Page 1

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

RABU, Pon, 3 Juli 2013/24 Sya’ban 1434 H


FOTO atas, bocah yang menjadi korban gempa. Bawah, permukaan jalan aspal di kawasan Asir-Asir retak.

No: 24272 Tahun Ke-67

Waspada/Irwandi MN

SEORANG anak terluka kepalanya tertimpa reruntuhan bangunan dan dilarikan orangtuanya.

Terbit 24 Halaman

Waspada/Irwandi MN

FOTO atas, bocah yang menjadi korban gempa saat gempa berlangsung di Paya Tumpi Takengen, Aceh Tengah, Selasa (2/7). Bawah, reruntuhan bangunan

Gempa Guncang Aceh

Medan Juga Goyang 7 Tewas, Puluhan Anak Tertimbun Bangunan MEDAN (Waspada) : Gempa yang mengguncang Kota Medan Selasa(2/7) pukul 14:37, berpusat di 4.70 LU96.61BT di darat sekitar 35 Km Barat Daya Kab. Bener Meriah atau 28 Km Barat Laut dari Kota Takengen Provinsi Aceh. Kedalaman gempa sekitar 10 Km di permukaan bumi dan tidak berpotensi tsunami Staf Pelayanan Jasa BBMKG Wilayah I Retno Agung mengatakan, kekuatan gempa dirasakan 2-4 MMI di Kota

Banda Aceh, Lhokseumawe, dan Takengen. Sedangkan gempa yang dirasakan di Kota Medan sekitar 2-3 MMI. Retno menambahkan, gempa terjadi oleh aktivitas tektonik dari Sistem Sesar Sumatera yang bergerak secara horizontal atau bergeser yang terjadi di dalam tanah sehingga menimbulkan efek guncangan yang disebut gempa tektonik.

Lanjut ke hal A2 kol. 6

TAKENGEN (Waspada): Gempa berkekuatan 6,2 Skala Richter (SR) mengguncang wilayah Gayo, Aceh Tengah dan Bener Meriah, Provinsi Aceh, Selasa (2/7), sekira pukul 14:37:03. Pusat gempa berada di 4.70 LU,96.61 BT.35 km Barat Daya Bener Meriah, pada kedalaman 10 Km (data BMKG). Dalam peristiwa itu, tiga orang tewas dan puluhan orang lainnya tertimbun bangunan di kecamatan Ketol, Bener Meriah. Tiga korban adalah

Doni, 12, Yudha, 16 dan Kartiyem, 60, kata Indah dari Tenaga Kesejahteraan Sosial Kecamatan (TKSK) kepada Antara, Selasa. Ketiga korban sudah dimakamkan, sedangkan empat mayat lainnya sudah dievakuasi. Indah melanjutkan

bahwa 30 anak-anak yang sedang mengaji di masjid tertimbun reruntuhan. Sampai malam ini belum ada kabar tentang nasib mereka. Berita sebelumnya menyebutkan, ratusan bangunan ambruk, sejumlah ruas jalan retak dan ratusan warga terluka akibat tertimpa reruntuhan bangunan. Pantauan Waspada, saat gempa terjadi di Aceh Tengah, masyarakat berhamburan keluar rumah.

Sementara, di hadapan Waspada, dua orang balita tertimpa reruntuhan di bagian kepala. Teriakan histeris orang tua korban dan masyarakat membuat suasana mencekam. Ada yang terduduk, juga sebagian berlarian menjauh dari lokasi yang ditaksir membahayakan. “Tolong...tolong, tolongin anak saya pak. Anakku.. anakku. Bangun nak, sayang

Lanjut ke hal A2 kol. 3

Listrik Panas Tak Ada Jaminan Tak Padam Di Bulan Ramadhan MEDAN (Waspada): Rapat dengar pendapat (RDP) antara Komisi D DPRD Sumut dengan direksi PT PLN Sumut, Selasa (2/7), berlangsung panas. Pihak PLN tidak bisa menjamin listrik tidak padam pada bulan Ramadhan. Pihak PLN hanya bisa mengeluarkan pernyataan “berusaha semaksimal mungkin.” Hari itu, Komisi D DPRD

Sumut kembali mengundang jajaran direksi PT PLN Sumut untuk mempertanyakan kondisi kelistrikan yang sering padam. Rapat dipimpin Ketua Komisi D, Guntur Manurung. Sementara jajaran direksi PT PLN dihadiri GM PLN Wilay a h I S u m u t D i a n a n t o,

Lanjut ke hal A2 kol. 6

Oposisi Dan Aliansi Partai Islam Tolak Kudeta Militer

USU Sediakan 1.544 Kursi Jalur UMB-PTN

KAIRO, Mesir (AP): Koalisi oposisi utama Mesir dan aliansi partai Islam Mesir, Selasa (2/7) menyatakan tidak akan mendukung kudeta militer.Mereka percaya pernyataan militer, yang memberikan waktu 48 jam untuk menyelesaikan krisis, tidak berarti tentara akan memegang peran politik. Aliansi partai Islam, termasuk Ikhwanul Muslimin (IM), juga menolak pernyataan militer dan menyebut serangan terhadap keabsahan dengan cara yang mengarah kepada kudeta, demikian laporan

Pendaftaran Ditutup 19 Juli

stasiun televisi resmi Selasa. Dalam satu pernyataan yang ditayangkan televisi, aliansi tersebut menyatakan “kelompok itu menolak upaya oleh sebagian pihak untuk membalikkan keabsahan masyarakat”. Aliansi tersebut menghormati semua gagasan guna menyelesaikan krisis, tapi semua itu harus berlandaskan undang-undang dasar. Sementara itu, Kepresiden Mesir menyatakan penolakannya terhadap ultimatum yang dikeluarkan tentara, Senin dan

Lanjut ke hal A2 kol. 1

Tersangka Pembakaran Hutan Riau Bertambah Jadi 25 Orang JAKARTA (Waspada): Tersangka pembakaran hutan di Provinsi Riau bertambah menjadi 25 orang. 25 Tersangka yang terbagi dalam 17 kasus ditangani polisi, 6 tersangka di Polres Bengkalis, 2 tersangka di Polres Dumai, 11 tersangka di Polres Rokan Hilir, 3 tersangka di Polres Siak, 2 tersangka di Polres Pelalawan dan 1 tersangka di Dirkrimsus Polda Riau. “Ada satu orang yang ditangani Polda Riau, tinggal di sebuah perusahaan. Tapi apakah perusahaan itu terlibat, masih dalam pengembangan,” kata Kabid Proddok Div Humas

MEDAN (Waspada): Universitas Sumatera Utara (USU) menyediakan 1.544 kursi pada penerimaan calon mahasiswa baru tahun akademik 2013/ 2014, yang diseleksi melalui jalur Ujian Masuk Bersama Perguruan Tinggi Negeri (UMB-PTN). “Hingga tadi siang jumlah pendaftar yang melakukan registrasi online melalui web mencapai 944 orang,” kata Ketua Panitia Lokal (Panlok) USU, Prof Zulkifli Nasution men-

Polri, Kombes Hilman Thayib di Mabes Polri, Selasa (2/7). Para tersangka yang ditahan di Polres Bengkalis, dengan 6 kasus adalah Subari dan Hartono dengan modus pembakaran tanaman kelapa sawit dengan dampak luas kebakaran seluas 75 hektare lahan terbakar. Lalu di Polres Rohil, ada tiga kasus yang melibatkan tersangka bernama Hotman Purba, Katiman, Sukadi, Aswin, Rizal, Heriyadi Saputra, Eka Budi Arianto, Marlin Nasution, M o h a m m a d Ya s i r, d a n

Lanjut ke hal A2 kol. 5

Al Bayan

esabar baran Kesa bar an

Waspada/Amir Syarifuddin

GUBERNUR Sumatera Utara H Gatot Pujo Nugroho meninjau penyaluran BLSM di Kantor Pos Medan, Selasa (2/7).

Gubsu Tinjau Penyaluran BLSM Di Kantor Pos Medan MEDAN (Waspada): Gubsu H Gatot Pujo Nugroho meninjau penyaluran Bantuan Langsung Sementara Masyarakat (BLSM) di Kantor Pos Pusat Kota Medan, Selasa (2/7). Peninjauan tersebut untuk memastikan penyaluran BLSM yang merupakan milik rakyat miskin tidak mengalami kendala. Gubsu yang dalam peninjauan itu didampingi Kepala Dinas Kominfo Provinsi Sumut Jumsadi Damanik

disambut Herman selaku kepala Area Ritel Sumatera Utara dan Aceh PT Pos Indonesia beserta jajarannya. Gubsu menyaksikan para petugas pos sibuk melayani masyarakat penerima BLSM. Gubsu menyapa sejumlah warga yang antre menunggu dipanggil petugas. Sejumlah warga tampak antusias ketika mengetahui Gubsu berada di tengah-tengah mereka. Selain bersalaman atau minta berfoto bersama, warga

memanfaatkan momen tersebut untuk menyampaikan sejumlah kendala yang mereka hadapi dalam proses penyaluran BLSM. “Pak saya belum dapat, katanya belum terdaftar,” kata salah seorang warga. “Pak kalau nomer antreannya sudah lewat, apa bisa lagi mendapat kesempatan,” kata seorang ibu yang kebingungan karena nomor antreannya telah lewat. Gubsu mencoba meladeni

Anak Batubara Penderita Kelainan Jantung Butuh Rp40 Juta Di India

Oleh Tgk. H. Ameer Hamzah

LIMAPULUH (Waspada): Salsa Aqilah, gadis kecil berusia 10 tahun, penderita kelainan jantung, warga Dusun II , Desa Lubuk Hulu, Kec. Limapuluh, Kab. Batubara, yang difasilitasi satu yayasan untuk dioperasi di India, kini masih dalam perawatan di ruang ICU salah satu rumah sakit di negara tersebut. Muhammad Jamil, 40, orangtua Salsa Aqilah menuturkan kepada Waspada, Selasa (2/7), operasi Salsa telah berhasil dilakukan, “Atas keterangan dokter, Salsa Aqilah butuh sebuah alat yang disebut pacemaker (alat pacu jantung) yang

Hai orang-orang yang beriman, bersabarlah kamu dan kuatkan kesabaranmu, dan tetaplah bersiap siaga, dan bertakwalah kepada Allah SWT supaya kamu beruntung. (QS. Ali Imran:200) SALAH satu sifat yang utama bagi orang muslim adalah sabar. Sabar ialah hiasan hidup bagi yang mendapat cobaan seperti kehilangan kekuasaan, anggota keluarga meninggal dunia, kehilangan harta yang kita cintai, menderita kelaparan, ketakutan, dan lain-lain. Sabar terapi jiwa yang mampu mengusir godaan setan. Disebutkan dalam Atsar; Abubakar Siddiq Radhiallahu anhu pernah lapar berhari-hari, supaya perutnya jangan pedih beliau ganjal dengan batu di atas perutnya. Beberapa hari beliau tidak keluar rumah, kecuali waktu shalat jamaah. Rasulullah SAW datang menjenguknya.

Lanjut ke hal A2 kol. 3 SALSA Aqilah bersama kedua orangtuanya.


Lanjut Lanjut ke ke hal halA2 A2 kol. kol. 13

dan membantu warga satu per satu. Bahkan Gubsu tak sungkan menanyakan serta mengcross check kendala warga ke petugas Kantor Pos. “Ayo saya bantu ke petugas BLSM, “ ujar Gubsu kepada seorang ibu yang kebingungan. Usai peninjauan, Gubsu kepada wartawan menjelaskan sejauh ini proses penyerahan BLSM di Kantor Pos Medan berlangsung tertib dan

Lanjut ke hal A2 kol. 3

jawab Waspada, Selasa (2/7). Dia mengatakan jumlah tersebut terdiri dari kelompok IPA 491, IPS 391, dan IPC 62. Sedangkan jumlah peserta yang telah melakukan pembayaran biaya ujian di Bank BNI sebanyak 500 orang, dengan rincian 258 kelompok IPA, 212 IPS dan 30 orang IPC. Selanjutnya peserta yang telah melakukan pencetakan kartu ujian sebanyak 422 orang (219 IPA, 179 IPS dan 24 IPC).

Lanjut ke hal A2 kol. 3

Mantan Ketua DPRD Sumut H.Raja Sjahnan Meninggal Dunia MEDAN (Waspada): Mantan Ketua Ketua DPRD Sumatera Utara Mayor Jenderal TNI (Purn) H.Raja Sjahnan, SH meninggal dunia, Selasa (2/7), menjelang malam, setelah dirawat di RS Mount Elizabeth Singapura, karena penyakit tua. “Pak H.Raja Sjahnan, SH mengembuskan nafas terakhir setelah dirawat di Rumah Sakit Mount Elizabeth Singapura ,” kata salah seorang keluarga kepada Waspada di rumah duka Jl. Sudirman Medan. H .Raja Sjahnan mantan anggota DPR/MPR RI pada Oktober1972-Oktober 1977, meninggal dunia pada usia 89

tahun . Pria yang lahir pada 24 November 1923 di Simatahari, Kotapinang Labuhanbatu (sekarang Labusel) tersebut, pernah menjabat Kepala Staf Kodam-I/Iskandar Muda Banda Aceh pada Juli 1968Maret 1970 dan Koordinator/ Kepala Staf Kekaryaan Wilayah–I Medan pada Juli 1970Desember 1975 Selain itu, suami dari Hj. Tengku Mas tersebut semasa hidupnya sempat menduduki berbagai jabatan strategis di pemerintahan dan partai politik, seperti, ketua DPRD

Lanjut ke hal A2 kol. 7

Ada-ada Saja Salah Oles Lem Super INGIN mengobati penyakit sariawan dengan lipbalm, wanita ini malah membuat mulutnya terkunci karena mengolesi bibirnya dengan lem super. Pekerja layanan darurat di Selandia Baru awalnya khawatir setelah menerima panggilan telepon dari seorang

Lanjut ke hal A2 kol. 2

Serampang - Naga-naganya buka puasa pakai lilin - He...he...he...

WASPADA Demi Kebenaran Dan Keadilan

RABU, Pon, 3 Juli 2013/24 Sya’ban 1434 H

z zNo: 24272 * Tahun Ke-67

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

Terbit 24 Halaman (A1-12, B1-12) z zHarga Eceran: Rp 2.500,-


PARA peserta seminar APEC Temu Kampus di Hotel Grand Aston Medan berhamburan keluar dari dalam hotel, ketika terjadi gempa, Selasa (2/7).

RDP DPRD Sumut-PLN Panas

Tak Ada Jaminan Listrik Tak Padam Bulan Ramadhan

Gempa Juga Terasa Di Medan MEDAN (Waspada) : Gempa yang mengguncang Kota Medan Selasa(2/7) pukul 14:37, berpusat di 4.70 LU96.61BT di darat sekitar 35 Km Barat Daya Kab. Bener Meriah atau 28 Km Barat Laut dari Kota Takengon Provinsi Aceh.Kedalaman gempa sekitar 10 Km di permukaan bumi dan tidak berpotensi Stunami Staf Pelayanan Jasa BBMKG Wilayah I Retno Agung mengatakan, kekuatan gempa dirasakan 2-4 MMI di Kota Banda Aceh, Lhoksumawe, dan Takengon. Sedangkan gempa yang dirasakan di Kota Medan sekitar 2-3 MMI. Retno menambahkan, gempa terjadi oleh aktivitas tektonik dari Sistem Sesar Sumatera yang bergerak secara horizontal atau bergeser yang terjadi di dalam tanah sehingga menimbulkan efek guncangan yang disebut gempa tektonik. Disinggung soal kemungkinan terjadi gempa susulaan Badan Meteorologi, Klimatologi, dan Geofisika (BMKG) mencatat sampai pukul 16:00 sudah terjadi tiga kali gempa susulan dengan kekuatan gempa yang lebih rendah dari gempa pertama. “sudah tiga kali terjadi gempa susulan, kemungkinan akan terus terjadi gempa susulan namun kekuatannya lebih kecil,” ungkapnya. Masyarakat diimbau tetap waspada kemungkinan terjadi gempa susulan yang lebih besar yang sewaktuwaktu bisa saja terjadi. Namun, gempa tidak berpotensi tsunami karena terjadi di darat bukan di laut. Peserta ‘APEC Berhamburan Gempa bumi berkekuatan 6,2 SR yang mengguncang Lanjut ke hal A2 kol 6

Waspada/Irwandi MN

SEORANG anak terluka tertimpa reruntuhan bangunan dan dilarikan orangtuanya saat gempa berlangsung di Paya Tumpi Takengen, Aceh Tengah, Selasa (2/7).

MEDAN (Waspada): Rapat dengar pendapat (RDP) antara Komisi D DPRD Sumut dengan direksi PT PLN Sumut, Selasa (2/7), berlangsung panas. Pihak PLN tidak bisa menjamin listrik tidak padam pada bulan Ramadhan. Pihak PLN hanya bisa mengeluarkan pernyataan “berusaha semaksimal mungkin.” Hari itu, Komisi D DPRD Sumut kembali mengundang jajaran direksi PT PLN Sumut untuk mempertanyakan kondisi kelistrikan yang sering padam. Rapat dipimpin Ketua Komisi D, Guntur Manurung. Sementara jajaran direksi PT PLN dihadiri GM PLN Wilayah I Sumut Diananto, GM Pembangkit Sumbagut Bernadus Sudarmanta dan sejumlah staf. Rapat dengar pendapat hari itu untuk mencari masukan kepada Panitia Khusus (Pansus) Kelistrikan DPRD Sumut, diketuai H. Ajib Shah. Topik utama rapat dengar pendapat hari itu, mempertanyakan komitmen PT PLN untuk tidak memadamkan listrik, khususnya pada bulan Ramadhan. Dewan mengaku gusar dengan pernyataan pihak PLN yang sebelumnya menyebutkan, tidak menjamin listrik akan tetap hidup pada saat bulan puasa. Menurut pengamatan Waspada, anggota Komisi D, bereaksi begitu GM PLN Wilayah I Sumut Diananto, usai memberikan penjelasan tentang masalah kelistrikan di daerah ini. Anggota dewan menilai, alasan pihak PLN sangat klasik dan tidak masuk akal. Diananto memaparkan sejumlah kendala yang dihadapi dalam pengadaan listrik untuk konsumen. Lanjut ke hal A2 kol 2

Gempa Guncang Aceh Ratusan Warga Luka, Ratusan Bangunan Ambruk Di Aceh Tengah Dan Bener Meriah

Aliansi Partai Islam Mesir Tolak Keterlibatan Militer KAIRO (Antara): Aliansi partai Islam Mesir—termasuk Ikhwanul Muslimi—menolak pernyataan militer dan menyebutnya sebagai serangan terhadap keabsahan dengan cara yang mengarah kepada kudeta, demikian laporan stasiun televisi resmi pada

Selasa (2/7) pagi. Di dalam satu pernyataan yang ditayangkan televisi, aliansi tersebut menyatakan “kelompok itu menolak upaya oleh sebagian pihak untuk membalikkan keabsahan masyarakat”, dan mendesak agar krisis diselesaikan sesuai

undang-undang dasar. Pernyataan tersebut menyeru rakyat Mesir agar membanjiri negeri itu untuk mempertahankan keabsahan pemerintah. “Kami menyampaikan Lanjut ke hal A2 kol 6

TAKENGEN (Waspada): Gempa berkekutan 6,2 skala richter (SR) melanda wilayah Gayo, Aceh Tengah dan Bener Meriah, Provinsi Aceh, Selasa (2/7), sekira pukul 14:37:03. Lokasi pusat gempa:4.70 LU,96.61 BT.35 km Barat Daya Bener Meriah, pada kedalaman 10 Km (data BMKG). Dalam peristiwa itu, ratusan bangunan ambruk, jalan-jalan retak dan ratusan pula warga terluka akibat tertimpa reruntuhan bangunan. Lanjut ke hal A2 kol 3

USU Sediakan 1.544 Kursi Jalur UMBPTN, Pendaftaran Ditutup 19 Juli MEDAN (Waspada): Universitas Sumatera Utara (USU) menyediakan 1.544 kursi pada penerimaan calon mahasiswa baru tahun akademik 2013/ 2014, yang diseleksi melalui jalur Ujian Masuk Bersama Perguruan Tinggi Negeri (UMB-PTN).

“Hingga tadi siang jumlah pendaftar yang melakukan registrasi online melalui web mencapai 944 orang,” kata Ketua Panitia Lokal (Panlok) USU, Prof Zulkifli Nasution menjawab Waspada, Selasa (2/7).

Dia mengatakan jumlah tersebut terdiri dari kelompok IPA 491, IPS 391, dan IPC 62. Sedangkan jumlah peserta yang telah melakukan pembayaran biaya ujian di Bank BNI sebanyak 500 orang, Lanjut ke hal A2 kol 1

Gubsu Tinjau Penyaluran BLSM MEDAN (Waspada): Gubsu H Gatot Pujo Nugroho meninjau penyaluran Bantuan Langsung Sementara Masyarakat (BLSM) di Kantor Pos Pusat Kota Medan, Selasa (2/7). Peninjauan tersebut untuk memastikan penyaluran BLSM yang merupakan milik rakyat miaskin tidak mengalami kendala. Gubsu yang dalam peninjauan itu didampingi Kepala Dinas Kominfo Provinsi Sumut Jumsadi Damanik disambut Herman selaku kepala Area Ritel Sumatera Utara dan Aceh PT Pos Indonesia beserta jajarannya. Gubsu menyaksikan para petugas pos sibuk melayani masyarakat penerima BLSM. Saat itu, Gubsu menyapa sejumlah warga yang antri menunggu dipanggil petugas.Sejumlah warga tampak antusias ketika mengetahui Gubsu berada di tengah-tengah mereka. Selain bersalaman atau minta berfoto bersama, warga memanfaatkan momen tersebut untuk menyampaikan Lanjut ke hal A2 kol 2

Waspada/Amir Syarifuddin

GUBSU Gatot Pujo Nugroho meninjau penyaluran BLSM di Kantor Pos Medan, Selasa (2/7).

setempat. Laman stasiun berita Al Arabiya, Selasa, mengungkapkan di awal tahun ini pihak Kerajaan mulai memeriksa tenaga kerja asing yang telah

BLANGKEJEREN (Waspada): Pemkab Gayo Lues akan menyurati Kanwil PT Perum Giro dan Pos Provinsi Aceh agar menghentikan pendistribusian dan pembayaran KPS BLSM ke kantor PT Perum Giro dan Pos Blangkejeren. Demikian dikatakan Wakil Bupati Gayo Lues, Adam, Senin (1/7) di Off Room Kantor Setdakab Gayo Lues ketika menggelar rapat terkait telah tersalurnya 60 persen Kartu Perlindungan Sosial (KPS) Bantuan Langsung Sementara Masyarakat (BLSM). Adam meminta PT Perum Giro dan Pos menunda penyaluran sekira 2.675 sisa KPS BLSM yang sebelumnya telah dibagi. Dan dari jumlah kuota 7.514 KPS BLSM tidak akan dilakukan pembayaran dan pendistribusian sebelum ada hasil musyawarah desa, menunggu verifikasi ulang data untuk penerima dan pengganti yang layak dari Pemkab guna mencapai sasaran yang tepat.

Lanjut ke hal A2 kol 6

Lanjut ke hal A2 kol 1

Arab Saudi Perpanjang Masa Amnesti Pekerja Asing Ilegal Sudah 70 Ribu WNI Urus Amnesti ARAB SAUDI (Waspada): Pemerintah Arab Saudi akhirnya memperpanjang masa amnesti kepada pekerja asing ilegal, yang semula tenggat waktunya pada 3 Juli menjadi tanggal 3 November 2013. Artinya, mereka diberi ke-

longgaran waktu lagi untuk mengurus dokumen-dokumen imigrasi sehingga tidak akan menjadi sasaran penangkapan dan pengusiran dari pihak berwenang Saudi, demikian ungkap Saudi Press Agency pada Selasa (2/7) waktu

Al Bayan

Kesabaran Oleh: Ameer Hamzah Hai orang-orang yang beriman, bersabarlah kamu dan kuatkan Kesabaranmu, dan tetaplah bersiap siaga, dan bertakwalah Kepada Allah SWT supaya kamu beruntung. (QS. Ali Imran:200) SALAH satu sifat yang utama bagi orang muslim adalah sabar. Sabar ialah hiasan hidup bagi yang mendapat cobaan seperti kehilangan kekuasaan, anggota keluarga meninggal dunia, kehilangan harta yang kita cintai, menderita kelaparan, ketakutan, dan lain-lain. Sabar terapi jiwa yang mampu mengusir godaan setan. Disebutkan dalam Atsar; Abubakar Siddiq Radhiallahu anhu pernah lapar berhari-hari, supaya perutnya jangan pedih beliau ganjal dengan batu di atas perutnya. Beberapa hari beliau tidak keluar rumah, kecuali waktu shalat jamaah. Rasulullah SAW datang menjenguknya. Lanjut ke hal A2 kol 2

Pembagian Kartu BLSM Di Gayo Lues Dihentikan

Granat Tak Bertuan Ditemukan Di Puskesmas BLANGKEJEREN (Waspada) : Sebuah granat nenas dengan kondisi berkarat ditemukan dalam tumpukan batu di halaman Puskesmas Kota Blangkejeren, Selasa (2/7). Granat ditemukan Aditya Wardana, 22, staf honorer pada Dinas Kesehatan Kabupaten Gayo Lues sekira pukul 16:30 di lokasi relokasi pembangunan ruang rawat inap Puskesmas Blangkejeren saat ia sedang membersihkan taman bunga di pekarangan rumah dinas puskesmas yang ditempatinya. Kondisi granat ditemukan di atas tumpukan batu kecil dalam keadaan bercampur tanah karena takut granat tersebut meledak, akhirnya ia melaporkan ke Polsek Blangkejeren. Lanjut ke hal A2 kol 5

KPK Periksa Saan Mustofa Terkait Mobil Anas JAKARTA (Antara): Komisi Pemberantasan Korupsi (KPK) memeriksa Wakil Sekretaris Jenderal 1 Partai Demokrat Saan Mustofa terkait kasus dugaan penerimaan hadiah berkaitan dengan pembangunan Pusat Pendidikan, Pelatihan dan Sekolah (P3SON) di Hambalang. “Ini penjadwalan ulang untuk Pak Anas, soal mobil Harrier,” kata Saan saat datang ke gedung KPK Jakarta, Selasa (2/7) siang. Saan seharusnya diperiksa penyidik KPK pada Selasa (25/6) namun ia tidak hadir dalam jadwal pemeriksaan tersebut. Lanjut ke hal A2 kol 4


BLSM - MENGADU KE DPRD. Seorang warga dan anaknya menghadiri rapat gabungan Komisi E DPRD dengan pihak Pemerintah Provinsi Sumatera Utara, membahas bantuan langsung sementara masyarakat (BLSM), di Medan, Selasa (2/7). Ratusan warga miskin yang tidak mendapatkan BLSM mendatangi gedung DPRD Sumut, minta anggota dewan menyelesaikan masalah tersebut.

Tersangka Pembakaran Hutan Riau Bertambah Jadi 25 Orang JAKARTA (Waspada): Tersangka pembakaran hutan di Provinsi Riau bertambah menjadi 25 orang mengakibatkan asap sampai ke Singapura dan Malaysia. 25 Tersangka yang terbagi dalam 17 kasus ditangani polisi, 6 tersangka di Polres Bengkalis, 2 tersangka di Polres

Dumai, 11 tersangka di Polres Rokan Hilir, 3 tersangka di Polres Siak, 2 tersangka di Polres Pelalawan dan 1 tersangka di Dirkrimsus Polda Riau. “Ada satu orang yang ditangani Polda Riau, tinggal di sebuah perusahaan. Tapi apakah perusahaan itu terlibat, masih dalam pengem-

bangan,” kata Kabid Proddok Div Humas Polri, Kombes Hilman Thayib di Mabes Polri, Selasa (2/7). Para tersangka yang ditahan di Polres Bengkalis, dengan 6 kasus adalah Subari ,46, dan Hartono ,35, dengan Lanjut ke hal A2 kol 1

Ada-ada Saja

Salah Oles Lem Super

INGIN mengobati penyakit sariawan dengan lipbalm, wanita ini malah membuat mulutnya terkunci karena mengolesi bibirnya dengan lem super. Pekerja layanan darurat di Selandia Baru awalnya

Lanjut ke hal A2 kol 5

Serampang - BaLSeM buat hangat - He.... he....he....

Berita Utama

A2 USU Sediakan ....

dengan rincian 258 kelompok IPA, 212 IPS dan 30 orang IPC. Selanjutnya peserta yang telah melakukan pencetakan kartu ujian sebanyak 422 orang (219 IPA, 179 IPS dan 24 IPC). “Seperti biasanya Fakultas Kedokteran dan Ilmu Kesehatan, hukum, dan ekonomi peminatnya tinggi, “ kata Prof. Zulkifli didampingi Kabag Humas USU, Bisru Hafi. Dia menjelaskan, UMB-PTN adalah seleksi penerimaan mahasiswa baru yang digelar 13 perguruan tinggi negeri (PTN) di seluruh Indonesia. Ketigabelas PTN yang tergabung dalam UMB-PT 2013, yaitu: Universitas Syiah Kuala (UNSYIAH) Banda Aceh, Universitas Malikussaleh (UNIMAL) Lhokseumawe,Universitas Sumatera Utara (USU) , Universitas Jambi (UNJA) Jambi, , Universitas Negeri Jakarta (UNJ), Universitas Negeri Jenderal Soedirman (UNSOED) Purwokerto,Universitas Diponegoro (UNDIP) Semarang, Universitas Palangka Raya, Universitas Islam Negeri Alauddin Makasar, Universitas Sultan Ageng Tirtayasa (UNTIRTA) Banten, Universitas Borneo (UB) Tarakan, dan Universitas Terbuka (UT) Jakarta. Disam-

Tersangka Pembakar ....

modus pembakaran tanaman kelapa sawit dengan dampak luas kebakaran seluas 75 hektare lahan terbakar. Lalu di Polres Rohil, ada tiga kasus yang melibatkan tersangka bernama Hotman Purba, Katiman, Sukadi, Aswin, Rizal, Heriyadi Saputra, Eka Budi Arianto, Marlin Nasution, Mohammad Yasir, dan KH Johari. Modus yang dilakukan sengaja membakar lahan milik tersangka seluas 65 hektare dengan menggunakan bensin dan dampak lahan yang terbakar seluas 400 hektare dan 270 warga ikut mengungsi. Lalu di Polres Pelalawan ada satu kasus dengan tersangka Sumardi dengan modus yang dilakukan membakar lahan seluas 1,5 hektare dengan menggunakan potongan ban bekas yang disiram bensin. (j02)

Pembagian Kartu ....

“Kita tidak ingin menimbulkan konflik yang mengganggu stabilitas keamanan masyarakat, gara–gara tidak tepat sasaran pendistribusian BLSM ini,” ujar wakil bupati. Pihak Pos sendiri mengatakan, sekira 4.389 Kartu Perlindungan Sosial (KPS) telah disalurkan dari jumlah kuota 7.514 KPS BLSM untuk Kabupaten Gayo Lues. Ke p a l a B a d a n P u s a t Statistik Gayo Lues, Tuismadi mengatakan, Basis Data Terpadu (BDT) yang dikelola oleh TNP2K adalah sumber Rumah Tangga Sasaran (RTS) yang dijadikan sebagai acuan untuk sumber data penerima Kartu Perlindungan Sosial (KPS). “Hingga saat ini pendataan RTS telah dilakukan sebanyak tiga kali oleh BPS, yang terakhir PPLS pada 2011,” ujar Tuismadi. (cjs)

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Kf7, Kxd5. 2. Gg5+mat. Hitam tak punya langkah terbaik mencegah sekakmat ini. Jawaban TTS: TTS Topik


ping PPL yang ada tersebut, Panitia Pusat juga membuka oulet dibeberapa daerah seperti Padang, Pekanbaru, Palembang, Lampung, Tangerang, Bogor, Bandung, dan Surabaya. Masa pendaftaran UMBPTN dibuka 27 Mei hingga 19 Juli 2013, secara online melalui website: http//:penerimaan. ‘’U jian tulis, bagi seleksi UMB-PT dijadwalkan Minggu 21 Juli 2013 mulai pukul 08.00 .Hasil ujian tulis dari seleksi ini diumumkan pada 28 Juli pukul 18.00 melalui website panitia. Tata cara pendaftaran UMB dilakukan secara online melalui website/situs atau,’’ katanya. Peserta terlebih dahulu melakukan pra registrasi pada situs tersebut, selanjutnya melakukan pembayaran biaya pendaftaran di BNI terdekat. Setelah itu, peserta dapat melakukan pencetakan kartu ujian. Bagi peserta yang tidak melakukan pencetakan kartu ujian, dianggap mengundurkan diri. Bagi peserta yang memilih PTN Mandiri USU, diharuskan memilih jenis pembayaran dengan pilihan dua kelompok ujian terdiri dari IPA atau IPS (tidak ada IPC). Pada masingmasing pilihan kelompok ujian tersebut, peserta dapat memilih sebanyak-banyaknya 3 (tiga) pilihan program studi. Daya tampung USU melalui UMB-PT sebanyak 1.544 orang , terdiri dari 819 Kelompok IPA dan 725 Kelompok IPS. Kabag Humas USU Bisru Hafi menambahkan, tahun ajaran baru ini, USU menerima mahasiswa melalui tiga jalur masing masing berdasarkan persentasi yang sudah di tentukan, yaitu 50 persen lewat SNPTN atau sejumlah 3.936 mahasiswa, SBMPTN 10 persen atau 2.406 mahasiswa, dan 40 persen dar i jalur mandiri atau sejumlah 1.544 mahasiswa. (m49)

Tak Ada Jaminan ....

Diantaranya, usia kabel bawah tanah yang sudah tua. Yakni mulai tahun 2001. Selain itu, di Medan sangat banyak pohon rimbun yang menghalangi jaringan listrik. Alasan lain ditambahkan GM Pembangkit Sumbanggut Bernadus Sudarmanta, situasi kelistrikan banyak dipengaruhi pembangkit yang perlu perawatan. ‘’ Saat ini PLN sedang merawat mesin pembangkit GT11 dan GT-12 yang berada di Belawan. Kondisi ini memaksa PLN memadamkan listrik secara bergiliran,’’ katanya. Selama ini, katanya, PLN berusaha tidak melakukan perawatan dengan harapan program tambahan daya masuk. Namun hal itu belum bisa terwujud. Karena pembangkit Nagan Raya belum juga beroperasi, dan pembangit Labuhan Angin (Sibolga) tidak maksimal menyuplay daya. PLN Bobrok Sedangkan, Zulkifli Effendi Siregar anggota Komisi D yang pertama bereaksi menanggapi pernyataan pihak PLN mengatakan, manajemen PLN bobrok. ‘’ PLN selalu menyebutkan alasan klasik. Masalah perawatan, jaringan terkena pohon dan lainnya,’’ kata Zulkifli. ‘’Kasihanlah liat rakyat.

