakarta Batam Batam

QG-830 QG-832 QG-834 QG -881 QG-883

08.05 09.05 09.35 13.15 17.55

QG-831 QG-833 QG-835 QG-880 QG-882


AIR ASIA 1 Kuala Lumpur QZ-8050 06.05 2 Kuala Lumpur QZ- 8054 11.20 3 Kuala Lumpur AK- 1351 08.00 4 Kuala Lumpur AK-1355 17.25 5 Penang QZ-8072 10.40 6 Penang AK-5837 18.30 7 Kuala Lumpur AK-1357 21.25 8 Baangkook QZ-8084 17.00 9 Bandung QZ-7987 08.25 10 Surabaya QZ-7611 11.35 11 Bandung QZ-7981 17.10 12 Banda Aceh QZ-8022 11.00 13 Pekanbaru QZ-8028 07.00 Selasa, Kamis, Sabtu

Kuala Lumpur QZ-8051 Kuala Lumpur QZ-8055 Kuala Lumpur AK-1350 Kuala Lumpur AK-1354 Penang QZ-8073 Penang AK-5836 Kuala Lumpur AK-1356 Bangkok (2,4,6) QZ-8085 Bandung QZ-7986 Surabaya QZ-7610 Bandung QZ-7980 Banda Aceh QZ-8023 Pekanbaru QZ-8029 Selasa, Kamis, Sabtu

08.30 10.55 07.35 17.00 16.30 18.15 21.05 29.55 05.35 11.10 19.55 13.20 10.30

LION AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Jakarta 5 Jakarta 6 Jakarta 7 Jakarta 8. Jakarta 9 Jakarta 10 Jakarta 11 Jakarta 12 Jakarta 13 Jakarta 14 Penang 15 Penang 16 Jakarta 17 Jakarta 18 Jakarta 19 Jakarta 20 Jakarta 21 Surabaya 22 Surabaya 23 Banda Aceh 24 Jakarta

JT- 211 JT- 381 JT- 397 JT- 207 JT- 301 JT- 395 JT- 303 JT- 215 JT-201 JT- 387 JT-399 JT-383 JT-385 JT-1282 JT-1288 JT-205 JT-203 JT-219 JT-309 JT-209 JT-0970 JT-972 JT-396 JT-305

0545 06.45 07.50 08.40 10.00 11.00 11.50 12.25 12.50 13.50 15.20 15.50 17.00 08.05 13.35 2010 18.00 20.40 19.10 21.00 07.00 12.55 12.15 18.30

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Penang Penang Jakarta Jakarta Jakarta Jakarta Jakarta Surabaya Surabaya Banda Aceh Jakarta

JT-380 JT-300 JT-394 JT-302 JT-214 JT-200 JT-204 JT-398 JT-382 JT-384 JT-202 JT-212 JT-396 JT-1283 JT-1289 JT-206 JT-208 JT-386 JT-308 JT-218 JT-971 JT-973 JT-397 JT-210

08.20 09.20 10.20 11.10 11.40 12.10 13.10 14.40 15.10 16.20 17.20 17.50 19.45 10.25 15.55 9.20 18.25. 21.05 22.20 23.20 12.15 16.00 07.05 07.20

MALAYSIA 1 Kuala Lumpur 2 Kuala Lumpur

MH-861 MH-865

09.40 15.45

Kuala Lumpur Kuala Lumpur

MH-860 MH-864

08.50 15.00

SILK AIR 1 Singapura 2 Singapura

MI-233 MI-237

08.40 20.35

Singapura Singapura

MI-232 MI-238

07.50 19.50

VALUAIR 1 Singapura (2.4,7) VF-282 2 Singapura (1,3,6) VF-284

11.45 17.55

Singapura (2.4.7) VF-281 Singapura (1,3,6) VF-283

11.05 17.15

SRIWIJAYA AIR 1 Jakarta 2 Jakarta 3 Batam 4 Pekanbaru 5 Pekanbaru 6 Banda Aceh 7 Penang 8 Padang

SJ-015 SJ-011 SJ-035 SJ-043 SJ-041 SJ-010 SJ-102 SJ-021

13.25 15.55 16.50 10.20 17.20 12.50 07.20 16.00

Jakarta Jakarta Batam Pekanbaru Pekanbaru Banda Aceh Penang Padang

SJ-010 SJ-016 SJ-034 SJ-042 SJ-040 SJ-011 SJ-103 SJ-020

11.00 16.20 14.55 11.50 15.45 14.20 09.50 14.10

FIRE FLY 1 Subang 2 Penang 3. Penang

FY -3413 FY- 3403 FY- 3407

14.35 10.55 18.20

Subang Penang Penang

FY-3412 FY-3402 FY-3406

14.05 10.35 17.55

07.30 11.45 18.50

Singapura Jakarta Jakarta

RI-862 RI-093 RI-097

08.00 12.00 19.30

MANDALA AIRLINE 1 Jakarta RI-092 2 Singapura RI-861 3. Jakarta RI-096

Jadwal Perjalanan Kereta Api No KA

Nama KA

U.2 Sri Bilah U.4 Sri Bilah U.6 Sri Bilah U.8 Sri Bilah U.1 Sri Bilah U.3 Sri Bilah U.5 Sri Bilah U.7 Sri Bilah U.10 Sri Bilah U.12 Sri Bilah U.9 Sri Bilah U.11 Sri Bilah U.14 Putri Deli U.16 Putri Deli U.18 Putri Deli U.13 Putri Deli U.15 Putri Deli U.17 Putri Deli U.22 Siantar Ekspres U.21 Siantar Ekspres PLB 7000 Sri Lelawangsa PLB 7002 Sri Lelawangsa PLB 7004 Sri Lelawangsa PLB 7008 Sri Lelawangsa PLB 7010 Sri Lelawangsa PLB 7012 Sri Lelawangsa PLB 7001 Sri Lelawangsa PLB 7003 Sri Lelawangsa PLB 700 Sri Lelawangsa PLB 7009 Sri Lelawangsa PLB 7011 Sri Lelawangsa PLB 7012 Sri Lelawangsa


Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Bisnis Bisnis Bisnis Bisnis Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi



Berangkat Datang

Medan Medan Medan Medan Rantau Prapat Rantau Prapat Rantau Prapat Rantau Prapat Medan Medan Binjai Binjai Medan Medan Medan Tanjung Balai Tanjung Balai Tanjung Balai Medan Siantar Medan Medan Medan Medan Medan Medan Tebing Tinggi Binjai Binjai Binjai Binjai Binjai

Rantau Prapat Rantau Prapat Rantau Prapat Rantau Prapat Medan Medan Medan Medan Binjai Binjai Medan Medan Tanjung Balai Tanjung Balai Tanjung Balai Medan Medan Medan Siantar Medan Tebing Tinggi Binjai Binjai Binjai Binjai Binjai Medan Medan Medan Medan Medan Medan

08.00 10.30 15.00 22.50 08.05 14.35 16.55 23.25 04.50 20.15 09.20 21.40 06.50 12.50 17.10 07.15 11.55 19.25 11.25 07.00 18.00 07.30 05.00 09.50 12.15 14.40 05.20 08.55 06.30 11.00 13.30 15.50

13.16 15.31 20.18 03.34 13.12 19.49 21.50 04.21 05.42 21.07 10.12 22.32 11.17 17.27 22.15 11.54 16.28 22.47 14.50 10.45 20.04 08.22 05.52 10.42 13.07 15.32 07.22 09.47 07.22 11.52 14.22 16.42


kereta, nama kamu selalu disebut-sebut anggota mu itu. Tapi kamu enggak pernah ketangkap, dan sekarang kami baru tahu kalau kamu selama ini pimpinan genk kereta,” kata hakim Sherliwaty dengan nada tinggi. Dalam persidangan lanjutan dengan agenda mendengarkan keterangan saksi verbal lisan, masing-masing Aiptu M Subakir dan Aiptu Hasyim Sahbana, yang merupakan petugas penyidik di Polsek Medan Baru menerangkan, terdakwa Ricardo kerap melakukan pengrusakan, dan terakhir kali ditangkap karena merusak mobil di Jalan Hangtuah. “Jadi bu hakim, dia (Ricardo) ini telah berulangkali melakukan pengrusakan. Ada beberapa mobil yang dirusaknya di tempat berbeda. Pertama mobil Alvard, mobil Jazz lalu merampok kereta,” kata saksi M Subakir.

Kata saksi, karena ada tiga laporan berbeda soal pengrusakan, petugas Polsek Medan Baru kemudian membentuk tim khusus untuk menangkap dalang pelaku yang belakangan diketahui bernama Ricardo. “Dari saksi-saksi yang kami periksa, yang juga anggota nya (Ricardo) masing-masing Beni Purba dan Ilham menerangkan bahwa pimpinan mereka itu adalah dia (Ricardo). Lalu kami membentuk tim khusus untuk menangkapnya,” ujar kedua saksi. Namun, pada saat dimintai tanggapannya soal keterangan para saksi, terdakwa Ricardo yang dikenal merupakan dalang pelaku pengrusakan mobil, sepedamotor, bahkan kerap disebut melakukan perampokan dengan cara kekerasan, membantah keterangan para saksi. “Tidak benar bu hakim. Saya juga sempat diancam sama

petugas yang namanya Pak Sitanggang,” kata terdakwa. Mendengar pernyataan terdakwa, majelis hakim kemudian tak langsung mempercayai ucapan terdakwa yang merupakan anak oknum polisi bertugas di Binjai. “Kamu yang benar. Di BAP ini kan keterangan kamu. Apalagi nama mu sering disebut-sebut anggota genk kereta yang bersidang di sini (PN Medan),” tutur hakim Sherliwaty. Mendengar ucapan hakim, terdakwa diam dan tak banyak berkomentar. Usai mendengarkan keterangan saksi, majelis hakim kemudian menunda sidang hingga pekan depan dengan agenda saksi meringankan (Adhecarge). Dalam kasus ini, Jaksa Penuntut Umum ( JPU) Oky Yudhatama menjerat terdakwa atas Pasal 140 Jo 460 KUHPidana dengan ancaman penjara minimal 5 tahun. (m38)


KH ZULFIQAR Hajar Lc (berlobe putih) didampingi HM Nasir Lc, MA (tengah) foto bersama jamaah umroh di depan Terminal Keberangkatan Internasional Bandara Polonia Medan.

Zulfiqar Hajar Pimpin Jamaah Umroh Gadika MEDAN (Waspada): Pimpinan Majlis Ta’lim/KBIH Jabal Noor Medan Al-Ustadz KH Zulfiqar Hajar Lc memimpin rombongan 44 jamaah umroh dari PT Gadika Expressindo Tours & Travel Medan yang berangkat melalui Terminal Keberangkatan Internasional Bandara Polonia, Senin (11/2) malam. Pemberangkatan jamaah umroh langsung dilakukan Direktur PT Gadika Expressindo Tours & Travel HM Nasir Lc, MA, dihadiri Ir H Erwin Afrizal dan H Bimo Sukarno. Menurut KH Zulfiqar Hajar,

perjalanan umroh tersebut selama 10 hari pergi-pulang dengan rute Medan-Singapura-JeddahMadinah dan Makkah. Sementara itu, Direktur PT GadikaExpressindoTours&Travel HM Nasir Lc, MA mengatakan, selamaenamgelombangpemberangkatan jamaah umroh yang dilaksanakanpihaknyasejakakhir Januari hingga sekarang berjalan lancar, meskipun dalam gelombang keenam ini sempat terjadi sedikit masalah tentang visa lima jamaah, namun semuanya berjalan lancar tanpa kendala. “Setiap gelombang kita be-

rangkatkan jamaah 40-50 orang untuk perjalanan 10 hari. Untuk paket awal maupun full Ramadhan tahun ini sudah ada calon jamaah umroh yang mendaftar, termasuk ada beberapa orang yang mendaftar untuk haji plus,” ujarnya. Kata Nasir, masih banyak masyarakat yang belum mengetahui keberadaan biro perjalanan haji dan umroh yang dikelolanya. Padahal, dalam setiap program umroh biayanya dapat dijangkau masyarakat dan setiap gelombang ada pembimbing yang berpengalaman. (cwan)

PDIP Gelar Psikotes Bagi Balon Legislatif MEDAN (Waspada): DPD PDI Perjuangan Sumatera Utara menggelar psikotes bagi bakal calon legislatif untuk DPRD kabupaten/kota dan provinsi. Sementara untuk bakal calon legislatif tingkat DPR RI sudah dilakukan pada gelombang pertama 6-7 Januari 2013. Wakil Sekretaris Bidang Internal DPD PDI Perjuangan Sumatera Utara Ir. Soetarto, MSi mengatakan, Selasa (12/2), untuk psikotes gelombang kedua digelar di Diklat Pekerjaan Umum, 11-12 Februari. “Diklat diikuti 775 peserta dari struktur partai, Anggota Fraksi PDI Perjuangan, departemen partai, badan partai, sayap partai, kader partai yang belum ikut pada gelombang pertama dan juga tokoh-tokoh masyarakat yang direkomendasikan DPC PDI-Perjuangan,” ungkapnya. Soetarto mengatakan, psikotes merupakan kebijakan dari DPP PDI Perjuangan untuk pemilihan legislatif 2014. Tujuannya, menghasilkan anggota legislatif yang memiliki kapasitas,

integritas dan ideologi yang jelas sehingga mampu menghadapi persoalan di masyarakat. “Di masa yang akan datang, persoalan di masyarakat jauh lebih kompleks dari yang kita hadapi saat ini. Karena itu, dibutuhkan anggota legislatif yang memiliki kapasitas, integritas dan ideologi yang jelas sehingga mampu menangani persoalan di masyarakat,” ujar Soetarto. Soetarto didampingi Bendahara DPD PDI Perjuangan Meinarty Bangun mengatakan, psikotes ini merupakan kebijakan secara menyeluruh di Indonesia. Hasil psikotes ini hanya diketahui Ketua Umum DPP PDI Perjuangan dan Ketua DPD PDI Perjuangan di provinsi masing-masing. “Hasil psikotes ini sepenuhnya dijamin aman, karena hanya diketahui Ketua Umum DPP PDI Perjuangan ibu Mega dan ketua DPD masing-masing. Psikotes ini belum menjamin pesertanya masuk dalam daftar calon sementara,“ tegas Soetarto. Wakil Ketua DPD PDI Perjuangan Sumatera Utara Ruben

Tarigan menambahkan, selain memiliki kapasitas, integritas dan ideologi yang jelas, para bakal calon anggota legislatif ini juga mendapat tugas dari partai untuk mensosialisasikan pasangan calon yang diusung partai di daerah masing-masing. Jadi, pada saat pulang ke daerah, para peserta psikotes dibekali alat peraga. “Para peserta psikotes ini akan kita berikan tugas mensosialisasikan pasangan calon gubernur-wakil gubernur di daerah masing-masing. Ini juga jadi cara mereka mensosialisasikan diri mereka sendiri,” tambah Ruben Tarigan yang juga Ketua Tim Kampanye Effendi MS Simbolon-Jumiran Abdi. PDI Perjuangan masih menjadi satu-satunya partai yang menggelar psikotes bagi bakal calon legislatif untuk pemilu 2014. Hadir Sekretaris DPD PDI Perjuangan M.Affan, Wakil Sekretaris Akhyar Nasution, Anggota DPRDSU dari Fraksi PDI Perjuangan Analisman Zalukhu dan Alamsyah Hamdani.(m49)

Polisi Periksa Dirut PD Pasar Kasus Pembongkaran Kios MEDAN (Waspada): Polresta Medan melakukan pemeriksaan selama 5 jam terhadap Direktur Utama (Dirut) PD Pasar Benny Sihotang dalam kasus pembongkaran kios di Pusat Pasar Medan, Senin (11/2) siang. Saat menjalani pemeriksaan sebagai saksi, Dirut didampingi kuasa hukumnya. Orang nomor satu di PD Pasar ini juga didampingi sejumlah pegawai PD Pasar yang datang ke Polresta Medan. Mengenakan kemeja lengan tangan panjang berwarna hijau, Benny Sihotang langsung masuk kedalam ruang penyidik dan hampir 5 jam lamanya menjalani pemeriksaan di Unit Jahtanras Polresta Medan. “Saya datang untuk memenuhi panggilan sebagai saksi dalam kasus tuduhan pembongkaran kios. Hampir 5 jam

saya dimintai keterangan,” ujar Benny Sihotang ketika ditanya wartawan. Ketika disinggung tentang pembongkaran kios, Dirut PD Pasar ini dengan tegas menyatakan kalau pembokaran itu telah sesuai dengan peraturan yakni Perda No 31 Tahun 1993 tentang Pemakaian Tempat Berjualan. ”Itu sangat jelas tertulis didalam Pasal 3 yang berbunyi stand, kios atau bangunan milik Pemda yang berada didalam kompleks pasar milik Pemda digusur, ditertibkan, dibongkar guna peremajaan pasar/kota. Penertiban lainya tidak akan diberikan ganti rugi dalam bentuk apapun kepada penyewa dengan ketentuan penyewa diberikan prioritas untuk memperoleh tempat berjualan dilokasi atau tempat yang direma-

jakan atau tempat lain yang ditunjuk oleh Pemda,” sebutnya. Sebelumnya kios yang dihuni oleh Elfrida Eka Susanti, 37, warga Jln. Mas, Medan Area, di Pasar Petisah dibongkar dan dirusak secara paksa oleh pegawai PD Pasar Kota Medan pada Rabu (22/12). Dirut PD Pasar Kota Medan Benny Sihotang dilaporkan Elfrida Eka Susanti dengan laporan pengaduan pengrusakan ke Mapolresta Medan. Kanit Jahtanras Polresta Medan AKP Anthoni Simamora menyebutkan, Dirut PD Pasar masih diperiksa sebagai saksi atas pengaduan penghuni kios di Pasar Petisah. “Kita mintai keterangan dan statusnya masih sebagai saksi atas pengaduan korban yang kiosnya dibongkar secara paksa. Masih kita selidiki dulu lah,” katanya.(m39)

WASPADA Rabu 13 Februari 2013

Waspada/Mursal AI

SEKDA Sumut Nurdin Lubis (kiri) saat melantik Pengurus Ikatan Penyuluh Keluarga Berencana (IpeKB) Sumut di Medan, Selasa (12/2).

800 Ribu PUS Di Sumut Belum Ber KB IPeKB Sumut Dilantik MEDAN (Waspada): Badan Kependudukan dan Keluarga Berencana Nasional (BkkbN) perwakilan Sumut memprediksi ada sekitar 800 ribu pasang usia subur (PUS) yang belum ber KB. Dari 800 ribu itu, 300 ribu di antaranya kelompok wanita hamil atau pasangan ingin punya anak. “Jadi target kita 500 ribu lagi. Namun dari jumlah itu, 48 ribu di antaranya berada di wilayah terpencil yang harus dilakukan gerakan khusus. Seperti di Nias Selatan, ada 7 kecamatan yang sulit dijangkau, harus menggunakan kapal tertentu untuk menuju ke sana,” kata Kepala Perwakilan BkkbN Sumut Drg. Widwiono, MKes usai membuka Rakerda Pembangunan Kependudukan dan Keluarga Berencana Sumut, Selasa (12/2). Widwiono berharap Rakerda ini dapat membangun komitmen yang kuat, semangat dan upaya sungguh-sungguh dengan menetapkan strategi operasional lebih fokus. “Kemudian dengan memanfaatkan potensi dan dukungan sumber daya yang ada, Insya Allah sasaran tersebut dapat kita capai,” ungkapnya. Lantik IPeKB Sumut Pada Rakerda itu, Sekda Sumut Nurdin Lubis melantik pengurus Ikatan Penyuluh Keluarga

Berencana (IPeKB) dengan ketua terpilih Anthony, S.Sos. Sekda Provsu Nurdin Lubis menerangkan tentang pentingnya sosialisasi secara terus menerus kepada masyarakat agar dapat memahami tujuan program pembangunan kependudukan dan keluarga berencana sehingga berdampak terhadap indeks pembangunan manusia (IPM) Indonesia. “Sosialisasi dan advokasi dilakukan dengan mempopulerkan penggunaan kontrasepsi modern dan membangkitkan kesadaran masyarakat guna tercegahnya kehamilan tidak diinginkan bagi keluarga yang tidak ingin punya anak lagi, atau menunda kelahiran berikutnya,” ucapnya seraya memberikan selamat kepada pengurus IPeKB Sumut periode 2013-2017. Sementara itu, Ketua IPeKB Sumut Anthony, S.Sos mengatakan, jabatan ini adalah sebuah tanggungjawab yang harus dijalani. “Siapapun yang menjabat tidak jadi soal, karena jabatan itu merupakan sebuah tanggungjawab. Dengan terpilihnya saya sebagai ketua, saya siap menjalankan tugas itu dengan sebaik-baiknya,” demikian Anthony. (h02)

Jangan Kaitkan Masalah Luthfi Dengan Pencalonan Gatot MEDAN ( Waspada): Relawan Ash Shaf pasangan GanTeng sudah teruji keterampilannya meminta lawan politik pasangan Gatot dan dalam memimpin daerah masing-masing. Saat Tengku Erry (GanTeng) tidak mengaitkan ini, Gatot Pujo Nugroho merupakan Plt Gubernur persoalan mantan Presiden PKS Luthfi Hasan Sumatera Utara dan Tengku Erry Nuradi adalah Bupati Serdang Bedagai yang merupakan salah Ishaaq dengan Gatot Pujo Nugroho. “Gatot itu bukan milik PKS semata, tapi milik satu kabupaten pemekaran terbaik di Indonesia. Bendahara Relawan Ash Shaf Khairuddin umat, rakyat Sumut, relawan maupun partai lain yang mengusungnya. Jadi, jangan melaku- Syah menambahkan, saat ini relawan pendukung kan kampanye hitam ke masyarakat, itu sama GanTeng sudah terbentuk di Hamparan Perak, sekali tidak ada hubungannya,” kata Sekretaris Medan Belawan, Medan Labuhan dan Medan Relawan Ash Shaf Akmal Samosir didampingi Deli. Mereka menyatakan siap memenangkan Ketua Relawan Ash Shaf Ustadz M. Nasir Karim, pasangan GanTeng. “Penasehat relawan GanTeng LC, MA, Wakil Sekretaris Syamsul Akmal Hamar, ini adalah mantan Wali Kota Medan Bachtiar Wakil Ketua H. Haidil A Hadi, Edi Zuhrawardi Jaffar,” demikian Khairuddin. (h02) Pane, Bendahara Khairuddin Syah, Wakil Bendahara Rahman Rais kepada wartawan di Medan, Selasa (12/2). Kata dia, relawan Ash Shaf siap menghempang kampanye hitam yang tidak mendidik tersebut. Saat ini, dukungan dan pernyataan siap memenangkan pasangan GanTeng dari masyarakat terus mengalir. Sebab, masyarakat khususnya umat Islam tidak bisa dibohongi dengan isu-isu yang menyesatkan. “Masyarakat sudah pintar dan bisa memilih mana yang baik dan benar,” tegasnya semWaspada/Ist bari mengatakan, relawan Ash Shaf sudah mengunjungi 18 SEKRETARIS relawan Ash Shaf Akmal Samosir SAg (kanan) kabupaten/kota di Sumut untuk didampingi Wakil Ketua Edi Zuhrawardi Pane mensosialisasikan pasangan GanTeng kepada masyarakat saat melakukan kunjungan mensosialisasikan GanTeng. A k m a l m e n j e l a s k a n , ke 18 daerah di Sumut, baru-baru ini.

Aset Bank Sumut Syariah Rp1,8 T 12 Nasabah Dapat Hadiah Umroh MEDAN (Waspada): Pertumbuhan aset perbankan syariah pada 2013 diperkirakan berada di kisaran 36-58%. Selaras dengan pertumbuhan itu, aset unit usaha syariah Bank Sumut juga mengalami pertumbuhan 38%. Pimpinan Divisi Usaha Syariah Bank Sumut Didi Duharsa SH, Mhum, mewakili Direksi Bank Sumut menyebutkan, tahun 2011 aset unit Syariah Bank Sumut tercatat Rp1,3 triliun, pada 2012 tumbuh 38% menjadi Rp1,8 triliun. Demikian pula dengan pertumbuhan Dana Pihak Ketiga (DPK) yang juga meningkat dari Rp667 miliar pada 2011 menjadi Rp902 miliar pada 2012 atau tumbuh 35%. “Meningkatnya DPK tersebut diikuti dengan peningkatan penyaluran pembiayaan sebesar Rp1,5 triliun atau meningkat 73% dibanding 2011,” ujarnya pada acara penarikan hadiah umroh ke Tanah Suci tabungan IB Martabe Wadiah dan Tabungan IB Martabe Bagi Hasil kepada 12 nasabah, Senin (11/2). Nasabah yang memperoleh paket umroh tersebut masing-masing delapan nasabah dari Cabang Medan, satu nasabah dari Cabang Multatuli, Jamin Ginting, Binjai, dan Stabat.

Didi Duharsa mengatakan, jika dilihat dalam share perbankan syariah terhadap konvensional yang dicanangkan Bank Indonesia sebesar 5%, share Bank Sumut unit usaha syariah terhadap Bank Sumut telah mencapai 10,13%. “Angka ini di atas yang dicanangkan oleh BI,” sebutnya. Dengan meningkatnya aset, DPK dan share yang melampui ketetapan dari BI, ujarnya, mencerminkan meningkatnya kepercayaan dan minat masyarakat melakukan transaksi di Bank Sumut Syariah. Bank Sumut unit usaha syariah juga menawarkan berbagai produk yang merupakan salah satu layanan syariah yang dibutuhkan masyarakat. “Salah satu produk yang paling diminati masyarakat adalah tabungan IB Martabe Bagi Hasil dan Tabungan IB Martabe,” tuturnya. Sebagai bentuk apresiasi terhadap nasabah, kata Didi, pihaknya kembali melakukan penarikan hadiah tabungan IB Martabe Bagi Hasil dan Tabungan IB Martabe priode 2012 berupa 24 paket hadiah umroh ke tanah suci. “Rinciannya 12 untuk Medan, 6 untuk Tebingtinggi dan Pematang Siantar, 6 untuk Padangsidempuan dan Sibolga,” katanya.(m28 )

Waspada/Amir Syarifuddin

PIMPINAN Divisi Usaha Syariah Bank Sumut Didi Duharsa SH, MHum, mewakili Direksi Bank Sumut menyerahkan hadiah undian umroh kepada pimpinan cabang untuk dilanjutkan kepada nasabah pemenang, usai penarikan undian di Bank Sumut Syariah Capem Marelan, Senin (11/2).

A7 Pentas Pilkada Nelayan Batubara Dukung ESJA

WASPADA Rabu 13 Februari 2013

‘’Kami Tahu Effendi Simbolon Bersih Dan Berani’’ MEDAN (Waspada) Kabar Effendi Simbolon adalah figur yang berani dan terutama bersih, ternyata bukan hanya diketahui kalangan kota yang akrab dengan media, namun juga sampai ke tingkat nelayan di daerah Batubara.

Waspada/M.Ferdinan Sembiring

CAWAGUBSU Jumiran Abdi bercengkrama dengan panitia bakti sosial pembagian paket Imlek di Sekretariat Lembaga Sahabat Center Medan di Jalan Iskandar Muda Baru Medan,baru-baru ini.

Pasangan ESJA Berbagi Dengan Etnis Tionghoa MEDAN ( Waspada): Pasangan cagubcawagub Sumut Drs Effendi Muara Sakti Simbolon-Drs H Jumiran Abdi mengucapkan Selamat Tahun Baru Imlek 2564 dan mengharapkan keberkatan dan keberuntungan bagi etnis Tionghoa di seluruh Provinsi Sumut. “Gong Xi Fa Cai buat semuanya, semoga tahun baru Imlek pada 10 Februari mendatang, membawa keberkatan, kesejahteraan dan keberuntungan bagi saudara-saudara kita yang merayakannya,” ucap cawagub Jumiran Abdi saat memberikan bantuan paket Imlek bagi etnis Tionghoa dari keluarga kurang mampu melalui Sekretariat Lembaga Sahabat Center Medan di Jalan Iskandar Muda Baru Medan,baru-baru ini. Cawagub nomor 2 usungan PDI-Perjuangan,PDS dan PPRN ini menuturkan perayaan Imlek, dari tahun ke tahun makin terasa bermakna sebagai sebuah momen perayaan keagamaan bagi etnis Tionghoa. Tidak seperti di era Orde Baru, di mana aktivitas keagamaan etnis Tionghoa terasa dimarjinalkan. “Kebebasan itu sudah dirasakan dan dirayakan oleh saudara kita etnis Tionghoa sejak puluhan tahun yang lalu, tak perlu lagi ada rasa sungkan terlebih rasa takut tatkala hendak merayakan Imlek. Bahkan di masa Presiden Megawati Soekarnoputri, Imlek ditetapkan sebagai hari libur nasional,”sebut Jumiran Abdi yang didampingi aktivis sosial Lembaga Sahabat Center Medan Lie-Lie Kho. Menurutnya, kebersamaan antara etnis Tionghoa di Provinsi Sumut dengan berbagai

etnis lainnya , telah menjadi kesadaran bersama untuk saling menghormati dan menerima perbedaaan yang ada. “Imlek telah menjadi pesta rakyat di seluruh pelosok Indonesia khususnya provinsi Sumut . Ini menunjukkan bahwa bangsa kita, benar-benar menjunjung tinggi nilai-nilai kebersamaan, meneguhkan semangat Bhineka Tunggal Ika, dan memberi ruang besar bagi etnis Tionghoa tanpa ada lagi sikap diskriminasi,” ujar JumiranAbdi. Terkait pencalonan dirinya bersama Cagubsu Effendi MS Simbolon, menurut Jumiran Abdi di Sumut masih banyak masyarakatnya hidup di bawah garis kemiskinan.Untuk itu, Effendi Simbolon sudah membuat program pembuatan akte kelahiran yang digratiskan bagi masyarakat kurangmampu yangdilakukandengansistemturun ke bawah mengawasi pembuatan akte kelahiran. “Jika kami terpilih pembuatan akte kelahiran digratiskan bagi warga kurang mampu.Etnis Tionghoa yang hidupnya kurang beruntung juga bisa menikmati program ini tanpa ada rasa diskriminasi lagi,” ucapnya. Di kesempatan itu Lie-Lie Kho berharap, melalui perayaan Imlek 2564 seluruh masyarakat etnis Tionghoa di Sumatera Utara ikut menyukseskan pesta demokrasi Pilgubsu dengan memilih pasangan Calon Gubernur dan Wakil Gubernur Sumatera Utara Effendi Simbolon/Jumiran Abdi yang bernomor 2 (dua). “Ini suatu angka yang menurut ramalan banyak orang merupakan angka pembawa rezeki maupun keberuntungan di tahun ular air ini,” ucapnya. (m49)

‘’Kami nelayan Batubara mendukung pasangan ESJA,’’ ujar tokoh masyarakat Batubara, Khaidir Basyrah didampingi Mulyadi saat datang menyampaikan dukungannya kepada pasangan ESJA, yang diterima tim pemenangan ESJA di Medan, kemarin. “Kami mengikuti seluruh perkembangan pemberitaan menyangkut seluruh calon, di mana hampir seluruhnya mendapat kritikan, termasuk juga Effendi Simbolon. Hanya saja menjadi catatan bagi kami, ternyata dari seluruh calon yang kena kritik, hanya Effendi Simbolon yang tidak pernah diberitakan negatif terkait masalah keuangan negara. Sedangkan yang lain, sebagaimana kita baca bersama, terlepas apakah itu benar atau tidak, selalu disangkut-sangkutkan dengan masalah-masalah penyelewenganuangnegara,”paparKhaidir.

Itulah, kata para pencari ikan tradisional tersebut, yang membuat mereka semakin yakin Effendi Simbolon adalah orang yang benar-benar bersih dari kasus-kasus terkait penyelewengan uang negara. “Yang diributkan orang-orang terkait beliau, hanyalah soal kesalahan menyebut teritorial dan lainnya, yang kalaupun itu benar, menurut kami, bukan hal penting bagi sebuah pemerintahan yang diharapkan harus bersih dan tegas, khususnya di Sumut, yang menurut pemberitaan termasuk daerah terkorup,” tegas Khaidir. Hal lain yang menjadi alasan kuat mereka mendukung ESJA adalah kekonsekuenan Effendi Simbolon dalam setiap kata maupun tindakan. “Jadi yang kami saksikan di televisi, bagaimana dia dengan berani dan tegas menolak setiap kebijakan yang menyusahkan masyarakat, tampak jelas saat kami bertemu dengan beliau. Saat dia mengutarakan keinginannya untuk mengubah paradigma pemerintahan di Sumut, dia terlihat sangat tegas. Tapi dia juga bisa langsung akrab saat berbicara dengan kami dan menampung semua keluhan dengan terbuka dan mencatat dalam agendanya. Dan apa yang sudah diucapkannya, saya sendiri

sudah melihat, itu juga yang dilaksanakannya,” sambung pengurus perkumpulan nelayan di Batubara ini. “Hal seperti itulah yang kita harapkan dan pasti juga diharapkan semua orang, bisa diterapkan di Sumut. Bagaimana Effendi Simbolon membela kepentingan masyarakat banyak di DPR RI, diharapkan dilakukannya juga di Sumut dengan Jumiran Abdi,” sambungnya. Dengan berbekal keyakinan, pasangan ESJA akan mau dan mampu membawa perubahan, maka pada kesempatan itu para perwakilan nelayan itu menyampaikan harapan, andai terpilih, supaya Effendi Simbolon lebih memperhatikan keberadan para nelayan, bukan hanya di Batubara, tapi juga di seluruh pesisir Sumut.“Kami nelayan ini adalah yang terpinggirkan selama ini di Sumut. Perhatian nyaris tidak ada. Melaut pun kami susah karena masalah BBM. Belum lagi soal harga ikan hasil tangkapan kami yang kadang tidak bisa menutup biaya operasi,” ungkap Khaidir. Khusus mengenai Jumiran Abdi, para nelayan itu mengaku memang sudah mengenal baik, karena kebetulan berasal juga dari Batubara. “Dan kami pikir, hasil pemeriksaan KPK kemarin

Relawan Amri RE Serahkan Material Bangunan LANGKAT (Waspada): Pasangan Cagub-Cawagubsu no urut 4 Haji Amri TambunanRustam Effendi Nainggolan MM memberi bantuan berupa bahan bangunan dan kebutuhan primer lainnya kepada kaum dhuafa di Teluk Aru, Kab Langkat. Bantuan diserahkan melalui tim relawan Amri RE Kab Langkatdi Pangkalanberandan, Langkat, Jumat (8/2). Koordinator tim relawan pemenangan Amri RE Kab. Langkat H. Idrus Salim mengatakan, bantuan tersebut merupakan satu bentuk kepedulian dan untuk mewujudkan visi misi

Amri RE yakni “Membangun dalam kebhinnekaan” dalam mensejahterakan rakyat Sumut. Dia menuturkan, bahan bangunan seperti semen, pasir, kayu, batubata, seng dan kebutuhan primer yakni seperti kasur, bantal dan kelambu guna merenovasi rumah mereka yang sudah tidak layak. “Penerima bantuan dari Desa Perlis, Pelawi Utara, Sei Bilah, Brandan Timur, Brandan Timur Baru, Desa Paluh Manis,” katanya. Idrus mengharapkan penerima bantuan mendoakan dan mendukung pasangan Amri RE menjadi Gubsu-Wagubsu .”Se-

moga bantuan yang diberikan dapat digunakan sebaik-baiknya dan bermanfaat,” harapnya. Penerima bantuan warga Desa Perlis Amiruddin merasa senang menerima bantuan dari Amri RE. “Saya merasa senang dan bangga apalagi saya orang yang tak punya dan sudah tak bisa bekerja. Terimakasih kepada Pak Amri RE,” katanya. Begitu juga Anum, warga Paluh Manis, berharap “Semoga Allah SWT membalas kebaikannya dan mendapat ridhonya untuk menjadi pemimpin yang arif dan baik,” harapnya.(c01)

yang mengungkapkan jumlah hartanya, sudah menunjukkan siapa Jumiran Abdi. Kalau dia orang yang tidak benar, saya kira

dengan pengabdiannya selama ini di birokrat, hartanya mungkin juga sudah bermiliar-miliar,” sebut Khaidir. (m49/m14)



WASPADA Rabu 13 Februari 2013

2,1 Juta Calhaj Daftar Tunggu

Waspada / Hasriwal AS

DIREKTUR Reserse Kriminal Umum Polda Metro Jaya Kombes Pol Tony Hermanto (tengah) didampingi Kasat Jatanras AKB Helmi Santika (kanan) dan Kabid Humas Kombes Pol Rikwanto (kiri), Selasa (12/2), memegang senjata laras panjang jenis F12 lengkap dengan magazen milik anggota Polri yang dirampok saat berjaga di SPN Batua Makassar, Sulawesi Selatan, oleh tersangka TMT (mantan TNI AD) beralamat di Perumahan Susun Kodam Makassar pada 5 Januari 2013. Selain membekuk dan menembak tersangka TMT, Serse Kriminal Umum juga menembak dua anggota TMT yang merupakan komplotan pelaku pencurian kenderaan bermotor, kedua tersangka yang ditembak itu satu orang tewas dan satu orang masih dirawat di RS Polri, Jakarta.

JAKARTA(Waspada): Hingga akhir tahun 2012, daftar tunggu (waiting list) jamaah calon haji (calhaj) Indonesia sudah mencapai 2,1 juta orang. Para calon haji tersebut harus menunggu gilirannya untuk beberapa tahun mendatang untuk melaksanakan rukun Islam ke lima. “Di provinsi Sulawesi Selatan masa tunggu calhaj mencapai 17 tahun. Jika umurnya panjang, mereka baru bisa berangkat tahun 2030. Sedang daftar tunggu yang terendah di provinsi Papua mencapai 5-6 tahun,” tegas Sekretaris Direktorat Jenderal Penyelenggaraan Haji dan Umrah (Set Ditjen PHU) Kementerian Agama, H. Cepi Supriatna. Cepi mengatakan hal itu saat mendampingi staf ahli Menteri Agama Abdul Fatah dan Kepala Biro Kepegawaian Kementerian Agama Mahsusi menerima anggota Dewan Pimpinan Daerah (DPD) RI asal Papua, Ferdinanda W. Ibo Yatipay dan anggota DPD Papua Barat Sofia Maipauw di kantor Kemenag, Jakarta, Senin (11/2). Menurut Cepi, banyak calon haji Indonesia yang akan menunaikan rukun Islam ke lima di tanah suci, akan ditentukan oleh pemerintah Arab Saudi, walaupun usulannya tetap dari pemerintah Indonesia yang dalam hal ini diwakili Kementerian Agama. “Tahun 2012, Indonesia mendapat kuota 211.000 orang, walaupun pemerintah Indonesia berharap dapat memperoleh tambahan kuota, namun tidak dipenuhi pemerintah Arab Saudi,” tutur Cepi. Pemerintah Arab Saudi bukan tidak mau memberi tambahan kuota, kata Cepi, tapi terbentur dengan kapasitas dan tempat, baik di kota Makkah, Arafah dan Mina yang hanya mampu menampung jamaah haji dari penjuru dunia sejumlah 2 juta orang. Sehingga masalah kuota telah diatur masing-masing negara sesuai ketetapan konferensi negara-negara OKI (Organisasi Konferensi Islam).(j06 )


Penetapan Daftar Terduga Teroris Dengan Syarat Ketat JAKARTA (Waspada): DPR RI akhirnya memberi persetujuan atas Rancangan Undang Undang tentang Pencegahan dan Pemberantasan Tindak Pidana Pendanaan Terorisme (RUU PPTPPT). Dalam rapat paripurna DPR yang berlangsung Selasa (12/ 1) di Gedung DPR Jakarta, juga mengatur penetapan Daftar Terduga Teroris atau Organisasi

Teroris. Penetapan ini dilakukan dengan rambu yang ketat sehingga seseorang atau organisasi tidak dapat dituduh begitu saja oleh aparat sebagai pendukung terorisme. “Penetapan Daftar Terduga Teroris atau Organisasi Teroris dengan syarat yang ketat sehingga tidak digunakan secara sewenang-wenang dan berdasarkan keputusan objektif. Selain

itu, perlu waktu yang limitatif terhadap penetapannya sehingga menjamin kepastian hukum hak-hak warga negara, keadilan dan efisiensi penegakan hukum,” kata Ketua Pansus RUU PPTPPT, Adang Daradjatun saat menyampaikan laporannya. Pimpinan sidang paripurna Priyo Budi Santoso berharap dengan persetujuan DPR atas UU PPTPPT ini kiranya dapat memperkuat kemampuan

negara dalam melindungi keamanan warga negara dari tindak pidana terorisme. “Hari ini negeri kita yang tercinta sudah mempunyai payung hukum yang cukup kokoh, yang dapat melindungi keamanan warga negara dari tindak pidana terorisme,” katanya. Sementara itu mewakili pemerintah, Menteri Hukum dan HAM Amir Syamsuddin menegaskan kehadiran UU me-

ngubah paradigma penanggulangan terorisme. “Kita memerlukan modernisasi pendekatan penanggulangan terorisme dari yang selama ini hanya berorientasi pada pelaku - follow the suspect menjadi berorientasi penelusuran aliran dana - follow the money agar kejahatan tersebut dapat segera terlacak dan ditanggulangi,” ujar Amir Syamsudin .(aya)

Wapres: SDM Motor Penggerak Kemajuan Bangsa Kurikulum 2013 Jangan Sampai Molor TANGERANG SELATAN (Waspada): Suatu bangsa akan mencapai kemajuan apabila generasi yang menggantikan lebih baik dari generasi yang diganti. Dalil sederhana tersebut adalah esensi dari pentingnya dunia pendidikan dalam satu negara. Demikian disampaikan Wakil Presiden Boediono pada pembukaan Rembuk Nasional Pendidikan dan Kebudayaan (RNPK) 2013 di Pusat Penge-

mbangan Tenaga Kependidikan (Puspangtendik), Bojongsari, Depok, Jawa Barat, Senin (11/2). RNPK yang diselenggarakan mulai 10 sampai 13 Februari 2013 ini mengangkat tema ‘Menuntaskan Program Prioritas Pendidikan dan KebudayaanTahun 2013-2014’. Kegiatan tahunan tersebut dihadiri Menteri Pendayagunaan Aparatur Negara dan Reformasi Birokrasi, Azwar Abubakar, Plh

Gubernur Jawa Barat, Atase pendidikan negara sahabat, Rektor Pendidikan Tinggi Negeri seluruh Indonesia serta kepala dinas pendidikan provinsi dan kabupaten/kota seluruh Indonesia. Wapres menekankan pentingnya meningkatkan kualitas sumber daya manusia (SDM) dibandingkan sekedar memanfaatkan sumber daya alam (SDA) yang ada. Indonesia, katanya, dikaruniai SDA yang

Anggota Komisi VI DPR RI Desak Pemerintah Selesaikan Jalan Cot Panglima BIREUEN (Waspada):Wakil Ketua Tim Pemantau Pemerintahan Aceh dan Papua DPR RI H Marzuki Daud, mendesak Pemerintahan Aceh untuk menyelesaikan masalah jalan Bireuen-Takengen di kawasan Cot Panglima, Kec. Juli, Bireuen, yang telah dikerjakan kontraktor beberapa waktu lalu, sesuai dengan ketentuan dan peraturan yang berlaku. Sehingga masalah tersebut tidak berlarut-larut dan tidak ada pihak yang dirugikan, setelah pekerjaan selesai dikerjakan. “Saya lihat masalah pembayaran pekerjaan pembangunan jalan kawasan Cot Panglima sudah berlarut-larut, sedangkan pekerjaannnya sudah lama rampung, masalah beda pendapat tentang volume pekerjaannya, silahkan dicek ulang atau diukur kembali, supaya jelas, masalah ini jangan dibawa ke ranah politik-lah,” katanya saat meninjau jalan Cot Panglima, Kecamatan Juli, Bireuen, Minggu (10/2). Didampingi, Wakil Ketua DPRA, H Sulaiman Abda dan Presiden Direktur Direktur PT Cipta Karya, H Saifannnur, Marzuki memuji sikap kontraktor telah berniat baik bekerja dan menyelesaikan pekerjaannnya Surat Perintah Kerja (SPK), yaitu membelah gunung untuk pelebaran jalan di kawasan Km 2729 lebih jalan Bireuen-Takengen. “Beda pendapat masalah volume itu biasa, namun jangan sampai membayar hak orang yang telah bekerja juga ditundatunda, lebih baik pihak pemerintah Aceh melalui pihak turun ke lokasi lihat pekerjaannya dan ukurlah kembali, lalu segeralah membayarnya sesuai dengan ketentuan atau peraturannya, kasihanlah kontraktornya giliran membayar diulur-ulurkan,” ujarnya yang diiyakan H Saifannur dan Sulaiman Abda. Marzuki menambahkan, untuk 2013-2015 Kementrian PU ada mengalokasikan dana Rp70 miliar proyek multiyears untuk pembangunan jalan Bireuen-Takengen mulai KM

Waspada/Abdul Mukhti Hasan

WAKIL Ketua Tim pemantau Pemerintahan Aceh dari DPR RI, Marzuki Daud (dua kiri) bersama wakil ketua DPRA, Sulaiman Abda (tiga kiri), mendengar penjelasan dari H Saifannur (satu kiri), kontraktor yang mengerjakan jalan Bireuen-Takengen di kawasan Cot Panglima, Juli, Bireuen, Minggu (10/2) siang. 25 dengan danannya Rp75 miliar yang sekarang ini tinggal menunggu pengumuman tendernya dan diharapkan turun Maret depan. “Uang itu dialokasikan bukan untuk menyelesaikan masalah pembayaran pembangunan jalan itu, namun untuk perluasan dan pengaspalannya,” terang anggota DPR RI Fraksi Partai Golkar yang duduk di Komisi VI. Ditanya, pendapatnya tentang hasil pekerjaan pengerukan atau pemotongan gunung di kawasan Cot Panglima, Marzuki dengan lantang mengatakan sudah sangat bagus, sehingga masyarakat Bireuen dan Takengen dapat melintas dengan lancar, walaupun jalannnya belum diaspal sekarang ini. “Makanya kita desak Pemerintah Aceh untuk menyelesaikan hal kontraktor yang telah berbuat. Sehingga 2014 jalan Bireuen-Takengen sudah selesai semuanya baik dana dari APBN maupun Otsus,” katanya. Marzuki menambahkan, dana dari APBN yang dialokasikan untuk pembangunan jalan dan jembatan di Aceh 2013 Rp1,25 triliun. Diharapkan tahun

berikutnya pemerintah menambahkan hingga mencapai Rp2 triliun. “Kita harapkan wacana pemindahan Balai Besar Aceh-Sumut ke Aceh sangat kita dukung, sehingga pembangunan jalan di Aceh dapat dipacu tentunya dengan adanya tambahan dana hingga Rp2 triliun tahaun depan, makanya kita sangat berharap kepada pemerintah pusat tahun depan untuk menambahkan dari tahun ini hingga Rp2 triliun, “ katanya, seraya memberi apresiasi kepada menteri PU yang telah membantu Aceh dalam hal ini. Wakil Ketua DPRA, Sulaiman Abda, menambahkan, dana untuk menyelesaikan masalah pembangunan jalan Bireuen-Takengen di kawasan Cot Panglima, untuk tahun ini telah diusulkan Rp40 miliar. “Penyelesaian masalah jalan ini tahap pertama DPRA sudah mnyelesaikan tahap Rp25 miliar, tahap II Rp50 miliar dan tahun ini telah kita usulkan Rp40 miliar untuk menyelesaikan masalah jalan ini dengan kontraktor, setelah diaudit BPK ataupun Bawasda,” kata Ketua DPD Partai Golkar Aceh.(cb02)

cukup baik, tetapi juga dikaruniai SDM yang besar. “Tugas kita memanfaatkan SDM untuk sebesar-besarnya bagi ke-manfaatan bangsa. SDM adalah motor penggerak kemajuan bangsa yang berkelanjutan,” katanya. Ditambahkan Wapres, upaya menyiapkan generasi mendatang merupakan tugas generasi saat ini.Tanggung jawab ini, kata Wapres, tidak dapat digeser ke manapun. “Apabila kita alpa melakukan maka kitalah yang bertanggung jawab atas kegagalan dari kemajuan bangsa,”tegasnya. Wapres berpandangan, ada dua fokus pengembangan SDM sebagai kunci peningkatan kualitas bangsa yaitu pendidikan dan kesehatan. Kedua hal itu dia ibaratkan sebagai perangkat keras dan perangkat lunak di bidang komputer. “Dua-duanya harus match kapasitasnya. Kalau tidak manusianya bisa “hang”,” imbuh Boediono. Kurikulum Baru Jangan ‘Molor’ Terkait kurikulum, Wapres mengatakan pemerintah akan mengimplementasikannya awal tahun pelajaran 2013/2014 pada Juli mendatang. Untuk itu, dia meminta agar dalam persiapannya tidak hanya terkait buku, guru, dan infrastruktur, tetapi juga isinya. “Meskipun secara operasional lancar, tetapi kalau isinya tidak dirumuskan dengan baik maka hasilnya tidak optimal,” kata dia. Masih soal kurikulum, Boe-

diono setuju jika implementasi kurikulum dilakukan secara bertahap. Tetapi jangan sampai molor karena yang rugi generasi muda. “Begitu molor pasti ada korban, sebagian generasi kita tidak bisa menerima manfaat dari kurikulum baru,” tegasnya. Persiapan dan keinginan untuk melaksanakan kurikulum tidak harus dilakukan sekaligus. Hal ini, kata dia, mengingat banyaknya jumlah peserta didik, sekolah, dan guru. Dia memperkirakan, kurun waktu tiga tahun untuk menyelesaikan implementasi kurikulum 2013 dianggap cukup selama dikerjakan dengan benar. “Kita harus realistis, tidak mungkin dilaksanakan sekaligus. Saya mendukung kurikulum 2013, kita semua berusaha sekeraskerasnya,” katanya. Sementara terkait isi kurikulum, Wapres menyerahkan hal tersebut kepada ahlinya. Menteri Pendidikan dan Kebudayaan (Mendikbud) Mohammad Nuh menyampaikan, kurikulum 2013 mendapatkan respon positif dari para pelaku utama dunia pendidikan yaitu guru, kepala sekolah, pengawas, dan pengelola pendidikan dan orang tua murid. “Kami yakin anggota Komisi X pada akhirnya memberikan pandangan yang sama. Oleh karena itu, ini menjadi tantangan tersendiri bagi Kemdikbud untuk menyiapkan segala sesuatunya dengan lebih baik,” katanya. (dianw)

10.051 Guru Agama Kristen Belum Peroleh Tunjangan Sertifikasi JAKARTA (Waspada): Sebanyak 10.051 guru agama Kristen belum memperoleh tunjangan sertifikasi dari pemerintah sejak tahun 2011 dengan total uang sebesar Rp179 miliar.“ Mereka yang belum menerima sertifikasi adalah para guru mulai dari tingkat sekolah dasar (SD), SMP dan SMA,” tegas Direktur Pendidikan Bimbingan Masyarakat Agama Kristen, Drs.Yan Kristianus Kadang kepada wartawan di kantor Kementerian Agama ( Kemenag), Jakarta, Selasa ( 12/2 ). Padahal Direktur Jenderal Bimbingan Masyarakat (Dirjen Bimas) Kristen, Kementerian Agama dalam tahun 2013 ini mempunyai misi, meningkatkan kualitas bimbingan masyarakat, kerukunan internal dan eksternal, kualitas pendidikan agama, mewujudkan tatakelola kepemerintahan yang bersih dan berwibawa. Menurut Yan Kristianus, pihaknya sangat beraharap kepada pemerintah agar hak yang diperoleh para guru cepat terlealisasikan. Namun dia tidak mengetahui secara pasti, dimana uang yang menjadi hak para guru tersebut “nyangkut”/ “Bukan guru Kristen saja, kemungkinan guru agama Islam juga mengalami hal yang sama,” tegas Yang Kristianus. Mengingat dalam tahun 2013 ini, pihaknya juga mempunyai kegiatan prioritas berskala nasional di bidang pendidikan. Seperti pemberian tunjangan profesi guru non PNS sebanyak 658 orang, pemberian subsidi tunjangan fungsional guru non PNS Kristen sebanyak 574 orang, bantuan penyelenggaraan pendidikan dan latihan (diklat) sertifikasi guru untuk 1000 orang, pemberian beasiswa bagi mahasiswa miskin sebanyak 100 orang, penyelenggaraan sertifikasi dosen non PNS sebanyak 250 orang dan peningkatan sarana dan prasarana pendidikan tinggi di tujuh lokasi. Selain itu, dalam bidang urusan gama, Dirjen Bimas Kristen akan memberikan bantuan bagi penyuluh agama non PNS sebanyak 6577 orang., tutur Yan Kritianus. ( j06 )


SILATURAHIM PCNU dan Majelis Wakil Cabang (MWC) NU se-Kabupaten Pakpak Bharat, di Salak, Kamis (7/2).

NU Akan Dikembangkan Di Pakpak Bharat Berantas Buta Aksara Quran SALAK (Waspada): Nahdlatul Ulama (NU) akan berkembang di Pakpak Bharat termasuk berperan untuk memberantas buta aksara Alquran di sana. Hal itu menjadi harapan Ketua Pengurus Wilayah Nahdlatul Ulama (PWNU) Sumatera Utara H Ashari Tambunan dengan menurunkan timnya ke sana dipimpin Ir Baharuddin Berutu. Sejalan dengan harapan itu, Pengurus Cabang (PC) NU Pakpak Bharat akan berperan aktif melakukan pemberantasan buta aksara Alquran dan melahirkan dai-dai yang siap berrkiprah hingga ke pelosok desa. “PCNU sebagai organisasi sosial, dakwah dan pendidikan, akan dikembangkan di Pakpak Bharat untuk memberantas buta aksara Alquran. PCNU Pakpak Bharat segera mencetak para dai yang siap terjun hingga pedesaan,” ucap Baharuddin

saat menghadiri silaturahmi PCNU dan MajelisWakil Cabang (MWC) NU se-Kab. Pakpak Bharat, di Salak, Kamis (7/2). Hadir dalam acara itu Rais Syuriah PCNU Pakpak Bharat Drs H Saidup Kudadiri, Sekretaris Tanfidziyah PCNU Drs Dunggar Angkat, dan para pengurus MWC NU se-Kabupaten Pakpak Bharat. Pada kesempatan itu, Ketua PWNU Sumut H. Ashari Tambunan mengucapkan terimakasih kepada Pemkab Pakpak Bharat yang telah membantu pengadaan tanah perkantoran PCNU Pakpak Bharat, sehingga dalam tahun 2013 ini akan berdiri kantor PC NU yang refresentatif di daerah tersebut. Ketua PCNU Pakpak Bharat diwakili Drs H Dunggar Angkat, kantor PCNU Pakpak Bharat segera dibangun di atas areal seluas 10 X 30 meter.

Menyahuti harapan PWNU Sumut, Dunggur Angkat juga mengatakan PCNU Pakpak Bharat mempunyai program di bidang dakwah dan pendidikan. Untuk itu, dalam waktu dekat PCNU akan melakukan pela-tihan buta aksara Alquran dan bilal mayit. “Kami akan meng-aktifkan semua badan otonom (Banon) NU yang selama ini keberadaannya kurang aktif,” tambah Angkat. Sedangkan Rais Syuriah PCNU Pakpak Bharat H Saidap Kudadiri mengharapkan, PCNU harus berbuat demi kemaslahatan umat khususnya di Pakpak Bharat. “Kita masih kekurangan dai dan ustadz yang siap turun ke tengah-tengah umat, terutama dalam memberantas buta aksara Alquran. Ini merupakan tugas PCNU dan MWC,” ujar Kepala Kantor Kementerian Agama Pakpak Bharat ini.(m13)

Marzuki: Seluruh DPD Dukung Langkah SBY JAKARTA (Waspada): Seluruh Ketua DPD Partai Demokrat (PD) mendukung dan menandatangani pakta integritas yang dilakukan di depan Ketua Majelis Tinggi Partai Demokrat Susilo Bambang Yudhoyono (SBY) di Cikeas, Bogor, Minggu (10/2) malam. Dalam pakta integritas tersebut telah diatur sanksi dan konsekuensi kader yang tersangkut korupsi. “Jadi, tidak ada yang ragu, semua DPD solid mendukung skenario penyelamatan Majelis Tinggi. Pakta integritas seperti janji yang mengikat semua kader PD di depan hukum. Tujuan utama SBY adalah untuk menata penyelamatan PD, dengan memberi sanksi terhadap kader bermasalah,” tandas anggota Ketua Dewan Pembina yang juga Ketua DPR RI Marzuki Alie pada wartawan di Gedung DPR RI Jakarta, Senin (11/2). Marzuki yakin upaya penyelamatan PD oleh Ketua Majelis Tinggi PD tersebut akan efektif. Bagaimanapun PD akan menghadapi Pemilu 2014 yang tinggal setahun lagi. “Kalau sudah berusaha, kita percaya dengan takdir. Yang penting niat kita baik, implementasi kita baik,” tambahnya. Setidaknya, selama tahun 2013 ini roda politik PD dijalankan oleh Majelis Tinggi yang dipimpin langsung oleh SBY. “Kami targetkan akhir tahun 2013 semua beres. Jadi masuk masa kampanye sudah bersih dan sehat,” kata anggota Majelis

Tinggi PD itu optimis. Untuk itu, dengan harapan menjelang Pemilu 2014 PD mampu mengembalikan kepercayaan masyarakat. Kalau tidak, katanya, maka PD bisa jadi terjun bebas. “Mudahmudahan masyarakat akan pilih Demokrat. Sedangkan Anas kita dampingi agar tidak digebuki lagi, karena Ketum itu sentral,” tambah Marzuki. Namun demikian, menurut Marzuki, Anas masih bisa melakukan sejumlah tugas. Seperti terlibat dalam penetapan calon anggota legislatif. Tapi, Ketum berhalangan, sesuai UU tugasnya bisa diwakili ketua-ketua dan sekjen. “Jadi, keterlibatan SBY dalam penyelamatan PD adalah hal yang wajar. Tentu tidak menganggu kinerjanya sebagai kepala negara. Sebanyak 33 Ketua Dewan Pimpinan Daerah Partai Demokrat menandatangi pakta integritas yang di hadapan majelis tinggi partai. Pakta integritas juga akan ditandatangani oleh seluruh anggota fraksi Partai Demokrat di DPR. Dan, setelah mewajibkan penandatanganan pakta integritas, Majelis Tinggi PD yang dipimpin SBY juga mempersiapkan rapat nasional. “Rapat nasional kita akan lakukan tanggal 17 Februari, bisa diundur 24 Februari,” kata Marzuki. Dalam pertemuan ini, menurut sejumlah sumber, Majelis Tinggi akan menghadirkan seluruh pimpinan DPD dan DPC PD. Tujuannya untuk menegaskan

kembali komitmen PD terhadap pakta integritas yang telah ditandatangani. Dia menambahkan, rapat itu sangat penting. “Ini agenda penting untuk mengembalikan jati diri Partai Demokrat. Rapat tersebut akan membahas restrukturisasi nasional PD. “Apakah dalam rapat nasional ini nanti akan ditunjuk Plt Ketua Umum PD pengganti Anas, itu tidak ada. Yang ada adalah Pak Anas dibantu melaksanakan tugas-tugasnya oleh seluruh MajelisTinggi,” ungkap Marzuki. Sementara Ketua FPD DPR Nurhayati Ali Assegaf mengaku telah menandatandatangani pakta integritas tersebut, dan semua anggota FPD DPR juga akan menandatanganinya. “Itu jadi agenda kita, semua anggota fraksi juga akan menandatandatangani, dan tidak ada yang keberatan. Pakta integritas adalah langkah konkret yang diambil oleh Majelis Tinggi PD untuk melakukan pembenahan di internal partai. Dengan pakta itu juga membuktikan tak ada yang kebal hukum di Partai Demokrat,” ujarnya. Menurutnya, PD sejak awal berdiri mendukung pemberantasan korupsi dan pak SBY sudah buktikan itu, siapa saja tidak ada yang kebal hukum meski masih aktif. Artinya Demokrat komitmen untuk pemberantasan korupsi. Saya kira semua partai akan melakukan hal yang sama ketika elektabilitasnya turun. “Jadi, itu langkah yang sehat dan positif,” jelas Nurhayati. (j07)

Mantan Menteri Agama HM Tarmizi Taher Meninggal Dunia JAKARTA ( Waspada): Mantan Menteri Agama Laksamana Muda (Purn) TNI AL dr. HM. Tarmizi Taher meninggal dunia Selasa (12/2) pukul 04:15 WIB di RSCM Jakarta, dalam usia 76 tahun. Almarhum dimakamkan di Taman Makam Pahlawan Kalibata dengan upacara militer. Wakil Menteri Agama Nasaruddin Umar bertindak sebagai inspektur upacara mewakili Presiden RI. Sebelum dimakamkan, jenazah dishalatkan di Masjid Imam Bonjol di Komplek Angkatan Laut Pondok Labu. Tampak hadir beberapa mantan pejabat tinggi negara, di antaranya Habibie, Harmoko, Azwar Anas, Qurais Shihab dan Farhan Hamid. Almarhum Tarmizi Taher menjadi Menteri Agama pada tahun 1993-1998, sebelumnya menjabat sebagai Sekjen Kementerian Agama dan Kapusbintal TNI. Pernah menjadi Dubes RI di Norwegia dan Ketua UmumDewanMasjidIndonesia. Almarhum Tarmizi Taher lahir di Padang, Sumatera Barat, 7 Oktober 1936. Setelah menyelesaikan pendidikan dokter di Universitas Airlangga Surabaya, dia meniti karier pada TNI AL dan pensiun dengan pangkat Laksamana Muda. Jabatan yang pernah diembannya di lingkungan militer termasuk sebagai Perwira Kese-


PRAJURIT TNI AL mengusung jenazah almarhum Laksamana Muda TNI (Purn) Tarmizi Taher menuju liang lahat di Taman Makam Pahlawan Kalibata, Jakarta Selatan, Selasa (12/2). hatan di KRI Irian, Juru Bicara Fraksi ABRI di MPR, Kepala Dinas Pembinaan Mental TNI AL dan Kepala Pusat Pembinaan Mental ABRI. Selain itu dia adalah lulusan Sekolah Staf dan Komando (Sesko) TNI AL dan sempat mengenyam pendidikan pada US Navy di bidang kesehatan. Selepas karier militer, ia kemudian ditugaskan sebagai Sekjen Departemen Agama selama 5 tahun, sebelum diangkat sebagai Menteri Agama pada tahun 1993. Selama menjabat Menteri Agama, dua inisiatif penting yang beliau laksanakan adalah pengembangan Siskohat (sistem komputerisasi haji terpadu) dan pembentukan Dana Abadi Umat (DAU). Beliau menjadi jembatan umat, ulama dan

umara melalui pergaulan yang luas dengan sejumlah tokoh dan pemuka agama. Sesudah tidak menjadi menteri, dia sempat diangkat untuk beberapa posisi lain, termasuk sebagai Duta Besar untuk Norwegia dan Islandia. Beliau juga pernah menjabat sebagai ketua umum pimpinan pusat Dewan Masjid Indonesia periode 2006 – 2011 dan rektor Universitas Islam Az-zahra di Jakarta periode 2004 – 2008. Almarhum dianugerahi Doktor Honoris Causa di bidang dakwah oleh Universitas Islam Negeri Syarif Hidayatullah Jakarta. Dari pernikahan dengan Hj.Djusma, Tarmizi Taher dikaruniai empat orang anak, tiga orang pria dan satu orang wanita yakni Afghan, Sakina, Halbana dan Dirgantoro. (j06)

Berita Utama


Warga Sudirejo I Sambut Meriah Pasangan GanTeng MEDAN (Waspada): Cawagubsu pasangan GanTeng nomor urut 5, Tengku Erry Nuradi menyerahkan bantuan dan perlengkapan sekolah bagi 500 KK dan 200 murid SD warga Kel.Sudirejo I, Kec. Medan Kota di lapangan bola SSB Patriot Jl. Air Bersih Medan, Selasa (12/2). Kehadiran Tengku Erry langsung disambut meriah seribuan kaum ibu dan anak-anak yang sudah lama menunggu kehadiran pasangan GanTeng tersebut. Tiba di lapangan, warga berebut menyalami, berfoto dan tidak sungkan-sungkan mengajak Tengku Erry berjoget bersama. Sejumlah ibu histeris saat menyalami dan memeluk Tengku Erry. Seperti yang dirasakan ibu Mamiek. Dia mengaku mengidolakan pasangan GanTeng (Gatot-Tengku Erry). ‘’Kami mendoakan pada Pilgubsu 7 Maret mendatang pasangan nomor urut 5 ini menang,’’ pintanya. Sementara itu, Tengku Erry dalam sambutannya mengatakan ada 5 kebutuhan hidup yang harus dipenuhi masyarakat. Kebutuhan itu yakni, sandang, pangan, papan, lapangan pekerjaan dan yang kelima adalah olahraga serta hiburan. ‘’Tersedianya lapangan bola di Jl. Air Bersih ini diharapkan dapat dimanfaatkan warga sebagai ajang silaturahmi selain berolahraga,’’ sebut Erry. (m46)

Waspada/Surya Efendi

DISAMBUT MERIAH: Cawagubsu pasangan GanTeng nomor urut 5, Tengku Erry Nuradi menggendong seorang anak saat disambut meriah warga di lapangan bola Jl. Air Bersih Medan, Selasa (12/2).