Gubsu Tinjau ....

sejumlah kendala yang mereka hadapi dalam proses penyaluran BLSM. “Pak saya belum dapat, katanya belum terdaftar,” kata salah seorang warga. “Pak kalau nomer antreannya sudah lewat, apa bisa lagi mendapat kesempatan,” kata seorang ibu yang kebingungan karena nomor antriannya telah lewat. Gubsu mencoba meladeni dan membantu warga satu per satu. Bahkan Gubsu tak sungkan menanyakan serta mengcross check kendala warga ke petugas Kantor Pos. “Ayo saya bantu ke petugas BLSM, “ ujar Gubsu kepada seorang ibu yang kebingungan.

Al Bayan ....

Jawaban Sudoku:

1 7 6 8 2 4 5 3 9

4 3 2 5 9 7 1 6 8

5 8 9 6 1 3 2 7 4

9 6 4 3 8 2 7 5 1

7 5 1 4 6 9 3 8 2

3 2 8 7 5 1 9 4 6

6 1 5 2 3 8 4 9 7

2 4 3 9 7 6 8 1 5

8 9 7 1 4 5 6 2 3

Beliau melihat shahabatnya itu pucat dan kurus. “Ada apa denganmu wahai Abubakar?”. Tanya baginda. “Saya kelaparan ya Rasulullah! Jawab Abubakar dengan perasaan lemah. Kebetulan kedua manusia utama itu sama-sama dalam kelaparan, “Saya juga sudah tidak makan beberapa waktu!” ujar Nabi. tetapi keduanya bersabar karena malu memintaminta. Tiba-tiba putra Abdurrahman bin Auf (dermawan paling kaya) datang mengundang keduanya agar makan siang. Alhamdulillah! Keduanya makan sampai kenyang. Sabar tentu bukan hanya dalam masalah menahan lapar. Sabar harus selalu

Gempa Guncang ....

Sekretar iat BPBD Aceh Tengah). Di RSU Benar Meriah 90 orang. Sementara yang meninggal dikabarkan 5 orang, namun data tersebut masih simpang siur. Hal itu karena komunikasi di daerah itu masih sulit dan jaringan yang tidak jelas. Sedangkan bangunan dan jalan yang roboh ada di beberapa ttik. Erwin, 28, salah seorang warga Lhokseumawe mengaku panik saat peristiwa itu dan dia juga berusaha secepatnya keluar dari rumah untuk menghindari terjadinya hal-hal yang tidak diinginkan. Kondisi tersebut juga dialami warga lainnya. Para warga berhamburan ke badan jalan takut terjadi rer untuhan bangunan. Getaran gempa juga dirasakan warga Aceh Utara. Sementar a a k t i v i t a s masyarakat di Kabupaten Nagan Raya berjalan lancar setelah gempa mengguncang Aceh. Kepala Badan Meteorologi, Klimatologi dan Geofisika (BMKG) Nagan Raya Haijol Risfan, Selasa (2/7) mengatakan, gempa yang terjadi tidak menyebabkan

warga di Nagan Raya panic. Ia menambahkan kepada masyarakat Nagan Raya supaya berhati- hati kemungkinan ada gempa susulan, tapi tidak terlalu besar. Posko Badan Nasional Penanggulangan Bencana (BNPB) mengakui korban gempa sudah dirawat di rumah sakit. Menurut Kepala Pusat Data Informasi dan Humas BNPB Sutopo Purwo Nugroho, di Jakarta, Selasa (2/7), BPBD setempat masih melakukan pendataan. Sementara itu, sejumlah rumah warga yang rusak juga terjadi di Kecamatan Bener Gelipah, Bener Meriah. Ketua DPD Sentra Komunikasi (Senkom) Mitra Polri Kabupaten Bener Meriah Suroto saat dihubungi dari Banda Aceh mengaku guncangan gempa cukup kuat. “Kami sudah mengerahkan personil anggota Senkom ke lokasi untuk membantu masyarakat dan sekaligus mendata jumlah rumah yang roboh,” katanya. (cb09/b32/ b33/b18/cb07/ant)

KPK Periksa ....

paling singkat 4-20 tahun dan pidana denda Rp200-Rp1 miliar. Bentuk hadiah tersebut adalah mobil Toyota Harrier senilai sekitar Rp800 juta dari kontraktor PT Adhi Karya untuk memuluskan pemenangan perusahaan tersebut saat masih menjadi anggota DPR dari 2009 dan diberi plat B 15 AUD. Mengenai mobil Harrier, pengacara Anas, Fir man Wijaya mengatakan bahwa kliennya memang membeli mobil tersebut dengan cara mencicil dari Nazaruddin pada Agustus 2009, namun Anas sudah menjual mobil itu pada Juli 2010 sehingga persoalan mobil dianggap selesai.

Lampu mati tidak beraturan, semaunya PLN saja. PLN bobrok betul,’’ imbuh Zulkifli Siregar. Menurut Zulkifli, semua yang disampaikan PLN tidak sama dengan yang dirasakan masyarakat. Mati lampu bergilir paling lama tiga jam pun dibantah Zulkifli Siregar. “Hampir setiap hari listrik mati. Waktunyapun tidak beraturan. Tadi pagi di rumah saya lampu mati pukul 05:00. Sampai saya berangkat ke DPRD pukul 09:00, lampu belum nyala,’’ katanya. Zulkifli, mengatakan rakyat dapat mentolelir kalau hanya sekali atau dua kali lampu mati tiba-tiba. Tapi, itu terjadi sewaktu-waktu. PLN tidak pernah menjelaskan kapan lampu akan padam. ‘’PLN suka-suka saja mematikan lampu,’’ katanya. Hal yang sama disebutkan anggota dewan lainnya, yakni Ramli. Menurut anggota Komisi D ini, dia sudah bosan bertemu pihak PLN, karena hasilnya tidak ada. ‘’Tapi, karena tanggungjawab jabatan, terpaksalah bertemu lagi.Dia berharap ada sesuatu yang baru untuk masyarakat,’’ kata Ramli dan menambahkan, alasan yang disampaikan GM PLN sangat mengada-ada. ‘’Kalau alasannya karena di Kota Medan banyak pohon yang menghalangi jaringan,

logikanya listrik padam hanya untuk Kota Medan. Tapi kenapa rumah pejabat teras tidak pernah mati lampu. Juga mengapa di Nias, yang jaringannya berbeda juga mati lampu?,’’ kata Ramli. Campakkan data Hal paling ekstrim dilakukan oleh anggota Komisi D, Marahalim Harahap. Karena kesal, dia sampai mencampakkan data yang dipegangnya, karena pihak PLN tetap menyebutkan saat ini Sumut terjadi defisit listrik. Datanya berbeda-beda. Ada pihak PLN yang menyebut defisit 400 mega watt (MW ), ada yang bilang 150 MW, 200 MW dan 250 MW. Dewan pun mengaku bingung melihat pernyataan pihak PLN yang hadir. Marahalim Harahap, mengaku memiliki data berbeda yang dia peroleh dari ekspose PLN pada rapat dengar pendapat dengan Komisi D beberapa bulan lalu. Menurut data itu, walaupun Sumut telah mensuplai listrik ke Aceh 66 MW dan Riau 50 MW, tapi masih juga memiliki cadangan 38 MW. Dia mengaku heran, mengapa hari itu pihak PLN mengatakan defisit. ‘’Apakah yang saya pegang ini bukan data PLN? Kalau ini diakui data PLN, mengapa saat ini kalian

menyebut Sumut defisit daya,’’ katanya sambil mencampakkan data tersebut. Pada rapat dengar pendapat hari itu, Komisi D DPRD Sumut tetap ‘ngotot’ meminta PLN tetap menghidupkan listrik pada bulan Ramadhan. Upaya yang akan dilakukan adalah membuat rekomendasi kepada pimpinan DPRD untuk membuat surat kepada Gubsu. Isinya meminta Gubsu untuk berbicara dengan Dirut PT Inalum. Ketua Pansus Kelistrikan DPRD Sumut H.Ajib Shah, mengatakan, seusai dengan penjelasan Bapeda Sumut kepada Pansus, diketahui kalau PT Inalum memiliki cadangan daya listrik sekitar 250 MW. Karenanya Pansus berharap, Gubsu bersedia bertemu dengan Dirut PT Inalum untuk meminta memasok daya ke Sumut sekitar 150 MW. ‘’Yang krusial ke depan adalah bulan Ramadhan. Jangan sampai lampu mati pada saat itu,’’ kata Ajib Shah. (m12)

Usai peninjauan, Gubsu kepada wartawan menjelaskan sejauh ini proses penyerahan BLSM di Kantor Pos Medan berlangsung tertib dan belum ada kendala serius. Dia juga mengapresiasi Kantor Pos Medan yang sigap memberikan layanan. “Ada lebih kurang 745 ribu Rumah Tangga Sasaran (RTS) di Provinsi Sumut. Sementara ini yang kita evaluasi adalah sudah tepat sasaran karena kita punya pekerja sosial yang turut mendampingi dalam proses pendataan,” ujar Gubsu. Namun, diakui Gubsu, ada beberapa warga yang belum mendapatkan BLSM karena kuota atau jumlah yang disalurkan tidak sebanyak

jumlah RTS. Sementara itu, Kepala Area Ritel Sumatera Utara dan Aceh PT Pos Indonesia, Herman meyampaikan, sejauh ini tidak ada kendala dalam pembayaran. ‘’Periode pembayaran empat bulan ini untuk tahap pertama. Tahap kedua dijadwalkan setelah Lebaran. Sampai saat ini untuk Medan hampir 70 persen telah tersalurkan dari 73.110,” katanya. Bagi masyarakat yang tempat tinggalnya jauh dari Kantor Pos, lanjut Herman, pihaknya akan mempermudah dengan layanan komunitas. Layanan ini dilaksanakan dengan cara petugas yang mendatangi masyarakat di tempat tertentu. (m28)

menghiasi ibadah kepada Allah SWT. Misalnya; ada godaan nafsu supaya berbuat maksiat, maka kita harus bersabar untuk tidak memperturutkan hawa nafsu, malah kita harus tetap sabar dalam keistiqamahan dalam berbuat amal kebajikan. Kekurangan harta jangan menghalangi langkah kita untuk berbuat amal shaleh. Orang-orang yang menghiasi dirinya dengan sifat sabar akan diberi kesuksesan dalam usahanya, cita-citanya, bahkan surga di hari pembalasan kelak. Bersabar itu wajib hukumnya sedangkan tergesagesa dari setan. Para Nabi yang mendapat gelar Ulul Azmi karena kesabarannya dalam mengembangkan agama Allah

sangat luar biasa. Ibrahim menghadapi Namruz yang kejam, Musa menghadapi Firaun yang zalim, Noh menghadapi kaumnya yang keras kepala, Isa dengan orangorang yang durhaka, Muhammad menghadapi kaum musyrikin Mekkah dan Yahudi Madinah. Rasulullah bersabda: Kesabaran itu cahaya yang benderang, (HR: Muslim). Ali bin Abi Thalib berkata: Bagi orang mukmin kesabaran adalah suatu nikmat darinikmat Allah, sebaliknya bagi orang munafik kesabaran sesuatu yang sangat tidak nikmat. Mudah-mudahan kita yang sedang mendapat cobaan Allah SW T selalu dalam bersabar. Amin!

Pantauan Waspada, saat gempa terjadi di Aceh Tengah, masyarakat berhamburan keluar rumah. Belum diketahui secara pasti apakah musibah ini menelan korban jiwa atau tidak. Sementara tepat di hadapan Waspada, dua orang balita tertimpa reruntuhan di bagian kepala. Teriakan histeris orang tua korban dan masyarakat membuat suasana mencekam. Ada yang terduduk, juga sebagian berlarian menjauh dari lokasi yang ditaksir membahayakan. “Tolong...tolong, tolongin anak saya pak. Anakku.. anakku. Bangun nak, sayang sama bapak nak,” kata seorang warga saat gempa berlangsung dan meminta bantuan ke tetangga terdekat. Kejadian ini tepat di hadapan Waspada yang kebetulan sedang melintasi daerah Kp. Paya Tumpi, Aceh Tengah. Selang beberapa saat, hal serupa juga dialami seorang anak lain, tampak orang tua korban menangis histeris, meminta pertolongan. Selanjutnya, meski situasi panik, masyarakat berupaya membawa korban ke lokasi pelayanan medis terdekat. Informasi lainnya yang diperoleh, ratusan rumah yang dilaporkan rusak terjadi di sejumlah kecamatan di Aceh Tengah dan Bener meriah. Daerah tersebut di antaranya, Kute Panang, Bloc C, Blang Mancung, Paya Tumpi Lampahan dan sejumlah tempat lainnya. Sementara masih dalam suasana panik, gempa susulan terjadi berulang kali. Hingga berita ini diturunkan, sudah 5 kali gempa susulan dengan kekuatan lebih rendah. Informasi lainnya yang diterima, saat ini puluhan korban gempa telah menyesaki RSUDatu Beru Takengen. Hingga saat ini korban luka dirawat di RS Datu Beru tercatat 140 orang (data dari

“Kemarin kita (rapat) paripurna,” katanya beralasan mengenai ketidakhadirannya dalam pemer iksaan tersebut. Mantan Ketua Umum Partai Demokrat Anas Urbaningrum ditetapkan KPK sebagai tersangka penyelenggara negara yang menerima suap atau gratifikasi berdasarkan pasal 12 huruf a atau huruf b atau pasal 11 UU no 31 tahun 1999 sebagaimana telah diubah menjadi UU no 20 tahun 2001 tentang Pemberantasan Tindak Pidana Korupsi. Ancaman pidana pelanggar pasal tersebut adalah pidana penjara seumur hidup atau pidana penjara

Granat Tak Bertuan ....

Satu jam setelah dilaporkan, Tim Jibom (penjinak bom) dari Kompi Brimob Kabupaten Gayo Lues turun ke lokasi untuk mengamankan granat nenas tersebut. Iptu Bachtiar, dari tim jibom Kompi Brimob menegaskan, keadaan granat saat ini sudah tidak aktif lagi dan tidak berbahaya. Dugaan sementara, granat tangan tersebut adalah sisa dari konflik dan pemiliknya belum diketahui, hingga saat ini pihak kepolisian masih dalam tahap penyelidikan. (cjs)

Ada-ada Saja ....

khawatir setelah menerima panggilan telepon dari seorang wanita dengan suara tercekat seperti mulutnya sedang disumbat. Otago Daily Times melaporkan, wanita itu bergumam memohon agar dikirimi mobil ambulan ke rumahnya. Karena khawatir korban sedang disekap penjahat, pihak rumah sakit membawa polisi datang ke lokasi dan mendapati wanita itu tak sengaja men gol es i l em s uper ke bibirnya. “Ambulans menerima panggilan, namun karena suaranya tak jelas, mereka tidak yakin apakah itu adalah peristiwa medis atau seseorang telah disekap,’’ kata Sersan Senior, Steve Aitken yang dilansir Orange, Selasa (2/7). Polisi mengatakan, wanita berusia 64 tahun itu mengambil lem super dan bukan lipbalm untuk mengobati bibirnya saat ia bangun pada tengah malam. Setelah kesalahpahaman tersebut, wanita itu akhirnya dibawa ke rumah sakit untuk menjalani perawatan. (orange/rzl)

WASPADA Rabu 3 Juli 2013

Waspada/Irwandi MN

SAAT gempa berlangsung di Aceh Tengah, warga berlarian menyelamatkan diri keluar rumah. Tampak sebagian warga berada di lokasi ‘aman’ ketika gempa masih mengguncang Gayo, Selasa (2/7).

Gempa Juga ....

lobby depan, beberapa tamu tampak panik sambil setengah berlari keluar. Bahkan seorang pria paruh baya tampak keluar hanya mengenakan sarung dan kaos dalam saja. Kebetulan pada hari itu, tidak ada jadwal pertemuan SOM III APEC di hotel tersebut. “Hari ini tidak ada pertemuan APEC di Grand Aston,” kata General Manager Grand Aston Medan Wahyono yang ikut keluar bersama para pegawai dan tamu-tamu hotel. Direktur Informasi dan Media Kementerian Luar Negeri RI P.L.E Priatna, yang menjadi pembicara pada seminar APEC Temu Kampus tersebut mengatakan, gempa dirasakan cukup kuat di dalam ruangan. “Saya melihat lampulampu semua bergoyang dan peserta mengatakan ada gem-

pa. Akhirnya peserta dievakuasi dibantu petugas keamanan hoel,” ujar Priatna. Setelah menunggu sekitar 20 menit, para peserta seminar APEC Temu Kampus kembali masuk untuk melanjutkan seminar. Meski getaran gempa ini belangsung sekira satu menit, namun sejumlah penghuni gedung perkantoran dan hotel di Medan sempat berhamburan keluar karena takut. Sementara itu, di Hotel Santika Medan tempat berlangsungnya pertemuan SOM III APEC 2013, para peserta delegasi dari berbagai negara tidak terlihat keluar dari dalam ruangan. Mereka tetap melaksanakan rapat. Bahkan, pihak panitia yang berada di lantai 1, mengatakan tidak merasakan ada gempa. (m41/cay)

Aliansi Partai ....

“Angkatan Bersenjata takkan menjadi bagian dari politik atau kekuasaan,” kata Menteri Pertahanan AbdelFattah As-Sisi di dalam pidato audio yang ditayangkan televisi resmi. Ia mengatakan tenggat 48jam merupakan “kesempatan terakhir” bagi semua pihak untuk memenuhi tuntutan rakyat dan menyelesaikan krisis. Ia menyebut kondisi saat ini “bersejarah”. As-Sisis memperingatkan, “Membuang-buang lebih banyak waktu akan mengakibatkan konflik dan perpecahan lebih besar.” Ia menyatakan rakyat sudah sangat menderita akibat krisis politik yang berlangsung. As-Sisi mengatakan peta jalan masa depan yang diawasi militer akan dilaksanakan “dengan keikut-sertaan semua

partai jujur dan kekuatan nasional, terutama pemuda, tanpa mengucilkan partai apa pun”. Sementara itu, Juru Bicara militer Ahmed Ali menyatakan di jejaring resmi Angkatan Bersenjata bahwa disiplin dan budaya militer tak mengizinkan “kudeta militer”. Ia menggambarkan pernyataan oleh As-Sisi sebagai “interaksi” dengan rakyat. Meskipun pemrotes yang menentang Presiden Mohamed Moursi menyambut baik pernyataan militer, pendukungnya telah mulai berkumpul di berbagai tempat di Mesir dan bukan di bundaran utama mereka di dekat Masjid Rabi Al-Adawiya di Kota Nasr di Kairo. Pendukung Presiden Mesir itu menyampaikan solidaritas mereka buat Moursi dan menolak pernyataan militer.

Arab Saudi ....

Kembali Merazia Setelah masa amnesti berakhir, Pemerintah Arab Saudi akan kembali merazia para tenaga kerja asing ilegal. Hal itu diakui Menteri Luar Negeri Indonesia, Marty Natalegawa, kepada media massa beberapa waktu lalu. Usai menerima kunjungan kerja Menlu Nikaragua, Samuel Santos Lopes, pertengahan Juni lalu Marty menyebut jumlah WNI yang mengurus pemutihan ke KJRI tidak sebanding dengan kemampuan petugas imigrasi Arab Saudi. Saat ini sudah ada 70 ribu WNI yang mengurus amnesti. Namun, “Pihak imigrasi Arab Saudi sendiri hanya bisa memproses permohonan WNI satu kali dalam seminggu. Dan satu kali seminggu itu pun mereka hanya mampu mengurus 200 permohonan visa. Apabila dihitung menggunakan hitungan matematika, mustahil dapat diproses sesuai tenggat waktu,” ujar Marty. Namun Marty mengatakan negara lain pun juga mendapat jatah yang sama, karena masalah ini tidak hanya dialami oleh Indonesia saja.

Dia juga menambahkan pihak Kemlu kini menanti tindak lanjut dari pemerintah Arab Saudi setelah semua proses pengajuan disampaikan ke kantor imigrasi. Pemerintah Indonesia mengatakan telah mendorong Arab Saudi supaya dapat meningkatkan kapasitas mereka untuk mengelola arus aplikasi yang datang dari beberapa negara. Kemlu mengaku juga sudah menyampaikan saran pemerintah untuk memperpanjang tenggat waktu masa pemutihan. Isu amnesti ini sempat memicu terjadinya kerusuhan di depan gedung Konsulat Jenderal Republik Indonesia di Jeddah pada 10 Juni lalu. Akibatnya satu orang TKI bernama Marwah binti Hasan tewas akibat dehidrasi saat tengah mengantre proses pemutihan dokumen. Jenazahnya kemudian dimakamkan di Arab Saudi. Sementara polisi Jeddah berhasil menahan 84 pelaku tindak kerusuhan. Sebanyak 78 tersangka sedang dalam proses untuk dideportasi. (vn/m09)

Kab. Bener Meriah, Aceh, Selasa(2/7), yang terasa hingga Medan, membuat peserta seminar ‘APEC Temu Kampus’ di Hotel Grand Aston City Hall Medan, berhamburan keluar. Kegiatan yang digelar Kementerian Komunikasi dan Informasi, Kementerian Luar Negeri, bekerjasama dengan Universitas Sumatera Utara (USU) dengan tajuk ,’’ Penguatan Kerjasama Asia Pasifik Melalui Peningkatan Kompetensi Sumber Daya Manusia‘’, itu terpaksa dihentikan selama 30 menit. Pihak hotel mengevakuasi peserta yang sebagian besar mahasiswa dan dosen. Mereka dievakuasi melalui tangga darurat keluar ke pintu belakang Grand Aston. Sementara itu, di bagian

penghormatan bagi prinsip damai dan dipeliharanya darah rakyat Mesir,” aliansi tersebut menambahkan. Aliansi itu mendesak semua rakyat agar mendukung keabsahan rakyat dan menentang setiap jenis kudeta. Aliansi itu mengatakan aliansi menghormati keinginan rakyat dan keabsahan konstitusional bagi pemilihan umum dengan keinginan kuat perujukan nasional, demikian laporan Xinhua. Aliansi tersebut menanggapi satu pernyataan yang dikeluarkan pada Senin oleh Angkatan Bersenjata, yang memberi semua partai politik waktu 48 jam untuk menyelesaikan krisis itu, sebelum memberlakukan peta jalan yang diawasi militer bagi masa depan Mesir.

melanggar izin tinggal atau visa. Alhasil banyak yang terjaring dari sidak yang digelar di jalan atau di perusahaanperusahaan yang beroperasi di Arab Saudi. Sebanyak 10 orang telah ditangkap dan selanjutnya dideportasi atau dipaksa meninggalkan Arab Saudi. Namun banyak pihak khawatir apabila semua tenaga asing ilegal dipulangkan, maka dapat mengganggu perekonomian. Negeri penghasil minyak tersebut selama ini mengandalkan banyak pekerja asing di sejumlah sektor. Maka, pemerintah Saudi kemudian mengumumkan memberikan pengampunan atau amnesti kepada para tenaga kerja asing ilegal dengan tidak mengenakan denda atau biaya tambahan kepada mereka yang melakukan pelanggaran imigrasi hingga waktu tertentu. Perpanjangan tenggat waktu dari Juli hingga November ini menandakan masih banyak tenaga kerja asing ilegal yang belum sempat mengurus status mereka.

Berita Utama


WASPADA Rabu 3 Juli 2013

Ahli Hukum Pidana :

Bila Sesuai Prosedur Tidak Ada Unsur Pidana MEDAN (Waspada) : Bila semua yang dilakukan sesuai prosedur dan tidak ada yang salah atau sesuai dengan perundang-undangan, maka tidak ada unsur melawan hukum. Hal itu diungkapkan Ahli Hukum Pidana Universitas Sumatera Utara (USU) Dr Mahmud Muliyadi SH MHum yang dihadirkan sebagai saksi ahli pada sidang dugaan korupsi Tunjangan Penghasilan Aparatur Pemerintahan Desa (TPAPD) Tapsel 2005 Rp1,59 miliar, dengan terdakwa mantan Sekda Tapsel

RH di Pengadilan Tipikor Medan, Selasa (2/7). “Tindak pidana korupsi sangat membutuhkan keterangan ahli lain. Misalnya ahli bidang administrasi dan keuangan daerah untuk menentukan ada tidaknya perbuatan melawan hukum atau perbuatan pidana,’’ katanya. Ia menambahkan, jika para ahli terkait menyatakan semua yang dilakukan telah sesuai prosedur dan tidak ada menyalahi peraturan perundang-undangan, tidak ada unsur perbuatan

Oposisi Dan Aliansi ... menyatakan akan melanjutkan rencana untuk rekonsiliasi nasional. Dalam satu pernyataan, kantor kepresidenan menyatakan delarasi militer bisa menimbulkan kebingungan dan kepresidenan akan melanjutkan jalan menuju rekonsiliasi nasional. Pernyataan itu mengecam ‘deklarasi yang akan memperdalam perpecahan’ dan ‘mengancam perdamaian sosial’ di negeri itu. Moursi, menurut pernyataan itu, sedang berkonsultasi ‘dengan semua kekuatan nasional untuk mengamankan jalan perubahan demokratis dan perlindungan kehendak rakyat.’ “Negara demokratis sipil Mesir adalah salah satu prestasi paling penting dari revolusi 25 Januari,” kata pernyataan merujuk pada pemberontakan tahun 2011 yang menggulingkan diktator Hosni Mubarak. “Mesir benar-benar tidak akan mengizinkan langkah mundur apapun keadaannya.” Pendukung Moursi di Ikhwanul Muslimin mengatakan dalam membela dia, mereka membela legitimasi presiden pertama yang terpilih secara demokratis, yang baru berada di kantor kepresidenan selama setahun. “Kami tidak mendukung kudeta militer,” kata Front Keselamatan Nasional (NSF) yang oposisi dalam pernyataan. “NSF telah berjanji, sejak dibentuk 22 November 2012 untuk membangun negara sipil, modern dan demokratis yang mengizinkan partisipasi seluruh aliran politik termasuk politik Islam. Kami percaya pernyataan militer itu, yang tercermin dalam pernyataan mereka (Senin) bahwa mereka tidak ingin melibatkan diri dalam politik, atau memainkan satu peran politik,” katanya. Kelompok itu menegaskan bahwa tuntutan kepada Presiden Mohamed Moursi untuk mundur tidak melanggar prinsip demokrasi tetapi adalah satu usaha untuk membawa pemberontakan tahun 2012 yang menggulingkan Presiden Hosni Mubarak kembali pada jalurnya. “Mendesak Moursi mundur tidak bertentangan dengan prosedur demokrasi. Tidak ada tuntutan-tuntutan revolusi itu dipenuhi, Moursi dan (Ikhwanul Muslimin) membawa negara itu ke arah lain yang terutama tercermin pada keinginan mereka untuk menguasai negara dan tidak membangun demokrasi (kebebasan) atau berhasil memperbaiki standar hidup rakyat Mesir dan memberikan kebutuhan-kebutuhan pokok mereka,” kata NSF. Tetapi aliansi partai Islam, dalam pernyataannya menyeru rakyat Mesir agar membanjiri negeri itu untuk mempertahankan keabsahan. “Kami menyampaikan penghormatan bagi prinsip damai dan dipeliharanya darah rakyat Mesir,” aliansi tersebut menambahkan. Aliansi itu mendesak semua rakyat agar mendukung keabsahan rakyat dan menentang setiap jenis kudeta dan menyatakan menghormati keinginan rakyat dan keabsahan konstitusional bagi pemilihan umum dengan keinginan kuat perujukan nasional, demikian laporan Xinhua. Aliansi tersebut menanggapi satu pernyataan yang dikeluarkan Senin oleh Angkatan Bersenjata, yang memberi semua partai politik waktu 48 jam untuk menyelesaikan krisis itu, sebelum memberlakukan peta jalan yang diawasi militer bagi masa depan Mesir. “Angkatan Bersenjata takkan menjadi bagian dari politik atau kekuasaan,” kata Menteri Pertahanan Abdel-Fattah As-Sisi di dalam pidato audio yang ditayangkan televisi resmi. Dia mengatakan tenggat 48-jam merupakan ‘kesempatan terakhir’ bagi semua pihak untuk memenuhi tuntutan rakyat dan menyelesaikan krisis. Dia menyebut kondisi saat ini ‘bersejarah.’ Sementara itu, jurubicara militer Ahmed Ali menyatakan di jejaring resmi Angkatan Bersenjata bahwa disiplin dan budaya militer tak mengizinkan ‘kudeta militer.’ Dia menggambarkan pernyataan oleh As-Sisi sebagai ‘interaksi’ dengan rakyat. Suasana tegang masih menyelimuti Mesir. Meskipun pemrotes yang menentang Presiden Mohamed Moursi menyambut baik pernyataan militer, pendukung Moursi juga telah mulai berkumpul di berbagai tempat di Mesir dan bukan di bundaran utama mereka di dekat Masjid Rabi Al-Adawiya di kota Nasr di Kairo Pendukung Presiden Mesir itu menyampaikan solidaritas mereka buat Moursi dan menolak pernyataan militer. (bbc/vn/ant/m10)

Anak Batubara Penderita ... menstabilkan denyut jantung. Alat tersebut bisa dipakai untuk seumur hidup,” katanya. Tetapi, sampai saat ini alat tersebut belum bisa dipasang, Jawaban Problem Catur, mengingat harganya mencapai Rp40 juta, sehingga MuhamTTS Dan Sudoku mad Jamil tidak mampu unDari Halaman Sport. tuk membelinya. Jamil menerangkan, sampai saat ini mereka sudah 40 hari Jawaban Problem Catur: berada di India, sedangkan Salsa 30 hari berada di ruang ICU. Kondisi Salsa sehat, hanya saja 1. Kf7, Kxd5. denyut jantungnya tidak stabil, 2. Gg5+mat. Hitam dan dibutuhkan pemasangan alat Pacemaker untuk menstatak punya langkah bilkan denyut jantung. ‘’ Jika alat tersebut sudah terbaik mencegah terpasang dalam waktu 4-5 hari ke depan Salsa Aqilah sudah bisekakmat ini. sa dibawa pulang ke tanah air,’’ kata Jamil. Ia berharap Pemkab BatuJawaban TTS: bara khususnya, bisa membantu meringankan bebannya, seTTS Topik Kesehatan bab selama ini keberangkatannya ke India, beserta biaya operasi Salsa, ditanggung yayasan tersebut.(c05)

Ada-ada Saja ...

Jawaban Sudoku:

1 7 6 8 2 4 5 3 9

4 3 2 5 9 7 1 6 8

5 8 9 6 1 3 2 7 4

9 6 4 3 8 2 7 5 1

7 5 1 4 6 9 3 8 2

3 2 8 7 5 1 9 4 6

6 1 5 2 3 8 4 9 7

2 4 3 9 7 6 8 1 5

8 9 7 1 4 5 6 2 3

wanita dengan suara tercekat seperti mulutnya sedang disumbat. Otago Daily Times melaporkan, wanita itu bergumam memohon agar dikirimi mobil ambulan ke rumahnya. Karena khawatir korban sedang disekap penjahat, pihak rumah sakit membawa polisi datang ke lokasi dan mendapati wanita itu tak sengaja mengolesi lem super ke bibirnya. “Ambulans menerima panggilan, namun karena suaranya tak jelas, mereka tidak yakin apakah itu adalah peristiwa medis atau seseorang telah disekap,’’ kata Sersan Senior, Steve Aitken yang dilansir Orange, Selasa (2/7). Polisi mengatakan, wanita berusia 64 tahun itu mengambil lem super dan bukan lipbalm untuk mengobati bibirnya saat ia bangun pada tengah malam. Setelah kesalahpahaman tersebut, wanita itu akhirnya dibawa ke rumah sakit untuk menjalani perawatan. (orange/rzl)

melawan hukum. Sehingga kasus tersebut harus dihentikan dan tidak perlu dimintai pertanggungjawaban hukum. Katanya, ketika adanya dugaan korupsi, sejak awal penyidikan sudah harus diverifikasi terhadap UU yang mengaturnya. ‘’ Ini butuh keterangan ahli lain. Hal ini agar tidak salah menghukum orang,’’ ujar Mahmud dan berulangkali menegaskan, penyidik harus betulbetul bisa membuktikan terlebih dahulu ada tidaknya perbuatan pidana dalam dugaan tersebut. “Unsur perbuatan pidana itu dulu yang harus dibuktikan, baru pertanggungjawaban pidananya,” kata dia. Mahmud yang pertama kali menjadi saksi ahli tentang hukuman mati di Mahkamah Konstitusi (MK), itu mencontohkan, unsur penyalahgunaan wewenang dalam Pasal 3 UU No 31 Tahun 1999 tentang Pemberantasan Tindak Pidana Korupsi, menjadi perbuatan melawan hukum ketika seseorang tidak menjalankan tugas pokok dan fungsinya (Tupoksi). Dan, dalam hukum pidana siapa yang berbuat, dia yang harus bertanggungjawab. “Bila seseorang telah melakukan sesuai Tupoksinya, dan

tidak melanggar ketentuan peraturan yang ada, dia tidak melakukan perbuatan pidana,” ujarnya. Mahmud tidak sepakat tindak pidana korupsi masuk dalam delik formil. Menurutnya, khusus Pasal 2 dan 3 UU Tipikor, harus ada ditemukan kerugian negara. Namun, kata dapat menimbulkan kerugian negara dalam kedua pasal itu, berarti ada potensi yang bisa menimbulkan kerugian negara. “Pengembalian kerugian negara tidak menghapus pidana, tapi meringankan pidana,” katanya menjawab Jaksa Penuntut Umum (JPU) Polim Siregar. Pada kesempatan itu, terdakwa RH mengajukan pertanyaan kepada saksi ahli. RH mengatakan bingung kenapa dirinya dijadikan terdakwa dalam perkara dugaan korupsi TPAPD, gara-gara sebagai Sekda Tapsel dia membuat Surat Permintaan Pembayaran (SPP). Menurutnya, dia pernah membuat SPP sebesar Rp480 juta untuk menutupi kekurangan TPAPD 2004. Dia juga membuat SPP triwulan I dan II TPAPD 2005, namun semua SPP tersebut telah dipertanggungjawabkan. “SPP yang saya ajukan su-

dah dipertanggungjawabkan semuanya. Nanti dipemeriksaan saya akan saya buktikan. Saya punya bukti itu, ada tandatangan dan nota dinasnya. Bukti itu tidak ada sama jaksa dan hakim,” katanya. Kemudian, lanjutnya, terjadi masalah dalam penyaluran TPAPD 2005 triwulan III dan IV saat dirinya sudah tidak menjabat Sekda Tapsel lagi. Lantas dia menanyakan apakah tugasnya membuat SPP tersebut bisa dikriminalisasi? Menjawab pertanyaan tersebut, saksi ahli mengatakan, hukum pidana harus terukur. Jika tidak terukur akibatnya bisa fatal , yakni seseorang bisa dihukum bukan karena kesalahannya. Ukurannya, kata ahli, adalah dari awal penyidikan suatu dugaan, penyidik harus mengakumulasi aspek-aspek lain di luar hukum pidana, untuk memastikan ada tidaknya pelanggaran. Tetapi, menurutnya,hal ini sering kali tidak dilakukan penyidik. Usai mendengarkan saksi ahli dari penasehat hukum terdakwa, sidang ditunda hingga Kamis (4/7), dengan agenda saksi ahli dari JPU, sekaligus direncanakan agenda pemeriksaan terdakwa. (m38)

Gempa Guncang Aceh ...

gempa telah menyesaki RSU Datu Beru Takengen. Korban luka yang dirawat di RS Datu Beru tercatat 140 orang (data dari Sekretariat BPBD Aceh Tengah). Di RSU Bener Meriah 90 orang. Sedangkan bangunan dan jalan yang rusak terdapat di beberapa titik. Erwin, 28, salah seorang warga Lhokseumawe mengaku panik saat peristiwa itu terjadi. Dia berusaha keluar dari rumah untuk menghindari terjadinya hal-hal yang tidak diinginkan. Warga berhamburan ke badan jalan takut terjadi reruntuhan bangunan. Getaran gempa juga dirasakan warga Aceh Utara.Namun, aktivitas masyarakat di Kab. Nagan Raya berjalan lancar setelah gempa mengguncang Aceh. Kepala Badan Meteorologi, Klimatologi dan Geofisika (BMKG) Nagan Raya Haijol Risfan, Selasa (2/7) mengatakan, gempa yang terjadi tidak menyebabkan warga di Nagan Raya panik. Ia menambahkan kepada masyarakat Nagan Raya supaya berhati- hati kemungkinan ada gempa susulan, tapi tidak terlalu besar. Posko Badan Nasional Penanggulangan Bencana (BNPB) mengakui korban gempa su-

dah dirawat di rumah sakit. Menurut Kepala Pusat Data Informasi dan Humas BNPB Sutopo Purwo Nugroho, di Jakarta, Selasa (2/7), BPBD setempat masih melakukan pendataan. Sementara itu, sejumlah rumah warga yang rusak juga terjadi di Kec. Bener Gelipah, Bener Meriah. Ketua DPD Sentra Komunikasi (Senkom) Mitra Polri Kab. Bener Meriah Suroto saat dihubungi dari Banda Aceh mengaku guncangan gempa cukup kuat. “Kami sudah mengerahkan personil anggota Senkom ke lokasi untuk membantu masyarakat dan sekaligus mendata jumlah rumah yang roboh,” katanya.(cb09/b32/b33/ b18/cb07/ant)

sama bapak nak,” kata seorang warga saat gempa berlangsung dan meminta bantuan ke tetangga terdekat. Kejadian ini tepat di hadapan Waspada yang kebetulan sedang melintasi daerah Kp. Paya Tumpi, Aceh Tengah. Selang beberapa saat, hal serupa dialami seorang anak lain, tampak orang tua korban menangis histeris, meminta pertolongan. Selanjutnya, meski situasi panik, masyarakat berupaya membawa korban ke lokasi pelayanan medis terdekat. Informasi lainnya menyebutkan, ratusan rumah yang dilaporkan rusak terjadi di sejumlah kecamatan di Aceh Tengah dan Bener meriah. Daerah tersebut di antaranya, Kute Panang, Bloc C, Blang Mancung, Paya Tumpi Lampahan dan sejumlah tempat lainnya. Dalam suasana panik, gempa susulan terjadi berulang kali. Bahkan, gempa susulan yang terjadi pukul 21:5 di Gayo guncangannya terasa lebih keras, sehingga warga berhamburan ke luar menerobos hujan deras yang mengguyur daerah itu. Informasi lainnya yang diterima, saat ini puluhan korban

Gubsu Tinjau ... belum ada kendala serius. Dia juga mengapresiasi Kantor Pos Medan yang sigap memberikan layanan. “Ada lebih kurang 745 ribu Rumah Tangga Sasaran (RTS) di Provinsi Sumut. Sementara ini yang kita evaluasi adalah sudah tepat sasaran karena kita punya pekerja sosial yang turut mendampingi dalam proses pendataan,” ujar Gubsu. Namun, diakui Gubsu, ada beberapa warga yang belum mendapatkan BLSM karena kuota atau jumlah yang disalurkan tidak sebanyak jumlah RTS. Sementara itu, Kepala Area

USU Sediakan ... “Seperti biasanya Fakultas Kedokteran dan Ilmu Kesehatan, hukum, dan ekonomi peminatnya tinggi, “ kata Prof. Zulkifli didampingi Kabag Humas USU, Bisru Hafi. Dia menjelaskan, UMB-PTN adalah seleksi penerimaan mahasiswa baru yang digelar 13 perguruan tinggi negeri (PTN) di seluruh Indonesia. Ketigabelas PTN yang tergabung dalam UMB-PT 2013, yaitu: Universitas Syiah Kuala (UNSYIAH) Banda Aceh, Universitas Malikussaleh (UNIMAL) Lhokseumawe,Universitas Sumatera Utara (USU) , Universitas Jambi (UNJA) Jambi, , Universitas Negeri Jakarta (UNJ) , Universitas Negeri Jenderal Soedirman (UNSOED) Purwokerto, Universitas Diponegoro (UNDIP) Semarang, Universitas Palangkaraya, Universitas Islam Negeri Alauddin Makassar, Universitas Sultan Ageng Tirtayasa (UNTIR-

Tersangka Pembakaran ...