BUPATI Tapsel Syahrul M Pasaribu memberi ucapan selamat kepada salahsatu pengurus Pertuni Tapsel yang dilantik di Aula Asrama Haji Tapsel, Jalan Imam Bonjol, Selasa (12/2).

PENGOBATAN GRATIS: Masyarakat antusias mengikuti acara pengobatan dan pembagian kaca mata baca gratis di Lapangan Reformasi Percut Sei Tuan,Deli Serdang, Selasa (12/2).

Bupati Tapanuli Selatan Kukuhkan Lima Ormas

Ratusan Warga Ikuti Pengobatan Gratis Dan Senam Poco-poco ESJA

P. SIDIMPUAN: Bupati Tapanuli Selatan Syahrul M Pasaribu mengukuhkan pengurus lima organisasi masyarakat (Ormas) yang bergerak di bidang sosial dan wirausaha, yakni Bina Karya (BK), Pekerja Sosial Masyarakat (PSM), Persatuan Tuna Netra Indonesia (Pertuni), Persatuan Penyandang Cacat Indonesia (PPCI), Kelompok Wirausaha Bidang Kepariwisataan (KWBK). Upacara pengukuhan lima ormas di bawah binaan Dinas Tenaga Kerja Transmigrasi dan Sosial ini digelar di Aula Asrama Haji Tapsel, Jalan Imam Bonjol, Kel. Sihitang, Kec. Sidimpuan Tenggara, Kota Padang Sidimpuan, Selasa (12/2). Kelima ketua organisasi yang dikukuhkan yakni Syahril Tanjung (PCCI), Irham KPK Usut ... Bhakti Pasaribu (KWBK), HaKorupsi” yang menetapmonangan Dalimunthe (KSM), Ahmad Edi Dani Waruhu (BK), kan bahwa tersangka Anas Urbaningrum selaku anggota DPR dan Irvan Rambe (Pertuni). Ketua IPSM Sumut Erliyanto periode 2009-2014 dikenakan pamenyematkan pin kehormatan sal12hurufaatauhurufbataupakepada Gus Irawan Pasaribu sela- sal 11 Undang-undang No 31 taku Tokoh Relawan Sosial Sumut. hun 1999 sebagaimana telah di“Saya terharu dan berterimakasih ubahdenganUUNo20tahun2001 atas penghormatan ini. Karena tentang Pemberantasan Tindak saya tidak menyangka apa yang Pidana Korupsi. saya perbuat ternyata mendapat Surat tersebut ditandataperhatian dari saudara semua,” ngani oleh tiga orang pimpinan ujar Gus.(m06) KPK yaitu Abraham Samad, Zul-

DELISERDANG (Waspada): Masih dalam rangka HUT PDI Perjuangan ke-40, DPD PDI Perjuangan Sumut menggelar acara pengobatan gratis dan perlombaansenampoco-pocountukibuibu yang berasal dari Kab. Deli Serdang, di Lapangan Reformasi Percut Sei Tuan, Selasa (12/2).

Kampanye Konvoi ...

iring-iringan ke lima pasangan calon, sebab jadwal dan agenda acara telah disosialisasikan ke masing-masing tim kampanye pasangan calon. Sementara informasi tersebut sempat membuat kaget komisioner KPU Sumut lainnya, Rajin Sitepu dan Sekretaris KPU Sumut Rajab Pasaribu. Awalnya Rajin tidak percaya ada keinginan seperti itu, sebab dalam sosialisasi jadwaldanagendaPilkadaDamai beberapaharilalutidakadapenolakan dari Polda dan sangat antusiasikutsertadalampengamanan seperti yang disampaikan oleh perwakilannya yang hadir. Bahkan,katanya,siapmengerahkan voorijders untuk setiap tim pasangan calon. “Kan sudah disetujui, mungkin hanya di batasi 15 kendaraan roda empat,” kata Rajin. Dia mengatakan, jika benar ada larangan konvoi, Pilkada Damai tidak akan ramai dan tidak dilihat banyak orang. “Nanti kami bicarakan dulu kalau memang seperti itu,” sebut dia. Beberapa hari sebelumnya, media massa sudah mendapat keterangan pers dari KPU Sumut terkait jadwal untuk mengarak kelima pasangan Cagubsu/ Cawagubsu pada 16 Februari, dengan titik kumpul dan start di LapanganMerdekaMedan,pukul 10:00. (m34/m27)

Terancam Batal Rencanabatalnyakonvoidan iring-iringan kendaraan masingmasing tim kampanye pasangan calonGubsu/CawagubsusaatpeluncuranPilkadaDamai,16Februari 2013 dibenarkan KPU Sumut. Anggota/Komisioner Komisi Pemilihan Umum (KPU) Sumut Surya Perdana kepada wartawan, Selasa(12/2)dikantorKPUSumut Jln. Perintis Kemerdekaan mengatakan, Poldasu menganggap arak-arakan tersebut rawan terjadinya gesekan antarpendukung. Sehingga Poldasu menganjurkan konvoi atau iring-iringan kendaraan tim kampanye ditiadakan. Menurutnya, KPU Sumut

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Bxg6+, Rh8. 2. Bxh6+, Rg7. 3. Mg5+, Rf8. 4. Bh8+mat. (Jika 1. ....., Rh7. 2. Mxf7+, Rh8. 3. Mg7+mat). Jawaban TTS: TTS Topik


Jawaban Sudoku:

6 4 7 1 5 8 3 9 2

5 1 9 3 2 7 4 8 6

2 8 3 4 6 9 7 5 1

8 3 2 6 7 1 5 4 9

4 6 5 9 8 2 1 3 7

7 9 1 5 4 3 6 2 8

1 5 6 2 9 4 8 7 3

3 2 8 7 1 5 9 6 4

9 7 4 8 3 6 2 1 5

didatangi unsur Poldasu yang meminta agar konvoi atau iringiringan kendaraan roda empat saat arak-arakan Pilkada Damai ditiadakan. “Ada informasi dari intelijen konvoi dianggap berpotensi menimbulkan gesekan antarpendukung pasangan calon,’’ujar Surya mengutip keterangan pihak Poldasu. Namun,katanya,KPUSumut belum bisa memutuskan apakah permintaanPoldasuitudiakomodir atau tidak, karena harus diputuskan melalui rapat pleno. Dia menjelaskan, mereka (KPU) tidak bisa begitu saja membatalkan rencana konvoi dan

Bupati Asahan ... Sementara, Camat Kisaran Timur Rahmat Hidayat Siregar didampingi Kepala Biro Harian Waspada Kisaran Nurkarim Nehe mengatakan, RTD akan dilakukan di Masjid An-Namira, Kelurahan Kedailedang, pada Kamis (14/2), dengan melibatkan Pengajian Adz Dzihniyah Kab. Asahan, dan elemen masyarakat lainnya, dengan perkirakan 1.500 jamaah akan hadir. “Kita juga akan mengisi kegiatan itu dengan menyantuni anak yatim, dan memberikan bantuan 120 kaca mata baca bagi lansia, agar bisa membaca AlQuran,” jelas Rahmat. (a15)

GusMan Semakin Berkibar Di Bursa SCWA MEDAN (Waspada): GusMan semakin berkibar di bursa SCWA (Siapa CagubsuWagubsu Anda). Hari ini rating GusMan naik lagi 1% mengurangi persentase GanTeng 1%. Sementara Amri-RE tetap di posisinya sebagai runner-up. Posisi bursa SCWA hari ini selengkapnya sbb:, GusMan 42%, Amri-RE 32%, GanTeng 26%, CH-Fadly 0%, ESJA 0%.

karnaindanAdnanPanduPradja. “Hari ini mungkin secara resmi tim akan dibentuk, hasil dari tim ini akan ditindaklanjuti untuk mencari kesimpulan apakah dokumen itu berasal dari KPK atau bukan, jadi kita tunggu hasil kerja tim dalam KPK yang berada di bawah deputi pengawasan internal dan pengaduan masyarakat,” tambah Johan. Iamemintaagarsebelumada kesimpulan dari tim tersebut, spekulasi masyarakat mengenai dokumen tersebut dihentikan.

Acarapengobatandanlomba senam poco-poco dihadiri sekitar 700-an orang yang berasal dari beberapa tempat di kawasan Percut Sei Tuan, Deli Serdang. Ketua Tim Kampanye Effendi-Jumiran, RubenTarigan dalam sambutannya menegaskan bahwa pengobatan gratis yang digelar Tim ESJA sudah berlangsung di beberapa daerah di Sumatera Utara. “Selainpengobatangratis,kali ini kita juga menggelar acara perlombaan senam poco-poco yang diikuti oleh kaum ibu-ibu PKK serta kelompok ibu-ibu rumah tangga,” papar Ruben Tarigan. Pengobatan gratis dan pembagian kaca mata baca gratis, lanjut Ruben merupakan salah satu bentuk perhatian Effendi-Jumiran terhadap masalah kesehatan masyarakat. (rel/m09)

1 Ton Ganja ... Menurut Kapolres Aceh Tengah AKBP Artanto. SiK, saat menyaksikan mobil yang dipenuhi paket ganja di halaman Mapolres Aceh Tengah, Selasa (12/ 2), petugas memburu tersangka yang sudah masuk ke dalam hutan. Berbekal petunjuk tetesan darah di antara dedaunan di dalam hutan itu, 10 petugas dibekali dengan pakaian rompi lapis baja. Saat ditemukan kedua tersangka dalam keadaan lemas.“Tersangka kita perkirakan kehabisan darahsaatmelarikandiri.Seorang tersangkaterkenatembakanpada lutut dan tersangka yang lain pada siku,” tutur Brigadir Iwan Abadi,menambahkanketeranganKapolres. Kedua tersangka adalah AMS,40,warga TanjungAmbalang Payung, Karo dan ABR, 38, warga Medan Tembung . (b32/cb09)

Al Bayan ... Beliau melihat sahabatnya itu pucat dan kurus. “Ada apa denganmu wahai Abubakar?”. Tanya baginda. “Saya kelaparan ya Rosulullah! Jawab Abubakar dengan perasaan lemah. Kebetulan kedua manusia utama itu sama-sama dalam kelaparan, “Saya juga sudah tidak makan beberapa waktu!” ujar Nabi. Tetapi keduanya ber-

Harian Waspada mengedarkan kupon SCWA dalam rangka untuk mencari tahu siapa pilihan pembaca pada Pilgubsu 7 Maret 2013 mendatang. Pendukung Cagubsu-Wagubsu yang ingin berpartisipasi lewat bursa SCWA dapat mengisi kupon yang tersedia di halaman Pentas Pilkada sesuai petunjuk yang ada. Panitia hanya menghitung fisik kupon dikirim dan membuat persentasenya. (tim)

Warga Siantar Terima ...

MEDAN (Waspada): Pemilihan rois syuriah dan tanfiziah pada Konferensi Cabang Ke17 Nahdlatul Ulama (NU) Kota Medan, Minggu (10/2), diwarnai politik uang (money politics). Akibatnya, proses pemilihan tidak dilanjutkan pada hari itu. Pimpinan sidang menunda pleno pemilihan rois syuriah dan tanfiziah sampai waktu yang ditentukan setelah terjadi perdebatan yang cukup alot membahas pakta integritas calon rois syuriah dan tanfiziah yang mengharamkan politik uang. Pantauan Waspada kelompokluaryangbekerjasamadengan calon rois dan tanfiziah “menabur” uang kepada beberapa MWC, menjelang pemilihan di AsramaHajiMedanuntukmenggolkan calonnya, menolak pakta integritas itu. Pasalnya, pakta integritasmengatursalahsatunya syarat calon rois syuriah, tanfiziah dan peserta pemilih harus bebas dari politik uang sekaligus bersedia disumpah Alquran 30 juz. Ketua Panitia Konfercab Maraimbang Daulay, Senin (11/ 2), kepada Waspada tidak menepis adanya politik uang yang mengakibatkan pemilihan rois syuriah dan tanfiziah ditunda untuk sementara waktu. Kata Daulay, penolakan pakta integritas memicu pertentangan dari sebagian majelis wakil cabang (MWC) yang menginginkan Konfercab bersih dari politik uang, sehingga mengorbankan jadwal pemilihan menjadi molor melampaui kontrak penggunaanAsramaHajidanizin pelaksanaan dari polisi 9-10 Februari. Akhirnya, memasuki Senin dinihari sekira pukul 01.00, pimpinan sidang dan panitia menunda pleno pemilihan hingga waktu yang ditentukan. Sementara, pengurus yang lama belum dinyatakandemisioner. Menurut Daulay, selama pengurus belum demisioner maka pelaksanaan pemilihaan masih menjadi tanggung jawab pengurus dan panitia Konfercab. Beberapa unsur MWC mengakui adanya pihak luar yang menabur uang kepada peserta untuk memilih salah satu calon syuriah dan tanfiziah. “Kami menolaknya karena upaya itu mencemarkan nama baik NU,” ujar pengurus MWC yang tak ingin disebutkan namanya. (m13)

tangannya untuk menyalami Cagubsu yang berpasangan dengan Cawagubsu Dr RE Nainggolan MM tersebut. Kehadiran Cagubsu nomor urut 4 Drs Haji Amri Tambunan acara tersebut selain sebagai memenuhi undangan warga Kelurahan Martoba, juga membawa berkah bagi keluarga alm Bahar serta keluarga Mahadi Purba. Pasalnya, karena keberadaan rumah kedua warga kurang mampu yang selama ini tidak layak huni, mendapat sentuhan melalui gerakan kemanusiaan “bedahrumah”sehinggamenjadi rumah sehat dan layak huni serta nyaman untuk ditempati. Ketika Amri Tambunan menyerahkan kunci rumah, kedua keluarga yang mendapat sentuhan kemanusiaan itu tak dapat menahan rasa harunya. Istri alm. Bahar yang merupakan veteran begitujugaMahadiPurbatampak meneteskan air mata saat menerima kunci dari Cagubsu yang diusung Partai Demokrat itu. Selain menyerahkan dua kunci rumah Amri Tambunan jugamenyerahkantaliasihkepada 100 anak yatim piatu, tikar plastik kepada 11 kelompok pengajian, 16orangbilalmayitserta20imam dari 4 masjid. Amri Tambunan mengaku Kel. Martoba tidaklah asing bagi dirinya.Karena masamasa kecilnya, ia tinggal di Kel. Kampung Melayu. Di hadapan ratusan warga dan sejumlah tokoh masyarakat di antaranya Drs H Burhanuddin Nasution, H Abdul Kadir Siregar, mantanpetinjunasionalSyamsul Anwar Harahap, Al-UstadzTaufiqurrahman yang dikenal dengan sebutan “Ustadz Pantun” serta Drs H Zulkarnaen Nasution, Cagubsu nomor urut 4 itu mengajak warga Pematangsiantar khususnya Kel. Martoba untuk tetap memupuk kebersamaan yang terjalin indah ini. Cagubsu Drs Haji Amri Tambunan yang hadir bersama istri Ir Hj Anita Lubis menyampaikan permohonan pamit, doa dan dukungan dari warga untuk tampil maju bertarung pada Pilgubsu 7 Maret 2013. Sebelumnya Ketua Panitia Maulid Nabi Besar Muhammad SAW H Abdul Kadir Siregar menyebutkan Drs Haji Amri Tambunan bagi warga Pematang-siantar khususnya Kelurahan Martoba yang dulunya Kampung Melayu bukanlah merupakan warga lain. Masa-masa kecilnya beliau (AmriTambunan-red) tinggal di daerah ini. Bahkan kakek beliau dari ibunya merupakan penghulu pertama di Kampung Melayu ini. (a06)

sabar karena malu memintaminta. Tiba-tiba putra Abdurrahman bin Auf (dermawan paling kaya) datang mengundang keduanya agar makan siang. Alhamdulillah! Keduanya makan sampai kenyang. Sabar tentu bukan hanya dalam masalah menahan lapar. Sabarharusselalumenghiasiibadah kepada Allah SWT. Misalnya; ada godaan nafsu supaya berbuat maksiat,makakitaharusbersabar untuk tidak memperturutkan hawa nafsu, malah kita harus tetap sabardalamkeistiqamahandalam berbuat amal kebajikan. Kekurangan harta jangan menghalangi langkah kita untuk berbuat amal shaleh. Orang-orangyangmenghiasi dirinya dengan sifat sabar akan diberi kesuksesan dalam usahanya, cita-citanya, bahkan surga di hari pembalasan kelak. Ber-

sabar itu wajib hukumnya sedangkan tergesa-gesa dari setan. Para Nabi yang mendapat gelar Ulul Azmi karena kesabarannya dalam mengembangkan agama Allah sangat luar biasa. Ibrahim menghadapi Namruz yang kejam, Musa menghadapi Firaun yang zalim, Nuh menghadapi kaumnya yang keras kepala, Isa dengan orang-orang yang durhaka, Muhammad menghadapi kaum Musyrikin Makkah dan Yahudi Madinah. Rasulullahbersabda:Kesabaran itu cahaya yang benderang, (HR: Muslim). Ali bin Abi Thalib berkata: Bagi orang mukmin kesabaranadalahsuatunikmatdarinikmatAllah,sebaliknyabagiorang munafik kesabaran sesuatu yang sangat tidak nikmat. Mudah-mudahan kita yang sedang mendapat cobaan Allah SWT selalu dalam bersabar. Amin!

Money Politics, Pemilihan Rois Dan Tanfiziah NU Medan Ditunda


WASPADA Rabu 13 Februari 2013


KANDIDAT Gubsu Chairuman Harahap bersama Bupati Langkat H.Ngogesa Sitepu dan Pembina Laskar Hang Tuah Indonesia HM Affan di Lap. Tanjung Beringin Pasar I Kec. Hinai, Kab. Langkat, Senin (11/02).

Masyarakat Melayu Bersama Chairuman LANGKAT (Waspada): Keberagaman masyarakat Sumatera Utara adalah modal besar bagi pembangunan daerah ini. Karena itu kandidat Gubsu Chairuman Harahap mengajak masyarakat Melayu bergandengan tangan memajukan Sumatera Utara lebih baik lagi ke depan. “Sumatera Utara memiliki potensi besar baik dari sisi sumber daya alam maupun budaya. Untuk itulah mari kita membangun Sumatera Utara lebih baik lagi ke depan,” kata Chairuman di hadapan masyarakat Melayu di Kabupaten Langkat pada pelantikan akbar delapan kecamatan Laskar Hang Tuan Indone-sia (LHTI) se-Kabupaten Langkat, Senin (11/2). AcarayangdihelatdiLapanganBolaPasarI,DesaTanjungBeringin, Kec. Hinai, Kabupaten Langkat dihadiri 3000-an orang dan turut dihadiri Bupati Langkat H Ngogesa Sitepu SE, Pembina LHTI Sumut H M Affan, Ketua LHTI Sumut M Hatta, jajaran pengurus MABMI Sumut, ibu-ibu PKK Kabupaten Langkat, dan sejumlah unsur organisasi masyarakat se-Kabupaten Langkat di antaranya AMPI. Chairuman menambahkan, keberagaman masyarakat Sumut khususnya masyarakat Melayu menjadi modal untuk membangun Sumut. “Kekuatan anak-anak Melayu sangat berperan untuk memajukan Sumut, untuk itulah saya mengajak bekerjasama membangun perekonomian masyarakat dalam mewujudkan Sumut lebih mapankedepan,”kataCagubsuChairumanyangberpasangandengan Fadly Nurzal dengan nomor urut 3 di Pilkada 7 Maret mendatang. Chairuman memberikan apresiasi positif atas pelantikan akbar delapan kecamatan LHTI se-Kabupaten Langkat. Sebelumnya Bupati Langkat menyampaikan motivasi kepada delapan kecamatan LHTI se-Kabupaten Langkat. “Saya mendukung acara pelantikan LHTI Sumut begitu juga SKPD se-Kabupaten Langkat,” kata Ngogesa yang hadir bersama istri. (m07/m18)

Ada-ada Saja ... Di restoran sake house ini ada dua ekor monyet yang dipekerjakan menjadi pelayan. Keduanya bernamaYat-Chan, Fuku-Chan. Tak ubahnya seperti pelayan biasa, monyet-monyet ini juga mengenakan pakaian lengkap dan bahkan menggunakan topeng. Yat-Chan, monyet berusia 16 tahun merupakan yang tertua dari keduanya. Namun ia selalu bergerak lebih cepat dalam melayani dan membawakan minuman para tamu yang datang ke tempat itu. Fuku-chan biasanya bertugas mengantar handuk hangat kepada tamu dan membantu mereka memberihkan tangan sebelum menyantap hidangan, sebagaimana kebiasaan yang berlaku di Jepang. Percaya atau tidak, kedua monyet ini mendapat sertifikasi resmi dari pejabat lokal untuk bekerja sebagai pelayan. (oc/rzl)

Luar Negeri

WASPADA Rabu, 13 Februari 2013

A9 Peringati Jatuhnya Mubarak, Pemrotes Bentrok Di Luar Istana Presiden Moursi

Serangan Di Mosul, 12 Tewas Di Irak MOSUL, Irak (Reuters): Seorang pengebom bunuhdiri dan kelompok bersenjata tak dikenal menewaskan sedikitnya 12 orang di kota Mosul, Irak, kata sumber di kepolisian dan rumahsakit, di saat ketegangan antara etnis makin meningkat. Pengebomtersebut,mengemudikankenderaanyangbermuatan bahan peledak ke arah satu pos pemeriksaan militer di Mosul, 390 km sebelah utara Baghdad, dan meledakkannya, menewaskan delapan orang dan menciderai 18 lainnya, termasuk beberapa tentara. Ledakan Senin (11/2) itu menghancurkan semuanya. Seakanakan tidak pernah ada apa-apa di sini sebelum ledakan terjadi,” kata seorang polisi di tempat kejadian.Dalam insiden terpisah di Mosul, sejumlah pria bersenjata yang menggunakan senjata berperedam suara menewaskan seorang penjaga dewan provinsi dan tiga orang lainnya, kata polisi. PM Nouri al-Maliki, seorang Syiah, menghadapi aksi protes besar-besaran dari kaum Sunni dan berselisih dengan etnis Kurdi yang memimpin wilayah utara secara otonom dari Baghdad.(m23)

Pesawat Prancis Bom Tempat Persembunyian Gerilyawan Mali GAO, Mali (Antara/AFP): Prancis membom tempat persembunyian gerilyawan di kota terbesar Mali Utara, meningkatkan tekanan keamanan terhadap serangan gerilyawan saat operasi negara itu memasuki bulan kedua. Saksi mengatakan serangan helikopter menghancurkan kantor polisi di kota Gao dalam satu serangan sebelum fajar. Sehari sebelumnya,gerilyawan dari Gerakan bagi Tauhid dan Jihad di Afrika Barat (MUJAO) bersembunyi di gedung itu sebelum melepaskantembakankepasukanMali,yangmemicupertempuran. Ratusan warga lokal berkumpul Senin (11/2) pagi untuk melihat kantor polisi yang hancur, di mana bagian-bagian tubuh dan granatgranat yang tidak meledak tergelak di antara reruntuhan bangunan itu. Tentara kemudian menutup daerah itu agar satu tim penjinak ranjau dari Prancis dapat melakukakan kerja mereka, juga mengosongkan pasar utama dekat lokasi itu. “Kami khawaiir terjadi serangan,” kata seorang perwira militer Mali. Seorang saksi mata yang menyaksikan serangan helikopter itu mengatakan seorang petempur Islam di dalam kantor polisi itu meledakan bom yang dibawahnya. Kemudian darah berceceran dau bagian-bagian tubuh manusia masih berceceran di lokasi itu. Dalam 10 bulan kelompok garis keras menduduki Mali utara, MUJAO menggunakan kantor polisi ssebagai markas“polisi Islam” nya, memberlakukan hukum Islam. MUJAO mengklaim serangan Ahad dan dua bom bunuh diri Jumat dan Sabtu. Pertempuran Ahad itu adalah serangan gerilyawan di kota berskala luas pertama di daerah yang direbut kembali pasukan pimpinan Prancis.

Anggota Navy SEAL, Penembak Osama Bin Laden Buka Rahasia WASHINGTON (Antara/AFP): Seorang mantan anggota pasukan khusus Amerika Serikat, NaVy SEAL, yang membunuh pemimpin al-Qaida, Osama bin Laden, akhirnya angkat bicara dalam wawancara dengan majalah Esquire. Dalam wawancara tersebut, diceritakan bagaimana dia menembak bin Laden tiga kali dan persoalan keuangan yang dihadapinya sekarang sebagai seorang sipil yang masih menjadi pengangguran. Anggota SEAL itu tidak mengungkapkan identitasnya namun memberikan detail mengenai peran dalam penyerangan Mei 2011 dan juga kekhawatiran mengenai keamanan anggota keluarganya. “Osama terlihat bingung, dan dia jauh lebih tinggi dari yang saya bayangkan,” kata mantan anggota SEAL itu. Saat anggota SEAL sampai ke tempat persembunyian bin Laden di Abbottabad Pakistan, pemimpin al-Qaida diceritakan sedang memegang bahu istri termudanya, dan“mendorong wanita itu ke depan” untuk melindungi diri. Majalah Esquire, yang menyebut anggota pasukan komando sebagai “the Shooter” atau “sang Penembak”, menggambarkan seorang pahlawan tak dikenal yang pensiun tanpa uang pesangon, asuransi kesehatan, ataupun perlindungan keamanan terhadap keluarga. Artikel itu diberi judul, The Man Who Killed Osama bin Laden... is Screwed. Tentara ataupun mata-mata di AS, baik yang sudah pensiun ataupun masih aktif, diharuskan untuk menyerahkan manuskrip soal aktivitasnya kepada Pentagon untuk ditinjau apakah mengandung informasi yang sensistif atau tidak. Seorang pejabat Amerika yang tidak disebutkan namanya mengatakan bahwa tulisan dalam majalah Esquire itu belum diserahkan kepada Departemen Pertahanan. Menurut majalah itu, tembak-menembak dengan bin Laden hanya memakan waktu selama 15 detik. Namun situasi yang paling kritis justru muncul setelah itu, ketika para anggota komando menyadari bahwa salah satu helikopter Black Hawk yang digunakan ternyata rusak karena salah mendarat.

12 Orang Tewas Dalam Bentrokan Di India Utara GUWAHATI, India (AP): Duabelas orang tewas, sebagian besar akibattembakandaripasukankeamanan,setelahkerusuhanmeletus di daerah timurlaut India yang bergolak menentang pemilihan umum lokal, demikian kata seorang pejabat Selasa (12/2). Tentara dikerahkan dalam usaha meredakan kerusuhan yang meletus di Goalpara, kira-kira 120 km dari Guwahati, kota utama negara bagian Assam, kata Bhupen Bora, seorang pejabat kementerian dalam negeri Assam. “Sejauh ini, 12 orang dilaporkan tewas di berbagai tempat dengan laporan sementara menyebutkan sembilan orang tewas akibat penembakan pasukan keamanan dan bentrokan lainnya,” kata Bora. “Para prajurit AD dikerahkan di kawasan rusuh guna menghentikan kerusuhan agar tidak meluas,” kata Bora. Pasukan keamanan melepaskan tembakan ketika dua kelompok suku yang menentang pemilihan mulai membakari desa dan menyerang para pejabat pemerintah dengan tombak dan golok, kata Bora. (m10)

The Associated Press

SEORANG pemrotes Mesir berlari untuk melemparkan kembali gas airmata ke arah polisi anti-huruhara (tidak terlihat), ketika terjadi bentrokan dekat istana kepresidenan di Kairo, Mesir, Senin (11/2).

Korut Ujicoba Nuklir Lagi SEOUL, Korea Selatan (Reuters): Korea Utara (Korut) melancarkan ujicoba nuklir Selasa (12/ 2), kata Kementrian Pertahanan Korea Selatan (Korsel), setelah terjadi getaran gempa dengan kekuatan 4,9 skala Richter terekam Badan Survei Geologi AS (USGS). Korut mengatakan ujicoba nuklirnya merupakan ‘respon pertama’ terhadap ancaman Amerika Serikat dan peringatan pihaknya akan melanjutkan dengan‘langkahkeduadanketiga dengan intensitas yang lebih besar’ jika AS terus bersikap bermusuhan. KementerianLuarNegeriKorut mengatakan dalam pernyataannyabahwaujicobanuklirSelasa merupakan satu ‘langkah bela diri’ yang tidak melanggar hukum internasional. Ujicoba itu terlihat sebagai satu langkah krusial terhadap tujuan Korut membangun satu bom atom kecil yang cocok ditempatkan pada misil yang mampu menghantam AS. Ujicoba Korut itu mengun-

dang kutukan segera dari Washington, PBB dan negara lainnya. Bahkan satu-satunya sekutu Korut, China, juga menyuarakan penentangannya. Menurut The Associated Press Selasa, di tengah dunia yang tengah menunggu langkah Korut melakukan uji coba nuklir, komunitas internasional sudah memperingatkan Korut mereka bisa terkena sanksi baru. Sementara mengenai rencana peluncuran roket terbaru ini, anggota biro politik Korut menjanjikan peluncuran roket tersebut sebagai bagian dari aksi utama dengan intensitas tinggi. Politbiro Korut menyebutkan, peluncuran roket ini akan dilakukan sekitar 27 Juli mendatang.Waktutersebutdipilihsebagai peringatan gencatan senjata yang menghentikan sementara Perang Korea yang berlangsung antara 1950 hingga 1953. Titik pusat getaran gempa tersebut, hanya satu kilometer dibawahpermukaanbumi,dekat dengan tempat yang dikenal sebagaipusatujicobanuklirKorut. “KamidiberitahuolehKorselbahwa Korut melancarkan ujicoba nuklir,” kata diplomat Dewan Keamanan PBB kepada Reuters. Satu badan pengawas ujicoba nuklir internasional menga-

takan, kekuatan gempa ‘hampir setara dengan ujicoba 2006 dan 2008’ yang dilakukan oleh negara terkucil tersebut dan memperlihatkan ‘karakteristik seperti ledakan’.Korut,yangselamainimengancam akan melakukan ujicoba nuklir ketiga, telah memberitahu Beijing dan Washington pada Senin tentang rencana untuk ujicoba tersebut, kata kantor berita Korsel Yonhap. Negaraterkuciltersebut,yang berdasarkan resolusi DK PBB dilarang mengembangkan teknologi nuklir dan rudal, tidak memberi komentar. Kementrian Pertahanan Korsel mengatakan, gempat di Korut kemungkinan dampak dari ledakan nuklir seberat 6-7 ton atau lebih. Presiden Korsel Lee Myung-bak menyerukan pertemuan dewan keamanan nasional pada pukul 04:00 waktu setempat. Korut mengumumkan rencana ujicoba nuklir ketiga sebagai tanggapan atas sanksi yang dijatuhkan Januari lalu setelah negara tersebut meluncurkan roket, meskipun gambaran satelit menunjukkan negara itu telah mempersiapkan tempat ujicoba itu selama lebih dari setahun. Presiden AS Barack Obama menegaskan, Korut jelas melan-

carkan provokasi melalui ujicoba nuklirnya Selasa. Percobaan nuklir skala mini Korut itu tidak akan membuat negara komunis di Semenanjung Korea itu aman, malah menyulut kecaman dunia. Obama juga berjanji dalam pernyataan tertulis,Washington akan kembali waspada menghadapi serangan dari negara penganut Paham Stalin itu dan memperkuathubungandengansekutu AS di Asia. “Tindakan provokasi itu tidak akan membuat Korea Utaradalamkeadaanaman,”kata Obama. Pihak berwenang Korsel di Seoul berada dalam keadaan siap siagaditengahupayapemerintah Korut di Pyongyang yang berketetapan akan melakukan ujicoba nuklir ketiga kalinya sebagai aksi menentang pemberlakuan sanksi PBB karena peluncuran roket pada Desember 2012. Sekjen PBB Ban Ki-moon mengutuk tindakan Korut yang mengadakan uji coba nuklir. “Sekretaris Jenderal mengutuk ujicoba senjata yang dilakukan oleh Korut. Ini jelasjelas meru-pakan pelanggaran terhadap resolusi Dewan Keamanan,” kata Jurubicara Ban, Martin Nesirky, dalam sebuah pernyataan tertulisnya. (m23/m10)

Kardinal Ghana Calon Pengganti Benediktus VATICAN CITY (Waspada): KardinalasalGhanaPeterTurkson disebut-sebut sebagai calon kuat pengganti Paus Benediktus XVI. Dia seakan memanifestasikan keinginan sebagian warga dunia bahwa jabatan Paus hendaknya dapat juga diemban oleh kardinal yang bukan berasal dari Eropa. Siapa sebenarnya Kardinal PeterTurkson. Dia kini menjabat sebagai presiden dari lembaga kepausan untuk keadilan dan perdamaian,sebagaimanadikutip dari laman Guardian. Perkembangan gereja Katolik di Afrika mengalami modernisasi sangat pesat. Peter Turkson lahir di Ghana baratdariibuberagamaMethodis danayahKatholik.Sebagaiseorang pelajar di seminari (sekolah bagi para calon pastor Katholik), dia dikenal sebagai anak yang kontemplatif. Diamendapatdorongankuat dari sang ibu agar belajar di seminari dengan bersungguhsungguh untuk menjadi imam Katholik. Dia kemudian meneruskan studi di Seminari St Anthonyo on Hudson di Rensselaer, New York. Dia kemudian ditahbiskan menjadi imam Katholik pada 1975. Kembali ke Ghana, dia

menjadi profesor di Seminari St Theresia. Dia mendedikasikan keahliannya di bidang pelayanan bagi umat Katholik di kawasan itu.Pada1992,diaterpilihmenjadi Uskup Agung Cape Coast oleh Paus Johanes Paulus II. Dia juga menjadi ketua dari konferensi para uskup Ghana dari 1997 sampai 2005. Dia berperan menjadi penengah bagi perdamaian di Pantai Gadingpada2011.PemilihanPaus yang bakal diikuti oleh seluruh kardinal dari seluruh dunia itu akan digelar pada akhir Maret 2013. SelainTurkson, ada sejumlah nama yang disebut-sebut sebagai kandidat pengganti paus Benediktus XVI, yakni Kardinal asal Nigeria Francis Arinze, Kardinal Marc Ouellet asal Kanada dan Kardinal Angelo Scola asal Italia. Kardinal Peter Turkson dari Ghanadianggapsebagaikandidat potensial dari Afrika. Tetapi kardinal berusia 64 tahun itu, tersandung masalah hubungan gereja dengan kelompok Islam di Ghana. Pada akhirnya, Turkson dilihat sebagai kandidat yang beresiko. Salah satu kandidat potensial lainnya berasal dari Amerika Latin.

Uskup Agung Sao Paolo, Brazil, Kardinal Odilo Pedro Scherer dianggap sebagai sosok kandidat yang memiliki peluang menggantikan Benediktus.Tetapi sepertinya pihak gereja belum sepenuhnya siap mendukung seorang paus dari Amerika Selatan.Kardinalberusia63tahun itu hanya dinilai sebagai calon di masa mendatang. Ada peluang juga Uskup Agung New York, Kardinal TimothyDolanmenjadipengganti Paus Benediktus.Tetapi kandidat dari Amerika harus menghadapi penolakan tradisional untuk memiliki paus yang berasal dari negara super-power. Setelah tidak lagi menjabat sebagai paus, Benediktus yang bernama Joseph Aloisius Ratzinger berkeinginan mendedikasikan “hidupnya untuk doa”. Filipina memuji Dari Manila dilaporkan, para pemimpin gereja di Filipina — negara Katholik terbesar di Asia — mengatakan mereka terkejut pada keputusan Paus Benediktus XVI untuk mengundurkan diri dan memuji langkahnya dan berdoa agar suksesinya berjalan sesuai dengan apa yang diharapkan.

Fr. Francis Lucas dari KonferensiParaUskupKatholikFilipina mengatakan Selasa (12/2) bahwa para uskup dan pendeta telah menerima kabar tentang keputusan Paus dengan rasa ‘kaget dan cemas,’ tetapi memuji kerendahan hatinya untuk mengakui dia tidak lagi mampu secara fisik untuk menangani kepausan. Lucas mengatakan telah ada permintaan untuk Paus berikutnya yang akan dipilih di antara para kardinal dari Asia, Afrika atau Amerika Latin dan meminta Filipina berdoa agar“Yang Maha Kuasa terus membimbing ... kardinal kami” dalam memilih Paus. Dari Berlin dilaporkan, saudara Paus Benediktus XVI mengatakan bahwa dia telah berbicara dengan pemimpim Katholik dunia itu setelah pengumumannya yang mengejutkan bahwa dia mengundurkan diri dan dia tidak berencana untuk pindah kembali ke kampung halamannya di Jerman setelah pensiun. Georg Ratzinger, saudara Paus yang berusia 89 tahun, mengatakan Selasa bahwa tampaknya Benediktus senang tetap tinggal diVatican.(bbc/ap/ vn/m10)

Gema Internasional

Apa Reaksi AS Jika Israel Menyerang Iran? KALI ini saya sajikan suatu cerita dari negeri Paman Sam, cerita ini bisa disebut sebagai imajiner masih sekitar regional Timur Tengah fokusnya lebih tertuju kepada kegatalan Israel untuk menyerbu Iran yang tujuannya tak lain adalah menghancurkan pusat penelitian dan pengembangan nuklir yang disinyalir oleh Israel, AS dan negara-negara Eropa yang menganggap Iran sedang mengembangkan atau memproduksi persenjataan nuklir. Cerita yang saya anggap imajiner ini bisa saja menjadi kenyataan apabila Israel (dan tentu saja bersama dengan Amerika Serikat) benar-benar

berkeinginan menyerbu Iran. Kalau AS dan Israel tidak menahan diri maka konflik yang terjadi tidak saja merembet ke wilayahTimurTengah tetapi juga dunia internasional akan terkena dampaknya pula baik langsung maupun tidak langsung. Jadi cerita ini berkisar di antara dua negara yang saling berpelukan satu sama lain. Sumber cerita saya kembangkan dari berbagai sumber dengan tujuan menjadi pemikiran dan perhatian kita semuanya bahwa perang bukanlah merupakan suatu keuntungan, lebih banyak ruginya. Kisahnya: Berbulan-bulan Israel telah mencancam menghancurkan tempat penyimpanan nuklir Iran. Amerika Serikat meminta Israel untuk mengendalikan diri. Jika benar-benar operasi penyerbuan ini dilaksanakan timbul pertanyaan:“Bagaimana kemungkinan reaksi Washington?” Presiden AS Barack Obama

sedang menikmati makan malamnya yang tenang bersama isteri dan anak-anaknya Kamis malam bulan Oktober. Dia mendapatpemberitahuanbahwadua lusin pesawat jet tempur Israel telah memasuki udara Jordania, nampaknya mengarah ke Iran. Pesawat tempur tersebut masuk wilayah udara Irak dan akan masukkeIrandiperkirakandalam waktu 85 menit. Dalamwaktu45menitkepala stafkeamananpresidenmengundang rapat di Situation Room. Menhan Leon Panetta menginformasikan peserta rapat bahwa dia telah berusaha menghubungi PM Israel Benjamin Netanyahu namuntakdapatsambungantapi para panglima Israel sedang memberi briefing Pentagon mengenai sasaran Israel. Panettamempersiapkanopsi AS: membujuk Netanyahu untuk menghentikanseranganataumenembak jatuh pesawat tempur Israel.Wapres Joe Biden berpen-

dapat bahwa menembak jatuh pesawat bukan suatu opsi. Biden marah, hubungan Bibi, nama panggilan Netanyahu, katakan Presiden AS ingin berbicara dengannya sekarang. Dalam beberapa menit suara Netanyahu terdengar dan dia segera dengan cepat menghentikan semua usaha misi itu. Bibi dengan tenang menyatakan kepada Obama bahwa dia tak dapat menunggu lebih lama, “saya bertanggungjawab bagi keamanan bangsa Yahudi.”. Ketika Netanyahu menjelaskan operasi militernya, mata Obama memperhatikan peta elektronik Timur Tengah yang ada di dinding Situation Room. Kordinat pesawat Israel menunjukkan bahwa mereka sedang mendekati wilayah Iran. Kembali terdengar suara Netanyahu mengatakan kepada Presiden Obama bahwa dia mengharapkan dukungan penuh Amerika Serikat.

Muka Obama menyembunyikan perasaan cacimakinya, dia terdiam sejenak sebelum menjawab: “Anda tahu saya menghormati hak anda untuk mempertahankan diri sendiri tetapi saya perlu mengambil langkah menurut kepentingan Amerika Serikat.” Sementara itu Menhan Panetta memerintahkan Jend. James Mattis sebagai Komando Sentral AS untuk mengaktifkan Operation Gulf Shield, menempatkan kekuatan militer AS di TimurTengah dengan sikap siaga penuh terhadap pembalasan Iran. Obama meminta pandangan peserta rapat, apa yang akan dikatakan kepada Iran? Iran pastilah berasumsi bahwa AS berada di belakang tindakan Israel. Garis pertempuran dengan cepat segera digambarkan. Susan Rice, dutabesar AS untuk PBB adalah yang pertama menyetujui via video teleconference menyatakan bahwa AS memerlukan

kejelasan Israel bertindak tanpa sepengetahuan AS. Iran sendiri yakin bahwa jika mereka meresponserbuanIsrael,ASakan masuk dalam perang ini. Direktur CIA menyatakan bahwajikaASmengirimkanpesan kepada Iran, mereka akan berpikir bahwa mereka dapat melakukan pembalasn tanpa respon dari Amerika. Mereka yakinASakanikutterjunkedalam perang ini. The American Israel Public Affairs Committee (AIPAC) tak ketinggalan ikut imajiner ini. Merekamulaimengedarkandraft resolusi ke Capitol Hill meminta kepadaSenatsuatuunconditional support untuk Israel. Cerita ini sekilas seperti tidak ada apa-apanya, namun bisa jadi letupan konflik sewaktu-waktu bisa terjadi apabila tidak segera dipintasi oleh para “pemangku kekuasaan” negara-negara yang terlibat sebagaimana saya kemukakan di atas. (Kosky)

KAIRO, Mesir (Reuters): Para pengunjukrasa yang menuntut Presiden Mesir Mohammed Moursi agar mundur bentrok dengan polisi di luar istana kepresidenan pada tahun kedua peringatan lengsernya pemimpin otoriter Hosni Mubarak. Puluhan pemuda melempari istana Ettihadiya dengan batu Senin (11/2) setelah pawai damai dilakukan ribuan demonstran yang menuduh Persaudaraan Muslim konservatif pimpinan Moursi membajak revolusi demokrasi Mesir dan mencoba memonopoli kekuasaan. Polisi membalas dengan menembakkan bom air dan gas air mata dari tembok kompleks kepresidenan, yang telah ditinggikan di beberapa bagian dan dipasangi kawat berduri setelah bom bensin menyebabkan kebakaran di satu bangunan di kompleks itu minggu lalu. Bentrokan tersebut, yang kelihatannya lebih kecil dan tidak begitu keras dibanding aksi unjukrasa anti Moursi sebelumnya, disiarkan secara langsung di saluran televisi. “Jumlah kami mungkin sedikit, tapi kami tidak akan mundur dari memerangi para penjahata yang mengenakan seragam polisi,” kata Ahmed Farghaly, seorang pengunjukrasa di luar istana kepresidenan. Polisi anti huru-hara tak lama kemudian keluar untuk mengejar para pengunjukrasa sampai ke pinggir jalan. Jubir kepresidenan Yasser Ali mengimbau semua pihak untuk mengecam bentrokan itu. “Kekerasan hanya akan membakar jari-jari orang yang menyulut dan menggunakannya…presiden mendukung semua unjukrasa damai dan kebebasan berpendapat namun usaha untuk merusak aksi damai akan ditangani dengan tegas,” kata Ali lewat televise Senin. Dia membantah spekulasi yang menyatakan Presiden Moursi akan membubarkan kabinet yang ada dan membantuk pemerintah persatuan nasional, dengan mengatakan “itu tidak benar.” PartaioposisisaatinimenuntutagarMoursidiadiliterkaittewasnya hampir 60 demonstran dalam aksi anti pemerintah yang terjadi 25 Januari lalu, namun jaksa umum mengatakan tidak ada bukti yang menghubungkan presiden yang terpilih secara demokrasi itu dengan kematian tersebut.(m23)

Tiga WNI Tewas Dalam Kecelakaan Di Kapal Malta LA PALMA, Pulau Canary (AP): Satu sampan penyelamat yang digunakan dalam satu pelatihan keselamatan di atas satu kapal mewah di Kepulauan Canary, Spanyol, jatuh kira-kira 20 meter ke satu pelabuhan ketika sampan tersebut jatuh dan sejumlah anggota awak kapal terperangkap di bawahnya, yang menyebabkan lima orang tewas, demikian menurut sejumlah pejabat. Tidak seorang pun dari ratusan penumpang yang ada di atas kapal yang dioperasikan Inggris itu yang terlibat dalam kecelakaan tersebut, yang juga mencederai tiga awak lainnya, kata otorita pelabuhan Kepulauan Canary. Para penyelam bergegas ke lokasi sampan penyelamat tersebut, yang jatuh ke laut dengan posisi telungkup. Mereka menemukan empat mayat dan berusaha menyelamatkan satu orang lainnya, namun gagal, karena korban terhenti pernafasannya, kata pihak otorita pelabuhan itu. Thomson Cruises membenarkan terjadinya kecelakaan dan jatuhnya korban di atas kapalnya Thomson Majesty di Pulau La Palma, Kepulauan Canary, Spanyol, yang menyebutkan tiga awak korban cedera mengalami cedera yang tidak serius. Kejadian terjadi ketika sampan penyelamat itu hendak diturunkan dari Kapal Pesiar Thomson Majesty Minggu (10/2). Tetapi, kabel yang digunakan untuk menurukan kapal terputus. Insiden ini membuat kru yang berada di kapal itu ikut terjatuh dan pada akhirnya tewas. Diantaralimakorbantewas,tigadiketahuiwarganegaraIndonesia, seorang warga Filipina dan seorang warga negara Ghana. Seluruh korban tewas dan korban luka saat ini berada di Pulau La Palma untuk dibawa ke rumah sakit setempat. Kementerian Luar Negeri RI, telah mendapatkan identitas tiga warga negara Indonesia yang meninggal akibat kecelakaan suatu kapal pesiar di Kepulauan Canary Minggu. Media setempat memberitakan bahwa mereka termasuk lima awak kapal yang tewas dalam latihan evakuasi penumpang. Direktur Perlindungan WNI Kemenlu Tatang Razak mengungkapkan bahwa identitas tigaWNI yang tewas itu didapat dari Director de la Administracion del Estado en la Palma, Miguel A Morcuende Hurtado, yang disampaikan ke Kedutaan Besar Republik Indonesia di Madrid, Spanyol. Mereka berinisial KAM, 56, NGA, 60, dan HAS, 34. Pihak Kemlu meminta identitas lengkap para korban tidak diungkapkan terlebih dulu, karena pihak keluarga masih sedang dihubungi.(m10)

The Associated Press

SATU boat berwarna oranye dari regu penyelamat berhenti dekat satu sampan penyelamat yang terbalik dari kapal penumpang yang dioperasikan perusahaan Inggris Thomson Majesty di pelabuhan Santa Cruz,Pulau La Palma,Kepulauan Canary,Spanyol, Minggu (10/2).

SEPUTAR ASEAN Presiden Filipina Segera Pilih Anggota Komisi Transisi MANILA, Filipina (Antara/Xinhua-OANA): Presiden Filipina Benigno Aquino III Senin (11/2) mengatakan dia akan mengumumkan para anggota Komisi Transisi terdiri 15 orang dalam pekan ini. Komisi Transisi Bangsamoro adalah badan yang bertugas untuk menyusun Undang-Undang Dasar Bangsamoro sebagaimana diatur dalam Persetujuan Kerangka Kerja mengenai Bangsamoro (FAB). “Daftar anggota yang diusulkan telah disampaikan kepada saya pekan lalu, tetapi saya belum meninjau ringkasan dari para calon. Kami ingin tampil dengan kelompok terbaik dari orang-orang yang akan menyusun hukum organik,” kata Aquino. Dia dan Ketua Front Pembebasan Islam Moro (MILF) Al haj Murad Ebrahim meluncurkan program layanan dasar bagi masyarakat di berdasarkan usulan wilayah otonom Bangsamoro Senin. Diberi nama sebagai Sajahatra Bangsamoro, program ini diluncurkan di provinsi Filipina selatan Maguindanao.Program ini akan dilaksanakan dalam 18 bulan. Asuransi kesehatan pemerintah dan Kas untuk Program Kerja akan mencakup 11.000 penerima manfaat MILF, sementara 500 pemuda Moro akan dapat memanfaatkan beasiswa.

Thailand Perketat Pengamanan Di Konsulat AS Chiang Mai BANGKOK, Thailand (AP): Pihak berwenang Thailand memperketat langkah pengamanan di Konsulat AS di Chiang Mai, kota di provinsi utara negeri itu, setelah adanya berbagai laporan yang menyebutkan tentang kemungkinan serangan dari kelompok al-Qaida dan Salafis bulan ini, demikian menurut para pejabat Selasa (12/2). PM Yingluck Shinawatra mengatakan kepada para wartawan dia telah diberitahu tentang laporan tersebut dan dia telah memerintahkan badan-badan keamanan untuk menambah pasukan guna mengamankan fasilitas tersebut, yang berada 570 km di utara Bangkok. “Kedubes AS di Thailand tidak meminta langkah pengamanan ekstra, namun kami harus memantau situasi sesering mungkin,” kata Yingluck. Deputi PM Chalerm Yubumrung menolak untuk memberikan rincian ancaman tersebut.(m10)



WASPADA Rabu 13 Februari 2013

Klasemen Liga Premier Man United 26 Man City 26 Chelsea 26 Tottenham 26 Arsenal 26 Everton 26 Swansea 26 West Brom 26 Liverpool 26 Stoke 26 West Ham 26 Fulham 26 Sunderland 26 Norwich 26 Southampton26 Newcastle 26 Aston Villa 26 Reading 26 Wigan 26 QPR 26


ENTRENADOR Jose Mourinho (tengah) dan asistennya mengawasi ketat latihan Cristiano Ronaldo (atas) dan kawan-kawan di Madrid, Selasa (12/2).

Optimis Los Blancos MADRID (Waspada): Striker Gonzalo Higuain optimis, Real Madrid mampu mengatasi Manchester United dalam laga yang turut ditayangkan langsung SCTV dinihari nanti mulai pkl 02:45 WIB. “Pertama tentu mencoba untuk meraih kemenangan demi membahagiakan para pendukung dan kami sendiri,” klaim Higuain melalui The Sun, Selasa (12/2). “Manchester mungkin merupakan tim yang kompak, tetapi dari segi kualitas dan di atas kertas kami dapat memberikan banyak kesulitan kepada mereka,” tambah bomber asal Argentina itu.

Padahal, memasuki arena laga leg pertama babak 16 besar Liga Champions di Santiago Bernabeu nanti, Los Blancos hanya meraih dua kemenangan, dua imbang dan satu kekalahan dalam lima penampilan terakhirnya. Sebaliknya dalam lima pertandingan terakhir di seluruh kompetisi, Setan Merah MU meraih empat kemenangan dan sekali imbang. “Yang kami bu-

tuhkan hanya pertahanan solid, mentalitas juara juga semangat tim,” tepis Higuain. Bek MU Jonny Evans sepertinya sependapat sekaligus mengingatkan rekan-rekannya untuk tak terhipnotis sosok Cristiano Ronaldo seorang, melainkan El Real sebagai tim. “Saya yakin satu dua pemain kami masih menjaga kontak dengan Ronaldo, Nani juga menjalankan tugas internasional bersama dia. Saya tidak tahu dengan siapa saja dia bicara, tapi saya yakin dia sangat fokus menatap duel ini seperti halnya kami,” jelas Evans. “Tapi saya rasa ini semua bukan hanya mengenai Cristiano Ronaldo. Ada sejarah kedua

Leg I Babak 16 Besar LC Malam Ini (GMT) Di Donetsk : Shakhtar (UKR) v B Dortmund (GER) Di Madrid : Real Madrid (ESP) v M United (ENG) *SCTV live mulai pkl 02:45 WIB klub, babak paling glamour dan siapapun tak sabar menatap laga ini,” katanya lagi. Evans juga membeberkan perubahan gaya bermain Ronaldo sejak meninggalkan Old Trafford untuk berlabuh di Santiago Bernabeu, empat musim silam. “Tapi yang jelas mereka (Madrid) tak hanya punya Ronaldo untuk dapat menyakiti Anda. Mereka punya banyak pemain yang dapat membuat masalah. Dia hanya akan menjadi salah

19:45 19:45

satu pemain yang harus dihentikan,” tegas Evans. Bek veteran MU Rio Ferdinand mendukung pendapat juniornya tersebut. “Kami harus menempatkan sebanyak mungkin pemain di sekitar bola ketika Ronaldo mendapatkannya,” bebernya. “Namun Madrid merupakan tim bagus. Kami harus memastikan berada di posisi yang tepat dan posisi yang bagus dari sisi pertahanan,” pungkas Ferdinand. (m15/okz/sun/espn)

Bocoran Formasi Madrid MADRID (Waspada): Entrenador Jose Mourinho menurut bocoran koran Marca, Selasa (12/2), sudah menentukan formasi 11 pemain yang akan diturunkannya saat Real Madrid menjamu Manchester United pada leg pertama babak 16 besar Liga Champions. Satu-satunya keraguan The Special One hanyalah penentuan bek sayap. Dengan belum fitnya Marcelo, Mourinho gamang dalam memilih Fabio Coentrao atau Alvaro Arbeloa sebagai bek kiri. Ketika El Clasico melawan Barcelona pada leg pertama semifinal Piala Raja, Mourinho menjadikan Michael Essien sebagai bek kanan dan Arbeloa sebagai bek kiri. Namun Marca mengklaim, Coentrao akan mengisi posisi bek sayap kiri, sedangkan Arbeloa di kanan untuk menjajal Setan Merah MU dinihari nanti di Santiago Bernabeu. Duet di jantung pertahanan akan menjadi milik Sergio Ramos dan Kepler Pepe, karena

Raphael Varane belum punya pengalaman yang cukup untuk bermain di laga penting sekelas Liga Champions. Untuk lini tengah dan depan tidak ada kejutan. Xabi Alonso dan Sami Khedira akan menjadi jangkar dalam formasi 1-4-23-1. Angel Di Maria, Mesut Oezil dan Cristiano Ronaldo, bermain di belakang striker Karim Benzema. Di bawah mistar, kiper utama Iker Casillas masih absen karena cedera. Mourinho memasang kiper anyar Diego Lopez sebagai starter, sedangkan Antonio Adan kembali duduk di bangku cadangan. Lopez yang didatangkan Los Blancos dari Sevilla pada bursa transfer Januari lalu, punya catatan yang pantas dibanggakan. Dia pernah menggagalkan penalti Lionel Messi, sehingga kematangan kiper 31 tahun itu lebih dibutuhkan mengingat Adan kerap tampil grogi menghadapi pertarungan besar. Pemilik nama lengkap Die-

go Lopez Rodriguez itu juga tampil gemilang saat melawan bekas klubnya, Sevilla, Dia berhasil mempertahankan gawangnya tetap perawan sekaligus membawa Madrid menang 4-0 akhir pekan lalu di La Liga. Kualitas Lopez mendapat pengakuan dari manajer Wigan Roberto Martinez, yang mengaku telah lama mengikuti sepak terjangnya. “Dia sangat gesit dan bagus di udara. Distribusinya juga luar biasa, menyamai level Pepe Reina dan segalanya tampak bagus bahkan sangat bagus,” puji Martinez. “Dia bagus saat satu lawan satu, dia sabar dan tak mementingkan diri sendiri. Dia terlihat tak punya kelemahan dan untuk seorang kiper dia sangat kuat,” tambah pelatih asal Spanyol itu. Satu catatan lain Lopez yang dapat menjadi modal penting Madrid, dia tak kebobolan di bawah mistarVillarreal ketika bersua MU pada fase grup Liga Champions 2008-09. Saat itu Villarreal dua kali bermain

21 2 3 62-31 15 8 3 48-24 14 7 5 55-28 14 6 6 44-30 12 8 6 50-29 10 12 4 40-32 9 10 7 38-29 11 4 11 36-35 9 9 8 44-34 7 12 7 26-31 8 6 12 29-38 7 8 11 36-42 7 8 11 28-34 6 11 9 25-40 6 9 11 36-45 7 6 13 34-46 5 9 12 25-50 5 8 13 33-48 5 6 15 30-51 2 11 13 19-41

65 53 49 48 44 42 37 37 36 33 30 29 29 29 27 27 24 23 21 17

Reds Apes LONDON ( Waspada): West Bromwich Albion melengkapi keunggulan gandanya atas Liverpool, Senin (Selasa WIB), setelah menang 2-0 saat tandang di Stadion Anfield. Dalam duel ini, kapten Steven Gerrard gagal membuat tim tuan rumah memimpin lebih dahulu karena eksekusi tendangan penaltinya menit 77 gagal bersarang di gawang The Baggies. Berselang empat menit setelah kegagalan Gerrard, West Brom secara mengejutkan membuka keunggulannya dengan gol Gareth McAuley. Tim tamu memantapkan kemenangannya melalui gol Romelu Lukaku menit 91. Menurut Soccerway, Selasa (12/2), Si Merah sebenarnya sa-


Titik Rawan Setan Merah LONDON (Waspada): Manchester United rawan kehilangan pemain serba bisa Phil Jones untuk laga leg pertama babak 16 besar Liga Champions melawan Real Madrid dinihari WIB nanti. Jones mengalami cedera betis kiri saat Si Setan Merah mengatasi Everton 2-0 akhir pekan lalu di Liga Premier. Dia tampil sangat bagus mengawal pemain berbahaya Everton Marouane Fellaini, sehingga mestinya menjadi sosok sentral dalam rencana manajer Sir Alex Ferguson untuk duel di Santiago Bernabeu. Namun pemain yang sangat bagus berposisi sebagai bek dan gelandang bertahan itu, tertatih-tatih meninggalkan lapangan pada babak kedua. “Dia mendapat tendangan di betis

dan kami akan memantaunya,” beber Sir Fergie dalam laman, selasa (12/2). Bek tengah Jonny Evans juga harus keluar lapangan karena mengalami kram. “Saya pikir dia hanya kekurangan beberapa pertandingan,” jelas Sir Fergie. Selain diragukan tanpa Jones dan Evans, The Red Devils juga punya titik rawan dengan keberadaan wasit Felix Brych yang akan memimpin duel klasik di markas Madrid. Brych merupakan wasit yang sempat mengusir NemanjaVidic pada kontra Otelul Galati di Liga Champions musim lalu. Vidic kena kartu merah langsung akibat menerjang Gabriel Giurgiu menit 66. Padahal laga 18 Oktober 2011 lalu itu

merupakan partai perdana Vidic setelah absen dua bulan lantaran cedera. Laga Setan Merah lain yang pernah dipimpinnya Brych adalah melawan Braga, yang dimenangkan pasukan Ferguson 3-1 pada babak penyisihan grup musim ini. Sedangkan laga Real Madrid yang sempat dipimpin Brych adalah saat pasukan Jose Mourinho membantai APOEL Nicosia 3-0 pada perempatfinal musim lalu. Juga ketika El Real menjamu Tottenham Hotspur dua musm lalu. Brych berusia 37 tahun asal Jerman, yang bekerja sebagai pengacara. Dialah wasit leg I semifinal musim lalu antara Chelsea menghadapi Barcelona. (m15/ant/rtr/espn)

ngat mendominasi permainan, bahkan melayangkan 15 shoot on goal. Namun The Reds benar-benar apes, sebab semua peluangnya gagal berbuah gol. “Pemain sudah memberikan segalanya. Ini termasuk laga sial, semua tendangan kami tak ada satupun yang berhasil masuk ke gawang lawan,” ratap manajer Brendan Rodgers kepada Sky Sports. Kiper Ben Foster merupakan pahlawan tim tamu, setelah melakukan banyak penyelamatan gemilang dan menjinakkan tendangan Gerrard dari titik putih karena Luis Suarez dijatuhkan Jonas Olsson di kotak terlarang West Brom. “Ben Foster melakukan beberapa penyelamatan fantastis. Kekalahan ini sungguh kekecewaan besar, tetapi kami akan bangkit besok dan berusaha kembali,” ujarnya lagi. Rodgers juga tak mau menyalahkan kegagalan penalti Gerrard. “Dia berani mengambil penalti tersebut. Jadi tak perlu disalahkan, lagipula itu pe-

nyelamatan yang bagus,” tegas Rodgers. Kemenangan itu merupakan mimpi yang menjadi kenyataan bagi Steve Clarke, mantan asisten pelatih Liverpool saat masih ditangani Kenny Dalglish. Bahkan pembalasan setimpal, sebab skuadnya digunduli Reds 3-0 pada pembuka laga musim ini di kandang sendiri. “Kami bermain bagus, ini merupakan kemenangan yang amat berarti bagi kami,” ucap Clarke, yang mengakhiri enam laga tanpa kemenangan bagi Baggies. Itu merupakan kemenangan kedua West Brom atas The Pool sejak musim 1966/67. Juga kemenangan ulang karena mereka juga menang di Anfield musim lalu. “Sejak pergantian tahun, keberuntungan menjauh dari kami. Tapi datang ke sini dan melawan Liverpool dan bermain amat bagus, tentu membuat para pemain amat bahagia,” klaim Clarke. (m15/sw/sky/uefa)

Leg I Babak 16 Besar LC Malam Ini (GMT) Di Donetsk: Shakhtar (UKR) v B Dortmund (GER) Di Madrid : Real Madrid (ESP) v M United (ENG) *SCTV live mulai pkl 02:45 WIB


19:45 19:45

Pukulan Dortmund


KIPER anyar Real Madrid Diego Lopez menggagalkan serangan mesin gol Barca Lionel Messi pada laga leg pertama perempatfinal Copa Del Rey, 13 Februari lalu. 0-0 di Old Trafford maupun El Madrigal. Pada Januari 2008, Lopez mampu menggagalkan penalti

Lionel Messi, kendati Villarreal dikalahkan Barcelona 0-1 di Camp Nou pada ajang Copa del Rey. (m15/vvn/marca/rtr)

DONETSK, Ukraina (Waspada): Kevin Grosskreutz absen dari pasukan Borussia Dortmund dalam laga tandang melawan Shakhtar Donetsk pada leg pertama babak 16 besar Liga Champions dinihari WIB nanti. Winger Grosskreutz mengalami gangguan kesehatan akibat virus dan sudah beberapa hari terakhir berada di rumah sakit untuk pemulihan. “Kevin pastinya tak bisa ambil bagian di laga Rabu,” ungkap pelatih Jurgen Klopp (foto). Dortmund juga rawan tanpa gelandang Ilkay Gundogan, yang mengalami cedera jempol kaki saat ditekuk Hamburg SV 4-1 akhir minggu lalu pada laga Bundesliga. Ini merupakan pukulan telak bagi juara dua tahun beruntun Bundesliga itu, yang juga mengalami penurunan prestasi di kancah domestik. Die Borussen kini rawan kehilangan gelar, karena sudah tertinggal 15 poin dari pemimpin klasemen Bayern Munich.

MILAN, Italia (Waspada): Presiden Inter Milan Massimo Moratti berharap, para pendukung klubnya menahan diri dari tindakan menghina Mario Balotelli. Hinaan-hinaan rasis terhadap Balotelli (foto kiri) memang menjadi spekulasi yang sangat mengkhawatirkan jelang derbi Milan pada laga Liga Seri A di Stadion Giuseppe Meazza. Balotelli gabung AC Milan dua pekan silam dari Manchester City. Mengingat bomber bengal berumur 22 tahun itu banyak berulah sebelum mandah dari Inter untuk berlabuh di City, tentu dia akan mendapat sambutan panas dari tifosi I Nerazzurri. Bahkan saat Inter menjamu Chievo akhir pekan lalu, teriakan-teriakan rasis yang ditujukan kepada Balotelli sudah terdengar di tribun, tempat sekelompok pendukung garis keras Inter mendiami lokasi tersebut. Moratti berharap hal itu tidak akan terulang ketika Balotelli yang membela La Beneamata pada 2006-2010, kembali ke Giuseppe Meazza dengan Milan pada 24 Februari. “Mereka berkata kepada saya bahwa terdapat teriakan rasis, namun saya tidak memahaminya. Saya benar-benar menyesal, saya berharap hal itu tidak terjadi saat derbi,” tutur Moratti, seperti dikutip dari AFP, Selasa (12/2). Balotelli memang sedang

menyedot perhatian, apalagi dia langsung menyumbangkan tiga gol dalam dua laga terakhir I Rossoneri. Dia pula yang menyelamatkan Milan dari kekalahan atas Cagliari dengan golnya dari titik 12 pas. Geliat Super Mario pun mulai menimbulkan persaingan di garis serang klub pemilik tujuh gelar juara Piala/Liga Champions tersebut. Terutama dengan penyerang muda Stephen El Shaarawy (foto kanan), yang sebelumnya menjadi target gol Il Diavolo Analisa media Italia, El Shaarawy dan Balotelli malah mempunyai tipe permainan yang mirip, sehingga sulit untuk bekerjasama. “Kritik yang kami

mengatakan, saya pasti akan bertahan sampai 2016,” papar pelatih berumur 45 tahun tersebut. “Semua orang berpikir jika klub seperti Chelsea atau Real Madrid datang, saya akan pergi. Anggapan ini tak bisa saya ubah, tapi mereka akan melihat kebenarannya,” klaim Klopp. Dengan penegasannya itu, plonglah Robert Lewandonski cs di Donetsk, meskipun Grosskreutz dan Gundogan tak masuk line-up. Apalagi Shakhtar pun tak kalah oleng, karena baru kehilangan Willian, pengatur permainan asal Brazil. Willian pindah ke Anzhi Makhachkala dengan harga 35 juta euro akhir Januari lalu, menyusul permintaan pelatih Mircea Lucescu. Cabutnya Willian bahkan bisa merusak stabilitas Shakhtar sebagai juara Liga Ukraina dalam tiga musim terakhir. (m15/goal/les/espn)

AP MADRID (Antara/Reuters): Penyerang Barcelona David Villa dibawa ke rumah sakit dan dipastikan absen dalam pertandingan La Liga Primera melawan tuan rumah Granada, Sabtu (16/2) mendatang. Menurut keterangan dalam laman yang dikutip Selasa (12/2), striker Spanyol berusia 31 tahun itu kelihatannya akan menjalani operasi untuk mengangkat penyakit batu ginjalnya. Villa juga masih dalam proses penyembuhan cedera kaki yang dialaminya pada kompetisi Piala Dunia Antar Klub di Jepang, Desember 2011. Dia mencetak lima gol dalam pertandingan liga musim ini dan lima gol pada kompetisi Piala Raja, namun belum dapat dipastikan turun melawan AC Milan pekan depan pada leg pertama babak 16 besar Liga Champions. Sepanjang musim ini, mantan mesin gol Valencia itu baru 16 kali membela El Barca, 8 sebagai starter dan 8 lagi turun dari bangku cadangan.

Klasemen Liga Seri A Juventus 24 17 4 3 50-16 55 Napoli 24 15 5 4 46-21 50 Lazio 24 13 5 6 35-26 44 Inter Milan 24 13 4 7 39-29 43 AC Milan 24 12 5 7 42-30 41 Fiorentina 24 11 6 7 41-29 39 Udinese 24 9 9 6 35-33 36 Catania 24 10 6 8 31-30 36 AS Roma 24 10 4 10 50-45 34 Parma 24 8 8 8 30-31 32 Sampdoria* 24 8 5 11 31-30 28 Torino* 24 6 11 7 27-27 28 Chievo 24 8 4 12 25-39 28 Atalanta* 24 8 5 11 21-33 27 Bologna 24 7 5 12 33-34 26 Cagliari 24 6 7 11 26-41 25 Genoa 24 5 7 12 25-37 22 Pescara 24 6 3 15 20-49 21 Siena* 24 6 6 12 24-34 18 Palermo 24 3 9 12 21-38 18 *Siena dikurangi 6 poin, Atalanta 2, Torino & Sampdoria 1 angka.

Namun Dortmund tetap dianggap sebagai kuda hitam Liga Champions, setelah memuncaki penyisihan grup yang dihuni Real Madrid, Manchester City, dan Ajax Amsterdam. Karenanya jelang lawatan ke markas Shakhtar, Klopp berusaha memotivasi pasukannya dengan menegaskan tak bakalan hengkang dari Signal Iduna Park. Dia mengaku tak akan tergoda, kendati mendapat tawaran untuk menukangi raksasa Madrid atau Chelsea. “Saya menikmati apa yang saya lakukan di Dortmund. Ini klub hebat, kota hebat, segalanya baik-baik saja,” tegas Klopp kepada London Evening Standard, yang dikutip Selasa (12/2). Nama Klopp mengemuka sebagai calon pengganti Rafael Benitez di Stamford Bridge pada akhir musim. Dia juga dikaitkaitkan dengan kursi entrenador El Real, yang kemungkinan ditinggalkan Jose Mourinho. “Saya mempunyai kontrak sampai 2016. Saya telah 20 kali

Villa Sakit Ginjal

Harap Jangan Hina Balotelli

GELANDANG Shinji Kagawa (tengah) ceria menyaksikan rekan-rekannya memainkan bola dalam sesi latihan MU di Carrington, Manchester, Selasa (12/2).


STRIKER Liverpool Luis Suarez (bawah) ditekan bek West Brom Steven Reid di Anfield Stadium, Selasa (12/2) dinihari WIB.


terima tampaknya agak berlebihan. Kami baru memainkan dua partain bersama-sama dan kami perlu waktu,” tutur El Shaarawy melalui Milan Channel. “Saya tahu kami perlu untuk meningkatkan di beberapa daerah dari permainan kami. Tetapi tidak benar bahwa kami tidak bisa bekerjasama,” tepis bomber berumur 20 tahun berdarah Mesir tersebut. El Shaarawy juga mengaku jengkel dengan cedera lutut yang dialaminya. “Saya memiliki masalah pada lutut saya selama dua atau tiga musim terakhir. Saya dapat mengatasi setiap masalah, namun sekarang masalah ini membuat saya jengkel,” katanya menambahkan. (m15/ant/afp/mc)

Gunners Sewakan Santos LONDON (Antara/AFP): Pemain bertahan Arsenal Andre Santos bergabung dengan Gremio dengan sistem sewa hingga akhir musim. Santos dikontrak The Gunners dari klub Turki Fenerbahce senilai 6,8 juta pound pada Agustus 2011. “Andre Santos bergabung dengan tim Brazili Gremio untuk musim 2012/13,” demikian pernyataan dalam laman Arsenal, yang dikutip Selasa (12/2). Santos sebelumnya pernah bermain di klub-klub Brazil seperti Corinthians, Atletico Reuters Mineiro, Flamengo dan Figueirense. Dia sudah tampil 36 kali membela Gunners, namun belakangan kalah bersaing dengan Nacho Monreal, Bacary Sagna dan Carl Jelkinson.


WASPADA Rabu 13 Februari 2013


36 Tim Perebutkan Piala Gatot SSF U-11 SSB Patriot Medan MEDAN (Waspada): Sejumlah 36 tim SSB di Sumut bersaing dalam Super Seri Festival VII U-11 memperebutkan Piala Plt Gubsu, Gatot Pujonugroho ST, di Lapangan SSB Patriot, Jl Air Bersih Medan, 12-17 Februari 2013. Festival yang diadakan SSB Patriot Medan itu dibuka resmi Ketua Pengprov PSSI Sumut, Drs H Darwin Syamsul, Selasa (12/2). Darwin memberikan apresiasi kepada SSB Patriot yang tetap eksis menggelar kompetisi usia dini. “SFF U-11 ini sudah tujuh kali berturut-turut digelar. Tentu ini satu kegiatan yang sangat positif bagi perkembangan pembinaan pemain usia dini. Kita berharap SSB yang lain juga bisa mengikuti apa yang sudah dilakukan SSB Patriot Medan,” ujarnya. Darwin juga mendukung penuh rencana SSB Patriot mendirikan Semi Akademi Sepakbola Project 2019. Menurutnya, rencana tersebut diharapkan berjalan lancar dan

semi akademi tersebut dapat membina potensi-potensi sepakbola terbaik di Sumut. Ketua Umum SSB Patriot, Drs Hendra DS, mengaku pihaknya senantiasa komit dalam mendukung pembinaan pemain usia dini di Sumut. Salah satunya dengan rutin menggelar Super Seri Festival U-11 yang sudah memasuki tahun ketujuh. “SSB Patriot juga segera mendirikan Semi Akademi Sepakbola Project 2019 dengan merekrut pemain-pemain muda berbakat kelahiran tahun 1999 dan 2000. Mereka akan kami bina secara intensif dan diharapkan pada tahun 2019 menjadi pemain yang siap bersaing di berbagai kompetisi, seperti PON 2020 dan sebagainya,” ujar Hendra. Dikatakan, semi akademi sepakbola dimaksud dapat diikuti siswa SSB mana saja di Sumut. Ketika pemain akan membela SSB-nya dalam satu kompetisi, pengelola akademi siap memberikan izin. Selama mengikuti

Waspada/Dedi Riono

KETUA Pengprov PSSI Sumut Drs H Darwin Syamsul disaksikan Ketua Umum SSB Patriot Medan Drs Hendra DS menyerahkan bola kepada wasit dalam pembukaan SFF U-11 di Lapangan Air Bersih Medan, Selasa (12/2). program akademi, sejumlah fasilitas juga akan diberikan kepada pemain. “Semi akademi sepakbola ini diharapkan menjadi Kawah Candradimuka (penggodokan sejumlah pemain berbakat masa depan Sumut). Kami berharap mereka menjadi pemainpemain hebat yang dapat me-

ngangkat citra sepakbola daerah dan nasional,” jelas Hendra. Ketua Panitia Turnamen, Ripho Buwono, mengatakan 36 tim yang bersaing berasal dari sejumlah kabupaten/kota di Sumut, di antaranya Kota Medan, Deliserdang, dan Tanah Karo. Selain piala, panitia juga menyiapkan hadiah dana pem-

binaan puluhan juta rupiah. Dalam pertandingan pembuka, juara bertahan SSB Kompas mengemas poin penuh setelah menaklukkan SSB Medan Soccer 3-0. Tiga gol kemenangan Kompas masingmasing dicetak Alfiansyah, Zam Zami, dan Halwan. (m42)

Gaji Pelatih Belum Cair Exco PSSI Evaluasi Manajemen Timnas JAKARTA (Waspada): Komite Eksekutif (Exco) PSSI pimpinan Djohar Arifin akan melakukan evaluasi pada manajemen tim nasional dari semua level, termasuk mengenai belum cairnya gaji pelatih. Koordinator Timnas Bob Hippy di Jakarta, Selasa (12/2) mengatakan, selain melakukan evaluasi yang rencananya digelar di Kantor PSSI Senayan Jakarta, Rabu (13/2), juga me-

minta pelatih memaparkan program yang akan dilakukan. “Besok juga akan ada pertemuan dengan direktur teknik (Lionel Charbonnier) terkait dengan visi dan misinya,” katanya.

Menurut dia, jajaran pelatih yang diundang dalam evaluasi dan pemaparan program adalah pelatih senior, U-23, U-16, serta pelatih U-14. Mereka juga diharapkan membawa daftar pemain yang akan dipanggil. Khusus untuk timnas senior, menurutnya, kemungkinan besar Exco PSSI akan meminta pertanggungjawaban terkait hasil pertandingan perdana

Waspada/Sukri Falah Harahap

BUPATI Tapsel Syahrul M Pasaribu bersama Muspida Plus dan Ketua KONI Sumut Gus Irawan Pasaribu melepas balon pertanda dibukanya Pordakab Tapsel 2013, Selasa (12/2).

Pordakab Tapsel Bergulir Lagi Gus Irawan: Momentum Kebangkitan P SIDIMPUAN (Waspada): Komite Olahraga Nasional Indonesia (KONI) bersama Pemkab Tapanuli Selatan menggelar kembali Pekan Olahraga Daerah Kabupaten (Pordakab) setelah 20 tahun vakum tidak pernah digelar. Pordakab yang berlangsung 12-17 Februari ini dibuka resmi Bupati Tapsel, H Syahrul M Pasaribu, didampingi Ketua Umum KONI Sumut, Gus Irawan Pasaribu, di Stadion Naposo/HM Nurdin Kota Padangsidimpuan, Selasa (12/2). Ketua KONI Tapsel diwakili Wakil Ketua I Junaidi berharap Pordakab dapat membangkitkan semangat dan jiwa atlet. Menurutnya, Tapsel merupakan gudangnya atlet potensial yang kerap mampu mewakili Sumut di event-event nasional dan internasional, seperti Parluatan

Siregar dan Irwansyah Pulungan. Ketua Panitia, Daulat Siregar, mengatakan Pordakab digelar kembali sejak 20 tahun vakum. Dia berharap Pordakab mampu mengembalikan gairah pembinaan olahraga di Tapsel. Event ini diikuti 14 kecamatan memperlombakan cabor sepakbola, voli, tenis meja, catur, karate, atletik, dan bulutangkis. Ketua KONI Sumut, H Gus Irawan Pasaribu, mengatakan Pordakab bisa menjadi momentum bangkitnya pembinaan dan prestasi olahraga Tapsel. Dikatakan, menjadi atlet adalah pilihan tepat untuk generasi muda. Itu karena atlet berprestasi saat ini mendapat jaminan kehidupan. “Atlet berprestasi di SEA Games dan Asian Games diberi peluang khusus masuk PNS. Di Sumut, banyak atlet berprestasi

Problem Catur


Putih melangkah, mematikan lawannya empat langkah.

Jawaban di halaman A2. 8







1 A






bekerja di Bank Sumut dan sejumlah instansi pemerintah,” jelas Gus, sembari menyebut olahraga kita bisa membentengi diri dari hal-hal yang negatif. Bupati Tapsel, Syahrul M Pasaribu, menyebut Pordakab terakhir kali digelar pada zaman kepemimpinan Bupati Abdul Rasyid Nasution. Sejak vakum 20 tahun lalu, kini di zaman kepemimpinannya Pordakab kembali dihidupkan. “Kami berpendapat dengan diaktifkannya turnamen olahraga maka akan terlahir atlet berbakat dan berprestasi yang bisa mengangkat dan mengharumkan nama daerah di tingkat provinsi, nasional, dan internasional. Kemudian olahraga adalah awal dari kebangkitan daerah dan negara, karena badan dan pemikiran rakyatnya menjadi sehat,” katanya. (a27)



Pra-Piala Asia (PPA) 2015 Grup C melawan Irak serta persiapan untuk menghadapi Arab Saudi. Rencananya manajemen timnas senior kembali akan memanggil pemain yang turun saat menghadapi Irak serta ditambah lima pemain baru, yaitu Bambang Pamungkas, Titus Bonai, Erol FX Iba, Greg Nwokolo, dan Victor Igbonefo. Sedangkan Sekjen PSSI Halim Mahfudz mengaku, telah mendapatkan laporan dari jajaran pelatih timnas senior yang belum mendapatkan haknya, terutama gaji dalam beberapa bulan terakhir. “Semua orang tahu gimana kondisi keuangan PSSI. Yang jelas kami berusaha keras melunasi kewajiban meski caranya berbeda,” janji Halim. Terkait masalah Asisten Pelatih Timnas Senior Fabio Oliviera yang belum mendapatkan gaji kurang lebih lima bulan, Halim belum bisa berbuat banyak. Hanya saja pihaknya telah menyampaikan ke bagian keuangan. “Beberapa sudah ada yang dibayar. Beberapa sudah ada yang dinego. Bisa saja dibayar setengah dulu atau dicicil dengan batas waktu yang ditentukan,” jelas CEO Halma Strategic itu. Khusus mengenai persiapan laga melawan Arab Saudi, Bob Hippy mengklaim, pihaknya akan memaksimalkan pemain di kompetisi, karena ketatnya jadwal kompetisi, baik Indonesian Super League (ISL) dan In-


TIMNAS Senior asuhan Nilmaizar belum mendapat kepastian lokasi pelatnas Pra Piala Asia. donesian Premier League (IPL). “Jadwal cukup padat. Kondisi ini membuat ujicoba sulit dilakukan. Pemain akan dimaksimalkan di kompetisi saja,” beber Bob. Dia yakin, melalui kompetisi pemain akan lebih matang. Apalagi banyak pemain yang dipanggil untuk memperkuat timnas adalah mereka yang selama ini menjadi tim inti dari hampir semua klub yang ada di ISL maupun IPL. Kompetisi ISL yang dikelola PT Liga Indonesia sudah digulirkan sejak 5 Januari lalu, sedangkan IPL yang dikelola PT Liga Prima Indonesia Sportindo baru akan digulirkan 16 Februari nanti. “Kompetisi adalah tempat yang tepat untuk mematangkan pemain. Setelah itu masuk Pelatnas untuk mempersiapkan diri menjalani pertandingan bersama timnas,” katanya. Sesuai rencana, PSSI akan kembali memanggil sedikitnya 32 pemain untuk persiapan menjalani pertandingan melawan Arab Saudi, 23 Maret nanti. Pemanggilan pemain akan dimulai 13 Februari ini. Soal tempat pelatnas, Halim Mahfudz mengaku hingga kini belum mendapat laporan pasti setelah kepindahan dari Kota Medan. Informasi berkembang ada beberapa lokasi yang akan dijadikan lokasi pelatnas, yaitu Surabaya, Yogyakarta, atau Pekanbaru. (m42/ant)

Rahmatsyah Bangun Pimpin PABBSI Binjai BINJAI (Waspada): Rahmatsyah Bangun terpilih menjadi Ketua PABBSI Kota Binjai periode 2013-2017, melalui Musyawarah Cabang (Muscab) Persatuan Angkat Besi, Berat, dan Binaraga (PABBSI) di Binjai, Selasa (12/2). Muscab dibuka resmi Ketua KONI Binjai, Juli Sawitma Nasution SH MH, dihadiri pengurus klub pemilik suara. Peserta Muscab akhirnya sepakat memilih Rahmatsyah untuk memimpin PABBSI Binjai empat tahun ke depan. Juli Sawitma Nasution sangat mendukung kegiatan PABBSI Binjai dan berharap mampu melahirkan atlet-atlet berprestasi. Kepada ketua terpilih, Sawitna berharap dapat bekerjasama dengan klub-klub dalam meningkatkan pembinaan dan prestasi. PABBSI Kota Binjai juga diminta segera menyusun pokok program untuk jangka waktu empat tahun ke depan. Dikatakan, angkat berat merupakan olahraga membanggakan Indonesia di Olimpiade, sehingga diharapkan Binjai dapat melahirkan atletatlet andal. (a04)



1. Kota yang sempat heboh tentang operasi vasektomi untuk rekor Muri. 3. Perubahan reaksi tubuh terhadap zat, makanan tertentu. 6. Tumbuhan sayuran daun, brmanfaat untuk mengurangi risiko penyakit jantung dsb. 7. Buah bulat dari tanaman sayuran berwarna merah mengandung antioksidan likopen. 9. Singkatan kedokteran (biasa disingkat dengan fakultas). 11. Binatang yang hidup di air, antara lain salmon dan tuna, mengandung asam lemak omega-3. 12. Tanaman sayuran berwarna kuning jingga, bermanfaat untuk kesehatan mata dan mengurangi risiko kanker. 13. Tumbuhan seperti padi yang menghasilkan makanan avermut (oat), termasuk makanan sehat. 15. Hasil unggas yang dimakan untuk kesehatan tubuh. 16. Minuman kesehatan hasil fermentasi untuk menghadapi bakteri jahat di dalam tubuh. 17. Tidak makan sebelum check up. 23. Penyakit demam akibat gigitan tikus, tulisan mirip tts sudoku. 24. Pemanis makanan dan minuman, tidak baik jika dikonsumsi berlebihan. 25. Buah biru gelap tumbuh di

ISG Tetap Sesuai Jadwal JAKARTA (Waspada): Gubernur Riau, Rusli Zainal, menyatakan 3rd Islamic Solidarity Games (ISG) akan tetap berlangsung sesuai jadwal di Pekanbaru, 6-17 Juni mendatang. Menurut Rusli, persiapan yang telah dilakukan panitia, baik pusat maupun daerah, sudah berjalan sedemikian rupa, sehingga tidak ada alasan menunda pelaksanaan event bergengsi dua tahunan antarnegara Islam ini. “Insya Allah, Islamic Solidarity Games dilaksanakan sesuai tanggal yang ditentukan. Sampai detik ini, sama sekali tidak ada wacana untuk mengubah jadwal penyelenggaraan,” ucap Rusli yang saat ini tengah menghadapi kasus dugaan korupsi pelaksanaan PON di wilayahnya ketika dihubungi Selasa (12/2). Terkait kasus yang saat ini tengah menimpa dirinya, orang nomor satu di Provinsi Riau ini menyatakan tak ada dampak signifikan. Kalaupun ada, hanya motivasi para pekerja yang sejak lama mengorbankan waktu dan tenaganya agar event ini bisa berlangsung sukses. “Secara khusus tidak ada pengaruhnya. Apalagi, selama ini pemantapan persiapan juga terus dilakukan dalam rapat dengan panitia

nasional, pusat, dan daerah. Sejauh ini kami tidak menemukan adanya kendala berarti,” tambah Rusli. Bukti kesiapan Riau juga ditandai dengan kehadiran Islamic Solidarity Sport Federation (ISSF) ke “Negeri Lancang Kuning”, sebanyak tiga kali. Sehingga bisa dipastikan tak ada keraguan, melainkan keyakinan bahwa Riau bisa menggelar ISG dengan baik. “Kesiapan Riau sangat didukung dengan pengalaman menyelenggarakan PON 2012 yang dinilai sukses. Dengan jumlah cabor lebih sedikit dari PON, Insya Allah ISG akan bisa kami kerjakan dengan baik,” tandas Rusli. Seperti diketahui, ISG III akan mempertandingkan 17 cabor dan seluruh venue pertandingan berada di Kota Pekanbaru. Event ini diprakarsai Islamic Solidarity Sport Federation (ISSF) dengan gelaran perdana di Mekkah pada 2005 silam. Kala itu, Indonesia turut berpartisipasi dan merebut satu medali emas melalui cabang taekwondo. Sementara Iran yang ditunjuk sebagai tuan rumah ISG II pada 2009, batal menggelar event ini menyusul merebaknya virus flu burung yang melanda negeri itu. (yuslan)

Daud Fokus Pemantapan Teknik SEMARANG (Waspada): Juara dunia kelas bulu IBO, Daud Yordan, fokus latihan pemantapan teknik dan fisik sambil menunggu jadwal pertarungan perebutan gelar juara kedua kalinya. Petinju dengan rekor bertarung 30 kali menang (23 di antaranya dengan KO) dan dua kali kalah itu mengaku hingga saat ini persiapannya masih bersifat umum karena belum ada kepastian kapan dirinya naik ring untuk mempertahankan gelarnya. “Kalau nanti jadwal pertarungan sudah ada, baru saya fokus pada latihan yang bersifat

khusus,” kata Daud dihubungi Selasa (12/2). Petinju yang terakhir kali mempertahankan gelarnya saat menang angka atas Cho Tseveenpurev (Mongolia) di Singapura, 9 November 2012, mengatakan pemantapan teknik tersebut lebih banyak untuk menutup kelemahan dari pertandingan yang telah dilaksanakan. “Setiap kali naik ring sudah pasti mendapat pengalaman baru dan itu yang sedang kita godok sekarang dengan pelatih Damianus Yordan,” katanya lagi. (m42/ant)

Monster Ronaldo ...

musim panas lalu. “Van Persie sedang dalam performa yang sangat… sangat baik,” jelasnya kepada The Guardian. “Kami tidak melihat dia sebaik ini selama bertahun-tahun. Dia cepat, menyerang dengan baik, dia merupakan gangguan yang konstan,” tegas Ramos. Reuni terakhir Madrid-MU terjadi di perempatfinal Liga Champions 2002/2003. Setelah bermain 2-2 pada leg pertama di Old Trafford, hatrik Luiz Ronaldo waktu itu memangkan El Real 4-3 pada leg kedua di Santiago Bernabeu, sehingga Los Blancos lolos ke semifinal dengan kemenangan agregat 6-5. “Terkadang saya ingin menghadapi mereka (MU). Saya punya kenangan hebat dari masamasa saya di sana,” klaim Ronaldo, yang bertekad membangkitkan semangat El Merengues setelah musim buruk di La Liga dengan hanya menghuni peringkat tiga di bawah Barcelona dan Atletico Madrid.*Jonny Ramadhan Silalahi

(Lanjutan dari hal1)

“Saya ingin MU menang, tapi untuk kali pertama saya tak tahu apa yang sebenarnya terjadi. Saya prediksikan skor 4-3 untuk MU, Cristiano mencetak tiga gol,” beber Solskjaer dalam Marca. Berbagai komentar menyangkut duel klasik Los Blancos versus Red Devils memang cenderung didominasi figur Ronaldo dan RvP. Gelandang El Real sekaliber Xavi Alonso malah tak sungkan menyebut laga ini sebagai pentas Ronaldo. “Dia sangat senang sejak undian mempertemukan kami dengan MU Dia sangat kompetitif, mungkin itu bagian dari ajaran Sir Alex Ferguson di MU,” ungkap Alonso. Tetapi menurut bek Sergio Ramos, mereka juga mesti mewaspadai para penyerang MU, khususnya bomber Belanda RvP yang tetap subur setelah direkrut United dari Arsenal di bursa

Amerika Utara, musuh utama kanker. 26. Tali persahabatan (Menurut ilmuan Inggris dan AS, meningkatkan peluang berusia panjang).


1. Hilang kesadaran akibat minuman keras. 2. Penyakit puru, terutama pada kaki. 3. Bengek. 4. Merek obat diare diawali dengan “Neo”, produksi Kalbe. 5. Alat kelamin reproduktif, seperti rahim, indung telur dan vagina. 7. Menggoncangkan jiwa (tentang pengalaman yang dahsyat). 8. Penyakit ditularkan nyamuk anofeles. 10. Uji gen (singkatan populer). 14. Dragon; Buah kaya vitamin. 18. Universitas di Medan yang punya rumah sakit baru (singkatan). 19. Tabah; Tahan menghadapi cobaan sakit. 20. Penyakit perut disertai buangbuang air dan muntah-muntah, dapat menular. 21. Sakit perut seperti di remas-remas. 22. Berasa sesuatu pada kulit sehingga digaruk. 25. Buah berwarna merah yang dijus, kaya dengan karbohidrat dan zat besi.

Sudoku Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tingkat kesulitan: sedang (***), bisa diselesaikan kurang dari sepuluh menit. Jawaban di halaman A2 kolom 1.


8 3

9 5


8 4 5 4 6 9 5 2 2 1 8 9 1 2 3 4 3 4 1 9 2 5 4 2 7 2 5 7 9




WASPADA Rabu 13 Februari 2013

W illiams FW35 Le wati Tes Ter akhir Lew erakhir


Kimi Optimis Tatap Barcelona JEREZ, Spanyol (Waspada): Kimi Raikkonen (foto) sangat optimistis jelang menjalani tes pramusim kedua di Barcelona pada 19-22 Februari nanti. Keyakinan pebalap Lotus itu berdasarkan hasil maksimal pada tes pertama di Sirkuit Jerez, Spanyol. Seperti diketahui, Kimi berhasil menjadi pebalap tercepat pada sesi terakhir tes pramusim dengan raihan 1 menit 18.148 detik dengan 82 lap. Pebalap asal Finlandia itu mengaku senang dengan performa mobil anyarnya, E21. Jelang bergulirnya tes kedua, Kimi pun optimistis meraih hasil gemilang.

“Kami senang dengan apa yang kami raih dan itu merupakan tes yang bagus. Kami akan melihatnya saat balapan pertama, tetapi sejauh ini cukup bagus. Saya pikir mobil sedikit lebih baik,” ujar Kimi, Selasa (12/2). “Tahun lalu Lotus bagus di Barcelona dan saya tidak melihat alasan kami tidak bagus (tahun ini). Kami cukup bahagia dengan jalannya sesi ujicoba kemarin dan perkembangan mobil,” sambung The Ice Man. Meski begitu, mantan driver Ferrari tersebut menuturkan bahwa hasil tes pertama belum bisa dijadikan tolak ukur kesuk-

sesan dirinya di musim baru nanti. Kimi pun mengatakan Lotus sendiri masih melakukan perbaikan di segala sektor. “Semoga kami bisa meningkat di sana, tetapi kami belum memiliki ide. Pasalnya, kami tak tahu apa yang akan dilakukan tim lain,” ujar Kimi. “Ini hari-hari awal dan sejauh ini semuanya baik. Namun kami masih memiliki banyak pekerjaan. Saya yakin bakal menghadapi tahun yang sulit untuk melakukan pengembangan, tetapi itu hal yang normal di Formula 1,” tutup mantan pereli itu. (m33/auto)

JEREZ, Spanyol (Waspada): Mobil baru Williams-Renault FW35 (foto) melewati serangkaian ujicoba terakhir menjelang tes resmi kedua pramusim Formula 1 (F1) 2013 di Barcelona, pekan depan. Dengan demikian, mobil baru itu siap diluncurkan jelang ujicoba di trek. Williams menggunakan mesin 2012 dalam ujicoba resmi pertama di Sirkuit Jerez, Spanyol, pekan lalu. Mereka memutuskan untuk tidak menggunakan mobil baru agar fokus mengevaluasi ban Pirelli 2013. Namun setelah melewati sesi ujicoba terakhir seperti yang dijadwalkan, mobil baru tersebut sudah bisa dipakai pada 19 Februari mendatang bersamaan dengan ujicoba resmi kedua dimulai. Di Jerez pekan lalu, Pastor Maldonado mengatakan bahwa dirinya yakin dengan mesin baru Williams. Menurutnya, Williams sudah membuat sebuah langkah maju dan kini dirinya menantikan ujicoba di Barcelona. “Kami mencoba untuk melihat setiap komponen tunggal, segalanya.Tetapi semua mobil terlihat sangat mirip dengan tahun lalu, karena aturannya sama,” ujar Maldonado, Selasa (12/2). “Ada sebuah perbaikan kecil pada mobil dan kami cukup yakin bahwa akan sangat kompetitif tahun ini, bahkan lebih baik dari yang sebelumnya,” pungkas driver asal Venezuela itu. (m33/auto)


Minus Bintang Spurs Tetap Prima CHICAGO, AS (Waspada): San Antonio Spurs tampil tanpa trio Tony Parker, Tim Duncan, dan Manu Ginobili yang cedera. Namun, Spurs masih terlalu tangguh bagi Chicago Bulls yang dikalahkan 103-89, Selasa (12/2). Tanpa ketiga pemain bintang itu plus Stephen Jackson yang absen karena masalah pribadi, Spurs masih memiliki pemain berbakat untuk mengalahkan salah satu skuad terbaik di Wilayah Timur tersebut. Kawhi Leonard mampu mengisi peran Duncan dengan baik. Pemain pelapis tersebut menyumbang 26 angka, begitu juga dengan Danny Green yang mengganti peran Tony Parker mencetak 18 poin. Nate Robinson menghasilkan angka tertinggi untuk Bulls lewat 20 poin disusul Richard Hamilton 16 dan Carlos Boozer 14 angka. Spurs sempat memimpin 14 angka (60-46) di kuarter ketiga, nmun, Robinson membawa Bulls bangkit. Guard mungil nan lincah itu melakukan layup untuk memangkas ketertinggalan menjadi 69-73. Bahkan, Bulls sempat memangkas selisih menjadi 76-75 lewat slam dunk Taj Gibson. Namun, skuad besutan Tom Thibodeau gagal memanfaat-

kan momentum. Sebaliknya, Spurs bangkit dan mencetak tujuh angka beruntun untuk unggul 89-78. Sejak itu, Spurs tidak terkejar lagi dan meraih kemenangan 103-89. Kemenangan ini membuat Spurs semakin kokoh di puncak klasemenWilayah Barat dengan raihan 41 kemenangan dan 12 kekalahan. Bulls tetap di posisi keempatWilayah Timur dengan rekor 30-21. Setelah mencatatkan tujuh kemenangan beruntun, rekor Boston Celtics akhirnya terhenti. Dalam lawatannya ke markas Charlotte Bobcats, Celtics dipaksa menyerah 91-94. Kemenangan Bobcats ditandai penampilan gemilang Byron Muellens yang mencetak double-double dengan 25 poin 18 rebound. Ramon Sessions dan Kemba Walker masing-masing menambah 19 dan 18 poin. Kevin Garnett mencetak 16 angka 13 rebound untuk menjadi pemain terbaik Celtics. Paul Pierce menyumbang 13 poin

dan Jeff Green 18 angka. Celtics boleh berang dengan kekalahan ini karena di atas angin saat unggul 89-85 di sisa 2:46. Dalam semenit terakhir, Bobcats berhasil comeback berkat Gerald Henderson dan Sessions sekaligus menjadikan situasi berbalik Bobcats unggul 92-91. Pelanggaran Jason Terry di sisa 14 detik menghasilkan free throw yang dieksekusi sempurna olehWalker untuk memastikan kemenangan. (m33/ap)

Hasil Selasa (12/2) Brooklyn Nets vs Indiana Pacers Charlotte Bobcats vs Boston Celtics

89-84 94-91

Minnesota T’wolves vs Cleveland Cavaliers


LA Clippers vs Philadelphia 76ers


New Orleans Hornets vs Detroit Pistons


San Antonio Spurs vs Chicago Bulls


Washington Wizards vs Milwaukee Bucks


Atlanta Hawks vs Dallas Mavericks


VR46 Masih Mampu Bersaing GERNO DI LESMO, Italia (Waspada): Valentino Rossi (foto) tampil cukup gemilang saat mengikuti tes perdana di Sirkuit Sepang, Malaysia, pekan lalu. Ini membuktikan Rossi masih mampu bersaing di balapan MotoGP 2013 nanti. Setidaknya itulah ungkapan dari Ketua Tim Yamaha, Lin Jarvis, Selasa (12/2). Menurut-

nya, Rossi sudah berhasil menjawab keraguan mengenai kemampuannya. The Doctor berhasil finish di peringkat ketiga dengan ketinggalan 0.442 detik dari Dani Pedrosa (Repsol Honda) dan di belakang Jorge Lorenzo sepanjang sesi ujicoba perdana itu. Diketahui, The Doctor gagal meraih kemenangan saat dua

musim membela Ducati. Jarvis mengatakan kembalinya performa Rossi tidak hanya melegakan bagi pebalap berusia 33 tahun itu, tapi juga bagi MotoGP dan Yamaha. “Saya bisa bayangkan dari sudut pandangnya ini seperti udara segar, apalagi setelah dua tahun mengalami masa sulit. Jika mengalami kesulitan, maka

Anda akan ragu dengan kemampuan diri sendiri,” kata Jarvis. “Tidak ada keraguan Rossi tidak bisa menyatu dengan motor Ducati. Tapi setelah dua musim gagal, apakah Anda masih ragu? Kompetisi telah berlalu setelah itu, tapi melihatnya kembali di papan atas memastikan Rossi masih belum habis,” sambungnya. “Saya rasa Rossi masih realistis mengenai ini dan sadar akan kecepatan Pedrosa, (Marc) Marquez maupun Lorenzo. Tapi tidak ada keraguan dirinya akan bisa bersaing. Ini bagus untuk olahraga, Yamaha, dan tentunya membuat Rossi lega,”

tutup Jarvis. Rossi sendiri berambisi untuk mendapatkan banyak podium di musim baru nanti dengan menargetkan ingin menempati posisi tiga besar klasemen. Kendati sadar sulit bersaing dengan Lorenzo dan Pedrosa untuk menjadi juara dunia, The Doctor menegaskan satu kemenangan di musim 2013 sudah cukup untuk menghapus kekecewaan itu. “Saya ingin sekali mendapatkan banyak podium paling tidak 10 kali dan finish ketiga di klasemen akhir,” tegas pebalap yang belum lama ini kembali menemui fans di Jakarta itu. (m33/mgp) GUARD San Antonio Spurs Danny Green (4) tampil gemilang saat dijamu Chicago Bulls dalam lanjutan kompetisi NBA di United Center, Chicago, Selasa (12/2). -AP-

Lutut Nadal Masih Mengganggu


Lorenzo Lebih Sempurna GERNO DI LESMO, Italia (Waspada): Valentino Rossi memberikan pujian kepada juara bertahan MotoGP, Jorge Lorenzo (foto), yang juga rekan setimnya di Yamaha. Menurut The Doctor, pebalap Spanyol itu sudah berkembang sangat pesat sehingga kian sempurna. Rossi dan Lorenzo sudah pernah menjadi tandem pada 2008-2010, sebelum pebalap Italia itu memutuskan pindah ke Ducati pada awal musim 2011. Alih-alih menjadi juara dunia bersama tim Italia tersebut, Rossi malah terpuruk dan mengalami masa terburuk dalam kariernya. Pasalnya, Rossi tak pernah meraih kemenangan dan hanya tiga kali naik podium. Setelah menjalani dua musim bersama Ducati, Rossi memutuskan kembali bergabung dengan Yamaha yang sudah

membawanya meraih 46 kemenangan serta empat gelar juara dunia. Tetapi, Rossi datang dengan status sebagai pebalap kedua, karena Lorenzo sudah bertumbuh menjadi rider hebat bersama tim “garpu tala” tersebut. Dalam pertarungan mereka saat melakoni ujicoba resmi pramusim pertama 2013 di Sirkuit Sepang, Malaysia, 5-7 Februari lalu, Rossi selalu kalah dari Lorenzo. Hasil terbaik sembilan kali juara dunia grand prix ini adalah peringkat ketiga. Lorenzo sendiri bersaing ketat dengan pebalap Repsol Honda, Dani Pedrosa, yang selalu berada di posisi teratas. Melihat performa Lorenzo itu, Rossi dengan mantap memberi pujian. Dia mengakui, Lorenzo memang sudah menjelma jadi pebalap hebat dan

PARIS (Waspada): Rafael Nadal (foto) mengaku cedera lutut bikin pergerakannya tidak nyaman. Petenis Spanyol itu pun harus bekerja keras untuk menemukan kembali performa terbaiknya. Setelah tujuh bulan tidak bermain, Nadal pertama kali tampil di sebuah turnamen resmi di Chile, pekan lalu. Kendati berhasil menembus partai final VTR Terbuka, Nadal gagal menjadi juara pada final perdananya itu. Meski bermain di lapangan tanah liat, mantan raja tenis

dunia itu secara mengejutkan harus mengakui keunggulan Horacio Zeballos di partai pamungkas. Namun, Nadal tetap mencoba untuk berpikir positif dari kekalahan itu. “Satu pekan lalu kami tidak tahu bagaimana badan ini akan merespons. Sekarang paling tidak, saya tahu kami bisa bersaing di level tertentu. Saya rasa ini adalah pekan yang positif,” ujar Nadal, Selasa (12/2). “Lutut sangat menganggu saya, tapi Anda harus menghadapi kesulitan dengan cara terbaik. Saya sudah tidak sabar

untuk berlatih dan menikmati apa yang saya sukai, untuk bermain tenis,” sambung petenis Spanyol itu. Tidak lama bermain membuat peringkat Nadal turun ke lima besar dunia. Raja Tanah Liat ini mengaku harus bekerja keras, untuk bisa bersaing lagi dengan petenis papan atas lainnya di musim ini. Nadal berada di bawah empat besar petenis putra, yaitu Novak Djokovic (Serbia), Roger Federer (Swiss), Andy Murray (Inggris Raya), dan David Ferrer (Spanyol). (m33/ap)

sangat lengkap untuk mengembangkanYZR-M1 dibandingkan ketika mereka masih bersama selama 2008-2010. “Sekarang dia sempurna karena dia sangat cepat dalam semua kondisi, sangat cepat sejak awal lomba, dan tak membuat kesalahan. Antara 2008 dan 2010, Lorenzo sudah sangat, sangat tangguh, tetapi sekarang lebih hebat lagi,” puji Rossi, Selasa (11/2). Meskipunmenjalanibalapan yang panjang, Rossi juga mengakui saat ini penampilan Lorenzo sangat konsisten. Inilah titik di mana Rossi merasa tidak punya lagi kemampuan tersebut, sehingga dirinya perlu bekerja ekstra keras jika ingin bersaing dengan Lorenzo dan pebalap lainnya. (m33/mgp)


Sumatera Utara

WASPADA Rabu 13 Februari 2013


Zhuhur ‘Ashar

Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

12:41 12:54 12:42 12:49 12:49 12:45 12:42 12:38 12:44 12:44

16:02 16:15 16:03 16:10 16:09 16:05 16:02 15:58 16:05 16:05

Magrib 18:42 18:53 18:43 18:48 18:48 18:48 18:43 18:39 18:45 18:44



Shubuh Syuruq


19:52 20:03 19:53 19:58 19:58 19:58 19:53 19:49 19:55 19:54

05:12 05:27 04:13 05:22 05:21 05:14 05:13 05:08 05:15 05:16

05:22 05:37 05:23 05:32 05:31 05:24 05:23 05:18 05:25 05:26

L.Seumawe L. Pakam Sei Rampah Meulaboh P.Sidimpuan P. Siantar Balige R. Prapat Sabang Pandan

06:39 06:54 06:39 06:48 06:47 06:40 06:39 06:34 06:42 06:42

Zhuhur ‘Ashar 12:47 12:40 12:40 12:51 12:39 12:40 12:40 12:36 12:54 12:41

16:08 16:01 16:00 16:12 15:59 16:00 16:00 15:57 16:15 16:01



Imsak Shubuh Syuruq


18:46 18:41 18:40 18:51 18:42 18:41 18:41 18:38 18:53 18:43

19:56 19:51 19:50 20:01 19:52 19:51 19:51 19:48 20:03 19:53

05:20 05:12 05:11 05:23 05:08 05:10 05:10 05:06 05:28 05:10

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

05:30 05:22 05:21 05:33 05:18 05:20 05:20 05:16 05:38 05:20

06:46 06:38 06:37 06:49 06:34 06:36 06:36 06:32 06:54 06:36

Zhuhur ‘Ashar 12:41 12:42 12:52 12:45 12:42 12:48 12:37 12:47 12:40 12:39

16:01 16:03 16:13 16:05 16:02 16:09 15:57 16:08 16:00 16:00





Shubuh Syuruq


18:43 18:44 18:51 18:47 18:42 18:48 18:38 18:48 18:42 18:40

19:53 19:54 20:01 19:57 19:52 19:58 19:48 19:58 19:52 19:50

05:10 05:13 05:25 05:15 05:13 05:20 05:07 05:18 05:10 05:10

05:20 05:23 05:35 05:25 05:23 05:30 05:17 05:28 05:20 05:20

Panyabungan Teluk Dalam Salak Limapuluh Parapat Gunung Tua Sibuhuan Lhoksukon D.Sanggul Kotapinang Aek Kanopan

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

06:36 06:39 06:51 06:41 06:39 06:47 06:33 06:44 06:36 06:36

Zhuhur 12:38 12:45 12:42 12:38 12:40 12:37 12:37 12:47 12:41 12:35 12:37

‘Ashar Magrib 15:57 16:04 16:03 15:59 16:00 15:57 15:57 16:08 16:01 15:55 15:57

18:41 18:48 18:44 18:39 18:42 18:40 18:40 18:46 18:43 18:38 18:39



Shubuh Syuruq

19:51 19:58 19:54 19:49 19:52 19:50 19:50 19:56 19:53 19:48 19:49

05:06 05:13 05:13 05:09 05:10 05:06 05:06 05:19 05:11 05:05 05:07

05:16 05:23 05:23 05:19 05:20 05:16 05:16 05:29 05:21 05:15 05:17

06:32 06:39 06:39 06:35 06:37 06:33 06:32 06:45 06:37 06:31 06:33

Warga Blokir Jalan Ke Mega Proyek PLTU PANGKALANSUSU (Waspada): Masyarakat Desa Sei Siur, Kec. Pangkalansusu, memblokir akses jalan menuju mega proyek Perusahaan Listrik Tenaga Uap (PLTU) 2 x 200 maga watt milik PT PLN (Persero), Selasa (12/2). Aksi dilakukan karena selama ini pihak konsersium kurang memperhatikan perbaikan kerusakan infrastruktur jalan. Masyarakat merintangi

jalan masuk menuju lokasi proyek, menyebabkan puluhan dump truk pengangkut material tanah timbun tak bisa melintas. Warga mengultimatum, seluruh kendaraan angkutan

Sosialisasi Jamkesda Dan Pengobatan Gratis PERCUT SEITUAN (Waspada): Puskesmas Bandar Khalifah Kec. Percut Seituan, Kab. Deliserdang, menggelar sosialisasi Jamkesda sekaligus pengobatan gratis bagi masyarakat, di Poskesdes Laut Dendang, kemarin. Hadir Kepala Desa Laut Dendang Suwardi, Kepala Puskesmas Bandar Khalifah dr. Boyke Sihombing dan anggota DPRD Deliserdang Alinatar Siregar. Ali Natar Siregar berterimakasih kepada masyarakat yang menyempatkan diri mengikuti dan memanfaatkan kegiatan pengobatan gratis. Hal sama disampaikan kepada dr. Boyke Sihombing selaku Kepala Puskesmas Bandar Khalifah, yang memprakarsai kegiatan sosial ini. Dijelaskan, dewan telah berusaha mengejar pendapatan asli daerah bidang kesehatan Rp465 miliar untuk dikembalikan kepada masyarakat dengan melakukan berbagai kegiatan social, seperti dilakukan puskesmas Bandar Khalifah ini. Sementara dr. Boyke Sihombing mengatakan, kegiatan semacam ini terus dilakukan karena ini tuntutan moral sebagai abdi negara.(crul)

berat tak boleh melintasi jalan desa, sebelum pihak perusahaan memperbaiki kerusakan sekaligus membersihkan tumpukan tanah dari ruas jalan. Untuk mengantisipasi halhal tak diinginkan, aparat Polsek Pangkalansusu, anggota Koramil-15 dan personel TNI AL, berjaga-jaga di ruas jalan Desa Sei Siur. Aksi warga berjalan damai. Guna mencari solusi, Muspika memfasilitasi dialog dengan mengundang masyarakat termasuk konsersium proyek PLTU, yakni Manager GPEC, Zhang ZhengYi, PT Bagus Karya diwakili Robertus Buta-butar,

dan dua perwakilan masyarakat Desa Sei Siur, H. Hermanto dan S. Manurung. Hasil pertemuan ditandatangani masing-masing pihak diperoleh kesepakatan, pengusaha harus melakukan reklamasi terhadap dampak yang ditimbulkan akibat operasional galian C, gundukan tanah harus diratakan, ruas jalan harus disemprot, dan konsersium harus memperbaiki ruas jalan dengan menimbun sirtu. Warga juga minta armada angkutan tanah timbun tidak melebihi kapasitas dan menutup muatan tanah dengan terpal. Sementara mobil karyawan

atau armada angkutan tanah diminta mengurangi kecepatan, tidak melebihi 40 km/jam. Jika musim hujan, operasional galian C dihentikan. Sebelum semua tuntutan dipenuhi perusahaan, masyarakat tidak membenarkan armada angkutan tanah timbun beroperasi. Kesepakatan ini turut ditandatangani saksi-saksi di antaranya Camat Pangkalansusu, Sukhyar Mulyamin, Kapolsek Pangkalansusu, AKP Untung Robert, anggota DPRD Langkat, Safrial, dari PT PLN (Persero) diwakili, Gusthama Dicky Z.(a02)

Mayat Mengapung Di Parit STABAT (Waspada): Sesosok mayat pria ditemukan warga mengapung di parit sekitar Desa Telaga Jernih Kec. Secanggang, Kab. Langkat, Selasa (12/2) pagi. Penemuan itu menghebohkan warga. Mayat itu ternyata Widi, warga setempat yang sudah tiga hari menghilang. Korban semasa hidup mengalami gangguan jiwa. Sebelumnya pihak keluarga berusaha mencari korban ke beberapa tempat karena tidak pulang, namun akhirnya ditemukan tewas. Warga setempat menduga korban tenggelam di parit akibat terjatuh, sebab tidak ditemukan bekas penganiayaan di tubuhnya. Meski demikian aparat Polsek Secanggang masih menyelidiki penyebab tewasnya lajang berusia 30 tahun itu. Jenazahnya telah dikebumikan di pekuburan desa setempat.(a03)

Wali Kota Binjai Buka Konpercab NU BINJAI (Waspada): Wali Kota Binjai H.M. Idaham, SH, M.Si membuka Konprensi Cabang Nahdlatul Ulama (NU) kota Binjai di Pendopo Umar Baki, Sabtu (9/2). Kopercab NU Kota Binjai untuk memilih kepengurusan periode 2013-2018, sekaligus peringatan Maulid Nabi Besar Muhammad SAW 1434 H, dihadiri Dandim 0203 Langkat Letkol. Inf. Tri Saktiono, Kakan Kemenag Binjai Drs. H. Al Ahyu, MA, pengurus NU Sumatera Utara, pengurus Partai Islam, pengurus Ormas Islam. Wali Kota HM Idaham mengemukakan, konprensi cabang NU Kota Binjai selain melakukan konsolidasi organisasi, diharapkan melahirkan program untuk membina umat Islam dan menjalin kerjasama dengan Ormas Islam. Kepala Kantor Kementerian Agama kota Binjai Drs. H. Al Ahyu, MA mengemukakan, konperensi NU dan peringatan Maulid bermakna strategis dan sangat penting untuk memberikan solusi atas tiga persoalan umat dan bangsa Indonesia , yaitu identitas keislaman, akhlak dan kerukunan umat beragama. Al Ahyu, menyebutkan, Nahdlatul Ulama merupakan lokomotif yang tampil dan mampu menggerakkan umat islam dan menyelesaikan persoalan umat Islam dan bangsa ini. Pengurus NU Sumatera Utara K.H. Abu Sammah Pulungan menyatakan NU merupakan salah satu organisasi Islam terbesar dan tertua di Indonesia. Dengan peringatan Maulid hendaknya kita dapat mengambil sari makna yang terkandung di dalamnya. (a04)

BINJAI (Waspada): Dua hari tak diberi uang minyak untuk truk sampah, sopir dan petugas angkutan sampah Dinas Kebersihan dan Pertamanan Kota Binjai, Selasa (12/2) mengadu ke Pemko Binjai. 10 Truk angkutan sampah diparkir di depan balai kota Binjai, Jalan Sudirman. Sementara puluhan petugas angkutan sampah, berkumpul di depan Pemko Binjai. Menurut sopir dan petugas angkutan sampah, mereka ingin mengadukan nasib, sebab uang minyak truk dua hari tak diberi, ditambah karyawan satu bulan tak gajian. Aksi mendapat respon Kadis DKP Kota

Waspada/HM Husni Siregar

WABUP Deliserdang H. Zainuddin Mars berbincang dengan masyarakat Tionghoa, pada acara bakti sosial dan semarak Imlek 2564 Tahun 2013, di Lubukpakam, Kab. Deliserdang.

Wabup DS Dan Warga Hadiri Imlek LUBUKPAKAM (Waspada): Pelaksanaan bakti sosial dan semarak menyambut hari raya Imlek 2564 Tahun 2013 bagi warga masyarakat Tionghoa berlangsung meriah di Kota Lubuk Pakam dan beberapa wilayah kecamatan di Kab. Deliserdang, baru-baru ini. Seperti di Kota Lubukpakam, penyambutan Imlek diawali penampilan Barongsai dirangkai pemberian talih kasih kepada masyarakat Tionghoa yang kurang mampu dan pentas seni budaya. Selain dihadiri ratusan warga etnis Tionghoa, juga hadir Wakil Bupati Deliserdang H Zainuddin Mars bersama Dandim 0204/DS Letkol Arh Syaepul Mukti Ginanjar, S.Ip, Camat Lubuk Pakam Drs H. Citra Effendy Capah, MSP bersama Muspika, tokoh masyarakat Tionghoa JS Suryadi CU, Fandy Chen dan sejumlah tokoh pemuda.

Wabup H Zainuddin Mars mengucapkan terima kasih serta penghargaan yang tulus dilaksanakannya acara yang merupakan momentum sangat penting bagi kita, khususnya bagi warga Tionghoa di daerah ini, untuk memperbaharui semangat dalam menjalin kehidupan yang lebih baik seiring masuknya Tahun baru Imlek 2564. Menurut Wabup, memperingati dan merayakan tahun baru tentu tidak sekedar dilakukan secara seremonial. Tapi lebih jauh dari itu juga harus diiringi keinginan kita untuk mengevaluasi diri dari apa yang telah dilakukan selama ini, sekaligus bertekad mengupayakan perbaikan ke depan. “Manusia yang berhasil adalah manusia yang dapat mewujudkan hari ini lebih baik dari hari kemarin, dan menjadikan hari esok lebih baik dari hari ini,” kataWabup H. Zainud-

din Mars. Sebelumnya tokoh masyarakat Tionghoa, JS Suryadi CU menjelaskan, dalam kehidupan sehari-hari kita hidup tidak sendiri, saling tergantung, butuh bantuan dan dukungan dari sesama. “Sebab itu hubungan yang harmonis serta kebersamaan yang telah terjalin baik selama inidengansesamamanusia,wajib dijaga dan ditingkatkan.” Di Batangkuis Sementara warga etnis Tionghoa di Batangkuis melakukan ibadah diVihara Dharma Sraddha Jalan Pelita Batangkuis Pekan, dipimpin Pengurus Vihara Poniman diwarnai pelepasan kembang api serta lampion ke udara. Pengurus Vihara Dharma Sraddha Poniman didampingi Sundoro Wijaya mengatakan, sebagaimana kebiasaan ibadah berlangsung selama beberapa hari.(a06)

Binjai, Drs. Hamdani, yang langsung menemui sopir truk dan petugas angkutan sampah, mempersilahkan mereka ke kantor DKP di Jalan Sibolga. “Di sana kita bicarakan,” ujar Hamdani. Hamdani menjelaskan, belum adanya uang minyak dan belum gajiannya karyawan pengangkut sampah, karena anggaran DKP belum cair dari Pemko Binjai. Meski Kadis DKP Binjai Hamdani baru berjanji menyelesaikan masalah tersebut, namun dia tetap berharap tugas mereka tetap berjalan. “Yang penting mereka tetap bertugas, sehingga sampah di kota Binjai tetap diangkat dan tak sampai menumpuk,” ujarnya.(a04)

Penyelundupan Bawang Asal India Digagalkan Polisi PANTAICERMIN (Waspada): Satpolair Polres Serdang Bedagai dan petugas Polsek Pantai Cermin menggagalkan penyelundupan 1.400 karung bawang merah dan bawang putih asal India melalui Malaysia, Minggu (10/2) dinihari, di perairan Pantai Pematang Gunung, Dusun I, Desa Lubuk Saban, Kec. Pantai Cermin. Diamankan empat truk Colt Diesel BA 9905 SE, BB 8929 LR, BM 8075 DB, BK 9946 DK berikut sopir, SUR, 25, AR, 31, MUS, 32, dan TUM, 37, ke empatnya warga Desa Meranti, Kisaran Kab. Asahan, serta satu kapal motor pengangkut bawang KM. Karya Baru-VI, GT 23, No.642 PPB. Keterangan dihimpun Waspada, Polair Polres Sergai sekira pukul 03:00 mendapat informasi ada aktivitas bongkar muat bawang dari kapal ke truk. Personel Polair Polres Sergai bekerjasama dengan Polsek Pantai Cermin dipimpin Kasatpol Air Polres Sergai, AKP

Bakhdaruddin meluncur ke lokasi dan menemukan ke empat truk tengah melakukan aktivitas bongkar muat dari kapal. Namun saat diamankan tekong bersama anak buah kapal (ABK) sudah tidak berada di lokasi, keburu kabur. Barang bukti truk bermuatan bawang berikut sopir yang sempat diamankan di Mapolsek Pantai Cermin dilimpahkan ke Satreskrim Polres Sergai, di Jl. Negara, Desa Firdaus, Kec. Sei Rampah. Sedangkan kapal motor diamankan ke Mapolair Polres Sergai di Desa Tebingtinggi, Kec. Tanjung Beringin. “Saya baru tahu barang yang akan diangkut adalah bawang setelah ditangkap polisi,” aku AR, sopir truk BM 8075 DB dan SUR, sopir truk BA 9905, SE kepada Waspada di kantor polisi. Kapolres Sergai, AKBP Arif Budiman, S.IK, MH ketika dihubungi Waspada menyebutkan, seluruh barang bukti telah diamankan.(c03)

Dewa Rezeki Meriahkan Them Park Pantai Cermin PANTAICERMIN (Waspada): Suasana perayaan tahun baru Imlek 2564 dimeriahkan aksi pemeran Dewa rezeki (Tjai Shen Ya) di obyek wisata bahari Theme Park Pantai Cermin, Kab. Serdang Bedagai, baru-baru ini.