Ritel Sumatera Utara dan Aceh PT Pos Indonesia, Herman menyampaikan, sejauh ini tidak ada kendala dalam pembayaran. ‘’Periode pembayaran empat bulan ini untuk tahap pertama. Tahap kedua dijadwalkan setelah Lebaran. Sampai saat ini untuk Medan hampir 70 persen telah tersalurkan dari 73.110,” katanya. Bagimasyarakatyangtempat tinggalnya jauh dari Kantor Pos, lanjut Herman, pihaknya akan mempermudah dengan layanan komunitas. Layanan ini dilaksanakan dengan cara petugas yang mendatangi masyarakat di tempat tertentu. (m28)

KH Johari. Modus yang dilakukan sengaja membakar lahan milik tersangka seluas 65 hektare dengan menggunakan bensin dan dampak lahan yang terbakar seluas 400 hektare dan 270 warga ikut mengungsi. Lalu di Polres Pelalawan ada satu kasus dengan tersangka Sumardi dengan modus yang dilakukan membakar lahan seluas 1,5 hektare dengan menggunakan potongan ban bekas yang disiram bensin. Di Polres Siak, ada satu kasus dengan satu tersangka bernama Taufik dengan tempat kejadian perkara di Jalan Doral Km 14, Sungai Rawa. Modus melakukan pembakaran lahan milik PT Rara Abadi seluas 2 hektare, dan mengakibatkan kebakaran meluas menjadi 20 hektare. Sedangkan Polres Dumai ada dua kasus dengan tersangka Eka Saputra. Lahan yang terbakar kurang lebih 50 hektare dan satu kasus lagi masih dalam tahap penyelidikan dengan lahan yang terbakar 48 hektare. (j02)

TA) Banten, Universitas Borneo (UB) Tarakan, dan Universitas Terbuka (UT) Jakarta. Disamping PPL yang ada tersebut, PanitiaPusatjugamembukaoulet dibeberapa daerah seperti Padang, Pekanbaru, Palembang, Lampung, Tangerang, Bogor, Bandung, dan Surabaya. MasapendaftaranUMB-PTN dibuka 27 Mei hingga 19 Juli 2013, secara online melalui website: http// ‘’Ujian tulis bagi seleksi UMB-PT dijadwalkan Minggu 21 Juli 2013 mulai pukul08:00.Hasilujiantulis dari seleksi ini diumumkan pada 28 Juli pukul 18:00 melalui website panitia.Tata cara pendaftaran UMB dilakukan secara online melalui website/situs atau,’’ katanya. Peserta terlebih dahulu melakukan pra registrasi pada situs tersebut, selanjutnya melakukan pembayaran biaya pendaftaran di BNI terdekat. Setelah itu, peserta dapat melakukan pen-

cetakan kartu ujian. Bagi peserta yang tidak melakukan pencetakankartuujian,dianggapmengundurkan diri. Bagi peserta yang memilih PTN Mandiri USU, diharuskan memilih jenis pembayaran dengan pilihan dua kelompok ujian terdiri dari IPA atau IPS (tidak ada IPC). Padamasing-masingpilihan kelompok ujian tersebut, peserta dapatmemilihsebanyak-banyaknya tiga pilihan program studi. Daya tampung USU melalui UMB-PT sebanyak 1.544 orang, terdiri dari 819 Kelompok IPA dan 725 Kelompok IPS. Kabag Humas USU Bisru Hafi menambahkan, tahun ajaran baru ini, USU menerima mahasiswa melalui tiga jalur masingmasing berdasarkan persentasi yang sudah di tentukan, yaitu 50 persen lewat SNPTN atau sejumlah 3.936 mahasiswa, SBMPTN 10 persen atau 2.406 mahasiswa, dan 40 persen dari jalur mandiri atau sejumlah 1.544 mahasiswa. (m49)

Al Bayan ... Beliau melihat sahabatnya itu pucat dan kurus. “Ada apa denganmu wahai Abubakar?”. Tanya baginda. “Saya kelaparan ya Rasulullah! Jawab Abubakar dengan perasaan lemah. Kebetulan kedua manusia utama itu samasama dalam kelaparan, “Saya juga sudah tidak makan beberapa waktu!” ujar Nabi. tetapi keduanya bersabar karena malu meminta-minta. Tibatiba putra Abdurrahman bin Auf (dermawan paling kaya) datang mengundang keduanya agar makan siang. Alhamdulillah! Keduanya makan sampai kenyang. Sabar tentu bukan hanya dalam masalah menahan lapar. Sabar harus selalu menghiasi ibadah kepada Allah SWT. Misalnya; ada godaan nafsu supaya berbuat maksiat, maka kita harus bersabar untuk tidak memperturutkan hawa nafsu, malah kita harus tetap sabar dalam keistiqamahan dalam berbuat amal kebajikan. Kekurangan harta jangan menghalangi lang-

kah kita untuk berbuat amal shaleh. Orang-orang yang menghiasi dirinya dengan sifat sabar akan diberi kesuksesan dalam usahanya, cita-citanya, bahkan surga di hari pembalasan kelak. Bersabar itu wajib hukumnya sedangkan tergesa-gesa dari setan. Para Nabi yang mendapat gelar Ulul Azmi karena kesabarannya dalam mengembangkan agama Allah sangat luar biasa. Ibrahim menghadapi Namruz yang kejam, Musa menghadapi Firaun yang zalim, Noh menghadapi kaumnya yang keras kepala, Isa dengan orang-orang yang durhaka, Muhammad menghadapi kaum musyrikin Mekkah dan Yahudi Madinah. Rasulullah bersabda: Kesabaran itu cahaya yang benderang, (HR: Muslim). Ali bin Abi Thalib berkata: Bagi orang mukmin kesabaran adalah suatu nikmat dari-nikmat Allah, sebaliknya bagi orang munafik kesabaran sesuatu yang sangat tidak nikmat. Mudah-mudahan kita yang sedang mendapat cobaan Allah SWT selalu dalam bersabar. Amin!


PARA peserta seminar APEC Temu Kampus di Hotel Grand Aston Medan berhamburan keluar dari dalam hotel ketika terjadi gempa, Selasa (2/7).

Medan Juga ... Disinggung soal kemungkinan terjadi gempa susulan Badan Meteorologi, Klimatologi, dan Geofisika (BMKG) mencatat sampai pukul 16:00 sudah terjadi tiga kali gempa susulan dengan kekuatan gempa yang lebih rendah dari gempa pertama. “sudah tiga kali terjadi gempa susulan, kemungkinan akan terus terjadi gempa susulan namun kekuatannya lebih kecil,” ungkapnya. Masyarakat diimbau tetap waspada kemungkinan terjadi gempa susulan yang lebih besar yang sewaktu-waktu bisa saja terjadi. Namun, gempa tidak berpotensi tsunami karena terjadi di darat bukan di laut. PesertaAPECBerhamburan Gempa bumi membuat peserta seminar ‘APEC Temu Kampus’ di Hotel Grand Aston City Hall Medan, berhamburan keluar. Kegiatan yang digelar Kementerian Komunikasi dan Informasi, Kementerian Luar Negeri, bekerjasama dengan Universitas Sumatera Utara (USU) dengan tajuk ,’’ Penguatan Kerjasama Asia Pasifik Melalui Peningkatan Kompetensi Sumber Daya Manusia ‘’, itu terpaksa dihentikan selama 30 menit. Pihak hotel mengevakuasi peserta yang sebagian besar mahasiswa dan dosen. Mereka dievakuasi melalui tangga darurat keluar ke pintu belakang Grand Aston. Sementara itu, di bagian lobbydepan,beberapatamutampak panik sambil setengah berlari

Listrik Panas ... GM Pembangkit Sumbagut Bernadus Sudarmanta dan sejumlah staf. Rapat dengar pendapat hari itu untuk mencari masukan kepada Panitia Khusus (Pansus) Kelistrikan DPRD Sumut, diketuai H. Ajib Shah. Topik utama rapat dengar pendapat itu, mempertanyakan komitmen PT PLN untuk tidak memadamkan listrik, khususnya pada bulan Ramadhan. Dewan mengakugusardenganpernyataan pihak PLN yang sebelumnya menyebutkan, tidak menjamin listrik akan tetap hidup pada bulan puasa. Menurut pengamatan Waspada, anggota Komisi D, bereaksi begitu GM PLNWilayah I Sumut Diananto, usai memberikan penjelasan tentang masalah kelistrikan di daerah ini. Anggota dewan menilai, alasan pihak PLN sangatklasikdantidakmasukakal. Diananto memaparkan sejumlah kendala yang dihadapi dalam pengadaan listrik untuk konsumen. Diantaranya, usia kabel bawah tanah yang sudah tua.Yaknimulaitahun2001.Selain itu, di Medan sangat banyak pohon rimbun yang menghalangi jaringan listrik. Alasan lain ditambahkan GM PembangkitSumbagutBernadus Sudarmanta, situasi kelistrikan banyak dipengaruhi pembangkit yang perlu perawatan. ‘’ Saat ini PLN sedang merawat mesin pembangkit GT-11 dan GT-12 yang berada di Belawan. Kondisi inimemaksaPLNmemadamkan listrik secara bergiliran,’’ katanya. Selama ini, katanya, PLN berusahatidakmelakukanperawatan dengan harapan program tambahan daya masuk. Namun hal itu belum bisa terwujud. Karena pembangkit Nagan Raya belum juga beroperasi, dan pembangkit Labuhan Angin (Sibolga) tidak maksimal menyuplai daya.

keluar. Bahkan seorang pria paruh baya tampak keluar hanya mengenakan sarung dan kaos dalam saja. Kebetulan pada hari itu, tidak ada jadwal pertemuan SOM III APEC di hotel tersebut. “Hari ini tidak ada pertemuan APEC di Grand Aston,” kata General Manager Grand Aston Medan Wahyono yang ikut keluar bersama para pegawai dan tamu-tamu hotel. Direktur Informasi dan Media Kementerian Luar Negeri RI P.L.E Priatna, yang menjadi pembicara pada seminar APEC Temu Kampus tersebut mengatakan, gempa dirasakan cukup kuat di dalam ruangan. “Saya melihat lampu-lampu semua bergoyang dan peserta mengatakan ada gempa. Akhirnya peserta dievakuasi dibantu

petugas keamanan hotel,” ujar Priatna. Setelah menunggu sekitar 20 menit, para peserta seminar APEC Temu Kampus kembali masuk untuk melanjutkan seminar. Meski getaran gempa ini belangsung sekira satu menit, namun sejumlah penghuni gedung perkantoran dan hotel di Medan sempat berhamburan keluar. Sementara itu, di Hotel Santika Medan tempat berlangsungnya pertemuan SOM III APEC 2013, para peserta delegasi dari berbagai negara tidak terlihat keluar dari dalam ruangan. Mereka tetap melaksanakan rapat. Bahkan, pihak panitia yang berada di lantai 1, mengatakan tidak merasakan ada gempa. (cay/m41)

Mantan Ketua DPRD Sumut ... Sumut pada tahun 1982-1992, Ketua Golkar Sumut pada tahun 1984-1988, dan Ketua Umum DHD Angkatan 45 Sumut pada tahun 1982-1993, serta diperbantukan pada Dubes RI di Karachi, Pakistan pada tahun 1965.Pada 1960- 1965, H Raja Sjahnan menjabat sebagai wakil gubernur Sumut. Atas pengabdiannya, H.Raja Sjahnan menerima sejumlah penghargaan, antara lain, Bintang Darma, Bintang Gerilya, Bintang Kartika Eka Paksi, Bintang Sewindu APRI, Satya Lencana Kesetiaan XXIV, Satya Lencana PK-I, Satya Lencana PK-II, Lencana GOM-V dan VII , dan Satya Lencana Sapta Marga, Satya Lencana Wira Darma serta Satya Lencana Penegak. Almarhum meninggalkan tujuh anak, yakni, Husni Kesuma, Dewi Fauziah, Netti Darwisyah, Helmi Indra, Melfi Faridah, Hardi Kelana (almarhum), dan Rusli Perana. Pantauan Waspada di rumah duka, jenazah almarhum tiba di Medan dari Singapura sekira pukul 21:30.Karangan bunga duka cita terus berdatangan dari para pejabat di Sumatera Utara, keluarga, rekan dan sahabat serta orang-orang dekat almarhum. Seperti karangan bunga duka cita dari Gubsu H Gatot Pujo Nugroho dan Wagubsu Tengku Erry Nuradi. (m49) PLN Bobrok Sedangkan,ZulkifliEffendiSiregar anggota Komisi D yang pertama bereaksi menanggapi pernyataan pihak PLN mengatakan, manajemen PLN bobrok. ‘’ PLN selalumenyebutkanalasanklasik. Masalahperawatan,jaringanterkenapohondanlainnya,’’kataZulkifli. ‘’ Kasihanlah melihat rakyat. Lampu mati tidak beraturan, semaunya PLN saja. PLN bobrok betul,’’ imbuh Zulkifli Siregar. Menurut Zulkifli, semua yang disampaikan PLN tidak sama dengan yang dirasakan masyarakat. Mati lampu bergilir paling lama tiga jam pun dibantah Zulkifli Siregar. “Hampir setiap hari listrik mati. Waktunyapun tidak beraturan.Tadipagidirumahsayalampu mati pukul 05:00. Sampai saya berangkat ke DPRD pukul 09:00, lampu belum nyala,’’ katanya. Zulkifli mengatakan rakyat dapat mentolelir kalau hanya sekali atau dua kali lampu mati tibatiba.Tapi,ituterjadisewaktu-waktu.PLNtidakpernahmenjelaskan kapan lampu akan padam. ‘’PLN suka-suka saja mematikan lampu,’’ katanya. Hal yang sama disebutkan anggota dewan lainnya, yakni Ramli. Menurut anggota Komisi D ini, dia sudah bosan bertemu pihak PLN, karena hasilnya tidak ada. ‘’Tapi, karena tanggungjawab jabatan, terpaksalah bertemu lagi.Dia berharap ada sesuatu yang baru untuk masyarakat,’’ kata Ramli dan menambahkan, alasanyangdisampaikanGMPLN sangat mengada-ada. ‘’Kalau alasannya karena di Kota Medan banyak pohon yang menghalangi jaringan, logikanya listrik padam hanya untuk Kota Medan.Tapi kenapa rumah pejabat teras tidak pernah mati lampu. Juga mengapa di Nias, yang jaringannya berbeda juga mati lampu?,’’ kata Ramli. Campakkan data Hal paling ekstrim dilakukan

oleh anggota Komisi D, Marahalim Harahap. Karena kesal, dia sampaimenyampakkandatayang dipegangnya, karena pihak PLN tetapmenyebutkansaatiniSumut terjadi defisit listrik. Datanya berbeda-beda. Ada pihak PLN yang menyebut defisit 400 mega watt (MW), ada yang bilang 150 MW, 200MWdan250MW.Dewanpun mengaku bingung melihat pernyataan pihak PLN yang hadir. MarahalimHarahap,mengaku memiliki data berbeda yang diaperolehdarieksposePLNpada rapat dengar pendapat dengan Komisi D beberapa bulan lalu. Menurut data itu, walaupun Sumut telah menyuplai listrik ke Aceh 66 MW dan Riau 50 MW, tapi masih juga memiliki cadangan 38 MW. Dia mengaku heran, mengapa hari itu pihak PLN mengatakan defisit. ‘’Apakah yang saya pegang ini bukan data PLN? Kalau ini diakui data PLN, mengapa saat ini kalian menyebut Sumut defisit daya,’’ katanya sambil menyampakkan data tersebut. Pada rapat dengar pendapat hari itu, Komisi D DPRD Sumut tetap‘ngotot’ meminta PLN tetap menghidupkan listrik pada bulan Ramadhan. Upaya yang akan dilakukan adalah membuat rekomendasikepadapimpinanDPRD untuk membuat surat kepada Gubsu. Isinya meminta Gubsu untuk berbicara dengan Dirut PT Inalum. Ketua Pansus Kelistrikan DPRD Sumut H. Ajib Shah mengatakan, seusai dengan penjelasan Bapeda Sumut kepada Pansus, diketahuikalauPTInalummemiliki cadangan daya listrik sekitar 250 MW. Karenanya Pansus berharap, Gubsu bersedia bertemu denganDirutPTInalumuntukmeminta memasok daya ke Sumut sekitar 150 MW. ‘’Yang krusial ke depan adalah bulan Ramadhan. Jangan sampai lampu mati pada saat itu,’’ kata Ajib Shah. (m12)

Medan Metropolitan

WASPADA Rabu 3 Juli 2013


Polisi Lamban Atasi Kejahatan Sepekan, Dua Warga Negara Asing Dirampok MEDAN (Waspada): DPRD Kota Medan menilai kinerja jajaran Kepolisian Daerah Sumatera Utara (Poldasu) khususnya Polresta Medan lamban dalam mengatasi aksi kejahatan terutama di jalan raya. Indikasi menurunnya kinerja kepolisian ini ditandai dengan maraknya aksi perampokan di jalan raya. Apalagi dalam waktu sepekan, tercatat dua warga negera asing yakni turis Australia dan peserta konferensi APEC yang menjadi korban perampokan. “Maraknya aksi kejahatan di Kota Medan akibat lambannya kinerja kepolisian dalam memberi pengamanan di tengah-tengah masyarakat,”

kata anggota DPRD Medan Ilhamsyah kepada Waspada di Medan, Selasa (2/7). Menurut Ilhamsyah, pihak kepolisian tidak boleh sekadar berwacana dalam meningkatkan pengamanan di Kota Medan dan sekitarnya, tapi harus melakukan tindakan tegas dan nyata. Dalam hal ini, polisi tidak bisa tinggal diam. Sebab aksi kejahatan di Kota Medan semakin meresahkan masyarakat. Bila perlu, pelaku kriminal seperti perampokan harus ditembak di tempat. Ilhamsyah pun menggarisbawahi kinerja polisi, yakni banyaknya kasus kejahatan seperti perampokan dan pencurian yang terjadi di Kota Medan mengindikasikan aparat kepolisian belum bekerja maksimal.

“Ini sangat meresahkan masyarakat,” tambahnya. Karena itu, Ilhamsyah meminta pihak kepolisian agar pro aktif menumpas kejahatan. Pihak kepolisian diminta menempatkan personel di sejumlah lokasi tertentu yang dianggap rawan. Selain itu, agar masyarakat tetap percaya kepada pihak keamanan, polisi harus memberitahukan kepada masyarakat bila berhasil mengungkap kasus kejahatan. “Kalau polisi berhasil mengungkap satu kejahatan, maka harus diberitahu kepada masyarakat melalui media massa. Hal ini dilakukan agar masyarakat jangan sampai merasa apatis terhadap pihak kepolisian,” jelasnya. Menurutnya, jaminan perlindungan dan keamanan yang

sudah diberikan pihak kepolisian saat ini belum maksimal dan belum sesuai kebutuhan masyarakat. Sementara itu, Anggota Komisi A DPRD Medan dari Fraksi Partai Amanat Nasional (PAN) Drs. Aripay Tambunan, MM mengatakan, keamanan harus mendapatkan prioritas dari pihak kepolisian. Seharusnya, tingkat keamanan untuk peserta konferensi APEC harus dilakukan secara berlapis. Sebab, kegiatan tersebut berskala internasional. Dari hasil kunjungan Komisi A DPRD ke Polresta Medan, lanjut Aripay, diperoleh penjelasan secara detail dari Kapolresta bahwa personel polisi untuk menjaga stabilitas keamanan khususnya di Kota Medan masih sangat kurang.

“Harusnya jumlah personel polisi dilipatgandakan dari jumlah yang ada saat ini untuk mengamankan Kota Medan dari aksi kriminalitas. Bagaimana polisi bisa bekerja maksimal jika jumlah personelnya sangat minim. Artinya, jumlah pelaku kejahatan lebih besar dari jumlah personel polisi

untuk mengatasi aksi kejahatan tersebut,” papar Aripay Anggota Komisi A DPRD Medan ini juga berpendapat, bagaimana mungkin polisi bisa mengayomi masyarakat khususnya untuk konferensi APEC jika jumlah personelnya yang ditempatkan di lokasi rawan kejahatan juga kurang.

Namun, lanjut Aripay, pihaknya menerima masukan dari Polresta Medan bahwa polisi akan menyurati perusahaanperusahaan seperti perbankan, hotel dan kantor-kantor pemerintah maupun swasta untuk melengkapi kantornya dengan CCTV. Hal ini dimaksudkan sebagai langkah protektif awal

untuk mengatasi tindak kejahatan. Pihak kepolisian juga segera membentuk polisi desa yang pernah ada pada tahun 1980an. Masyarakat di setiap desa/ kelurahan akan dilibatkan untuk menjaga keamanan dengan dibina oleh satu personel polisi.(m30)

Pengurus Pondok Pengajian Laporkan Mantan Murid Ke Polisi MEDAN (Waspada): Pengurus Pondok Pengajian Ihya Ulumiddin di Jln. Karya Bhakti, Kec. Medan Johor, mengadukan mantan muridnya ke Polresta Medan, dengan sangkaan telah menebar fitnah dan penistaan terhadap agama, Selasa (2/7). H Rudi Suwarno selaku Khalifah sekaligus pengurus di pondok pengajian tersebut didampingi para jamaah di antaranya H Abdul Rahim dan Rico Purba kepada wartawan di Polresta Medan mengatakan, laporan tertuang dengan nomor laporan polisi Nomor : STTLP/ 1772/K/VII/2013/ Resta Medan. Dalam laporan yang diterima Aiptu S Pangaribuan tersebut, tertulis orang yang dilaporkan masing-masing, Ar, Ef, Su, HM, dan CS. Terlapor dijerat pasal 311 yo 156 yo 156 a KUHPidana dengan ancaman hukuman 5 tahun penjara. Dijelaskan, mereka melaporkan mantan murid yang telah menebar fitnah karena menuding guru besar meraka telah berbuat cabul terhadap murid wanita yang ada di pondok pengajian tersebut. “Kami melaporkan mantan murid ke polisi karena mereka telah menebar fitnah, tuduhan palsu melalui media dan penistaan terhadap agama,” kata Rudi Suwarno diamini jamaah lainnya yang siang itu turut melapor ke polisi.

Dijelaskan Rudi Suwarno, mantan murid pondok pengajian itu nekat berbuat demikian karena pimpinan pondok pengajian mengetahui perbuatannya mengundang para jamaah khususnya kaum ibu untuk datang ke rumah dan mengutip uang untuk kepentingan pribadi dari kaum ibu yang datang. Tak hanya Su, suaminya juga berinisial HS ketahuan menyalahgunakan dana STM. Sehingga mantan murid itu melakukan aksi balas dendam dengan menebar fitnah. “Penyebabnya kami lihat karena permasalahan ekonomi. Mantan murid itu ketahuan oleh guru besar kami memungut uang dari jamaah dengan dalih untuk pondok pengajian tapi nyatanya tidak. Guru besar lalu memanggil mereka untuk klarifikasi, namun mereka tidak mengindahkan pemanggilan sampai batas waktu yang ditentukan. Akhirnya mereka diberhentikan dan dikeluarkan dari pengajian. Baru beberapa bulan yang lalu mereka diberhentikan, akhirnya kami mendengar kabar jika mantan murid itu membuat pernyataan di media dan bahkan sampai kepada polisi dan MUI, Su itu mengaku telah disetubuhi oleh AA, gurunya. Parahnya lagi, sampai-sampai menuding mantan gurunya telah mengajarkan ajaran sesat kepada jamaahnya, itu semua

tidak benar, itu fitnah. Kami berani menjamin bahwa tidak ada satupun ajaran dari guru besar kami yang dapat diindikasi atau dikategorikan sebagai ajaran sesat. Ajaran yang ada di pengajian kami dilandasi oleh Alquran dan Sunnah,” kata Rudi Suwarno. Kata dia, beberapa jamaah wanita yang disebut-sebut mantan murid telah digauli oleh guru besar mereka juga membantah semua keterangan Su. “Murid wanita kami undang

untuk memberikan keterangan langsung kepada MUI, masingmasing N, M, F, R, LF, M, R, I mereka tadi telah disumpah diatas Alquran, mereka membantah keras keterangan mantan murid kami itu. Kan berarti mantan murid itu sengaja merekayasa dan mencemarkan nama baik pengajian kami,” sebutnya. Suwarno mengimbau kepada jamaah lainnya agar tidak terprovokasi dan terpancing dengan isu-isu yang tidak bertanggungjawab. (m39)

Tewas Ditabrak Truk MEDAN (Waspada): Pengendara sepeda dayung Yusman, 56, warga Jln. Balaidesa, Kel. Timbangdeli, Kec. Medan Amplas, tewas tertabrak dump truk di Jln. Sisingamangaraja depan Auto 2000 Medan, Selasa (2/7) sekira pukul 11:00. Jenazah korban selanjutnya dibawa ke rumah duka, sedangkan sopir dump truk BK 9860 BL Hirmansah Lubis, 51, warga Jln. Garu VI, Kec. Medan Amplas, diamankan di Sat Lantas Polresta Medan. Informasi yang diperoleh di kepolisian, kejadian berawal saat dump truk baru saja keluar dari bengkel Setia di Jln. Sisingamangaraja menuju arah ke Medan, namun dari arah berlawanan muncul pengendara sepeda dayung. Diduga sopir dump truk tidak melihat pengendara sepeda dayung itu, sehingga menabraknya. Akibatnya, korban langsung tergilas dump truk. Petugas Unit Laka Sat Lantas Polresta Medan Aiptu Asram Nasution yang tiba di lokasi tabrakan segera mengamankan sopir dump truk ke Unit Laka Sat Lantas Polresta Medan, sedangkan dump truk BK 9860 BL diamankan di Pergudangan Jln. Kayu Putih, Kec. Medan Deli. “Pengendara sepeda dayung meninggal saat dalam perjalanan menuju rumah sakit. Jenazah korban langsung dibawa ke rumah duka, sedangkan sopir dump truk diamankan di Unit Laka Sat Lantas Polresta Medan,” ujar Asram Nasution.(h04)


Medan Metropolitan

WASPADA Rabu 3 Juli 2013

Surya Paloh Akan Buka Orientasi Para Caleg NasDem Se-Sumut MEDAN (Waspada): Partai Nasional Demokrat (NasDem) Sumatera Utara, Jumat (5/7), menggelar Orientasi bagi 625 calon legislatif (Caleg) untuk daerah pemilihan Sumut I dan Sumut III, di Medan International Convention Centre (MICC) di Jln. Gagak Hitam/Ringroad Medan. Demikian dikatakan Ketua DPW Partai NasDem Sumut H.M.Ali Umri, SH,MKn didampingi Ketua Panitia H.OK. Tun Hidayat yang juga Ketua Bapillu Partai NasDem serta Humas NasDem Refwandi Sanan kepada wartawan di kantor NasDem Sumut Jln. Sudirman Medan, Selasa (2/7). Menurut Ali Umri, peserta yang akan mengikuti orientasi adalah caleg partai NasDem meliputi Dapil Sumut I untuk caleg DPR RI daerah Medan, Deliserdang, Serdang Bedagai dan Tebingtinggi. Untuk Dapil Sumut III DPR RI caleg dari Kota Binjai, Kabupaten Langkat, Karo, Dairi, Pakpak Bharat, Tanjungbalai, P.Siantar, Simalungun, Batubara dan Asahan. Secara rinci, caleg DPR RI sebanyak 100 orang dan caleg DPRDSU, Kabupaten/Kota 525 orang. Acara orientasi caleg partai NasDem itu, akan dibuka oleh Ketum DPP Partai NasDem H Surya Paloh. Sedangkan Ketua Bapillu DPP Partai NasDem selaku pembicara visi, misi dan kesiapan insfrastruktur Partai NasDem dalam menghadapi Pemilu 2014. Sementara pembicara mengenai strategi membangun dan membina komunikasi publik adalah Prof.Subhilhar. Ph.D Guru Besar Fisip USU. Pembicara menyangkut masalah isu aktual daerah, panitia akan menghadirkan Drs. Edy Sofian, MAP, Kepala Badan Kesbang Provinsi Sumut. Sementara Prof Dr. Bachtiar Aly, MA dari DPP Partai NasDem akan memaparkan makalah tentang program pemenanngan partai NasDem di daerah pemilihan. “Acara ini dilaksanakan sehari penuh. Diharapkan para peserta sudah berada di Medan sehari sebelumnya, karena acara dibuka tepat waktu oleh Ketum Partai NasDem Surya Paloh,” ujar Ali Umri (m22)

Oknum Polisi Cabuli Mahasiswi Dituntut 18 Bulan Penjara MEDAN (Waspada): Personel Polres Sibolga Briptu AS yang didakwa melakukan pencabulan terhadap mahasiswi berinisial UMK, dituntut 18 bulan penjara oleh Jaksa Penuntut Umum (JPU) R Tarigan, pada persidangan tertutup yang digelar di ruang Cakra IV Pengadilan Negeri (PN) Medan, Senin (1/7) siang. “Terdakwa dianggap terbukti bersalah melanggar Pasal 293 KUHPidana,” ujar JPU dihadapan majelis hakim yang diketuai Sugiyanto. Mendengar tuntutan jaksa, terdakwa melalui penasehat hukumnya menyatakan akan mengajukan pembelaan (pledoi) pada pekan depan. Usai persidangan, JPU R Tarigan yang dikonfirmasi wartawan sekaitan dengan hukuman terdakwa yang dinilai ringan meminta wartawan menemui atasannya Asisten Pidana Umum (Aspidum) di Kejaksaan Tinggi Sumut. “Pertimbangannya, tanya saja atasan (Aspidum) dek. Atasan yang tahu itu,” katanya. Pencabulan itu pertama kali terjadi pada 31 Desember 2012 di Hotel Bumi Asih Kota Sibolga. Kemudian berlanjut dilakukan terdakwa pada tempat berbeda. Saksi korban yang masih kuliah itu, dirayu dan diajak berhubungan badan layaknya suami isteri. Karena dijanjikan akan dinikahi, korban akhirnya pasrah atas ajakan terdakwa untuk melakukan hubungan layaknya suami istri. Namun, kenyataannya terdakwa menikah dengan wanita lain. Merasa sakit hati, korban mengadukan perbuatan cabul tersebut ke pihak kepolisian. Usai mendengarkan tuntutan jaksa, majelis hakim menunda sidang hingga pekan depan dengan agenda mendengarkan pledoi terdakwa. (m38)

50 Pengurus OSIS SMA/SMK Ikuti PKP MEDAN (Waspada): Sebanyak 50 peserta dari pengurus OSIS tingkat SMA/SMK sederajat utusan Kabupaten/kota se Sumut, mengikuti pelatihan Kepemimpinan Pemuda (PKP) di Dhaksina Hotel Medan, mulai tanggal 2 s/d 5 Juli 2013. Kadisporasu Ir Khairul Anwar MSi, didampingi Kabid Bina Kepemudaan M Tohir SPd, dan Sekretaris H Sakiruddin SE, MM, dan Drs Sujamrat Amro saat membuka even empat hari tersebut, Selasa (2/7), sangat mengapresiasi seluruh panitia, Pembina, dan para instruktur yang telah mempersiapkan penyelenggaraan pelatihan ini. Menurut Khairul, melalui program ini dapat memberikan harapan yang positif sebagai out put pengembangan, pemberdayaan, dan pembinaan sumber daya pemuda seperti diamanatkan dalam Undang Undang Kepemudaan No. 40 Tahun 2009 khususnya dalam bidang kepemimpinan kepada generasi muda yang tergabung dalam pengurus OSIS Tingkat SMA/SMK kabupaten/kota se Sumut Tahun 2013. Sekaligus merupakan awal persiapan para generasi muda khususnya para pengurus OSIS dalam proses pengembangan diri baik di lingkungan sekolah maupun lingkungan masyarakat. “Kepada seluruh peserta pelatihan yang diutus oleh daerah masingmasing, mengingat masih banyak lagi para pemuda khususnya pengurus OSIS yang belum mempunyai kesempatan untuk mengikuti pelatihan ini, saya berpesan ikutilah kegiatan ini dengan serius dan penuh rasa tanggungjawab serta disiplin,” ujar Khairul. Ketua panitia Rehana Syahbi SE melaporkan, tujuan digelarnya PKP, antara lain untuk mencapai, memahami, dan mampu mengaktualisasikan berbagai aspek kepemimpinan, serta dapat mengekspresikan dan melaksanakan wawasan kebangsaan dan semangat nasionalisme. Serta mampu menghargai dan mengamalkan etika dari moral kepemimpinan.(m24)

Pulmed Studi Banding Ke Multimedia University Malaysia MEDAN (Waspada): Para dosen, staf, dan mahasiswa Politeknik Unggul LP3M (Pulmed) melakukan studi banding ke Multimedia University Malaysia, baru-baru ini. “Hal ini adalah kegiatan rutin tahunan Pulmed dalam upaya merealisasikan visi institusi yaitu menjadi politeknik yang terunggul, terdepan, dan terkenal dalam bidang vokasi,” kata Ketua Pembina Yayasan Pulmed yang juga ketua rombongan kegiatan studi banding HM Nasir Mahmud SE, MSi, MBA, di Medan, Selasa (2/7). Menurut Nasir, dalam kegiatan studi banding ini, pihak Pulmed mendapat sambutan Multimedia University Malaysia. Para mahasiswa dan dosen Pulmed dibawa tour keliling ke Faculty of Creative Multimedia, serta melihat langsung laboratorium pembuatan karya mahasiswa Multimedia University Malaysia. Kegiatan ini, kata dia, diharapkan dapat menambah wawasan dan keahlian para mahasiswa guna menciptakan SDM yang memiliki daya saing yang tinggi. “Kita berharap Pulmed dapat menjalin kerjasama dengan Multimedia University Malaysia dimasa yang akan datang,” ujarnya. Pada studi banding tersebut, pihak Pulmed dan Multimedia University Malaysia saling bertukar cenderamata. Peserta studi banding mengaku sangat antusias untuk mengikuti acara kujungan tersebut, karena dapat memberikan memberikan pengetahuan dan motivasi untuk belajar lebih giat lagi. (cwan)


ROMBONGAN Politeknik Unggul LP3M (Pulmed) foto bersama di depan kampus Multimedia University Malaysia, disela-sela kegiatan studi banding di universitas Malaysia tersebut.