Kehadiran dewa rezeki yang sedang membagi-bagi angpao berisi uang, membuat ribuan pengunjung yang sedang menikmati sea food dan keindahan pantai spontan menyerbu. Bahkan dewa rezeki sempat

NasDem Langkat Syukuran STABAT (Waspada): Ketua DPD Partai NasDem Langkat Khairuddin Nasution menggalar syukuran di Stabat atas lulusnya verifikasi faktual Partai NasDem sebagai peserta pemilu 2014, baru-baru ini. Syukuran dihadiri Ketua DPW Partai NasDem Sumut Ali Umri beserta rombongan. Dalam sambutannya Ali Umri mengajak masyarakat dan kader NasDem mendukung pasangan Gatot Pudjonugroho dan T. Erry Nuradi dalam Pilgubsu mendatang. Syukuran dirangkai pemberian santunan kepada puluhan anak yatim.(a03)

Tak Gajian Dan Tak Ada BBM Truk

Sopir Dan Petugas Kebersihan Binjai Ngadu Ke Pemko

Jelang Pilgubsu, Berikan Pendidikan Politik Masyarakat TEBINGTINGGI (Waspada): Dalam menyongsong Pilgubsu 7 Maret 2013, Pemko Tebingtinggi menyelenggarakan sosialisasi pendidikan politik masyarakat, baru-baru ini. Acara di egdung Hj. Sawiyah itu mengundang tokoh agama, tokoh masyarakat, tokoh adat, LSM dan Tim Kampanye ke lima pasangan Cagub dan Cawagubsu, menghadirkan nara sumber Wakil Walikota H. Irham Taufiq, Kapolres Tebingtinggi, AKBP Andi Rian Djajadi, S.Ik, Ketua KPUD, Wal Asri, Ketua Panwaslu Muhammad Idris Sitorus. Kaban Kesbang Pol dan Linmas, Amas Muda, SH selaku penyelenggara menyebutkan, kegiatan untuk meningkatkan rasa persatuan dan kesatuan serta untuk memahami nilai-nilai kebangsaaan bernegara. Terlebih dapat memahami hak dan kewajiban selaku warga negara yang baik dalam menyongsong Pilgubsu,” ucapnya SementaraWakilWalikota mengimbau masyarakat tidak golput pada Pilgubsu, gunakan hak pilih dengan baik dan benar. Ketua Panwaslu, Mhd. Idris Sitorus menyampaikan tugas dan fungsi Panwaslu dalam melakukan pengawasan pemilu dan mengawal UU penyelenggaraan Pemilu. Karena itu masyarakat turut mengawasi tahapan penyelenggaraan Pemilu, agar semua dapat berjalan lancer dan sukses.(a11)

Waspada/Riswan Rika

BARISAN truk angkutan sampah yang diparkir di depan balaikota Binjai.

Waspada/Edi Saputra

DEWA Rezeki membagi angpao kepada pengunjung anakanak di open stage Theme Park Pantai Cermin pada tahun baru Imlek 2564.

dikejar anak-anak yang belum kebagian angpao. Usai pembagian angpao, pengunjung dihibur kesenian barongsai. Resident Manager Theme Park Pantai Cermin, Lee Beng Teik didampingi Asisten Direktur Ops Sales and Marketing Theme Park, T. Feria Aznita menjelaskan, bagi-bagi angpao lambang memperlancar rezeki, menurut sebagian kepercayaan uang di angpao harus disimpan dan tidak boleh dibelikan sesuatu. “Menurut kepercayaan kami, angpao memperlancar rezeki, Dewa Rezeki akan memberi rezeki kepada manusia. Mudah-mudahan mereka yang memperoleh angpao mudah mendapat rezeki,” kata Lee Beng Teik. Pengamatan Waspada, pada libur tahun baru Imlek, kemarin, pengunjung yang berdatangan dari berbagai daerah memadati sejumlah objek wisata pantai di Kab. Serdang Bedagai, seperti Pantai Pondok Permai, Pantai Klang, Pantai Kuala Putri, Pantai Sri Mersing, Pantai Lestari Indah dan Pantai Cermin Theme Park.(c03)

Waspada/Edi Saputra

PERSONEL Satreskrim Polres Sergai memeriksa barang bukti bawang merah ilegal yang dimuat empat truk di Mapolres Sergai.

Desk Pemilukada Sosialisasi Pilgubsu Di Sergai SEIRAMPAH ( Waspada): Tim Desk Pemilihan Kepala Daerah (Pilkada) Gubernur dan Wakil Gubernur Sumatera Utara, menggelar sosialisasi di 17 kecamatan seSergai dibagi berdasarkan 5 daerah pemilihan (dapil), Senin (11/2) dan Rabu (13/2). TimIdipimpinAsistenPemerintahanUmum Rudi Sitorus SH, M.IP. Tim II dipimpin Asisten Administrasi Umum H. Rapotan SH, MAP. Demikian Kabag Humas Sergai Dra. Indah Dwi Kumala dari Tim I didampingi Kabag Pemerintahan dan Kerjasama H. Chairin FS. S.Sos, MM, di komplek Kantor Bupati Sergai di Sei Rampah, kemarin. Dikatakan Kabag Humas, narasumber berasal dari Komisi Pemilihan Umum (KPU) Sergai yang menyampaikan materi tahapan, program dan jadwal penyelenggaraan Pemilu

Gubsu danWagubsu tahun 2013. Kemudian juga disampaikan pedoman teknis tata cara kampanye dalam pemilu Gubsu dan Wagubsu sebagaimana Keputusan KPU Provinsi Sumut No. 11/Kpts/KPU-Prov-002/2012, jelas Kabag Humas. Selanjutnya narasumber dari Panitia Pengawasan Pemilihan Umum (Panwaslu) Sergai menyampaikan tata cara penyelenggaraan pemilu berdasarkan UU No. 15 tahun 2011, yakni prosedur penyelenggaraankampanyedanpengawasanyang dilakukan pada kampanye 18 Februari - 3 Maret, mau pun mekanisme pelaksanaan pemilihan umum langsung 7 Maret mendatang. Sosialisasi diikuti perangkat desa dan kelurahan, Camat, Panitia Pemilihan Kecamatan (PPK), para Kasie Pemerintahan dan tokoh masyarakat.(a08)

Sumatera Utara


Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu Lusia Damayanti (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: H. Halim Hasan. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Zulkifli Harahap. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Promosi: Edward Thahir (Koordinator). Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Sinur Manik (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi). Wartawan Kota Medan: Umum: H. Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Hj. Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa, Avli Yarman. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Arianda Tanjung, Dio Utama. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebingtinggi: Muhammad Idris, Abdul Khalik. Pematangsiantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Tarutung: Parlindungan Hutasoit. Sibolga/Tapanuli Tengah: Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan/Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies, H. Rusli Ismail, Arman Konadi. Aceh Besar: Iskandarsyah. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanafiah. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar, Dedek Juliadi. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Jasvira Sautisa. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan WASPADA dilengkapi dengan kartu pers. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada yang mengaku wartawan WASPADA tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada

Banjir Rob Genangi Pemukiman Dan Jalan TANJUNGBALAI (Waspada): Banjir rob (naiknya permukaan laut) akibat pasang mulai melanda Kota Tanjungbalai, yang menyebabkan sejumlah pemukiman dan ruas jalan tergenang. Meski belum begitu parah, fenomena alam tahunan yang biasa disebut ‘pasang keling’ ini cukup merepotkan warga dan pengguna jalan. Bagaimana tidak, air mulai memasuki kawasan padat penduduk terutama kontur tanah yang re l a t i f re n d a h s e h i n g g a mengganggu aktifitas seperti berdagang, mengaji, dan lainnya. “Kalau sudah pasang besar (pasang keling) begini, susahlah kami bang. Pembeli malas datang, anak mengaji diliburkan, dan kami selalu was-was jika air semakin besar dan merendam seisi rumah,” ujar salah seorang pedagang di Jl. M Abbas dekat Sekolah Madrasah Aliyah Negeri, Kota Tanjungbalai, Selasa (12/2).

Pemukiman yang kerap dilanda banjir rob seperti sejumlah Kelurahan di Kec. Tanjungbalai Selatan, Teluknibung dan Seitualang Raso. Selain rumah warga, sejumlah gedung perkantoran baik milik pemerintah maupun swasta, pertokoan, dan pasar tak luput dari genangan. Sementara di jalan raya, para pengendara terutama sepeda motor dan becak bermotor kerap mengalami mogok karena mesin dan busi dimasuki air. Akibatnya, mereka harus rela mendorong sendiri kendaraan keluar dari genangan. Ruas jalan yang menjadi langganan banjir diantaranya Jl. M Abbas, Jl. Besar Teluknibung (KLYos Sudarso), dan jalan menuju Pasar Bengawan. Se-

KOTAPINANG (Waspada): Proyek peningkatan kapasitas Jalan Aek Nabara SP Kotapinang di Kec. Kotapinang, Kab. Labusel yang dikerjakan PT. Seneca Indonesia hampir tuntas. Namun sepanjang lebih kurang 5 Km jalan itu dikhawatirkan akan menjadi pemicu kecelakaan lalu lintas, karena sebagian besar tidak dilengkapi bahu jalan. Pengamatan Waspada, Senin (11/2), selain badan jalan yang terasa bergelombang dan di beberapa titik mengalami kerusakan, sebagian besar badan jalan yang diperbaiki melalui dana APBN 2012 senilai Rp16

miliar lebih itu juga tidak memiliki bahu jalan. Badan jalan langsung berbatasan dengan berem, sementara berm tidak ditinggikan serta badan jalan. Akibatnya, badan jalan menjadi curam dengan ketinggian rata-rata 20 Cm hingga 35 Cm. Bahkan di beberapa titik badan jalan langsung berbatasan dengan parit. Diperkirakan, ada sepanjang 1,5 Km badan jalan yang tidak memiliki bahu jalan dari 5 Km badan jalan yang diperbaiki dan dilebarkan. Parahnya, lokasi itu terletak di kawasan padat penduduk dan padat lalu lintas, seperti di kawasan Per-

LIMAPULUH (Waspada): Ratusan ABK atau buruh nelayan di Batubara terancam kehilangan pekerjaan, jika operasional pukat teri gandeng dua atau istilah pukat gerandong dikatagorikan melanggar Undang-undang Kep/02/MEN/ 2011 tentang izin dan zona penangkapan. Sehingga, diperlukan adanya uji kelanyakan untuk memastikan hal itu sebelum berbuat lebih jauh melakukan penertiban. “Jika dilihat dari sisi operasi, pukat teri gandeng dua hanya mengambang pada kedalaman air laut dan tidak sampai men-

dasar. Apa lagi dikatakan merusak,” sebut sejumlah nelayan pukat teri gandeng dua yang bertangkahan di Kuala Batubara, perairan Kec Tanjungtiram, Selasa (12/2). Diperkirakan, mencapai 50 unit pukat teri gandeng dua beroperasi di perairan tersebut dengan rata-rata jumlah ABK warga tempatan mencapai belasan orang. “Bayangkan jika ini ditertibkan, apakah tidak ratusan orang buruh nelayan atau ABK yang selama ini bekerja akan kehilangan mata pencarian,” ujar Budi dan Amat, nelayan pukat teri. (a13)

Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874.

� Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 13.000,-, berwarna Rp. 36.000,Halaman depan: hitam-putih Rp. 39.000,-, berwarna Rp. 108.000,Ukuran kolom: 40,5 mm. E-mail Iklan: Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Warga Labusel Jalan Santai Meriahkan HUT Gerindra KOTAPINANG (Waspada): Puncak peringatan HUT ke lima Partai Gerakan Indonesia Raya (Gerindra) di Kab. Labusel, Minggu (10/2) berlangsung meriah. Lebih dari 2.000-an warga dari berbagai daerah ambil bagian dalam kegiatan jalan santai dan berbagai perlombaan yang digelar DPC Gerindra Labusel. Jalan santai tersebut dilepas Ketua DPC Gerindra Arwi Winatha didampingi Sekretaris Abdul Hakim Siregar bersama Sekretaris DPD Gerindra Sumut Sri Kumala, Wakil Ketua Bidang Buruh dan Transmigrasi Pahala Napitupulu, Bendahara Richard Sidabutar serta jajaran fungsionaris DPC Gerindra Labusel, di halaman Sekretariat DPC Gerindra di Jl. Labuhan, Kotapinang. Peserta berjalan melintasi Jl. Pulo, Jalan Jawa, Sudirman, dan finish di Sekretariat partai tersebut. Usai mengikuti jalan santai, peserta dan para undangan kemudian mengikuti upacara kenegaraan. Seremonial peringatan hari lahirnya partai berlambang kepala burung Garuda itu juga dimeriahkan dengan perlombaan peragaan busana, tarik tambang, dan lari goni putra-putri memperebutkan piala dan hadiah total Rp100 juta. Ketua DPD Gerindra Sumut, Ramses Simbolon dalam amanatnya yang disampaikan Richard Sidabutar mengatakan, Gerindra memiliki peluang besar menghadapi Pemilu 2014 mendatang. Sebab, sejauh ini kader Gerindra belum pernah terkait kasus korupsi. “Partai Gerindra telah lulus sebagai partai peserta pemilu. Ini tidak terlepas atas kerja keras dari simpatisan pengurus dan kader Gerindra di Kab. Labusel,” katanya. Sementara itu Arwi Winatha mengatakan, kegiatan tersebut merupakan upaya Gerindra agar lebih dekat kepada masyarakat di Labusel. (c18)

Waspada/Iwan Has

BUPATI Batubara H. OK Arya Zulkarnain, SH, MM pada penyerahan kartu Jamkesmas di Desa Padang Genting, Kec. Talawi.

Bupati: “Bilangkan Sudah Dibayar OK” TALAWI (Waspada): “Jaga dan manfaatkan dengan baik kartu Jamkesmas untuk kesehatan. Jika ditagih biaya, bilangkan sudah dibayar OK,” sebut Bupati Batubara H. OK Arya Zulkarnain, SH, MM kepada warga penerima kartu Jaminan Kesehatan Masyarakat (Jamkesmas) di Desa Padang Genting, Kec Talawi, Minggu (10/2). Program kesehatan gratis

kebunan PTPP Lonsum Sei Rumbia Estate, Kampung Bedagai, dan Jalan Bukit. Kondisi itu menyebabkan ruas jalan tersebut menjadi rawan kecelakaan lalu lintas. Acap kali pengendara khususnya sepedamotor yang melintas terjatuh karena terperosok ke berem jalan, karena menghindar saat berselisih dengan kendaraan lain. “Sudah sering pengendara terjatuh di berm ini. Aneh ini pemborongnya, kok nggakadabahujalannya,”kataMasroni, warga Kampung Bedagai. Pelaksana Lapangan PT. Seneca Indonesia, Elenda Rozi

yang dikonfirmasi belum lama ini mengakui bahwa di beberapa titik badan jalan tidak dibuat bahu jalannya. Karena kata dia, sejak awal ruas jalan tersebut tidak ada bahu jalannya.“Kalauyangnggakadabahujalannya, ya nggak kita buat,” katanya. Terpisah Ketua ICMI Labusel, Abdullah MN Situmorang yang juga warga Kampung Bedagai mengatakan, sudah berulang kali dirinya menyampaikan kepada pekerja PT. Seneca Indonesia agar membuat bahu jalan. Namun pihak rekanan hanya memberi janji. (c18)

Penertiban Pukat Teri Ancam Pekerjaan Nelayan


� Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109.

mentara, banjir rob yang semakin parah tiap tahun disebabkan kondisi drainase buruk ditambah rendahnya tingkat kesadaran masyarakat untuk tidak membuang sampah sembarangan. “Setiap tahun semakin parah bang, dulu masih sebatas mata kaki airnya, sekarang sudah sampai lutut. Bagaimana lagi nanti beberapa tahun ke depan,” cetus Syahrul, 45, pengendara sepeda motor saat melintas menuju pasar Bengawan. Untuk itu, Pemerintah Kota pun dituntut untuk ambil bagian mencegah tingkat keparahan banjir ini. Pantauan Waspada, banjir rob terjadi umumnya di sore hari, ketinggian air sejumlah tempat masih sebatas 10 cm. Diperkirakan, banjir akan semakin parah pada puncaknya beberapa hari ke depan dengan ketinggian hingga melewati lutut orang dewasa. (a32)

Kondisi Jalinsum Kotapinang Mengkhawatirkan

Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002

� Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385.

WASPADA Rabu 13 Februari 2013

Waspada/Iwan Has

PERTEMUAN nelayan dengan Komisi B DPRD Batubara terkait pro dan kontra operasional pukat ikan gandeng dua.

Waspada/Syahri Ilham Siahaan

PIMPINAN Bimbingan Belajar HCL Rudi Armansyah Sitorus foto bersama para juara lomba berbahasa Inggris.

Gubsu Peduli Pendidikan AEKKANOPAN (Waspada): Plt. Gubernur Sumatera Utara (Gubsu) H. Gatot Pujo Nugroho ST sangat peduli dengan kemajuan Pendidikan di Sumut. Bahkan Gatot yang menganggap jabatan itu adalah amanah, merupakan sosok pemimpin yang sepenuh hati memajukan pendidikan di Sumut. Demikian di sampaikan Rudi Armansyah Sitorus SPd, Pimpinan Bimbingan Belajar HCI di hadapan puluhan peserta lomba pidato berbahasa Inggris tingkat SMP dan SMA sederajat se Kab. Labuhanbatu Utara (Labura) di aula Kantor Camat Kualuselatan Sabtu (9/2). Lomba pidato berbahasa Inggris memperebutkan piala Plt Gubsu itu, dihadiri Kadisdik Labura H Ridwan Rambe, Kabid PNFI Subekti MPd, Camat Kualuhselatan M Yakub Marpaung

SH, serta ratusan pelajar baik tingkat SMP maupun SMA. Menurut Rudi, Plt Gubsu telah menunjukkan kepeduliannya terhadap pendidikan di Sumut khususnya di Labura, hal itu terbukti dengan dilaksanakan nyakegiatanperlombaanpidato.” Plt. Gubsu sangat merespon dan mendukung kegiatan ini,” kata mantanFMIPAUnimed tersebut. Untuk Lomba Pidato berbahasa Inggris tingkat SMP, keluar sebagai juara adalah Asriani Zuriah dari SMP Negeri I Kualuhhulu, juara II Siti Nurmala Sari, SMP Swasta Pelita Aekkanopan, dan juara III EKa Lestari dari SMP Pelita. SedangkantingkatSMA,juara I Fatimah Sri Diah dari SMA Negeri I Na IX X, juara II Ardiana Sari Nababan SMA Negeri I Aeknatas danjuaraIIIWildanMurthadodari MAN Kualuhhulu. (c08)

Mahasiswa UNA Ujian Di Luar Ruangan KISARAN (Waspada): Dekan Fakultas Pertanian Universitas Asahan (UNA) dicopot, sementara mahasiswa semester ganjil ujian di luar ruangan karena lokal dikunci, Selasa (12/2). Hal itu dikarenakan dualisme Dekan Fakultas Pertanian. Yang satu dicopot dan tetap mempertahankan jabatannya, karena merasa masih sah, sedangkan Rektorat memilih Dekan Plt untuk memimpin Fakultas Pertanian. Akibatnya, ada dua gelombang jadwal ujian, yang satu dinyatakan legal, dan

satu lagi dinilai ilegal (di luar ruangan-red). “Jadwal telah kami tentukan, dan ujian yang kami buat sesuai dengan prosedur, dengan meletakkan jadwal di papan pengumuman. Namun lokal dikunci, dan terpaksa mahasiswa ujian di luar ruangan,” jelas Ir Maimunah Siregar, Dekan Fakultas Pertanian yang dicopot oleh Rektor UNA. Menurutnya, penguncian lokal, karena buntut dari pencopotan dirinya. Dan berdasarkan SKS yang dilalui mahasiswa

fakultas pertanian, ujian mulai 11 sampai 13 Februari. Sementara sebelumnya, Plt Dekan Fakultas Pertanian yang diangkat Birokrat UNA, telah mengadakan ujian terlebih dahulu. Namun berdasarkan peraturan, selama ini yang diterapkan di Fakultas Pertanian, jadwalujianditentukanolehpihak dekan, dan bila SKS yang dijalani mahasiswa telah terpenuhi. “Namun pihak Rektorat melakukan ujian lebih awal, dengan menggunakan Bank Soal, dan hal itu dinilai tidak se-


SEJUMLAH mahasiswa Fakultas Pertanian UNA melakukan ujian semester ganjil di luar ruangan, karena lokal mereka dikunci birokrat.

suai dengan peraturan. Karena tidak memanfaatkan dosen yang ada,” jelas Maimunah. Di lain tempat, Pembantu Rektor I Ir Ramlan Tambunan M.Sc, ditemui Waspada, menuturkan, bahwa pencopotan Dekan Pertanian dan menetapkan Plt berdasarkan statuta dan prosedur yang berlaku. Begitu juga dengan jadwal ujian, sesuai dengan kalender akademik. Sehingga ujian yang di luar jadwal tergolong ilegal. Ramlan juga menjelaskan, pihaknya telah telah memberi pemberitahuan sebelumnya, bahwa ujian semester ganjil dimulai 28 Januari sampai 2 Februari. Namun karena ada masalah (pencopotan Dekan Pertanian dan pengangkatan Plt), ujian diundur menjadi 49 Februari. Diharapkan, para dosen memberikan lembar soal, dan bila tidak, akan menggunakan Bank Soal. Anggota Komisi D DPRD Asahan Budianto Lubis, bersama Rosmansyah, terkejut mendengar mahasiswa yang ujian di luar. Dia berharap UNA bisa menyelesaikan gejolak dengan baik dan bijaksana.“UNA kini menjalani masa perbaikan, dan kini sudah cukup baik. Kita berharap adanya gejolak antar dosen dengan birokrat menelantarkan bahkan membingungkan mahasiswa yang ingin belajar,” tuturnya. (a15)

merupakan bagian terpenting dalam program kerja yang dijalankan. Mengingat selama ini banyak menemukan masyarakat yang sakit, namun tidak dapat berobat, karena keterbatasan dana. “Di sini tidak ada alasan, bila sakit, segera datang ke Puskesmas atau rumah sakit, semua gratis,” ujar OK Arya gelar Datuk Setia Amanah. Menurut data, sekitar 176 ribu warga di Batubara penerima Jamkesmas, yang tidak saja

bermanfaat untuk berobat, namun dapat juga digunakan untukrujukankerumahsakit.Apa lagi Batubara kini telah memiliki Rumah Sakit Umum Daerah (RSUD). Karena kese-hatan, katanya, merupakan harta tidak ternilai bagi manusia. Turut mendampingi bupati, anggota DPRD Batubara, Rizky Aryetta, SST, Kepala SKPD, Camat Talawi, Luthfi Panjaitan, S.Sos, Kades Padang Genting, Suhaimi, tokoh masyarakat. (a13)

KPU L.Batu Rakor Jadwal Dan Kampanye Pilgubsu RANTAUPRAPAT (Waspada): Komisi Pemilihan Umum (KPU) Kab. Labuhanbatu melaksanakan Rapat Koordinasi (Rakor) tentang jadwal dan bentuk kampanye Pilgubsu dengan Tim Kampanye Pasangan Calon Gubernur-Wakil Gubernur Sumut, Senin (11/ 2) di Aula Sekretariat KPU setempat. Dalam Rakor yang dipimpin Ketua KPU L. Batu Hj. Ira Wirtati M Pd bersama H. Syam Hasri SH, Irwansyah SH MH, HM Sofyan MA dan Ilham Maulana SE (komisioner KPU L. Batu lainnya) itu, ditandatangani kesepakatan bersama tentang jadwal dan lokasi kampanye danpemasangan alat peraga kampanye Pilgubsu di L.Batu. Selain unsur Pemkab dan Polres L.Batu, Tim Kampanye pasangan calon yang hadir dan menandatangani kesepakatan terdiri dari, Drs. H. Sutan Nafsan Nst (Gusman), Bayu Eko Broto (Esja), Muniruddin S.Ag (Chairuman-Fadly), Ahmad Zaki (AmriRE) dan Puji Hartoyo (Ganteng). (a18)

MPC PP L. Batu Bantu Korban Kebakaran PANAI HILIR (Waspada): Majelis Pengurus Cabang (MPC) Pemuda Pancasila (PP) Kab. Labuhanbatu turut prihatin atas kejadian kebakaran yang menimpa 124 kepala keluarga (KK) di Kelurahan Sei Berombang, Kec. Panai Hilir, beberapa waktu lalu, dan mengunjungi para korban dan memberikan bantuan berupa uang kepada para ahli musibah, Jumat (8/2). Kedatangan para pengurus MPC PP Labuhanbatu disambut haru oleh n warga. Terlebih kunjungan tersebut untuk memberikan semangat sekaligus menunjukan rasa simpati kepada para korban termasuk tujuh rumah korban merupakan milik kader PP setempat. “Kami segenap pengurus PP baik di tingkat MPC Labuhanbatu maupun MPW Sumut turut perihatin atas musibah ini. Kami juga menyampaikan salam dari Ketua MPW PP Sumut, Anuarsah dan Ketua MPC PP Labuhanbatu Ir. Andi Suhaimi yang berpesan kepada seluruh korban musibah kebakaran agar bersabar menghadapai cobaan ini,” kata Sekretaris MPC PP Labuhanbatu Mora Tahan Hasibuan didampingi ketua PAC PP Panai Hilir Razali Nasution. Menurut Mora, di bawah kepemimpinan Ketua MPW PP Sumut Anuarsah, Pemuda Pancasila akan menjadi garda terdepan dalam menggalakkan aksi-aksi sosial kemasyarakat. (c07)

Ponpes Atthoyyibah Indonesia Labura Tasyakur Ke-39 RANTAUPRAPAT (Waspada): Pondok Pesantren (Ponpes) Atthoyyibah Indonesia melaksanakan peringatan Tasyakur ke39 di Komplek Ponpes setempat di tepi Jalan Lintas Sumatera Km 13 Desa Pinang Lombang, Kec. NA IX-X, Kab. Labuhanbatu Utara, Minggu (10/2). Pimpinan Ponpes Atthoyyibah Indonesia Ir. H. Tamsil Lubis, didampingi Humas Ismayuddin, S.Ag dalam arahannya menyampaikan, 39 tahun yang lampau Ponpes ini didirikan oleh Almarhum Buya H Adenan Lubis (ayahanda Tamsil Lubis) dan Buya H. Dahlan Lubis dengan kondisi yang sangat sederhana. Perlahan tetapi pasti, Ponpes Atthoyyibah Indonesia semakin berkembang dan salah satu Ponpes tertua di Sumut ini menjadi favorit masyarakat untuk mempercayakan anak-anaknya dididik di pesantren tersebut. Hingga saat ini, kata Tamsil Lubis, para santri/santriwati yang berasal dari dalam daerah dan luar daerah Labura yang menimba ilmu di Ponpes Atthoyyibah Indonesia sebanyak 1.500 orang. Hadir dalam acara itu, Bupati Labura H Kharuddinsyah Sitorus SE, anggota DPRDSU Ali Abu Bakar Abdul Latif, unsur Muspida Labura, Kapolsek NA IX-X, alumni PAI yang tergabung dalam Ikatan Alumni PAI (IKAPPAI) dan orang tua santri. (a18)

Kasat Lantas Dan Reskrim Polres T. Balai Mutasi TANJUNGBALAI (Waspada): Dua perwira Polres Tanjungbalai, masing-masing Kasat Lantas A Manullang dan Kasat Reskrim AKP Firman Darwin dimutasi. A Manullang dimutasi ke Polres Nias juga di posisi Kasat Lantas. Sedangkan jabatan lama digantikan AKP Zulkarnaen, yang sebelumnya Kanit II Subdit Bin Gakkum Dit Lantas Poldasu. Sementara, Firman menjabat tugas baru sebagai Gadik Muda Sekolah Polisi Negara (SPN) Sampali Medan. Posisinya digantikan AKP ArisWibowo SIk yang sebelumnya bertugas di Pama di Poldasu. Sertijab keduanya berlangsung di Lapangan Mapolres Tanjungbalai, Sabtu (9/2). Kapolres Tanjungbalai AKBP Marthin L Hutagaol dalam amanatnya mengatakan mutasi di tubuh kepolisian merupakan hal yang wajar bertujuan untuk penyegaran dan meningkatkan inovasi di tempat bertugas yang baru. (a32)

Pengangguran Rampas Dua Goni Bawang TANJUNGBALAI (Waspada): Seorang lelaki pengangguran AP alias Cosek, 36, merampas dua goni bawang merah dari tangan pemiliknya Lesti boru Sinaga, Rabu (6/2) sore sekira pukul 17.00. Akibatnya pria warga Jl. MT Haryono, Kel. Selattanjung Medan, Kec. Datukbandar Timur ini harus berurusan dengan pihak Kepolisian Resort Tanjungbalai. Aksinya tergolong nekat karena berpura-pura sebagai pemilik bawang lalu membawa kabur rampasannya. Awalnya tersangka menguntit korban yang sedang membeli bawang di sebuah toko di Kota Tanjungbalai. Saat ibu rumah tangga itu keluar dari toko berjarak sekitar seratus meter, tersangka menghampirinya dan mengaku bawang sebanyak dua goni masing-masing 20 kilogram itu miliknya. Korban yang merasa tertipu langsung melaporkan hal itu ke Polsek Tanjungbalai Selatan. Tak berapa lama, tersangka dibekuk tanpa perlawanan berikut barang bukti dua goni bawang merah dan satu sepedamotor Yamaha Mio BK 2032 QAE. (a32)

Sumatera Utara

WASPADA Rabu 13 Februari 2013


Wali Kota Sibolga Ngantor Di Kelurahan SIBOLGA (Waspada): Lurah dan aparatur Pemerintah Kelurahan Aek Manis, Kec. Sibolga Selatan Jalan SM Raja sempat kaget dan setengah tidak percaya saat Wali Kota Sibolga Drs. HM Syarfi Hutauruk mendadak ngantor di kelurahan tersebut memberikan pelayanan langsung kepada masyarakat, Senin, (11/2).

Pengaturan Tambang Rakyat Sangat Mendesak Di Madina PANYABUNGAN (Waspada): Keberadaan tambang rakyat di Madina yang semakin marak, semakin meluas dan menyerap puluhan ribu pekerja, tentu saja berimplikasi meningkatnya pendapatan masyarakat Madina secara nyata. “Pertambangan rakyat di Madina mendesak untuk diatur dan dilegalisasi melalui Perda Pertambamgan Rakyat agar masyarakat nyamandantenangberusaha,lingkunganhidupterjagakelestariannya, dan PAD Madina bertambah dari tambang rakyat,” ujar Ketua PERADI Tabagsel Ridwan Rangkuty, SH kepada Waspada, kemarin. Dijelaskan, pertambangan rakyat adalah suatu usaha rakyat dalam bidang pertambangan yang diatur secara khusus dalam UU No.4 tahun 2009 tentang Minerba, PP No.22 tahun 2010 tentang WP dan PP No.23 tahun 2010 tentang Kegiatan Usaha Pertambangan Minerba. Selain opsi legalisasi, Ridwan Rangkuty juga menawarkan opsi tambang rakyat harus ditutup demi menjaga dan menghindarkan kerusakan lingkungan yang semakin parah, dan akibat pemakaian mercury kepada manusia dan lingkungan hidup yang dapat berakibat cacat permanen dan bahkan kematian. Sebelum ditutup, lanjut dia, dilakukan imbauan kepada pengusaha tambang rakyat dan diberikan batas waktu untuk menarik semua peralatan dan pekerjannya dari lokasi, setelah itu baru dilaksanakan penertiban dengan melakukan penangkapan kepada para pengusaha dan pemilik lubang tambang rakyat, termasuk pemilik galundung. Disampaikannya, dalam persoalan tambang rakyat, Bupati dan DPRD Madina mempunyai tanggung jawab besar untuk melindungi rakyatnya dengan membuat Perda. “Saya sudah lama mengajukan Ranperda Pertambangan Rakyat kepada Bupati dan RDPRD tapi sampai saat ini tidak ada respon positif,” ujarnya. (c14)

Waspada/Sarmin Harahap

LUBANG tambang emas milik si Awal ini lah yang runtuh dan menelan korban jiwa manusia, dan telah di Police Line petugas.

Masjid Agung Nur Ala Nur Ditargetkan Terbaik Sumut PANYABUNGAN (Waspada): Bupati Kabupaten Mandailing Natal (Madina) HM Hidayat Batubara, SE menargetkan Masjid Agung Nur Ala Nur sebagai masjid terbaik dalam kategori terbersih di Sumatera Utara tahun mendatang. Itu disampaikannya usai menyaksikan penerimaan piagam dan trophi masjid terbersih ketiga se-Sumut oleh Kementerian Agama melalui Kakan Kemenag, kepada Ketua BKM Nur Ala Nur H.Abdullah Amru Rangkuty dan Sekretaris H.Zulkarnaen Nasution di pelataran parkir masjid, baru-baru ini. Bupati berharap, penghargaan yang diterima menjadi motivasi bagi KM dan masyarakat, untuk sama-sama menjaga nama dan kebersihan masjid kebanggan di Madina itu, baik bersih dari sampah dan juga bersih dari tingkah-laku manusia. Bupati Madina Hidayat Batubara melihat, masih banyak hal yang harus diperhatikan di areal Masjid Agung Nur Ala Nur, utamanya pagar dan dekorasi taman serta areal parkir. Bila dimungkinkan petugas malam pun harus lebih aktif menjaga masjid. Hal itu menurut bupati dipandang penting, mengingat masjid berada di sekitar bendungan muara batang gadis, yang setiap saat selalu ramai dikunjungi masyarakat utamanya kaum mudamudi di malam hari. Ketua BKM Nur Ala Nur H.Abdullah Amru Rangkuty kepada Waspada menyampaikan rasa syukur atas pengargaan yang diberikan Kementerian Agama. Baginya, hal itu adalah anugrah bagi masyarakat Madina kota santri yang religius. (c14)

Sengketa Lahan Hutalombang Belum Ada Penyelesaian LUBUK BARUMUN (Waspada): Kasus sengketa lahan H.R Hutagalung dengan masyarakat Desa Hutalombang, Kec. Lubuk Barumun, Kab. Padanglawas masih belum ada titik temu penyelesaian. Bahkan, ketika dilakukan peninjauan lapangan, baru-baru ini, yang dihadiri pihak pemerintah kecamatan, masing-masing pihak yang bersengketa bertahan. Sebagaimana disampaikan R. Hutagalung sebelumnya, dia telah mengusahai lahan di Desa Hutalombang sejak 90-an. Tetapi ironisnya baru sekarang ada permasalahan. Padahal, seluruh lahan, kata R. Hutagalung, telah dibeli dari masyarakat pemilik lahan sedikit demi sedikit, tetapi dari luas lahan itu sudah banyak yang ditingkatkan suratnya, baik berupa akte jual beli, juga ada yang telah sertifikat. Hutagalung sangat berharap agar pihak pemerintah Padanglawas bisa memediasi penyelesaian persoalan lahan itu, sehingga dapat diselesaikan secepatnya dan seadil mungkin. Bila persoalan lahan ini tidak juga ada titik temu, Hutagalung akan menempuh jalur hukum. (a33)

PPSL Pesta Bona Taon Di P. Sidimpuan P.SIDIMPUAN (Waspada): Punguan (Persatuan) Pomparan (Turunan) Si Raja Lumbantobing Boru, Bere, Ibabere (PPSL) se Kota Padangsidimpuan melaksanakan Pesta Bona Taon (pesta awal tahun 2013) di Gedung Nasional, Sabtu (9/2). Ketua Umum PPSL Pukka Lumbantobing (Oppu Cindy) mengungkapkan, marga Pasaribu Mataniari Biccar Hula-hula ni (mertua perempuan pendahulu yang melahirkan) si Raja Lumbantobing di Bona Pasogit, Tapanuli Utara dahulu kala. “Saudara/i ku sekalian, Mataniari biccar nami Pasaribu perhelatan pesta bona taon ini bertujuan menjalin persatuan dalam keberagaman. Seluruh marga pomparan (turunan) Si Raja Lumbantobing sudah marsada (bersatu), hal ini sebagi tonggak sejarah di kota ini kita sudah dapat bersatu dalam dua warna maka kami anak boru podai (bimbinglah) kami,” ujar Oppu Cindy. Saat itu hadir mewakili Hula-hula marga Lumbantobing, yaitu H Syahrul Martua Pasaribu diwakili Arman Syahma Pasaribu SH beserta rombongan. Perhelatan pesta riuh dengan iringan gondang batak saat tarian tortor somba-somba digelar, kepada hula-hula mereka selempangkan ulos (kain adat) Batak di bahu para Hulahula pada saat akan manortor. Ketua Panitia, Oloan Lumban Tobing menuturkan PPSL merupakan organsiasi sosial dan budaya dan telah tedaftar di Kantor Kesatuan Bangsa dan Perlindungan Masyarakat (Kesbang Linmas) Kota Padangsidimpuan 17 Juni 2011 lalu. Jumlah anggota mencapai 289 KK, dari Muslim 89 KK selebihnya Kristiani, dengan Sekretaris Ronal Lumbantobing, Bendahara Pittor Simanungkalit. (c13)

Amatan Waspada, seluruh surat masuk maupun surat keluar yang sedianya ditandatangani di Kantor Wali Kota, semuanya dibawa ke Kantor Lurah Aek Manis dan ditandatangani langsungWali Kota Sibolga Syarfi Hutauruk. Demikian pula beberapa pejabat penting di Kota Sibolga terlihat silihberganti datang membawa berkas untuk ditandatangani wali kota. “Saya memilih ngantor di kelurahan, tujuannya untuk mengetahui lebih dekat, bagaimana sistem pelayanan yang diberikan aparatur pemerintah kepada masyarakat, apakah sudah berjalan dengan baik, atau malah tidak sesuai dengan diharapkan. Termasuk juga untuk mengetahui kendala apa saja yang dihadapi aparatur kita ketika memberikan pelayanan kepada masyarakat,” ungkap Wali Kota Syarfi Hutauruk di-

dampingi Lurah Aek Manis, Syahril kepada wartawan. Pemko Sibolga, jauh hari sebelumnya sudah memprogramkan, seluruh urusan masyarakat di kantor pemerintahan jangan dipersulit, tetapi harus dapat diusahakan selesai dengancepatdalamwaktusatuhari. “Kegiatan ngantor di kelurahan akan terus saya lakukan di seluruh Kantor Kelurahan di Kota Sibolga, tentunya secara acak dan mendadak atau tanpa ada pemberitahuan sebelumnya. Sehingga, kita dapat mengetahui kondisi riil di lapangan,” terang Syarfi. Lurah Aek Manis, Syahril, mengakui terkejut atas kunjungan Wali Kota Sibolga yang mendadak tanpa adanya pemberitahuan. “Terus terang saya kaget, begitu melihat rombongan kendaraan wali kota berhenti dan parkir di depan kantor kita,”

kata Syahril. Kasi Pemerintahan Kelurahan Aek Manis, Hamdan Panjaitan juga mengatakan hal senada. Dalam melaksanakan tugas, diakuinya terkadang ada berkas yang belum dilengkapi warga yang datang mengurus suratsurat di kantor kelurahan tersebut, semisal fotokopi KTP, fotokopi Kartu Keluarga, fotokopi buku nikah dan lainnya. Saat berada di Kantor Lurah Aek Manis, Wali Kota Syarfi Hutauruk juga menyempatkan diri berbincang dengan sejumlah warga yang datang mengurus surat-surat di kantor tersebut. Usai ngantor di Kantor Lurah Aek Manis, Wali Kota Syarfi Hutauruk bersama rombongan juga menyempatkan diri melayat salah seorang warga Kota Sibolga yang meninggal dunia di Kelurahan Aek Muara Pinang, Kec. Sibolga Selatan. (a24)

P. Sidimpuan Rawan DBD P.SIDIMPUAN (Waspada): Sejumlah kalangan di DPRD Padangsidimpuan menyoroti berbagai hal, termasuk Demam Berdarah Dengue (DBD) yang dinyatakan rawan di daerah itu. “Padangsidimpuan termasuk daerah rawan DBD yang telah banyak memakan korban setiap tahun. Ini harus segera dituntaskan,” ujar Fraksi Fraksi Gabungan Nasional Bersatu (FGNB) disampaikan H. Lukman Siregar. Sedangkan Wali Kota Padangsidimpuan Andar Amin Harahap SSTP MSi menyampaikan Nota Jawaban R-APBD terhadap pandangan umum Fraksi-fraksi DPRD di gedung dewan, Senin (11/2). Sidang paripurna dibuka Ketua DPRD Kota Padangsidimpuan H. Azwar Syamsi Lubis, SE, MM bersama Wakil Ketua Tati Tambuan, yang dihadiri lebih

separuh dari 25 anggota dewan. Sebelumnya, Jumat (8/2), sidang paripurna digelar dalam pembahasan nota pengantar RAPBD 2013. Selain Fraksi Gabungan Nasional Bersatu, Fraksi Demokrat (FPD) dan Fraksi Gabungan Karya Bersatu (FGKB) juga menyampaikan pandangan fraksinya. FPD melalui Rika Hanum Nasution menyampaikan beberapa poin, satu di antaranya mengenai besaran belanja langsung lebih besar dibandingkan belanja tidak langsung berdampak kepada warga kota Padangsidimpuan, efektifitas Pendapatan Asli Daerah (PAD) dan lainnya. Sedangkan Fraksi Gabungan Karya Bersatu (FGKB) diwakili Sahrun Harahap SH menyoti rencana pembangunan kantor DPRD Kota Padangsidimpuan di lahan eks PTPN 3 Pijorkoling

yang status tanahnya masih mengambang. Kemudian sarana irigasi di Desa Simatohir yang mendesak bagi rakyat desa itu serta berbagai persoalan lainnya. Dari pandangan umum yang disampaikan ketiga fraksi itu, wali kota menyampaikan, akan serius menindaklanjuti poin-poin yang sedang mengemuka di tengah masyarakat Kota Padangsidimpuan, dengan bekerjasama dengan SKPD (Satuan Kerja Perangkat Daerah) dipimpinnya. Sida n g pa r ipur n a in i dihadiri unsur Muspida, Wakil Wali Kota M. Isnandar Nasution S.Sos, Sekda H. Sarmadan Hasibuan, SH, MM, sejumlah pimpinan SKPD, Sekwan Ahmad Faisal, Camat, Kabag. Sidang komisi akan digelar Selasa (12/ 2) Gedung DPRD Jalan Sutan Soripada Mulia. (c13)

Pemkab Tapsel Salurkan 128.593 Kartu Jamkesmas BATANG ANGKOLA (Waspada): Pemkab Tapanuli Selatan menyalurkan 128.593 kartu Jaminan Kesehatan Masyarakat (Jamkesmas) tahun anggaran 2013 kepada masyarakat 14 kecamatan. Penyerahan dilakukan secara simbolis kepada tiga orang penerima per kecamatan di Puskesmas Pintu Padang, Kec. Batang Angkola, Selasa (12/2). Ketua panitia dr. Khodri Simatupang, menyebutkan, Dinas Kesehatan Tapsel telah membentuk kepanitiaan untuk mendistribusikan kartu Jamkesmas di 14 kecamatan se-Tapsel. Rincian penerima Jamkesmas per kecamatan adalah, Sayur Matinggi 12.734, Batang Angkola 13.617, Angkola Selatan 13.944, Angkola Barat 7.955, Batangtoru 8.351, Muara Batangtoru 5.727, Marancar 4.407, Angkola Timur 9.659, Sipirok 16.442, Arse 4.560, Saipar Dolok Hole 8.651, Aek Bilah 5.432, Tantom Angkola 9.996, Angkola

Sangkunur 7.118. Total 128.593 orang Kadis Kesehatan Tapsel, dr. Ali Syahbana Siregar Sp.THT, menyebut jumlah penerima Jamkesmas di Tapsel bertambah setiap tahun. Tahun lalu 121 ribu jiwa, sebelumnya 110, dan saat ini 128.593. Khusus untuk Kec. Batangangkola saja, 40,96 persen warganya sudah masuk Jamkesmas. Bupati Tapsel, Syahrul M Pasaribu menegaskan, dia bersama Kadis Kesehatan terus berupaya dan mencari segala kemungkinan untuk dapat menyehatkan serta mensejahterakan seluruh rakyat Tapsel. “Tahun ini 128.593 warga kita menerima Jamkesmas. Sebagai tambahannya, pada APBD TA 2013 ini kita menampung Rp600 juta untuk Jaminan Kesehatan Masyarakat Daerah (Jamkesda) dan kita targetkan pada Perubahan APBD nanti menjadi Rp1 miliar,” katanya. Syahrul juga menjelaskan,

derajat kesehatan masyarakat Tapsel saat ini sudah meningkat. Namun seiring dengan itu, tuntuan masyarakat untuk mendapatkan pelayanan kesehatan yang maksimal dan memadai juga turut meningkat. “Kita akan berupaya menggratiskan seluruh pelayanan kesehatan dasar kepada masyarakat. Sementara kepada tenaga kesehatan PNS akan diberikan stimulus tambahan, agar pelayanan kesehatan semakin baik dan lebih maksimal lagi,” jelasnya sembari menekankan kepada seluruh bidan desa di Tapsel untuk benar-benar berada dan siaga di daerah tugas masing-masing. Arpan Dahyar Nasution, sebagai yang mewakili penerima Jamkesmas, berterimakasih banyak kepada Bupati dan Kadis Kesehatan yang telah berupaya keras serta gigih mengusahakan alokasi Jamkesmas untuk masyarakat Tapsel. (a27)

Waspada/Alam Satriwal Tanjung

WALI KOTA Sibolga HM Syarfi Hutauruk didampingi Lurah Aek Manis, Syahril saat melayani warga sedang mengurus surat di Kantor Lurah Aek Manis, Kec. Sibolga Selatan.

Logistik Pilgubsu Tiba Di Tapteng PANDAN, Tapteng (Waspada): Bahan logistik untuk pelaksanaan Pilgubsu telah tiba di kantor KPUD Tapteng di Pandan, Senin (11/ 2) sekira pukul 15.30. Namun, para komisioner KPUD beserta para petugas sekretariat belum membuka bahan logistik tersebut dan masih disimpan di gudang yang berdekatan dengan kantor KPUD. “Kemarin (Senin) bahan logistik yang dikirimkan dari KPU Sumut memang telah tiba di sini (kantor KPUD). Namun kami belum menghitung jumlah yang ada dari bahan logistik itu,” kata Ketua KPUDTapteng melalui Divisi Hukum dan Humas Juaja Hutajulu kepada Waspada, Selasa (12/2). Dijelaskannya, bahan logistik tersebut dikawal petugas dari Poldasu dan juga petugas dari Sekretariat KPU Sumut yang terdiri dari surat suara, formulir C6 yang digunakan untuk

panggilan kepada para pemilih, tinta, kunci dan gembok, kertas segel dan beberapa perangkat yang digunakan untuk Pilgubsu. “Kita rencanakan pekan depan surat suara akan mulai dilipat dan sekaligus nanti akan kita hitung jumlah surat suara yang akan dipergunakan. Setelah itu, sejumlah logistik itu akan didistribusikan ke PPK dan PPS, baru pada saatnya nanti akan digunakan pada hari H Pilgubsu,” jelas Juaja tanpa menentukan tanggal dan hari pastinya surat suara akan dilipat. Disinggung tentang petugas PPS dan KPPS yang akan bertindak sebagai penyelenggara di tingkat kelurahan/desa dan di TPS, pihak KPUD Tapteng saat ini sedang dalam perampungan administrasi para petugas.”Paling lambat pekan depan para petugas PPS dan KPPS telah kita lantik,” ujarnya. (cpol)

DP4 Madina 377.889 Jiwa PANYABUNGAN ( Waspada): Bupati Madina diwakili Sekdakab M. Daud Batubara, S.Sos, M.Si menyerahkan Data Penduduk Potensial Pemilih Pemilu (DP4) dengan jumlah 377.889 kepada Ketua Komisi Pemilihan Umum (KPU) Kabupaten Mandailing Natal Jefri Anthoni, SH di aula Bappeda di kompeleks perkantoran Payaloting Panyabungan, Kamis (7/2). “DP4 yang diserahkan hari ini 377.889 jiwa yang dikemas dalam bentuk compact dics. Kemudian merupakan pemilahan dari database kependudukan secara keseluruhan yang akurasinya sudah ditingkatkan secara maksimal,” ujar Daud Batubara. Hadir dalam kegiatan itu, Ketua dan Panwaslu Madina Henri Pulungan dan Sarman Nasution, Sekretaris KPU Dahlan, Sekretaris Bappeda Abu Hanifah, Kadis Kependudukan dan Capil M. Jamil Lubis, Kabid Kependudukan Ibrahim Lubis, Kabag Tapem Hasan Basri Rangkuti, Kabag Humas dan Protokol Haposan

Nasution beserta unsure terkait lainnya. Menurutnya, penyerahan DP4 ini juga merupakan bagian tahapan yang sangat penting dan strategis dalam penyelenggaraan Pemilu 2014, karena merupakan bahan yang akan diproses lebih lanjut oleh KPU melalui pemutakhiran data pemilih, penyusunan dan pengumuman data pemilih sementara (DPS) menjadi data pemilih tetap (DPT). Ketua KPU Madina Jefri Anthoni mengungkapkan, dengan diserahkannya DP4, pihak KPU sudah dapat memproses lebih lanjut tahapan pemutakhiran data pemilih, penyusunan DPS sampai dengan penetapan DPT. “Penyerahan DP4 ini dalam rangka pemilu DPR,DPD,danDPRDtahun2014nanti,”sebutnya. Dikatakan,DP4merupakandataawalyangpenting dalam proses pemutakhiran data pemilih menjadi Daftar Pemilih Tetap (DPT) untuk Pemilu 2014. DP4 yang telah diserahkan itu akan diolah, diteliti, dan disusun menjadi data pemilih. (a28)

Kapoldasu Diminta Tindak Tegas Illegal Mining Di Madina PANYABUNGAN (Waspada): Ketua Majelis Mahasiswa Muslim Mandailing Natal (M Four Madina) Faisal Chan, meminta Kapolda Sumatera Utara (Kapoldasu) turun tangan memerintahkan jajarannya bertindak tegas melakukan penertiban illegal mining (tambang tanpa izin) yang ada di Madina, termasuk menangkap toketoke tambang ilegal tersebut. Itu di sampaikannya kepada Waspada, Minggu (10/2) di Panyabungan, terkait tambang rakyat di Hutabargot Julu yang baru-baru ini telah menelan korban jiwa. Bahkan Tim SAR dan juga BPBD Madina masih berada di lokasi untuk mencoba melakukan evakuasi meski tidak ada hasilnya hingga saat ini. Karena, diduga masih ada warga yang terjebak di dalam lubang tambang emas ilegal diketahui milik warga Panyabungan berinisial A. Walaupun saat kejadian pintu masuk lobang tam-

bang emas itu telah ditutup yang bersangkutan. Penetiban, kata dia, utamanya dilakukan di Kec. Hutabargot yang sudah banyak menelan korban jiwa, dan juga banyak penambang atau toke tambang yang tersandung pidana tanpa kepastian hukum yang jelas. Faisal Chan yang juga Bendahara Badko HMI Sumut ini meminta Kapolda Sumut, Irjen Pol.Wisnu Amat Sastro supaya bertindak cepat, agar tidak ada kesan di mata publik bahwa institusi yang di pimpinnya terkesan tutup mata atau setengah hati dalam menegakkan undangundang pertambangan. “Pak Kapolda kita minta harus bertindak cepat sehingga tidak ada kesan, atau tudingan yang muncul bahwa aparat kepolisian sengaja membiarkan praktik illegal mining. Karena, fakta yang ada sering masyarakat yang ditangkap terkait tambang ilegal justru dibebaskan. (c14)

Membenahi Sarana Dan Prasarana Pendidikan Madina SARANA dan prasarana pendidikan, tentu saja hal sangat penting untuk meningkatkan dan memajukan dunia pendidikan. Tanpa sarana dan prasarana pendidikan yang layak, mustahil proses belajar dan mengajar berjalan baik dan lancar. Karena itu, sarana dan prasarana pendidikan harus terus ditingkatkan jumlahnya, sesuai kebutuhan sebenarnya. Di sisi lain, kondisi fisik bangunan juga harus

terus dijaga dan dipelihara agar kondisi fisik bangunan aman dan nyaman digunakan dalam proses belajar-mengajar. Untuk itulah, dalam rangka mengoptimalkan sarana dan prasarana pendidikan, Pemkab Madina melalui Dinas Pendidikan terus berupaya semaksimal mungkin agar jumlah murid seimbang dengan jumlah ruang belajar yang dibutuhkan. Pada tahun anggaran 2012, rehabilitasi ruang kelas yang rusak dan pembangunan unit

sekolah baru (USB) yang tersebar di seluruh kecamatan yang ada merupakan skala prioritas untuk segera direhab dan pada beberapa tahun mendatang rehabilitasi ruang kelas yang rusak ini diharapkan tuntas. Sehingga, memberikan dampak positif bagi kemajuan pendidikan di Madina, terutama dibidang sarana dan prasarana. Aplikasi diturunkannya dana untuk penuntasan ruang kelas yang rusak itu pendanaannya bersumber dari APBD, DAK

Waspada/Munir Lubis

BUPATI Madina Hidayat Batubara didampingi Kadis Pendidikan Imron Lubis saat menyerahkan tabungan beasiswa kepada orangtua mahasiswa miskin berprestasi di halaman SMA Negeri 1 Panyabungan, belum lama ini.

dan APBN. Mengenai mekanisme pelaksanaannya, tentu mengacu pada juklak dan juknis yang telah ditetapkan. Untuk tahun 2012, Dinas Pendidikan Madina menerima kucuran dana alokasi khusus (DAK) berkisar Rp16 miliar lebih dan BDB Rp12 miliar lebih. Dana tersebut sudah dialokasikan untuk peningkatan pembangunan sarana dan prasarana dengan berpedoman kepada semua pelaksanaan yang telah dilakukan pada tahun sebelumnya guna penujang kualitas pendidikan itu sendiri. Kepala Dinas Pendidikan Madina H.Imron Lubis, SPd, MM yang dihubungi di kantornya baru-baru ini, membenarkan, program pendidikan gratis sudah berjalan sejak 2012 sebagai implementasi visi misi Bupati Madina Hidayat Batubara danWakil Bupati Dahlan Hasan Nasution. Untuk tahun anggaran 2013 ini, katanya, program pendidikan gratis akan semakin ditingkatkan dananya di APBD. “Bantuan BOS daerah untuk SMA dan SMK terus ditingkatkan tahun ini Rp8 miliar. Selain dianggarkan untuk pembebasan uang komite, tahun ini kami juga menganggarkan Rp3,2 miliar untuk pembelian seragam pakaian seragam bernuansa daerah bagi siswa-siswi SMA dan SMK,” ungkapnya. Selain itu, lanjutnya, kalau pada tahun 2012 Pemkab Madi-

na memberikan bantuan beasiswa dalam bentuk tabungan Rp1 miliar kepada 180 mahasiswa berprestasi berasal dari keluarga miskin atau kurang mampu Rp5 juta per orang per tahun, pada tahun 2013 ini akan ditingkatkan menjadi Rp1,5 miliar. Dengan demikian, akan semakin banyak jumlah mahasiswa yang mendapat beasiswa dari program pendidikan gratis tersebut. Apalagi, bantuan dinilai sudah cukup untuk membayar uang kuliah selama satu tahun, tentunya hal ini sangat membantu mahasiswa berprestasi dari keluarga kurang mampu secara financial. Pemberian bantuan biaya pendidikan bagi putra-putri terbaik Madina yang kuliah di perguruan tinggi negeri seIndonesia itu, merupakan salah satu prioritas pembangunan daerah lima tahun ke depan di sektor pendidikan. Tidak kalah pentingnya Pemkab Madina akan tetap memberikan penghargaan kepada mahasiswa, seperti diberikan kepada tiga mahasiswa terbaik BLU- STAIM lulusan tahun akademik2012-2013dalammendapatkan beasiswa melanjutkan studi ke program S-2. Imron mengungkapkan, sejumlah dana terhadap upaya dan nilai anggaran juga akan dikucurkan pada tahun 2013 ini dari bidang pembangunan sarana dan prasarana dimaksud, sehingga diharapkan mutu

pendidikan di daerah ini dapat meningkat secara merata ke seluruh pelosok Madina. Menurutnya, untuk mewujudkan kebijakan pendidikan gratis harus didukung semua pihak. Perubahan hanya akan terjadi jika ada komitmen yang kuat di dalam diri kita untuk berubah. Begitu juga membangun pendidikan di Madina, harus ada komitmen yang kuat dari pemerintah pusat, pemerintah daerah, manajemen kampus, mahasiswa serta pihak-pihak yang berkepentingan seperti dunia usaha. Ke depan, kata Imron, tantangan untuk daerah ini semakin pesat, benar-benar dibutuhkan kesiapan SDM yang siap dalam berkompetisi. Ini, lanjut dia, tanggungjawab kita bersama untuk membangun pendidikan di negeri ini. “Kalau kita ingin hasil bulanan tanamlah padi-padian, dan kalau kita ingin hasil tahunan tanamlah kayukayuan. Kalau kita ingin hasil investasi, tanamlah ilmu dan pendidikan. Dari falsafah ini, mari sama-sama kita berorientasi dan memadukan dengan satu pandangan yaitu bagaimana dunia pendidikan di Madina bisa maju dan setara dengan daerah lain,” harapnya. Amiiin. * Munir Lubis

B4 1 CM 2 CM


Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000



: : : : :

Bursa Automotive

Air Condition Ban Radial Central Lock Nippon Denso Double Blower


: Power Stearing : Power Window : Radio Tape : Ve l g R a c i n g :Electric Window


Berpeluang dapat hadiah emas 1,5 Kg. Uang Rp. 1 milyar ready stock. Xenia, Terios, Granmax. Hub. Hasibuan Astra: 0813 6297 1844 DAIHATSU BARU PAKET IMLEK Khusus PNS, Swasta dan Wiraswasta juga ok. Terios, Xenia, Luxio, Gran max PU dan MB. Beli Daihatsu sekarang...! Raih kesempatan dpt emas/uang Rp. 1M. Hub. PAIREN. 0812 6305 0708


Xenia, Terios, GM Pick Up, GM Minibus, Luxio, SIrion, Cash n Credit, Proses cepat, Data dijemput Hub. Riky 0812 659 5820 - 0878 6700 0029 DAIHATSU XENIA BARU DP 20 JT-AN Terios DP 22 Jt-an / Pick Up DP 12 Jt-an Luxio DP 30 Jt-an / Proses Cepat data dijemput Pemesanan Hub. Astra: 0813 9644 1622/ 0813 96444 104

DIJUAL DAIHATSU TAFT GT Independent Thn. 96. Harga Nego. Hub. 0853 5998 4488 DAIHATSU Terios TX Matic Thn. 2007. Silver, BK Medan Rp. 135Jt. Hub. 0852 7538 3218

DA I H AT S U Z e b r a Espass Pick Up 2001. Biru tua. 34 Jt Nego. Hub. 0813 6233 5574 DAIHATSU Taft Th. 89/90, W. Hitam, Ban Besar, AC, CD, Asesoris ok. Hub. 0853 6172 0189 PUAAS DGN DAIHATSU !!

DP Dan Angsuran Nego. Terios DP 20 Jutaan Grand Max 1.3 Jutaan. Xenia DP 15 Jutaan Sirion , Luxio dan Ayla juga bisa Serius !! Hub. HIDAYAT 0853 7073 3999


DAIHATSU Taft GTS, 87 itam met, komplit Rp. 35Jt. Toyota Corolla SE, Saloon 87, Itam met Komplit Rp. 35Jt Hub. 0823 76888808 HONDA ACCORD MAESTRO DIJUAL

Thn. 93/94. Hitam, AC, TV, DVD, PWR, VR, BR, Mobil sangat mulus, Hrg. 52Jt. damai. Hub. Rumah Makan Surya Baru Jl. Karya No. 90 Sei Agul. 20 Mtr Dari Simpang (4) Lampu Merah.


Panther Pick Up Turbo..............DP 20 Jt-an Panther LM, LV, LS, Touring.......DP 50 Jt-an Hub. Suprapto 0813 7507 0088 /(061) 7786 0168

ISUZU Panther High Sporty Thn. 97. Hijau metalik, siap pakai. Hub. 0812 6080 2804

5 CM 6 CM

Rp. 65.000 Rp. 78.000

7 CM 8 CM

Rp. 91.000 Rp. 104.000

ISUZU Panther Royal ‘96, 2500cc, W. Hijau Met, AC, VR, BR, H. 60 Jt/ net Hub. 0852 760 11333/ TP

TOYOTA Avanza G Th. 2007 BK Mdn. W. Hitam, Cat dan mesin mulus, siap pakai. Hrg. Nego. HP. 0821 6021 0957


TOYOTA Kijang LGX Th. 2001 BK Mdn W. Hitam Cat dan mesin mulus, siap

Mitsubishi L300 Pick Up Thn. 2010. Harga 125Juta. Bisa Nego. HP. 0812 6000 280

DIJUAL 1 UNIT MOBIL BOX L300 Diesel Thn. 2000. Hub. 0812 6469182 Mulai jam 14.00 WIB. Dijual Mesin Bakso Lengkap. 90% Baru Hub. 0812 646 9182


Mobil L300 Mitsubishi Thn. 2010. Harga 125Juta. Bisa Nego. HP. 0812 6000 280

pakai. Hrg. Nego. HP. 0852 7650 6242

TOYOTA Kijang Th. 91 Dijual. Kr. Commando. Mobil cantik, jokjok bagus. Mesin halus. H. Damai. HP. 0821 65522 533 KIJANG Super G Bensin Th. ‘95 Wrn abu2 tua metalik, BK Asli Medan, Velg Racing, ban baru, AC, Rp. 67Jt. Jl. SM. Raja No. 200. Hub. 0815 337 33688 / 7851402

9 CM Rp. 126.000 10 CM Rp. 140.000

PROTON SAGA 1.3 M/T Thn. 2009. Hijau met, BK Mdn Rp. 89Jt. Hub. 0853 7089 9893

TOYOTA Avanza G Th. 2008 Wrn hitam, BK Baru pajak 1 thn. Harga Nego. HP. 0813 6212 2339

DIJUAL Mobil Prado, hitam, thn. 2005, plat baru diperpanjang. Hub. 061 77126413

TOYOTA Avanza W. hitam G Thn. 2005. Mobil cantik, mulus. Hub. 0812 652 5760


KIJANG Super MB 91/92 Long, AC Sentral, Tape, VR, SL, 6 Speed, Mdn Biru met mulus luar dalam. KARIMUN Thn. 2000. Biru met. Mdn. Mulus kali. Body kaleng2. Lengkap, full musik.

Rp. 1.350.000,Jok (model press) + Alas


* Carry PU 1.5 DP 14 Jt-an. Angs. 2 Jt-an * APV Mega Carry DP 22 Jtan Angs. 2 Jt-an * Ertiga DP 38 Jt-an, Angsuran 3 Jt-an * APV Arena DP 27 Jt-an, Angs. 4 Jt-an * Dapatkan Banyak lagi hadiah2 lainnya Serius Hub. Ramadhan Nst. 0853 5856 9999 - 0821 6376 0192 NB: Tanpa Biaya Survey dan Pasti ok. Bawa Pulang Mobil

Ingin Promosikan Produk Anda Harian


Jaminan apa saja Sertifikat Tanah mobil & Sp. Motor. Segala tahun. Hub. 061-8222774 HP. 0853 6199 1500







TOYOTA Kijang New Krista Diesel ‘03 Biru Met orisinil. BPKB 1 nama dari baru, TV & sound System. Hrg. 148Jt. Hub. 0812 6078 732. Jl. Tuasan No. 141 A.





BPKB Mobil Toyota BK 1104 JZ A/n. Muhammad Gultur alamat Jl. Karya Dalam No. 2 Lk. X Medan Barat. No. BPKB 2780676 TERCECER

1 (Satu) Buah Surat Tanah SK Camat Kecamatan Medan Selayang a/n. Sastra Sinulingga yang terletak dijalan Jamin Ginting Gg. Beringin No. 35. Jatuh Antara Padang Bulan ke Simalingkar. Bagi yang menemukan hub. HP. 0812 6224 0841 dan diganti segala ongkosnya.


Thn. 93. Biru met, AC, DB, Tape, PW, VR, BR, Mobil mulus. Hrg. 51Jt. damai. Hub. Rumah Makan Surya Baru Jl. Karya No. 90 Sei Agul. 20 Mtr Dari Simpang (4) Lampu Merah.

TOYOTA Innova 2008 Diesel. W. Silver, BK Mdn asli, sangat mulus, terawat belum pernah sisip. HP. 0812 6400 427


Tercecer, 1 bh surat Tanah A/n. WAHAB. SK Kepala Desa Kwala Tanjung. Kec. Air Putih Kab. Asahan No. 201/95/1980. dan Surat Akta Jual Beli No. 20/500/AH/1980. Tercecer disekitar Jalan Ibrahim Umar sampai Jl. Prof. HM. Yamin SH. Medan Apabila menemukan mohon Hub. 0813 6230 1104

Manasik Haji Multazam: Setiap hr Sabtu Pkl. 14.00-16.00 Wib Hr Minggu pkl. 09.00-11.00 Wib SEGERA DAFTARKAN KE KANTOR PUSAT MULTAZAM JL. TITI PAPAN/ PERTAHANAN NO. 10 SEI SIKAMBING D MEDAN TELP. (061) 457 6116 FAX. (061) 451 2319 HP: 0813 6137 2321 - 0812 6495 8456



Menerima Siswa Baru, Instruktur Berpengalaman, Garansi Sampai Mahir, Ruang belajar Wi-Fi, Bonus Alat Kerja Hub. MB 1 Celullar Jl. Besar Delitua No. 1 (Depan Jl. Stasiun/Sekolah Istiqlal) Telp. (061) 703 2619HP. 0813 6113 9888


STUK BK 9757 BS. No. Uji Mdn 64558 - A. A/n. Joko Purnomo. Alamat Jl. Menteng VII M. Denai. Merk Mitsubishi L300.

Layanan Fardhu Kifayah Jl. Denai No. 140 Medan




STUK BK 8436 LU No. Uji AB. 01.001279. A/n. ARDIANSYAH. Alamat Jl. Manunggal Kel. Denai Medan. Merk Mitsubishi.


100 Unit Kursi Bekas Restoran (Kondisi 80%). Komposisi dibuat dari bahan plastik + Pipa nikel. Yang berminat hubungi Ibu ANI (0853 6298 9988)


Media yang Tepat untuk Iklan Anda

Sebuah BPKB Kereta Vega R 2007. BK 4538 CJ A/n. Chairi Fani. Tercecer di Jalan Ringroad Ngumban Surbakti Medan Hub. 0853 5872 7771


Telah hilang/tercecer surat2 tanah yang terletak di Jl. Bersama sudut Jl. Bantan (Dahulu Jl. Pukat Langge) No. 18 Kel. Bantan Kec. Medan Tembung. A/n. Aminuddin Hasibuan dan Tians Saragih.




HP. 8442246

0812 631 6631 Ada Garansi

WC TUMPAT Hub. 061 7673 5534 Setia Budi M. IBNU



HP. 0813 7035 7291 Ada Garansi



Dibutuhkan Karyawan/ti untuk ditempatkan di posisi sbb: - Captain/ Bisa bahasa Hokien - ADM/ Bisa bahasa Hokien - Cashier - Bartenders - Waiters/ess Syarat: - Minimal lulusan SMU/ sederajat - Berpenampilan menarik - Pria/ wanita - Bertanggung jawab, jujur, disiplin - Berpengalaman dibidang masing²

Asli Sertifikat Hak Guna Bangunan No. 59. Kel/Desa Lalang, Kec. Mdn Sunggal, A/n. Bank Rakyat Indonesia, berkedudukan di Jakarta yang diterbitkan oleh Kantor Pertanahan Kota Madya Medan tgl. 27-6-1988 disekitar Jl. Pinang Baris Link. V Kel. Llang Kec. Mdn Sunggal.


1 Berkas Asli Surat Tanah A/n. DJALALUDIN ZAKARIA Surat pernyataan melepaskan hak atas tanah No. 593.83/05/SPM HAT/ML/ 1991. Tgl. 8 Januari 1991. Letak tanah di lingk. III A Kel. Pekan Labuhan Kec. Medan Labuhan. Luas tanah 215 Mtr. Tercecer disekitar Jl. Sahbudin Yatim M. Labuhan sampai rumah Tgl. Tercecer 10 - 01 - 2013 belum ditemukan.

1. Supir Pribadi Pria : 1 Orang 2. Administrasi Wanita : 1 orang Persyaratan: 1. Mempunyai SIM & KTP Rajin, ulet dan bisa kerjasama dalam tim, bertanggung jawab 2. Tamatan D1-D3 yang berpengalaman dibidangnya Hub. 0812 6000 280


TERCECER Surat Sertifikat Tanah HGB No. 553, a/n. Drs. Ali Musa Siregar di daerah Jalan Setia Budi Indah pada Bulan Juni 2012. Hub. 0819 9048 86400





Avanza, Innova, Fortuner PURBA: 0813 9736 0333 -0878 6946 5276

DIBUTUHKAN Segera, Beberapa Karyawan Toko & Administrasi, Syarat: Jujur, Rajin & Bertanggungjawab, Diutamakan yg berpengalaman, Lamaran diantar ke: Jl. Cirebon No. 51/91 Medan (dpn Hotel Novotel), diterima paling lambat 15 Februari 2013

A. MUBARAKH Layanan Fardhu Kifayah, membutuhkan seorang Supir dengan syarat: - Pria, muslim - Mampu membawa mobil ambulance dalam dan luar kota Silahkan datang langsung ke:

STUK BK 8940 CJ. No. Uji Mdn 65862-A. A/n. PT. ASSA TRANSPORT. Alamat Jl. Kayu Putih Pergudangan No. 30 Medan. Merk Mitsubishi.



Jl. SM. Raja No. 4 / 18 Medan Telp. 061-7326981, 0813 7503 1889, 0852 6213 3488


HILANG Satu Akta Jual Beli Dan Pengoperan Vlag No. 42, tanggal 27-9-1990. a/n. Ramotan Hutapea, tanah tersebut terletak di Jalan Sei Babalan No. 3 Medan.

2013 5 Maret & 17 Maret 20 Maret 6 Maret 16 Maret 13 Maret 20 maret 22 Maret

Pesawat via Singapore




- TOYOTA Kijang Kommando 89/90 W. Merah pd metalic, AC. - Mitsubishi Jet star minibus 87 mesin sehat. Hub. 0852 7602 7789.

UMROH Umroh Reguler 9 Hari Umroh Reguler 11 Hari Umroh Reguler 14 Hari Umroh Plus Cairo Umroh Plus Turkey Umroh Plus Dubai Umroh Plus Aqso

Bagi Jamaah luar kota menginap di Hotel Madani (Gratis)


TOYOTA Yaris J M/T, Thn. 2012. Silver, BK Rp. 159Jt. Hub. 0853 6161 5977

SUZUKI Karimun Over Kredit Hitam met Th. 2003. Sgt orisinil, terawat, sudah dibayar 12 x sisa 2.400.000 x 24 balik DP 35Jt. Nego Abis. Hub. 0812 6063 7823, Full Sound Pake TV.



Apabila anda mencurigai sesuatu, silahkan hubungi kami di

TOYOTA Fortuner Bensin V 4x4 Matic. Thn. 2007, Hitam, BK Mdn Rp. 265Jt. Hub. 0812 65942789

FORTUNER ‘08, Hitam, M/T Km.48 xxx, jok kulit, sound sistem. Hrg. 290/Nego. Mobil simpanan. Hub. 0813 7525 7988

Iklan Anda Dijemput Khusus Wilayah Medan Hub. 0813 6207 8393 Wilayah Marelan, Labuhan, Belawan Hub. 0812 6390 660


OPEL BLAZER LT Injection Hitam met th. 96. Sgt orisinil, mesin sehat, AC Dingin, S. Pakai. Hrg. 46Jt. Nego. Hub. 0823 6261 5557

SUZUKI Side Kick W. Hijau met, BK Mdn. Kondisi mobil mulus, siap pakai Hrg. Nego. HP. 0811 652506


Pelanggan Yang Terhormat

TOYOTA Avanza Type S Th. ‘07, 1500cc, Manual, Wrn silver metalic, pajak panjang. Ban Baru, mobil ctk, 1 tangan dr baru Rp. 128Jt. Depan Kampus UISU No. 200. Hub. 0821 6767 7000 / 7851402

PEUGEOT THN. 03 TYPE 206 Warna Merah, cat mulus. BK Asli Medan. Harga 80Jt/ Nego. Hub. 0812 6025 2520

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000


HA TI-HA TI terhadap penipuan yang mengatas HATI-HA TI-HATI namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk TI-HA TI apabila membeli produk anda, dan HA HATI-HA TI-HATI anda ingin melakukan transaksi jual beli melalui transfer. Segala akibat yang terjadi diluar tanggungjawab

Mitsubishi T120 SS Pick Up. Tahun 2005 warna putih, mobil cantik, sehat. a. nego. Daihatsu Zebra Jumbo Pick Up Thn. 95, W. biru mobil cantik. a. nego. Hub. 0821 6754 7635


11 CM Rp. 165.000 12 CM Rp. 180.000

Rabu, 13 Februari 2013

Antar lamaran langsung ke : USAHA MIKRO SABLON KAUS Ingin punya skill sablon sekelas DAGADU-JOGER? Ingin buka usaha sablon dengan modal minimal? Training sablon “no basa-basi” 1. Kelas Sablon Basic Rp. 1,5 Jt 2. Kelas Sablon Kreatif Rp. 2,5 Jt 3. Kelas Sablon Advance Rp. 3 Jt 4. Kelas Buka Usaha Rp. 5 Jt s/d 10 Jt (Termasuk alat, bahan & support) Juga dibuka kelas: Desain Grafis Terapan Sablon Digital + DGT & Fotografi New: Mesin Stempel Import (2/3 Flash), DTG A4 - DTG A3, Decal Transfer, Mesin Karet, Laminating UV, CNC, Hot Print - HP: 0812 6000 0090 Jl. Jamin Ginting 247



Dibutuhkan Tukang Pangkas, Berpengalaman, Penghasilan menarik, Tukang luarkota/lajangdisediakan,Tempattinggal Hub. 0811 602 4156


Pengemudi/ Supir Pribadi, Pria, Memiliki SIM + KTP, Rajin, Jujur dan bisa bekerja sama dalam tim Hub. 0812 6000 280


Jl. Kejaksaan No. 7A-B Medan (061) 7669 6888


Syarat: - Pria/ wanita - Minimal tamatan D3 - Mempunyai kendaraan sendiri - Mempunyai SIM C - Menguasai computer minimal Ms. Office - Rajin, disiplin, jujur dan bertanggung jawab Kirimkan surat lamaran lengkap dengan CV ke:



Mari bergabung bersama kami Nadarya Aviation Centre (NAC) sebagai Pramugari, Airlines Staff, Travel Agent Staff dan GSE Operator (laki-laki) Persyaratan sebagai berikut: - Pria/ wanita usia 18 s/d 24 tahun - Max 30 thn khusus GSE Operator - Minimal lulusan SMA/ SLTA sederajat - Boleh yang sedang kuliah - Tinggi dan berat badan proporsional - Berpenampilan menarik - Berbadan sehat, jasmani dan rohani


Pengarahan Kerja FOR GOOD CAREER Daftarkan diri anda langsung ke: Jl. Karya Jaya No. 96 Pkl. Mashyur Telp. (061) 786 1348 ATAU Pendaftaran via sms: Ketik: Nama_Umur_Asal Sekolah_Alamat Kirim ke: 0819 6077 252 - 0821 6412 6225


Administrasi, Wanita, Tamatan D1 - D3, Berpengalaman dibidangnya minimal 1 tahun Hub. 0812 6000 280







Garansi 30 hari Uang Kembali

Turun/Naik Berat badan 5 - 3 Kg Sehat Berstamina (Sarapan Sehat) Baik Untuk Gemuk Turunan dan Gemuk Setelah melahirkan. SITI RAHMAH 0812 6056 2302. YANUARLIN LUBIS 0812 6477 875



PROMO!!! Mencari Member, Pendaftaran

Rp. 65 Rb saja (Buku produk 2 bh + uk. Baju, Uk. Kaki, Kartu nama, bon, buku panduan, discount, bonus) Gratis Kalender 2013 / Persediaan terbatas, siapa cepat dia dapat (Produk lengkap, baju, sepatu, assesories, tas, cosmetic, kopi, bumbu masak) Dapatkan bonus uang, perjalanan ibadah, wisata, mobil, rumah, dll. Hub. 0812 6548 425, 0813 6229 7935, 0819 6015 795, 061 794 7364


Pemasangan Depot Air Minum Isi Ulang paling murah Sesuai kemampuan anda 1. Depot RO 40 s/d 400 Galon/ hari 2. Depot Air Mineral/ Pegunungan 3. Jual alat-alat depot isi ulang Terima siap untuk jualan

UD. RIZKY ABADI JAYA Jl. Veteran Psr. 10 (dpn Mesjid Al-Hidayah) Helvetia Telp. (061) 685.3334 HP. 0813.7580.8866


PERABOT TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 7653.2188


Spring Bed 6 kaki 2 lapis Rp. 1.150.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun

Hub Telp. (061) 661.8116 - (061) 661.6802 - 7653.2188

Anda Butuh Perabot Jepara Asli?

MALIOBORO PERABOT Hubungi: Jl. Bilal No. 90 P. Brayan Medan Telephone Toko : 661.6285 Rumah : 661.1540 Fax : 661.6285 (061) Jl. K.L. Yos Sudarso depan SMA Negeri 1 Tebing Tinggi Telp. (0621) 24243

Sumatera Utara

WASPADA Rabu 13 Februari 2013


Wisman Ke Karo Menurun KABANJAHE (Waspada): Jumlah kunjungan wisatawan ke Kabupaten Karo dalam kurun waktu delapan tahun terakhir terus menunjukkan peningkatan. Namun kunjungan wisatawan mancanegara (Wisman) cenderung mengalami penurunan. Data pada Dinas Kebudayaan dan Pariwisata Kabupaten Karo, jumlah kunjungan wisatawan domestik maupun mancanegara ke Kab. Karo yang tercatat masuk ke objek wisata maupun yang tidak masuk ke

objek wisata pada 2012 berjumlah 570.788 orang. Yang masuk ke objek wisata, wisatawan domestik 433.421 orang, wisatawan mancanegara (wisman) 5.647 orang dan yang tidak masuk ke objek wisata di-

Musrenbang Dorong Partisipasi Masyarakat PEMATANGSIANTAR (Waspada): Tujuan Musyawarah Perencanaan Pembangunan (Musrenbang) sangat penting guna mendorong partisipasi masyarakat dalam menyusun perencanaan pembangunan tahunan di tingkat kecamatan. Camat Siantar Utara Junaedi Sitanggang, S.STP menyebutkan pentingnya tujuan Musrenbang saat pembukaan Musrenbang Kecamatan Siantar Utara di aula kantor camat setempat, Senin (11/2). Musrenbang dibuka Wali Kota Pematangsiantar Hulman Sitorus, SE didampingi Wakil Wali Kota Drs. Koni Ismail Siregar. Musrenbang yang merupakan rangkaian kegiatan Musrenbang kelurahan itu turut dihadiri Ketua DPRD Marulitua Hutapea, SE, Muspika, Ketua TP PKK, para lurah, tokoh masyarakat, LPM, Karang Taruna dan PNPM. Selain itu, lanjut Junaedi, untuk melakukan klasifikasi atas prioritas kegiatan pembangunan kecamatan berdasarkan fungsi, menampung serta membahas kebutuhan masyarakat. Kepala Bappeda Herowhin TF Sinaga, AP. M.Si dalam pemaparannya menjelaskan pembangunan daerah merupakan pemanfaatan sumber daya yang dimiliki untuk peningkatan kesejahteraan masyarakat yang nyata. Sekcam Siddik, S.STP selaku Ketua Panitia Pelaksana Musrenbang dalam laporannya menyebutkan peserta Musrenbang terdiri para lurah, delegasi perwakilan dari kelurahan, camat dan aparatur kecamatan dan dihadiri kepala Puskesmas, kepala sekolah, Karang Taruna, fasilitator kelurahan (Faskel), PNPM, pimpinan SKPD terkait, Ketua TP PKK. (a30)

Penolakan RAPBD Berdampak Buruk Terhadap Warga Miskin SIDIKALANG (Waspada): Penolakan Rancangan Anggaran Pendapatan Belanja Daerah (RAPBD) Dairi 2013 oleh DPRD berdampak buruk terhadap masyarakat khususnya warga miskin. Hal tersebut dijelaskan Kabag Kesra Drs. Marisi Siantui kepada Waspada, Jumat (8/2). Dampak buruk dimaksud salah satu diantaranya, beras miskin (Raskin) akan terlambat diterima rumah tangga sasaran (RTS), sebab pengelolaan APBD 2013 belum jelas apakah diatur Perbup (Peraturan bupati) atau Perda (Peratuan daerah). Selama ini, pengelolaan APBD diatur oleh Perda melalui sidang Dewan. Tetapi RAPBD ditolak DPRD dalam sidang paripurna 25 Januari 2013,dengan agenda sidang mendengarkan pendapat akhir Fraksi. Sianturi mengatakan, belum dapat memastikan kapan Raskin dapat diterima RTS. Padahal, selama ini Raskin disalurkan setiap bulan. (a20)

perkirakan 30 persen dari kunjungan wisatawan yang memasuki objek wisata sehingga jumlah keseluruhan 570.788 orang. Jumlah tersebut menunjukkan peningkatan dibandingkan dengan jumlah kunjungan wisatawan tahun- tahun sebelumnya, terutama wisatawan domestik. Namun dari data tersebut untuk kunjungan wisman dalam kurun waktu delapan tahun terakhir ini terus mengalami penurunan. Jumlah kunjungan wisatawan yang masuk ke objek wisata yang tersebar di sejumlah tempat di Kab. Karo, pada 2005, domestik 218.963 orang dan wisman 8.365 orang, tahun 2006, domestic 374.233 orang dan wisman 4.665 orang, tahun 2007, domestik 395.923 orang dan wisman 6.242 orang, tahun 2008, domestik 405.875 orang dan wisman 6.483 orang. Selanjutnya tahun 2009, domestik 434.641 orang dan wisman 5.796 orang, tahun 2010, domestik 402.102 orang dan wisman 5.796 orang, tahun 2011, domestik

406.245 orang dan wisman 5.647 orang. Diperkirakan sebanyak 30 persen wisatawan yang berkunjung ke Kabupaten Karo tidak masuk ke objek wisata, tetapi hanya mengunjungi pasar buah Berastagi, Fun Land Mikie Holiday, tempat bermain dan rekreasi lainnya dan villa yang umumnya terdapat di Kec. Berastagi, Merdeka dan Kec. Dolatrayat. Sehingga, hitungan jumlah kunjungan wisatawan domestik dan mancanegara ke Kab. Karo tahun 2005 berjumlah 295.526 orang, tahun 2006 berjumlah 492.567 orang, tahun 2007 berjumlah 522.815 orang, tahun 2008 berjumlah 536.065 orang, tahun 2009 berjumlah 573.472 orang,tahun 2010 berjumlah 530.267 orang dan tahun 2011 berjumlah 535.269 orang. KunjunganWismankeKabupaten Karo untuk tahun 2012 umumnya berasal dari Malaysia berjumlah 2.230 orang, Belanda 1.654 orang, Singapura 604 orang, Thailand 186 orang, Jerman 129

orang, Perancis 121 orang. Sedangkan kunjunganWisman dari Taiwan, India, Australia, Swiss, Italia, Inggris, China, Jepang, Spanyol, Amerika Serikat, Swelovenia, Srilangka dan Maroko berjumlah relatif sedikit masing-masing di bawah 100 orang. Objek wisata yang umumnya dikunjungi Bukit Gundaling di Berastagi, Panorama Sipisopiso di Kec. Merek, kawasan Gunung Sibayak/Lau DebukDebuk, Kec. Merdeka, kawasan Gunung Sinabung/Danau Lau Kawar di Kec. Naman Teran dan Taman Mejuah-juah di Kec. Berastagi. Pengamatan Waspada, jumlah kunjungan wisatawan ke Kab. Karo masih memungkinkan untuk lebih ditingkatkan dengan mengoptimalkan pembangunan sarana dan prasarana serta fasilitas di sejumlah objek wisata yang ada, juga melakukan pemberdayaan potensi sumber dayaalamKab.Karoyangmemilikipanoramaalamyangindahdan berhawa sejuk. (c09)

Waspada/Basita Bukit

ALAM TERBUKA salah satu tempat rekreasi di kota turis Berastagi yang belakangan ini banyak diminati masyarakat pada hari libur.

Jembatan MRS Marihat Amblas, Masyarakat Tobasa Dukung Investor Perekonomian Warga Terganggu Lokal Kerjakan PLTA Asahan III MEDAN (Waspada): Masyarakat Kabupaten Toba Samosir (Tobasa) mendukung sepenuhnya pelaksanaan pekerjaan proyek PLTA Asahan III setelah Pengadilan Negeri Medan memutuskan dengan memenangkan gugutan PT.Subur Sari Lastderich (PT.SSL) terhadap PT PLN atas sengketa pembangunan Pembangkit Listrik Tenaga Air di Desa Maranti Utara, Kec. Pintu Pohan Maranti, Kab. Tobasa 28 Desember 2012. Dukungan masyarakat itu disampaikan Horman P.Hutagaol, SE bersama Marlyn Simanjuntak, Senin (11/2) dalam suatu temu pers di Medan. Kedua tokoh pemuda Tobasa dan Sumut itu menyebutkan, dengan putusan PN Medan yang memenangkan PT.SSL, kini sudah ada titik terang pelaksanaan pekerjaan proyek berbiaya

Rp2,2 triliun akan segera diselesaikan setelah menuntaskan seluruh persoalan termasuk pembebasan lahan yang belum rampung. “Kita sebagai warga masyarakat yang dilahirkan di desa tersebut sejak awal telah menyambut baik siapapun dan perusahaan manapun yang akan melaksanakan pekerjaan proyek PLTA Asahan III itu,” kata Hotman P.Hutagaol yang mengaku tidak berpihak tetapi harus proporsional dan profesional terhadap perusahaan yang sudah memenuhi segala dokumen persyaratan untuk pekerjaan proyek tersebut. Sebagai putra Tobasa, Hotman Hotagaol sangat menyesalkan proyek raksasa itu sampai hari ini belum dikerjakan padahal kebutuhan pasokan listrik tambahan untuk masyarakat Sumut sudah begitu mendesak,

apalagi kini masih sering terjadi pemadaman listrik. Kepada PT.PLN, atas nama masyarakat Toba Hutagaol meminta agar segera legowo untuk memberikan kesempatan kepada PT.SSL sebagai investor lokal yang sudah sah dan berkekuatan hukum untuk mengerjakan pekerjaan proyek PLTA Asahan III. Marlyn Simanjuntak yang juga dikenal tokoh pemuda Sumut meminta agar pemerintah kabupaten, provinsi dan pusat harus mendukung putusan PN Medan itu. “Kalau sudah diputuskan pengadilan bahwa PT.SSL yang berhakmengerjakanproyekPLTA Asahan III, pemerintah mesti memberikan dukungan sepenuhnya sehingga persoalan itu tidak ada lagi di kemudian hari, sekaligus pekerjaannya segera diselesaikan,” ujarnya. (m22)

SIMALUNGUN ( Waspada): Akibat jembatan MRS di atas Sungai Marihat Nagori Semangat Baris, Kec. Siantar, Simalungun, praktis membuat akses perekonomian masyarakat terganggu. Jembatan MRS yang amblas itu persis berada di Km 6 jalan provinsi menghubungkan Pematangsiantar-Tanahjawa, Kab. Simalungun dan Pasir Mandogei Asahan. Kerusakan jembatan belum mendapat penanganan dari pemerintah, karena memang kerusakannya cukup parah. Jika dilakukan perbaikan, tidak mungkin hanya bagian yang amblas saja diperbaiki, tetapi harus dilakukan rehabilitasi total. Pengamatan Waspada di lokasi, Jumat (8/ 2), tidak ada pekerjaan yang mengarah terhadap perbaikan jembatan. Beberapa anggota masyarakat terlihat mengatur arus lalulintas dengan sistem buka tutup terhadap pengendara roda dua dan roda empat yang ingin melintas dari jembatan rusak tersebut. Kondisi beton penyangga jembatan amblas di bagian barat, persis bersebelahan dengan

pagar besi kantor pembibitan Marihat. Lantai jembatan miring dan patah. Hanya kendaraan roda dua dan roda empat yang dapat melintas. “Untuk sementara baru kenderaan roda dua dan mobil pribadi roda empat yang dapat melintas, sedangkan truk dan angkutan umum berbadan besar diarahkan dari jalur alternatif, bisa dari kebun Bahjambi maupun dari Sionggang. Hanya saja kami tidak tau apakah kondisi jalan alternatif itu dapat dilalui atau tidak,” jelas warga. Hubungan arus transportasi benar-benar terganggu, terutama truk pengangkut kelapa sawit dariKec.TanahjawadanHatonduhan.Trukangkutan ini tidak dapat melintas, sedangkan jalan alternatifsebagaimanadiakuisalahseorangpengemudi sulit dilalui karena kondisinya cukup parah. Bupati Simalungun JR Saragih saat turun ke lokasi beberapa jam setelah jembatan amblas menegaskan, akan mendesak Pemprovsu melalui Dinas Jalan dan Jembatan segera memperbaiki jembatan. “Kita sudah laporkan keadaan itu dan kita berharap segera ditangani,” tegas bupati. (a29)

Waspada/Hasuna Damanik

PASCA putusnya jembatan MRS Marihat, praktis arus transportasi terganggu, hanya dapat dilalui kenderaan roda dua dan kenderaan roda empat.

Forum Kepala Desa Taput Surati Mendagri Terkait Pilkada TARUTUNG (Waspada): Forum Kepala Desa (Kades), para tokoh adat/masyarakat kembali mendatangi Kantor Bupati Tapanuli Utara (Taput), Selasa (12/2). Aksi ini mereka lakukan untuk menyampaikan sikap kepada Mendagri terkait Pilkada (Pemilihan Kepala Daerah) yang akan dilaksanakan September tahun 2013. Kedatangan masyarakat dari Kec. Pahae Julu itu, disambut baik Bupati Taput Torang Lumbantobing di ruang balai data kantor Bupati, Jalan Letjen Soeprapto, Tarutung. “Kami warga masyarakat Kecamatan Pahae Julu, telah mengirimkan surat kepada Menteri Dalam Negeri di Jakarta, tentang permohonan dukungan pencalonan Bupati Taput. Kami mengharap, adanya peraturan yang memberikan kesempatan kepada Bupati Taput Torang Lumbantobing untuk bisa mencalonkan kembali pada Pilkada tahun ini. Sebab, Torang Lumbantobing masih satu kali dipilih langsung oleh rakyat Taput,” ujar Bitner Sitompul , utusan para tokoh dari 14 desa se-Pahae Julu membacakan pernyataan sikap mereka.

Mewakili Forum Kepala Desa se-Pahae Julu /14 Kepala Desa yang hadir yakni, Kepala Desa Luntong Dolok James Harianja menyampaikan pernyataan sikap mereka senada dengan para tokoh masyarakat yaitu, telah mengirimkan surat ke Menteri Dalam Negeri di Jakarta. “Bupati Taput Torang Lumbantobing kami pandang mampu dan sangat cakap menjalankan roda pemerintahan di daerah ini. Kami masih mendambakan kepemimpinanTorang Lumbantobing, karena selama kepemimpinannya sudah banyak kemajuan di berbagai sektor. Ini masih perlu tindaklanjutnya,” sebut James Harinja. Torang Lumbantobing mengatakan terharu dan tidak menyangka kehadiran para tokoh, para kepala desa dan warga masyarakat Pahae Julu, yang datang jauh-jauh dari kecamatannya untuk menyampaikan dukungan, agar bisa maju dalam Pilkada Taput tahun ini. “Terimakasih banyak kepada masyarakat Bona-pasogit. Kita harus akui, bahwa kasih, masih banyak kita temui di daerah ini. Hal ini harus menjadi memotivasi bagi kita untuk senantiasa bekerja keras,” ujarnya. (a21)

Bupati Remigo:

Membangun Pertanian Harus Kreatif PAKPAK BHARAT (Waspada): Bupati Pakpak Bharat Remigo Yolando Berutu, MBA terus berupaya mengangkat nilai ekonomi pertanian masyarakat Pakpak Bharat. Dalam dua tahun terakhir, kerja kerasnya melakukan pembenahan di tingkat birokrasi mulai membuahkan hasil, salah satu indikatornya adalah terbukanya lahan Kebun Inti Gambir 100 Ha setelah melakukan reposisi dan evaluasi di Dinas Pertanian. “Tidak cukup hanya melakukan evaluasi di tingkat birokrasi dan persoalan anggaran saja. Saya pun harus turun langsung ke tengahtengah masyarakat,” ujar pemegang titel MBA lulusan Pasca Sarjana Universitas La Trobe Australia itu, Kamis (7/2). Dikatakan, melewati hari pekan Sabtu dan Minggu dalam satu tahun terakhir, ia terus melakukan kunjungan langsung ke masyarakat petani melakukan dialog dan menampung aspirasi petani secara langsung. Bahkan, dalam membuka jalan masuk ke setiap sudut lahan pertanian, ia telah menyediakan alat berat yang selalu siap membuka jalan ke seluruh pelosok. “Masyarakat hanya mengusulkan dan menyerahkan surat penyerahan jalan yang akan dibuka, maka Dinas Peker-

jaan Umum akan mengerjakan pembukaan jalan bagi mereka,” ujarnya. Seperti terlihat, baru-baru ini, ia hanya ditemani ajudan dan Kabag Umum mengunjungi masyarakat petani cikaok yang dikenal masih menggunakan bibit jagung lokal. “Masyarakat kita dapat menghasilkan jagung 8 ton per hektar dengan menggunakan bibit lokal. Alasan mereka menggunakan bibit lokal adalah ketahanan terhadap penyakit, harga bibit lebih murah serta lebih mudah dalam melakukan perawatan,” tutur Bupati Remigo menjelaskan hasil pembicaraanya dengan petani setempat. Kendati masih banyak persoalan yang mesti dicari solusinya, Bupati Remigo mengaku akan terus mendorong petani setempat untuk bekerja keras,aktifsertaikhlas,termasukmendorongpetani untuk meningkatkan modal usaha dengan memanfaatkan pinjaman Kredit Nduma Pakpak Bharat yang disediakan Pemkab Pakpak Bharat. Di samping itu, masyarakat juga didorong untuk berhubungan dengan bank dalam meretas keterbatasan modal usaha pertanian dengan memanfaatkan program perkreditan yang saat ini banyak disediakan Bank Sumut dan BRI di Pakpak Bharat. (csb)



SBY Menepuk Air Di Dulang


omunitas pers memberi apresiasi atas kedatangan Presiden Susilo Bambang Yudhoyono pada puncak peringatan Hari Pers Nasional ke-27 di Manado, Senin (11/2). Walaupun molor dua hari karena Presiden SBY melakukan kunjungan kenegaraan ke sejumlah negara Arab namun peringatan Hari Pers/HUT PWI yang seyogianya diperingati setiap 9 Februari seperti sudah diperkirakan tetap berjalan meriah. Yang di luar dugaan, Presiden Yudhoyono mengeluarkan kritik lagi terhadap lembaga/ perusahaan pers. Kali ini ditujukan kepada pemilik media massa. Dia mengingatkan para pemilik media memberikan ruang yang sama dan adil dalam peliputan para calon kandidat legislatif dan calon presiden pada Pemilu 2014. SBY menyebut pers bukan cuma milik partai politik, calon legislatif, atau calon presiden semata-mata. Presiden mengungkapkan pers penting dalam menyebarkan informasi akurat kepada masyarakat terkait para kandidat yang akan berkompetisi pada 2014. SBY mengingatkan jangan sampai rakyat memilih kucing dalam karung. SBY boleh saja resah dengan elektabilitas partainya yang menurun drastis, hanya 5,8 persen menurut satu institusi survei nasional ternama (Waspada 12/2). Padahal, hasil survei Saiful Mujani Research & Consulting (SMRC) tidak sekecil itu. SMRC menyatakan elektabilitas Partai Demokrat anjlok, sebagian media menggunakan istilah terjun bebas ke angka 8 persen. Artinya, partai atau calon anggota DPR yang dipilih bila pemilihan legislatif digelar saat ini, berdasarkan survei SMRC Golkar meraih suara 21 persen, PDI Perjuangan 18 persen, Partai Demokrat 8 persen, Gerindra 7 persen, PKB 5 persen, Nasdem 5 persen, PPP 4 persen, PKS 2 persen, PAN dan Hanura masingmasing satu persen. Tentu pers terbuka untuk dikritik oleh siapa saja, termasuk oleh Presiden SBY. Dan kita tidak menafikan kalau keterpurukan Demokrat disebabkan partai ini tidak mempunyai media televisi sehingga mudah diserang dengan berbagai isu negatif oleh pemilik media televisi lain yang berasal dari parpol lain, seperti Golkar. Popularitas Golkar naik pun diyakini karena didukung deIntisari ngan promosi (iklan) yang gencar di media massa, khususnya televisi milik Aburizal Bakrie. Sama halnya dengan popularitas NasDem baPutusan SBY mengunyak terbantu oleh promosi dari berbagai telerusi partai secara langvisi swasta lainnya. Jika SBY merasa pemilik media massa tidak sung merupakan sikap adil karena selalu berpihak pada figur-figur tertentu, seharusnya Demokrat pun bisa melainkonsisten merugikan kukan hal sama dengan mendirikan media 240 juta rakyat Indonesia massa khususnya televisi. Soal independensi media tidak musti menyiarkan seluruh kegiatan parpol dan tokohtokoh parpol dalam kolom dan jam tayang yang sama. Misalnya gambarnya samasama 3 kolom atau ditayangkan pada jam-jam tertentu di televisi dengan durasi yang sama pula. Independensi media itu boleh berpihak kepada partai atau tokoh tertentu jika memang dinilai itulah yang terbaik untuk diketahui dan dipilih masyarakat. Biasanya setelah melewati tahapan reporting berimbang, akan jauh lebih cerdas bila media massa melakukan liputan investigasi terkait track record. Menurut hemat kita, kini liputan media massa sudah semakin berkualitas. Itu sejalan dengan masyarakat sudah semakin cerdas sehingga mengetahui betul mana berita yang bernilai tinggi dan berita-berita seremonial atau pesan sponsor. Oleh karenanya diharapkan semua pihak menghormati liputan atau agenda setting yang dijalankan media massa baik cetak, radio, televisi, termasuk sosial media. Masyarakat punya banyak pilihan untuk memilih media-media yang berkualitas, mendidik pembaca dan pemirsanya semakin cerdas. Tegasnya, kita tidak melihat ada yang salah dengan pemberitaan media massa secara umum masih di jalur yang benar. Kalaupun ada pihak yang merasa keberatan dan dirugikan bisa menggunakan hak jawab sebagaimana diatur dalam kode etik jurnalistik dan UU Pers No. 40/1999. Kita mencatat Presiden SBY beberapa kali menunjukkan kekesalannya pada media massa. Ketua Dewan Pembina/Majelis Tinggi Partai Demokrat itu pernah menuding media massa kurang objektif dalam memberitakan konflik di tubuh PD dengan maraknya pemberitaan negatif soal PD, terutama terkait dengan maraknya kasus Nazaruddin setahun lalu. Terkait pemberitaan Presiden SBY terjun langsung menangani partai, menjadi hak media massa pula mengkritik dengan menyatakan SBY inkonsisten, seharusnya diterima dengan lapang dada. Masalahnya, SBY pernah meminta agar seluruh menteri dan kepala daerah yang duduk sebagai fungsionaris partai politik untuk fokus di pemerintahan. Tapi, pekan lalu dia sendiri yang mengumumkan mengambil alih tugas dan tanggung jawab kepartaian (Demokrat) dari tangan ketua umum Anas Urbaningrum. Wajar saja kalau banyak pengamat politik menilai SBY ibarat pepatah ‘’menepuk air di dulang terpercik muka sendiri’’ karena SBY yang menyarankan anak buahnya fokus bekerja mengurus rakyat dan pemerintahan, tapi dia (SBY) sendiri melibatkan dirinya mengurus partai sehingga urusan pemerintahan terkait 240 juta rakyat Indonesia dari Sabang hingga Merauke hampir dapat dipastikan terbengkalai.+


Faks 061 4510025

Facebook Smswaspada

+6285277850101 Akibat kalap dan panik serta pengaruh pengacaranya (ES), maka Bupati Garut Aceng M. Fikri akan gugat DPRD, MA dan Mendagri. Yang diuntungkan disini adalah pengacaranya (ES), dapat job/uang. Hajar terus ES agar AMF berhasil kau miskinkan. +6283199025981 TIDAK ADA PENGALIHAN ISSUE • Mengenai S. P.T. Pa’ S.B.Y., supaya jangan disimak orang , lalu ditangkap LH• Picik sekali orang yang mengatakan begitu • Politicus yang daya fikirnya class the goat =kambing • Ada laporan masyarakat , K.P. K. segera bergerak menuju ke T.K.P. Ternyata laporan yang jitu dan accurate • Ditemukan di T.K.P. tanda ~ tanda bukti konkret , berupa ; Karung ber isi Uan g dan Buku Tabungan • Akhmad Fathonah yang di sergap K.P.K., berkata terus-terang, apa mengapa dan siapa !! Jadi tidak betul , ada pengalihan issue ! Cakap ngawor saja !# isnin 04 february di wisma atjeh family kruengsikameng # +6285763196160 Saya lewat jalan pasar 5 Tembung saya lihat baliho pak Amri Tambunan dekat kali jalan yg ada kolam renang gratis di tengah jln . Pak Amri ketawa sambil angkat tangan. Mungkin saja pak ketawa lihat kolam .saya kalau nggak salah di baliho itu gini tulisannya kalau menang Amri sumut akan cememerlang . Kedua bapa pandai juga milih nomor 4 . Sahabat nabi empat. Dasar kita empat .api angin air tanah dan usaha kita empat . Langkah rezki pertemuan maut.dan kucikak org minang empat gini bunyinya .indak tau di nan ampek waang komah .dri lb ktorong di pondok nyo nan langang tmbg. +6285763196160 Apapun cerita nya . Itu soal yg kelima itu . Islam rukunnya lima .salat lima waktu jari2 ku lima.cari makan ku juga di kaki lima .tidurku juga di kaki 5 pilihanku juga nomor lima .dari lb ktorong di pondok nyo nan langang tmbg. +6285261616845 Halo Arifin S Srg saya berhaji thn 2011 azan shalat Jumat baik di Medinah maupun di Mekah ataupun dimesjid belakang hotel Alfalah itu ada empat atau lima mesjid di belakang Jln Sari Mansur azan nya pun sama dua kali seperti di indonesia kebanyakan apa itu tak benar atau salah ? +6281377256005 Kepada panitia SNMPTN Bidikmisi, penerimaan pendaftaran bidikmisi di sekolah MAN Panyabungan di kenakan biaya 500 ribu, di SMKN1 Panyabungan 250 rb, termasuk cuci rapor, anak saya termasuk 3 besar dan saya tdk mampu membayarnya. +6281265459234 Halo Waspada..tolong jadwal sepak bola jgn membingungkan...kalau tgl 13 Januari jam 2.45 itu,setahu saya udh hari kamis dini hari tgl 14 Januari...bkn nya msh hr rabu...tlng jgn sampe pembaca jd bingung...maaf klo saya salah... +6288262009493 Taburkan garam, untuk, mepengaruhi hujan sia sia. berikan saja uang itu pd masyarakat. cuaca kedep slr dn tdk dpt di tbk. gemp dn snm terj adi di ina, terj di eropa. +6285296086282 Saya beserta warga Aek Nabara Lab.batu resah karena oknum PDAM TIRTA BINA di daerah ini mengutip iuran penggunaan air yg tanpa menggunakan meteran utk keuntungan pribadi. sehingga pelanggan resmi yg menanggung pemakaian mereka. tolong pak yg berwenang singkirkan tikus2 kecil spt ini, sebelum mereka jadi monster.(Tlg di muat ya Pak) +6285262918743 Pak Camat warga Desa Kampung Lalang dan Camat kami juga. tapi kok malah tak mendegar keluhan masyaratnya ttg BPD nya Desa Kampung Lalang Tolong bapak tinjau kembali pak. +6281361504814 Ayo ojo lali karo konco tunggal kapal elek - elek nek wong jowo isih du we roso satriyo mulo a yo dadi siji pilih nomor 5 ora usah mikir tenan ojo kliru maturnuwun.

WASPADA Rabu 13 Februari 2013

Demokrat; Antara Demokratisasi & Korupsi Oleh Dr Drs H.Ramli Lubis, SH, MM Sepintas mirip masa orde baru yang otoriter. Bahwa sebuah kebijakan dari proses demokratisasi yang demokratis bisa dengan begitu saja dianulir oleh kekuasaan.


asus Hambalang telah menyeret sejumlah nama petinggi Partai Demokrat, yang merupakan partai pemenang Pemilihan Umum (Pemilu). Kemarin Presiden Susilo Bambang Yudhoyono (SBY) selaku Ketua Dewan Pembina Partai Demokrat mengambil langkahlangkah politik. “Tekad kami adalah ingin melakukan tindakan cepat dan nyata untuk menyelamatkan Partai Demokrat,” sebut SBY. Ada delapan langkah yang diambil dalam rapat Majelis Tinggi yang dipimpin SBY itu. Langkah-langkah yang berupa penegasan kewenangan Ketua Dewan Pembina yang juga Ketua Majelis Tinggi partai. Langkah-langkah tersebut yaitu; Ketua Majelis Tinggi partai bertugas, berwenang, dan bertanggungjawab untuk memimpin penyelamatan dan konsolidasi partai; Segala keputusan, kebijakan, dan tindakan partai ditentukan dan dijalankan Majelis Tinggi partai; Ketua Majelis Tinggi partai mengambil keputusan dan arahan yang penting dan strategis; Elemen utama partai, utamanya Fraksi Partai Demokrat di DPR beserta DPD dan DPC Partai Demokrat, berada dalam kendali dan bertanggungjawab langsung pada Majelis Partai, sesuai hierarki dan konstitusi partai; Majelis Tinggi melakukan penataan dan penertiban partai untuk meningkatkan kredibilitas dan integritas partai; Putusan Majelis Tinggi mutlak dijalankan. Yang tidak menjalankan akan diberikan sanksi tegas, termasuk yang tidak nyaman dengan kondisi elektabilitas partai yang turun saat ini, atau tak suka dengan kebijakan penyelamatan partai yang dipimpin Ketua Majelis Tinggi partai, dipersilakan untuk meninggalkan partai; Penataan dan konsolidasi partai yang dipimpin Majelis Tinggi berakhir setelah nama baik partai pulih dan normal Sementara langkah-langkah ini diambil, Anas Urbaningrum selaku Ketua Umum Partai Demokrat diarahkan untuk memfokuskan diri menghadapi masalah dugaan hukum di Komisi Pemberantasan Korupsi. SBY juga mengatakan bahwa Partai Demokrat siap memberi bantuan hukum kepada Anas. Bahasa yang lebih lugas dari seluruh pernyataan tersebut adalah bahwa SBY

mengambilalih kepemimpinan Partai Demokrat dan menonaktifkan Anas Urbaningrum dari jabatan Kerua Umum partai. Anas sendiri adalah orang yang terpilih sebagai Ketua Umum Partai Demokrat periode 2010-2015 dalam sebuah mekanisme partai. Kongres II Partai Demokrat tahun 2010 di Padalarang, Kabupaten Bandung Barat, Jawa Barat mengukuhkan nama Anas sebagai Ketua Umum partai penguasa tersebut. Anas memperoleh 280 suara (53 persen) sedangkan rivalnya Marzuki Alie hanya memperoleh 248 suara (47 persen) dari 530 pemilik suara. Calon lain yang dikalahkan Anas dalam kongres tersebut adalah Andi Mallarangeng. Sejak kongres tersebut sudah santer terdengar bahwa Anas bukanlah jagoan SBY. Karena memang Anas bukan murni kader Demokrat. Karena Anas adalah sebelumnya anggota KPU yang kemudian bersama rekannya Andi Nurpati bergabung ke Partai Demokrat. Anas juga adalah mantan Ketua Himpunan Mahasiswa Islam (HMI) yang disebut-sebut mendapat amunisi dukungan melalui jaringan organisasinya ini. Berbagai latar belakang ini tak “menyerempet” indikator pada kedekatan dengan SBY. Ini kemudian yang dipercaya dibuktikan dengan langkah menonaktifkan Anas. Para pengamat menilai bahwa keputusan SBY membuktikan adanya konflik berlarut di antara keduanya. Konflik yang memuncak pada dinonaktifkannya Anas akan membuat tubuh Partai Demokrat mengalami perpecahan. Lebih jauh lagi, tindakan SBY ini dianggap sebagai sebuah pelanggaran demokrasi di negeri ini. Karena seorang ketua umum partai yang terpilih secara demokratis, kemudian bisa dengan sekali keputusan seorang ketua dewan pembina partai, dinyatakan nonaktif dan diambilalih segala kewenangannya. Bahkan disertai dengan ancaman bahwa siapa saja kader partai yang tidak setuju dengan keputusan ini maka akan ada sanksi yang dijatuhkan terhadap mereka. Secara sepintas ini bahkan mirip masa orde baru yang otoriter. Bahwa sebuah kebijakan yang dihasilkan oleh proses demokratisasi yang demokratis bisa dengan begitu saja dianulir oleh

kekuasaan. Tentunya ini adalah sebuah pelajaran politik yang tidak mendidik dari para elit bangsa ini. Namun inilah kenyataannya, bahwa keputusan tersebut telah diambil. Maka tidak mengherankan ketika muncul “denyut” gerakan untuk melawan. Para loyalis Anas sepertinya tidak menerima begitu saja keputusan tersebut—meski hingga saat ini belum melakukan langkah-langkah politik yang berarti. Dari sudut lain, langkah SBY ini bisa dilihat dari sebuah dukungan terhadap pemberantasan korupsi. Karena indikasi kasus Hambalang telah mengarah ke Anas—telah berlangsung berlarut-larut yang membuat kerugian pada partai ini—seperti yang disampaikan SBY. Sinyal ke arah ini sebenarnya telah lebih dahulu disampaikan salah seorang petinggi Demokrat, yaitu Jero Wacik. Ia meminta Anas mundur dari jabatannya, karena partai tersebut sudah capek. Hal yang paling menyandera Demokrat menurut Jero adalah banyaknya kader yang tersangkut kasus korupsi, termasuk Ketua Umum Demokrat Anas Urbaningrum. Ini pula yang diyakini sebagai salah satu alasan mengapa rakyat sudah tidak percaya lagi pada Demokrat. “Saya tidak tahu proses di KPK bagaimana. Katanya sudah ada bukti. Katanya bakal tersangka. Tapi sudah setahun ini kami disandera kasus Anas Urba-

ningrum.Walau kami tak ingin campuri KPK, kami menunggu dengan tidak pasti kasus ini. Kami resah sekarang Partai Demokrat sudah 8 persen. Kalau Anas mau mundur, bagus. Kami sudah capek,” kata Jero pada wartawan pekan kemarin. Ketidakpercayaan rakyat terhadap Demokrat yang disebut Jero adalah berdasarkan survei yang dilakukan. Salah satunya, berdasarkan survei Lingkaran Survei Indonesia (LSI) yang digelar 211 Juni 2012, Partai Demokrat yang memperoleh suara terbanyak pada Pemilihan Umum 2009, berada di urutan ketiga dengan 11,3 persen jika pemilu digelar saat itu. Penutup Ada dua hal yang saling berlawanan dalam masalah Demokrat ini. Pertama adalah preseden buruk menyangkut pelanggaran demokratisasi dengan putusan yang cenderung otoriter dari SBY terhadap Ketua Umum Partai Demokrat yang dipilih secara demokratis. Kedua adalah komitmen melawan korupsi yang mengharuskan semua pihak untuk mendukung dengan langkah-langkah yang bahkan tak biasa. Kita tentu berharap yang kedua inilah yang menjadi kebenaran yang sedang terjadi. Penulis adalah Mantan Wakil Wali Kota Medan.

Manajemen Politik Partai Demokrat Oleh Hari Murti, S.Sos Partai Demokrat mungkin melihat bahwa saat ini belumlah momentum yang tepat untuk membangun citra dan elektabilitas partai dalam kaitannya dengan Pemilu.


anyak orang berpikir bahwa Partai Demokrat akan tenggelam. Beberapa kasus korupsi yang melibatkan beberapa kader elit-nya menunjukkan hal itu. Berbagai survey semakin mempertegasnya. Pendeknya, Partai Demokrat seperti kapal yang akan karam. Sebagai sebuah partai besar di antara partai besar lain yang akan menjadi lawan-lawannya di 2014 nanti, kondisi Partai Demokrat sekarang adalah sasaran empuk. Gempur habis mereka melalui media massa dan lihat hasilnya nanti dimana Partai Demokrat akan kandas karena ditinggalkan pemilih. Begitulah kira-kira pemikiran lawan-lawan Partai Demokrat sekarang tentang cara mengkanvaskan di 2014 nanti. Tapi, berapa kali kita saling mengingatkan bahwa politik bukan matematika? Bahkan matematika sendiri pun mengatakan negatif dikali negatif sama dengan positif. Jadi, agak lugu orang yang mengambil simpulan tentang eksistensi Partai Demokrat yang segera berakhir berdasarkan situasinya hari ini. Sebab, kalau ending politik bisa diprediksi secara tepat berdasarkan kronologi-kronologi, tak ada kader partai yang berani macam-macam. Mereka akan menjaga serius citra partainya di setiap ruang dan waktu. Tak perlu ada kata-kata bahwa politik itu bukan matematika. Pendeknya, tak ada situasi seperti artis yang justru semakin booming setelah kasusnya diekspos infotainment. Memang, setidaknya saat ini, hampir mustahil membuat orang percaya bahwa situasi negatif yang dialami Partai Demokrat hari ini bisa berbanding terbalik dengan eksistensi mereka yang akan booming di 2014 nanti. Siapa pula yang mau percaya bahwa citra dan elektabilitas yang jatuh adalah sekaligus memberi ruang gerak baginya untuk memantul lebih tinggi nantinya. Walaupun berkali-kali terlihat bahwa bocah yang nakal yang tiba-tiba baik menjelang ujian sekolah lebih diapresiasi dibanding anak yang sepanjang hari baik. Tapi politik jauh lebih kompleks dibanding sekadar anak nakal dan anak baik dalam menghadapi ujian di sekolah. Jadi, kecuali apabila ada penyelamatan besar dan nyata oleh, katakanlah SBY sebagai tokoh sentralnya, Partai Demokrat se-

perti layang-layang putus benangnya. Tapi kita bicara tentang politik dimana segala sesuatu bisa terjadi di sana. Setidaknya, bagi saya sendiri, ingin tampil beda dengan yang lain yang secara garis besar pendapatnya tentang prospek Partai Demokrat terbagi dalam 3 bagian, yaitu (1) yang pesimistis, (2) yang membela (orang Partai Demokrat), dan (3) yang apatis. Saya ingin mengatakan bahwa segala situasi negatif Partai Demokrat hari ini adalah energinya untuk memantul tinggi menjelang Pemilu 2014 nanti. Pendeknya, negatif dikalikan negatif, sama dengan positif bagi partai ini nanti. Jelas bahwa akan ada gerakan besar katakanlah oleh SBY untuk menyelamatkan partainya. Persoalannya, kita berpikir bahwa Partai Demokrat akan selamat bila ia melakukan gerakan seperti yang kita pikirkan, bukan seperti yang mereka sendiri pikir dan rencanakan. Padahal, dalam politik praktis, soal penyelamatan lebih pada soal bagaimana strategi dilakukan, bukan soal akomodasi suara publik. Hari ini, kita bisa saja mengatakan bahwa korupsi oleh beberapa kadernya itu mengempesi Partai Demokrat di kemudian hari. Tetapi di kemudian hari itu, bisa saja Partai Demokrat balik mengatakan kadernya yang masuk penjara itu adalah bukti bahwa mereka di jajaran depan menghunus pedang melawan korupsi. Toh faktanya memang banyak kadernya yang sekarang meringkuk di penjara. Di sisi lain, khalayak luas terlalu repot untuk membahas-bahas siapa yang benar-benar menghunus pedang melawan korupsi itu. Insidental Dalam politik, opini itu jauh lebih menentukan dibanding fakta sekalipun. Hal ini menjelaskan bahwa ada aspek insidensional publik dalam menentukan pilihan politiknya berdasarkan opini. Ya, kita tahu bahwa opini terhadap sesuatu, positif atau negatif, seringkali muncul secara insidental. Nah, aspek opini yang insidental inilah yang terlewatkan oleh kita ketika membahas situasi Partai Demokrat nanti di 2014 nanti. “Badai pasti berlalu”, begitu orang Partai Demokrat sering bilang. Mungkin bagi Partai Demokrat sendiri badai opini negatif lebih baik muncul sekarang un-

tuk kemudian berganti dengam musim panen opini positif di 2014 nanti. Partai Demokrat mungkin melihat bahwa saat ini belumlah momentum yang tepat untuk membangun citra dan elektabilitas partai dalam kaitannya dengan Pemilu. Justru, sekarang ini adalah momentum untuk bersikap efisien dalam pencitraan yang menelan biaya ekonomi dan sosial yang tidak sedikit. Saya jadi berpikir bahwa sedemikian bagusnya Partai Demokrat memanajemen politiknya sehingga badai yang umumnya datang pada semua partai besar itu—memilih momentum yang begitu baik pra-tahun politik dan mulai diselesaikan oleh SBY mulai awal tahun politik ini. Jika kita ingat bahwa sifat orang Indonesia yang durasi ingatan kolektifnya selalu temporal, maka badai yang datang dua atau tiga bulan menjelang Pemilu adalah “kiamat” bagi partai ini. Artinya, sekarang inilah waktunya Partai Demokrat untuk melepaskan segala beban yang dibuat oleh kader-kadernya yang nakal agar energi politiknya menjadi fokus di 2014 nanti. Tampaknya, akan ada penurunan intensitas badai secara signifikan menjelang 2014 nanti. Bukan karena partai ini memenuhi aspirasi publik, tetapi lebih karena sifat insidentil kolektif publik yang bertemu dengan apa yang saya sebut sebagai kehebatan manajemen politik partai ini. Ketika sifat insidentil ini bertemu dengan manajemen yang sedemikian apik, maka prospek Partai Demokrat pada pemilu 2014 cukup cerah. Apalagi, sampai saat ini belum ada partai lain yang menonjolkan sesuatu yang dapat dipandang oleh publik, baik dari aspek aksi nyatanya maupun momentum waktu terjadinya aksi nyata itu. Semua partai masih“menjual” secara konvesional, yaitu menjelang Pemilu dengan aksi yang biasa-biasa saja. Lawan-lawan Partai Demokrat masih melihat bahwa kejatuhan citra dan elektabilitas akibat ulah beberapa kadernya itu akan bertahan lama sampai akhirnya publik benar-benar meninggalkan mereka di 2014 nanti. Padahal, siapa bisa menolak bahwa kejatuhan itu justru bisa mengundang publik untuk berbalik menolongnya. Kalau kita memerhatikan grafikgrafik dari lembaga survai tentang citra dan elektabilitas partai penguasa dalam satu periode pemerintahan dibanding grafik periode pemerintahan sebelumnya, maka pola grafik relatif tidak banyak berbeda. Pola grafik bersifat fluktuatif, yang jika digambarkan dengan sebuah garis kurva, maka gambar kurva itu cekung di tengah dan relatif lebih tinggi di kedua ujung garis

kurva. Maksudnya, citra sebuah partai penguasa tinggi di awal pemerintahannya, lalu menurun terus di pertengahan periode, dan menanjak kembali di menuju batas akhir sebuah periode. Kecuali di negara-negara yang opini publiknya terkungkung oleh sistem otoriter, pola ini terjadi pada hampir semua partai penguasa di negara yang demokrasinya membuka ruang lebih besar kepada opini publik. Jadi, marilah kita lihat apakah Partai Demokrat melihat kejatuhan itu sebagai akhir dari kejayaannya atau justru menjadikannya sebagai momentuk men-charging energi dan mempersiapkan ruang gerak luas untuk memantulkan citra dan elektablitasnya dengan sangat tinggi dalam pemilu 2014 nanti. Penulis adalah Alumnus Sekolah Tinggi Ilmu Komunikasi “Pembangunan” Medan, Pemerhati Komunikasi Politik.