Waspada/Rudi Arman

KANIT Jahtanras AKP Anthoni Simamora saat memaparkan tangkapan sindikat perampok mobil antarprovinsi di Polresta Medan, Selasa (2/7).

Polisi Tangkap Sindikat Perampok Mobil MEDAN (Waspada): Sat Reskrim Unit Jahtanras Polresta Medan menangkap sindikat perampok mobil antarprovinsi dalam penyergapan di Millenium Plaza Jln. Kapten Muslim, Senin (1/7) malam. Dalam penangkapan ini, seorang anggota polisi Aiptu Kondowati dan penarik becak mengalami luka cukup serius setelah ditabrak mobil tersangka. Saat ini, mereka dirawat di rumah sakit terdekat. Kanit Jahtanras Polresta Medan AKP Anthoni Simamora mengatakan kepada wartawan, Selasa (2/7), terungkapnya kasus tersebut setelah polisi mendapat informasi bahwa tersang-

ka H dan FT sedang berada di Millenium Plaza Medan, Senin (1/7) malam. Setelah diintai, ternyata informasi itu akurat. Tersangka sedang berada di dalam mobil Terios warna silver BK 1833 TZ. Polisi langsung menyergapnya. Tidak disangka, tersangka H yang duduk di belakang kemudi mencoba kabur meski sudah dihadang petugas. Tersangka H memundurkan mobilnya kemudian menabrak barisan petugas yang menghadangnya. Akibatnya, Aiptu Kondowati terpental dan mengalami luka-luka. Upaya tersangka untuk melarikan diri kemudian kandas setelah mobilnya kembali menabrak becak bermotor (bettor).

Setelah meringkus tersangka H dan FT, lanjut Anthoni, polisi melakukan pengembangan dan berhasil menangkap Y di kawasan RPH Mabar, tersangka A, serta tersangka F. Polisi juga menyita barang bukti berupa truk colt diesel dan mobil Terios yang digunakan tersangka. “Ada beberapa tersangka yang masih diburu. Karena saat mencuri truk, mereka tidak bertiga,” jelas Antoni. Dari hasil pemeriksaan, sindikat ini terlibat dalam dua kasus pencurian dan perampokan mobil. Kasus pertama terjadi pada 15 Juni lalu. Perampokan diawali oleh FH, 26, warga Jln. Bromo yang menyewa mobil Avanza milik Rizki Pulungan, yang juga tetangga

Polisi Tembak Penjambret Karyawan Bank Danamon MEDAN (Waspada): Reskrim Unit Jahtanras Polresta Medan menembak pelaku penjambretan terhadap karyawan bank, usai melakukan aksinya di depan Bank Danamon Jln. Diponegoro Medan, Senin (1/7). Tersangka SY, 26, warga Jln. Pukat 1 Gang Mandailing, yang mengalami luka tembak di kaki kirinya karena berusaha melarikan diri, dibawa polisi ke RS Bhayangkara Medan untuk mendapatkan perawatan. Informasi di Polresta Medan menyebutkan, peristiwa itu terjadi saat korban Calvin Tandiawan, 21, karyawan Bank Danamon, baru keluar dari bank dengan berjalan kaki. Kemudian datang tersangka SY dengan mengendarai sepedamotor

Yamaha RX King mendekati korban dan langsung menarik tas sandang yang dibawa Calvin. Namun, korban melakukan perlawanan sehingga terjadi tarik-tarikan tas. Seorang pengendara sepedamotor yang melintas melihat kejadian itu lalu menabrak kendaraan tersangka. Akhirnya, tersangka terjatuh dari sepedamotornya. Begitu juga Amir, 26, warga Simpang Limun, pengendara sepedamotor yang menabrak kendaraan tersangka ikut terjatuh sehingga mengalami luka di tangan dan kaki. Selanjutnya, terjadi perkelahian antara tersangka dengan Amir. Karena kalah, tersangka melarikan diri dengan meninggalkan sepedamotornya di

lokasi ke arah Kantor Gubernur dan berbelok ke Jln. RA Kartini. Warga dan pengguna jalan mengejar tersangka. Karena di lokasi jalan protokol, polisi cepat meluncur. “Saat tersangka masih mencoba melarikan diri, disitulah ditembak,” kata Kanit Jahtanras Polresta Medan AKP Anthoni Simamora. Kata dia, karena luka tembak, tersangka dievakuasi ke RS Bhayangkara di Jln. KH Wahid Hasyim. Tersangka SY merupakan penjahat kambuhan yang kerap beraksi di Kota Medan. “Dia baru keluar dari penjara. Sejauh ini dari pengakuannya sudah beberapa kali beraksi di sejumlah wilayah seperti Delitua, Titi Kuning, Amplas, Patumbak,” sebutnya. (m39)

Terkait Pengelolaan RM Pujasera

Tjung Koan Minta Perlindungan Hukum Ke LBH Medan MEDAN (Waspada): Tjung Koan, 46, meminta perlindungan hukum ke kantor Lembaga Bantuan Hukum (LBH) Medan terkait pengelolaan rumah makan (RM) Pujasera milik Puskopad ‘A’ Dam I/BB di Jln. Kapten Muslim Medan. “Tjung Koan sebagai penyewa RM Pujasera mendapat perlakuan sewenang-wenang atau dapat dikatakan tindakan abuse of power (penyalagunaan kekuasaan) yang dilakukan oleh Kapuskopad yang baru yakni Kolonel Kav. Bambang Supardi Sip, MM,” kata Anggun Rizal Pribadi SH, selaku penasehat hukumTjung Koan kepada Waspada, Senin (1/7) sore. Anggun didampingi Ismail Hasan SH mengatakan, sebelumnya Tjung Koan dan istrinya Sumarni melakukan perjanjian kerjasama kepada pihak Puskopad terkait sewa-menyewa bangunan untuk didirikan RM Pujasera di Jln. Kapten Muslim No.189 A Medan. Dalam perjanjian disepakati terhitung mulai 23 Agustus 2010-22 Agustus 2015 suami istri itu menyewa dua pintu bangunan Pujasera tersebut. Perjanjian itu dibuat saat Kapuskopad dijabat Letkol Inf. Fachri. Di dalam perjanjian yang disepakati kedua belah pihak dan dituangan dalam surat perjanjian kerjasama Nomor: Sper/11/VIII/2010 (sebelah selatan) dan Nomor: Sper/12/ VIII/2010 tentang kerjasama permanfaatan bangunan

Puskopad ‘A’ Dam I/BB Jln. Kapten Muslim No.1-A Medan (sebelah utara). Namun, ketika Puskopad dijabat pimpinan baru yakni Kolonel Kav. Bambang Supardi Sip, MM, perjanjian itu dilanggar atau ingkar janji (Wanprestasi) dimana telah melanggar ketentuan Pasal 1243 KUHPerdata dimana adanya perbuatan yang ditimbulkan dari bentuk perjanjian tersebut sehingga menimbulkan kerugian terhadap Tjung Koan dan istrinya Sumarni. Menurut Anggun, sebelumnya pihak Tjung Koan disuruh datang menghadap Kepala Puskopad Kol Kav. Bambang terkait paparan akan direnovasi bangunan Pujasera tersebut. Namun, kenyataannya pihak Kapuskopad memberitahukan kepada Tjung Koan adanya orang lain sebagai pemenang tender yang baru terhadap gedung yang disewanya, sehingga menyebabkan kerugian yang besar kepada Tjung Koan. Dalam hal itu, Tjung Koan mendapatkan surat Nomor: B/ 116/VI/2013 perihal pembantalan perjanjian kerjasama secara sepihak tertanggal 24 Juni 2013. Tentunya surat tersebut sangat merugikan karena secara otomatis Tjung Koan harus mengikuti aturan pihak pemenang tender tersebut. “Perbuatan ini sangat merugikan Tjung Koan, sebab sesuai perjanjian pertama semestinya dia masih memiliki izin kerjasama hingga 22 Agustus 2015. Ini

dapat dikatakan perbuatan semena-mena yang dilakukan pihak Kapuskopad yang baru,” tutur Anggun. Kata dia, jika surat ini harus dijalankan Tjung Koan, maka LBH Medan akan mendampingi melaporkan masalah tersebut kepada Pangdam I/BB dan Panglima Mabes TNI. “Kami meminta pihak Kapuskopad untuk bersikap arif dan bijaksana dalam menangani persoalan ini dan jangan semena-mena melakukan tindakan diluar kekuasaan,” sebutnya. Secara terpisah, Kapuskopad ‘A’ Dam I/BB Kolonel Kav. Bambang Supardi Sip, MM, ketika dikonfirmasi mengatakan, bangunan Pujasera akan dilakukan renovasi sehingga bangunan itu menjadi bertingkat. Menurut dia, sebelum itu dilakukan, pihaknya telah mengundang Tjung Koan untuk paparan tentang proposal tawar terhadap bangunan baru itu nantinya. “Selain itu, penawar lainnya yakni pak Purba juga diundang.Ternyata tawaran pak Purba lebih tinggi dari tawaran Tjung Koan. Ini bukan tender, tapi penawaran proposal untuk umum. Kalau tender Rp300 juta ke atas,” ujarnya. Bambang Supardi yang juga menjabat Aster Kasdam I/BB menjelaskan, sesuai perjanjian pertama MoU bukan dengan Tjung Koan melainkan dengan Sumarni. “Intinya Sumarni sudah tiga kali dipanggil tapi tidak hadir,” katanya. (m36)

tersangka F dengan alasan mengantarkan temannya ke P. Siantar. Setelah menyepakati harga, Rizki sang pemilik mobil kemudian melepas mobil yang dikemudikan tersangka H. Kemudian tiga tersangka HST, 23, adiknya FLT, 19, keduanya warga Saribu Dolok, Siantar, dan DS alias A, 29, warga Jalan Pertempuran Pulo Brayan berangkat dengan mengendarai mobil tersebut.

”Ternyata para tersangka menggelapkan mobil tersebut. Modusnya, sopir pura-pura ditodong dan dibuang di Tiga Dolok, Simalungun,” jelas Anthoni. Kemudian, sindikat ini melanjutkan aksinya dua pekan kemudian.Kaliini,merekamenggondol truk Colt Diesel BK 8447 BJ yang sedang terparkir di depan rumah pemiliknya di Parluasan, P. Siantar, Minggu (30/6). Ketika itu, tersangka HT mengajak adiknya FLT dan Y.

Mereka menggunakan kunci palsu untuk mencuri truk tersebut. Tersangka H mengaku, mobil Avanza sudah mereka jual. “Saya menyerahkan Rp13 juta ke A yang menjual mobil, tapi uangnya baru Rp7 juta kami terima,” ujar tersangka H. H menyebutkan orang yang menyuruh mereka adalah S, warga P. Siantar.“Dia yang imingimingi kami, makanya mau kami kerjakan,” katanya. (m39)

Rekonstruksi Pembunuhan Penjaga Toko Digelar

Istri Korban Dan Selingkuhannya Diancam Hukuman Mati MEDAN ( Waspada): Polresta Medan melakukan rekonstruksi pembunuhan penjaga toko Mairizal, 36, warga Jln. Jermal, Medan Denai, yang dilakukan selingkuhan istri korban, dengan menampilkan 31 adegan, Selasa (2/7). Dalam rekonstruksi tersebut, korban tewas dihabisi istrinya bersama selingkuhannya. Keduanya diancam hukuman mati. ”Rekonstruksi untuk melengkapi Berita Acara Pemeriksaan (BAP) yang berkasnya akan kita kirim ke Kejaksaan, jadi motifnya karena suami menjadi penghalang untuk berselingkuh. Kedua tersangka kita jerat pasal berlapis,” kata Kanit Jahtanras Polresta Medan AKP Anthoni Simamora saat memimpin tahapan rekonstruksi. Dalam adegan pertama diketahui Rabu (8/ 5), tersangka M alias Ani, 29, bersama selingkuhannya DA, 34, di rumah kos Pasar VII merencanakan pembunuhan terhadap korban, karena dianggap menjadi penghalang atas hubungan terlarang itu. Adegan selanjutnya, Sabtu (11/5) malam, tersangka Ani yang menggebu untuk membunuh suaminya, mengirim sms kepada tersangka DA memastikan waktu yang tepat untuk mengeksekusi Mairizal. Anthoni menjelaskan, kasus pembunuhan

ini terjadi Minggu (12/5) dinihari. Korban bersama istrinya Ani menjaga toko majikannya yang pergi ke luar negeri di JermalVII No 16, Medan. Dinihari itu, Mairizal yang tengah tertidur pulas didatangi tersangka DA yang tidak lain kekasih gelap istrinya. Dengan memakai alat penutup wajah (sebo) usai memukul dan menikam korban, tersangka lalu menggorok leher korban memakai pisau cutter hingga tewas seketika. Melihat korbannya tewas, DA lalu meninggalkan lokasi membawa sepedamotor milik korban dan uang Rp4 juta. Polisi yang menyelidiki kasus ini, sempat terkecoh dengan menduga pembunuhan ini bermotif perampokan. Motif pembunuhan diketahui setelah polisi curiga dengan gerak gerik Ani yang tampak tak berduka atas meninggalnya suaminya. Penyidik yang terus menginterogasinya akhirnya menemukan titik terang, istri korban dan pelaku pembunuhan masih berhubungan via pesan dan akhirnya Rabu (15/5) DA ditangkap di Stasiun KUPJ Rantau Prapat. Dalam kasus ini, menurut Anthoni, kedua tersangka dijerat pasal berlapis 340 Subs 338 Yo 55, 56 KUHP dengan ancaman maksimal hukuman mati. (m39)

Pakar Animasi Bisnis Multimedia Ceramah Di AMIK MBP MEDAN (Waspada): Pakar sekaligus praktisi animasi bisnis multimedia Anditya ST, tampil dalam seminar sehari yang dihadiri 500 mahasiswa AMIK MBP, di kampus Jln. Letjen Jamin Ginting Medan, Sabtu (28/6). Sebagai praktisi yang mahir dalam proses memadukan bentuk foto asli dengan animasi (bentuk filem bergerak) untuk program penanganan (desainer) bangunan atau infrastruktur (jalan), Anditya mampu menarik perhatian para peserta seminar dalam bentuk praktik langsung dengan hanya menggunakan perangkat komputer yang hampir belum pernah dilihat dan disaksikan. Anditya yang mengaku ikut terlibat dalam merancang infranstruktur Bandara Kuala Namu, memperagakan proses perancangan suatu proyek seperti Jalan Tol Kuala Namu yang dua arah berlawanan serta rel kereta api yang melintas dalam terowongan dengan mengkombinasikan teknik manual komputer dan animasi, sehingga bangunan atau infrastruktur terlihat seolah-olah sudah siap dikerjakan, padahal itu baru bentuk desainer. Dia juga memperagakan perancangan sebuah rumah tempat tinggal permanen non bertingkat dengan teknik komputer dan animasi tiga dimensi (3D). Hanya dalam tempo 15 menit sudah menyiapkan bentuk rumah mewah itu mulai dari lantai, dinding, pintu, jendela, platform, atap sampai kepada bentuk sofa dan kamar mandi yang telihat seolah-olah sudah menjadi rumah

siap huni, padahal baru rancangan. Menurut Anditya, industri kreatif dewasa ini kekurangan sumber daya manusia (SDM) khususnya bidang animasi. Selain prospeknya cukup baik, permintaan proyek seperti di Sumut juga meningkat. “Misalnya, proyek animasi Bandara Kuala Namu yang dikerjakan animatornya dari Jakarta, kenapa tidak lulusan dan mahasiswa di daerah ini yang mengerjakannya,” tutur alumnus UGM Bandung itu. Sementara itu, Direktur AMIK MBP Drs Tenang Malem Tarigan Ak, MSi mengatakan, orientasi lulusan kedepan sudah mengarah pada pembentukan mahasiswa yang memiliki kemampuan teknik, salah satunya menciptakan mahasiswa menjadi animator di bidang multimedia dalam teknologi dan informasi. “AMIK MBP merangsang mahasiswa menjadi praktisi animasi dengan pengembangan arah ilmu komputer dan tidak hanya sebagai programmer maupun analis komputer,” katanya usai mengikuti Seminar Informasi Teknologi “Multimedia Dalam Dunia Bisnis itu.. Tampil sebagai pembicara selain Anditya CEO Dreamarch Animasi, Arsitek, Praktisi, juga Direktur Penerbit Buku Media Cerdas Surabaya Bagus Triyanto ST, MM. Turut juga hadir Ketua Jurusan Teknik Informatika Misdem Sembiring ST, Ketua Jurusan Manajemen Informatika Sariadin Sialagan ST, MCs, dan Humas Drs Romanus Sipayung. (m22)

Waspada/Aidi Yursal

PAKAR Animasi Anditya ST, Direktur AMIK MBP Drs Tenang Malem Tarigan Ak, MSi (tengah), Bagus Triyanto ST, MM (kanan), dan Misdem Sembiring ST (kiri), dalam Seminar Informasi Teknologi “Multimedia Dalam Dunia Bisnis” di Kampus AMIK MBP Jln. Letjen Jamin Ginting, Medan.

Medan Metropolitan

WASPADA Rabu 3 Juli 2013


Kinerja Disbudpar Lemah Tempat Hiburan XXX Harus Ikut Peraturan Pemko Medan MEDAN (Waspada): Kinerja Dinas Kebudayaan dan Pariwisata Kota Medan dinilai lemah. Buktinya, instansi tersebut tidak mampu menindak tempat hiburan malam XXX di gedung Yanglim Plaza yang diduga telah melanggar peraturan Pemko Medan. Melihat kenyataan tersebut, Sekretaris Daerah (Sekda) Kota

Medan Syaiful Bahri memerintahkan Disbudpar segera

Jadwal Penerbangan Di Bandara Polonia No. Penerbangan Ke Flight


Tiba Dari


GARUDA INDONESIA 1 Jakarta GA-181 2 Jakarta GA-183 3 Jakarta GA-185 4 Jakarta GA-187 5 Jakarta GA-189 6 Jakarta GA-191 7 Jakarta GA-193 8 Jakarta GA-147 9 Jakarta GA-195 10 Banda Aceh GA-142 11 Banda Aceh GA-14.6 12 Banda Aceh GA-278 13 Pekanbaru GA-276 14 Batam GA-272 15 Palembang GA-266 16 Batam GA-270 17 Padang GA-262 18 Penang GA-802 19 Penang GA-804

05.20 08.45 10.30 11.55 13.55 15.55 17.55 18.45 19.55 09.45 14.50 06.10 09.55 13.20 06.00 10.40 14.50 06.05 13.55

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Banda Aceh Banda Aceh Banda Aceh Pekanbaru Batam Palembang Batam Padang Penang Penang

GA-180 GA-182 GA-184 GA-186 GA-146 GA-188 GA-190 GA-192 GA-196 GA-143 GA-147 GA-279 GA-277 GA-273 GA-267 GA-271 GA-263 GA-803 GA-805

Pukul 08.00 09.45 11.10 13.20 14.20 15.10 17.10 19.10 22.00 13.10 17.55 08.45 12.40 19.45 09.55 14.05 20.50 08.30 16.25

CITILINK 1 Jakarta 2 Jakarta 3 Jakarta 4 Batam 5 Batam

QG-831 QG-833 QG-835 QG-880 QG-882

8.40 18.50 20.05 10.00 14.20

Jakarta Jakarta Jakarta Batam Batam

QG-830 QG-832 QG-834 QG -881 QG-883

08.05 09.05 09.35 13.15 17.55

AIR ASIA 1 Kuala Lumpur 2 Kuala Lumpur 3 Kuala Lumpur 4 Kuala Lumpur 5 Penang 6 Penang 7 Kuala Lumpur 8 Baangkook 9 Bandung 10 Surabaya 11 Bandung 12 Banda Aceh 13 Pekanbaru

QZ-8050 QZ- 8054 AK- 1351 AK-1355 QZ-8072 AK-5837 AK-1357 QZ-8084 QZ-7987 QZ-7611 QZ-7981 QZ-8022 QZ-8028

06.05 11.20 08.00 17.25 10.40 18.30 21.25 17.00 08.25 11.35 17.10 11.00 07.00

Kuala Lumpur Kuala Lumpur Kuala Lumpur Kuala Lumpur Penang Penang Kuala Lumpur Bangkok (2,4,6) Bandung Surabaya Bandung Banda Aceh Pekanbaru

QZ-8051 QZ-8055 AK-1350 AK-1354 QZ-8073 AK-5836 AK-1356 QZ-8085 QZ-7986 QZ-7610 QZ-7980 QZ-8023 QZ-8029

08.30 10.55 07.35 17.00 16.30 18.15 21.05 29.55 05.35 11.10 19.55 13.20 10.30

LION AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Jakarta 5 Jakarta 6 Jakarta 7 Jakarta 8. Jakarta 9 Jakarta 10 Jakarta 11 Jakarta 12 Jakarta 13 Jakarta 14 Penang 15 Penang 16 Jakarta 17 Jakarta 18 Jakarta 19 Jakarta 20 Jakarta 21 Surabaya 22 Surabaya 23 Banda Aceh 24 Jakarta

JT- 211 JT- 381 JT- 397 JT- 207 JT- 301 JT- 395 JT- 303 JT- 215 JT-201 JT- 387 JT-399 JT-383 JT-385 JT-1282 JT-1288 JT-205 JT-203 JT-219 JT-309 JT-209 JT-0970 JT-972 JT-396 JT-305

0545 06.45 07.50 08.40 10.00 11.00 11.50 12.25 12.50 13.50 15.20 15.50 17.00 08.05 13.35 2010 18.00 20.40 19.10 21.00 07.00 12.55 12.15 18.30

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Penang Penang Jakarta Jakarta Jakarta Jakarta Jakarta Surabaya Surabaya Banda Aceh Jakarta

JT-380 JT-300 JT-394 JT-302 JT-214 JT-200 JT-204 JT-398 JT-382 JT-384 JT-202 JT-212 JT-396 JT-1283 JT-1289 JT-206 JT-208 JT-386 JT-308 JT-218 JT-971 JT-973 JT-397 JT-210

08.20 09.20 10.20 11.10 11.40 12.10 13.10 14.40 15.10 16.20 17.20 17.50 19.45 10.25 15.55 9.20 18.25. 21.05 22.20 23.20 12.15 16.00 07.05 07.20

MALAYSIA 1 Kuala Lumpur 2 Kuala Lumpur

MH-861 MH-865

09.40 15.45

Kuala Lumpur Kuala Lumpur

MH-860 MH-864

08.50 15.00

SILK AIR 1 Singapura 2 Singapura

MI-233 MI-237

08.40 20.35

Singapura Singapura

MI-232 MI-238

07.50 19.50

VALUAIR 1 Singapura (2.4,7) VF-282 2 Singapura (1,3,6) VF-284 3 Singapura (Jumat)VF-282

10.35 18.30 09.45

Singapura (2.4.7) VF-281 Singapura (1,3,6) VF-283 Singapura (Jumat)VF-281

09.55 17.40 09.05

SRIWIJAYA AIR 1 Jakarta 2 Jakarta 3 Batam 4 Pekanbaru 5 Pekanbaru 6 Banda Aceh 7 Penang 8 Padang

SJ-015 SJ-011 SJ-035 SJ-043 SJ-041 SJ-010 SJ-102 SJ-021

13.25 15.55 16.50 10.20 17.20 12.50 07.20 16.00

Jakarta Jakarta Batam Pekanbaru Pekanbaru Banda Aceh Penang Padang

SJ-010 SJ-016 SJ-034 SJ-042 SJ-040 SJ-011 SJ-103 SJ-020

11.00 16.20 14.55 11.50 15.45 14.20 09.50 14.10

FIRE FLY 1 Subang 2 Penang 3. Penang

FY -3413 FY- 3403 FY- 3407

14.35 10.55 18.20

Subang Penang Penang

FY-3412 FY-3402 FY-3406

14.05 10.35 17.55

07.30 11.45 18.50

Singapura Jakarta Jakarta

RI-862 RI-093 RI-097

08.00 12.00 19.30

MANDALA AIRLINE 1 Jakarta RI-092 2 Singapura RI-861 3. Jakarta RI-096

Jadwal Perjalanan Kereta Api No KA

Nama KA





U.28 Sri Bilah Eks/Bisnis Medan RantauPrapat U30 Sri Bilah Eks/Bisnis Medan Rantau Prapat U.32 Sri Bilah Eks/Bisnis Medan Rantau Prapat U.34 Sri Bilah Eks/Bisnis Medan Rantau Prapat U.27 Sri Bilah Eks/Bisnis Rantau Prapat Medan U.29 Sri Bilah Eks/Bisnis Rantau Prapat Medan U.31 Sri Bilah Eks/Bisnis Rantau Prapat Medan U.33 Sri Bilah Eks/Bisnis Rantau Prapat Medan U35 Sri Lelawangsa Ekonomi Tebing Tinggi Medan U36 Sri Lelawangsa Ekonomi Medan Tebing Tinggi U37 Sireks Ekonomi Siantar Medan U38 Sireks Ekonomi Medan Siantar U.39 Putri Deli Ekonomi Tanjung Balai Medan U.40 Putri Deli Ekonomi Medan Tanjung Balai U.41 Putri Deli Ekonomi Tanjung Balai Medan U.42 Putri Deli Ekonomi Medan Tanjung Balai U.43 Putri Deli Ekonomi Tanjung Balai Medan U.44 Putri Deli Ekonomi Medan Tanjung Balai U45 Sri Lelawangsa Ekonomi Binjai Medan U46 Sri Lelawangsa Ekonomi Medan Binjai U47 Sri Lelawangsa Ekonomi Binjai Medan U48 Sri Lelawangsa Ekonomi Medan Binjai U49 Sri Lelawangsa Ekonomi Binjai Medan U50 Sri Lelawangsa Ekonomi Medan Binjai U51 Sri Lelawangsa Ekonomi Binjai Medan U52 Sri Lelawangsa Ekonomi Medan Binjai U53 Sri Lelawangsa Ekonomi Binjai Medan U54 Sri Lelawangsa Ekonomi Medan Binjai U55 Sri Lelawangsa Ekonomi Binjai Medan U56 Sri Lelawangsa Ekonom Binjai Medan U57 Sri Lelawangsa Ekonomi Medan Binjai U58 SriLelawangsa Ekonomi Binjai Medan U59 Sri Lelawangsa Ekonomi Medan Binjai Reservasi Tiket KA Medan (061-4248666)

08.17 10.47 15.46 22.50 08.45 15.20 17.10 23.55 05.36 18.17 06.25 14.27 07.55 06.57 13.20 13.12 19.00 16.57 05.45 05.00. 07.15 06.30 09.15 08.30 11.35 10.00 14.30 12.30 16.15 17.45 17.00 21.30 20.10


13.57 16.00 21.16 03.52 14.04 20.43 22.11 05.09 07.53 20.38 10.22 18.15 12.52 11.28 17.55 17.36 23.20 21.35 06.14 05.29 07.44 06.59 09.44 08.59 12.04 10.29 14.59 12.59 16.44 18.14 17.29 21.59 20.39

menindak tegas pengelola tempat hiburan malam XXX. Pemilik tempat hiburan malam di kota ini harus mengikuti peraturan yang telah ditetapkan Pemko Medan. “Saya perintahkan Disbudpar menindak tegas semua pengelola tempat hiburan malam yang menyalahi aturan. Tidak ada alasan Disbudpar kesulitan menembus lokasi tempat hiburan malam tersebut. Kalau memang pengelolanya tetap melanggar aturan, maka cabut saja izinnya.Yang penting harus ada fakta ditemukan apakah menyalah atau tidak. Kalau memang menyalah, kenapa harus takut menindaknya. Saya akan hubungi kadis atau kabid yang bersangkutan,” kata Syaiful kepada Waspada, Rabu (3/7). Mantan Kepala Bappeda ini menegaskan, penindakan tersebut bukan saja terhadap penge-

lola tempat hiburan malam XXX, namun semua tempat hiburan harus mengikuti aturan yang telah ditetapkan Pemko Medan. Disbudpar harus berani menindak tegas pengusaha tempat hiburan malam yang membandel. “Kita kan menjalankan aturan, jadi kenapa kita takut? Kalau memang tidak bisa diatur,ya cabut saja izinnya. Namun, kita lihat dulu tingkat kesalahannya,” tegas Syaiful. Sebelumnya, Kabid Objek Dayatarik Wisata (OTW) Disbudpar Kota Medan Fahmi Harahap mengatakan, pihaknya kesulitan menindak tegas pengelola tempat hiburan malam XXX yang berlokasi di gedung Yanglim Plaza Jln. Emas Medan. “Sulit sekali menjumpai pengelolanya. Sudah berulangkali kami hendak masuk ke lokasi, namun selalu kesulitan. Tapi kami akan tetap menerobosnya

dan menindaknya. Kalau kita datang ke sana, semua sudah dikondisikan termasuk petugas sekuriti. Bahkan, liftnya langsung terkunci. Jadi bagaimana kita menindaknya,” ujar Fahmi. Ditanya kapan tempat hiburan malam XXX akan dirazia? Fahmi tidak bisa memastikannya. Dia mengatakan, Disbudpar sudah berulangkali melakukan razia ke lokasi tersebut, tapi sulit bertemu dengan pengelolanya.“Kita lagi menyusun jadwalnya, namun belum diketahui kapan. Nanti kita koordinasikan dulu dengan pak kadis,” katanya. Sementara itu, Kadisbudpar Kota Medan Busral Manan ketika hendak dikonfirmasi Waspada di ruang kerjanya, Rabu (3/7), tidak berada di tempat. Menurut stafnya, beliau sedang berada di luar. Saat dihubungi melalui ponselnya, ternyata tidak aktif.(m50)

Sekdaprovsu Ajak Guangdong Kunjungi Danau Toba MEDAN (Waspada): Dinas Kebudayaan Provinsi Guangdong mengunjungi Provinsi Sumatera Utara untuk misi pertukaran budaya. Mereka terlebih dahulu audiensi ke Pemerintah Provinsi Sumut (Pemprovsu) yang diterima Sekdaprovsu H Nurdin Lubis SH, MM, di Kantor Gubsu Jln. Diponegoro Medan, Senin (1/7). Pada kesempatan itu, Nurdin Lubis memperkenalkan wisata Danau Toba kepada perwakilan pemerintah Guandong. Sekdaprovsu juga meminta agar pemerintah maupun masyarakat Guangdong mengunjungi Danau Toba, karena di bulan September 2013 akan digelar Festival Danau Toba. “Kami undang Guangdong mengunjungi Danau Toba, sebuah danau yang eksotik dengan panorama yang sangat indah dan didukung oleh latar belakang masyarakat di sekitarnya yang berbudaya dan bersahabat,” ujar Nurdin didampingi Asisten Ekbang Setdaprovsu Hj Sabrina, Kadis Kominfo Jumsadi Damanik dan lainnya. Selain Danau Toba, masyarakat Guangdong juga diharapkan meningkatkan kunjungannya ke Sumut karena alasan investasi, pertukaran budaya, dan lainnya. “Sumut adalah salah satu provinsi yang memiliki kekayaan sumber daya alam dan sumber daya manusia. Tentu Sumut sangat welcome bagi

siapa saja yang ingin mengunjungi Sumut,” sebutnya. Pada bulan Juli ini, kata Nurdin, akan diadakan pembukaan Kawasan Ekonomi Khusus (KEK) Sei Mangkei yang merupakan kawasan produksi hilir kelapa sawit. Dia berharap pihak Guandong berkenan meninjau dan dapat berinvestasi di kawasan Sei Mangkei tersebut. Kemudian sehubungan agenda rutin Pemprovsu yakni Pekan Raya Sumatera Utara (PRSU), Sekdaprovsu juga mengajak pihak Guandong untuk menampilkan kebudayaannya di sana. “Untuk lebih mempererat lagi hubungan yang sudah terjalin selama ini, Pemprovsu mengajak Provinsi Guandong untuk mengisi stand tempat menampilkan kebudayaan Guangdong,” ujarnya. Sementara itu, Kadis Kebudayaan Provinsi Guangdong Fang Jian Hong menyatakan, sangat senang atas sambutan Pemprovsu. Dia merasa sangat terhormat atas berkenannya Sekdaprovsu mengundang GuangdongmengunjungiDanau Toba dan berinvestasi di Sumut. Kata Fang Jian Hong, kunjungannya ke Sumut diutus Gubernur Provinsi Guangdong untuk pertukaran kebudayaan Provinsi Guangdong dengan Provinsi Sumut. “Gubernur Guangdong menitip salam dan mengucapkan selamat telah dilantiknya Gubernur danWakil

Waspada/Amir Syarifuddin

SEKDAPROVSU H Nurdin Lubis menerima kunjungan Kadis Kebudayaan Provinsi Guangdong Fang Jian Hong, di Kantor Gubsu.