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengandisertaiCDataumelaluiemail: opini-waspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkandiMediamanapun.Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Wisatawan Asean ke Medan hanya belanja - Mau nengok apa di Medan? * Pemilih pinggiran kota jangan tergoda uang - Kayaknya susah menolaknya! * Medan incar Adipura Kencana - Kejar terus bos, he...he...he


D Wak

Medan Metropolitan A5 DPRD Pesimis Medan Raih Adipura Kencana WASPADA

Rabu 13 Februari 2013

MEDAN (Waspada): DPRD pesimis Kota Medan mampu meraih Adipura Kencana. Pasalnya, tumpukan sampah masih terlihat di beberapa lokasi dan penempatan bak penampungan sampah yang tidak tepat sehingga merusak keindahan Kota Medan. Parahnya, bak penampungan sampah tersebut ditempatkan di sekitar Tugu Perjuangan Medan Area. Hal ini membuktikan bahwa Pemko Medan tidak menghargai nilai-nilai perjuangan para pahlawan yang merebutkemerdekaanIndonesia. Demikian dikatakan politisi dari Fraksi Partai Keadilan Sejahtera (F-PKS) Muslim Maksum Yusuf, Lc kepada Waspada di gedung dewan, Selasa (12/2). Ketua Komisi D DPRD Medan ini menyatakan pesimis karena fakta di lapangan tidak sesuai dengan ucapan wali kota terutama masalah persampahan dan tata kelola infrastruktur yang tidak tuntas. “Apa yang diprogramkan

Wali Kota Medan untuk menciptakan kota ini bersih dan lingkungan sehat, ternyata tidak mampu dijabarkan Dinas Kebersihan selaku instansi pemerintah yang bertanggungjawab terhadap keindahan dan kebersihan Kota Medan,” kata Muslim. Sejauh ini, pihak DPRD Medan selalu memantau dan mengevaluasi masalah sampah dan kebersihan Kota Medan. Hasil evaluasi DPRD Medan, penanganan sampah belum berjalan secara teratur. Namun DPRD terus mengawasinya guna mewujudkan Medan Bersih. Menurut Muslim, tempat penampungan sampah sementara di Kota Medan sudah ada, namun pihak kelurahan belum mampu mengelolanya dengan baik. Dalam hal ini, Dinas Kebersihan Kota Medan yang bertanggung jawab dalam menjalankan program kebersihan kota harus didukung oleh pihak kecamatan, kelurahan dan kepala lingkungan (kepling). Untuk penanganan sampah, pihak terkait harus mampu menyusun strategi mengurangi sampah di Kota Medan. Dinas

Mayat Membusuk Ditemukan Di Komplek Patih Indah MEDAN (Waspada): Aryanto Gunawan, 41, tanpa busana ditemukan tewas dalam keadaan membusuk dan berulat di dekat kamar mandi rumahnya di Jln. Kapten Patimura, Komplek Patih Indah, Medan, Minggu (10/2). Informasi Waspada peroleh di lapangan, korban yang telah bercerai dengan istrinya tahun 2006, tinggal sendiri di rumahnya. Penemuan mayat itu berawal, warga mencium bau tidak sedap dari rumah korban. Selanjutnya, warga memberitahukan kepada kepala lingkungan di kawasan itu dan diteruskan ke pihak berwajib. Kapolsek Medan Baru Kompol Jean Calvijn Simanjuntak SH, SIK, MH mendapat informasi adanya mayat di dalam rumah langsung turun ke Tempat Kejadian Perkara (TKP) mengamankan lokasi. Kapolsek bersama personel Olah TKP Polresta Medan Misnan langsung melihat korban Aryanto Gunawan di lantai dengan polisi telungkup tanpa busana. Kondisi mayat sudah membusuk dan berulat. Selanjutnya, mayat korban di evakuasi ke ruang Instalasi Jenazah RSU Dr. Pirngadi Medan disaksikan orangtuanya Agus Gunawan, 59. Menurut personel Olah TKP Polresta Medan Misnan, ketika dilakukan pemeriksaan tidak ditemukan tanda-tanda bekas penganiayaan dan diduga korban terpeleset dan terjatuh saat menuju ke kamar mandi sehingga kepalanya terbentur ke lantai. Misnan memperkirakan korban tewas pada Selasa (5/2), dan mayatnya ditemukan sudah busuk dan berulat. Kasusnya kini masih lidik Polsek Medan Baru. (m36)

Kebersihan Kota Medan dan seluruh kepling yang langsung berhubungan dengan masyarakat harus memiliki strategi persampahan, sehingga tidak ada lagi penumpukan sampah di tingkat lingkungan. “Masyarakat harus berperan serta dalam menjaga kebersihan dan membuang sampah pada tempatnya,” tegas Muslim. Pelatihan Sebelumnya, Wali Kota Medan Drs. H. Rahudman Harahap, MM, mewajibkan seluruh lingkungan memiliki satu contoh pemukiman yang bebas dari sampah dan memiliki tempat pengelolaan sampah menjadi kompos. Untuk mewujudkan itu, harus melibatkan seluruh lapisan masyarakat. Sebab, pengelolaan lingkungan hidup yang bersih dan sehat, bukan hanya tanggungjawab pemerintah tetapi juga tanggungjawab bersama. “Saya minta seluruh kelurahan mencontoh apa yang telah dilakukan pihak kelurahan dan warga di Jln. Sutrisno Gg. Sehati, Kelurahan Sukaramai I, Kecamatan Medan Area. Selain telah menjadi kawasan hijau dan bersih, mereka juga telah memiliki tempat pengelolaan sampah menjadi kompos,” kata Rahudman ketika menghadiri acara

pelatihan pembuatan kompos metoda Takakura di Jln. Sutrisno Gg. Sehati Medan, Senin (11/2). Menurut dia, seluruh sampah yang ada di kawasan Gg. Sehati telah dimanfaatkan dengan sebaik-baiknya oleh warga setempat. Sampah organik dijadikan pupuk organik dan telah digunakan untuk memupuk seluruh tanaman milik warga, sedangkan sampah an-organik dijual ke bank sampah sehingga membantu pendapatan warga. “Jadi saya minta setiap kelurahan wajib memiliki tempat pengelolaan sampah menjadi kompos,” sebutnya. Rahudman menyampaikan apresiasi kepada Konsul Jenderal Jepang di Medan Mr. Yuji Hamada karena telah mendatangkan tenaga ahli dari Kota Kitakyushu, Jepang, guna memberi pelatihan pengelolaan sampah menjadi kompos. Menurut Rahudman, sampah yang dihasilkan setiap harinya diperkirakan mencapai 1.500 ton. Dari jumlah itu, sampah yang berhasil diangkut ke Tempat Pembungan Akhir (TPA) hanya sekitar 81 persen. Sedangkan sisa sampah yang tidak terangkut jangan dipandang sebagai musuh karena dapat diolah sehingga menghasilkan rupiah. Salah satunya

100 Peserta Ikuti Seleksi Guru, Pengawas, Kepsek Berprestasi MEDAN (Waspada): Sebanyak 100 peserta mengikuti seleksi guru, pengawas, dan kepala sekolah (kepsek) berprestasi tingkat SD, SMP, SMA, SMK negeri dan swasta se Kabupaten Deliserdang selama tiga hari di komplek Yayasan Perguruan (YP) Bayu Pertiwi, Kec. Sunggal. Acara seleksi yang berlangsung sejak Senin-Rabu (11-13/ 2) tersebut, dibuka oleh Camat Sunggal Dedi Maswardi MAP, didampingi Kepala Unit Pelaksana Teknis (KUPT) Dispora Sunggal Drs Lontar Siregar SPd, MSi, beserta Muspika setempat. Menurut Dedi Maswardi,

seleksi ini diadakan pemerintah setiap tahun untuk meningkatkan kompetensi guru sehingga diharapkan mampu meningkatkan mutu pendidikan. Selain itu diharapkan para guru dapat melakukan inovasiinovasi dalam pembelajaran, sehingga mampu menggunakan media yang lebih interaktif dalam mentransfer ilmu pendidikan kepada anak didik. Kata dia, dengan seleksi tersebut diharapkan terpilih guru, kepsek, dan pengawas sekolah yang mampu meningkatkan mutu pendidikan di Sunggal. Sedangkan KUPT Dispora

Tiga Pemakai Narkoba Diringkus MEDAN (Waspada): Tim Khusus (Timsus) Reskrim Polsek Sunggal menggerebek satu rumah diduga digunakan tempat untuk mengkonsumsi narkoba di Jln. Balai Desa Gang Buntu, Kel. Sunggal, Kec. Medan Sunggal, Senin (11/2) sore. Kapolsek Sunggal Kompol M Luther Dachi SSos, SH, Selasa (12/2) mengatakan, dari lokasi itu, polisi meringkus tiga tersangka yakni DIJ, 42, penduduk Jln. Sunggal Komplek Dirjen Pajak, Kel. Sunggal, Kec. Medan Sunggal, BS, 32, warga Komplek Perumahan Sri Gunting Blok X-5, Desa Sunggal, Deliserdang, dan RH, 36, penduduk Jln. Sunggal Gang Sederhana, Kel. Sunggal, Kec. Medan Sunggal. “Sedangkan barang bukti yang disita berupa empat plastik kecil bungkus sabu-sabu, dua mancis, dua bong alat pengisap sabu,” ujar Dachi. Dachi didampingi Kanit Reskrim Iptu Bambang Gunadi Hutabarat SH, MH, dan Kasi Humas Aiptu H Hambali Prayatna SH, menuturkan, penangkapan itu berawal dari informasi masyarakat yang menyatakan di salah satu rumah warga berinisial FI sering dimanfaatkan sebagai tempat mengkonsumsi narkoba. Selanjutnya polisi menuju lokasi dan melakukan penggerebekan sekaligus menangkap tiga tersangka yang sedang menikmati sabu. Sedangkan pemilik rumah FI berhasil melarikan diri dan kini masih dalam pengejaran. (m36)

GM GRIB Sumut Bagikan Sembako Kepada Warga Pra Sejahtera MEDAN (Waspada): Generasi Muda Gerakan Rakyat Indonesia Baru (GM-GRIB) Sumut membagikan paket sembako kepada masyarakat pra sejahtera di Jln. Prof HM Yamin, Gg. Obat, Sei Kera Hilir 2, Kecamatan Medan Perjuangan, Minggu (10/2). “Pembagian paket sembako ini diberikan GM GRIB Sumut kepada warga Tionghoa yang kurang mampu karena mereka sedang merayakan Tahun Baru Imlek,” kata Ketua GM GRIB Sumut Bobby Octavianus Zulkarnaen melaluiWakil Ketua Ismayadi Husein kepada wartawan, Minggu (10/2). Paket sembako yang diberikan tersebut berupa kue, sirup dan gula.“Semoga paket sembako ini bermanfaat bagi warga yang sedang merayakan imlek,” ujarnya di dampingi Bidang Pemuda dan Olahraga Mustika, ST dan Bidang Peranan Wanita Fauziah Nur . Dia menambahkan, bakti sosial ini merupakan bagian dari program kerja yang selalu ditekankan Ketua Umum GRIB Hercules Rozario Marshal melalui Ketua DPD GRIB Sumut HM Darwin Syamsul agar GM GRIB Sumut tetap peduli dan peka terhadap kehidupan masyarakat kecil tanpa pandang ras, suku atau golongan. Salah seorang penerima paket sembako, Amin mengucapkan terimakasih kepada GM GRIB Sumut yang peduli terhadap masyarakat kecil. “Semoga kegiatan seperti ini dilaksanakan secara berkelanjutan, sehingga kami bisa merayakan Imlek dengan suka cita,” ujarnya.(m25/rel)


WAKIL Ketua GM GRIB Sumut Ismayadi Husein menyerahkan paket sembako kepada warga pra sejahtera, Minggu (10/2).

dengan mengelola sampah menjadi kompos yang memiliki banyak manfaat, mulai dari manfaat ekonomi, lingkungan sampai manfaat bagi tanaman. Konjen Jepang di Medan Mr Yuji Hamada mengatakan, sampah di Jepang tidak hanya diolah menjadi kompos, tetapi bahan pembuatan tekstil. “Dasi yang saya pakai ini merupakan hasil daur ulang dari sampah,” ujarnya sambil memperlihatkan dasi yang dikenakannya. Atas dasar itu, Hamada ingin membantu Pemko Medan mengatasi masalah sampah dengan mendatangkan tenaga ahli dari Kota Kitakyushu, Jepang. Sebab, kota itu terkenal akan keberhasilannya dalam pengelolaan sampah, salah satunya dengan menggunakan metoda Takakura. Sementara itu Masami Izhuka dari JICA Junior Exppert Jepang menjelaskan cara mengelola sampah menjadi kompos dengan menggunakan keranjang Takakura. Kata dia, mereka telah melakukan kerjasama dengan Kota Surabaya dalam pengelolaan sampah. Dari kerjasama tersebut, sampah di Surabaya hanya tinggal 30 persen. Sedangkan untuk Kota Medan, dia optimis bisa menjadi 50 persen.(m30/m37)


KEPALA UPT Dispora Sunggal Drs Lontar Siregar didampingi Camat Sunggal Dedi Maswardi (kanan) memberikan arahan kepada peserta seleksi.

Sunggal Drs Lontar Siregar mengatakan, seleksi ini juga diharapkan dapat menanamkan nilai-nilai kompetensi dalam diri guru, sehingga mampu mengangkat mutu pembelajaran yang lebih baik di Sunggal. Sementara itu, Ketua Panitia Pelaksana Seleksi H Rozikun S.Sos mengatakan, seleksi guru, pengawas, dan kepala sekolah berprestasi ini merupakan program tahunan pemerintah. Seleksi berlangsung selama tiga hari dalam lima gelombang dengan agenda hari pertama pembukaan sekaligus uji kompetensi guru (UKG), dilanjutkan hari kedua wawancara, dan hari ketiga presentasi dan hasil seleksi. “Sebanyak 100 peserta yang mengikuti seleksi dibagi menjadi 20 orang dalam tiap lima gelombang,” tuturnya. Disebutkan Rozikun, seleksi tersebut untuk memotivasi para pengajar dan penyelenggara pendidikan lainnya guna meningkatkan kualitas anak didik secara berkesinambungan. “Seleksi yang diselenggarakan tahun ini berbeda dibanding tahun sebelumnya, khususnya para guru dan peserta penyelenggara pendidikan diharuskan memahami sistem informasi teknologi (IT) untuk menyesuaikan perkembangan dunia pendidikan ke depan,” ujarnya.(m40)

Alumni SMA Josua Serahkan Komputer Kepada Sekolah MEDAN (Waspada): Pemerintah harus dibantu dalam menegakkan empat pilar bangsa yaitu Pancasila, UUD 1945, Bhinneka Tunggal Ika, dan Negara Kesatuan Republik Indonesia (NKRI), sehingga empat pilar ini kokoh dalam jatidiri generasi muda bangsa menapaki era kesejagatan yang dilingkupi jiwa dan semangat kepedulian sosial. “Generasi muda dewasa ini menghadapi tantangan globalisasi yang tidak lagi jelas batasbatas wilayah kenegaraan dalam pergaulan antar bangsa. Untuk itu, agar eksis dalam tatanan pergaulan global itu, anak bangsa harus memiliki jatidiri yang kokoh yakni empat pilar bangsa,” ujar Kepala SMA Josua Medan M Parlindungan Harahap SpD, saat menerima alumni senior sekolah tersebut di Jln. GB Josua Medan, Sabtu (9/2). Di hadapan ratusan siswa salah satu sekolah tertua di Sumut yang berdiri tahun 1932 ini, puluhan alumni SMA Josua Medan Kelas 3 IPA 5 Angkatan Tahun 1985 yang tergabung dalam wadah Tripanca Foundation (TPF) Provinsi Sumut, melakukan silaturahmi sekaligus menyerahkan bantuan komputer lengkap dengan printer untuk almamaternya. “Kami juga terus menggalang kegiatan penegakan empat pilar bangsa bagi generasi muda dengan berbagai kegiatan dalam waktu dekat termasuk sosialisasi nilai-nilai kebangsaan dan nasionalisme bagi warga etnis keturunan. Beberapa waktu lalu TPF juga telah menggelar seminar wawasan kebangsaan

Waspada/Amir Syarifuddin

PULUHAN alumni SMA Josua Medan yang tergabung dalam wadah Tripanca Foundation (TPF) Sumut, menyerahkan bantuan komputer lengkap dengan printer untuk almamaternya. di SMA Negeri 2 Medan,” sebut Ketua TPF Provinsi Sumut Masri Effendi Siregar SpD, didampingi Sekretaris TPF Kota Medan Edward P Hutagalung. Kepala SMA Josua pada acara yang juga dihadiri pimpinan Yayasan GB Josua Taufik Salim SE, dan sejumlah guru mengucapkan terimakasih atas kepedulian para alumni tersebut kepada almamater dan menyampaikan apresiasi atas terbentuknya wadah alumni yang didasari ikatan kekeluargaan alumni TPF yang terbentuk sejak tahun 2005. Selain Ketua Sumut dan Sekretaris Medan, fungsionaris TPF yang bersilaturrahmi antara lain Sumedi, Ety Gusniarti, Arif Fadillah, Yasnelli Rianti, Safaruddin,

Surya Zulkarnain, Ramli, MYazid, Heri Muliono, Gusnaidy Nazir, Marwan Bakti Siregar, Junjungan Siregar dan Halason Pakpahan. Masri Effendi Siregar maupun Edward P Hutagalung mengajak segenap alumni SMA Josua lainnya dari setiap angkatan membentuk wadah sosial dan kepedulian serta menghimpun sumbangan atau bantuan untuk sekolah yang masih sangat dibutuhkan. “Kami juga bersedia menerima sumbangan atau bantuan dari para alumni yang tidak terbatas hanya seangkatan kami, melainkan dari seluruh angkatan yang berkeinginan memberikan bantuan guna kami salurkan kepada almamater,” kata Masri.(m28)

Waspada/Abdullah Dadeh

KEPALA Staf TNI Angkatan Darat (KASAD) Jenderal TNI Pramono Edhie Wibowo dan istri Kiki Gayatri, saat mendarat di Bandara Polonia Medan dari Banda Aceh, Selasa (12/2) sore, diulosi oleh Wali Kota Medan H Rahudman Harahap (kiri) dan Wakil Wali Kota Medan H Dzulmi Eldin (kanan) mengapit KASAD dan istri. Selain itu, ditangga pesawat Garuda, KASAD disambut Pangdam I/ Bukit Barisan Mayjen TNI Lodewijk F. Paulus bersama Kapoldasu Irjen Pol Wisjnu Amat Sastro, Dan Lanud Soewondo Kolonel Pnb SM Handoko beserta perwira Kodam I/BB. Kedatangan KASAD dalam kunjungan kerja ke Medan.

Diduga Terlibat Pembunuhan

Dua Oknum TNI Diserahkan Ke Den POM MEDAN (Waspada): Dua oknum anggota TNI diserahkan ke Den POM I/5 karena diduga terlibat dalam kasus tewasnya wanita bernama Tri Utami, sedangkan seorang lagi yang diduga sebagai dalang pelakunya masih diburon. Penyerahan kedua oknum TNI yang belum diketahui identitasnya itu, setelah petugas Polsek Medan Area memeriksa 12 orang saksi terkait tewasnya wanita asal Malang, Jawa Timur, yang mayatnya ditemukan di dalam parit pinggir jalan tol Belmera km 26.600 tepatnya di Kelurahan Menteng, Kec. Medan Denai. “Kedua oknum TNI itu telah diserahkan ke Den POM I/5, sedangkan seorang lagi yang diduga sebagai dalang pelakunya masih diburon,” sebut sumber Waspada di kepolisian, Selasa (12/2). Menurut dia, kedua oknum TNI itu ditangkap di kawasan Helvetia, sedangkan seorang lagi pelaku masih dalam pengejaran. Pelaku yang masih diburon tersebut, merupakan dalang pelaku pembunuhan dan masih dalam pengejaran petugas kepolisian. Sementara itu, Kapendam I/BB Kolonel Kav. Halilintar yang dikonfirmasi via telefon mengatakan, tidak ada penangkapan terhadap

oknum TNI. Hanya saja, Komandan Satuan dari salah satu Batalyon menyerahkan oknum TNI yang diduga pacar korban tersebut kepada Denpom 1/5 Medan. “Penyerahan ke Denpom itu berdasarkan laporan ke Batalyon. Jadi kasus ini dalam tahap penyidikan Denpom,” ujarnya. Sebagaimana diberitakan sebelumnya, Tri Utami, 24, ditemukan telah menjadi mayat di dalam parit pinggir jalan tol Belmera oleh petugas kebersihan Jasa Marga. Saat ditemukan, korban mengenakan baju kaos yang bertuliskan I Love Malang. Selama di Medan, korban bekerja di Griya Dome Jln. Amir Hamzah Medan, dan mengontrak rumah di kawasan Perumnas Helvetia. Adik korban bernama Ika, 22, mengaku, terakhir melihat kakaknya keluar dari rumah pada Rabu (2/1) lalu, dan setelah itu tak pernah kembali lagi hingga akhirnya ditemukan menjadi mayat. Sebelum pergi, korban sempat meminjam uang dari tetangga sebesar Rp500 ribu. Ika mengaku belum mencurigai siapapun yang tega membunuh kakaknya. Namun, sebelum meninggal, korban sempat bertengkar dengan calon suaminya yang juga anggota TNI. (h04)

Chairuman: Hormati Pilihan Rakyat 605 Saksi Ikuti ToT MEDAN (Waspada): Calon Gubernur Suma- dipilih pada Pilgubsu itu. Sementara itu, Ketua Panitia ToT HM. tera Utara Dr. H. Chairuman Harahap, SH, MH meyakini kecerdasan politik rakyat sudah cukup Hanafiah Harahap mengatakan, pertemuan ini baik. Sebab, rakyat sudah mampu menentukan merupakan sarana pembekalan bagi para saksi siapa calon yang memiliki track record baik, guna menghindari berbagai kecurangan yang sehingga tidak akan salah dalam menjatuhkan mungkin terjadi dalam Pilgubsu. “Saksi adalah ujung tombak, maka perlu pilihannya. Saat ini, rakyat sudah menentukan pilihannya dibekali dengan pengetahuan yang luas seputar karena menaruh harapan besar terhadap sosok pesta demokrasi ini,” ujar Hanafiah. SebelumnyaWakil Ketua Partai Golkar Sumut yang didukungnya. Karenanya, semua elemen masyarakat dan partai politik harus menghormati H. Amru Daulay, SH mengatakan, peran saksi hak politik dan hak konstitusional rakyat dalam sangat strategis dalam memenangkan Chairuman-Fadli. Selain bertugas mengawasi dan Pilgubsu pada 7 Maret 2013. Demikian dikatakan Chairuman Harahap menjaga proses pemungutan suara, saksi harus pada pembukaan kegiatan Training of Trainners memastikan tidak ada kecurangan dalam (ToT) Untuk Para Saksi Pasangan Chairuman - pemungutan suara. “Saksi yang militan tidak akan Fadly di Madinatul Hujjaj Asrama Haji P. Masyhur bisa muncul tanpa melalui proses perekrutan Medan, Selasa (12/2). Kegiatan itu dibuka Plt Ketua dan pelatihan,” katanya. Golkar dan PPP, masing-masing telah mengPartai Golkar Sumut diwakili Wakil Ketua H. Amru utus tiga kadernya dari setiap kabupaten/kota Daulay, SH. Hadir sejumlah pimpinan Partai Golkar Su- se Sumut untuk mengikuti pelatihan saksi itu. mut antara lain H. Wagirin Arman, HM Hanafiah Diharapkan, para peserta mampu memberi peHarahap, Hj Tati Habib Nasution, Drs. H. Tukari- mahaman yang sama soal Pilgubsu kepada calon min Adenan, Mulkan Ritonga dan lainnya. Kemu- saksi lainnya di setiap kabupaten/ kota.(m25/rel) dian fungsionaris DPW PPP Sumut yakni Ketua Fadly Nurzal, Yulizar Parlagutan Lubis dan ratusan kader lainnya, serta 605 peserta dari utusan DPD Partai Golkar Sumut dan PPP se Sumut. Menur ut Chair uman, pelaksanaan Pilgubsu tahun ini harus berjalan sesuai asas Luber, (langsung, umum, bebas dan rahasia). Seluruh lapisan masyarakat maupun partai politik harus saling menghormati hak rakyat sebagai pemilih. “Siapapun pilihan rakyat harus dihormati. Karena hal itu merupakan hak politik dan konstitusional rakyat yang harus dijunjung tinggi. Jadi, biarkan Waspada/ist rakyat memilih sesuai hati nu- CAGUBSU dari Partai Golkar Dr. H. Chairuman Harahap, SH, rani, sebab rakyat sudah menge- MH (kanan) didampingi Sekretaris DPD Partai Golkar Sumut nal track record calonnya se- HM. Hanafiah Harahap, SH saat memberi keterangan pada acara hingga dinilai pantas untuk TOT di Asrama Haji Medan.


WASPADA Rabu 13 Februari 2013


Sikap Mahasiswa Nias Aliansi mahasiswa/i Nias se-Sumatera Utara menyayangkan sikap oknum Ketua DPRD Nisel Pernyataan Ketua DPRD Nisel lewat media terbitan Medan yang menyatakan Bahwa: Ada 5 point mata anggaran atau kegiatan yang dicoret atau tidak disetujui sementara item anggaran tersebut sudah disahkan melalui DPRD Nias Selatan Oktober 2012 yang lalu. Ini berarti oknum Ketua DPRD Nisel dengan sengaja menghambat laju percepatan pembangunan serta membatasi setiap kinerja mahasiswa yang ingin mengembangkan karir dalam dunia pendidikan dengan tidak meng follow-up APBD Nisel 2013 yang telah dieksaminasi oleh Pemprovsu. Sesuai dengan point pertama “jasa konsultan penelitian dan perencanaan pembangunan rumah sakit” dalam hal ini, kita mengetahui tidak akan mungkin rumah sakit dibangun tanpa perencanaan matang melalui jasa konsultan untuk malakukan kajian akademis. Point kedua “ Belanja Pembak Nias Selatan “ seharusnya oknum Ketua DPRD lebih gampang dan paham untuk menentukan plafon anggaran belanja rumah tangga yang hanya berpedoman pada realisasi anggaran tahun 2012. Berani merubah putusan Paripurna dan dengan tidak menanda-tangani APBD tersebut bukan merupakan solusi yang tepat. Justru kami menilai oknum Ketua DPRD Nisel berani menentang hasil eksaminasi yang telah dilakukan oleh plt Gubernur Sumatera Utara, bukan menentang Pemkab Nisel. Point ketiga yang mengatakan “ Pengadaan tanah lahan “ di sini juga kami menilai bahwa suatu dasar bangunan tidak dapat berdiri tanpa adanya pembebasan lahan tempat untuk mendirikan bangunan untuk dijadikan sarana umum. Pembebasan lahan tersebut digunakan untuk mendirikan Rumah sakit demi kepentingan masyarakat Nisel bukan untuk kepentingan pribadi bupati. Jadi kami mohon agar kepada DPRD Nisel sebagai wakil rakyat mampu bersikap bijak dan arif untuk segera memproses APBD Nisel 2013 demi kemajuan nias Selatan. Point ke 4 yang mengatakan “ Belanja modal pengadaan alat-alat angkutan darat/bermotor 1(unit)jeep...dengan adanya pengadaan tersebut. Ini merupakan aset Nisel yang akan melakukan pelayanan prima terhadap tamu atau para pejabat dari luar Nias. Sehingga, pelayanan yang diberikan kepada tamu akan menimbulkan kesan positif, yang dapat memudahkan Pemkab Nisel mendapatkan bantuan anggaran dari Pemprov dan pemerintah setempat. Point ke 5 “Pernyataan modal “Menurut kami bahwa anggaran ini sangat wajar jika diberikan mengingat Perda BUMD ini cukup positif mengolah dana serta menggali potensi alam Nisel yang dapat mendongkrak PAD Nisel. Jadi apabila oknum Ketua DPRD tidak menyetujui anggaran penyertaan modal kepada BUMD, kenapa Perdanya disahkan tahun sebelumnya??? Hormat kami YASO LAIA ROY NDRAHA YASTINUS NDRURU

Pemblokiran Dana Rekanan Dinas PU Hiruk pikuk yang terjadi pada Bulan Desember terjadi setiap tahunnya dijajaran setiap SKPD di PemerintaH Kabupatent. Penyerapan anggaran yang dilakukan pemerintah daerah sering terjadi penumpukan. Pelaksanaan proyekproyek ‘kejar tayang’ yang dilakukan di SKPD sangat banyak dilakukan. Berbagai upaya telah dilakukan oleh BUD dalam mencermati fenomena pengeluaran kas akhir tahun. Upaya yang paling mendasar adalah menetapkan batas akhir pengajuan SPM dari SKPD untuk diterbitkan SP2D oleh BUD. Biasanya hal ini ditetapkan melalui Surat Edaran Sekretariat Daerah perihal pengajuan SPM akhir tahun, yang menetapkan batas akhir tanggal berkisar 15 – 25 Desember. Hal ini tergantung kebijakan Pemda yang bersangkutan. SPM yang diterima oleh BUD setelah tanggal ditentukan seyogyanya ditolak penerbitan SP2D nya, namun pada pelaksanaanya tidak dapat setegas itu. Pekerjaan yang benar-benar selesai dan tidak dapat terbayar akan menimbulkan masalah bagi Pemda, dan dapat menurunkan kredibilitas Pemda ybs. Sesuai dengan Permendagri 59/2007 pasal 216 ayat (1) yaitu Kuasa BUD meneliti kelengkapan dokumen SPM yang diajukan oleh pengguna anggaran/ kuasa pengguna anggaran agar pengeluaran yang diajukan tidak melampaui pagu dan memenuhi persyaratan yang ditetapkan dalam peraturan perundangundangan. Kelengkapan SPM dimaksud dijelaskan dalam ayat (5) berupa surat pernyataan tanggung jawab pengguna anggaran/kuasa pengguna anggaran dan bukti-bukti pengeluaran yang sah dan lengkap sesuai dengan kelengkapan persyaratan yang ditetapkan dalam peraturan perundang-undangan. “Buktibukti pengeluaran yang sah dan lengkap” terkait dengan dokumen pelaksanaan kegiatan berawal saat SPP akan diterbitkan oleh bendahara pengeluaran. Dokumen yang menjadi dasar adalah merupakan kewajiban PPTK untuk menyiapkannya, yaitu antara lain : SSP disertai faktur pajak (PPN dan PPh) yang telah ditandatangani wajib pajak dan wajib pungut, berita acara penyelesaian pekerjaan/berita acara serah terima barang dan jasa, berita acara pemeriksaan barang berikut lampiran daftar barang yang diperiksa, berita acara pembayaran/kwitansi bermeterai, nota/faktur, surat jaminan bank, surat pemberitahuan potongan denda keterlambatan pekerjaan dari PPTK apabila pekerjaan mengalami keterlambatan, dan kelengkapan kontrak (ikhtisar kontrak, surat perjanjian kerja sama yang disertai dengan nomor rekening pihak ketiga, dokumentasi, berita acara prestasi kemajuan pekerjaan, dll) Dalam melaksanakan ketentuan diatas, SKPD sering melakukan keterlambatan pengajuan SPM yang berawal dari keterlambatan pengajuan SPP, karena belum lengkapnya syarat sahnya diterbitkan SPP untuk dilakukan pengajuan pembayaran. Keterlambatan dokumen yang utama adalah belum dibuatnya berita acara penyelesaian pekerjaan karena pekerjaan akhir tahun SKPD yang molor, dalam hal ini pekerjaan belum selesai pada akhir tahun. Pekerjaan yang belum selesai antara lain disebabkan terlambat mulainya proses lelang/surat perintah kerja dan terlambatnya penyelesaian proyek oleh rekanan. Proses pencairan kas akhir tahun merupakan proses yang sangat rawan, karena dilema hal-hal diatas. Sistem administrasi pengeluaran kas yang merupakan sistem pengendalian intern yang dirancang untuk melindungi aset pemerintah sangat berpotensi “dilabrak” karena kepentingan pencairan dana. Pada akhir tahun, BUD selain sibuk dalam mengurusi penerbitan SP2D, juga sibuk menerima telepon dari SKPD, pihak-pihak yang memiliki kepentingan yang “memaksa” pencairan dana sebelum melewati akhir tahun. Hal-hal yang perlu diwaspadai; Blokir dana rekanan Pemda melakukan cara yaitu meminta surat pernyataan dari rekanan pelaksana untuk menyelesaikan pekerjaan sesuai batas waktu di kontrak. Berdasarkan surat tersebut, SKPD membuat surat pengajuan pembayaran dengan dokumen berita acara penyelesaian pekerjaan/serah terima yang sudah dikondisikan. Saat SP2D terbit, kepala SKPD mengajukan permohonan pemblokiran dana sehingga uang yang sudah masuk ke rekening rekanan tidak bisa dicairkan sebelum ada surat pembukaan pemblokiran dari kepala SKPD. Surat tersebut ditandatangani kepala SKPD dan rekanan diatas materai. Surat ini tak beda halnya dengan “nikah siri” antara SKPD dan Bank, kesepakatan yang mereka anggap sah, namun berkaedah salah yang sangat sistemik dimata hukum. Bagaimana tidak?, syarat SP2D sesuai mekanisme adalah telah selesainya pekerjaan 100%, dibuktikan dengan disetujuinya dan ditandatanganinya Berita Acara Hasil Akhir Pekerjaan, jelas kontradiksi atas pernyataan yang tertuang di surat pernyataan dari rekanan pelaksana. Bila dasar pemblokiran tersebut dikategorikan atas permintaan nasabah, toh nyatanya draft/format surat pernyataan tersebut adalah akal akalan PPK dan PA/KPA yang berpolemik dimata hukum. Sudah seharusnya yang berhak meminta pembukaan atas blokir rekening dimaksud juga atas permintaan nasabah. Adalah suatu hal yang konyol menurut logika awam bila nasabah yang berhak absolut atas dana direkeningnya sendiri, harus rela diintervensi kesepakatan “nikah siri” antara pihak Bank dan SKPD. Surat ini disampaikan penulis atas kebobrokan birokasi yang dinilai kronis dan terkesan pembiaran, karena berlangsung dari tahun ketahun tanpa ada niat dari pemangku kebijakan untuk melakukan reformasi birokrasi. Semoga tahun tahun kedepan hal ini dapat menjadi perhatian untuk diperbaiki. Penulis adalah A. ZUHRI ADDIN Ketua Asosiasi Kontraktor Seluruh Indonesia (DPK ASKINDO) Kabupaten Langkat Jl. Jend. Sudirman No. 50B Titi Putih - Kel. Perdamaian Kecamatan Stabat

Menanti Duet Pemimpin Baru Oleh Aldwin Surya Pemerataan pendidikan serta hak hidup memadai bagi warga di Sumatera Utara agaknya semakin kompleks untuk diatasi, karena ada kesenjangan dalam menikmati hasil-hasil pembangunan.


nalisa banyak orang tentang duet pemimpin baru Sumatera Utara hasil pemilihan gubernur dan wakil gubernur semakin mengemuka di banyak media cetak dan elektronik. Hingga menjelang pemilihan gubernur Sumatera Utara pada 7 Maret 2013, kepemimpinan di provinsi Sumatera Utara masih dijabat oleh pelaksana tugas (Plt) gubernur. Keadaan ini justru membuat warga semakin semangat menggunakan hak pilihnya dan berharap gubernur defenitif dapat segera menjalankan tugas bersama wakil gubernur terpilih. Duet pemimpin baru Sumatera Utara semakin dinantikan oleh warganya untuk bersama-sama mengarahkan dan mewujudkan pembangunan dalam banyak bidang. Potensi energi dan sumber mineral di Sumatera Utara sangat memadai untuk dieksplorasi dan hasilnya dikembalikan dalam bentuk pembangunan di kota/kabupaten untuk berbagai bidang. Dukungan akses transportasi darat, laut dan udara cukup tersedia dan bila perlu dapat ditambah sesuai kebutuhan. Sebut misalnya bandara internasional Kualanamu, pelabuhan laut dan akses jalan darat yang telah disiapkan oleh pemerintah kota/kabupaten. Pembangunan merata di kota/kabupaten yang dilakukan gubernur dan wakil gubernur bersama para wali kota dan bupati, akan memungkinkan terwujudnya pemerataan pembangunan. Namun, pembangunan merata di berbagai sektor patut juga diikuti dengan pemerataan kesempatan menikmati hasil-hasilnya. Pasalnya, meski 33 kota/ kabupaten telah terwujud pembangunan, namun masih terjadi kesenjangan menikmati hasil pembangunan pasca pemekaran kota/kabupaten. Kesenjangan semakin kentara jika dilihat dari kemampuan kota/kabupaten dalam menggali pendapatan asli

daerah. Meski ada batasan atas kewenangan antara pemerintah provinsi dengan pemerintah kota/kabupaten, namun sinergi yang diwujudkan antara keduanya dipercaya akan menjadi kekuatan besar dalam mengembangkan Sumatera Utara. Itu sebabnya, kesenjangan ini ini agaknya menjadi agenda kerja penting bagi gubernur dan wakil gubernur terpilih. Kesenjangan menikmati hasil-hasil pembangunan boleh jadi masih terjadi. Lihat pada kesempatan menikmati pendidikan di semua jenjang pendidikan, mulai dari jenjang pra sekolah (taman kanak-kanak), pendidikan dasar (sekolah dasar dan sekolah menengah pertama), pendidikanmenengah(SMA/SMK/Aliyah dan sejenis), dan pendidikan tinggi (Diploma, sarjana dan pasca sarjana). Indikasi kesenjangan itu masih ditemukan pada angka partisipasi kasar sekolah menengah atas dan pendidikan tinggi. Di jenjang pendidikan tinggi, pemerintah mematok angka partisipasi kasar sebesar 25 persen dari penduduk usia 18-25 tahun. Patokan angka ini memang masih belum tercapai meski jumlah perguruan tinggi negeri dan swasta di Indonesia telah mencapai lebih dari 4.000 unit. Persoalan lain pada jenjang pendidikan tinggi adalah kecenderungan sebaran unit, kualitas, dan fasilitas yang tidak merata pada perguruan tinggi swasta. Oleh karena itu, 12 kantor Koordinasi Perguruan Tinggi Swasta (Kopertis) dinilai masih patut ditambah menjadi satu lagi di provinsi Aceh yakni Kopertis Wilayah 13 yang sudah menjalankan perannya sejak tahun 2013. Provinsi Aceh sebelumnya termasuk pada KopertisWilayah I (AcehSumatera Utara). Pemisahan ini diharapkan pengelolaan pendidikan tinggi di wilayah provinsi Aceh semakin mandiri, berkualitas dan mampu bersaing dengan perguruan tinggi skala nasional dan internasional.

Persoalan pemusatan perguruan tinggi swasta di ibukota provinsi seperti di kota Medan, justru menimbulkan persoalan ikutan seperti urbanisasi ke ibukota provinsi. Selain itu penyediaan fasilitas rumah tinggal, rumah kos, keamanan, kemacatan lalulintas adalah beberapa akibat ikutan yang harus diemban oleh kota-kota metropolitan dan kota-kota besar. Pertambahan penduduk ikut menyumbang bagi terjadinya tindak kejahatan yang berpengaruh kepada keamanan dan kenyamanan warga. Pertambahan penduduk menjadi dilematis bila dikaitkan dengan kesempatan memperoleh pendapatan bagi pelaku bisnis skala mikro dan kecil. Aktivitas bisnis yang belum ditata secara konsisten mengikut regulasi berlaku, perlakuan memihak dari kalangan birokrat kepada pebisnis tertentu dan aroma korupsi yang mengemuka, justru membuat rumit penanganan dan capaian penyelesaian kondusif. Padahal di sejumlah negara, peran pelaku usaha skala mikro dan kecil justru memberi kontribusi sebesar 80 persen kepada pendapatan nasional. Pemekaran Persoalan peningkatan populasi penduduk, ekonomi dan bisnis, pemerataan pendidikan serta hak hidup memadai bagi warga di Sumatera Utara agaknya semakin kompleks untuk diatasi, karena ada kesenjangan dalam menikmati hasil-hasil pembangunan. Wujud kesejangan itulah yang menimbulkan hasrat dan upaya untuk melakukan pemekaran provinsi dan kota/kabupaten. Keinginan pemekaran sudah dirintis oleh warga yang merasa belum menikmati hasil-hasil pembangunan. Lihat keinginan warga di kabupaten Simalungun, Langkat, Deliserdang yang ingin daerahnya berpeluang menjadi lebih maju melalui pemekaran. Namun, keinginan pemekaran kabupaten belum dapat diwujudkan karena kriterianya harus didukung oleh enam kecamatan belum dapat dipenuhi. Persoalan yang sama juga terjadi pada lima kota/kabupaten kepulauan Nias. Syarat untuk menjadi sebuah provinsi belum terpenuhi karena harus mengikut regulasi berlaku yaitu sebuah provinsi harus didukung oleh enam kota/kabupaten.

Kriteria dukungan enam kecamatan untuk pemekaran satu kota/kabupaten dan enam kota/kabupaten untuk menjadi satu provinsi, merupakan salah satu tugas penting yang akan diemban oleh gubernur dan wakil gubernur Sumaera Utara terpilih. Syukurlah, meski provinsi Sumatera Utara memiliki keragaman suku, adat, agama dan budaya, namun kerukunan dan keamanan warga terbilang salah satu provinsi paling kondusif di Indonesia. Beberapa faktor yang disebut itulah yang menjadi dasar kinerja warga dan pemerintah Sumatera Utara menggapai kesejahteraan lebih baik. Indikasi menggapai kesejahteran lebih baik itu tercermin dari pemilikan sumber energi dan mineral yang masih potensial digali, dikembangkan dan kemudian dijual ke manca negara. Tiap kota/daerah di Sumatera Utara memiliki keunggulan bersaing tinggi, memiliki sumber daya manusia memadai dan rencana jangka pendek, menengah dan panjang. Dengan pemilikan sumber energi dan mineral, potensi tenaga kerja yang memadai, infrastruktur yang mendukung dan masih mungkin diberdayakan, maka kinerja kepemimpinan duet gubernur dan wakil gubernur terpilih menjadi sangat penting dan menentukan capaian keberhasilan. Wujud keberhasilan itu tercermin dalam banyak aspek seperti pemerataan mengecap pendidikan, pendapatan, dan pemanfaatan teknologi canggih tanpa mengabaikan harmonisasi kerukunan dan keamanan warga. Capaian keberhasilan di bidang ekonomi dan keuangan, pendidikan, teknologi dan keamanan itulah yang menjadi agenda penting di awal kepemimpinan duet gubernur dan wakil gubernur Sumatera Utara. Boleh jadi janji capaian keberhasilan di banyak bidang itu semakin sering didengar oleh warga dalam masa kampanye, sehingga wajar jika warga Sumatera Utara akan menagih janji yang pernah mereka dengar di masa kampanye. Maka ketika janji untuk membangun Sumatera Utara dilakukan secara bersama-sama, sangat mungkin provinsi ini berkembang pesat dan diminati oleh banyak investor. Penulis adalah Anggota Dewan Pendidikan Provinsi Sumatera Utara 20122017, pemerhati perkotaan.

Menyoal Netralitas PNS Dalam Pilgubsu Oleh Effan Zulfiqar Harahap Sangat sulit mewujudkan netralitas PNS mengingat PNS Indonesia—selama 32 tahun menjadi pendukung utama partai politik yang berkuasa pada masa itu— menyebabkan hancurnya tatanan politik yang demokratis.


ejak Pilkada dimulai tahun 2005, netralitas pegawai negeri sipil (PNS) sangat diragukan. Faktanya hampir semua perhelatan Pilkada PNS terlibat dukung mendukung calon kepala daerah/wakil kepala daerah. Bahkan sejak masih berstatus bakal calon, keterlibatan PNS sudah mulai terlihat sekalipun dilakukan secara sembunyisembunyi. Keterlibatan PNS tersebut juga banyak terungkap dalam kasus gugatan hasil Pilkada di Mahkamah Konstitusi. Bahkan ada beberapa daerah terpaksa dilakukan pencoblosan ulang karena terbukti keterlibatan PNS yang terencana dan massif. Penelitian LIPI tahun 2005 menyangkut ketidaknetralan PNS dalam Pilkada di Malang, Gowa, dan Kutai Kartanegara diketahui faktor yang mempengaruhi PNS tidak netral sebagaimana diperintahkan undang-undang, karena: kuatnya ketokohan (personality) menanamkan pengaruh terhadap PNS, vested interest PNS untuk mobilitas karir secara cepat, lemahnya sosialisasi institusi, kuatnya hubungan patron-client dan peran shadow bureaucracy. Padahal regulasi soal keharusan netralitas PNS sangat tegas dalam UU No. 43 Tahun 1999, PP No. 37/2004. UU No.

32/2004, PP No. 6/2005. Hal ini dipertegas lagi Surat Edaran Mendagri nomor 270/4627/sj tertanggal 21 Desember 2009. Terakhir dalam PP No 53Tahun 2010 tentang Disiplin PNS Pasal 4, dengan sangat tegas menyebutkan larangan bagi PNS untuk terlibat dukung mendukung. Praktik dukung mendukung oleh PNS merupakan fenomena umum yang terus terjadi. Posisi PNS sangat dilematis dengan segala resikonya bila yang didukung kalah atau menang. Istilah yang kerap muncul di kalangan PNS menjelang Pilkada, adalah :“mendukung salah, tidak mendukung salah, bahkan netral juga salah”. Bila misalnya mendukung tapi ia kalah, maka resiko sudah pasti akan terkena “tsunami” mutasi. Sebaliknya pula kalau mendukung yang menang, karier sudah pasti bersinar terang. Kalau bersikap netral biasanya tidak akan berpengaruh terhadap karier karena dianggap tidak memberikan konstribusi apapun atas kemenangan. PNS yang bersikap netral dicap tidak ikut berjuang alias tidak capek dan berkeringat jadi tidak wajar diberikan jabatan apapun. Yang terjadi kemudian begitu selesai Pilkada sudah menjadi rahasia umum ada PNS yang meningkat kariernya

dengan jabatan baru. Adapula PNS yang menjadi korban, kehilangan jabatan struktural dan menjadi non-job, karena yang didukung kalah. Yang lebih sakit adalah PNS yang bersikap netral tidak jarang digusur dan tergusur oleh PNSPNS yang mendukung yang menang. Harus diakui sangat sulitnya mewujudkan netralitas PNS mengingat PNS Indonesia—selama 32 tahun menjadi pendukung utama partai politik yang berkuasa pada masa itu—menyebabkan hancurnya tatanan politik yang demokratis. Ketidaknetralan PNS dalam Pilkada bukan sepenuhnya pilihan mereka, tapi karena kondisi riil sistem birokrasi yang lebih berorientasi kepada loyalitas terhadap pimpinan dari pada negara. Keterlibatan PNS baik secara individu maupun institusional dalam Pilkada sudah pasti menyebabkan konflik kepentingan (conflic of interest) yang bisa merusak tatanan bernegara dalam jangka panjang. Netralitas PNS, mutlak diwujudkan, mengingat Keputusan Mahkamah KonstitusiterhadaphasiljudicialreviewBawaslu terhadap UU No.32Tahun 2004 pasal 116, yangsudahmengategorikankeberpihakan PNS sebagai tindak pidana. Semua pihak harus benar-benar mau mengawasi dan mendukung netralitas PNS untuk menghasilkan Pilkada yang berkulitas dan bermartabat. Tanggung jawab menjaga netralitas PNS sebenarnya menjadi tanggungjawab kepala daerah sekalipun yang bersangkutan ikut bertarung dalam Pilkada. Sekaitan dengan Pilgubsu 7 Maret 2013 ini secara kebetulan ada 4 orang petahana

yang ikut mencalon. Salah satunya adalah Plt Gubernur Sumatera Utara Gotot Pujo Nugroho dan Bupati Deli Serdang Amri Tambunan, keduanya maju sebagai calon gubernur Sumut. Adapun T. Erry Nuradi yang menjabat sebagai Bupati Serdang Bedagai dan wakilnya Soekirman, keduanyamajusebagaicalonwakilgubernur. T. Erry Nuradi berpasangan dengan Gatot Pujo Nugroho. Sedangkan Soekirman berpasangan dengan calon gubernur Gur Irawan Pasaribu. Kita sangat berharap keempat calon tersebut tidak memanfaatkan jabatannya dengan memobilisasi PNS. Peluang terjadinya penyalahgunaan jabatan sangat terbuka lebar, mengingat semuanya bisa dilakukan secara tersembunyi. Bahkan Panwaslu sendiri akan kesulitan melakukan pembuktian adanya keterlibatan PNS dalam dukung mendukung tersebut. Sejatinya memang netralitas PNS dalam Pilgubsu menjadi keharusan dalam upaya melahirkan Pilkada yang benar-benar bermartabat dan bukan sarat dengan banyak masalah. Kita tidak bisa bayangkan misalnya kalau sempat terjadi PNS di kabupaten terpecah karena pilihan yang berbeda. Sangat diharapkan jiwa besar para calon dalam Pilgubsu mendatang. Bila tidak tertanam sikap fair play untuk bertarung secara kesatria, jujur, bermartabat dan menghargai nilai-nilai demokrasi lokal, sudah pasti sulit terwujudkan netralitas PNS dalam Pilgubsu. Penulis adalah Wakil Rektor I Universitas Muhammadiyah Tapanuli Selatan – Kota Padangsidimpuan.


B8 07.00 Dahsyat 09.00 Sinema Pagi 11:00 Infotainment : INTENS 12:00 Seputar Indonesia Siang 12:30 Namaku Cinta 14.30 Cek & Ricek 15.00 Silet 15.30 Hanya Kamu 16.30 Seputar Indonesia 17.00 Magic 18.00 Cinta 7 Susun 19.30 Tukang Bubur Naik Haji 22.30 Sedap Malam 23.30 Film Tengah Malam


07:00 Inbox 09.00 Liputan 6 Terkini 09:03 Halo Selebriti 10:00 SCTV FTV 12:00 SL Liputan 6 Siang 12:30 SCTV FTV Siang 14.03 SCTV FTV Siang 14:30 SL Eat Bulaga Indonesia 16.00 Liputan 6 Terkini 16:03 SL Eat Bulaga Indonesia 16:30 SL Liputan 6 Petang 17.00 Cookies 18.00 Biang Kerok Cilik 19.30 Putih Abu-Abu 20.30 SCTV SInetron : Ustad Fotocopy 22.30 Liputan 6 Terkini 23.00 SCTV FTV Utama

07.30 Serial Pilihan 09.00 Serial Pilihan 10:30 Kisah Unggulan 11:30 Lintas Siang 12:00 Layar Kemilau 13:30 I Drama 15:00 Diantara Kita 15:30 Lintas Petang 16.00 Animasi Spesial 18.00 Somad 19:00 Legenda MD The Series 21.00 Raden Kian Santang 22:00 Berbagi Cinta 23:00 Intermeaao 00.00 Lintas Malam

07:05 WIB Bedah Editorial Media Indonesia 08:05WIB 8 Eleven Show 11:30 WIB Metro Siang 13:05 WIB Wideshot 16:30WIB Java Overland 18:05WIB Metro Hari Ini 19:05 WIB Suara Anda 20:30 WIB Otoblitz 21:05 WIB Top Nine News 21:30 WIB Mata Najwa 22:30 WIB Stand Up Comedy 23:05WIB Metro Realitas 23:30 WIB Metro Sports

07:00 KISS Pagi 08:00 Sinema TV Pagi 10:00 Sinema TV Spesial 12:00 Patroli 12:30 Sinema Drama Indonesia 14:30 KISS Sore 15:30 Fokus 16.00 Kata Hati 17.00 Drama Seri Indonesia 18:00 Drama Seri Indonesia 20:00 Drama Seri Keluarga 22:00 Mega Bollywood

07.00 Bedah Editorial Media Indonesia 08.30 811 On The Weekend 10.05 Untuk Buah Hati 10.30 Metro Xin Wen 11.05 Oprah Winfrey 12.05 Metro Siang 13.05 Spirit Football 13.30 Auto Zone 14.05 Power Players 16.05 Oprah Winfrey Show 18.05 Metro Hari InI 18.30 Metro Highlights 20.05 Metro Files 21.05 Top Nine News 21.30 Idenesia 22.30 Stand Up Comedy 23.05 Destroyed in Seconds 23.30 Metro Sports

WASPADA Rabu 13 Februari 2013

07:30 Ranking 1 08:30 Sinema Pagi Indonesia 10:30 Moccachino 11.00 Insert Siang 12:00 Reportase Siang 12:00 Bioskop Indonesia 14:00 Reportase Siang 14:30 Sketsa 15.450 Show Imah 16:45 Reportase Sore 17:15 Insert Investigasi 18:00 Ethnic Runaway 19:00 Oh Ternyata 20:00 Bioskop TransTV 00:00 Bioskop TransTV

09:30 Live News Kabar Pasar Pagi 10:00 Coffee Break 11:30 Live News Kabar Siang 1 3 : 3 0 Ap a Ka b a r Indonesia Siang 15:30 Live News Kabar Pasar 16:00 Live News Kabar Petang 19:00 Kabar Utama 20:00 Apa Kabar Indonesia Malam 21:00 Live News Kabar Malam 22:00 Menyingkap Tabir 22:30 Kabar Arena 23:00 Radio Show

08:00 The Penguins Of Madagascar 08:30 Sketsa Tawa 09.00 Dapoer Cobek 09.30 Hot Spot 10:00 Obsesi 11:00 Buletin Indonesia Siang 12:00 Untung Ada Sule 13.00 Kungfu Panda 13:30 Avatar 14:00 100 % Ampuh 17:00 Fokus Selebriti 17:30 Transformers Prime 18.00 Jomblowati 19.00 Raja Dan Aku 20.00 Kinara 21.00 Big Movie 23:30 Big Movie

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

07:30 Selebrita Pagi 08:00 Makan Besar 08:30 Gak Nyangka 09:00 Ups Salah 09:30 Spotlite 10:30 Warna 12:00 Selebrita Siang 12:30 Si Bolang 13:00 Laptop Si Unyil 13:30 Dunia Binatang 14:00 Brownies 15:00 Fish N Chef 16:00 Redaksi Sore 17:00 Orang Pinggiran 18:00 Hitam Putih 19:00 On The Spot 20:00 Opera Van Java 22:00 Bukan Empat Mata 23:30 Berburu 00:00 Jejak Jejak Misterius 00:30 Sport7 Malam


Anne Hathaway Santai Jelang Oscar Anne Hathaway merayakan keberhasilannya meraih anugerah British Academy of Film and Arts (BAFTA) untuk kategori aktris pendukung terbaik dalam film Les Miserables di Royal Opera House, London, Inggris, Minggu (10/2)/rtr

Aktris Anne Hathaway mengakui tidak terlalu memikirkan apakah dirinya akan meraih kemenangan dalam penghargaan Oscar. Seperti dikutip dari laman Digital Spy, Hathaway yang memenangi Aktris Pendukung Terbaik dari film Les Miserables di BAFTA mengatakan bahwa dia akan tetap senang apapun hasil yang keluar di Academy Award. “Apapun yang terjadi dua ming-

gu lagi, terjadilah,” kata dia. “Jika saya tidak menang, bukanlah hal yang terburuk, karena ada suamiku di sisiku. Itu juga bukan hal terbaik. Jadi saya merasa baik-baik saja apapun hasilnya.” “Saya harus bilang bahwa mendapat kesempatan berakting dengan jejeran artis itu adalah pengalaman paling indah. Saya tidak tahu mengapa saya sangat beruntung. Jadi saya ti-

dak memikirkan apa yang terjadi nanti.” Hathaway juga mengatakan dia sudah punya rencana di mana akan meletakkan piala Oscar jika dia menang. “Saya punya fantasi ini, karena tahun ini saya cukup beruntung mendapat beberapa piala, saya akan membuat tempat di garasi, tapi sementara ini saya akan menyimpannya di dapur.” Acara penghargaan Oscar akan dihelat pada 24 Februari.(ant)

Film The Tower :

Petaka Dan Cinta Di Gedung Pencakar Langit APA jadinya bila salah satu gedung kembar pencakar langit termegah di Soul – Korea Selatan yang memiliki 108 lantai dan disesaki ribuan orang undangan pembukaan Tower Sky di malam perayaan Natal, tiba-tiba mengalami kebakaran hebat ?. Tak pelak, suasana pesta mewah dihadiri para pejabat tinggi, tamu kehormatan, konglomerat, dan para pemilik apartemen super mewah, sontak berubah menjadi malapetaka yang mencekam, menakutkan sekaligus memilukan. Suasana serba menegangkan tersebut bakal tersaji dalam Film Box Office The Tower atau Hangul berdurasi 121 menit. Film bersutan Sutradara Kim Jihoon yang sejak dirilis 24 Desember tahun silam hingga akhir Januari 2013 sukses mendulang 5 juta lebih di Korsel dipastikan segera beredar di bioskop kota besar pilihan di Indonesia mulai 15 Februari mendatang.

Film dibintangi sejumlah bintang ternama negeri Gingseng seperti Sol Kyung-gu (peran Kang Young-ki), Kim Sang-kyung (Lee Dae-ho) dan Son Ye-jin (Soe Yoon-he), dibuka dengan gambaran kesibukan Lee Daeho, sang manager Tower Sky. Lantaran dijejali kesibukan menggelar pesta pembukaan di malam Natal, ia agak menelantarkan Hana – putrinya yang masih kecil. Untung ada SoeYoon-he, manager restoran China di mal yang cantik bersedia mendampingi putri Lee. Disisi lain KangYoung-ki digambarkan sebagai komandan pemadam kebakaran legendaris pangkalanYoido – berhasil mendapat cuti setelah bekerja terus-menerus sepanjang tahun. Namun, lantaran ada kebakaran hebat di gedung pencakar langit, ia menunda rencana liburannya berdua dengan sang istri. Awalnya, pesta berjalan me-

raih dan nyaris meninggalkan kesan menakjubkan dan tak terlupakan kepada tamu undangan. Termasuk upaya Jo (Cha In-Pyo) pemilik gedung pencakar langit membuat suguhan spektakuler dan menakjubkan dengan menaburkan hujan Salju buatan di atas kepala hadirin yang sudah berkumpul di puncak Tower Sky lewat Helikopter sewaan. Ketakjuban mereka segera berubah menjadi teror menakutkan ketika salah satu Helikopter hilang kendali dan menabrak gedung hingga menyulut malapetaka kebakaran hebat yang berpotensi meruntuhkan tower. Sekaligus mengancam keselamatan ribuan orang dengan maut kobaran api yang siap membakar hidup-hidup. Dae-ho dan Young-ki, berjibaku secara heroik mempertaruhkan nyawa mereka guna menyelamatkan jiwa semua orang termasuk me-

nyelamatkan sang bocah Hana dan Soe Yoon-he, wanita yang secara diam-diam sangat dicin-

tainya serta diidamkan Dae-ho, menjadi pendamping hidupnya. * (AgusT)

Panitia pelaksana Java Jazz saat memberikan keterangan pers

Java Jazz Festival Diklaim Terbesar di Dunia Jakarta International Java Jazz Festival 2013 kembali digelar pada 1-3 Maret mendatang di JIExpo Kemayoran, Jakarta. Sederet musisi dan penyanyi kelas dunia mulai New York Voices, Phil Perry, Roberta Gambarini, Roy Hargrove Quintet, Roy Hargrove, RH Factor, Spyro Gyra, Fourplay, George Duke & Stanley Clarke, GREGORY PORTER QUARTET, James Carter Organ Trio, hingga Jazz Orchestra of the Con-certgebouw memastikan bakal tampil semakin mengukuhkan keberadaan Java Jazz sebagai event festival tahunan wajib bagi musisi besar dunia. “Memasuki gelaran ke-9, kami berani menyatakan Java Jazz dengan sponsor utama Djarum Super Mild adalah festival musik jazz terbesar di dunia. Apalagi para penampilnya, selain makin berbobot juga menyuguhkan musik yang bervariasi,” ujar Peter Gontha didampingi Roland Halim, Brand Manager PT Djarum di Jakarta, baru-baru ini. Sementara Paul Dankmeyer

selaku Program & Artistic Director menambahkan, sederet musisi internasional lainnya yang siap menyuguhkan aksi memukau yakni Balance and The Traveling Sounds, Basia, Bob James, Brian Simpson, Butterscotch, Chucho Valdes, Chuck Loeb, David Helbock, Eldar Djangirov. Kemudian, Emily Elbert, Fernandez4, Jimmy Cliff, Jose James lalu nama besar Joss Stone, Lee Ritenour & Dave Grusin, Lisa Stansfield, Magnus Lindgren with special guest Gregory Porter, Marcus Miller, Mellow Motif, dan Miles Smiles feat. Larry Coryell, Joey DeFrancesco, Omar Hakim, Daryll Jones, Rick Margitza, Monday Michiru, The Kenny Garrett Quintet, The Soul Rebels, dan Wouter Hamel. Sedangkan Eki Puradiredja - Program Coordinator Java Jazz menjelaskan sesuai denganTagline diusung tahun ini “Jazz Up the World” dicitrakan sebagai keberhasilan sebuah festival internasional dipersiapkan dan diproduksi bangsa Indonesia. Sejumlah musisi negeri sendiri telah malang melintang da-

lam dunia jazz, di antaranya Abdul and The Coffee Theory, Ade & Brothers, Andi Wiriantono, Andien, Balawan Bifan Trio feat Didiet Violin, Bandanaira, dan Barry Likumahuwa Project (BLP) Tribute to Weather Report siap menjadi tuanrumah yang baik. Begitu pula Benny Likumahuwa Jazz Connection, BubuGiri, Calvin Jeremy, Cindy Bernadette, Dewi Sandra, Donny Suhendra PowerFusion Trio, Dwiki Dharmawan and String Quartet, For Better Life Movement 57kustik, G-Pluck Beatles, Ginda and The White Flowers, Glen Dauna - Jimmy Hendrix Experience, serta Glenn Fredly, dan Heaven On Earth. Serta Idang Rasjidi, Indra Lesmana-LLW, Indro Hardjodikoro The Fingers feat, dr Tompi, IYR (Indonesian Youth Regeneration), Karim Suweileh & Jazzy Quintet, Krishna Balagita, Maliq & D’essentials, Manna, Margo Rising Stars, Matthew Sayersz, Maya Hasan, Nino, Oddie Agam - 4 Dekade. * (AgusT)

Pengorbanan Seorang Diva KeTelevisi

Salah seorang peserta lomba karaoke melalui Android saat mulai menyanyikan lagu dibawakan Ariel NOAH di Music Coffee yang cukup mendapat perhatian meriah para pengunjung

Diva di tayangan televisi dengan beragam berita yang menyertainya harus diakui kehidupan diva memang menjadi santapan berita yang tak ada habisnya. Film DIVA merupakan karya sutradara perempuan muda Heiward Mak dan menceritakan tentang bagaimana seseorang mencapai impian menjadi diva dan pergelutan yang dihadapinya. Adalah J (Joey Yung), seorang penyanyi pop ternama sukses. Walau tampak berkilau di depan publik namun ternyata gejolak yang dihadapi membuat hidupnya meronta. Sebagai manusia biasa, ia lelah menjalani rutinitas, show, kilatan blitz, wawancara dan lainnya yang rupanya telah diatur sang produser juga manajer, Man Kin-sun (Chapman To, Mr and Mrs Gambler, Vulgaria).

Joey juga harus menghadapi artis baru Red (Mag Lam) yang digadang-gadang akan menggantikan posisi Joey sebagai diva. Kehidupan pribadinya pun jadi terkukung dan akhirnya ditumpahkan kepada tukang pijat tunanetra Hu Ge yang menjadi tambatan hatinya. Film ini merefleksikan berbagai tekanan yang dihadapi seorang diva dan menjadi aspirasi bagi pendatang baru. Menurut Heward, masyarakat melihat diva itu hanya bisa menyanyi, sementara faktanya, karir seorang diva bukanlah melulu tentang dunia nyanyi. “Dia harus berhubungan dengan media, manajer, fans, paparazzi dan tekanan-tekanan lain dalam hidupnya. Belum lagi kehadiran penyanyi baru yang mulai menapaki karir. Kekontrasan dua tokoh ini bakal menghadirkan

drama yang sesungguhnya,” ungkapnya. Menurut Joey, plot kisah DIVA adalah sebuah fiksi (bahkan ada yang berlebihan) dibuat sutradara dan produser. Namun demikian tiap situasi sebenarnya didasarkan pada kumpulan pengalaman bertahun-tahun. “Kita benar-benar mengerahkan seluruh emosi dan menganalisanya dalam alur cerita”. Bagaimana perjuangan hidup seorang diva dalam film DIVA, tayang Minggu, 17 Februari, pukul 20:00 di saluran TV berbayar Celestial Movies melalui Indovision (ch. 20); Top TV (ch. 20); Okevision (ch. 19); Telkomvision - Yes TV (ch. 108); Telkomvision IPTV – Groovia TV (ch. 608); Orange TV (ch. 162); Centrin TV (ch. 312), Aora (ch, 211), Skynindo (ch. 19), dan Topaz TV (ch.27).(m19)

XL Gelar Lomba Karaoke NOAH Di Music Coffee Suasana di Music Coffee Jalan Dr Mansyur Kampus USU Medan Minggu (10/2) sore sontak menjadi ramai dengan atribut band NOAH. Apa gerangan yang terjadi: Ternyata sore itu, XL lagi mengadakan acara lomba karaoke menggunakan android khusus membawakan jingle XL dibawakan Ariel bersama grup band-nya NOAH. Memang Music Coffee belakangan menjadi tempat tongkrongan anak muda, apalagi di tempat ini juga diisi home band secara bergantian. Cuma saja sosialisasi lomba karaoke NOAH baru pertama kali diadakan dan tentunya suasana Ariel pun sangat terasa. Menurut Oloan Jimmy Martua R-Marketing and Promotion PT XL AXiata Medan & NAD tujuan diadakannya lomba karao-

ke dengan membawa NOAH sebagai Ikon kebebasan. XL mengajak anak muda kota Medan untuk ikut menyuarakan kebebasan mereka dengan merekam dan mengunggah Audio Karaoke mereka di, atau melalui AR (Augmented Reality Application). Kemudian Audio yang sudah di upload akan dikompetisikan dengan audio lain untuk menjadi yang terbaik dan mendapatkan Tiket Nonton Gratis Konser Noah di Jakarta 24 Februari 2013. Selain itu, rangkain acara ini juga sekaligus mensosialisasikan Campain Bebas XL Rp5000 Bebas Internetan 6 Bulan. Pre event diadakan mulai 10–15 Februari 2013 di Sekolah dan hang out Place kota Medan. Tiga peserta terbaik di setiap

region serta 10 peserta favorit seluruh Indonesia akan mendapatkan tiket konser NOAH di Jakarta beserta akomodasi ditanggung XL. Memang bagi yang belum pernah mengikuti lomba Karaoke melalui perangkat Android seperti Tablet ataupun smartphone lainnya terasa agak repot. Namun teknologi canggih ini ternyata memungkinkan pengguna berkaraoke ria lewat aplikasi Augmented Reality. Pengguna Android bisa mengarahkan kameranya ke logo XL yang secara perlahanan muncul video Ariel NOAH memandu peserta disertai teks layaknya karaoke. Setelah suara terekam, peserta bisa meminta bantuan teman-temannya untuk mendukung mereka agar keluar sebagai pemenang lewat upload atau situs yang telah ditentukan.(m19)

Pierce Brosnan/

Diundang Hadiri Oscar, PierceBrosnanTolak ReuniJamesBond

Aktor Pierce Brosnan memberi isyarat bahwa dirinya tidak akan hadir dalam acara kumpul-kumpul para pemeran James Bond di penganugerahan piala Oscar. Bos acara penganugerahan Oscar baru-baru ini mengatakan bahwa para pemeran 007 akan diundang, mulai dari Sean Connery hingga Daniel Craig untuk menghadiri Academy Award pada 24 Februari. Namun, Brosnan, pemeran James Bond dalam Die Another Day mengisyaratkan dirinya tidak akan hadir. Seperti dikutip dari laman Female First, saat ditanya apakah dia akan ikut berpartisipasi dalam reuni pemeran James Bond, Brosnan menjawab, “Mereka akan kekurangan satu orang.” Brosnan menolak berkomentar siapa yang dia maksud. Pelantun lagu-lagu James Bond seperti Adele dan Shirley Bassey sudah menyatakan diri akan hadir.(ant)

Guruh Senang Barang Jadul

Joey Yung

Putra bungsu mantan Presiden Soekarno, Guruh Soekarnoputra, mengaku lebih menyenangi barang-barang yang diproduksi pada zaman dahulu atau dikenal dengan istilah barang “jadul” karena lebih berkualitas. “Kalau barang-barang tempo dulu kualitasnya lebih bagus, mungkin karena penggarapannya serius. Tapi kalau sekarang barang-barang cepat rusak, mungkin karena komersialisme,” ujar Guruh disela-sela acara Cinta Tempo Doeloe diselenggarakan pada 11-21 Februari di Plaza Blok M, Jakarta Selatan, Senin. Barang-barang “jadul”, sa-

Guruh Soekarnoputra mbung Guruh atau Mas Ruh, juga mengundang nostalgia dan bisa belajar banyak hal dari barang-barang tersebut. “Sesuai dengan Bapak Bangsa, Bung Karno, yakni“Jas Merah”. Artinya jangan sesekali meninggalkan sejarah, bukan melupakan sejarah. Sejarah diperlukan untuk kebaikan di masa depan,” ujar dia. (ant)

Ekonomi & Bisnis

WASPADA Rabu, 13 Februari 2013

Gas Elpiji 3 Kg Tidak Naik

Inflasi Menjadi Ancaman Bagi Redenominasi MEDAN (Waspada): Ancaman inflasi masih menjadi sisi negatif bagi rencana pemerintah untuk melakukan redenominasi (pengurangan angka) pada mata uang Rupiah. Hal tersebut sudah dialami sejumlah negara yang gagal melakukan redenominasi dikarenakan laju inflasi terlalu tinggi. “Ancaman inflasi masih menjadi sisi negatif yang harus dihindarkan untuk melakukan redenominasi. Meskipun di Indonesia laju inflasi relatif masih terkendali, namun kondisinya bisa saja berbalik mengingat inflasi yang rendah di Indonesia saat ini lebih dikarenakan oleh subsidi BBM pemerintah,” kata pengamat ekonomi dari IAIN Sumut Gunawan Benjamin, Selasa (12/2). Gunawan mengatakan, laju inflai di Indonesia bisa dikatakan semu dan bila dikaitkan dengan redenominasi, maka subsidi yang terus dipertahankan oleh pemerintah seharusnya segera dihapus. Karena bila nantinya kenaikan harga BBM justru dilakukan di saat masa transisi dari mata uang lama ke mata uang baru, tentunya potensi lonjakan inflasi sangat besar. “Hal ini bisa terjadi karena masyarakat yang panik akan mudah menjadi pihak yang dirugikan bila para pedagang secara sengaja memanfaatkan momentum tersebut untuk menaikan harga dengan mata uang baru setingi-tingginya,” ujarnya. Meskipun struktur pasar untuk konsumsi di Indonesia saat ini mengacu pada persaingan sempurna, sehingga kenaikan harga barang yang tak wajar akan diimbangi dengan bentuk persaingan diantara sesama pedagang, namun bentuk tingkat keseimbangan harga yang baru tentunya membutuhkan waktu. Sehingga tetap akan terjadi kejutan-kejutan inflasi. “Sebenarnya pemerintah kita tidak mungkin mampu menahan beban besaran subsidi yang demikian besarnya. Potensi kenaikan BBM jelas sangat terbuka khususnya setelah Pemilu nanti. Oleh karena itu, sebaiknya pemerintah berhati-hati dengan memberikan subsidi di tengah proses redenominasi. Jangan sampai begitu subsidi dilepas, harga menanjak tinggi saat redenominasi. Dampak multiplier-nya sulit untuk diperkirakan,” kata Gunawan. Selain itu, lanjutnya, pemerintah harus mewaspadai pula bentuk struktur pasar yang monopoli maupun oligopoli. Tidak semua struktur pasar di Indonesia menggunakan mekanisme perdagangan bebas. “Umumnya hanya di tingkat pengecer yang berdasarkan mekanisme pasar sempurna. Sementara itu untuk tingkat produsen maupun pedagang besar strukturnya banyak yang oligopoli, dimana hanya ada sedikit pemain di level tersebut,” katanya. Sehingga proses pembentukan harga barang lebih ditentukan oleh pihak yang berkepentingan. Bayangkan saja bila produsen maupun pedagang besar sengaja menaikkan harga barang dengan mata uang baru di luar yang seharusnya, maka distribusi barang tersebut nantinya akan dijual oleh pedagang ritel maupun pengecer. “Bisa dibayangkan harga yang berlaku di tingkat pengecer, tentu akan lebih tinggi dari harga yang ditetapkan oleh pedagang besar maupun produsen. Untuk itu, pemerintah harus mengawasi proses pembentukan harga pada struktur pasar tersebut agar redenominasi Rupiah tidak dikatakan gagal,” pungkasnya. (m41)

Daftar Harga Bahan Pokok Di Medan, Senin (11/2) : Rp9.800 per kg : Rp9.300 per kg : Rp9.600 per kg : Rp9.400 per kg : Rp9.000 per kg : Rp9.000 per kg : Rp8.500 per kg : Rp8.500 per kg : Rp13.000 per kg : Rp10.000 per kg : Rp85.000 per kg : Rp22.000 per kg : Rp50.000 per kg : Rp1000 per butir : Rp1.500 per butir : Rp1.200 per kg : Rp2.000 per kg : Rp7.000 per kg : Rp20.000 per kg : Rp30.000 per kg : Rp10.000 per kg : Rp23.000 per kg : Rp23.000 per kg : Rp6.000 per kg : Rp3.000 per kg : Rp5.000 per kg : Rp75.000 per kg : Rp12.000 per kg : Rp23.000 per kg : Rp8.000 per kg : Rp9.000 per liter : Rp7.600 per kaleng : Rp8.200 per kaleng : Rp25.500 per kotak : Rp27.200 per kotak (m41)

Harga Emas London Murni (LM)


Perhiasan (97%)


Emas Perhiasan (70%)


Emas Putih (75%)




(50 %)

Dunia Apresiasi Konferensi Ekonomi Syariah BELANDA (Antara): Para akademisi dan praktisi dari berbagai lembaga di seluruh dunia mengapresiasi pelaksanaan Konferensi Ekonomi Syariah. Kegiatan Perhimpunan Intelektual

TAKENGEN (Waspada): Meski nilai jual tomat dari petani ke agen penampung di Aceh Tengah sempat turun dikisaran Rp300 per kg pada akhir 2012 lalu, namun kini harganya mulai meroket, capai Rp6.000 per kg. Menurut penuturan seorang petani yang sedang melakukan transaksi jual beli di Pasar Pagi, Takengen, naiknya harga disebabkan tingginya permintaan pasar. Sementara stok dari petani minim dan berkurang. “Akibat musim hujan berkepanjangan, tanaman tomat petani banyak lenes (layu). Meski sebagian masih bisa diselamatkan, namun hasil panen berkurang. Ini salah satu penyebab naiknya harga di pasaran,” kata Syukur, petani tomat asal Kampung Toweren, Aceh Tengah menjawab Waspada Senin (11/2). Selain itu lanjutnya, pengaruh cuaca juga telah mempengaruhi kualitas buah. Hasil panen tidak seperti biasanya. Namun demikian, petani tomat terbantu dengan tingginya permintaan pasar. Di mana harga jualnya Rp6.000 per kg. “Bila kualitasnya normal, agen juga sanggup menampung dengan harga lebih, mencapai Rp8.000 per kg. Namun, mendapatkan tomat super seperti dimaksud, saya kira cukup sulit saat ini,” pridiksi petani ini. Secara terpisah, di lokasi pasar tradisional itu, Hamid, seorang pedagang dan agen penampung sayur mayur membenarkan, nilai jual tomat bergerak naik saat ini. Bahkan, nilai ecerannya mencapai Rp8.000-Rp10.000 per kg. Tergantung kualitas buah yang dipasarkan. “Sebetulnya bukan saja tomat yang mulai mahal. Namun, berbagai komoditi lainnya juga mulai memiliki nilai jual menjanjikan diantara seperti; cabai merah, hijau, rawit, kentang dan berbagai jenis sayuran ,” ungkapnya. (cb09).

Beras Ramos 1 Beras Ramos 2 Beras KKB 1 Beras KKB 2 Beras Arias Beras Jongkong IR 64 Beras Jongkong Kasar Beras Jongkong IR 64/Kw3 Gula Pasir Minyak Goreng Curah Kuning Daging Sapi Murni Daging Ayam Broiler Daging Ayam Kampung Telur Ayam Broiler Telur Ayam Kampung Garam Kasar Garam Halus Terigu Segi Tiga Biru Cabai Merah Cabai Rawit Cabai Hijau Bawang Merah Bawang Putih Tomat Kol Kentang Ikan Asin Teri (no.2) Kacang Hijau Kacang Tanah Kacang Kedelai Minyak Tanah Susu KM Bendera 357 gr Susu KM Indomilk 390 gr Susu Bubuk Bendera 400 gr Susu Bubuk Indomilk 400 gr


KERAJINAN BATU ALAM. Sugi, 21, menyelesaikan pembuatan kerajinan dari batu alam di Pabelan, Kartasura, Sukoharjo, Jawa Tengah, Selasa (12/2). Kerajinan batu alam yang bahan dasarnya didatangkan dari Gunung Kidul,Yogyakarta dibuat untuk hiasan rumah tersebut dijual paling murah Rp 10.000,- tergantung ukuran dan tingkat kesulitannya.

itu diselenggarakan oleh

Harga Tomat Meroket


Muslim Indonesia (PRIMA) pada 9 Februari di Hannover, Jerman. Panitia pelaksana Adhipati Y. Indradiningrat, dalam pernyataanya yang diterima Antara di Delft, Belanda, Selasa (12/2), mengatakan peserta konferensi tersebut berjumlah lebih 100 orang. Berasal dari Indonesia,

Malaysia, Pakistan, Inggris, Belanda, Jerman, Italia, Azerbaijan, Australia dan Georgia. Konferensi Ekonomi Syariah menjadi agenda tahunan PRIMA dan rencananya tahun depan akan diadakan di Goettingen, Jerman. Konferensi bertema “Hubungan Ekonomi Syariah Dalam Turbulensi Ekonomi Global” menghadirkan para pembicara internasional. Yakni Prof Dr Volker Nienhaus dari Pusat Pendidikan Keuangan Islam Internasional (International Centre For Education In Islamic Finance/INCEIF) dan Jamal D Harwood dari UniversitasWales, Inggris. Selain itu Idries de Vries, penasihat bidang industri minyak dan gas bumi, Dr Hadi Susanto dari Universitas Nottingham, Inggris serta Dr Dwi Condro Triono dari Institut Agama Islam Negeri (IAIN) Surakarta.

Konselor Kedutaan Besar Republik Indonesia (KBRI) di Berlin, Jerman, Ayodhia GL Kalake, menyatakan apresiasinya atas penyelenggaraan konferensi tersebut yang membahas permasalahan ekonomi global dan mengajukan solusi untuk mengatasinya. “Saya yakin konferensi ini menghasilkan masukan yang penting bagi perencanaan ekonomi Indonesia di masa mendatang dan menjadikan ekonomi dunia lebih baik,” kata Ayodhia. Peserta dari Azerbaijan, Ayaz Asad, mengaku sangat berterima kasih atas penyelengaraan konferensi syariah tersebut karena mendapatkan banyak manfaat dari pemaparan materi konferensi. Dia juga mengatakan penyelenggaraan kegiatan tersebut sangat baik. ‘’Saya senang dapat berpartisipasi dan memperoleh banyak kebaikan,” ujarnya.

Apresiasi atas konferensi ini juga disampaikan peserta dari Akademi Penelitian Syariah Internasional Untuk Keuangan Islam (ISRA), Universitas Lorong, Malaysia, Abdussalam Ismail Onagun yang berkebangsaan Nigeria. Menurutnya kegiatan tersebut sangat luar biasa. Yakni sebuah konferensi yang memberikan kontribusi sangat besar bagi ekonomi syariah. ‘’Semoga Allah memberikan kesuksesan selalu untuk anda semua,” katanya. Dalam konferensi ini Onagun menulis makalah berjudul “Sistem Pemerintahan Syariah: Suatu Kebutuhan Bagi Pendekatan Profesional”, yang dipaparkan bersama dengan belasan makalah lainnya yang ditulis para akademisi dan praktisi dari Italia, Georgia, Inggris, Jerman, Malaysia dan Indonesia.

CBP Di P.Siantar Tidak Terpakai P.SIANTAR ( Waspada): Cadangan beras pemerintah (CBP) untuk penanganan tanggap darurat bagi enam daerah di wilayah kerja Bulog Divisi Regional (divre) Pematangsiantar pada periode 2012 tidak terpakai. Padahal banyak bencana alam terjadi di tahun itu. “CBP tahun 2012 tidak terpakai, karena tidak ada permintaan dari daerah,” kata Kasi pelayanan publik Bulog Divre Pemtangsiantar Haris Fadillah Harahap, di ruang kerjanya, Selasa (12/2). Enam daerah di bawahi kantor Bulog Divre Pematangsiantar, yakni Kota Pematangsiantar, Kab. Simalungun, Kab.

Tapanuli Utara, Kab. Toba Samosir, Kab. Samosir dan Kab. Humbang Hasundutan. Dalam tahun 2012, menurut catatan diperoleh Waspada, ada beberapa bencana alam terjadi. Seperti banjir sungai Bah Bolon sebanyak tiga kali di kota Pematangsiantar, peristiwa bencana angin puting beliung di Kab. Simalungun, serta bencana gempa di daerah Tapanuli Utara. Ketika ditanya, mengapa kepala daerah idak memintakan CBP disalurkan kepada masyarakat korban bencana alam itu, Harahap mengatakan, tidak tahu. Padahal dia mengaku pihak Bulog sudah melakukan

sosialisasi kepada pihak pemerintah kabupaten/kota di enam daerah itu. Di tempat terpisah, Kepala Bulog Divre Pematangsiantar, H.Murdillah Maito,SE, mengatakan, CBP adalah beras milik pemerintah pusat yang pengadaannya didanai dari APBN yang disimpan dan dikelola Perum Bulog untuk kepentingan tanggap darurat. Tanggap darurat meliputi kejadian menimpa masyarakat, seperti bencana alam, bencana sosial dan keadaan darurat. Set ia p ma s ya ra ka t a ka n diberikan beras sebanyak 0,4 kg (400 gram) per jiwa per harinya dari beras CBP.

Menurut Murdillah, pelaksanaan penyaluran CBP sesuai dengan ketentuan ditetapkan dalam Peraturan Menteri Sosial RI, nomor 20 tahun 2012 dan stok CBP disimpan dan dikelola Perum Bulog untuk wilayah provinsi jumlahnya 200 ton/ tahun, tingkat Kabupaten/kota jumlahnya sebanyak 100 ton/ tahun. Mekanisme penyaluran CBP dari Bulog setelah adanya permintaan dari kepala daerah di wilayah tempat kejadian bencana. Misalnya permintaan oleh Gubernur ditingkat provinsi, dan Walikota atau Bupati di wilayah kabupaten ataupun kota.(c16)

MEDAN (Waspada): PT Pertamina belum ada menaikkan harga gas elpiji 3 kilogram. Sejauh ini harga masih tetap sesuai dengan SK Gubernur, dengan Harga Eceran Tertinggi (HET) di kisaran harga Rp13.000-Rp14.000 per tabung 3 kilogram. Assistant Customer Relation PT. Pertamina (Persero) - M&T Region I Sumbagut Sonny Mirath, mengatakan itu kepadaWaspada, Selasa (12/2). Tentang kelangkaan gas elpiji 3 kilogram di beberapa daerah seperti Langkat, Asahan, Tanjungbalai, Kisaran, Batubara, dan Tebingtinggi beberapa pekan terakhir ini, disebutkan Sonny, Pertamina menyalurkan sesuai dengan angka yang ditetapkan oleh Dirjen Migas ketika penghitungan waktu konversi. Menurutnya, saat ini jumlah pertumbuhan penduduk terus mengalami peningkatan dan pengguna elpiji juga terus meningkat. Namun pihaknya tidak boleh menyalurkan melebihi kuota yang sudah ditetapkan tersebut. Menurutnya, terjadinya kelangkaan gas elpiji 3 kilogram tersebut disebabkan banyaknya masyarakat pengguna gas elpiji 12 kilogram beralih menggunakan gas 3 kilogram. Apalagi secara ekonomi lebih murah, karena disubsidi pemerintah. Sehingga permintaan bertambah dan akhirnya terjadi kekurangan. Apalagi bila ada spekulasi-spekulasi pihak-pihak yang mencari keuntungan pribadi dengan memanfaatkan kondisi tersebut, ini akan membuat masyarakat mengalami kesulitan. Oleh karena itu, pihaknya meminta kepada masyarakat, bila ada spekulanspekulan yang memanfaatkan situasi tersebut segera melaporkan kepada pihak kepolisian setempat. Sonny, mengatakan,pasokan gas saat ini masih cukup mencapai 6 ribu hingga 8 ribu metric ton. Pasokan tersebut diperkirakan dapat memenuhi 8 hari kebutuhan masyarakat Sumut yang ratarata perharinya sekitar 900 metrik ton. (m41)

Harga Tiket Pesawat Masih Mahal MEDAN (Waspada) : Harga tiket pesawat terbang saat ini masih tergolong mahal untuk semua penerbangan. Tiket Medan tujuan Jakarta bertahan antara Rp 800 ribu hingga Rp 900 ribu sekali jalan. Sebelum perayaan Imlek, harga tiket untuk tujuan MedanJakarta antara Rp 550 ribu hingga Rp 600 ribu sekali jalan. Baik melalui penerbangan Lion Air, Sriwijaya Air, Garuda Indonesia dan Mandala Airline. ‘’Pihak airline menerapkan sistim ekonomi pasar. Permintaan meningkat, hargapun mereka naikkan,’’ kata seorang penumpang penerbangan Lion Air JT-303, Selasa (12/ 2). Suratman, asal Purwokerto saat akan bertolak ke Jakarta di Bandara Polonia Medan menyatakan dia membeli tiket Lion Air bersama rekannya masing-masing Rp 910 ribu. Tiket tersebut dinilainya masih mahal, karena sebelumnya bisa dapat Rp 600 ribu. “Karena ada keperluan keluarga, mau tidak mau harus saya beli untuk pulang ke kampong,’’kata ayah tiga anak ini. Menurut catatan Waspada, biasanya kenaikan harga tiket pesawat mengacu pada empat moment. Yakni liburan sekolah, Imlek, tahun baru dan lebaran. Pada saat itu operator airline menaikan harga tiket lebih dari 200 persen, apalagi mengacu pada multi kelas. Kalau permintaan banyak, harga kelas terendah diabaikan. Yang terjual tiket harga kelas tertinggi. Pillion Hutabarat, agen tiket senior dari Bison Travel, ketika dikonfirmasi mengatakan pergerakan arus penumpang pada rute Jakarta dan kota-kota besar lainnya belum begitu bergerak, tapi tiket bertahan di harga Rp 800 ribu sekali jalan. ‘’)perator penerbangan yang punya gawe. Jadi, asal terlihat pergerakan penumpang meningkat melalui booking seat, harga tiket pasti akan naik,’’ kata Hutabarat. Sementara itu staf penerbangan boarding gate Lion Air saat dikonfirmasi tidak membantah, arus penumpang pada rute Medan tujuan Jakarta dan Medan tujuan Batam meningkat sejak dua hari belakangan ini. Rata-rata seat pesawat ER-900 terisi hingga 95 persen. Bahkan kadang full seat. Furqan, petugas penerbangan Air Asia, juga mengatakan arus penumpang pada rute luar negeri Medan tujuan Bangkok, juga meningkat. Demikian juga Medan tujuan Kuala Lumpur dan Penang. Rata-rata seat pesawat Airbus 320 berkapasitas 168 penumpang terisi semua. “Sejak dua hari ini, arus penumpang dari Medan tujuan luar negeri meningkat. Dengan demikian harga tiket juga dipastikan naik,’’ katanya. (m32)

Mentan Hibahkan 23 Sapi Brahman Untuk Aceh Besar KOTA JANTHO (Waspada): Kementerian Pertanian melalui Direktorat Jenderal Peternakan dan Kesehatan Hewan menghibahkan 23 sapi Brahman Cross kepada Pemkab Aceh Besar untuk diserahkan kepada kelompok peternak yang ada di wilayah itu. Penyerahan hibah tersebut dilakukan Dirjen Peternakan dan Kesehatan Hewan Kementerian Pertanian yang diwakili Kepala Balai Pembibitan Ternak Unggul (BPTU) Sapi Aceh Muchti kepada Bupati Aceh Besar Mukhlis Basyah di Aula BPTU Sapi Aceh, Desa Reukih Dayah, Kecamatan Indrapuri,

Selasa (12/2). Dirjen Peternakan dan Kesehatan Hewan Kementerian Pertanian dalam sambutan tertulis yang dibacakan Kepala Balai BPTU Sapi Aceh Muchti mengharapkan, Pemkab Aceh Besar dapat menjaga, memelihara dan mendistribusikan bantuan Sapi Brahman Cross kepada kelompok peternak sehingga dapat meningkatkan pendapatan dan kesejahteraan mereka. Dijelaskan, saat ini BPTU Sapi Aceh memiliki 619 ternak Sapi Aceh yang menempati lahan seluas 430 hektare. Lebih dari 30 persen lahan yang ada

merupakan daerah perbukitan dan semak belukar, sisanya merupakan Kebun Rumput. Di antara 70 persen kebun rumput, 49 hektare digunakan untuk padang gembala dan 80 hektare lainnya digunakan untuk rumput potong. Bupati Aceh Besar Mukhlis Basyah menyampaikan apresiasi dan terima kasih atas bantuan hibah yang diberikan Direktorat Jenderal Peternakan dan Kesehatan Hewan Kementerian Pertanian Republik Indonesia. Bupati berharap, dengan adanya bantuan Ternak Sapi

jenis Brahman Cross, para peternak bisa meningkatkan kesejahteraannya guna pencapaian target Program Swasembada Daging Sapi dan Kerbau tahun 2014 yang mendorong upaya pengembangan peternakan sapi, terutama di Kabupaten Aceh Besar. Populasi ternak di Aceh Besar, khusus ternak sapi sebanyak 142.000 ekor. Sebelum musibah tsunami pada akhir 2004, populasi ternak sapi sebanyak 260.000 ekor. Ini menunjukkan masih terdapat kekurangan sapi sebanyak 118.000 ekor. (b05)

Masih Banyak Kendala Hambat Pertumbuhan Industri JAKARTA (Antara): Pengamat ekonomi Faisal Basri, mengatakan hingga saat ini masih banyak kendala internal dan eksternal yang menghambat pertumbuhan industri di dalam negeri. Berbicara di Jakarta, Selasa (12/2), Faisal Basri, mengatakan ada dua hambatan, hambatan internal yang melekat pada industri itu sendiri dan hambatan eksternal, seperti kebijakan dan lingkungan usaha baik di dalam dan luar negeri yang bisa menghambat pertumbuhan industri di tanah air. Faisal, mengatakan faktor

pertama adalah kendala di sektor internal, seperti struktur industri sangat rapuh, yang digambarkan dengan lemahnya keterkaitan antara industri hulu dan hilir, dan juga antara industri kecil, menengah, dan besar. Selain itu, industri dasar dan industri berteknologi tinggi juga belum berkembang. Faisal, menjelaskan untuk industri dasar, ketergantungan dengan impor bahan baku masih sangat tinggi. Karena industri dasar pemasok bahan baku, bahan penolong, bahan setengah jadi dan komponen belum berkembang. Sementara

untuk industri berteknologi tinggi masih belum berkembang, dan jumlahnya masih sangat sedikit. Faisal, menambahkan kapasitas produksi yang masih belum maksimal dan juga ketergantungan pesanan negara di tujuan ekspor juga menjadi faktor penghambat internal untuk pertumbuhan industri di Indoensia. “Untuk faktor eksternal, ketersediaan dan kualitas infrastruktur baik fisik dan nonfisik masih kurang memadai, dan juga aturan ketenagakerjaan masih kurang mendukung perkembangan industri,” ujar Faisal.

Bukan hanya itu, lanjut Faisal, permasalahan ketidakpastian hukum dan juga penyaluran kredit ke sektor industri yang sulit juga menjadi penghambat. Dan yang terakhir adalah kurangnya perlindungan di pasar domestik dan hambatan perdagangan di pasar ekspor. Kementerian Perindustrian menyampaikan pertumbuhan industri nonmigas pada 2013 diperkirakan mampu mencapai sedikitnya 6,8 persen, dengan terus membaiknya kinerja sektor industri tersebut dalam tiga tahun terakhir ini dan meningkat pesatnya investasi di sektor tersebut.

XL Operator Pertama Melayani LBA Di Seluruh Indonesia SEMAKIN luas masyarakat memanfaatkan layanan telekomunikasi seluler dalam mendukung aktivitasnya seharihari. Pada sebagian kalangan, keberadaan perangkat ponsel tidak dapat dipisahkan dari rutinitasnya. Di mana pun dan kapan pun, ponsel hampir selalu ada di tangan. Fenomena ini merupakan hal menarik bagi marketer di mana mereka ingin menjangkau konsumen dengan efektif dan cepat, dan mengirimkan pesan komersial yang relevan pada lokasi tertentu. Menjawab kebutuhan ini, PT XL Axiata Tbk (XL) meluncurkan layanan Mobile Advertising terbaru yaitu pengiriman pesan komersial berbasis lokasi (Location Based Advertising – LBA) secara real-time di seluruh Indonesia. Direktur Technology Digital Services XL – Dian Siswarini mengatakan, “XL percaya industri Mobile Advertising di Indonesia akan tumbuh pesat, termasuk kebutuhan akan LBA. Kami melakukan inisiatif strategis dan menjadi operator telekomunikasi pertama yang menyediakan layanan LBA dengan ruang lingkup nasional secara nyata.” Dian menambahkan, pelanggan XL tidak akan dikenakan biaya sama sekali alias gratis untuk menerima promosi via LBA ini. Dengan LBA, marketer dapat berinteraksi langsung dengan target market yang dikehendaki berdasarkan lokasi dan waktu di seluruh wilayah Indonesia, baik indoor seperti antara lain pusat perbelanjaan/mal dan airport. Sementara itu untuk outdoor seperti antara lain sentra bisnis, perumahan, dan kampus. Sehingga respon dan performa campaign pun akan meningkat karena pesan yang dikirimkan relevan dengan profil dan lokasi konsumen. Sebagai contoh, layanan ini sangat efektif digunakan untuk menginformasikan suatu promo atau penawaran spesial di sebuah mall, di mana pesan dikirimkan ke konsumen yang sedang berada di dalam mall tersebut. Contoh lainnya adalah untuk menginformasikan pembukaan cabang usaha baru di lokasi tertentu, di mana pesan promo dikirimkan ke konsumen yang tinggal di perumahan sekitar tempat usaha tersebut.



WASPADA Rabu 13 Februari 2013

Polres Langsa Gagalkan Penyelundupan Trenggiling Asal Pidie

5 Instansi Pantau Penerimaan Brigadir Polisi LHOKSEUMAWE (Waspada): Guna menghindari terjadinya korupsi, kolusi dan nepotisme (KKN) lima instansi diajak pantau kegiatan penerimaan Brigadir Polisi pada tahun 2013. Kelima instansi tersebut yaitu Disdukcapil, MPU, Disdikpora, Dinkes, PWI, dan Depag. Senin (11/2), kelima instansi tersebut melakukan penandatanganan MoU dengan pihak Polresta Lhokseumawe. Penandatangan MoU berlangsung di Mapolresta Lhokseumawe. “Kerjasama ini kita buat untuk menghindari terjadinya KKN pada penerimaan Brigadir Polisi pada 2013, dan ini merupakan yang pertama kita lakukan di Aceh,” kata AKBP Kukuh Santoso, Kapolres Kota Lhokseumawe melalui M Ramlan, Kabag Sumber Daya. Ramlan mengatakan, penerimaan Brigadir Polisi mulai dilaksanakan sejak l 2 hingga 29 Maret 2013. Dalam proses penerimaan tersebut, tahapan tes administrasi dilakukan Polres di kabupaten/kota masing-masing. Tes ADM meliputi tinggi badan, ijazah, KTP dan lainnya. (b18)

Fungsionaris Golkar Orientasi Partai BIREUEN (Waspada): Puluhan anggota dan fungsionaris Partai Golkar dari Kabupaten Bireuen, DPD I dan Aceh Besar, mengikuti orientasi Partai Golkar yang dilaksanakan Ketua dan Pengurus DPD II Bireuen, di Cot Gapu, kabupaten setempat, Minggu (10/2). Ketua DPD I Partai Golkar Aceh Sulaiaman Abda mengatakan, orientasi fungsionaris partai Golkar dilaksanakan dalam rangka membekaliparaanggotadanfungsionarispartaiberlambangpohon beringin tersebut, supaya menambah wawasannya mengenai partai maupun pengetahuan lainnya yang dianggap perlu. “Bagi partai Golkar orientasi ini, harus diikuti seluruhnya, karena itu satu syarat untuk bisa mencalonkan diri untuk menjadi anggota DPRK, DPRA maupun DPR RI,” katanya. Ketua DPD II Partai Golkar Bireuen, Saifannur mengatakan, peserta yang mengikuti acara orientasi partai Golkar tersebut, di antaranya utusan 17 kecamatan di Bireuen yang terdiri setiap kecamatan lima orang, ditambah dari DPD setempat 35 orang dan lima orang dari DPD II Aceh Besar. (cb02)

Pemilih Di Bireuen 297.275 Jiwa BIREUEN (Waspada) : Jumlah pemilih potensial Pemilu (DP4) 17 Kecamatan dalam Kabupaten Bireuen yang diserahkan ke KIP sebanyak 297.275 jiwa. Kadis Kependudukan dan Pencatatan Sipil Kabupaten Bireuen Drs Darmansyah, menjelaskan, Senin (11/2), jumlah pe-milih sudah final sebagai bahan yang akan diproses KIP melalui tahapan pemutakhiran data pemilih, penyusunan dan pengu-muman daftar pemilih sementara (DPS) hingga menjadi daftar pemilih tetap (DPT). Penambahan jumlah pemilih di Kabupaten Bireuen lantaran Pemilu berlangsung 2014 nanti kemungkinan ada penambahan pemilih diperkirakan relatif kecil dan pihak KIP dapat mengkoordinasikan kembali dengan Pemkab setempat. Dikatakan, jumlah pemilih yang paling menonjol di 17 kecamatan dalam Kabupaten Bireuen didominasi Kecamatan Peusangan 36.399 pemilih, disusul Kecamatan Kota Juang 35.291 pemilih, dan Kecamatan Jeumpa 24.002 pemilih. (b12)

Pertimbangkan Aspek Bencana LHOKSEUMAWE (Waspada): Setiap warga Aceh yang membuat bangunan, baik rumah maupun tempat usaha, haruslah mempertimbangkan hal terburuk berkaitan dengan bencana alam. Peringatan ini berkaitan dengan kerapnya terjadi bencana banjir, gempa bumi, dan erosi bagi mereka yang tinggal berdekatan dengan sungai. Dan yang terpenting adalah kelestarian serta keselamatan manusianya. “Kesadaran warga terhadap bencana belum terbangun de-ngan baik. Bukan hanya di kalangan masyarakat, di pemerintahan dan legislatif sendiri masih kurang peduli,” ungkap Saifuddin Irhas, pegiat lingkungan dan juga Direktur Eksekutif Bina Masyarakat Sejahtera (Bytra) Lhokseumawe, Senin (11/2). Sesungguhnya seluruh lapisan masyarakat dituntut untuk peka terhadap bencana dengan perencanaan pembangunan yang harus mempertimbangkan aspek bencana. Hal ini untuk mengurangi potensi kerugian, terutama sumber daya manusia. (b14)

Kursi Roda Untuk Penyandang Cacat BIREUEN (Waspada): Ketua Komite Peralihan Aceh (KPA), Wilayah III Peusangan, Bireuen, Syukri Daud alias Boing yang didampingi Maideh menyerahkan satu unit kursi roda kepada A Rahman, 55, seorang penyandang cacat asal Desa Pante Bidari, Aceh Timur di kantor KPA setempat, Minggu (10/2). “Kami tersentuh sekali melihat Pak A Rahman yang ditemani anaknya Maulana baru berumur 8 tahun yang masih duduk di kelas II SD, mencari sedekah dengan cara mengesot di Keude Peusangan ini, makanya kami menyumbang satu unit kursi roda kepadanya, mudah-mudahan bermanfaat baginya,” kata Syukri. Menurut Boing, pemberian kursi roda kepada seorang peminta-minta yang anggota badannya cacat tersebut, sebagai bentuk bentuk kepedulian pihaknya kepada orang penyandang cacat tersebut. (cb02)


KASAT Reskrim AKP Muhammad Firdaus menunjukkan 12 ekor trenggiling yang berhasil ditangkap di depan Mapolres Langsa, Selasa (12/2).

Korupsi Alkes RSUCM, Jaksa Titip BB Ke RS LHOKSEUMAWE (Waspada): Tim Kejaksaan Negeri Lhoksukon menitip sementara barang bukti (BB) dugaan korupsi yang disita beberapa waktu lalu. Sebanyak empat item besar alat kesehatan itu diserahkan kepada Direktur Rumah Sakit Umum Cut Meutia (RSUCM) Aceh Utara di Lhokseumawe, Selasa (12/2). Kepala Kejaksaan Negeri Lhoksukon T Rahmatsyah melalui Kasi Intel M Kadafi menyebutkan, penyerahan barang

bukti ini untuk memperlancar fungsi pelayanan masyarakat di rumah sakit plat merah ini. “Barang-barang ini hanya kita titip sementara untuk rumah sakit, dan kalau kami perlu sewaktu-waktu untuk proses pemeriksaaan, ini kami tarik kembali,” tutur Kadafi. Barang sitaan yang dititip tersebut seperti alat operasi tulang (orthopedie set) sebanyak lima jenis, kemudian alat instrument untuk operasi besar (mayor surgeri set) sebnyak tiga jenis, alat operasi melahirkan (section caesarean instrument set) ada enam jenis, dan terkahir unit photo theraphy merk olidef Cz-Brazil. Sebagian besar alat-

alat tersebut buatan Jerman. Lanjutnya, alat kesehatan itu hingga saat ini masih ada dua jenis alat lainnya yang belum juga tiba di RSUCM, terakhir hari Sabtu kemarin tiba satu alat lagi ke rumah sakit. Padahal seluruh dana telah dibayar full pada 14 Desember 2012 lalu. Terkait pemeriksaan, jaksa masih fokus memeriksa dua tersangka, yakni MSA, warga Desa Mibo Banda Raya, Banda Aceh, Direktur PT Visa Karya Mandiri selaku kontraktor dan Pejabat Pembuat Komitmen (PPK) RSU CM, berinisial SDN, wanita asal Kuta Blang, Lhokseumawe. Sementarasaksiyangtelahdiperiksa berjumlah 18 orang. (cmk/b19)

Lima Terdakwa Korupsi Alkes RSU Bireuen Mulai Disidang BANDA ACEH (Waspada): Lima terdakwa kasus korupsi pengadaan obat-obatan dan alat kesehatan pada Rumah Sakit Umum (RSU) dr Fauziah Bireuen, mulai disidangkan di Pengadilan Tipikor Banda Aceh, Selasa (12/2). Para terdakwa itu, oleh jaksa penuntut umum membaginya dalam lima berkas terpisah menurut peran masing-masing terdakwa. Jaksa Penuntut Umum Faisal Moga dan Munawal Hadi dari Kejari Bireuen membacakan dakwaana satu persatu di hadapan majelis hakim diketuai Syamsul Kamal dibantu anggota Zulfan Effendi dan Syaiful Asy’ari. Ke-lima terdakwa yaitu, terdakwa M (mantan Kabag TU BLU RSU dr Fauziah Bireuen), terdakwa MN (Ketua Panitia Penerima Barang), terdakwa MZ (Direktur CV MU), terdakwa Jaf (Direktur CV ED) dan terdakwa MHV. Para terdakwa ini hadir didampingi penasihat hukumnya Saifuddin Gani.

Jaksa penuntut umu dalam dakwaan yang dibacakan secara bergiliran itu mengatakan, RSU dr Fauziah Bireuen tahun 2006 mendapatDipauntukpengadaan obat-obatan dan alat kesehatan sebesar Rp920.900.000,- kemudiandalamtahun2007mendapat dana lagi Rp1.125. 601.325. Dikatakan, untuk memenuhi kebutuhan obat-obatan dan alat kesehatan, dr Edf (almarhum) selaku Direktur RSU dr Fauziah telah melakukan pengambilan obat-obatan pada apotik Asli dan alkes berupa gas oksigen terapi pada Toko Amin Bireuen dengan sistem utang. Menurut jaksa, terdakwa M yang juga selaku ketua panitia pengadaan obat-obatan dan alkes tersebut mempersiapkan semua dokumen pelelangan secara fiktif dengan meminjam dokumen beberapa perusahaan yang telah ditunjuk atas nama terdakwa Jaf, terdakwa MZ, terdakwa MHV dan MRN selaku Direktur CV RP (almarhum).

Masih kata jaksa, terdakwa M juga mempersiapkan dokumen kontrak yang turut ditandatangani dengan para terdakwa lain. Dan kemudian diserahkan kepada bagian keuangan BLU RSU dr Fauziah Bireuen untuk dilakukan pencairan dana ke Pemkab Bireuen. Perbuatan para terdakwa, lanjut jaksa, telah mengakibatkan kerugian negara Rp199.910. 760,- sesuai hasil perhitungan BPK Perwakilan Provinsi Aceh. Para terdakwa telah dipersalahkan melanggar pasal 2 ayat (1) jo. pasal 18 UU RI No.31 tahun 1999 tentang pemberantasan tindak pidana korupsi jo.pasal UU RI No.20 tahun 2001 tentang perubahan atas UU No.31 Tahun 1999 jo.pasal 55 ayat (1) ke-1 KUHP. Untuk mendengarkan eksepsi dari penasihat hukum para terdakwa, majelis hakim menunda sidang hingga, Selasa (19/2). (b02)

Puluhan PNS Pulang Tak Sesuai Jadwal Terjaring IDI (Waspada): Tak hanya sebatas melakukan Inspeksi Mendadak (Sidak), kedisiplinan juga dilakukan melalui langkah razia jalan Medan – Banda Aceh khusus terhadap para Pegawai Negeri Sipil (PNS) yang pulang lebih cepat dari aturan dan PNS yang bolos saat jam kerja, Senin (11/2) sekira pukul 14:00 - 16:00. Titik razia perdana di Jalinsum ini dipusatkan di depan

Kantor Dinas Perhubungan, Telekomunikasi dan Komunikasi Kab. Aceh Timur di Peureulak Kota. Seluruh mobil dan Angkutan Umum Antar Kota Antar Provinsi yang dicurigai seluruhnya dirazia para PNS. PNS yang kedapatan pulang cepat dan bolos diturunkan, tak terkecuali. Razia yang dipimpin Bupati AcehTimur Hasballah HMThaib atau Rocky ikut didampingi Kadis

Perhubungan, Zahri, Asisten III SetdakabAcehTimur,IrfanKamal, Asisten II Setdakab Aceh Timur, M. Ihsan Ahyat, Kepala Satpol PP/ WH Safrizal Fauzi, S.STP.MAP. Setelah razia dilakukan hingga pukul 16:00, para PNS yang sudah diturunkan dibariskan guna diberikan pengarahan terkait dengan sanksi PNS yang tidak masuk kerja ataupun bolos pada saat jam kerja. (b24)

Asteroid 2012 DA14 Segera Lintasi Samudera Hindia

Waspada/Abdul Mukthi Hasan

A RAHMAN, penyandang cacat foto bersama dengan Ketua KPA Wilayah III Peusangan, Bireuen, Minggu (10/2)

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu)

Garuda Indonesia

GA 142 Jakarta/Medan GA 146 Jakarta/Medan

Lion Air

JT 304 Jakarta JT 306 Jakarta/Medan JT 396 Jakarta/Medan

Sriwijaya Air

SJ 010 Jakarta/Medan

Air Asia

QZ 8023 Medan AK 1305 Kuala Lumpur *

Fire Fly

FY 3401 Penang* * Setiap Senin, Rabu, Jumat dan Minggu.

Berangkat (flight, tujuan, waktu)

10:40 16:00

GA 143 Medan/Jakarta GA 147 Medan/Jakarta

11:20 16:45

11:35 15:55 21:30

JT 397 Medan/Jakarta JT 307 Jakarta JT 305 Medan/Jakarta

06:00 12:15 16:35


SJ 011 Medan/Jakarta


12:00 11:00

QZ 8022 Medan AK 1306 Kuala Lumpur*

12:25 11:30


FY 3400 Penang*


LHOKSEUMAWE (Waspada): Asteroid 2012 DA14 memiliki diameter 58 meter dengan estimasi massa sekitar 330.000 ton. Ia pertama kali terekam di Observatorium Mallorca (Spayol) pada 23 Februari 2012 sebagai titik cahaya amat redup yang beringsut pelan di antara bintang-bintang di latarbelakangnya. Dengan cepat titik cahaya ini juga terdeteksi oleh sistemsistem penyigian langit lainnya dan segera disimpulkan sebagai asteroid. Hal itu disampaikan Tgk Ismail, S.SY, Ketua Unit Kegiatan Mahasiswa Lembaga Kajian Ilmu Falak STAIN Malikussaleh Lhokseumawe, Selasa (12/2). Kata Ismail, sesuai dengan tatanama yang berlaku di IAU (International Astronomical Union), karena ditemukan di paruh kedua Februari 2012, maka asteroid ini dikodekan sebagai 2012 DA14 tanpa nama resmi. Penamaan resmi hanya akan dilakukan IAU jika memang diperlukan, namun ada proses panjang yang harus dilalui. Asteroid 2012 DA14 bakal melintas sangat dekat dengan Bumi, Sabtu (16/2) dinihari pukul 02:26 mendatang. Saat itu asteroid hanya akan berjarak 27.700 km dari permukaan bumi. Jarak terdekatnya dengan bumi terjadi di atas Samudera

Hindia di lepas pantai Sumatera pada koordinat 4 LS dan 93,5 BT. “Meski melintas sangat dekat dan memecahkan rekor sebagai asteroid besar yang berjarak terdekat dengan bumi, peluang asteroid 2012 DA14 untuk jatuh menumbuk bumi adalah nol (tidak membahayakan bumi). Dengan demikian asteroid ini hanya bakal lewat saja tanpa menyalakan alarm sistem bahaya asteroid. Manusia mencermati asteroid ini hanya dalam rangka untuk mendapatkan pengetahuan dasar lebih lanjut terkait sifat-sifat fisisnya guna menyempurnakan strategi defleksi asteroid/komet bilamana ada benda langit sejenis yang benar-benar bakal mengancam bumi kelak,” kata Tengku Ismail. Tambah Ismail, dengan titik terdekat asteroid 2012 DA14 ke bumi, Samudera Hindia lepas pantai barat Sumatera pada koordinat 4 LS dan 93,5 BT, maka secara umum Indonesia menjadi kawasan terbaik di Bumi guna menyaksikan peristiwa langka dan bersejarah perlintasan sangat dekat asteroid 2012 DA14 ini, khususnya Aceh bagian pantai Barat seperti Tapak Tuan, Lamno Banda Aceh dan Sabang. Proyeksi lintasan asteroid 2012 DA14 di permukaan bumi

menunjukkan hingga, Sabtu (16/2) pukul 00:00, asteroid tersebut masih berposisi jauh tinggi di atas Antartika. Namun seiring berjalannya waktu, secara dramatis asteroid mulai bergerak cepat ke utara menyeberangi Samudera Hindia di lepas pantai barat Australia, pukul 02:00, dan Sumatra pukul 02:30. Secara teratur kemudian asteroid melintas tinggi di atas Bangladesh, Tibet, Kazakhstan dan Rusia bagian barat untuk kemudian memasuki perairan Samudera Arktika di kutub utara, tepatnya di atas Islandia. Namun, baik di wilayahwilayah tersebut maupun di lepas pantai Australia, asteroid ini hanya nampak sebagai bintik cahaya redup dengan magnitudo di sekitar +10. Asteroid akan nampak paling terang hanya ketika berada di lepas pantai Sumatera, bentuknya seperti cahaya bintang yang berjalan cepat dari arah selatan ke utara. “Dalam hal ini kami dari Unit Kegiatan Mahasiswa Lembaga Kajian Ilmu Falak STAIN Malikussaleh Lhokseumawe akan melakukan observasi ilmiah guna menambah penge-tahuan dan wawasan mahasis-wa, acara ini kami pusatkan di kampus STAIN Malikussaleh Lhokseumawe di lantai III Gedung Syari’ah,” kata Tengku Ismail. (b18)

LANGSA (Waspada): Polres Langsa berhasil menggagalkan penyelundupan 12 hewan trenggiling asal Tangse, Pidie yang dibawa tersangka, Hs, 55, warga Desa Pulo Baro, Kec. Tangse, Kab. Pidie, melalui bus untuk dijual di Kota Medan di depan Mapolres Langsa, Selasa (12/2) sekira pukul 03:00. Demikian dikatakan Kapolres Langsa AKBP Hariadi, SH. SIK melalui Kasat Reskrim AKP Muhammad Firdaus kepada wartawan, Selasa (12/2). Menurut Firdaus, penangkapan 12 ekor trenggiling ini berkat informasi dari masyarakat, ada seseorang membawa hewan yang dilindungi negara melalui bus dengan tujuan TangseKota Medan dengan nopol sudah diketahui. Polres Langsa kemudian melakukan razia dadakan di depan Mapolres Langsa. ‘’Selanjutnya kita lakukan penggeledahan dan berhasil

menemukan 12 trenggiling, seekor di antaranya sudah mati dengan seorang tersangka Hs. Selanjutnya tersangka dan barang bukti 12 Tringgiling tersebut sudah kita amankan di Mapolres Langsa,’’ urainya. Menurut informasi dari Hs sendiri, dirinya membawa 12 Tringgiling dengan berat sekira 40 kg ini karena sudah ada orang yang menunggu membeli di Medan di terminal bus. Tersangka Hs diancam Pasal 21 ayat 1 dan 2 junto Pasal 40 Ayat 2-4 Undang-undang No. 5 Tahun 1990 tentang sumber daya hayati dan ekosistem dengan acaman 5 tahun penjara. Sementara untuk 11 ekor trenggiling yang masih hidup dan 1 ekor yang telah mati selanjutnya akan kita serahkan ke Badan Konservasi Sumber Daya Alam (BKSDA) Provinsi Aceh. “Bagaimana selanjutnya kita serahkan kepada mereka,” demikian Firdaus. (m43)

Akibat Pungli, Warga Langkahan Terancam LANGKAHAN (Waspada): 36 Unit rumah bantuan Komunitas Adat Terpencil (KAT) dari Kementerian Sosial dibangun di kawasan terpencil Sarah Raja, Desa Lubok Pusaka, Kecamatan Langkahan, Aceh Utara. Namun warga di dusun terpencil itu mengaku tidak bisa menempati rumah karena tak mampu membayar dana Rp3 juta per unit rumah. Samsari, 40, warga Sarah Raja kepada Waspada, Senin (11/2) mengakui, dia bersama sejumlah warga lain belum bisa menghuni rumah bantuan Kementerian Sosial. “Karena saya tidak punya uang sebanyak Rp3 juta, rumah tidak dikasih,” jelasnya. Padahal, ketika pemerintah daerah setempat menaikkan proposal rumah, mengatasnamakan warga terpencil,” tambah dia. Namun sekarang tempat tinggal itu akan diserahkan kepada pihak lain. Kepala Desa Lubok Pusaka, Halimat juga mengakutelahmenerimapengaduanwargaSarah Raja yang tidak mendapat rumah ban-tuan.

Menurut dia, ada oknum yang melakukan pengutipan Rp 3 juta per rumah. “Alasannya untuk dana gotong-royong,” jelas Halimat. Ketika rumah-rumah tersebut dibangun awal 2012 lalu, warga setempat melakukan gotong-royong untuk pertapakan. Namun sejumlah warga tidak sempat ikut kegiatan itu sehingga terancam tidak mendapat rumah. Dia juga menjelaskan, warga tidak mungkin bisa melunasi biaya kutipan sebanyak itu. “Apa lagi janda-janda yang tidak punya uang sehingga tidak mampu melunasi uang sebanyak itu,” tambah Halimat yang mengaku sudah melaporkan mengenai kutipan tersebut kepada Camat Langkahan. Camat Langkahan T Nadirsyah menjelaskan, penerima rumah bantuan telah ditetapkan melalui SK Bupati Aceh Utara. Sehingga, menurut camat, walaupun tidak membayar uang gotong-royong rumah tersebut tidak bisa dialihkan kepada pihak lain. (b15)

Mahkamah Syariah Gagal Eksekusi Harta Gono-gini LHOKSEUMAWE (Waspada): Mahkamah Syariah Lhoksukon gagal mengeksekusi rumah dan sepetak tanah harta bersama (gonogini) milik Rosni dan M.Yahya di Desa Meunasah Aron, Kecamatan Muara Batu, Aceh Utara, Selasa (12/2). Panitera Mahkamah Syariah Lhoksukon, Irfan Nusir mengatakan, eksekusi terpaksa ditunda setelah M.Yahya menyerahkan bukti akta jual beli tanah tertera tahun 2006. “Tanah dibeli pada 2006, sedangkan mereka cerai pada 2002, kita sarankan M.Yahya mengajukan Peninjauan Kembali (PK) kepada Mahkamah Agung RI melalui Mahkamah Syariah Lhoksukon,” sarannya. Namun, bila dalam kurun waktu sebulan, PK tidak diajukan, maka pihaknya akan turun kembali untuk membagikan langsung objek eksekusi. Eksekusi ini dilaksanakan berdasarkan penetapan perintah eksekusi Ketua Mahkamah Syariah Lhoksukon, nomor 126/pdt.G/2011/ Ms/Lsk tanggal 24 Juli 2011.

Dalam perkara harta bersama suami istri antara Rosni (penggugat) dan M. Yahya (tergugat), dan menetapkan menghukum tergugat supaya menyerahkan setengah harta sebagai hak penggugat secara utuh dan tidak menyangkut dengan pihak lain. Dalam surat nomor WI-A11/437/Hk.05/ VI/2012 perihal mohon kesediaan membayar setengah dari satu unit rumah dan tanah pertapakan disebutkan kedua objek eksekusi Rp260 juta dan setengah dari harta tersebut Rp130 juta yang merupakan hak dan bagian Rosni binti Harun. Menurut M.Yahya, objek eksekusi ini bukan harta bersama, melainkan tanah keluarganya yang diberikan untuk membangun rumah ketika dia miskin dulu. Sementara Rosni mengatakan, tanah lokasi pertapakan rumah tersebut telah dibeli bersama dari abang mantan suaminya semasih bersama. (cmk)

Baitul Mal Dituding Diskriminatif Terhadap Mualaf TANAH JAMBO AYE (Waspada): Nur Azizah, 30, mualaf yang juga warga Gampong Alue Mirah, Kecamatan Tanah Jambo Aye, menuding Baitul Mal Aceh Utara diskriminatif terhadap mualaf. Pasalnya, sejak Juli 2012 mengajukan proposal bantuan modal usaha hingga Februari 2013 bantuan tersebut belum dicairkan. “Saya ajukan proposal bantuan modal usaha (pinjaman modal) kepada Baitul Mal Aceh Utara. Pada waktu itu pihak Baitul Mal menjanjikan bantuan modal dapat dicairkan pada November 2012, namun sampai kini belum cair juga. Mereka tidak menepati janjinya,” kata Nur Azizah, Selasa (12/2) yang datang mengadu ke Kantor Biro Waspada Lhokseumawe. Lebih jauh dia menjelaskan, dia hanya membutuhkan modal usaha sebanyak Rp2 juta untuk menjual produk multi level marketing (MLM). Pada waktu itu, pihak Baitul Mal menyarankan untuk tidak menjual produk MLM karena membutuhkan modal yang cukup banyak dan pihak Baitul Mal menyarankan untuk merubah jenis usaha. Mendapat saran tersebut, Nur Azizah akhirnya merubah jenis usaha yaitu berjualan es cream keliling, tapi modal uasaha yang diminta sampai kini belum dicairkan. Selasa (12/2) , Nur Azizah dan suaminya Mustafa Kamal, 29, mendatangi Baitul Mal untuk mempertanyakan bantuan modal usaha. Namun pihak Baitul Mal malah memintanya

untuk berjualan bakso. Jika dia mau mengikuti saran itu, maka Baitul Mal akan memberikan bantuan dalam bentuk barang.“Saya tolak saran itu, saya nggak mungkin jualan bakso, saya tidak punya kulkas dan lainnya. Saya maunya diberi modal untuk jualan es krim itu saja. Modal yang saya butuhkan hanya Rp2 juta,” katanya. Fakhrurrazi, Kepala Baitul Mal Aceh Utara didampingi stafnya kepada Waspada menjelaskan, tidak ada tindakan diskriminatif terhadap muallaf. Bantuan modal usaha dalam bentuk uang tidak dapat diberikan. Pengalaman beberapa waktu lalu, banyak penerima bantuan uang tidak memanfaatkan modal seperti apa yang mereka katakan. “Kita tetap membantu mereka. Kalau memang setelah disurvey benar adanya seperti yang dikatakan, maka modal akan kita berikan dalam bentuk barang bukan dalam bentuk uang. Tidak benar kita diskriminatif pada Nur Azizah. Peluang untuk dia tetap ada,” katanya. Staf Baitul Mal yang dikonfirmasi Waspada menjelaskan, jenis usaha yang ingin dibuka oleh Nur Azizah sangat tidak jelas dan jenis usaha selalu berubah-ubah. “Banyak pernyataan Nur Azizah yang sifatnya memfitnah pihak kami. Hasil survey kami pola pikir dia yang selalu berubah-ubah. Bantuan akan diberikan jika apa yang dikatakan sesuai dengan permo-honannya,” kata beberapa staf dan tim survey lapangan. (b18)

2013 Bebas Narkoba, TNI Tes Urin LHOKSEUMAWE (Waspada): Seratusan prajurit TNI dari Kodim 0103/Aceh Utara melakukan tes urin di Makodim setempat di Kota Lhokseumawe, Senin (11/1). Tes urin ini juga melibatkan seluruh perwakilan Kodim di Aceh Utara untuk antisipasi penggunaan narkoba oleh TNI. Kepala Satuan Kodim (Kasdim), Mayor Kav Yusri mengatakan, mencegah itu lebih baik, makanya pihak kodim melaku-kan tes urin bagi prajurit. TNI sebagai penegak hukum perlu memberikan contoh yang baik kepada masyarakat. Kalau pun ada anggota TNI yang positif menggunakan narkoba, maka harus diproses.