15 Caleg Perempuan NasDem Ikut Training MEDAN (Waspada): Sebanyak 15 calon anggota legislatif (caleg) tingkat provinsi dan kabupaten/kota Partai Nasional Demokrat (NasDem) mengikuti training caleg perempuan di Tiara Convention Hall pada 2829 Juni. Para Caleg NasDem yang berasal dari Kota Medan, Deliserdang, Tapanuli Selatan dan Toba Samosir tersebut dikoordinir Soraya Siahaan selaku Ketua Garnita Malahayati Partai NasDem yang juga caleg Partai NasDem Dapil 2 Kota Medan. Soraya menjelaskan, training yang diikuti 12 partai ini menampilkan narasumber dari kalangan dosen, aktivis perempuan, KPU Medan, praktisi lokal

dan KPU Sumut.“Kegiatan serupa juga dilaksanakan di Aceh, Sulawesi Selatan, Nusa Tenggara Timur dan Nusa Tenggara Barat,” tambahnya. Kegiatan ini bertujuan memberikan training khusus untuk kampanye efektif dan terarah bagi caleg perempuan tingkat provinsi dan kabupaten/ kota. Selain itu, untuk mewujudkan keterwakilan perempuan di parlemen. “Training ini mampu memotivasi para peserta, termasuk dari Partai NasDem agar bisa membuat perencanaan lebih matang dalam mengikuti kampanye serta meningkatkan pengembangan kapasitas organisasi,” ujar Soraya.(m49)

Waspada/M.Ferdinan Sembiring

PARA caleg perempuan tingkat I dan kabupaten/kota dari Partai NasDem, foto bersama Ketua Garnita Malahayati Partai NasDem Soraya Siahaan (enam dari kiri) usai mengikuti training caleg perempuan.

Gubernur Sumut Bapak Gatot Pujo Nugroho dan Bapak Tengku Erry Nuradi,” tuturnya. Menurut dia, Gubernur Guangdong juga mengundang Gubernur dan Wakil Gubernur beserta masyarakat Sumut untuk berkunjung ke Provinsi Guangdong melihat kebudayaan Guangdong, kuliner dan keindahan wisata yang ada di Guangdong. “Dengan kunjungan ini diharapkan hubungan semakin erat lagi, bukan hanya kebudayaan tetapi juga di bidang ekonomi dan lainnya,” ujar Jian. Jian juga mengundang Pemprovsu untuk hadir menyaksikan acara pertunjukan dan pertukaran kesenian dan kebudayaan antara IndonesiaChina di Hotel Tiara Medan, Senin (1/7) malam.(m28)

Waspada/Ismanto Ismail

PETUGAS Sentral Pelayanan Kepolisian Terpadu (SPKT) ‘A’ Polsek Medan Baru Briptu Supriadi, SH sedang memeriksa barang bukti berupa gelas plastik berisi pasir disaksikan korban Lurah Polonia Solli Barkan.

Disiram Air Parit

Lurah Polonia Ngadu Ke Polisi MEDAN (Waspada): Lurah Polonia Solli Barkan, 53, disiram warganya dengan air parit saat menerima tamu di ruang kerjanya, Selasa (2/7). Kepling X Kel. Polonia Irwan Syari yang melihat peristiwa itu mengatakan kepada Waspada, Selasa (2/7) sore, tiba-tiba saja pelaku berinisial MT, 47, penduduk Jln. Starban menyiramkan pasir dan air parit ke wajah lurah. Awalnya, kata Irwan, Lurah Polonia Solli Barkan, warga Jln. Medan Tenggara, Gg. Silaturahim, Kec. Medan Denai sedang menerima tamu di ruang kerjanya. Tiba-tiba pelaku MT datang dengan berjalan kaki sambil membawa dua gelas plastik berisi pasir dan air parit. Begitu melihat korban, pelaku MT langsung menyiramkan pasir dan air parit ke arah wajahnya. “Tindakan itu sempat disaksikan tamu dan sejumlah pegawai kelurahan,” kata Irwan Syari bersama sejumlah kepling yang turut mendampingi Lurah Polonia membuat pengaduan ke Mapolsek Medan Baru.

Setelah itu, pelaku MT langsung meninggalkan lokasi kejadian. Selanjutnya, staf di Kantor Lurah Polonia melaporkan peristiwa tersebut kepada Camat Medan Polonia dan dianjurkan membuat pengaduan ke Mapolsek Medan Baru. Camat Medan Polonia Odi Dody Prasetio, SSTP, MAP mengatakan, tindakan pelaku MT sangat tidak terpuji. “Kasus ini diserahkan sepenuhnya kepada Polsek Medan Baru karena sudah masuk ranah hukum,” tegas Odi. Sementara itu, kepling lainnya mengatakan, pada Sabtu (29/6), pelaku MT melakukan pemukulan terhadap mandor pengorekan parit di Jln. Starban Medan. Awalnya, terjadi keributan diduga karena masalah pembuangan tanah galian parit di depan rumah pelaku. Pelaku sempat memukul mandor proyek tersebut dan kasusnya telah dilaporkan kepada pihak berwajib. “Para kepling di Kelurahan Polonia meminta Kapolresta Medan dan Kapolsek Medan Baru segera mengusut kasus tersebut hingga tuntas agar memberikan efek,” ungkap Kepling. (m36)

Medan Metropolitan


WASPADA Rabu 3 Juli 2013

Pemko Medan Tegur Lurah Aur Aksi Main Petasan Marak Di Jln. Letjen Suprapto MEDAN (Waspada): Sekretaris Daerah (Sekda) Kota Medan Syaiful Bahri melalui Kabag Administrasi Pemerintahan Umum (Adpemum) Kota Medan Fahri Matondang menegur Lurah Aur, Kec. Medan Maimon.Pasalnya, aksi main petasan marak di Jln. Letjen Suprapto.

“Saya sudah minta Kabag Adpemum menegur lurah itu supaya melarang warga main petasan. Hal itu bisa mengundang ketidaknyamanan masyarakat terutama pengguna jalan. Karenanya, lurah dan kepala lingkungan harus segera melarangnya dan jangan sampai berlarut-larut,” tegas Syaiful.

Pencuri Sepedamotor Nyaris Dibakar Massa MEDAN (Waspada): Seorang pencuri sepedamotor dihajar dan nyaris dibakar massa di Jln. Pegadaian, Medan Kota, Senin (1/7). Tersangka I, 24, warga Pasar VII Tembung, Komplek Bumi Asri, Kec. Percut Seituan, dalam kondisi babak belur diboyong polisi ke Polresta Medan. Informasi di Polresta Medan, peristiwa berawal ketika korban Mimi Aulia, 18, warga Jln. AR Hakim Gang Langgar, Medan Area, yang mengendarai sepedamotor Mio BK 3499 ABV datang ke Jln. Pegadaian, Medan Kota, untuk membeli buku. Korban memarkirkan sepedamotornya di depan kedai buku. Merasa aman karena jarak kedai buku ke parkiran sepedamotornya berjarak 2 meter, korban tidak mencabut kunci kontak. Saat bersamaan tersangka yang sedang melintas jalan kaki melihat sepedamotor korban yang kunci kontaknya masih tergantung dan membawanya kabur. Namun, aksi tersebut diketahui korban yang lansung menjerit minta tolong. Warga yang mendengar jeritan itu mengejar dan menangkap tersangka. Massa kemudian menghajar tersangka I sampai babak belur. Bahkan, nyaris membakarnya. Anggota Reskrim Unit Ranmor Polresta Medan yang datang ke lokasi mengamankan tersangka sehingga nyawanya terselamatkan dari amuk massa. Karena luka yang dialami tersangka cukup serius, pihak kepolisian membawanya ke RS Bhayangkara Medan. Setelah mendapatkan perawatan, tersangka diboyong ke Polresta Medan untuk menjalani pemeriksaan. Kanit Ranmor Iptu Alexander Piliang menjelaskan, tersangka nyaris dibakar massa. “Hampir dibakar, untunglah anggota cepat menyelamatkannya. Saat ini tersangka masih menjalani pemeriksaan,” ujarnya. (m39)

Oknum Bendahara UPTK Dikpora Sunggal Menghilang MEDAN (Waspada): Oknum Bendahara Unit Pelaksana Tekhnis Kecamatan (UPTK) Dikpora Sunggal berinsial S, 49, warga Komplek Martubung, telah empat bulan menghilang dan tidak masuk bertugas. Informasi di UPTK Sunggal menyebutkan, menghilangnya S diduga terkait dana Rp550 juta milik pengawas guru UPT Dikpora Sunggal dan lainnya. Kepala UPTK Dikpora Sunggal Lontar Siregar SPd, MSi kepada wartawan, Jumat (28/6) mengatakan, S yang merupakan bendahara di UPT tersebut sejak Februari 2013 hingga saat ini tidak masuk bekerja. “Hal itu dapat dibuktikan dari daftar absensi yang telah dilaporkan ke Dinas Pandidikan Deli Serdang,” ujarnya sembari mengaku adanya dugaan S menghilang terkait kasus penggelapan dana Rp550 juta lebih. Menurut dia, S sebelum menghilang ada bertengkar dengan seseorang wanita di kantor UPTK tersebut sekira Januari 2013, sehingga pihaknya memanggil petugas kepolisian untuk pengamanan kantor. “Kasus dana tersebut tidak hanya itu saja, tetapi ada juga masalah dana lainya yang tidak disetorkan S, di antaranya dana kemalangan sebesar Rp30 juta lebih dan cicilan kredit guru Rp300 juta di salah satu bank sempat bermasalah,” sebutnya. Sementara itu, Pengawas Guru UPTK Sunggal Dra Pinta yang dikonfirmasi wartawan terkait dana Rp550 juta miliknya yang tidak dikembalikan S membenarkannya. Menurutnya, uang itu milik pribadinya yang dipinjam S sekitar Desember tahun 2012 dengan alasan untuk keperluan menutupi kekurangan gaji guru dan lainnya. Namun sejak Februari 2013 hingga Juni 2013 S tidak dapat ditemui lagi baik di rumahnya komplek perumahan Martubung dan kantor UPTK Sunggal.(m40)

Ruko Jual Sembako Terbakar MEDAN (Waspada): Rumah toko (ruko) berlantai II yang menjual sembako (sembilan bahan pokok) di kawasan Jln. Selamat Ujung, Lingkungan II, Kel. Binjai, Kec. Medan Denai, Senin (1/ 7) sekira pukul 16:45, terbakar. Kebakaran diduga karena arus pendek listrik (korsleting). Ruko tersebut milik H Rusdi Siregar, 56, yang saat kejadian tidak berada di tempat.Warga disana mengatakan, H Rusdi sedang pulang kampung untuk berziarah ke makam orangtuanya di Tumbukan Bantu, Kec. Daha Selatan, Kalimantan Selatan. “Yang tinggal di ruko hanya anak-anaknya saja,” kata warga. Seorang warga Syarifuddin mengatakan, kebakaran itu terjadi disaat aliran listrik yang padam hidup kembali.“Sebelum kebakaran, arus listrik disini padam. Namun disaat listrik hidup, tiba-tiba terlihat kepulan asap di lantai II ruko itu. Kami tidak tahu penyebabnya, namun kemungkinan karena korsleting arus listrik,” ujarnya menyebutkan, asap terlihat di lantai II ruko dan membakar barang-barang yang ada di lantai itu. Sebelum petugas kebakaran dari Dinas Pencegah dan Pemadaman Kebakaran (DP2K) Kota Medan tiba di lokasi, warga sekitar sempat membantu memadamkan api dan mengevakuasi barang-barang keluar dari ruko. Namun api semakin membesar dan menghanguskan bangunan lantai II. Tidak berapa lama, sekitar 10 armada DP2K Kota Medan tiba di lokasi memadamkan api. Kanit Reskrim Polsek Patumbak AKP Hatopan Silitonga tampak di lokasi melakukan identifikasi dan memintai keterangan warga untuk mengetahui penyebab kebakaran itu. Namun karena wilayah itu masuk wilayah Polsek Medan Area, penyidikan kemudian diserahkan ke Polsek Medan Area. “Kita sudah lakukan pemeriksaan, karena masuk wilayah Medan Area penyelidikan selanjutnya diserahkan ke Polsek Medan Area,” tuturnya. Tetapi hingga api berhasil dipadamkan, petugas Polsek Medan Area belum tampak di lokasi, namun Hatopan Silitonga mengatakan sudah melakukan koordinasi dengan Polsek Medan Area untuk menindaklanjuti penyelidikan kebakaran itu. “Kita sudah koordinasikan ke mereka (Medan Area),” sebut Hatopan sembari mengaku belum mengetahui jumlah kerugian, sedangkan korban jiwa tidak ada.(m27)

Waspada/gito ap

KONDISI ruko di Jln. Selamat Ujung, Kec. Medan Denai setelah terbakar pada Senin (1/7) sore.

Dalam waktu dekat, lanjut Syaiful, pihaknya akan menggelar rapat bersama Forum Koordinasi Pimpinan Daerah terkait bulan suci Ramadhan. Salah satu isu yang akan dibahas dalam rapat tersebut adalah penertiban petasan. “Karena itu, saya minta Lurah Aur agar melarang warganya main petasan. Aksi ini dapat memicu terjadinya ketidaknyamanan sesama warga,” ucapnya. Kabag Adpemum Fahri Matondang ketika dikonfirmasi Waspada mengaku telah menghubungi Lurah Aur untuk menindak atau melarang warga yang main petasan. Karena aksi main petasan dapat membuat situasi tidak nyaman. “Saya sudah menghubungi Lurah Aur, tapi dia mengatakan tidak tahu dimana aksi main petasan ter-

sebut. Namun pihak kelurahan bersama kepling akan menyisir lokasi yang dijadikan tempat bermain petasan,” ucap Fahri. Mantan Camat Medan Sunggal ini mengucapkan terimakasih kepada Waspada yang memberikan masukan ke Pemko Medan. Dengan adanya informasi tersebut, maka semua yang terjadi di masyarakat dapat ditindaklanjuti Pemko Medan. “Kita akan tindaklanjuti aksi main petasan tersebut. Saya juga meminta lurah supaya secepatnya dihentikan aksi main petasan tersebut. Kalau memang ada pedagang petasan di sekitar wilayah tersebut, maka harus ditindak tegas. Petasan itu berbahaya bagi warga. Jadi, saya akan mendesak lurah dan camat supaya menghentikan aksi main petasan tersebut,”

katanya. Pantauan Waspada di lapangan, Senin (1/7) malam, aksi ‘perang’ petasan berlangsung di dekat jembatan Jln. Letjen Suprapto, Kel. Aur, Kec. Medan Maimun. Sejumlah anak-anak dan remaja melemparkan petasan ke arah jalan raya sehingga membahayakan pengguna jalan. Aksi ‘perang’ petasan ini sudah berlangsung selama beberapa hari terakhir. Namun tidak ada tindakan dari kepling setempat muapun Lurah Aur. “Kenapa bebas kali mereka main petasan. Padahal tindakan mereka sangat mengganggu pengguna jalan. Seharusnya lurah dan kepling segera melarangnya sehingga mencegah terjadinya hal-hal yang tidak diinginkan,” tegas Fahri.(m50)

Pemko Medan Lakukan Pendataan Keluarga MEDAN (Waspada): Untuk mendapatkan pendataan keluarga yang lebih akurat dan akuntabel, Pemko Medan melalui Badan Pemberdayaan Perempuan dan Keluarga Berencana Kota Medan melakukan pendataan keluarga mulai 1 Juli hingga 30 September 2013. Hal tersebut dikatakan Plt Wali Kota Medan Drs H Dzulmi Eldin S, MSi, di Medan, Senin (1/7). Menurut dia, pendataan keluarga tersebut melalui instruksi Mendagri No 463/2374/ SJ tanggal 8 Mei 2013 tentang pendataan keluarga secara serentak diseluruh Indonesia. “Suratnya sudah kita terima dan pendataan akan kita laksanakan mulai 1 Juli hingga 30 September 2013,” ujarnya. Dijelaskannya, pendataan keluarga tersebut dilaksanakan untuk mendapatkan data yang lebih akurat dan akuntabel. Sehingga dapat membantu kelangsunganhidupyangharmonisdan berkelanjutan di Kota Medan. Kata Eldin, pendataan ke-

luarga merupakan kegiatan pengumpulan data primer tentang data demografi, data keluarga berencana, data tahapan keluarga sejahtera, dan data anggota keluarga yang dilakukan oleh masyarakat beserta pemerintah. “Data Primer ini penting kita laksanakan dengan baik dan benar. Sehingga data demografi dan data keluarga berencana dan tahapan data selanjutnya dapat terlaksana secara berkelanjutan,” sebut Eldin seraya menambahkan, harapan ke depan data dapat diterapkan sebagai pedoman dalam menentukan kota yang mensejahterakan masyarakat Kota Medan. Sementara itu Kaban Pemberdayaan Perempuan dan Keluarga Berencana (Badan PPKb) Kota Medan Pulungan Harahap SH, MSi mengatakan, pendataan keluarga dilakukan dari rumah ke rumah oleh petugas pendata tingkat kecamatan, kelurahan, dan lingkungan. “Jadi pendataannya dapat

akurat dan jelas cakupannya. Ini yang kita harapkan nantinya. Sehingga petugas harus dapat mempedomani pendataan yang dilakukan,” katanya. Menurut dia, setiap wilayah harus dibuat peta keluarga yang akan memudahkan pemetaan Pasangan Usia Subur (PUS). Dan untuk mengetahui tahapan keluarga sejahtera seperti tahapan keluarga pra sejahtera, keluarga sejahtera tahap satu, tahap dua, tahap tiga, serta keluarga sejahtera tiga plus. “Itulah rincian yang akan kita lakukan dalam melaksanakan pendataan. Sehingga data yang kita butuhkan dapat benar-benar terlaksana dengan baik,” tuturnya. Pulungan mengatakan, pendataan ini dilakukan untuk keperluan operasional program KB nasional dan juga untuk manfaat di sektor pembangunan Kota Medan. Khususnya susunan program dukungan pemberian bantuan keluarga pra sejahtera.(m30)

Wagubsu Buka Jambore Remaja Masjid MEDAN (Waspada): Wakil Gubernur Sumatera Utara Ir H Tengku Erry Nuradi MSi, membuka Jambore Entrepreneur Remaja Masjid ASEAN II 2013, di Aula Martabe Kantor Gubsu Jln. Diponegoro, Kamis (27/6). Hadir Presiden Dunia Melayu Dunia Islam Datuk Sri H Muhammad Ali Rustam, Konsul Malaysia Tuan Ahmad Rozian Abdul Ghani, Pengurus BKPRMI Sumut Armansyah, Brigade Masjid BKPRMI, Utusan BKPRMI Kalsel, NTB, Sulsel, undangan serta ratusan peserta lainnya. Dalam sambutannya, Wagubsu menilai jambore yang digelar bernilai positif dan strategis dalam membangun jiwa enterpreneur generasi muda Islam khususnya di Sumatera Utara. Dia juga mengapresiasi kerja seluruh panitia yang telah mensukseskan acara tersebut. Kata Tengku Erry, tahun 2015 mendatang Indonesia

akan memasuki ASEAN Community, sehingga kompetisi ekonomi dan budaya bakal semakin besar. Dia menilai dengan jambore entrepreneur dapat meningkatkan jiwa enterpreneur di kalangan remaja Islam, sehingga mampu menciptakan peluang usaha. “Pemuda terkenal dengan jiwa kreativitasnya sehingga sangat tepat untuk menciptakan jenis usaha baru, meningkatkan mutu dan kualitas dari usaha tersebut,” tuturnya. Selain itu, diharapkan dengan ASEAN Community nantinya akan terjalin kerjasama saling menguntungkan antar negara. Kerjasama tersebut seharusnya saling menguntungkan dan jangan kiranya remaja Islam Indonesia dan Sumatera Utara, hanya menjadi penonton di negerinya sendiri. Jika hanya menguntungkan satu pihak saja, maka hal tersebut akan menimbulkan persaingan tidak sehat.

Wagub bersyukur empat tahun terakhir ekonomi Sumut tumbuh pesat, investasi memuaskan. Untuk itu dia berharap wirausahawan harus membangun semangat persaudaraan serumpun karena sejarah mencatat pesebaran Islam termasuk di Indonesia juga dibawa oleh para saudagar dari Malaysia.”Saatnya kejayaan ekonomi Islam yang pernah tercatat di masa lalu kita raih kembali,” sebutnya. Datuk Sri H Mahmud Ali Rustam, Presiden Dunia Melayu Dunia Islam, dalam sambutannya mengharapkan agar remaja Islam bersatu. “Di belahan dunia lainnya umat Islam ada yang tertindas, baik secara budaya dan ekonomi. Maka dari itu kita selaku umat Islam harus bersatu bangun semangat kebersamaan dan persaudaraan termasuk membangun ekonomi kita,” katanya.(m28)

Waspada/Zulkifli Dartwis

ROMBONGAN PD Pemuda Muhammadiyah Kota Medan beraudensi ke Redaksi Harian Waspada.

Muhammadiyah Medan Gelar Pengkaderan Melati Muda MEDAN (Waspada): Pimpinan Daerah (PD) Pemuda Muhammadiyah Kota Medan, menggelar pengkaderan (pelatihan) Melati Muda Gerakan 1000 Kader Muda, di Asrama Haji Pangkalan Mansyur Medan, Sabtu-Minggu (29-30 Juni 2013). Demikian disampaikan Ketua PD Pemuda Muhammadiyah Kota Medan Maulana Malik Muttaqin MA, beserta rombongan panitia pelaksana Ibrahim ST (ketua), Dt Imam Marzuki MA (sekretaris), Edisaputra IT (Sekretaris PDPM), Munawar A (bendahara), Robie Fanreza (wakil ketua PDPM) ketika beraudiensi ke Redaksi Waspada Medan, yang diterima Kepala Humas Waspada H Erwan Effendi di lantai 3 ruang rapat Gedung Bumi Warta Waspada,

Kamis (27/6). Kata Maulana Malik, latar belakang dilaksanakannya pengkaderan Melati Muda Gerakan 1000 Kader Muda, setelah akhir-akhir ini melihat kecenderungan para remaja, pemuda rentan dengan berbagai problem dalam kehidupan seharihari seperti narkoba, seks bebas, geng kereta, dan tindak kejahatan lainnya bersifat anarkis yang semakin meresahkan para orangtua maupun masyarakat. “Ini merupakan program PD Pemuda Muhammadiyah Kota Medan yang nantinya diadakan 25 kali dalam satu tahun, dan pengkaderan Melati ini merupakan kegiatan awal,” ujarnya. Diharapkan, dari even perdana ini akan muncul pelo-

por kader Muhammadiyah yang memiliki elektabilitas dan secara individu bisa terhindar dari hal-hal negatif seperti anarkis ketika penyampaian aspirasi . Ketua Panpel Ibrahim ST mengatakan, sesuai target dari setiap cabang akan direkrut 40 peserta terdiri dari pimpinan cabang Muhammadiyah Se Kota Medan didata melalui validasi, sedangkan lounching digelar Sabtu (29/6). Kepala Humas Waspada H Erwan Effendi menyatakan, sangat mengapresiasi program Pemuda Muhammadiyah Kota Medan, dengan menggelar even tersebut. Diharapkan mampu memberikan kontribusi yang positif khususnya bagi pemuda dan masyarakat luas.(m24)

Polisi Gelar Rekonstruksi Pembunuhan Siswa SMP MEDAN (Waspada): Penyidik Polsek Percut Seituan menggelar rekonstruksi kasus perampokan yang menewaskan siswa kelas III SMP M Safiq Gultom,14, warga Jln. Pancasila Gg Datuk Rasyid, Dusun III, Kec. Batangkuis, di halaman Polsek Percut Seituan, Jumat (28/6). Dalam rekonstruksi tersebut, penyidik menghadirkan tiga tersangka berinisial UA dan MA, serta dan IQ (masih buron), sedangkan korban diperagakan oleh orang lain. Rekonstruksi tersebut memperagakan 24 adegan. Awalnya, Senin (13/5) sekira pukul 22:00, tersangka UA, 26, warga Aspol Jln. HM Joni Blok F, Kel. Binjai, Kec. Medan Denai, menghubungi korban Safiq Gultom untuk bertemu di kawasan Pasar X, Tembung. Setelah menghubungi korban via telefon seluler, tersangka UA menghubungi tersangka MA yang saat itu bersama tersangka IQ. Selanjutnya tersangka UA menjemput korban dan tersangka MA berboncengan dengan tersangka IQ dan bertemu di SPBU Pasar XI Tembung. Disana tersangka UA merencanakan mencuri sayur di kawasan Sambu. Namun, rencana mencuri sayur batal karena tersangka UA mengalihkan untuk merampok satu rumah di kawasan tersebut. Untuk meyakinkan korban, tersangka UA mengatakan akan mengisi badan dengan ilmu kebal mana tahu ketangkap nanti sehingga tidak mempan dipukuli massa. Untuk mengisi ilmu kebal tersebut mereka berangkat ke Kampung Agas, Pasar IV, Desa Sampali. Disana, tersangka IQ menunggu di luar sementara tersangka UA, MA dan korban menuju pondok. Di lokasi korban Safiq Gultom disuruh menanggalkan baju dan handphonenya. Kemudian korban disuruh tidur dan tersangka MA menutup mata korban, lantas tersangka UA menyerahkan pisau

Waspada/Andi Aria Tirtayasa

TERSANGKA UA menutup mata korban Safiq Gultom dan menyuruh MA untuk menikam leher korban saat melakukan rekonstruksi perampokan dan pembunuhan terhadap siswa kelas III SMP tersebut di halaman belakang Mapolsek Percut Seituan. untuk menusuk korban, selanjutnya MA menusuk leher dan bagian lain. Setelah itu tersangka MA membuang pisau dan berlari menuju tersangka IQ yang menunggu di luar pondok. Selanjutnya, ketiga tersangka melarikan diri sekaligus membawa kabur sepedamotor Yamaha Vixion milik korban. Korban sempat dirawat selama dua hari di rumah sakit akhirnya meninggal dunia akibat luka gorokan di leher, Rabu (15/5). Seminggu kemudian, tersangka UA diringkus di rumahnya Asrama Polisi Pasar Merah dan tersangka MA di ru-

mahnya kawasan Desa Bandarsenembah, Kec Tanjungmorawa. Sedang tersangka IQ masih diburon. Kanit Reskrim Polsek Percut Seituan AKP Faidir Chan menjelaskan, rekonstruksi tersebut dilakukan untuk melengkapi berkas acara pemeriksaan (BAP) sebelum BAP-nya dilimpahkan ke jaksa penuntut umum (JPU). Pantauan Waspada, rekonstruksi tersebut berjalan lancar, namun tidak terlihat keluarga korban sedangkan para pelaku didampingi tim penasehat hukum. Hadir juga Kapolsek Percuit Seituan Kompoil Erinal. (h04)

Fasilitas Publik Untuk Lansia Minim MEDAN (Waspada): Fasilitas publik untuk kelompok lanjut usia (lansia) masih sangat minim. Karena itu, Gubernur Sumatera Utara H Gatot Pujo Nugroho ST, MSi, segera mengeluarkan kebijakan membangun fasilitas publik untuk mereka. Rencana tersebut diutarakan Gatot pada Peringatan Hari Lanjut Usia Nasional (HLUN) Provsu 2013, di Aula Martabe Kantor Gubernur Sumatera Utara, Senin (1/7). Menurut Gubsu, sudah saatnya Sumatera Utara meniru negara-negara maju yang tetap memperhatikan kepentingan para lansia dan orang berkebutuhan khusus dalam pembangunannya. Tak heran, jika di kota-kota negara maju sangat mudah menemukan fasilitas seperti jalur khusus untuk kursi roda, toilet khusus, tangga khusus, bahkan tempat penyeberangan khusus bagi golongan ini. Melihat masih minimnya sarana tersebut, mendorong Gubsu segera mengeluarkan kebijakan yang nanti juga disosialisasikan hingga ke kabupaten/ kota. Untuk mengeluarkan kebijakan ini, Gubsu mengaku sudah berdiskusi dengan Sekda dan para stafnya. Terkait Hari Lanjut Usia, Gubsu berharap agar para Lansia di usia senjanya tetap aktif dan memberikan teladan bagi generasi muda. Dengan pengalaman hidup yang banyak para Lansia dapat menularkan ilmu kebajikan dan kebijaksanaan untuk anak-anak muda masa kini. Dalam kesempatan itu

Gubsu menyerahkan bantuan kursi roda, tongkat, bingkisan, bantuan bagi Kelompok Usaha Bersama Lansia dan lainnya. Drs H Daeng Malewa MM, selaku Ketua Panitia melaporkan, kegiatan tersebut telah rutin dilaksanakan setiap tahunnya. Adapun tema peringatan kali ini adalah “Lanjut Usia Pelopor Jati Diri Bangsa”. Dengan tema tersebut, Daeng berharap para Lansia tetap mampu memberikan sumbangsih bagi pembangunan bangsa dalam pembentukan karakter anak bangsa. Lansia adalah orangtua yang layak jadi teladan dan tidak boleh dibiarkan apalagi disia-siakan. Dilaporkannya, dalam rangkaian peringatan panitia melaksanakan pengobatan gratis, anjangsana bagi pasien di RSU Pirngadi Medan dan RS

Haji Medan, lomba antar Lembaga Pemberdayaan Perempuan Lanjut Usia (LPPLU) dan kegiatan sosial lainnya. Acara HUT dimeriahkan dengan penampilan tarian sambutan dan grup vokal oleh para Lansia. Usia lanjut tak menghalangi mereka manortor bersama pejabat Pemprovsu dan sesama mereka. Hadir dalam acara tersebut Wakil Gubernur Sumatera Utara Ir H Tengku Erry Nurady MSi, Pelaksana Kabiro Binsos Provsu H Hasban Ritonga, Ketua MUI Sumatera Utara Prof DR Abdullah Syah MA, anggota DPD RI Pralindungan Purba, perwakilan Kodam I BB, Lantamal Medan, Kosekhanudnas 3, Ketua Dharma Wanita Persatuan Ny Doharni Nurdin Lubis, Legiun Veteran RI, serta ratusan peserta Lansia lainnya.(m28)

Waspada/Amir Syarifuddin

GUBSU Gatot Pujo Nugroho bersama Wakil Gubsu T Erry Nuradi, anggota DPD-RI Parlindungan Purba, dan para undangan lainnya menghadiri acara Peringatan Hari Lanjut Usia Nasional (HLUN), di Aula Martabe Kantor Gubsu.


WASPADA Rabu 3 Juli 2013


DPR Setujui RUU Ormas FPAN, Hanura Dan Gerindra Menolak JAKARTA (Waspada): DPR RI melalui rapat paripurna yang pimpinan sidang Wakil Ketua DPR Taufik Kurniawan, Selasa (2/7) di Gedung DPR, Jakarta, akhirnya menyetujui Rancangan Undang-undang tentang Organisasi Kemasyarakatan (Ormas) untuk disahkan sebagai undang-undang. Persetujuan DPR ini diambil melalui voting setelah jalan musyawarah dan mufakat tidak tercapai, sebab ada tiga fraksi yang menolak RUU Ormas ini yakni Fraksi Partai Amanat Nasional, Fraksi Partai Hanura, dan Fraksi Partai Gerindra. Sesuai hasil voting DPRRI atas RUU Ormas ini, sebanyak 311 orang anggota dewan setuju RUU Ormas terdiri dari 107

anggota Fraksi Partai Demokrat, 75 anggota Fraksi Partai Golkar, 62 anggota Fraksi PDI Perjuangan, 35 anggota Fraksi PKS, 22 anggota Fraksi PPP, dan 10 anggota Fraksi PKB. Sedang yang menolak hanya 50 orang yang terdiri dari 26 anggota Fraksi PAN, 18 anggota Fraksi Gerindra dan 6 anggota Fraksi Hanura. Sementara di depan gedung DPR berbagai elemen buruh melakukan demo untuk menolak RUU Ormas. Adapun ormas yang ikut dalam demonstrasi antara lain Konfederasi Serikat Pekerja Indonesia (KSPI), Majelis Pekerja Buruh Indonesia (MPBI), Gabungan Lembaga Swadaya Masyarakat, Kontras, WWF dan ormas - ormas lainnya.

Lebih Karena Politis Penolakan RUU Organisasi Kemasyarakatan oleh fraksifraksi di DPR lebih karena pertimbangan politis dan bukan substansi atau kontens dalam RUU. “Penolakan RUU Ormas menjadi UU lebih pada pertimbangan politis, bukan substansi atau kontens. Karena sejak awal masing-masing fraksi di Pansus ikut rapat dan di Pansus tak ada pertentangan sama sekali,” kata Ketua Panitia Khusus RUU Ormas Abdul Malik Haramain di Gedung MPR/DPR/DPD RI di Jakarta, Selasa (2/7). Ia juga menyebutkan penolakan terhadap RUU Ormas oleh beberapa fraksi terhadap RUU inisiatif DPR RI menjadi preseden buruk bagi DPR RI. “Ini preseden buruk teruta-

ma produktifitas DPR RI. Mestinya RUU inisiatif DPR RI harus didukung hingga ke rapat paripurna. Kalau menolak, harusnya di Badan Legislatif dan itupun dalam konteks substansi atau isi dari RUU. Perdebatannya pada substansi, bukan menolak atau menerima,” kata politisi PKB itu. Bahkan, ia juga menyebutkan, fraksi yang menolak di Panitia Kerja (Panja), Pansus dan rapat paripurna adalah bentuk ketidakkonsistenan fraksi-fraksi tersebut. “Oleh karena itu, UndangUndang MPR, DPR, DPD dan DPRD (MD3) harus direvisi. Bila RUU inisiatif DPR RI, maka RUU tersebut harus didukung, harus konsisten, kecuali RUU dari pemerintah.” (aya/ant)


ANGGOTA DPR dari fraksi Partai Demokrat berdiri menyatakan setuju dengan pengesahan RUU Ormas dalam rapat paripurna di Kompleks Parlemen, Senayan, Jakarta, Selasa (2/7).

IPW: Polri Jangan Anggap DPR Setujui 7 Anggota KIP 2013-2017 JAKARTA (Waspada): DPR nasari, Henny S. Widyaningsih menjalankan Undang-Undang Enteng Dinamit Yang Hilang RI memberi persetujuan terha- (incumbent), John Fresly, No.14Tahun 2008 dan peraturan


CAPRES Partai Hanura Wiranto didampingi Istri Rugaiya Usman Wiranto dan Cawapres Partai Hanura Hary Tanoesoedibjo didampingi Istri Liliana Tanaja Tanoesoedibjo mendeklarasikan Capres Cawapres dari Partai Hanura di Jakarta, Selasa (2/7). Partai Hanura mendukung pasangan ini untuk mengikuti pemilihan Presiden dan Wakil Presiden dalam pemilu 2014.

Hanura Deklarasikan WirantoHary Tanoe Capres-Cawapres JAKARTA (Antara): Partai Hati Nurani Rakyat (Hanura) resmi mengumumkan akan mengusung pasangan Wiranto dan HaryTanoesoedibjo sebagai calon presiden dan wakil presiden pada Pemilu 2014 melalui deklarasi yang dilakukan di Jakarta, Selasa (2/7). “Saya dan Hary Tanoe telah meneguhkan tekad untuk mengambil peran memimpin perubahan di Indonesia sebagai calon presiden dan wakil presiden RI pada Pemilu 2014,” kata Wiranto dalam deklarasi di hadapan ratusan calon legislatif Partai Hanura. Panglima TNI periode 1998 -1999 itu mengatakan, perbedaan latar belakang dia dan Hary Tanoe akan digunakan sebagai senjata untuk melakukan perubahan.

“Dengan modal pengalaman saya memimpin organisasi militer ditambah pengalaman pasangan saya sebagai pengusaha sukses, kami yakin perpaduan itu saling mengisi dan melengkapi untuk mewujudkan perubahan menjadi kenyataan,” jelasnya. Hary, yang baru saja ditunjuk menjadi Ketua Badan Pelaksana Pemenangan Pemilu (Bapilu) Partai Hanura, mengaku sepaham dengan visi dan misi Wiranto untuk mencalonkan diri men-jadi presiden. “Dengan latar belakang kami yang berbeda,Wiranto dari militer yang sangat berpengalaman, tegas dan saya dengan kemampuan ekonomi dan bisnis, maka itu akan menjadi kekuatan maksimal untuk bangsa ini,” kata Hary Tanoe

yang belum lama keluar dari Partai NasDem itu. Hanura adalah partai politik pertama yang mendeklarasikan pasangan calon presiden dan calon wakil presiden ketika pelaksanaan Pemilu 2014 masih dalam tahap pencalonan anggota legislatif. Pada Pemilu 2009, Partai Hanura hanya mendapat 18 kursi (3,21 persen) di DPR dari total perolehan suara sebesar 3.922.870. Pemilu 2014, Partai Hanura percaya diri dapat meraih banyak suara dan menempati posisi tiga besar partai politik pemenang Pemilu. “Dengan sekarang ini, yang sudah dikenal publik dan memiliki instrumen lengkap di daerah, kita ingin masuk sebagai tiga besar, nomor berapanya, itu urusan belakang,” ujarnya.

JAKARTA (Waspada) : Indonesia Police Watch (IPW ) minta Polri tidak anggap enteng atas hilangnya 250 dinamit yang dapat saja digunakan oleh teroris yang ingin mengacaukan situasi di tanah air, apalagi dalam waktu dekat ada dua event internasional yang akan di gelar di Indonesia. “Jangan anggap enteng, lengah dan ceroboh terhadap kasus hilangnya 250 dinamit dalam perjalanan dari Subang ke Bogor. Sebab bukan mustahil dinamit tersebut jatuh ke jaringan teroris mengingat dalam waktu dekat ada dua even internasional di Indonesia,” kata Ketua Presedium IPW Neta S Pane dalam keterangan persnya di Jakarta, Selasa (2/7). Menurut Neta, dua event inetrnasional yang dalam waktu dekat ini berlangsung yakni, kunjungan Perdana Menteri Australia Kevin Rudd ke Jakarta dan Bogor pada 4 - 5 Juli 2013. “Situs berita Sydney Morning Herald sudah mengaitkan berita hilangnya dua kotak dinamit itu di Bogor dengan rencana kunjungan Kevin ke Bogor,” kata Neta. Sedangkan event kedua yakni, konferensi tingkat tinggi Kerja Sama Ekonomi Asia Pasifik (APEC) yang akan berlangsung di Bali pada Oktober 2013. Selain itu pada 17 Juli adalah peringatan 14 tahun tragedi bom Kuningan 3. “Kawasan Kuningan sudah tiga kali kena serangan teror bom. Terakhir, 17 Juli 2009 Hotel JW Marriott dan Ritz Carlton Kuningan hancur diterjang

bom. Sembilan orang tewas dan 53 luka dalam tragedi tersebut,” kata Neta. Sehingga lanjut Neta, eventevent ini patut diwaspadai Polri, sebab saat ini ada dua kelompok teroris yang masih bergentayangan, yaitu kelompok Upik Lawanga dan Santoso dari Poso yang masih menghimpun kader-kadernya untuk membuat bom termos, bom buku, bom senter dan lainnya. “Lalu kelompok pengikut Sigit Qurdowi dari Solo. Meski Sigit sdh tewas tertembak, pengikutnya masih beraksi. Bom bunuh diri di mesjid Polres Cirebon pada 15 April 2011 adalah rancangan mereka,” terang Neta. Hilangnya 250 dinamit, harus diwaspadai karena bisa dijadikan bom ransel oleh teroris bila dinamit yang hilang itu ada pada para teroris. “Karena bahan peledak (handak) organik dalam dinamit (seperti TNT) adalah bahan utama pembuatan bom ransel, yang ringkas, tidak perlu banyak tapi hi-explosive. Bom ransel bukan terbuat dari handak anorganik low explosive (yang biasa disebut black powder), jadi ledakannya akan lebih dahsyat. Jadi, dalam kasus hilangnya 250 dinamit tersebut, Polri harus mengantisipasi serangan bom bunuh diri dengan target dalam ruangan, seperti yang terjadi di Hotel Marriott II dan Jimbaran Cafe, Bali. Jika Polri bisa segera menemukan 250 dinamit itu kekhawatiran tersebut tentu akan berkurang,” ucap Neta.(j02)

Langkah Hanura Cukup Berani, Tapi Kurang Strategis JAKARTA (Waspada): Politisi Partai Demokrasi Indonesia Perjuangan (PDIP), H Irmadi Lubis mengakui langkah yang diambil Partai Hanura mendeklarasikan pasangan calon presiden-calon wakil presidennya sebuah langkah yang baik, sekaligus menjadi pendidikan politik bagi rakyat. Tetapi, langkah yang ditempuh Hanura kurang strategis sebab akan sangat sulit mewujudkannya menginggat ambang batas parlemen (parliamentary threshold)

perolehan suara minimal partai politik Pemilu 3,5 persen. Artinya, Hanura harus memperoleh 3,5 persen suara pada pemilu legislatif, baru bisa mengajukan capres dan cawapresnya. “Kalau Hanura tidak mendapatkan PT pada Pemilu legislatif, tentu pasangan Wiranto - Hary Tanoesoedibjo akan kandas. Tapi dari segi pendidikan politik, langkah ini sangat baik dan cukup berani, “ ujar Irmadi Lubis menjawab Waspada, Selasa (2/7), di sela-sela

mengikuti rapat paripurna di Gedung DPR, Jakarta. Irmadi pun menegaskan, langkah Hanura mendeklarasikan pasangan Capre-cawapres sesuai dengan konstitusi, walaupun sulit untuk mewujudkannya. Yang jelas, katanya, Hanura sudah menunjukkan ke rakyat Indonesia bahwa partai itu sudah memiliki capres-cawapres jika nanti bisa mendapatkan suara sesuai dengan ambang batas yang ditetapkan. “ Hanura memberi contoh

yang bagus dan berani ambil risiko,” tegasnya. Anggota DPRRI dari daerah pemilihan Sumut 1 ini pun menyarankan partai politik lain untuk sejak awal mendeklarasikan capresnya sebagai informasi yang tegas dan jelas kepada masyarakat. Dengan deklarasi awal, tambah Irmadi, pemilih parpol di Pemilu legislatif sudah mengetahui siapa yang akan dijagokan parpol pilihannya menjadi capres. Jika pemilih sudah me-

ngetahui capres akan diusung parpol pilihannya, maka rakyat (pemilih) tidak akan merasa suaranya dijual parpol lagi. “ Selama ini kan pemilih legislatif yang memilih anggota DPR dan parpol tidak mengetahui secara pasti siapa caprescawapresnya. Rakyat yang punya hak pilih baru mengetahui siapa pasangan caprescawapres setelah adanya koalisi yang dibangun parpol jelang pemilihan presiden, “ujar Irmadi Lubis. (aya)

dap tujuh orang anggota Komisi Informasi Pusat (KIP) periode 2013-2017 yang dihasilkan Komisi I DPR melalui uji kelayakan. Persetujuan DPR atas tujuh anggota KIP ini diambil melalui rapat paripurna DPR, yang dipimpin Wakil Ketua DPR Taufik Kurniawan di Gedung DPR, Jakarta, Selasa (2/7). Sebelumnya, Wakil Ketua Komisi I DPR Ramadhan Pohan menyampaikan tujuh nama yang terpilih adalah Abdulhamid Dipopramono, Dyah Aryani Prastyastuti, Evy Trisulo Dia-

Rumadi, danYhannu Setyawan. Dengan persetujuan inui, DPR mengharapkan anggota KIP menetapkan petunjuk teknis standar layanan informasi publik, serta menyelesaikan sengketa informasi publik melalui mediasi dan/atau ajudikasi non litigasi. “Kita mengharapkan agar tujuh orang calon anggota Komisi Informasi Pusat periode 2013-2017 terpilih ini dapat melaksanakan fungsi Komisi Informasi yang baik, yaitu sebagai lembaga mandiri untuk

pelaksanaannya,” tegas Ramadhan Pohan Selain itu, untuk mengantisipasi kemungkinan adanya anggota KIP yang berhalangan tetap, maka DPR juga menyetujui empat nama cadangan yaitu Wahyu Kuncoro, Halomoan Harahap, Juniardi, dan Tiurma Mercy Sion Sihombing. Selanjutnya, DPR akan menyampaikan persetujuan ini kepada Presiden untuk mendapatkan penetapan Presiden menjadi Anggota KIP periode 2013-2017. (aya)


BEBERAPA mahasiswa Doshisha University Jepang ikut belajar tari Saman Aceh pada personel grup Sanggar Mirah Delima Umuslim, di kampusnya tersebut, Senin (1/7).

Mahasiswa Doshisa University Belajar Tari Saman Aceh PEUSANGAN (Waspada) : Sejumlah mahasiswa Doshisha University, Kyoto, Jepang, meminta kepada para personel grup Sanggar Mirah Delima, Universitas Almuslim (Umuslim), Peusangan, Bireuen, yang sedang melakukan kunjungan Muhibah Seni ke negara tersebut sekarang ini untuk mengajarkan Tari Saman Aceh. Karena mereka mengaku tertarik dengan seni tarian tradisional Aceh yang penuh heroic, juga mereka mengaku sangat kagum dengan penampilan Sanggar Mirah Delima yang tampil dalam kunjungan ke perguruan tinggi yang berada di Kota Kyoto tersebut. Demikian dilaporkan Rektor Umuslim, Peusangan, Bireuen, Amiruddin Idris dan para dosen yang ikut dalam dalam kegiatan itu, Selasa (2/7) via surat elektronik. “Kedatangan kami langsung disambut Asisten Profesor Shiozaki bersama civitas Akademika Dosisha University dengan meriah,” katanya.

Menurut Amiruddin, tim muhibah seni Umuslim tiba di Doshisha setelah dua jam menempuh perjalanan dengan shinkazen (kereta cepat) dari Tokyo selama dua jam dan acara dimulai pada pukul 17:00 waktu setempat atau 19:00. “Acara berlangsung sebagaimana rencana atau yang telah diagendakan, karena memang budaya Jepang yang sangat disiplin waktu,” katanya. Tidak lama setelah tiba di Doshisha University, grup sanggar seni Mirah Delima Umuslim pimpinan Nuryani Rachman, langsung menampilkan kesenian nusantara antara lain tari Pakarena (Sulawesi), Kreasi Tsunami, Serunuee Kalee, Tari Saman dan Tari Rapaii Geleng. “Penampilan anak-anak saat itu sungguh luar biasa sehingga sempat berdecak kagum para penonton yang terdiri dari akademisi, mahasiswa, masyarakat Jepang dan mahasiswa Indonesia yang sedang menempuh pendidikan di

Kyoto,” ujarnya. Karena penampilan yang luar biasa itu anak-anak Umuslim, sambungnya, para penonton serta mahasiswa setempat meminta Koko cs untuk memperpanjang waktu lagi dan juga setelah tampil mereka dikerumuni seraya memohon untuk mengajarkan tarian Saman Aceh tersebut. Selain itu, tambah Rektor, setelah acara pertunjukan selesai, para mahasiswa Doshisha juga meminta dialog dengan mahasiswa Umuslim yang berthemakan tentang kebudayaan khusunya tari Saman dan asal usul budaya Aceh yang sangat bernuansa Islami. Tim Sanggar Mirah Delima mengajarkan mereka tari Saman dan saat itu mahasiswa Jepang sangat senang mengikutinya dan saat itu mereka berbaur bersama mahasiswa Umuslim. mahasiswa Almuslim sempat dijamu makan malam bersama di sebuah restoran.(cb02)

penonton yang dibalut dengan nilai-nilai estetika, melainkan di dalamnya bertujuan agar masyarakat pendengarnya dapat memaknai hidup sesuai dengan realitas akan kehidupan para Nabi dan tokoh yang sesuai dengan Islam. Dalam didong itu kental bernafas nilainilai religius, nilai-nilai keindahan, nilai-nilai kebersamaan dan lain sebagainya. Pesan didong yang digemakan oleh ceh, itu menyindir lemahnya kesetiakawanan sosial dan memudarnya ketaatan manusia kepadaTuhan sehingga manusia menjadi murka terhadap Allah dan lingkungan di sekitarnya. “Sindiran itu dapat disimak ketika ceh ber-didong dengan gaya syair dan suara yang merdu dibumbui tepuk tangan,” kata Syafaruddin yang turut menyaksikan pertunjukan tersebut. Memang setiap hajatan akan menentukan tema yang diusung. Pada malam itu, didong tidak ditampilkan untuk tema hari-hari besar agama Islam, melainkan hajatan untuk penyambutan tamu seorang kepala daerah di Kabupaten Bener Meriah. Dua kelompok didong menyampaikan tekateki yang berkisar pada aturan

adat bagaimana memimpin rakyat yang baik, religius, dan cinta bangsa- tanah air. Dalam hal ini para senimannya saling membalas “serangan” berupa lirik yang dilontarkan oleh lawannya antar-kelompok yang saling ber-didong. Ahli budaya Gayo di Medan Dr Fikarwin mengatakan, pergelaran kesenian didong cara masyarakat Gayo di perantauan yang ingin meneguhkan identitas ke-Gayo-annya sekaligus memberikan pengetahuan masyarakat tentang nilai-nilai adat agar terus terpelihara. Di sinilah peran ceh sebagai pewaris nilai-nilai yang hampir punah agar pemerintah memikirkan regenerasinya. Dengan demikian para ceh dapat secara berkesinambungan mengungkap kembali nilai-nilai adat dan kesenian ini agar terlestarikan. Saat ini keberadaan ceh mulai terasa langka. Jika kita ingin didong tetap sebagai warisan budaya sebagai penyeimbang kegersangan nilainilai globalisasi, ditandai tergerusnya identitas kebangsaan, maka pemerintah harus menekankan sosialiasi kesenian ini di dalam kurikulum pendidikan. Muhammad Thariq

Didong Perekat Orang Gayo Di Perantauan KABAR didong sampai ke telinga mereka begitu cepat pada minggu siang itu. Seolaholah teknologi komunikasi mahfum akan pentingnya menghidup-suburkan kembali peran kesenian tradisional di tengah krisis identitas kebangsaan akibat gersangnya nilai-nilai globalisasi, terutama bagi komunitas Gayo di negeri urban seperti Kota Medan. Bahkan, tidak cukup menggunakan short message service (SMS), prihal adanya pertunjukan kesenian dari dataran tinggi Gayo itu dikabarkan secara sukarela dari mulut ke mulut dalam sebuah paguyuban. Orang-orang Gayo terutama para orangtua (jema tetue) langsung membuat janji satu sama lain untuk datang dan pulang bersama-sama sedari pertunjukan kesenian itu, layaknya kawula muda. Yang memiliki mobil berpenumpang atau yang masih tergolong muda (mude) rela menjemput orang yang dituakan ke rumahnya dan juga keluarga yang lain, meski jarak rumahnya cukup jauh. Pada malamnya, setelah sampai di arena pertunjukan, mereka pun “berebut” duduk di kursi depan di sebuah gedung pertunjukan seni berkapasitas

lima ratus orang di Jalan Perintis Kemerdekaan Medan. Penonton ingin tanpa sekat menikmati kesenian didong semalam suntuk itu, dimana mereka masih berkeyakinan pesan didong masih sebagai “magnet” dalam memadukan kembali identitas Gayo, yang menjadi minoritas di perantauan diharapkan dapat menjadi mayoritas dari sisi moral, ketaatan kepada Tuhan, dan merekatkan interaksi sosial antar-sesama yang kini mulai dikubur hiduphidup. Melalui didong ini, mereka pun sedari awal menunjukkan relasi sosial yang cukup bermakna. Sebab ada keyakinan di kalangan mereka, menjemput tetue oleh orang mude sama-sama meraih derajat kehormatan yang tinggi, pun masih hidup subur di tengah menggerusnya kesetiakawan sosial di negeri kita. “Orang muda menjemput orang yang dituakan belum lekang dalam masyarakat Gayo di perantauan, walau hidup di perantauan dan di kota. Kebiasaan ini terus terpelihara, tidak hanya dilakukan saat pertunjukan kesenian didong akan digelar, tetapi berlaku saat acaraacara yang lain seperti pengajian

PERTUNJUKAN kesenian didong Gayo dan pesta perkawinan,” kata mantan Ketua Keluarga Gayo Su m a t e ra Ut a ra ( KG S U ) Syafaruddin, kemarin. Identitas bangsa Dia yakin jika kesenian didong ini rutin dilaksanakan, bangsa ini akan menemukan kembali nilai-nilai yang telah luntur dan kita akan menemukan kembali identitas bangsa

yang besar dan cinta kasih sayang. Didong dikenal sebagai sebuah kesenian rakyat yang memadukan unsur tari, vokal, dan sastra. Dari sejarahnya, didong sudah ada sejak zaman Raja Linge XIII, seorang pemimpin di tanah Gayo mulai abad ke-11 (Takengon-Bener Meriah). Kesenian ini diperkenalkan pertama kali oleh Abdul Kadir


To‘et, dan kesenian ini lebih digemari oleh masyarakat Takengon dan Bener Meriah, Provinsi Aceh. Ada pula berpendapat kata “didong” mendekati pengertian kata “denang” atau “donang” yang artinya “nyanyian sambil bekerja atau untuk menghibur hati atau bersamasama dengan bunyi-bunyian”. Dan, ada pula yang berpendapat

bahwa didong berasal dari kata “din” dan “dong”. “Din” berarti agama dan “dong” berarti dakwah. Pada pertunjukan didong malam itu yang dihadiri ratusan orang Gayo di Medan, tampil dua kelompok (didong jalu) terdiri dari seniman/penyair (ceh) dan anggota lainnya yang disebut dengan penunung. Jumlahnya mencapai 30 orang, yang terdiri atas 4-5 orang ceh dan sisanya adalah penunung. Ceh yang tampil memiliki bakat yang komplit dan mempunyai kreativitas yang tinggi. Ia mampu menciptakan puisi-puisi dan bernyanyi. Penguasaan terhadap lagu-lagu juga diperlukan karena satu lagu belum tentu cocok dengan karya sastra yang berbeda. Anggota kelompok didong ini umumnya adalah laki-laki dewasa. Peralatan yang dipergunakan pada mulanya bantal (tepukan bantal) dan tangan (tepukan tangan dari para pemainnya) yang disertai gerakan badan ke depan atau ke samping. Jadi kurikulum pendidikan Masih seperti sediakala, ceh didong tidak semata-mata menyampaikan tutur kepada

Luar Negeri


WASPADA Rabu, 3 Juli 2013

Snowden Minta Suaka Ke-19 Negara, Termasuk China WASHINGTON (AP): Website WikiLeaks mengatakan Selasa (2/7), Edward Snowden, pembobol dokumen Badan Keamanan Nasional AS (NSA), saat ini meminta suaka ke 19 lagi, termasuk China. Website itu mengatakan penasehat hukum Snowden, Sarah Harrison, menyampaikan permohonan suaka itu kepada seorang pejabat Konsulat Rusia di Bandara Moskow Minggu lalu. WikiLeaksmengatakan beberapa permintaan telah disampaikan kepadakedutaanyangdiinginkan. Pernyataan WikiLeaks mengatakan permohonan itu dibuat untuk China, Kuba, Nikaragua, Venezuela, India dan beberapa negaraEropa.Snowdensebelumnya telah berencana untuk mendapatkan suaka di Ekuador dan telah meminta suaka di Rusia. Sebelumnya, pembocor rahasia intelijen buronan AS itu menuduh Presiden AS Barack Obama melakukan ‘tekanan kepada para pemimpin negaranegara’ yang menjadi tujuannya untukmengajukanperlindungan. Dalam pernyataan pertama kaliyangdibuatnyadidepanpublik sejakdiameninggalkanHongkong delapanharilalu,SnowdenmenuduhObamatelahmemerintahkan Wakil Presiden Joe Biden untuk menekan para pemimpin negara yang menjadi tempat baginya untuk mengajukan suaka. “Kamis, Presiden Obama menyatakankepadaduniabahwa

Kremlin Selasa. “Menyampaikan permohonan suaka dari luar negeri adalah secara prinsip tidak diperbolehkan,” kata Sekretaris Deputi Kehakiman Norwegia Paal Loenseth

kepadapenyiarnegaraNRK.“Mengajukan permohonan untuk suaka seharusnya dilakukan di tanah Norwegia. Berdasarkan prosedur yang normal...permintaannya akan disangkal,” tambah

Loenseth. Sebelumnya Kementerian Luar Negeri Norwegia mengatakanmenerimapermohonansuaka dariSnowdenmelaluifaxdiKedutaan Besar negara tersebut di

MoskowpadaSeninsore.Jurubicara KementerianLuarNegeriNorwegia menolak memberikan rincian mengenai isi surat itu atau dari mana fax itu dikirim ke Kedubes Norwegia di Moskow. (m10)

dia tidak akan mengizinkan adanya ‘tawar menawar’ diplomatik dalam kasus saya,” kata Snowden dalam pernyataan yang dikeluarkan untuk situs WikiLeaks. “Tapi sekarang dilaporkan bahwasetelahdiaberjanjitidakakan melakukannya, Presiden memerintahkan Wakil Presiden untuk menekanparapemimpinnegaranegara -yang menjadi tujuan bagi saya untuk meminta perlindungan—untukmenolakpermintaan suaka saya,” tambahnya. Presiden Ekuador Rafael Correa mengatakan bahwa Biden telahmengungkitmasalahSnowden dalam pembicaraan yang berlangsung pekan lalu dan memintanya untuk menolak permintaansuakayangdiajukanoleh analis komputer buronan AS itu. Dari Oslo, Snowden mengajukan suaka politik kepada Norwegia,namunpemerintahnegara itukemungkinantidakmengabulkanpermintaanya,katapihakberwenang Norwegia Selasa (2/7). Warga negara AS berusia 30 tahunitu,yangmenghadapituduhanmata-matadiAS,mengajukan permintaan kepada 15 negara dantetapberadadidalamwilayah singgah di bandar udara Sheremetyevo,Moskow,katajurubicara

KUALA LUMPUR, Malaysia (Waspada): Pemerintah Malaysia telah menetapkan biaya untuk menggunakan seorang pembantu rumahtangga (PRT) Indonesia sebesar 8.000 ringgit Malaysia (sekitar Rp 25 juta lebih), namun ada perkiraan baru yang telah diusulkan bagi upah yang harus diterima PRT Indonesia. Deputi PM MuhyiddinYassin, yang mengetuai Komisi Kabinet mengenai Pekerja Asing dan Imigran Ilegal, mengatakan bahwa ketentuan baru itu telah diputuskan setelah mempertimbangkan semua biaya dari kedua negara, Malaysia dan Indonesia. “8.000 Ringgit Malaysia telah diputuskan setelah mempertimbangkan biaya pelatihan selama sekurang-kurangnya 200 jam, dokumentasi, makanan dan akomodasi sebelum transter kepada para majikan baru, biaya perjalanan, check-up medis serta bayaran untukagen-agenkeduapemerintah,”katanyadalamsatupertemuan di Gedung Parlemen Senin (1/7). Hal itu telah dilaporkan sesuai dengan Memo-randum of Understanding (MoU) antara pemerintah Malaysia dan Indonesia tahun 2011, biaya perekrutan para PRT Indonesia ditetapkan sebesar 4.511 ringgit Malaysia — yang mana 2.711 ringgit dibayar oleh majikan dan 1.800 ringgit oleh pembantu domestik. Muhyiddin mengatakan perubahan biaya struktural akan dibahas bersama oleh kedua pemerintah. “Rincian itu akan dijelaskan olehKementerianSumberDayaManusiasetelahmendapatpersetujuan kedua belah pihak,” katanya. Dia mengatakan perubahan baru tingkat biaya penggunaan itu telah dipertimbangkan dengan berbagai alasan dibandingkan dengan negara-negara lain, seperti Singapura dan Hongkong yang membayar PRT Indonesia dengan gaji yang lebih tinggi. Muhyiddin menambahkan bahwa gaji PRT Indonesia tidak akan terikat pada Aturan Upah Minimum 2012 dan sebaliknya akan didasarkan pada harga pasar saat ini dan majikan. (thestar/m10)

19 Orang Tewas Dalam Kecelakaan Heli Di Siberia YAKUTSK, Siberia (AP/Antara/RIA Novosti-OANA): Sekurangkurangnya 19 orang tewas dalam kecelakaan helikopter Mil Mi8, yang jatuh saat mendarat Selasa (2/7) di Republik SiberiaYakutia Rusia (Sakha), kata kementerian dalam negeri. Helikopter itu, termasuk maskapai Avialinii Polyarnye, dalam penerbangan angkutan penumpang rutin ketika gagal menjalin hubungan dengan pengendali udara pada waktu yang ditetapkan. “Helikopter membawa 25 orang termasuk tiga awak, setidaknya 15 orang tewas menurut informasi awal,” kata pelayanan juru bicara kepada RIA Novosti. Dua helikopter pencarian dan penyelamatan serta pesawat An-26 dengan para pekerja darurat dan petugas medis telah dikirim ke lokasi pendaratan, kata pejabat itu. Sementara itu, pusat darurat regional sebelumnya melaporkan bahwa ada 28 orang di dalamnya, termasuk tiga anggota awak dan 11 anak-anak. Helikopter mendarat kecelakaan 50 km dari titik asal satu lapangan udara dekat Desa Deputatsky setelah pilot dilaporkan kehilangan kendali pesawat karena turbulensi yang parah. Komisi tertinggi penerbangan Rusia mengatakan terdapat 28 orang di dalam pesawat saat terjadi kecelakaan. Para pejabat darurat mengatakan bahwa 11 orang di antara penumpang adalah anak-anak. (m10)

Gema Internasional

BANDAR SERI BEGAWAN, Brunei (Antara/Xinhua-OANA): Norwegia menandatangani perjanjian persahabatan dan kerja sama dengan Perhimpunan Bangsa Asia Tenggara (ASEAN) di Bandar Seri Begawan Senin, berikrar lebih mengembangkan hubungan dengan kelompok kawasan beranggotakan 10 negara itu. Menteri Luar Negeri Norwegia Espen Barth Eide, yang menghadiri penandatanganan dengan sepuluh sejawatnya dari ASEAN, mengatakanperjanjianadalahperpanjanganalamidariketerlibatan jangka panjang negaranya di wilayah tersebut dan tekad untuk multilateralisme. Eide mengumumkan Dana Prakarsa Regional Norwegia-ASEAN tujuh juta dolar AS sebagai langkah untuk keterlibatan lebih lanjut dengan ASEAN. Perjanjian Persahabatan dan Kerja sama di AsiaTenggara adalah non-agresi dan perjanjian kerja sama antara anggota serta mitra ASEAN.

Gedung Terbesar Di Dunia Diresmikan Di China

PROTES LAHAN DI KAMBOJA. Seorang pemrotes danau Boeung Kak (tengah) dihalangi oleh petugas kepolisian dalam satu rapat umum protes menentang penyitaan lahan di dekat kediaman PM, di Phnom Penh, Kamboja, Selasa (2/7). Lebih dari seratus petugas kepolisian Selasa dikerahkan guna menjamin para pemrotes tidak mendekati kediaman PM Hun Sen ketika mereka berusaha mengajukan petisi kepadanya guna memberikan mereka lahan.

Pangeran Saudi Dijerat Kasus Komisi Jual-Beli Pesawat LONDON, Inggris (Waspada): Seorang pangeran Arab Saudi, Al-Waleed BinTalal Bin AbdulAziz Al-Saud, saat ini tengah dibelitkasushukumterkaitsoalkomisi pembelian pesawat Airbus A340 oleh mantan pemimpin Libya, Moammar Khadafi. Al-Waleed didugamenggunakanjasaseorang pengusaha wanita asal Jordania, Daad Sharab, sehingga terjalin kesepakatan penjualan pesawat tersebut. Menurut Daily Mail, Khadafi membeli pesawat Airbus milik Al-Waleed pada 2005 silam se-

harga 70 juta poundsterling atau setara Rp1 triliun. Namun, menurut Sharab, setelah terjadi kesepakatanpenjualan,Al-Waleedingkar janji untuk memberi dia komisi dari hasil penjualan pesawat itu. Iniyangmembuatmerekabertikai sehingga Sharab mengadukan Al-Waleed ke pengadilan di London, Inggris. Sharab dan Al-Waleed bertemu tahun 2001 di kapal pesiar pribadi milik pangeran Arab tersebutdiCannes,Perancis.Disana mereka mendiskusikan kemungkinanuntukmenjualsebuahpesa-

Pejabat Muslim Pertama Australia Dilantik Langsung Terima Hinaan MELBOURNE, Australia (Waspada): Satu jam setelah Ed Husicdinobatkansebagaipejabat Muslim pertama di Kabinet Australia, komentar-komentar rasial yang menyerang Husic langsungbermunculandiinternet. Hal itu disebabkan karena Husic mengucap sumpah jabatannya di depan kitab suci Al Quran. PM Kevin Rudd menobatkan pria berusia 43 tahun itu sebagai Sekretaris Parlemen Australia. Husic adalah seorang putra imigranBosniayangsekaligusmenjadi pejabat Muslim pertama di kabinet Negeri Kangguru. Husic sangat menerima keputusan Rudd yang menunjuk HusicsebagaiSekretarisParlemen. Husic memandang penunjukan itusebagaikehormatanyangsangat besar.SebagaiseorangMuslim,Husicmengucapsumpahnyadidepan Al Quran. “Sayatidakbisamengucapkan sumpahsayadenganmenggunakan Injil, saya adalah saya, dan saya baru saja membuat kepu-

tusan yang jelas,” ujar Husic, seperti dikutip PTI, Selasa (2/7).(ok/ r-m10)

wat kepada Khadafi. Al-Waleed kemudian menjelaskan di hadapan pengadilan bahwa menjual salah satu pesawatnya kepada Khadafi sudah menjadi agendanya sejak lama. “Saya menilai Khadafi adalah seorang pembeli potensial,” kata Al-Waleed soal pilihannya menawarkan pesawat kepada Khadafi. Diamemangmemilikihubungan baik dengan Khadafi, tetapi Al-Waleed berpikir dengan bantuan Sharab, maka akan dapat meyakinkan dan mempercepat proses terjadinya kesepakatan penjualan.Sharabkemudianmengatur sebuah pertemuan antara Al-Waleed dengan Khadafi di sebuah tenda pada 2005 silam. Saat itu Sharab mengaku dijanjikan akan memperoleh komisi senilai 6,5 juta poundsterling atau Rp983 miliar apabila

lainnya yang menjarah depot senjata kimia. Seorang pejabat senior pemerintah Perancis di Washington bahwadiamempunyaivisisendiri: Setelahkalahdalampertempurandi Damaskus,Assaddanpasukannya melancarkanduafaseuntukmundur, pertama menuju pusat kota Homdandaerahpedesaansepanjang perbatasan dengan Lebanon, kemudiansebagaitempatterakhir, yaitudaerahjantungAlawisepanjang pantaiutaraSyria.Halinimungkin takterjadidalambeberapaminggu, danmungkin sekaliberbulan-bulan. Pertanyaannya: Bagaimana menghentikan hal ini? Amerika Serikat dan Prancis bersama-sama dengan beberapa negara Arab dan sekutu Eropa sedang berapat di Marrakesh, Maroko. Mereka mengharapkan untuk mendukung koalisioposisiyangdibentuk dengan nama Syrian National Coalition.PemerintahASmungkin sekali akan mengakui koalisi ini

sebagai pemerintahan Syria yang legitimate. Tetapi,tak seorang pun akan merasa yakin bahwa hal ini akan menghentikan skenario buruk untukdilaksanakan.Adasatuhal, koalisiyangdibangununtukmendirikan mata-rantai yang tetap - kurang banyak komando atau kontrol terhadap alasan unit pasukan pemberontak meskipun formasi dewan militer pemberontak yang baru berada pada langkah dan arah yang tepat. Koalisimemperolahdanadari Perancis dan pemerintah negara tertentu,tetapikhususpemerintah Amerika tak bisa secara langsung memberikan bantuan kepada pemberontak. Sementara itu unit al-Qaida diguyur bantuan dari kontribusi Arab Saudi dan negara Arab lainnya. Pandangan AS bagaimana strateginya akan bekerja bila tergantung pada aliran dana yang luar biasa, pertama mungkin sekali koalisi akan mengambil

terjadi kesepakatan pembelian di antara keduanya. Namun tuntutan Sharab dibantah mentahmentah oleh Al-Waleed. Menurutnya, dia sama sekali tidakpernahmenjanjikansepeser pun sebagai komisi dari hasil penjualan pesawat itu. “Dia telah menusuk saya dari belakang dan mengatakan akan ke kamp di Libya.Tapi semua yang dikatakan mengenaiperannyasangatberlebihan,” kata Al-Waleed. Ini bukan merupakan kasus hukum pertama yang dihadapinya. Sebelumnya dia juga menuntut majalah Forbes ke Pengadilan Tinggi kota London, karena tidak memasukkannya ke dalam jajaran 10 orang terkaya di seluruh dunia versi majalah itu. Menurut Al-Waleed, hal itu dianggapsebagaipenghinaanbagi dirinya. (vn/r-m10)

Kebakaran Hutan Terburuk Terjadi Di Yarnell, Arizona YARNELL, Arizona (AP): Satu kesatuanelitpemadamkebakaran yang terlatih dalam menangani kebakaran hutan di Amerika Serikat telah menjadi korban dan tewas terpanggang dalam kobaran apidihutanArizona.19Oranganggota tim pemadam kebakaran itu tewasketikamerekaberusahamelindungi diri mereka dari kobaran apidibawahpelindungtahanapi. Peristiwa itu merupakan perjuangan yang paling mematikan bagi para anggota pemadam kebakarantersebutyangmenangani satukebakaranhutandiASdalam beberapa dasawarsa terakhir ini. Kebakaran yang disebabkan

petir itu, yang meluas sekurangkurangnya 800 Ha di tengah temperatur udara panas itu, juga merusak 200 rumah dan menyebabkanratusanorangmengungsidari Yarnell, satu kota berpenduduk 700 jiwa yang terletak kira-kira 135 km di baratlaut Phoenix. CNN melaporkan Senin (1/ 7), peristiwa kebakaran sudah melanda kawasan hutan tersebut sejakJumat.Kebakarankemudian meluasdengansangatcepatakibat cuaca panas, rendahnya kelembaban dan hembusan angin. Menurut laporan, kebakaran membakar lahan seluas 804 Ha, menghancurkan 200 rumah dan

Syria Terjerembab Perebutan Kekuatan Dan Kekuasaan SESUATU yang menakutkan tentang Syria dari sudut pandang Barat, bukan tak mungkin akan terjadi celah antara nyaris terjadi suatuskenarioparapejabatsenior mendiskusikan apa yang mungkin akan rerjadi selanjutnya. Syria sekarang ini dapat disamakandenganapayangterjadi di Somalia. Salah seorang pejabat Syriabaru-baruinimenggambarkan dalam waktu dekat sehubungan dengan situasi sekarang ini, akan terjadi perang sipil mengarah pada perkelahian umum dalam hal mana kelompok Sunni berkelahidengankelompokKurdi sebagaimanajugaantara pengikut Alawi dengan sisa-sisa pasukan Presiden Bashar Assad. Selain itu cabang al-Qaida dikenal sebagai Jabhat al-Nusra menambah penguasaan pada bagian-bagian wilayah yang substansial; dan di mana bahaya penggunaan persenjataankimia datangtidaksaja darirezimAssadtapidarikekuatan

PHNOM PENH, Kamboja (Antara/Xinhua-OANA): Kecelakaanlalulintasmenewaskansedikit-dikitnya1.054orangdiKamboja pada enam bulan pertama tahun ini, turun dua persen dari masa sama tahun lalu, kata laporan resmi Selasa (2/7). Selama JanuariJuni tahun ini, terjadi 2.254 kecelakaan di jalan, turun empat persen dari masa sama tahun lalu, kata laporan Kemente-rian Pekerjaan Umum dan Angkutan. Kecelakaan maut terbaru terjadi pada 18 Juni di bagian utara Provinsi Kompong Thom ketika sebuah bus menabrakmobilyangmembawakeluargaKoreaSelatan,menewaskan tiga orang Korea dan satu orang Kamboja dan tujuh orang lainnya, termasukduaperempuanChinadariwilayahTaiwan,terlukaparah. PreapChanVibol,direkturKementerianPerhubungan,mengatakan bahwapenyebabutamakecelakaanadalahmengebut,mengemudi sambil minum alkohol, dan ceroboh dalam mengemudi.