“Kalau ada anggota saya positif menggunakan narkoba, ya harus diproses secara hokum, bagaimana aturan hukum negara yang berlaku. Masalah dipecat atau tidak, sesuai dengan proses hukum juga,” tuturnya. Kasdim juga mengimbau kepada prajurit agar tidak semena-mena bermain dengan narkoba, karena narkoba itu merusak bangsa dan negara. Pasi Intel, Kapten Aris NL mengatakan, hasil tes urin yang dilakukan kemarin semuanya negatif, artinya tidak ada satu pun prajurit TNI hasil pemeriksaan yang menggunakan barang haram tersebut. (cmk)

3.000 Kasus HIV/AIDS Di Aceh Utara LHOKSEUMAWE (Waspada): Hingga saat ini jumlah kasus penderita HIV/AIDS di Kabupaten Aceh Utara telah mencapai 30 kasus, 16 di antaranya masih HIV dan 14 sudah pada tingkat AIDS. Dari jumlah kasus sebanyak itu, 8 penderita telah meninggal dunia. Jika menggunakan fenomena gunung es, maka diduga jumlah kasus penderita HIV/AIDS di Aceh Utara ada sekitar 3.000-an kasus, dengan perbandingan 1:100. Hal tersebut disampaikan dr Makhrozal, Sekretaris Komisi Penanggulangan AIDS Kabupaten Aceh Utara, Senin (11/2). Usia para penderita mulai dari 11 tahun hingga 51 tahun, namun dominan di antaranya mereka masih berusia produktif.

Jumlah kasus yang telah terdeteksi KPA Aceh Utara setelah dikurangi jumlah penderita yang telah meninggal tersisa sebanyak 22 kasus, dari 22 kasus tersebut, 6 kasus masih dalam tahap penjangkauan penderita. Untuk menjangkau penderita membutuhkan tenaga yang memiliki kemampuan dalam mewawancarai dan mampu membangun hubungan dengan penderita. “Kita menduga ada sekitar 3000-an kasus HIV/AIDS yang belum mampu kita deteksi. Mengapa kita berani menduga ada sekitar 3000an kasus, karena dalam persoalan ini dan untuk scope Aceh ditafsirkan setiap ada 1 kasus sama dengan ada 100 kasus lain di sekeliling penderita atau disebut dengan fenomena gunung es,” kata Makhrozal. (b18)


WASPADA Rabu 13 Februari 2013

KSAD Nyatakan Aceh Sangat Aman

Mantan Dirut PDKS Digelandang Ke Simeulue

BANDA ACEH (Waspada): Kepala Staf Angkatan Darat (KSAD) Jenderal Pramono Edi Wibowo pada kunjungan kerjanya ke Banda Aceh, Senin (11/2) menyatakan Aceh saat ini sangat aman dan kondusif. “Dari laporan sehari-hari yang saya terima, Aceh kini sudah sangat damai sejak perjanjian damai antara pemerintah RI dan GAM, damai dalam artian aman dan kondusif,” kata jenderal bintang empat itu saat berkunjung ke Makodam Iskandar Muda. Pramono Edi berharap kepada seluruh warga Aceh, termasuk TNI, Polri, agar bisa menjaga perdamaian yang telah tercipta seperti sekarang ini, agar ke depan pembangunan di Aceh berjalan dengan baik dan lancar. Terhadap pengamanan daerah perbatasan seperti Aceh, KSAD menyebutkan, pembentukan Komando Pertahanan Laut (Kohanla) dinilai sangat strategis untuk memperkuat pertahanan dan keamanan di daerah perbatasan. Ancaman tradisional di perbatasan antara

SIMEULUE (Waspada): Kapolres Simeulue AKBP Parluatan Siregar menyatakan pihaknya sudah membawa mantan Dirut PDKS Ali Uhar, 49, ke Mapolres setempat. “Saat ini dia sedang di-BAP,” papar Parluatan, Selasa (12/ 2). Mantan Direktur Perusahaan Daerah Kabupaten Simeulue (PDKS) dijemput via ferry dan tiba di Simeulue, Selasa (12/2). Menurut informasi di masyarakat, Ali Uhar dibekuk Tim Reskrim Polres Aceh Barat Daya, Minggu (10/2) malam di Blangpidie, ibu kota Kabupaten Abdya. Beberapa waktu lalu Polres Simeulue telah menetapkan Ali Uhar sebagai tersangka penyalahgunaan dana operasional PDKS kemudian yang bersangkutan menghilang hingga dimasukkan Daftar Pencarian Orang (DPO) . (cb08)

Camat Harus Makmurkan Masjid REDELONG (Waspada): Dalam rangka memakmurkan masjid, para camat yang baru dilantik harus bisa membangun dan merawat masjid, serta mengajak masyarakat utuk shalat berjamaah, ungkap Bupati Bener Meriah Ruslan Abdul Gani, Dipl, di Kantor Camat Weh Pesam, Selasa (12/2). “Ini adalah salah satu penilaian untuk semua camat, kami akan melihat bagaimana dia mampu memakmurkan masjidmasjid di wilayahnya serta mengembalikan kebiasaan anakanak dan orang tua untuk mengaji di masjid, meunasah ba’da shalat maghrib seperti dulu,” kata Ruslan. (b33)

Bupati Agara Ambil Sumpah 120 CPNS KUTACANE (Waspada) : Bupati Aceh Tenggara, H Hasanuddin B, Selasa (12/2) mengambil sumpah sejumlah 120 CPNS yang lulus melalui jalur umum tahun 2010, diangkat menjadi PNS, di lingkungan Pemerintahan Agara. Acara dipimpin Bupati dilaksanakan di lapangan apel kantor Bupati, dihadiri wakil Bupati, seluruh SKPK, para camat serta PNS di lingkungan setdakab. Hasanuddin, B menyampaikan agar PNS yang baru diangkat menunjukkan kinerja yang baik, serta diharapkan tetap semangat mengikuti pendidikan ke jenjang pascasarjana maupun pelatihan penjenjangan untuk menunjang kinerja dalam karier di PNS. Adapun mereka yang dilantik dari status CPNS menjadi PNS berdasarkan golongan kepangkatan, masing-masing, golongan IIIB sejumlah 6 orang, golongan III A sejumlah 90 orang, golongan II C sejumlah 16 0rang, dan golongan II B sejumlah 8 orang. Usai melaksanakan pelantikan, Bupati Hasanuddin B, bersamaWabup H Ali Basrah melanjutkan kegiatan mengikuti rapat paripurna pembahasan rancangan 10 qanun di gedung dewan dipimpin ketua DPRK Agara, dan pada Selasa (12/2), dalam sidang paripurna yang dihadiri seluruh SKPK tersebut 10 Raqan itu disahkan menjadi Qanun Kabupaten Aceh Tenggara. (b25)

Banjir Kembali Landa Aceh Selatan TAPAKTUAN (Waspada) : Banjir besar kembali melanda kawasan Kec. Kota Bahagia, Kab. Aceh Selatan, Minggu (10/ 2), akibat hujan lebat di kawasan pegunungan setempat sejak sehari sebelumnya. Kondisi itu menyebabkan Sungai Bakongan meluap. Meski tak ada korban jiwa, tetapi dua rumah warga dan ribuan meter pipa air bersih hancur total diterjang banjir. Camat Kota Bahagia, Muhammad Rasyid menyebutkan, kedua rumah yang hancur tersebut masing-masing milik Azul Bini, 30, dan Ali Akbar, 40, warga Seunebok Alu Buloh. Kedua keluarga itu kini ditampung di rumah keluarga terdekat. Menurut Rasyid, banjir luapan itu juga menggenangi ratusan rumah warga setinggi satu meter itu di enam gampong , meliputi Betong, Bukit Gadeng, Ujung Tanoh, Ujung Gunong Rayek, Ujung Gunong Cut dan Seunebok Alu Buloh. Selain Kota Bahagia, banjir juga melanda Kecamatan Trumon Timur dan Bakongan. “Tapi kini air mulai surut dan warga mulai membersihkan rumah,” tutur Camat Bakongan, Wahidin. (b30)

Jalan Meurah Mulia Rusak MEURAH MULIA (Waspada): Sepanjang 7 km jalan di Kecamatan Meurah Mulia kupak-kapik. Masyarakat petani kesulitan melintasi jalan tersebut karena hampir di sepanjang badan jalan terdapat lubang-lubang berukuran besar. Masyarakat di sana meminta Pemkab Aceh Utara untuk segera memperbaiki jalan tersebut. Beberapa masyarakat, Sabtu (9/2) mengatakan, jalan tersebut telah lama rusak dan hingga kini belum diperbaiki. Kata masyarakat, jalan tersebut merupakan jalan sentra ekonomi produktif. Pasalnya, berbagai hasil produksi petani hanya dapat diangkut dengan mempergunakan jalan tersebut. Selain petani, para pelajar dan mahasiswa yang tinggal di Kecamatan Meurah Mulia mengaku sering terlambat sampai di sekolah dan kampus karena untuk melintas di jalan tersebut harus ekstra hati-hati, kalau tidak mereka bisa terjatuh dari kendaraannya. (b18)

Diharap Atasi Masalah Petani TAKENGEN (Waspada): Untuk memacu peningkatan produksi pertanian dan kesejahteraan, Badan Penyuluhan di Aceh Tengah diharap mampu berperan aktif mengatasi masalah dihadapi petani. “Peran penyuluh begitu urgen dalam memberikan pemahaman ke petani. Karena itu, perlu adanya terobosan, bagaimana mendukung dan membantu para petani sehingga nantinya mereka mampu mengatasi berbagai persoalan,” kata Bupati Aceh Tengah Nasaruddin, saat memberi pencerahan di hadapan petugas Penyuluhan dan Ketahanan Pangan, kabupaten setempat, Senin (11/2) di Takengen. Dia juga mengharapkan peran aktif petugas penyuluh pertanian untuk bekerja lebih serius dan mampu melihat peluang yang bisa memacu kinerja para petani sebagai sektor utama penyedia kebutuhan pangan. “Dalam UU no 16 tahun 2006, tentang sistem penyuluhan, perikanan dan kehutanan diamanatkan, penyelenggaraannya wewenang dan tanggungjawab pemerintah. Itu dapat diwujudkan dengan melakukan pemantapan program, meliputi aspek penataan dan penguatan kelembagaan, ketenagaan, sarana dan prasana serta pembiayaan penyuluhan,” terangnya. Kepala Badan Penyuluh dan Ketahanan Pangan Aceh Tengah Adiyan melalui sekretarisnya, Husaini menyebutkan, jumlah tenaga penyuluh pertanian 180 orang. Dengan rincian 65 berstatus PNS dan 115 tenaga kontrak. (cb09)

Segera Bayar UP Petugas PAD KUTACANE (Waspada) : Pembayaran upah pungut terhadap petugas pemungut Pendapatan Asli Daerah dari Kadis Pengelolaan Keuangan dan Kekayaan Daerah, harus menjadi prioritas dan penting segera direalisasikan. Pasalnya, mengejar dan merealisasikan target PAD yang telah dibebankan merupakan tugas yang berat, sebab itu kerja dan jerih payah petugas yang turun langsung ke lapangan harus dihargai dan diberikan motivasi yang lebih. Demikian disampaikan M Sopian Desky, anggota Fraksi Kerakyatan menanggapi pembahasan Qanun Agara Tahun 2012, pada Sidang Paripurna Dewan masa sidang I tahun 2013, di gedung DPRK setempat, Senin (11/2). Pada sidang Paripurna Perubahan APBK 2012 yang lalu , berulang kali disampaikan tentang keprihatinan dewan terhadap lemahnya pencapaian realisasi target PAD Aceh Tenggara, hal ini merupakan tanggungjawab langsung dari Dinas Pengelolaan Keuangan dan Kekayaan Daerah. Tanpa memberikan intensif atau motivasi bagi petugas yang melakukan pemungutan langsung PAD ke lapangan, jelas merupakan pekerjaan berat memenuhi target PAD yang dibebankan kepada objek pajak yang dikenakan PAD. Namun, ujar Sopian Desky, meski telah didesak dan disampaikan langsung kepada Kadis Keuangan di sidang Paripurna Perubahan APBK Agara 2012 lalu, pembayaran upah pungut bagi petugas yang melakukan pemungutan PAD, belum juga direalisasikan kadis keuangan. (b26)


Waspada/Gito Rolies

KEPALA Staf Angkatan Darat (KSAD) Jenderal Pramono Edi Wibowo melihat senjata api ilegal yang diserahkan masyarakat Aceh di Makodam Iskandar Muda, Senin (11/2)

Warga Gugat Pengeras Suara Di Menara Masjid BANDA ACEH (Waspada): Merasa kurang nyaman dalam beribadah, Sayed Hasan bin Sayed Abbas, 75, warga Gampong Jawa, Kecamatan Kutaraja, Banda Aceh, menggugat 10 alat pengeras suara (speaker) yang dipasang pada menara masjid di gampong tersebut. Dari 10 pengeras suara, dua unit di antaranya corongnya diarahkan ke rumah penggugat tinggal yang berdekatan dengan masjid. Akibatnya, penggugat yang telah berusia lanjut dan sedang menderita penyakit jantung, hipertensi mengganggu ibadah penggugat yang sebagian besar penggugat lakukan di rumah. Gugatan alat pengeras suara itu mulai disidangkan di Pengadilan Negeri Banda Aceh, Senin (11/2). Penggugat Sayed Hasan hadir sendiri tanpa memakai kuasa hukum. Adapun yang digugat adalah Kakankemenag

Kota Banda Aceh (tergugat 1) hadir diwakili Iqbal Muhammad, Kepala Seksi Urais Kemenag Banda Aceh. Selanjutnya, Ketua MPU Kota Banda Aceh A Karim Syeich (tergugat III), Keuchik Gampong Jawa (tergugat V), Imam Chik Masjid Al-Muchsinin (tergugat VI) dan Ketua Pengurus Masjid Al-Muchsinin Gampong Jawa (tergugat VII). Tergugat V,VI dan VII hadir kuasa hukumnya Tarmizi. Sementara dua tergugat lain tidak hadir yakni tergugat II Ketua MPU Aceh dan tergugat IV Kadis Syariat Islam Kota Banda Aceh. Penggugat mempersoalkan bahwa setiap hari ketika menjelang waktu shalat subuh selama 30 menit sebelum azan shubuh dan satu jam sebelum azan shalat maghrib oleh tergugat V,VI danVII menghidupkan tape recorder memutar kaset ceramah agama dan bacaan Alquran. Parahnya lagi, ketika bulan puasa setelah shalat tarawih dilanjutkan dengan tadarus sampai menjelang azan shalat subuh dengan menggunakan

alat pengeras suara. Penggugat beberapa kali meminta secara lisan dan tulisan memohon kepada tergugat agar dua mic toa yang mengarah ke rumah penggugat dapat digeser, namun para tergugat tidak mengindahkan. Bahkan, penggugat juga telah melaporkan pada Polsek dan Camat Kutaraja, namun tidak ada hasil. Penggugat meminta majelis hakim untuk memerintahkan para tergugat segera menggeser dua unit arah corong dari 10 unit mic toa pengeras suara yang diarahkan ke rumah penggugat ke arah lain. Majelis hakim diketuai Syahrul Rizal meminta kedua pihak untuk menempuh jalan damai dengan menunjuk hakim mediasi. Pada kesempatan itu, penggugat meminta kepada majelis hakim agar wali nanggroeAcehsebagaimediator.Majelis hakim tidak keberatan, namun dengan mempertimbangkan usulan kuasa hukum tergugat, majelis hakim untuk sementara menunjuk Ainal Mardhiah sebagai hakim mediator. (b02)

Krisis Air Di Lambung Teratasi Pemko Dan Warga Sepakati Beberapa Poin BANDA ACEH (Waspada): Aksi menuntut penyediaan air bersih oleh warga Lambung, Kecamatan Meuraxa kepada Pemerintah Kota Banda Aceh ditanggapi serius oleh Pemko Banda Aceh. WakilWali Kota Banda Aceh Illiza Sa’aduddin Djamal bersama Sekdakota T Saifuddin TA, Dirut PDAM Tirta Daroy Junaidi, Kadis PU Zahruddin, Camat Meuraxa serta sejumlah Kepala SKPD lainnya turun ke lokasi melakukan pertemuan dengan Keuchik, Ketua Pemuda, tokoh masyarakat dan sejumlah elemen masyarakat Gampong Lambung, yang berlangsung di kantor Keuchik setempat, Senin (11/2) sore. Pertemuan itu menghasilkan beberapa poin kesepakatan, di antaranya pemasangan kembali semua instalasi pipa ke rumah penduduk harus dimulai pengerjaannya dari nol dengan ketinggian lebih rendah dari pipa induk atau minimal sejajar dengan pipa induk. Kemudian, apabila dalam pengerjaanjaringanpipatersebut melewati bangunan akan dilakukanpembicaraandenganpemilik bangunan terkait biaya ganti rugi. WakilWali Kota Banda Aceh Illiza Sa’aduddin Djamal mengatakan kehadiran dirinya bersama Sekda dan sejumlah Kepala SKPD melakukan pertemuan dengan warga Lambung merupakan komitmen dan wujud kepedulian pemerintah kota untuk duduk bersama warga mencari solusi terhadap perma-

salahan krisis air yang dialami warga Lambung. Sekdakota T Saifuddin juga mengisyaratkan akan menindaklanjuti permintaan warga. Kata dia, terlepas dari kendala teknis dan kebocoran, harus diakui memang debit air yang mengalir ke Gampong Lambung masih minim. “Ini mungkin saja karena tekanan dariWTP Lambaro masih lemah dan belum mampu memberi tekanan yang maksimal hingga ke Gampong Lambung, namun kita tetap harus meningkatkan komunikasi sehingga menemukan solusi yang konkrit,” jelas Sekda. Junaidi, Dirut PDAM juga berjanji akan mempercepat proses pendeteksian kendala teknis dan pengerjaan jaringan. Menurutnya, persoalan krisis air di Gampong Lambung merupakan persoalan serius karena berada di titik akhir jaringan. “Sudah tiga hari kami melakukan pengecekan khusus di pipa induk sepanjang Jalan Iskandar Muda, sampai saat ini belum kita temukan, saya minta waktu seminggu untuk mengecek, begitu kita temukan kendala, pengerjaannya kita pacu sehingga dalam empat bulan ke depan air akan normal ke rumah warga,” kata Junaidi. Keuchik Lambung Zaidi M Adan berharap kesepakatan yang dicapai pada pertemuan tersebut dapat terealisasi sehingga persoalan krisis air yang selama 8 tahun dialami warga bisa teratasi dengan tuntas. Pada

kesempatan tersebut, Kechik Lambung juga meminta wakil wali kota agar segera membenahi manajemen PDAM Tirta Daroy dan melakukan peningkatan SDM perusahaan air minum milik Pemko Banda Aceh tersebut. Sebagaimana diberitakan, ekses krisis air bersih di Gampong Lambung, warga juga menyita Puskesmas Bulan Sabit yang digunakan Pemko Banda Aceh sebagai fasilitas kesehatan bagi warga. Menurut Keuchik Zaidi, lahan tempat pendirian puskesmas merupakan milik desa yang didirikam Pemko pascatsunami. Saat itu pendiriannya tanpa meminta izin warga, namun karena dinilai dibutuhkan, warga tidak keberatan dengan pembangunan puskesmas itu. “Sejak Sabtu (9/2), Dinas Kesehatan Banda Aceh sudah mengosongkan puskesmas. Kami memang butuh juga (puskesmas), tapi air juga tidak kalah penting bagi kami,” jelas Zaidi. Seperti diketahui, 246 KK di Lambung atau sekitar 700 jiwa, sejak Rabu pekan lalu, menggelar aksi menagih janji pemerintah kota Banda Aceh untuk memperoleh fasilitas air bersih. Pasalnya meski dinyatakan sebagai desa percontohan, namun pascatsunami 8 tahun silam, warga mengaku belum mendapat fasilitas air bersih. Akibatnya mereka terpaksa mengeluarkan biaya tambahan untuk membeli air bersih dari pedagang eceran. (b02/cb06)

Lagi, Bayi Tanpa Batok Kepala Lahir Di Pidie SIGLI (Waspada): Badan L a y a n a n Um u m D a e r a h (BLUD) Rumah Sakit Umum, Kabupaten Pidie kembali merawat seorang bayi perempuan tanpa batok kepala, Senin (11/ 2). Sehari sebelumnya RSU setempat juga telah merawat bayi perempuan yang lahir dalam kondisi serupa. Bayi tanpa batok kepala (Ancephaly-red), berjenis kelamin perempuan dan baru berusia satu hari itu lahir di Desa Peudaya, Kecamatan Padang Tijie dengan berat badan 3.000 gram. Namun Waspada sulit menghubungi kedua orang tua bayi

untuk dimintai keterangan, karena kondisi masih syok. Kepala Badan Pelayanan BLUD RSU Sigli, dr Fajriman membenarkan pihaknya sudah menerima satu lagi bayi tanpa batok kepala berjenis kelamin perempuan, Senin (11/2) pagi. Dan saat ini bayi tersebut sudah ditempatkan di ruang Perinatologi Rumah Sakit Umum (RSU) Sigli untuk dirawat. “Kami sudah menerima satu lagi pasien Ancephaly yang masuk tadi pagi. Kondisinya sama seperti bayi yang masuk kemarin,” katanya membenarkan. Menurut dia, kasus bayi

yang lahir dalam kondisi tanpa batok kepala di daerah itu tergolong banyak. Hal itu disebabkan tidak terbentuknya janin secaralengkapyangmengakibatkan beberapa faktor risiko, seperti prematur, infeksi, pskologis ibu, dan juga bisa disebabkan faktorfaktorlainsemisal toksikologi,dan keracunan atau dapat juga disebabkan radikal bebas. Sebelumnya, Minggu (10/ 2), pasien Ancephaly juga lahir di Kecamatan Mila dan kini telah dirawat di ruang perinatologi, sedangkan kondisi bayi masih dalam penangganan khusus pihak RSU Sigli. (b10)

lain pembajakan, penyelundupan manusia, penyelundupan barang terlarang, dan penyelundupan bahan peledak. Ancaman konvensional yang berpotensi berkembang adalah konflik dengan negara tetangga. “Dan saya telah perintahkan Pangdam untuk pertahankan dan ditingkatkan pengamanan jangan sampai ada gangguan,” terangnya. Sementara pemerintah berkomitmen untuk terus meningkatkan dan memodernisasi alat utama sistem senjata TNI, hal itu ditandai dengan akan dibelinya heli black hawk 20 unit produksi Amerika dan peralatan tempur lain untuk penambahan kemampuan pertahanan NKRI. Ia menyebutkan, sejumlah peralatan tempur tersebut nantinya akan dibagikan kepada satuan-satuan utama di wilayah Indonesia, “InsyaAllah kita akan memperkuat sistem alutsista sesuai modernisasi tahun ini,” kata dia, didampingi Pangdam Iskandar Muda Mayjend TNI Zahari Siregar serta sejumlah petinggi militer. (cb01)

Hukum Cambuk Makin Melemah Di Aceh BANDA ACEH (Waspada): Pidana cambuk sebagai pidana badan (corporal punishment) bagi para pelaku pelanggar hukum syariat yang berlangsung di Aceh, sepertinya sedang melemah dan meredup. Melemahnya pidana cambuk tersebut disebabkan banyak kabupaten/kota yang tidak menganggarkan dana eksekusi cambuk. Selain itu, banyak pilihan lain yang digunakan dalam menyelesaikan kasus-kasus pelanggaran syariat. Indikator melemahnya hukum cambuk diungkapkan Dosen FH Unsyiah, Adi Hermansyah, dalam diskusi rutin yang diselenggarakan di fakultas itu, Selasa (12/2). Menurut dia, pilihan lain yang selama ini dilaksanakan adalah penyelesaian secara adat dan kekeluargaan. “Penyelesaian tersebut pada dasarnya mengurangi pelaksanaan pidana cambuk,” ujar Adi. Adi menjelaskan, pidana cambuk sudah ada di Aceh sejak 2003 yang diatur dengan qanun. Pidana cambuk yang terdapat dalam qanun adalah pidana badan di samping jenis pidana lain yang terdapat dalam hukum Islam dan hukum pidana. “Di Aceh, pidana cambuk telah banyak

diterapkan pada beberapa kasus yang berkenaan dengan khalwat (mesum), maisir (perjudian), khamar (minuman keras dan sejenisnya),” ujarnya. Dalam kajian pidana, kata dia, hukuman cambuk dapat dianggap sebagai pidana badan. Namun, pidana badan tersebut harus dibedakan untuk membuat jera dan membuat malu. “Di Aceh, sepertinya hanya untuk membuat malu, bukan untuk membuat jera,” tutur Adi. Sementara pakar hukum pidana, M Din, dalam diskusi itu menyebutkan, dalam pidana apapun, semua pihak harus melihat dan tidak boleh melupakan filosofi pemidanaannya. “Bila cambuk sebagai alternatif dalam KUHP, itu harus dilihat dulu filosofi pemidanaannya. Kita lihat pidana penjara, itu awalnya di Eropa. Kenapa di Eropa awalnya penjara, karena kebebasan di sana sangat berharga awalnya,” ujar M Din. Pengelola diskusi FH Unsyiah, Sulaiman Tripa, menyebutkan, secara periodik pihaknya memfasilitasi diskusi yang menghadirkan isuisu mutakhir yang dilihat dalam perspektif masing-masing ilmu. (b04)

Bupati Dan DPRK Singkil Memanas SINGKIL (Waspada) : Hubungan kemitraan dua lembaga penentu di Kabupaten Aceh Singkil diisukan kembali retak. Bantuan Gubernur Aceh sebesar Rp5 miliar untuk daerah itu dinilai sebagai pemicu keretakan hubungan tersebut yang sampai saat ini terus memanas. Sekretaris Komisi A DPRK Aceh Singkil Frida Siska Sihombing, Selasa (12/2) membenarkan belum dicapai solusi terkait bantuan Gubernur Aceh sebesar Rp5 miliar sesuai dengan Pergub Nomor 91 Tahun 2012 Tanggal 19 Desember 2012. Sehingga memperlambat penyempurnaan APBK Aceh Singkil tahun 2013 sebagaimana hasil evaluasi yang telah disampaikan Gubernur Aceh berdasarkan SK Gubernur Aceh Nomor : 903-06 Tahun 2013 tentang hasil evaluasi Raqan APBK Aceh Singkil TA 2013 dan rancangan Perbup Aceh Singkil tentang penjabaran APBK Aceh Singkil TA 2013, tanggal 23 Januari 2013. Menurut politisi wanita dari PKB itu , belum tercapainya penyempurnaan APBK tahun 2013 karena Bupati Safriadi bersikukuh bantuan tersebut sebagai bantuan banjir, padahal sesuai pergub dana Rp5 miliar merupakan bantuan keuangan Pemerintah Aceh kepada pemerintah kabupaten/kota yang peruntukan secara umum dan harus dibahas secara bersama antara eksekutif dan legislative. “Kalau benar itu bantuan banjir seharusnya

bupati memprogramkan untuk enam kecamatan sesuai proposal yang diajukan, bukan hanya untuk satu Kecamatan. apa mungkin hanya Rp5 miliar mampu mengatasi banjir di Singkil,” kata Ketua Fraksi Reformasi itu. Frida Siska mengaku sudah mendapat surat dari Dinas Keuangan Provinsi Aceh agar bisa disepakati dan sampai batas waktu hingga 30 Maret 2013 juga belum tuntas secara otomatis akan dilakukan pembatalan oleh gubernur sekaligus menyatakan berlakunya pagu APBK tahun 2012 . Begitupun Siska membantah kalau diberlakukan pagu 2012 tidak ada proyek fisik, sebab, menurutnya, ada sebesar Rp58 miliar yang sudah disepakati kalau proyek tetap ada hanya saja Silpa untuk tahun 2014 akan membengkak. Sekda Aceh Singkil M Yakub KS yang juga Ketua TAPK Aceh Singkil membenarkan bantuan Rp5 miliar dari Gubernur Aceh sebagai bantuan keuangan provinsi kepada pemerintah kabupaten/kota, namun dana tersebut akan diperuntukkan untuk penanggulangan banjir sesuai proposal Bupati Aceh Singkil kepada Gubernur Aceh. Ketua DPRK Aceh Singkil Putra Ariyanto yang dikonfirmasi terpisah mengatakan sedang membahas dana Rp5 miliar bersama dengan TAPK. (cdin)

Sepuluh Rumah Di Perlak Terbakar BLANGKEJEREN (Waspada) : Terhitung sejak kemarin, kebakaran melanda Gayo Lues, kali ini tepatnya di Desa Perlak, Kecamatan Tripe Jaya, telah menghanguskan 10 pintu rumah di desa itu. Selasa (12/2) sekira pukul 12:30. Sementara, sebanyak 12 kepala keluarga penghuni rumah korban kebakaran saat ini telah ditampung di rumah keluarga dan menumpang pada rumah tetangga. Pantauan wartawan, sebanyak 10 unit rumah beratap seng dan berkonstruksi papan itu musnah dan rata dengan tanah. Korban kebakaran, Aman Samsul, 45, menjelaskan, saat kebakaran, dia sedang berada di kebun, dia baru tahu rumahnya terbakar setelah ditelepon tetangganya. Korban lainnya, Mardi, mengatakan sebagian besar rumahnya musnah terbakar karena api menjalar sangat cepat. Pemkab Gayo Lues melalui Bupati Ibnu Hasim, ketika mengetahui kabar itu, langsung melibatkan dinas terkait seperti Dinas Sosial, BPBD, untuk terjun ke lapangan serta akan menyiapkan bantuan. Bupati Gayo Lues Ibnu Hasim menyatakan kebakaran ini merupakan cobaan dari Allah

SWT. Karena itu, para korban diharapkan bersabar. Karena itu, kata bupati, baru semalam tepatnya, Senin (11/2) pada jam dan tempat yang berbeda telah menghanguskan lima rumah, di Desa Bener, Kec, Blangpegayon dan kebakaran kedua di Desa Cinta Maju, Kec. Blangpegayon yang menghanguskan satu unit rumah milik A Wahab. Sementara itu empat kepala keluarga korban kebakaran di Desa Cinta Maju, Kecamatan Blangpegayon, menerima bantuan tanggap darurat dari Pemkab Gayo Lues. “Bantuan tersebut berupa sembako, dan keperluan lainnya,” tutur Asisten III Setdakab Gayo Lues Nya’Mat, yang menyerahkan bantuan mewakili Bupati Gayo Lues, berupa uang senilai Rp2 jt kepada masing-masing KK, beras 27 karung, mi instan 8 kardus, kain arung 74 potong. Sajadah 16 potong, kerudung 8 buah, seragam SD dua lusin, baju kaus berkerah 24 buah, lampu emergenci 4 buah. Selanjutnya bantuan dari PKK Gayo Lues, memberikan ban-tuan uang senilai Rp500 ribu dan satu karung beras masing-masing KK. (cjs)

Wabup Agara Serahkan Bantuan Untuk Korban Kebakaran KUTACANE (Waspada) : Wakil Bupati Aceh Tenggara Ali Basrah, bersama Ketua DPRK Agara Salim Fakhri, Selasa (12/2) memberikan bantuan kepada 19 kepala keluarga korban kebakaran di Kecamatan Lawe Sigala-gala dan Semadam. Penyerahan bantuan dihadiri Camat Semadam Amri, bersama unsur muspika, bantuan korban kebakaran di Semadam sejumlah

12 rumah diberi bantuan sejumlah Rp 55 juta, diserahkan Ali Basrah dan Salim Fakhri. Di Lawe Sigala, bantuan kebakaran kepada warga korban kebakaran, diserahkan di aula kantor camat disalurkan sebesar Rp30 juta.Wakil Bupati Agara Ali Basrah menyampaikan bantuan ini merupakan kepedulian pemerintah daerah Agara bagi rakyatnya. (b25)

Pemkab Simeulue Canangkan Hari Menanam SIMEULUE (Waspada): Pemerintah Kabupaten Simeulue, Selasa (12/2) mencanangkan penanaman pohon di pinggir Pantai Desa Busung, Kecamatan Simeulue Timur. Bupati menyebutkan, untuk mendapatkan daerah yang hijau diharapkan masyarakat turut serta melakukan penanam program 1 miliar pohon yang telah dicanangkan Pemerintah Indonesia secara nasional oleh Presiden SBY.

Bupati juga mengatakan, sasaran utama penanam pohon ini untuk menopang peran hutan lindung, hutan konservasi, dan hutan produksi yang menipis. Kadis Perkebunan dan Kehutanan Simeulue Ibnu Abbas yang menjadi ketua panitia acara mengatakan, acara itu adalah lanjutan dari program nasional yang sudah dicanangkan pemerintah pusat beberapa tahun lalu. (cb08)



WASPADA Rabu 13 Februari 2013

25 Kios Di Perbatasan Aceh-Sumut Telantar

Warga Masih Keluhkan Banjir Genangi Sawah Dan Perkebunan LANGSA (Waspada): Menyusul lambannya realisasi pengerukan parit induk yang ada di Gampong Paya Bili Satu hingga tembus ke Gampong Merbo Dua serta Alur Gadeng Gampong, Kecamatan Birem Bayeun dari Pemerintah Aceh Timur, membuat resah warga setempat dikarenakan luapan air dari parit tersebut membanjiri areal persawahan dan perkebunan pada saat hujan turun. Sebagaimana diketahui sebelumnya luapan air yang mengenangi areal persawahan dan perkebunan warga tersebut dikarenakan debit air yang turun dari Gampong Paya Bili Dua sangat deras, pasalnya parit induk di Gampong ini telah dilakukan pengerukan Desember 2012 lalu. Sementara itu, parit induk Paya Bili Dua merupakan sambungan langsung dengan parit induk di Paya Bili Satu hingga Merbo Dua yang sama sekali belum dilakukan pengerukan sehingga menyebabkan air meluap keareal persawahan dan perkebunan milik masyarakat. Bahkan, hasil pertanian di tiga gampong tahun ini terancam gagal panen. Keuchik Merbo Dua Hasbi, Senin (11/2) di Langsa menyebutkan, dirinya mengkhawatirkan apabila terlalu lalu dilakukan pengerukan parit di tiga gampong tersebut maka akan berdampak pada perekonomian warga, dikarenakan tidak bisa memanen hasil pertanian serta kebun mereka. Bahkan, ia sudah pernah mengusulkan ke kecamatan setempat untuk dilakukannya pengerukan parit induk tersebut,namun hingga saat belum terealisir. Hasbi sangat mengharapkan kepada Pemerintah Aceh Timur melalui instansi terkait agar dapat turun ke lapangan untuk melihat bagaimana kondisi yang dialami masyarakat di Gampong ini akibat luapan air dari parit induk. “Kita berharap juga parit itu segera dilakukan pengerukan,” pintanya lagi. Camat Birem Bayeun, Murdhani yang ditemui wartawan pada hari yang sama di ruang mengatakan, pihaknya saat ini telah keluhan yang disampaikan masyarakat dari Paya Bili Satu dan Merbo Dua. “Untuk pengerukan parit induk ini kita menunggu pengesahan APBK Aceh Timur tahun 2013,” sebutnya. Lanjutnya lagi, pengerukan parit induk akan dilakukan melalui program lanjutan 100 hari Bupati Aceh Timur Hasballah M.Thaib yang kemungkinan besar akan dilaksanakan dalam dua bulan ke depan ini. (m43)

Resam Gampong Dan Imbauan Muspida Atim Tak Berlaku Di Simpang Jernih LANGSA (Waspada):Warga Simpang Jernih, Kab. Aceh Timur mengeluhkan pertunjukan pesta keyboard yang terjadi barubaru ini yang terjadi di depan Kapolsek Simpang Jernih hingga pukul 04:00. Pasalnya, pertunjukan itu telah melanggar resam gampong dan imbauan yang dikeluarkan muspida berdasarkan hasil musyawarah ulama se Kab. Aceh Timur. Hal itu dikemukakan salah seorang warga Simpang Jernih bersama tokoh adat setempat, Senin (11/2). Menurutnya, warga Simpang Jernih, mengeluhkan supaya kegiatan-kegiatan seperti ini dapat dihentikan, selain meresahkan warga disinyalir akan berdampak kepada hal-hal yang negatif, seperti mabuk-mabukan dan kegiatan asusila. “Jika kegiatan ini terus berlangsung dikhawatirkan Simpang Jernih ini bakal menjadi daerah bebas,” katanya. Anehnya, terangnya lagi, aparat kepolisian setempat tidak mampu menghentikan kegiatan seperti yang terjadi pada Rabu malam yang digelar di depan kantor Polsek hingga pukul 04:00. “Yang menjadi persoalan bukan pertunjukannya, tapi banyak aktivitas lain warga yang melakukan hal-hal negatif,” pungkasnya. Apalagi, Muspida berdasarkan hasil musyawarah ulama se Kab. Aceh Timur tanggal 20 Septeber 2012 bersama tokoh ulama mengimbau seluruh masyarakat yang di bawah wilayah Kab. Aceh Timur menyatakan, setiap orang yang melakukan kegiatan kesenian atau hiburan diwajibkan menutup aurat yang mukhalaf dan permainnya tidak bertentangan dengan syariat Islam, harus menutup aurat. Selain itu, kesenian dan hiburan yang bertentangan dengan syariat, tidak dibolehkan dilaksanakan.(m43)

Tahun 2013, Dinkes Langsa Tidak Tambah Bidan PTT LANGSA (Waspada): Menyusul kuota untuk saat ini sudah memadai, maka Dinas Kesehatan Kota Langsa pada tahun 2013 tidak melakukan rekrutmen Bidan Pegawai Tidak Tetap (BidesPTT). Hal itu disampaikan Sekretaris Dinas Kesehatan Kota Langsa Drs Muhammad, MM, Selasa (12/2). “Saat ini Bidan Desa di Kota Langsa sudah ada 79 orang yang ditempatkan di 66 gampong yang ada di wilayah Langsa,” ujarnya. Ditegaskannya, di mana untuk bides yang kini telah ditempatkan di gampong-gampong agar dapat berdomisili di gampong tersebut dalam upaya mengoptimalkan pelayanan kesehatan yang dibutuhkan oleh masyarakat ditempat Bides ditugaskan. Disinggung, menyusul gaji bides untuk bulan Juli dan Desember 2012 yang belum dibayarkan, Muhammad membenarkan hal tersebut dan seraya menjelaskan, gaji Juli menurut keterangan bendahara kepada dirinya sudah dibayarkan dan sudah masuk langsung ke rekening para bides. Sementara gaji untuk Desember 2012 saat ini masih dalam proses, hal ini bisa terjadi kemungkinan karena proses pengangkatan bides PTT secara bergelombang dan gaji nya dihitung TMT. “Ya, mungkin saat itu adanya keterlambatan proses pengusulan gaji Bides ke Kementrian Kesehatan RI,” terang Muhammad. Dalam kesempatan itu, Muhammad juga menyampaikan, di mana Dinkes Kota Langsa mengupayakan untuk ke depannya para Bides tersebut bisa mendapat insentif tambahan selain dari gaji mereka terima saat ini yaitu lebih kurang sebesar Rp1.400.000. (m43)

Dibangun Pakai Uang Negara Rp2 M Lebih KUALASIMPANG ( Waspada ): Sebanyak 25 pintu kios permanen dan satu buah mushala yang berlokasi dekat pintu gerbang perbatasan Provinsi Aceh –Sumatera Utara, di Desa Seumadam, Kecamatan Kejuruan Muda, Kabupaten Aceh Tamiang yang dibangun mencapai Rp2 miliar lebih pada tahun anggaran 2011 dan tahun anggaran 2012 dengan sumber dana Otsus masih telantar. Menurut pantauan Waspada, Senin (11/ 2), meskipun sudah selesai pelaksanaan pembangunannya, namun kios dan mushala belum juga digunakan oleh para pedagang. Sejumlah pintu kios sudah banyak yang hilang dijarah karena di lokasi belum ada pedagang yang berjualan. Kadis Koperasi, Perindustrian dan Perdagangan ( Koperindag) Kabupaten Aceh Tamiang, A.Muin ketika dikonfirmasi Waspada, Senin (11/2) menyatakan, pelaksanaan pembangunannya menggunakan dana Otsus dan pembangunannya juga dilaksanakan dua tahap. Pada tahap pertama , rinci A.Muin, menggunakan dana otsus Tahun Anggaran 2011 sebesar Rp1.151.437.000,- dibangun sebanyak 15 pintu kios dan pada tahap kedua juga menggu-

nakan dana Otsus tahun anggaran 2012 senilai Rp1.358.326.400,- untuk pembangunan sebanyak 10 pintu kios dan dilengkapi dengan mushala di lokasi itu. Menurut Muin, semua kios-kios yang ada di lokasi itu sudah ada pedagang yang akan menyewa, namun sampai saat ini belum diketahui apa alasan sehingga belum juga berjualant. “ Padahal kita sudah memberikan kemudahan bagi pedagang untuk berjualan terlebih dahulu di kios –kios itu, sedangkan sewanya nanti kita selesaikan, tetapi tanpa ada alasan yang jelas entah mengapa sampai saat ini mereka belum juga menempati,” ujar Muin. Kadis Koperindag itu juga menyatakan, para pedagang sebelumnya berdasarkan hasil rapat koordinasi antara pedagang, Koperindag dan Camat Kejuruan Muda menyatakan ingin menyewa dan berjualan di lokasi itu . “ Jika mereka tidak mau menempati dan berjualan di kios itu dalam waktu dekat pihak Koperindag akan memberikan kesempatan kepada pihak lain untuk menyewa dan berjualan di kios itu,” pungkas Muin seraya menambahkan saat ini saja sudah ada pintu belakang kios di lokasi itu yang digondol maling. (b23)


12 DARI 20 ton illegal logging yang berhasil diangkat dari DAS Tamiang hasil temuan Pamhut Aceh Timur kini diamankan di depan Gedung Dishutbun Aceh Timur. Sementara 8 ton diamankan di Kantor Dishutbun Aceh Timur yang lama di Langsa. Foto direkam Selasa (12/2).

100 Ton Kayu Sulit Diangkat Dari DAS Dishutbun Bakal Lelang 24 Ton ACEH TIMUR (Waspada): Sebanyak 100 ton illegal logging yang ditemukan Pengamanan Hutan (Pamhut) Sabtu (9/2) lalu di daerah aliran sungai (DAS) Kabupaten Aceh Tamiang, Provinsi Aceh sulit diangkat. Sementara 24 ton yang sudah disita dari tiga titik temuan dalam waktu dekat segera dilelang. “Masih ada sekitar 30 Radup atau lebih kurang 100 ton kayu hasil rambahan dikawasan hutan produksi masih berada di sungai Aceh Tamiang. Tapi sekitar 20 ton sudah kita angkut sebagai barang bukti hasil gerilya Pamhut,” kata Kepala Dinas Kehutanan dan Perkebunan Kab. Aceh Timur, Ir Saifuddin, M.AP melalui Kasat Pamhut, Agus Irfan kepada Waspada Selasa (12/2) di Idi. Menurut dia, temuan kayu dalam skala besar kali ini berkat kerjasama Pamhut dengan masyarakat khususnya yang berada

dipinggiran sungai, sehingga aksi penyelundupan kayu hasil rambahan di kawasan Simpang Jernih (Aceh Timur) ke Kuala Simpang (Aceh Tamiang) bisa digagalkan petugas Pamhut yang sedang bergerilya sejak beberapa pekan terakhir. Gerilya yang dilakukan petugas dilapangan dengan menelusuri beberapa titik sungai yang dicurigai kerap terjadi penyelundupan illegal logging. Agus Irfan menambahkan, 100 ton illegal logging yang sulit ditarik dan membutuhkan dana operasional besar berada di DAS Aceh Tamiang di dalam Desa Babo, Desa Sunting dan Desa Mangklang, Kecamatan Bandar Pusaka. “Berdasarkan amatan kita, kayu yang ditemukan kali ini meliputi kelompok Merante dan kelompok Rimba Campuran,” sebut Agus Irfan seraya menambahkan, diperkirakan 120 ton illegal logging itu hendak diolah dikawasan industri Kota Lintang, Kuala Simpang oleh pemilik kayu. 24 Ton Segera Disita Sementara jumlah kayu

Waspada/Muhammad Hanafiyah

yang disita Pamhut Aceh Timur kini berjumlah 24 ton yang ditemukan pada tiga titik yang berbeda yakni 3 ton di Sijuek, Kecamatan Pante Bidari dan 1 ton di Peureulak akhir Januari 2013 lalu serta 20 ton di daerah aliran sungai (DAS) Simpang Jernih yang hendak dialirkan ke sungai Aceh Tamiang, Sabtu (9/2). Sisa di DAS Tamiang sebanyak 100 hingga kini masih dibiarkan di sungai, karena sulit untuk diangkat dari DAS. Agus Irfan mengakui di pedalaman Aceh masih rawan penebangan hutan oleh pihakpihak yang tak bertanggungjawab. “Namun dia tetap mengharapkan kesadaran semua pihak khusus masyarakat yang berdomisili di kawasan hutan sama-sama menjaga dan melestarikan hutan,” katanya seraya menandaskan, perlu diketahui, kerusakan hutan akan menimbulkan bencana seperti banjir bandang sebagaimana terjadi tahun 2006 lalu dan tanah longsor sebagaimana kerap terjadi di lintasan utama Peureulak - Lokop. (b24)

25 KIOS permanen dan satu unit mushala yang dibangun menggunakan uang negara miliaran rupiah terkesan mubazir karena tidak ada pedagang yang membuka usaha di kios yang berlokasi tidak jauh dari pintu gerbang perbatasan Aceh-Sumatera Utara di Desa Seumadam,Kecamatan Kejuruan Muda,Kabupaten Aceh Tamiang. Foto direkam, Senin (11/2).

Pelajar Se Kota Langsa Dilatih Amati Transaksi Narkoba LANGSA (Waspada): Sebanyak 52 pelajar SMA dan SMK di Kota Langsa dilatih simulasi untuk bagaimana mengamati transaksi narkoba dan teknik melaporkan kepada Badan Narkotika Nasional (BNN) Kota Langsa dan pihak berwajibbaiklisanmaupuntulisanyangdilaksanakan di Aula Sanggar Kegiatan Belajar (SKB) AcehTimur di Kota Langsa, Selasa-Rabu (12-13/2). 52 Pelajar itu berasal dari 7 sekolah yakni, SMAN 1 Langsa, SMAN 2 Langsa, SMAN 3 Langsa, SMAN 4 Langsa, SMKN 2 Langsa dan SMK Cut Nyak Dien. Sedangkan pemateri yakni Ir Zulkifli Ali, SPdI dengan materi ‘Cegah Narkoba Langsa’, Saifullah, SH. MM. MH ‘Narkotika dan Permasalahannya’, Cut Maria, S.Sos ‘Pembentukan Karakter’, Ipda M Lumbantoruan ‘Interpersonal Skill (IPS)’, Briptu Rudi Suwito ‘Focus Group Discussion’ dan Rozeihan Fadil, SE dengan materi ‘The Best Agent’. Ipda M Lumbantoruan selaku pemateri Interpersonal Skill (IPS) mengatakan, meteri ini menjadikan seorang pelajar menggeluti profesi agent informan yang tangguh dengan pem-

WH Bentrok Dengan Anak Jalanan LANGSA (Waspada): Sekira sepuluh anak jalanan di kawasan Lapangan Merdeka Kota Langsa depan eks kantor Bupati Aceh Timur, Senin, (11/2) malam sekira pukul 22:30 membuat onar dan menyerang WH. Pasalnya, ketika polisi Wilayatul Hisbah (WH) sedang melakukan patroli rutin di kawasan itu, anak punk itu diduga sedang mabuk, bernyanyi-nyanyi, berjoget-joget dengan pakaian yang super seksi. Ketika ditegurWH mereka tidak terima dengan nasihat itu dan lantas memaki-makiWH dengan katakata kotor. Mengetahui itu, Kepala Dinas Syariat Islam, Drs H Ibrahim Latif, MM memerintah-

kan polisi WH untuk mengamankan anak-anak jalanan itu untuk dibawa ke markas Syariat Islam, namun anak jalanan yang laki-laki berjumlah delapan orang melakukan perlawanan. Sementara yang perempuan dua orang lagi dilarikan menggunakan sepedamotor oleh orang lain yang tidak dikenal. Ibrahim Latif mengatakan, anak-anak jalanan itu menyerangWH, sementara anak-anak jalanan yang ada di situ juga turut menyorak-nyorakiWH. ‘’Akhirnya, berkat bantuan masyarakat yang pro ke WH, anakanak jalanan itu dapat kita pukul mundur, namun tidak dapat kita tangkap, mereka melarikan diri. Kemudian WH terus me-

nguber mereka, namun tidak berhasil kita tangkap,’’ katanya. Menurut Ibrahim, kelakuan anak-anak punk sudah sangat keterlaluan, sikap dan pergaulan mereka sudah merusak tatanan kehidupan anak-anak Aceh yang lain. Sebelumnya mereka telah kita antar ke kampungnya masing-masing, tetapi kini mereka muncul lagi Langsa, seperti ada yang mengorganisirnya. “Kita terus menertibkan mereka, agar mereka dapat hengkang dari Langsa. Dalam waktu dekat kita akan mengkoordinasi dengan pihak-pihak terkait untuk menertibkan habis anak-anak punk ini,” demikian Ibrahim. (m43)

bekalan komunikasi yang kuat dan tangguh dalam melihat transaksi narkoba di lingkungan pelajar berada baik di lingkungan sekolah maupun di lingkungan tempat tinggal siswa tersebut. Kepala BNN Kota Langsa Kompol Navri Yulenny, SH. MH mengharapkan kegiatan ini dapat membentuk karakter pelajar SMA dan sekaligus menanamkan ke pikiran mereka agar menjadi agent of change (agen perubahan-red) di kelompok pelajar sehingga menjadi lebih terfokus. Makanya kita sajikan pemateri dengan spesialisasi yang nantinya setelah pelajar selesai mengikuti pengkaderan ini mereka ke depan bisa menjelaskan, melakukan, menjalankan tugasnya selaku Agen of Change. “Sehingga melalui materi ini pelajar bisa mengamati saat melihat transaksi narkoba di lingkungan sekolah dan lingkungan gampongnya. Ini merupakan tolok ukur kita agar Indonesia Bebas Narkoba di tahun 2015 dan Masa Depan Aceh lebih berprestasi lagi tanpa narkoba dengan kata lain semua element pelajar akan berperang melawan narkoba,” kata Navri. (m43)


SIMULASI Interpersonal Skill (IPS) yang disampaikan pemateri Ipda M Lumbantoruan kepada pelajar SMA/SMK tentang simulasi untuk bagaimana mengamati transaksi narkoba dan teknik melaporkan kepada Badan Narkotika Nasional (BNN) Kota Langsa, Selasa-Rabu (12-13/2).

Proyek “Kongkalikong” Di Aceh Tamiang Semakin Terkuak KUALASIMPANG ( Waspada): Proyek yang diduga bernuansa “kongkalikong” antara sejumlah oknum anggota DPRK Aceh Tamiang dengan Dinas Kelautan dan Perikanan Kabupaten Aceh Tamiang yang menggunakan sumber dana APBK Tahun Anggaran (TA) 2012 semakin terkuak. Sejumlah nama anggota dewan yang “bermain mata” dalam program pemberian bantuan bibit ikan,pakan ikan dan peralatan lainnya. Informasi yang dihimpun Waspada,Senin (11/2) mengungkapkan, hal itu bisa terjadi disinyalir ada “kongkalikong” antara oknum di SKPK dengan oknum anggota dewan setempat ketika proposal permohonan bantuan diserahkan ke Dinas Kelautan dan Perikanan Kabupaten Aceh Tamiang. Walaupun proposal yang diajukan tidak sesuai dengan Permendagri No 32 Tahun 2011 dan Permendagri No 39 tahun 2012 Tentang bantuan hibah dan bantuan sosial serta bertentangan dengan SK Bupati Aceh Tamiang Nomor 353 Tahun 2012 Tentang Pengesahan nama kelompok tani//nelayan se Aceh Tamiang, namun proposal

yang “direstui” atau digiring oleh oknum anggota dewan setempat wajib hukumnya diberikan bantuan oleh dinas itu. Sumber Waspada menyatakan , adapun sejumlah anggota DPRK Aceh Tamiang yang diduga bermain “mata” menitipkan proyeknya di Dinas Kelautan dan Perikanan Kab.Aceh Tamiang yaitu : Mar yang diduga menitipkan anggaran dana reses /aspirasi senilai Rp64 juta, Us paling banyak menitipkan menitipkan dana sebesar Rp154 juta, Her titip dana Rp50 juta dan Is, anggota dewan yang paling sedikit menitipkan dana senilai Rp35 juta. Dana titipan oknum anggota dewan yang bernitial Mar senilai Rp64 juta digunakan untuk bantuan benih ikan lele 6.574 ekor,benih ikan bawal 4.574 ekor dan bantuan pakan starter 18 kg, Grower 43 kg dan finisher 60 kg yang diberikan kepada Kelompok Niat Bersama di Kampung Selamat, KecamatanTenggulun yang diterima Endang (Ketua Kelompok). Kelompok ini tidak ada masuk dalam Keputusan Bupati Aceh Tamiang Nomor 353 Tahun 2012. Selanjutnya dari dana itu

juga untuk pengadaan bantuan bibit ikan lele 6.571 ekor,bibit ikan bawal 4.571 ekor,pakan starter 17 kg,grower 43 kg,finisher 71 kg yang diterima Kelompok Mudah Subur,Desa Alur Tani Dua, Kecamatan Tamiang Hulu yang diketuai Iskandar. Kelompok ini juga tidak masuk dalam SK Bupati Aceh Tamiang Nomor 353 Tahun 2012. Seterusnya dari jumlah dana itu juga untuk pengadaan bantuan bibit ikan lele 6.571 ekor, bibit ikan bawal 4.571 ekor, pakan starter 17 kg,grower 43 kg, finisher 71 kg yang diterima Kelompok Gunung Jaya, Desa Tenggulun,Kecamatan Tenggulun yang diterima oleh Rohinsu ( Ketua Kelompok). Kelompok ini memang sudah resmi terdaftar pada SK Bupati Aceh Tamiang . Selain itu dari dana itu juga untuk pengadaan bibit ikan kepada kelompok lainnya yang memang sudah resmi terdaftar pada SK Bupati Aceh Tamiang Nomor 353 Tahun 2012 yang ada menerima bantuan benih ikan lele, ikan bawal dan pakan yang masing-masing jumlahnya 6.571 ekor benih lele,ikan bawal 4.571 ekor, pakan starter

17 kg, grower 43 kg dan finisher 58 kg yaitu Kelompok Sido Muncul,Desa Alur Sele-bu, Kecamatan Kejuruan Muda, ( Ketua, Yusen). Kelompok Mentawak Sejahtera, Desa Seumadam,Kecamatan Kejuruan Muda, Ketua Kelompok Agus, Kelompok Sejahtera Dua, Kampung Selamat ,Kecamatan Tenggulun, Ketua Kelompok, Boimin.Kelompok Darma Sentosa,Desa Alur Selebu, Kecamatan Kejuruan Muda, Ketua Kelompok, Noor Abdi menerima bantuan benih ikan lele 6.571 ekor, ikan bawal 4.571 ekor,pakan starter 17 kg, grower 43 kg dan finisher 58 kg. Sedangkan oknum anggota dewan yang berinisial Us menitipkan dana yang dikalim miliknya sebesar Rp154 juta untuk pengadaan bantuan benih ikan lele 11.100 ekor, benih ikan nila 4.750 ekor, benih ikan bawal 1.644 ekor , Hava Pendeder 1 unit, pakan starter 167 kg,grower 278 kg dan finisher 500 kg untuk Kelompok Subur Jaya,Desa Alur Tani Dua, Kecamatan Tamiang Hulu,Yunus ( Ketua Kelompok), Kelompok ini juga tidak ada dalam SK Bupati Aceh Tamiang. Bantuan benih ikan lele 11.000

ekor, benih ikan nila 4.750 ekor, benih ikan bawal 1.644 ekor, bantuan Hava Pendeder 1 unit, pakan starter 167 kg, grower 278 kg, finisher 500 kg untuk Kelompok Mandiri Sejahtera, Desa Kaloy,Kecamatan Tamiang Hulu yang diterima Ersanto (Ketua), kelompok ini juga tidak terdaftar pada SK Bupati Aceh Tamiang. Kemudian dari jumlah dana itu juga untuk pengadaan bibit ikan dan pakan bagi kelompok Berkah I ,DesaWono Sari, Kecamatan Tamiang Hulu, Penerima bantuan Misfan ( Ketua Kelompok). Kelompok ini juga tidak ada namanya di dalam SK Bupati Aceh Tamiang. Bantuan benih ikan lele 11.000 ekor, benih ikan nila 4.750 ekor, ikan bawal 1.644 ekor, bantuan Hava 1 unit, pakan starter 167 kg, grower 278 kg, finisher 500 kg untuk Kelompok Sumber Jaya , Desa Blang Kandis, Kecamatan Bandar Pusaka, diterima Roman Saputra ( Ketua Kelompok),kelompok ini juga tidak terdaftar pada SK Bupati Aceh Tamiang. Dari dana yang dititipkan di dinas itu juga untuk pengadaan bantuan benih dan hava serta pakan starter, grower dan finisher dalam jumlah yang sama

seperti kelompok tersebut diatas juga diterima Kelompok Tani Jaya, Desa Bandar Khalifah ( Ketua Kelompok,Selamat HR). Kelompok ini juga namanya tidak ada dalam SK Bupati Aceh Tamiang itu. Bantuan yang sama juga jumlahnya diterima oleh Kelompok Berkah II, DesaWono Sari, Kecamatan Tamiang Hulu diterima oleh M.Ruslan (Ketua Kelompok) dan Kelom-pok ini juga tidak terdaftar pada SK Bupati Aceh Tamiang itu. Sedangkan anggota dewan yang berinisial Her, menitipkan dana sebesar Rp50 juta untuk pengadaan benih ikan dan pakan kepada kelompok Sepakat di Desa Telaga Meuku II,Kecamatan Banda Mulia dan kepada kelompok “Sinar Tambak” di Desa Bandar Khalifah, Kecamatan Bendahara.Kedua kelompok ini juga tidak terdaftar pada SK Bupati Aceh Tamiang itu. Sementara itu anggota dewan yang berinitial Is hanya menitipkan dana di dinas itu senilai Rp 35 juta untuk bantuan bib--it ikan kerapu 5.725 ekor, pakan ikan starter 75 kg, grower 100 kg, finisher 125 kg,kapur 250

kg, saponin 50 kg dan pupuk NPK 250 kg yang diterima Bukhari, Ketua Kelompok Tunas Muda, Desa Tanjung Neraca,Kecamatan manyak Payed. Kelompok ini juga tidak ada tercantum namanya di SK Bupati Aceh Tamiang tentang nama kelompok nelayan di Desa Tanjung Neraca. Informasi dari sumber, walaupun proposal yang diajukan tidak sesuai dengan Permendagri No 32 Tahun 2011 dan Permendagri No 39 tahun 2012 tentang bantuan hibah dan bantuan sosial serta bertentangan dengan SK Bupati Aceh Tamiang Nomor 353 Tahun 2012 tentang pengesahan nama kelompok tani/nelayan se Aceh Tamiang, namun proposal yang “direstui” atau digiring oknum anggota dewan setempat wajib hukumnya diberikan bantuan kepada “kelompok siluman” atau kelompok dadakan oleh dinas itu. Tetapi ada juga bantuan yang diberikan sudah sesuai dengan Permendagri dan ada juga yang sudah sesuai dengan SK Bupati Aceh Tamiang itu. Kepala Dinas Kelautan dan Perikanan Kabupaten Aceh Ta-

miang, Asmai ketika dikonfirmasi Waspada di ruang kerjanya, Senin (11/2), mengakui pihaknya bekerjasama dengan sejumlah anggota DPRK Aceh Tamiang itu dalam hal pemberian bantuan kepada kelompok yang menerima bantuan. “ Semua bantuan tersebut sudah kami salurkan kepada kelompok penerima bantuan dan memang ada juga yang sudah sesuai dengan Permendagri itu dan ada juga yang sudah sesuai dengan SK Bupati Aceh Tamiang, namun ada juga terjadi kesalahan admintrasi yang tidak sesuai dengan Permendagri dan SK Bupati Aceh Tamiang ,” tegas Asmai . Asmain mengakui program akhirnya benar-benar sangat memusingkan petugas di Dinas Kelautan dan Perikanan Aceh Tamiang, sebab sangat banyak proposal yang masuk, sedangkan jumlah bantuan yang disalurkan tidak sebanyak proposal yang masuk ke Dinas ini. “ Bantuan kami salurkan kepada kelompok yang telah ditunjuk oleh anggota dewan,” terang Asmai. (b23)

Waspada, Rabu 13 Februari 2013