Norwegia Tandatangani Perjanjian Persahabatan Dengan ASEAN

The Associated Press

Malaysia Tetapkan Biaya Untuk Gunakan PRT Indonesia RM8.000

Lakalantas Tewaskan 1.054 Orang Di Kamboja Semester 1 Tahun Ini

alih pengontrolan terhadap kelompok-kelompok pemberontak. Kemudian Rusia atau para pembangkang, kelompok Alawi akan memaksa kelompok rezim Assad dipinggirkan. Kemudian juga akanadanegosiasiyangmengarah pada suatu kesepakatan menuju sebuahpemerintahantransisional. Mungkin ada skenario yang lebihkecilyaitubahwaBaratakan mujurdanrezimAssadakansegera tumbang di Damaskus. Dalam keadaan vakum, koalisi akan memperoleh pengakuan dari dunialuar,dankebanyakanpasukan pemberontakdanpemerintahSyria akan mengikuti Libya yang tertatih-tatih berjalan dengan pemerintahan yang lemah yang dikawalolehmilisiabersenjatalengkap beberapa dari mereka bersekutu dengan al-Qaida. Perbedaannya yaitu bahwa persenjataan yang berlimpah yang berada di tangan para teroris akan berakibat pada Israel, Turki, Irak dan Jordania.

Alasanutamayangtakmungkin terjadiialahbahwabagiAssad dan kebanyakan kelompok Alawi dan bagi sponsor utama mereka, Iran,skenariomimpiburuk Barat tidak begitu menarik. Lebih baik bertahan di daerah kantong terutama bagi sekte minoritas ketimbangrisikopembinasaanditangan sekteSunniyangmenaruh dendam. Lebih baik menjadi penggarong di dalam negara yang anarkis dalam bayangan Syi’ah Iran ketimbang menyaksikan rencana strategis sekutu menyerahkan ke tangan blok Sunni. Akhirnya,apapun yangterjadi semisal rezim Assad memenangkan pertarungan atau kelompokkelompok pemberontak atau oposisi yang sejatinya memiliki agendasendiri-sendiri,makaSyria akan menjadi‘Irak ke dua,’ dunia akan menyaksikan Syria yang terjerembab dalam kancah perebutan kekuatan dan kekuasaan. (Kosky)

memaksapendudukdisekitarBukit Peeples danYarnell mengungsi. CNNmenyebutinimerupakanperistiwa kebakaran terparah sejak kejadian rubuhnyaWorld Trade Center tahun 2001 silam. KepalaPemadamKebakaran Kota Prescott, Dan Faijo, mengkonfirmasi bahwa sebagian besar anggota yang tewas berasal dari kesatuannya. Fraijo mengatakan petugas yangtewasmerupakanunitterlatih khususuntukmema-damkantitik api saat kebakaran terjadi. Merekabahkansudahpernah menghadapiperistiwaserupasaat kebakaran yang terjadi di New Mexico dan Arizona da-lam satu minggu terakhir.(m10)

CHENGDU, China (CNN): Kemegahan China terus berlanjut— simbol terbaru China dengan ciri khas bigger is much, much better ( lebih besar jauh lebih baik) terbuka untuk bisnis. Terletak di Chengdu (yang berpenduduk 14 juta jiwa), ibukota provinsi Sichuan di barat daya China, gedung New Century Global Center adalah ‘menara terbesar di dunia,’ kata pejabat China. Meskipun kata-kata ‘terbesar di dunia’ biasanya menciptakan gambaran gedung pencakar langit yang menjulang tinggi, proyek ini sebenarnya tidak semuanya tinggi. Tapi pasti besar. Denganukuranpanjang 500meter,lebar400meterdanketinggian mencapai 100 meter, bangunan mega ini dengan luas mencapai 1,7 juta meter persegi mampu menampung 20 Rumah Opera Sydney dan hampir tiga kali ukuran Pentagon di Washington, DC Global Center, yang dibuka 28 Juni lalu menaungi kantor bisnis, hotel, bioskop, pusat perbelanjaan, sebuah desa tiruan Mediterania dan atraksi keluarga bertema seperti taman air yang disebut Paradise Island.The New Century Global Center terletak di daerah yang baru direncanakan di Chengdu yang disebut Tainfu New District. Chengdu saat ini juga sedang memperluas jalur kereta bawah tanah dan berencana membangun bandara baru pada tahun 2020, lebih lanjut menunjukkan ambisi resmi untuk menjadikan kota itu sebagai ibukota ekonomi dan budaya China bagian barat. Dari 6-8 Juni, tahun ini Chengdu menyelenggarakan Fortune Global Forum, acara tahunan khusus mengundang-tamu tamu terhormat, presiden, dan CEO dari perusahaan terbesar di dunia.(b)

NYPD Cari Dua Tersangka Penembakan Di Brooklyn NEW YORK, AS (CNN): Departemen Kepolisian New York (NYPD) mencari dua tersangka penembakan yang terjadi pada saat pesta di satu rumah di Brooklyn yang mengakibatkan sembilan orang harus dirawat dirumah sakit Senin pagi itu, Polisi New York menyiarkani rekaman video yang memperlihatkan dua orang yang menggunakan baju putih saat menyeberang jalan bersama. Penembakan itu dimulai sekitar pukul 01:00 dinihari Minggu di lingkungan Flatbush Timur, kata polisi. Seorang tetangga mengatakan kepadaWCBS, afiliasi CNN bahwa dia mendengar suara tembakan. Empat laki-laki dan lima perempuan yang semuanya berumur kurang dari 45 tahun , terluka dan harus dibawa ke rumah sakit. Tujuh orang bisa kembali ke rumah, dua orang lagi tetap tinggal dirumah sakit dan dalam keadaan stabil. Luka-luka yang diderita tidak terlaku serius, kata SophiaTassy Mason, petugas dari Departemen Kepolisian New York.(f)

Korsel: Forum Asia Kirim ‘Pesan Kuat’ Pada Korut BANDAR SERI BEGAWAN, Brunei (Antara/AFP): Negaranegara Asia Pasifik mengirimkan ‘pesan yang sangat kuat’ kepada Korea Utara pada Selasa (2/7) bahwa negara itu harus melepakan program nuklisnya, kata diplomat tinggi Korea Selatan. Para menteri luar negeri dari Amerika Serikat, China, Rusia dan lintas wilayah mengadakan pertemuan di Brunei sebagai bagian dari forum tahunan terkait persoalan keamanan dengan fokus pada permasalaha nuklir di Utara. “Banyak menteri-menteri di pertemuan menyatakan pesan yang sangat kuat kepada delegasi Korea Utara bahwa mereka harus melakukan denuklirisasi, mereka seharusnya menahan diri dari tindakan yang provokatif,” kata Menteri Luar Negeri Korea Selatan Yun Byung-Se kepada wartawan di sela-sela pertemuan. DiamengatakanKoreaUtaraharusmendengarkanpesantersebut secarasangatserius.Seharisebelumnya,MenteriLuarNegeriAmerika SerikatJohnKerrymengatakansetelahberbicaradenganrekan-rekanya dari Cina, Jepang dan Korea Selatan di sela-sela pertemuan di Brunei bahwa empat dari mereka bersatu mengenai masalah tersebut. Kerry mengatakan dirinya dan Menteri Luar Negeri CinaWang Yi keduanya sangat menegaskan keseriusannya pada komitmen untuk denuklirisasi Korea Utara.

The Associated Press

PROTES RENCANA PEMERINTAH. Seorang pemrotes berusaha untuk berjalan di tepi jalan ketika polisi Mexico berusaha meredakan kerumunan massa dalam satu rapat umum memprotes apa yang mereka katakan rencana pemerintah untuk menswastakan PEMEX, perusahaan minyak pemerintah. Unjukrasa di Mexico City Senin (1/7) itu, juga untuk memperingati ulangtahun pemilihan Presiden Mexico Enrique Pena Nieto.


WASPADA Rabu 3 Juli 2013


Pecatur Sumut Tembus Grip Atas JAKARTA ( Waspada): Hingga hari keempat pelaksanaan Kejurnas Catur 2013 di Asrama Haji Pondok Gede, Jakarta, pecatur Sumut masih bertengger di papan atas nomor standar kelas terbuka. Pitra Andika meraih dua kemenangan beruntun pada babakkelimadankeenam,Selasa (2/7). Pecatur andalan Sumut inipunmengumpulkan5,5poin dan tetap bertengger di posisi kedua klasemen sementara. Pada babak keenam, Pitra mengalahkan MN Hudallah

SPd (Jambi) pada langkah ke44, setelah sebelumnya menghentikan perlawanan pecatur berdarah Batak yang membela Bali, Hasian Panggabean. Kemenangan juga dibukukan Roy Charles Marpaung yang sehari sebelumnya membuat kejutan mengalahkan mantan juara Waspada Cup 2011. Kali ini, pecatur Mikroskil itu menang atas MN Budiman HS (Sulsel). Alhasil, Roy mengumpulkan lima poin dan juga bertengger di grip atas. Tiga pecatur Sumut lainnya

harus bermain remis. Mereka adalah M Johan Goliong yang berhadapan dengan FM Laksana Agusta (Jatim), Maruhum EN Manalu yang menahan MI Tirto Ir (Kaltim), dan Sarmadoli Siringo-ringo yang berhadapan dengan MN Iqra Moesa Putra (Kaltim). Nasib kurang beruntung dialami Sabar Tobing di meja 54 saat dikalahkan pecatur KalimantanTengah, Nanang Abrani. Selain itu, Marihot Simanjuntak harus mengakui keunggulan Christoper (Sulsel). (yuslan)

Waspada/Yuslan Kisra

PECATUR andalan Sumut, Pitra Andika (kanan), menghadapi pecatur berdarah Batak yang kali ini membela Bali, Hasian Panggabean, di babak kelima, Selasa (2/7).

PSMS LI Siap Seret Indra Sakti Terancam Sanksi PSSI JAKARTA (Waspada): Terancam mendapat sanksi dari PSSI, ke-11 pemain PSMS Medan siap membawa Ketua Umum Indra Sakti Harahap dan manajemen tim terkait kasus penunggakan gaji ke meja hijau.

Demi menuntut tunggakan gaji selama 10 bulan yang belum dibayar manajemen, 11 pemain Ayam Kinantan mengadu ke PSSI, dua pekan lalu. Selama seminggu, Alamsyah Nasution cs menunggu bantuan dari PSSI. Namun, kenyataan berbeda dari

Waspada/Armansyah Th

PENGURUS dan anggota HDCI Sumut pose bersama saat penyerahan bantuan semen ke Masjid Iksan Simpang Dolok Tebingtinggi dalam rangka memperingati HUT HDCI ke-50.

HDCI Sumut Baksos, Touring Ke Balige Sambut HUT Ke-50 MEDAN (Waspada): Komunitas motor besar Harley Davidson Club Indonesia (HDCI) Sumut dalam rangkai memperingati HUT HDCI ke-50, menggelar touring ke Balige, Tobasa, dan bakti sosial di Tebingtinggi. “HUT HDCI se Indonesia ini kita memperingati di berbagai kota, termasuk juga HDCI Sumut yang memperingatinya dengan kegiatan touring dan bakti sosial,” ujarWakil Sekretaris HDCI Sumut, Oesmantiong, di Medan, Selasa (2/7). Disebutkan, touring ber-

langsung Sabtu (29/6) lalu diikuti sekitar 20 anggota HDCI Sumut ke Balige dan Tobasa. Rute yang ditempu sekira 300 km, namun sebelumnya anggota menggelar bakti sosial dengan menyerahkan bantuan semen untuk pembangunan Masjid Iksan di Simpang Dolok, Tebingtinggi. Bantuan diserahkan Ketua Umum HDCI Sumut diwakili Apin BK (pengurus HDCI Sumut), AKBP Andi Rian (Kapolres Tebingtinggi), dan Oesmantiong. Anggota HDCI Sumut, kata Oesmantiong, selalu antusias

touring, apalagi bakti sosial seperti di Tebingtinggi. Dikatakan, kegiatan bakti sosial dan touring juga dalam kaitan menyambut bulan suci Ramadhan dan program HDCI Sumut. Oesmantiong menambahkan, kegiatan mereka laksanakan sesuai arahan Ketua Umum HDCI Sumut, Ijeck. HDCI Sumut, di dalam bulan suci Ramadhan sekaligus menyambut Idul Fitri, akan kembali mengadakan kegiatan bakti sosial serta buka puasa bersama. (m47)

SSB Diski Medan Juara LAN U-12 PANTONLABU (Waspada): SSB Diski Kota Medan tampil juara Liga Anak Nusantara (LAN) U-12 zona Aceh Utara, setelah mengalahkan SSB Boca United Lhokseumawe 2-1 di Lapangan Bintang Aceh, Pantonlabu, Aceh Utara, Selasa (2/7). Posisi ketiga diraih tuan rumah SSB Patriot Pantonlabu dengan meraih kemenangan tipis atas SSB PTP Wilayah I Su-

matera Utara 1-0. “Dengan hasil ini, maka SSB Disky, Boca United, Patriot Pantonlabu, dan PTPN berhak melaju ke LAN Tingkat Nasional yang akan berlangsung di Stadion Gelora Bung Karno, Senayan Jakarta, akhir Desember 2013,” ujar Rabujuli, Ketua Panitia LAN Zona Aceh Utara. Rabu menambahkan, sehari sebelumnya di lapangan

Datuk Selamat Pimpin PBSI DS LUBUKPAKAM (Waspada): Tokoh peduli olahraga dan pendidikan Deliserdang, H Datuk Selamat Fery, terpilih secara aklamasi menjadi Ketua Pengurus Kabupaten Persatuan Bulutangkis Seluruh Indonesia (Pengkab PBSI) Deliserdang periode 20132018. Selamat dipilih dalam Musyawarah Kabupaten (Muskab) PBSI Deliserdang baru-baru ini di RM Padang Raya, Jl Negara Lubukpakam. Seluruh peserta musyawarah dari berbagai kecamatan kompak memilih Selamat. Selamat mengaku tidak dapat berbuat apa-apa tanpa dukungan seluruh pengurus. Begitu juga dukungan para atlet bulutangkis yang ada di Deliserdang sangat dia harapkan untuk mengangkat citra olahraga kebanggaran bangsa Indonesia itu. “Predikat Deliserdang sebagai ‘gudangnya’ atlet andal harus tetap kita jaga dan pertahankan. Melalui pembinaan terprogram, diharapkan lahir atlet-atlet bulutangkis andal dari Deliserdang,” ucapnya. Dalam Muskab juga ditetapkan Sekertaris Dr Maily Citra serta Bendahara Tumarningsih. Kepengurusan PBSI Deliserdang periode 2013-2018 selain dilengkapi unsur wakil ketua, wakil sekretaris dan wakil bendahara, juga dilengkapi seksi-seksi. (a06)

Problem Catur Jawaban di halaman A2. 8







1 B







sebut, maka PT LI akan memberikan sisa subsidi sebesar Rp200 juta langsung kepada pemain. Kecewa dengan sikap PSSI yang tidak bisa memberi solusi dan membantu penyelesaian tunggakan gaji tersebut, pemain pun siap menyeret manajemen PSMS ke pengadilan. Hal itu diungkapkan Dzulham Putra, salah satu kiper asal Medan itu. “Kami ini sudah tak mendapat hak (gaji) dari manajemen. Kenapa kami yang disalahkan? Sikap PSSI sungguh mengecewakan sekali!” ketus Putra, Selasa (2/7). “Kalau caranya seperti ini, kami akan membawa masalah ini ke jalur hukum. Kami akan menyeret Indra Sakti ke pengadilan. Dia tak punya hati nurani,” sebut Putra lagi. (m33/ini)

Tamora Puas Emas Sepakbola TANJUNGMORAWA (Waspada): Manajer Tim Kecamatan Tanjungmorawa (Tamora), Drs H Ibnuh Hajar, mengaku puas timnya sukses meraih medali emas sepakbola pada Pekan Olahraga Kabupaten (Porkab) Deliserdang 2013. “Ini prestasi yang sangat membanggakan dan kami puas serta bersyukur. Hampir sepanjang laga anak-anak di bawah tekanan lawan, namun dengan kerja keras dan mental juara, akhirnya tim mampu meraih gelar juara,” ujar Ibnuh, Selasa (2/7). Tamora meraih medali emas setelah di final yang berlangsung di Stadion Baharuddin Siregar Lubukpakam, Minggu (30/6), menaklukkan Kecamatan Percut Sei Tuan 4-2 lewat adu penalti. Di waktu normal, Percut Sei Tuan unggul lebih dulu sebelum Tamora menyamakan skor lewat gol Wandi. (c02)

Hari Hilang Binjai Syukuran BINJAI (Waspada): Perguruan pencak silat Hari Hilang Binjai menggelar syukuran di Balai Pertemuan SMAN 3 Binjai, Jl Padang Sidempuan, Kota Binjai, Selasa (2/7). Acara tersebut sebagai bentuk rasa syukur atas prestasi memboyong Piala Bupati Langkat setelah tampil sebagai juara umum Kejuaraan Pencak Silat Pelajar di Tanjungpura yang berlangsung 28-30 Juni lalu. Hari Hilang menjadi juara umum dengan menyabet lima medali emas, enam perak, dan empat perunggu. Medali emas disumbangkan Indah Lupita (A putri), Yuni Alpani (E putri), Alwi Prastio (tunggal putra), Ita Juliana (tunggal putri), Nadia, Iin Indah, dan Edheline (beregu putri). Medali perak disabet BagasianariTarigan (D putra), LisaWardani (B putri), Ditia Aprila (C putri), Auria Azzahra (tunggal putri), Alwi, Zaki, Rinaldi (beregu putra), Fadilah, Hilma, dan Delima (beregu putri). Medali perunggu oleh Setiahaki Rahman (E putra), Frenco Ginting (B putra), Iin Sri Wahyuni (B putri), dan Amelia (C Putri). Acara syukuran juga sekaligus mendoakan Muhamad Irfan yang kini mengikuti Olimpiade Olahraga Siswa Nasional (O2SN) tingkat pelajar SLTP di Kalimantan Timur. (a04)

PS Mata Ie Tiga Terbaik Piala Hasan Basri Husen RANTAU PANJANG (Waspada): PS Mata Ie merebut posisi ketiga turnamen sepakbola Piala Hasan Basri Husen SH MH ke-VIII tahun 2013 di Lapangan Benteng Rantau Panjang, Kecamatan Ranto Peureulak, Kabupaten Aceh Timur, Selasa (2/7). Tempat ketiga berhasil diduduki PS Mata Ie setelah menaklukkan PS Punti Payong 4-1. Babak pertama, PS Mata Ie sudah langsung memimpin 2-0 lewat gol yang disumbangkan Muklis dan Madun. Menit 55, Punti Payong memangkas jarak lewat gol yang dicetak Manan. Namun anakanak Mata Ie langsung membalasnya dengan dua gol beruntun cetakan Madun dan Amad.

Laga yang dipimpin wasit Muhadi itu pun berakhir dengan kemenangan telak Mata Ie. Rabu (3/7) ini, akan berlangsung partai final yang mempertemukan PS Persada Alue Dua dan PS Seunabok Johan. PS Seunabok merupakan juara bertahan yang diperkuat sejumlah pemain terbaik di Rantau Panjang sekitarnya. “Partai final bakal berlangsung seru, mengingat kedua tim sama-sama difavoritkan tampil juara. Kedua kubu selama babak penyisihan juga belum pernah mengalami kekalahan, sehingga sama-sama menjadi tim sempurna melaju ke final,” ujar Penggagas Turnamen, H Hasan Basri Husen SH MH. (m43)

Lomba Dayung Sampan Semarakkan HUT T. Tinggi TEBINGTINGGI (Waspada): Lomba dayung sampan dan renang di Sungai Padang menyemarakkan Hari Jadi Kota Tebingtinggi ke-96 pada 28-30 Juni lalu. Event tersebut baru pertama kalinya digelar dan mendapat antusiasme masyarakat. Unsur Panpel, Andi Sujendral, mengatakan kegiatan ini berbentuk perlombaan dayung sampan dari hulu ke hilir, dengan jarak tempuh sekira 2 km. Para peserta start di Kelurahan Bulian dan berakhir di Kelurahan Bandar Utama. Tampil juara lomba dayung sampan untuk kategori eksekutif regu Polres, runner-up Kodim 0204/DS, dan posisi ketiga KONIT. Tinggi. Kategori

instansi, gelar juara diraih Polres, diikuti PTPN IV, dan Dinas Pendidikan. Ketegori umum, juara Kelurahan Rantau Laban, runner-up Karya Jaya, dan peringkat ketiga Lubuk Baru. Untuk perlombaan renang instansi, gelar juara diraih Kodim 0204/DS, diikuti Kodim 0204, dan PT Karindo. Kelompok umum, Kelurahan Bulian tampil juara, disusul Persiakan, dan Kelurahan Lubuk Baru. Wali Kota Tebingtinggi, Ir H Umar Zunaidi HasibuanMM,saatpenutupankejuaraan,mengatakan kegiatan dayung sampan dan renang sungai akan dilaksanakanberkesinambungansetiaptahun.(a09)

Siska Debora Juara Di Bekasi MEDAN (Waspada): Karateka Perguruan Kala Hitam Dojo M3 Medan Tembung, Siska Debora, menjadi juara pada Kejurnas Karate Kala Hitam Antardojo se Indonesia baru-baru ini di Bekasi. Ketua Perguruan Karate Kala Hitam Dojo M3 Medan Tembung, Wahyu Sembiring, mengatakan acara syukuran berlangsung di sekretariat Jl Bhayangkara Kel Indra Kasih Kec Medan Tembung dan turut dihadiri Lurah Aidil Paturrachman SSos, Senin (1/7). Sembiring menambahkan, Dojo M3 mengirimkan Affan Azis, Andika, Siska Debora di kategori junior, dan Zulkarnaen di level senior. Dari keempatnya, hanya Siska Debora yang berhasil menuai prestasi kala bertanding di kelas

putri +50 kg. “Patut disyukuri, walau hanya Siska yang meraih sukses di kejurnas. Padahal dojo M3 baru beberapa bulan terbentuk. Kendati begitu, antusias generasi muda mengikuti latihan cukup lumayan,” ujar Sembiring didampingi Bendahara Dra Ernauli Tobing, Penjab Willy Handiono SH, Pembina Hen-drik BK, dan Pelindung Kompol S Zalukhu. Sukses Siska diharapkan mampu memicu karateka lainnya untuk lebih giat berlatih guna mencapai prestasi tingkat nasional maupun internasional. Aidil Paturrachman mengharapkan, Kala Hitam Dojo M3 terus melakukan pembinaan dengan merekrut sebanyak-banyaknya remaja di lingkungannya. (m24)

Komunitas Honda Kampanye Keselamatan Lalin Sambut HUT Bhayangkara Ke-67 MEDAN (Waspada): Menyambut HUT Bhayangkara ke67, akhir pekan lalu komunitas sepeda motor Honda bersama pihak kepolisian bagi-bagi helm gratis bagi pengguna sepeda motor Honda yang melintasi jalanan Kota Medan tanpa memakai helm SNI. Kegiatan berlangsung di dua lokasi, yakni Pos Polisi Jl Juanda (Simpang SM Raja) dan Pos Polisi Jl SM Raja (Simpang Masjid Raya). Aksi ini melibatkan komunitas Honda Scoopy Medan, Scoopers, yang mensosialisasikan pentingnya pemakaian helm SNI yang benar demi menghindari bahaya kecelakaan lalu lintas. Menurut Sofyan, Ketua Scoopers, Selasa (2/7), kegiatan ini merupakan bentuk kepedulian komunitas Honda terhadap keselamatan pengendara sepeda motor. “Melalui semangat Brotherhood, rekan-rekan di Scoopers mengingatkan masyarakat untuk memperhatikan keselamatan berkendara dengan selalu menggunakan helm SNI. Kehidupan menjadi sesuatu yang paling berharga untuk dijaga. Kami berharap kegiatan ini memberikan manfaat bagi masyarakat,


Putih melangkah, mematikan lawannya dua langkah.


yang sama juga berlangsung laga final Camp Patriot Festival U-15. Event tersebut dijuarai tuan rumah SSB Patriot Pantonlabu, runner-up SSB Garda Aceh Tamiang, dan posisi ketiga diduduki SSB Putra Banna. “Camp Patriot Festival ini kami gelar untuk memberi kesempatankepadaanak-anakberkompetisi pada event resmi berskala nasional,” ucap Rabu. (b19)

yang diharapkan. PSSI menganggap aksi yang dilakukan oleh 11 pemain tersebut bisa memberi contoh buruk bagi tim lain. Sekjen PSSI, Joko Driyono, mengatakan pihaknya akan menugaskan Komisi Disiplin memanggil 11 pemain, manajer, dan Ketua Umum PSMS datang ke Jakarta, Rabu (3/7) ini. Sebelumnya, PT Liga Indonesia menyatakan siap membantu PSMS untuk membayar tunggakan gaji ke-11 pemain. Namun, PT LI mengaku akan mengkaji terlebih dahulu proposal yang diajukan oleh klub yang berlaga di Divisi Utama tersebut. Jika dalam proposal yang diajukan PSMS tersebut dirasa ada yang mengganjal dan tidak disetujui oleh 11 pemain ter-

Proud To Be Honda Community,” jelas Sofyan. Salah seorang pengendara Honda yang beruntung mendapatkan helm SNI gratis, Sidik mengaku sangat senang. “Awalnya sempat kaget karena saya kira mau ditilang, tapi ternyata malah diberikan helm SNI gratis. Terima kasih Honda, terima kasih juga pak polisi,” ucap Sidik. Gunarko Hartoyo, Corporate & Marketing Communication Manager CV Indako Trading Co selaku main dealer Honda di Wilayah Sumatera Utara mengungkapkan, kegiatan ini menjadi bukti peran nyata Honda menyosialisasikan keselamatan berkendara dan menjadi mitra aparat kepolisian dalam program mengurangi angka kecelakaan lalin. “Kami berharap kegiatan ini dapat meningkatkan kesadaran masyarakat akan keselamatan berlalulintas, salah satunya dengan menggunakan helm SNI. Juga mengharapkan agar para anggota klub motor dapat menjadi pengendara yang baik, sehingga jadi contoh bagi masyarakat,” tutur Gunarko. Selain bagi-bagi Helm SNI gratis, beragam kegiatan juga telah dilakukan CV Indako Trading Co untuk mendukung upaya ke-


polisian dalam melakukan sosialisasi keselamatan berkendara kepada masyarakat. Di antaranya program pendidikan berkenderaan untuk anak usia dini, kegiatan Satu Hati Kampanye Keselamatan Lalu Lintas Hadirkan Konvoi 1000 Scoopy, sosialisasi safety riding, dan beragam kegiatan lainnya. (adv)



1. Penyakit anjing gila. 4. Belang putih pada kulit (karena suatu penyakit). 7. Air Susu Ibu. 9. Keadaan tulang menjadi keropos dan lapuk. 10. Penyakit wanita selain mioma. 12. Penyimpangan dari normal; ———kromosom artinya kelainan kromosom dalam jumlah maupun bentuk. 13. Tidak sakit. 14. Menceret. 16. Air seni. 18. Rangka atau bagian rangka tubuh manusia. 20. Lapisan tipis. 21. Jerawat (Inggris). 23. Keadaan suhu tubuh turun hingga di bawah 35 derajat Celcius. 26. Rumah Sakit Cipto Mangunkusumo. 27. Rasa obat flu. 29. Binatang air, makanan sehat. 30. Dragon, buah kaya vitamin C. 31. Penanaman bibit penyakit yang sudah dilemahkan (misal cacar) agar kebal terhadap penyakit tersebut.


2. Radang jaringan tubuh yang memungkinkan timbulnya rongga tempat nanah mengumpul. 3. Bahan obat-obatan berasal dari pohon Sindora sumatrana. 4. Burik kecil-kecil; Bintik-bintik. 5. Penyakit hidung (sejenis bisul dalam hidung). 6. Pohon yang kayunya berukuran besar dan kulitnya digunakan sebagai obat diare, disentri dsb. 8. Ikatan Keluarga Dokter Indonesia. 10. Segala sesuatu yang berhubungan dengan dokter. 11. Komponen dalam asap rokok, bersifat karsinogenik. 15. Bengek. 17. Enzyme-Linked Immunosorbent Assay. 18. Minuman sore untuk menenangkan pikiran atau sambil silaturahmi. 19. Makanan bergizi; Ilmu tentang gizi. 22. Penyakit tampek; Rubella; Rubeola. 24. Penyakit kulit disebabkan oleh spora; Frambusia. 25. Rasa obat batuk sirup. 28. Virus AIDS.

Isi dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di kotak 3x3 bergaris tebal. Tingkat kesulitan: sedang (***), bisa diselesaikan kurang dari sepuluh menit. Jawabannya di halaman A2 kolom 1.

1 7

8 8 6 2 1 9 8 4 5 6 2 9 4 7 9 8 6 5 9 7 3 8 6 9 7 3 2 7 5 4 9 9 3 ***405



WASPADA Rabu 3 Juli 2013

Janda Cole Pesta Ultah Sampai Pagi

PRESIDEN FIFA Sepp Blatter dan Sekjen Jerome Valcke, memuji gemuruh Piala Konfederasi 2013 di Brazil.


FIFA Tunda Rilis Harga Tiket Puji Gemuruh Piala Konfederasi RIO DE JANEIRO (Waspada): Presiden FIFA Sepp Blatter memuji gemuruh pendukung di Stadion Maracana pada final Piala Konfederasi 2013 antara Brazil kontra Spanyol akhir pekan kemarin, yang dinilainya sangat mengesankan. “Terima kasih untuk semua yang membantu membuat kompetisi ini berjalan sukses, meskipun diwarnai kerusuhan dan protes,” beber Blatter, seperti dilansir Reuters, Selasa (2/7). “Saya senang untuk sampai pada kesimpulan sekarang, hasilnya baik secara olahraga, turnamennya juga mengesankan. Kerusuhan sosial kini mungkin sedikit istirahat. Saya tidak tahu berapa lama, tapi sekarang mungkin jauh lebih berkurang,” ujarnya lagi.

Berbicara pada konferensi pers didampingi Sekretaris Jenderal FIFA Jerome Valcke di Rio de Janeiro, Senin (SelasaWIB), Blatter menjanjikan pemasangan layar raksasa di Piala Dunia 2014 untuk perkampungan kumuh di Brazil. Karena adanya aksi demo dan kerusuhan, FIFA memutuskan untuk menunda rilis harga tiket untuk Brazil 2014. Sebelumnya, pihak berwenang atas penjualan tiket berencana merilis detil harga tiket Piala Dunia, Se-

nin waktu Amerika. “Kami ingin melihat semua masalah yang kita hadapi di Piala Konfederasi. Kami ingin menghindari 10.000 tiket yang tidak terkumpul dua hari sebelum pertandingan,” timpal Valcke. “Ada tiga juta tiket yang tersedia untuk Piala Dunia, tapi ini negeri yang berpenduduk 200 juta orang. Sehingga kita akan punya zona penggemar dan layar raksasa di banyak lokasi berbeda, mungkin sampai perkampungan kumuh,” katanya lagi. Pengumumannya kemungkinan baru dilakukan 19 Juli mendatang. Penundaan diperkirakan terkait potensi demonstrasi yang bisa meningkat di Negeri Samba. Protes terus berlanjut, bahkan headline koran-koran di negara penghasil kopi itu lebih

banyak memberitakan tentang demonstrasi ketimbang kemenangan 3-0 Selecao atas Spanyol. Media setempat lebih tertarik mengabarkan tajamnya peluru karet dan gas air mata yang digunakan polisi untuk meredam aksi demonstran. Valcke mengklaim, protes itu telah menjadi bagian dari turnamen, tingkat hormat juga muncul antara pengunjuk rasa di luar stadion dan orang-orang yang ingin menonton. “Para pengunjuk rasa tidak menghentikan mereka, kami tahu apa situasinya dan kami memiliki itu selama dua minggu terakhir. Tapi di satu sisi, Anda punya semua fans yang ingin menonton pertandingan dan di sisi lain fans yang melakukan demonstrasi,” jelasnya. “Ada rasa saling menghormati antara dua kelompok dan

Gunners Gaet Sanogo LONDON (Waspada): Arsenal melalui situs resminya yang dikutip Selasa (2/7), mengaku telah menggaet penyerang Prancis U-20 Yaya Sanogo dengan ikatan kontrak jangka panjang. Bomber berumur 20 tahun itu berstatus bebas transfer setelah meninggalkan klub Ligue 2, AJ Auxerre. Sanogo mantan striker andalan Les Bleus unuk level U-16, U-17 dan U-19. Dia kini bersama tim Ayam Jantan Junior di Turki untuk mengikuti Piala Dunia U-20 dan menjadi pilar penting yang membawa Prancis lolos dari babak penyisihan grup. Sanogo bersama Auxerre sejak berusia 14 tahun. Perekrutannya membuktikan keseriusan manajemen The Gunners untuk meningkatkan kekuatan setelah hampir satu dekade tanpa meraih trofi bergengsi. Arsenal juga hampir pasti mendatangkan striker Argentina Gonzalo Higuain dari Real Madrid. Namun menurut gelandang Jack Wilshere, itu ternyata belum cukup untuk bisa mendongkrak performa The London Reds, yang musim lalu menghuni peringkat empat Liga Premier “Kami sangat bersemangat menyambut pemain bagus seperti Higuain. Tapi kami butuh lebih banyak lagi. Skuad Arsenal mesti memiliki kedalaman, seperti MU dan ManCity,” tutur

Wilshere kepada Mirror. “Saya bisa bilang, MU tidak akan mampu mempertahankan gelar jika hanya punya 18 pemain. Itu alasan mengapa Arsenal juga butuh lebih banyak pemain baru,” tambahWilshere. Namun menurut striker Lukas Podolski, Gunners bakal lebih bagus lagi dibandingkan musim lalu. “Harapan sangatlah besar. Pertama-tama saya senang, kemudian saya yakin bahwa musim kedua akan lebih baik,” papada Podolski. Penyerang dengan koleksi 110 caps bersama Timnas Jerman itu cukup cemerlang pada musim pertamanya bersama pasukan Arsene Wenger. Podolski mencetak 16 gol dari 42 penampilannya bagi Arsenal di seluruh kompetisi, dus bisa dimainkan sebagai striker maupun winger. “Jika kami mampu menguasai klasemen Liga Premier, seperti pada 15 pertandingan terakhir musim lalu, maka Arsenal akan ada di posisi pertama atau kedua,” klaim mantan pemain Koeln dan Bayern Munich tersebut. Selain memboyong beberapa pemain baru, Gunners juga melepas beberapa pemainnya yang tidak masuk skenario Wenger. Bek serba bisa Johan Djourou, termasuk yang dilepas dengan kembali dipinjamkan ke klub Bundesliga. Setelah musim lalu disewa

RIO DE JANEIRO (Waspada): Paulinho (foto), gelandang tangguh Timnas Brazil, mengklaim segera meninggalkan Corinthians untuk bergabung dengan Tottenham Hotspur. Pemain berusia 24 tahun itu pilar penting skuad Samba yang memenangi Piala Konfederasi 2013 dengan menggunduli Spanyol 3-0 dalam duel final akhir pekan lalu di Stadion Maracana, Rio de Janeiro. Melalui acara temu pers di Sao Paulo, Senin (Selasa WIB), Paulinho mengaku Corinthians sudah setuju dengan alih statusnya senilai 20 juta euro (26 juta dolar AS, 17 juta pound) yang ditawarkan Spurs. “Kini memasuki tiga tahun menggembirakan dalam karir saya, karena menang, karena bekerja dengan orang-orang AP

YAYA Sanogo (kanan) tampil gemilang bersama Prancis pada Piala Dunia U-20 barubaru ini di Turki. Hanover selama enam bulan, musim ini giliran Hamburg SV yang memanfaatkan jasa bek Swiss tersebut. (m15/ant/afp/mir)

Waspada/Dedi Riono

5 Pemain Sumut Seleksi Timnas U-16 untuk menjadi skuad inti timnas,” ujar Ketua Asosiasi PSSI Sumut, Ir Kamaludin Hararap MSi, saat melepas keberangkatan kelima pemain di Bandara Polonia Medan, Selasa (2/7). Dikatakan, Timnas U-16 ini diproyeksikan mengikuti kualifikasi Piala AFC. Sehingga sangat diharapkan ada duta pemain Sumut yang memperkuat tim tersebut untuk menambah pengalaman bertanding sekaligus menjadi kebanggaan bagi orang Sumut. “Saya yakin lima pemain yang dikirim merupakan yang terbaik berdasar pantauan Asosiasi PSSI Sumut, sehingga diharapkan dapat turut memberikan warna bagi skuad Timnas U-16. Kita tentu sangat rindu


pantas disematkan pada Cole, yang terkenal suka gonta-ganti pasangan kencan. Teraktual, bek senior Timnas Inggris itu mengencani seorang wanita cantik kebangsaan Prancis yang dikenalnya lewat situs jejaring sosial instagram. The Sun melansir, wanita itu bernama Eglantine-Flore Aguilar, yang baru berusia 20 tahun. Namun perannya hanya sebagai wanita idaman lain, karena Cole masih menjalin asmara dengan wanita biseksual bernama Anne Kelle atau lebih akrab disapa AK. Hanya saja Aguilar mengaku terkesima Cole, yang telah berumur 32 tahun. “Di sana (Inggris) saya tak menonton sepakbola. Saya sebenarnya tahu Cole, karena dia mantan suami dari Cheryl Tweedy. Saya penggemarnya,” jelasnya. “Saya suka musiknya. Rasa-

nya saya hanya bisa berfantasi ria ketika mengirim pesan dengan Cole di instagram. Saya kagum dengan Cheryl,” tambah Aguilar. Kabarnya, Aguilar datang ke Inggris dengan uang pemberian Cole dan ditempatkan di rumah bekas peninggalan Cheryl. “Kesan pertama saya adalah dia (Cole) sangat kurus,” tuturnya. “Dia mengenakan celana pendek di kolam renang. Dia menghisap rokok dan menengguk wiski. Kami kemudian berbicara bahasa Inggris, tapi dia justru minta diajarkan bahasa Prancis,” beber Aguilar. “Setelah itu, kami berduaan selama kurang lebih dua jam. Kemudian, kami tertidur pulas dan saling merangkul. Selama saya di sini, dia tak meninggalkan rumahnya,” katanya menambahkan. (m15/vvn/mir/sun)

Paulinho Klaim Tottenham

LIMA pemain muda Sumut yang akan mengikuti seleksi Timnas U-16 di Bogor, bersama Ketua Asosiasi PSSI Sumut, Kamaluddin Harahap, di Bandara Polonia Medan, Selasa (2/6).

MEDAN (Waspada): Lima pesepakbola muda Sumatera Utara dikirim mengikuti seleksi pembentukan Timnas U-16 di Sawangan, Bogor, 2-8 Juli 2013. Pengiriman lima pemain terbaik itu berdasarkan undangan Badan Tim Nasional (BTN) PSSI. Kelima pemain dimaksud adalah Alwi Hasibuan (SSB PTP Wil-I), Juan Williater Malau (SS Havea Batubara),M Dendi Jihan Abdillah (SSB Karya Muda Leuser Tebingtinggi), Satria Wardana (SSB KTB Binjai), dan Syaiful Bahri Ambiya (SSB KTB Binjai). “Ini satu kebanggaan bagi lima putra Sumut bisa mendapat kesempatan mengikuti seleksi Timnas U-16. Kita berharap kelimanya terjaring tim seleksi

mereka berdampingan di Piala Konfederasi. Ini kompetisi besar dan itu telah berakhir, kini kita benar-benar fokus pada Piala Dunia,” tambah Valcke. Menurut Blatter, dia tidak pernah menyaksikan hal seperti itu. “Maracana sesuatu yang luar biasa dan itu sangat bergemuruh. Para penggemar luar biasa kemarin. bukan hanya fanatik tapi juga fantastis,” sanjungnya. Sebanyak 70.000 penonton di dalam Stadion Maracana, Rio de Janeiro, terus menyanyikan lagu kebangsaan setelah iringan musik berhenti untuk mendukung aksi anak asuh Luis Felipe Scolari. Mereka terus bernyanyi dan bernyanyi sampai Neymar da Silva cs menerima trofi juara Piala Konfederasi. “Mereka menyanyikan lagu kebangsaan begitu lama sampai menunda pertandingan selama dua menit, tapi itu tidak penting. Ya ada masalah, tetapi akan diselesaikan dan kami akan memiliki Piala Dunia yang hebat di Brazil tahun depan,” pungkas Blatter. (m15/ant/rtr/fifa)

LONDON (Waspada): Janda bek Chelsea Ashley Cole, Cheryl Tweedy (foto), berpesta semalam suntuk bersama pacar barunya, Tree Holloway. Mereka bermesraan sampai pagi akhir pekan lalu di bar Hakkasan, Las Vegas, Amerika Serikat. Menurut Mirror sebagaimana dikutip Selasa (2/7), penyanyi top Inggris itu dengan mengenakan terusan putih, jelang pagi tampak duduk kelelahan bersama rekan-rekannya di salah satu sofa sudut bar. Dalam pesta ini, Cheryl memang mengajak dua sahabatnya, KimberlyWalsh dan Nicola Roberts. Pesta ini untuk merayakan ulang tahun ke-30 Cheryl, sehingga dia yang menanggung seluruh biasa perjalanan dan akomodasi pacar serta kedua sahabatnya tersebut. “Cheryl telah melalui begitu banyak masalah dalam beberapa tahun terakhir. Dia sangat bangga telah mencapai usia 30 dan melihatnya sebagai kesempatan besar untuk memulai hidup baru,” ungkap sahabat dekatnya kepada Mirror. Sahabat dimaksud malah mengaku, pesta Ultah itu sudah dipersiapkan janda Cole sejak berbulan-bulan lalu. “Bersama pacar barunya, dia telah merencanakan pesta dan ingin melayani orang-orang dekatnya. Itu sebabnya dia membayar seluruh biaya penerbangan dan akomodasi menginap di hotel bintang lima untuk mereka semua,” tambahnya. Meski sangat seksi dan memiliki karir cemerlang di dunia tarik suara, Cheryl sempat frustrasi karena pernikahannya dengan Cole akhirnya kandas tahun 2008 silam. Sang suami yang dicintainya, berulang kali kedapatan selingkuh dengan sejumlah wanita. Julukan playboy memang

anak-anak Medan kembali menjadi andalan timnas,” pungkas Kamal. Sedangkan lima pemain yang mengikuti seleksi mengaku akan berjuang maksimal menunjukkan kemampuan terbaik, sehingga nantinya bisa terpilih memperkuat tim Garuda Junior. Timnas U-16 sendiri akan ditangani pelatih Sutan Harhara. “Senang sekali bisa mendapat kesempatan seleksi timnas. Mohon doa masyarakat Sumut agar cita-cita kami untuk bisa mengenakan seragam timnas bisa kesampaian,” ujar Juan Williater, pemain asal SSB Havea Batubara dan diamini rekanrekannya. (m42)

hebat, yang selalu menolong saya,” papar Paulinho, seperti dilansir Reuters, Selasa (2/7). Dengan mata memerah pertanda terharu, dia menam-

bahkan; “Semua yang ingin saya katakan adalah, saya akan kembali ke Corinthians.” Paulinho bermain 167 kali bersama klub Brazil itu selama tiga musim dan mencetak 34 gol. Dia mengaku siap gabung Spurs di London, namun sebelumnya akan membela Sao Paulo pada turnamen Supercup di Amerika Selatan pada 3 dan 17 Juli. Corinthians memenangi kompetisi selevel Liga Champions bertajuk Copa Libertadores, sedangkan Sao Paulo pemenang kompetisi Copa Sudamericana. Tottenham belum mengeluarkan pernyataan resmi terkait klaim Paulinho. The London Whites musim lalu menempatkan diri di urutan kelima klasemen Liga Premier, sehingga tidak

masuk dalam spot ke Liga Champions. Kenyataan itu justru bisa mendorong winger andalan Spurs, Gareth Bale, hengkang dari White Hart Lane. Sebab setelah dua musim tak berlaga di Liga Champions, Bale mengaku sangat merindukan atmosfer turnamen kelas satu di Benua Biru tersebut. “Musik itu (theme song UCL) adalah sesuatu yang bermakna besar bagi saya. Ketika kami berlaga di sana, itu seperti menjadi sesuatu yang kami tunggutunggu untuk mendengarkan bersama di stadion,” beber Bale melalui The Sun. “Musiknya sangat terasa istimewa, terlebih bagi saya,” tambah Bale, yang sedang diburu raksasa Real Madrid. (m15/ant/rtr/sun)

Kontroversi Kucuran Fulus Abramovich LONDON (Waspada): Para ofisial Chelsea, Senin (Selasa WIB), memprediksi akan datang lebih banyak kesuksesan bagi klub raksasa Inggris itu saat satu dekade di bawah kepemilikan Roman Abramovich. Miliarder Rusia kekasih dari model Daria Zhukova (foto) itu, memegang kendali penuh di Stamford Bridge dan telah menghabiskan sekitar 874 juta pound untuk urusan transfer pemain. Juga 1,5 miliar pound untuk gaji selama sepuluh tahun sejak dia menguasai The London Blues pada 1 Juli 2003. “Ini merupakan dekade sangat sukses Chelsea sejak Roman Abramovich mengambil alih klub. Jumlah trofi sangat banyak, klub juga membuat langkah-langkah hebat dan terus beradaptasi,” sanjung Ron Gourlay, Ketua Eksekutif Chelsea, seperti dikutip dari Reuters, Selasa (2/7). Sejauh ini kucuan fulus Abramovich telah mendaratkan tiga gelar juara Liga Utama Inggris di Stamford Bridge, mengatasi dahaga The Blues yang puasa gelar sejak 1955. Si Biru juga

telah merebut empat Piala FA, dua Piala Liga, dan yang paling signifikan trofi Liga Champions dan Liga Europa. Tapi kontroversi muncul, karena RayWilkins, mantan staf pelatih Chelsea, menuding fulus Abramovich telah merusak sepakbola Inggris. “Sejauh ini, perubahan yang dilakukannya (Abramovich) memang membuat klub itu menjadi lebih bagus. Tapi tidak bagi tim Inggris,” jelasnya kepada The Sun. “Masuknya pemain asing dalam jumlah besar membuat para pemain Inggris tidak mendapat kesempatan bermain sebanyak pemain dari luar,” sentil Wilkins. Abramovich yang suka menonton laga Chelsea bersama kekasihnya Zhukova, memang gemar menghambur-hamburkan uang demi mendapatkan pemain asing berkelas dunia. Tren itu diikuti klub Liga Premier lainnya, sehingga menghambat perkembangan pemain muda Inggris. “Tim U-21 tersingkir (di Piala Eropa). Sedangkan di level U-20, mereka terdepak oleh Me-

sir, Irak dan Cile, yang seharusnya mereka lah yang kami singkirkan karena sebenarnya kami mampu,” sesalWilkins, mantan pemain Inggris era 1970-an. Presiden Chelsea Bruce Buck, punya pandangan berbeda. Melalui tulisannya di The Times, Buck mengatakan bahwa Abramovich telah mengubah klub London Barat itu dari tim medioker menjadi kekuatan utama global. “Hanya sedikit orang yang dapat memahami pada 10 tahun silam betapa kepemilikan Roman Abramovich akan dengan cepat mengubah Chelsea. Dia membawa klub menghadapi mediokritas papan tengah itu dan dekat dengan kebangkrutan untuk menjadi salah satu tim paling tangguh di dunia,” pujinya. “Akankah Roman Abramovich menjadi bosan, setelah memenangi semua trofi utama? Jawaban saya adalah tidak. Dapatkah Jose Mourinho membawa lebih banyak kesuksesan kepada klub ini, jawaban saya adalah ya,” optimisme Buck. (m15/ant/rtr/sun/times)


Bintang Jaya Tekad Promosi Divisi Utama

Waspada/Bustami Chie Pit

KISARAN (Waspada): Setelah menjuarai Grup I Kompetisi Divisi Satu Liga Amatir Indonesia XVIII tahun 2013 di Kisaran, PS Bintang Jaya Asahan bertekad terus melaju hingga merebut tiket promosi ke Divisi Utama PSSI. Caranya dengan memenangkan babak 24 Besar, bersaing dengan para juara dan runner-up dari 11 grup lainnya. Demikian Ketua Umum sekaligus Manajer Tim PS Bintang Jaya Asahan, H Erwis Edi Pauja Lubis SH MAP (foto).

Kepada Waspada, Selasa (2/ 7), Erwis mengatakan babak 24 Besar rencananya berlangsung September mendatang. “Saya berharap tim dapat terus tampil konsisten. Target kita adalah merebut tiket promosi ke kompetisi Divisi Utama tahun depan,” jelasnya. “Ini merupakan target yang cukup berat tentunya, namun saya yakin dengan perjuangan maksimal, mimpi itu bisa terwujud,” tambah Erwis. Untuk memenuhi target yang diusung, menurutnya, tim

berjuluk Kijang Gunung yang kini ditangani duet pelatih Legimin dan Rizaldy itu, segera melakukan penambahan pemain supaya kemampuan tim dapat lebih meningkat dari sebelumnya. “Sejumlah mantan pemain PON Sumut yang sebelumnya memperkuat PSSA Asahan akan bergabung bersama Bintang Jaya. Begitu juga dengan beberapa pemain PSMS Medan sudah ada yang berniat membela Bintang Jaya,” beber Erwis. Kadisporabudpar Asahan

ini menilai PS Bintang Jaya memiliki peluang besar untuk promosi ke Divisi Utama tahun depan. Salah satu syaratnya adalah harus meningkatkan kualitas tim dengan menambah amunisi. “Tim pelatih sudah melakukan evaluasi lebih mendalam dan kesimpulannya tim harus menambah beberapa pemain berkualitas jika ingin mencapai target meraih tiket promosi ke Divisi Utama tahun depan,” pungkas Erwis. (a31)

WASPADA Rabu, 3 Juli 2013


SUASANA para peserta Audisi Umum beradu kemampuan memperebutkan Beasiswa Bulutangkis PB Djarum.

Audisi Umum Beasiswa Bulutangkis PB Djarum 2013

Mimpi Meraih Beasiswa Bulutangkis PB Djarum

PADA Malam Apresiasi Prestasi PB Djarum dan PB Jaya Raya memberikan bonus kepada Moh. Ahsan-Hendra Setiawan masing-masing sebesar sebesar Rp100 juta.

PARA peserta Audisi Umum dan orang tua mendapatkan penjelasan pentingnya nutrisi dan gizi dari ahli gizi.

PARA peserta Audisi Umum Beasiswa Bulutangkis PB Djarum dipupuk sportifitas sejak dini.

DALAM tes tahap pertama para peserta Audisi Umum Beasiswa Bulutangkis PB Djarum saling beradu kemampuan di 12 lapangan.

SEBANYAK 1.035 atlet muda mulai meretas mimpi menjadi pebulutangkis berprestasi dunia lewat Audisi Umum Beasiswa Bulutangkis PB Djarum di GOR Djarum di Jati Kabupaten Kudus, 28-30 Juni 2013. Para calon juara berusia 10-15 tahun tersebut berebut meraih beasiswa bulutangkis. Para atlet tidak hanya datang dari Pulau Jawa, tetapi juga dari Meulaboh, Aceh, Ternate, Maluku Utara. “Dengan mengangkat tema Win the Big Fight, sesuai komitmen yang terus dipegang teguh PB Djarum terhadap kemajuan prestasi bulutangkis Indonesia, tahun ini kami kembali menggelar Audisi Umum Beasiswa Bulutangkis PB Djarum . Audisi Umum ini kami gelar untuk mencari dan membina pemain bulutangkis berkualitas super agar proses regenerasi bulutangkis Indonesia berjalan mulus,” ujar Yoppy Rosimin, Program Director Bakti Olahraga Djarum Foundation, dalam jumpa pers di GOR PB Djarum, Jati, Kudus, Jumat (28/6). Dengan tema tersebut, para pemain muda dikenalkan untuk harus berjuang sejak dini demi menjadi pemenang untuk menerima beasiswa bulutangkis PB Djarum. Audisi umum ini juga merupakan jalan meretas karier menjadi juara dunia masa depan dengan bergabung ke klub bergengsi yang telah melahirkan banyak juara dunia. “Saya ikut Audisi Umum ini karena saya lihat klub Djarum adalah perkumpulan bulutangkis terbaik di Indonesia. Saya lihat fasilitasnya juga sangat mewah, makanya saya sangat ingin bisa diterima dan mendapat beasiswa bulutangkis dari PB Djarum,” kata Muhammad Mochdar, pemain kelahiran Ternate, Maluku Utara, 10 September 1999 yang berasal dari PB Putra Mainaky. “Saya juga ikut audisi umum ini untuk mengembangkan prestasi bulutangkis sekaligus untuk terapi trauma psikis karena saya juga jadi korban bencana tsunami di Aceh tahun 2004,” tutur Sabilla Yasarah, pemain kelahiran Meulaboh, 8 Juli 2002 ini. Agar mendapatkan pemain berbakat dan proses seleksi berjalan fair dan objektif, Yoppy sudah mewanti-wanti proses seleksi akan berjalan transparan dan dijamin tidak ada titipan atau cara-cara tidak fair lainnya. “Handphone para pelatih yang masuk menjadi tim seleksi telah dikumpulkan agar mereka tidak ada interaksi dengan calon peserta. Jadi saya jamin, yang namanya titipan itu tidak ada. Kalau pun ada dan ketahuan, pelatih tersebut akan mendapat sanksi sangat berat dari PB Djarum,” tegas Yoppy. Audisi Umum Beasiswa Bulutangkis PB Djarum kali ini merupakan salah satu bukti nyata dari klub yang berdiri tahun 1969 dan telah melahirkan begitu banyak juara dunia tersebut bagi kemajuan prestasi bulutangkis Indonesia. Kegiatan ini juga untuk melestarikan dan menjaga supremasi bulutangkis Indonesia di kancah internasional. “Tahun ini kami kembali mencari bibit-bibit pemain berkualitas super melalui Audisi Umum Beasiswa Bulutangkis PB Djarum 2013. Seperti tahun sebelumnya, kami tidak menargetkan berapa orang yang akan diterima. Yang terpenting adalah kualitas bukan kuantitasnya. Asal memiliki kualitas super, dari mana pun asalnya, pasti akan kami terima. Toh ini pada akhirnya juga untuk kemajuan prestasi bulutangkis Indonesia,” tambah Yoppy. Para Audisi Umum juga dikenalkan secara langsung dengan segala fasilitas dan sarana yang ada di GOR PB Djarum. Selain itu para peserta dibimbing untuk mengenal dari dekat para pahlawan bulutangkis PB Djarum yang terangkum dalam Hall of Fame. “Para peserta kita kenalkan betapa menyenangkan bisa menjadi sang juara. Menekuni olahraga bulutangkis itu mampu memberikan jaminan masa depan. Makanya, selama di Kudus, mereka kelak bisa bertemu langsung dengan para bintang bulutangkis. Tujuan kegiatan ini adalah untuk memberikan motivasi kepada para pemain agar terus memiliki semangat bermain bulutangkis dan tidak patah semangat ketika tahun ini gagal masuk seleksi,” ujar Yoppy. Hal ini diakui Maria Kristin Yulianti ketika mendaftar ke klub Djarum. Peraih medali perunggu Olimpiade Beijing 2008 itu sampai 5 kali mengikuti audisi sebelumnya. Akhirnya diterima sebagai anggota klub yang telah banyak melahirkan juara dunia itu. “Saya punya prinsip pantang menyerah untuk bisa diterima di PB Djarum. Setiap tahun selalu berusaha keras agar bisa diterima. Setelah tes yang kelima saya baru diterima ke klub Djarum,” kata Maria Kristin. Ditambahkan Fung Permadi, manajer tim PB Djarum, sejak Audisi Umum Beasiswa Bulutangkis PB Djarum digelar, klub yang telah banyak melahirkan juara-juara dunia tersebut bakal menjaring pemain-pemain dengan kualitas super. “PB Djarum bakal menjaring bibit-bibit atlet dengan kualitas terbaik, bukan kuantitasnya. Atlet yang tangguh, pantang menyerah, memiliki daya juang tinggi dan bermental juara adalah kriteria pebulutangkis yang kami cari. Oleh karena itu, proses seleksi ini akan berlangsung sangat ketat,“ kata Fung Permadi, mantan pemain nasional ini. Dikatakan oleh Vita Marissa, dirinya dulu juga mulai pegang raket umur enam tahun dan masuk klub umur 12 tahun. Dirinya bisa mengukir prestasi karena sejak kecil dia memiliki mimpi untuk kelak bisa menjadi pemain berprestasi. “Bagi adik-adik peserta Audisi Umum PB Djarum yang mulai sekarang meretas karier sebagai pemain, yang terpenting mulai sekarang memiliki tujuan dan berani bermimpi saja. Ditunjang dengan latihan yang rajin dan jangan gampang menyerah saja kuncinya,” pesan Vita. Selain itu, memeriahkan acara Audisi Umum Beasiswa Bulutangkis PB Djarum, di luar arena berdiri booth-booth yang menawarkan permainan interaktif, games, dan talk show tentang pentingnya nutrisi dan gizi bagi atlet. Sementara pada Jumat (28/6) malam akan digelar malam Apresiasi Prestasi bagi Mohammad Ahsan yang bersama Hendra Setiawan, sukses menjadi juara pada turnamen Djarum Indonesia Open Super Series Premier dan Singapura Super Series, pekan lalu. Acara ini juga dimeriahkan hiburan penampilan artis-artis ibu kota, seperti Super Girlies, Last Child, stand up comedy Akbar. (adv)

AKSI Jump Smash dari salah satu peserta Audisi Umum Beasiswa Bulutangkis PB Djarum.

SALAH satu peserta Audisi Umum Beasiswa Bulutangkis PB Djarum melakukan aksi akrobat.

EKPRESI para peserta dan orangtua mencari nama yang lolos ke tahap selanjutnya.

LEBIH dari seribu peserta mendaftar ulang Audisi Umum Beasiswa Bulutangkis PB Djarum.

RIBUAN peserta Audisi Umum Beasiswa Bulutangkis PB Djarum dengan serius menyimak arahan tim Pelatih PB Djarum.

MALAM Apresiasi Prestasi Dimeriahkan Oleh Super Girlies, Last Child dan Comic Akbar.

A12 Radwanska Favorit LONDON (Waspada): Setelah publik Wimbledon 2013 dengan tersingkirnya tiga unggulan utama, di antaranya Serena Williams, Maria Sharapova, dan Victoria Azarenka, Agnieszka Radwanska (foto) menjadi favorit kampiun tunggal putri. Unggulan keempat asal Polandia ini sukses menumbangkan Li Na (China) 7-6 (5), 4-6, 6-2, Selasa (2/7). Dalam laga babak delapan besar itu, Radwanska memang bertahan habishabisan dan memaksa empat deuce sebelum akhirnya menyamakan skor 5-5 di set awal. Aga, sapaan akrabnya, pun merebut set pertama dengan kemenangan tiebreak dalam satu jam lima menit. Set kedua kembali berlangsung ketat, hingga kedudukan imbang 4-4. Li sempat mematahkan servis Radwanska untuk membalas kekalahannya di set pertama demi mencuri set kedua. Sebelum set ketiga, Radwanska mendapat medical time out karena nyeri paha. Dengan tambahan balutan di paha, Aga pun membuka set ketiga dengan mematahkan servis Li. Setelah laga sempat tertunda akibat hujan hingga memaksa atap Centre Court tertu-

tup sempurna, Radwanska tetap memegang kendali permainan. Melewati tujuh deuce dan delapan match point, petenis berusia 24 tahun ini memastikan tiket semifinal. Nantinya, Aga akan meladeni penakluk Serena, yakni Sabine Lisicki. Melawan Kaia Kanepi (Estonia), peringkat 24 dunia asal Jerman itu meraih kemenangan straight set 6-3, 6-3 untuk mengulangi sukses pada tahun 2011 silam. Partai babak delapan besar lain mempertemukan unggulan delapan Petra Kvitova (Rep Ceko) melawan Kirsten Flipken (Belgia) dan Sloane Stephens (AS) kontra Marion Bartoli (Prancis). Di tunggal putra, peta kekuatan tidak berubah pasca-tersingkirnya Rafael Nadal (Spanyol) dan Roger Federer (Swiss). Tercatat, sejumlah unggulan dan pesaingnya masih bertahan sekaligus rehat pada Selasa


“Mereka adalah tim yang bagus, mereka punya mobil yang cepat, mereka punya pebalap yang bagus. Mereka tentu akan jadi pesaing untuk gelar juara mulai sekarang sampai akhir musim, seperti Ferrari dan Lotus,” ujar Horner, Selasa (2/7). “Tidak ada alasan sama sekali, tapi jalan di kejuaraan ini masih sangat panjang,” lanjutnya lagi. Sementara itu, Horner masih menyayangkan kegagalan Sebastian Vettel menyelesaikan lomba di GP Inggris. Seperti diketahui, tiga kali juara dunia itu terhenti di lap 42 atau 10 putaran tersisa saat tengah memimpin balapan karena masalah gearbox. “Dia ada di posisi yang sangat bagus menuju kemenangan. Dia mengendalikan jarak, melakukan segalanya dengan benar, namun sangat disayangkan harus mengakhiri balap lebih cepat,” kata Horner. (m33/auto)


Celtics Fokus Bangun Kekuatan Baru


KUBU Mercedes mulai menebar ancaman kepada tim pesaing lain, setelah sukses menjuarai GP Inggris akhir pekan lalu.

Kondisi Lorenzo Berangsur Pulih


Rabu 3 Juli 2013

(2/7). Unggulan utama Novak Djokovic (Serbia) akan berusaha merebut tempat di babak empat besar kala ditantang Tomas Berdych (Rep Ceko). Djokovic lolos dengan menyudahi perlawanan Tommy Haas (Jerman) 6-1, 6-4, 7-6 (4), sedangkan Berdych mengungguli Bernard Tomic (Australia) 7-6 (4), 6-7 (5), 6-4, 6-4. Peluang tiket semifinal juga didapat Andy Murray. Harapan tunggal publik Inggris Raya yang juga unggulan kedua ini, mengakhiri harapan petenis Rusia, Mikhail Youzhny, 6-4, 7-6 (5), 6-1. Lawan Murray adalah Fernando Verdasco (Spanyol) yang melewati hadangan Kenny De Schepper (Prancis) 6-4, 6-4, 6-4. Petenis Argentina, Juan Martin del Potro, juga melangkah pasti ke perempatfinal. Del Potro, membukukan kemenangan atas Andreas Seppi (Italia), bersua David Ferrer (Spanyol). Laga perempatfinal lainnya menampilkan perang saudara antar-sesama petenis Polandia, Jerzy Janowicz kontra Lukasz Kubot. (m33/ap)

Red Bull Waspadai Mercedes LONDON (Waspada): Kemenangan Nico Rosberg di GP Inggris lalu membuat bos Red Bull, Christian Horner, mulai memperhitungkan Mercedes. Dia menilai tim asal Brackley itu akan menjadi salah satu kandidat juara. Di Sirkuit Silverstone akhir pekan lalu, Rosberg tampil sebagai pebalap terbaik. Pria asal Jerman itu mengungguli Mark Webber (Red Bull) dan Fernando Alonso (Ferrari) yang masing-masing finish di belakang Rosberg. Kemenangan Rosberg itu seakan menegaskan dominasi Mercedes di Silverstone. Di sesi kualifikasi, Mercedes menempatkan dua pebalapnya di posisi terdepan. Lewis Hamilton yang merebut pole harus puas finish keempat setelah sempat mengalami masalah pada bannya. Di klasemen konstruktor, Mercedes menjadi runner-up di bawah Red Bull yang unggul 48 poin.


BARCELONA, Spanyol (Waspada): Kondisi Jorge Lorenzo (foto kanan) atas cedera bahu yang dialaminya tidak terlalu serius dan terus membaik. Kepastian tersebut didapatkan pebalap Yamaha tersebut usai pemeriksaan di Rumah Sakit De Catalunya, Selasa (2/7). Seperti diketahui, Lorenzo harus terkena cedera bahu kala menjalani sesi latihan kedua MotoGP Belanda, pekan lalu. Pebalap asal Spanyol tersebut langsung diterbangkan ke Barcelona guna menjalani operasi. Kemudian, Lorenzo memutuskan kembali ke Belanda dan mengikuti sesi pemanasan, hingga akhirnya mendapat lampu hijau dari tim medis untuk ikut lomba. Meski start pada posisi ke-12, juara bertahan MotoGP itu berhasil mengakhiri lomba di peringkat lima. Kini kondisinya pun membaik dan bisa mengikuti seri berikutnya. “Cedera yang dialami Lorenzo selama berada di Belanda tampaknya tidak menimbulkan dampak apapun. Pasalnya, dalam pemulihan bahu kiri berjalan dengan baik,” ujar Dr Teresa Sola. Lorenzo sendiri mengaku tak percaya dirinya bisa pulih dengan cepat hingga berhasil finish kelima dalam kondisi seperti itu. Dikatakan, beberapa menit setelah kecelakaan, Lorenzo mengaku merasa mustahil bahwa kecelakaan itu dialaminya. (m33/mgp)

BOSTON, AS (Waspada): Setelah melepas pelatih Doc Rivers ke LA Clippers, Boston Celtics berusaha membangun kekuatan baru dengan menempatkan sejumlah bintang di bursa transfer, seperti Paul Pierce (foto kiri) dan Kevin Garnett (foto kanan). Baru-baru ini, manajemen klub setuju melepas dua anggota Big Three yang turut membawa Celtics meraih gelar juara NBA 2008 ke Brooklyn Nets untuk paket draft NBA dan beberapa pemain lain. Garnett merupakan calon penghuni Hall of Fame, namun kepergian Pierce menjadikan Celtics kehilangan salah satu ikon. “Sangat sedih melihat semua orang meninggalkan Boston. Anda hanya ingin mereka pergi ke sebuah tempat dengan peluang menang. Ini juga menjadi transfer yang bagus untuk Boston. Danny Ainge ingin membangun sebuah tim baru dan itu sedang dilakukannya,” kata Rivers di markas Clippers, Selasa (2/7). Pierce merupakan anggota terlama dan kapten di Celtics dengan prestasi 10 kali terpilih bermain di NBA All-Star serta calon Hall of Famer. Pierce juga merupakan pebasket yang memiliki skor terbanyak kedua dalam sejarah NBA dan tujuh besar kategori rebound, assist, steal, game, dan menit bermain. “Ini sangat menyedihkan. Anda tentu benci meihatnya, tapi itulah NBA. Saya rasa apa yang dilakukan Paul (Pierce) dan Kevin (Garnett) sangat bagus karena memiliki kesempatan melanjutkan karier. Berita ini juga bagus untuk Celtics yang bisa membangun kekuatan baru,” ungkap Asisten Pelatih Celtics saat juara 1998 dan kini arsitek Chicago Bulls, Tom Thibodeau. (m33/ap)


Sumatera Utara

WASPADA Rabu 3 Juli 2013


Zhuhur ‘Ashar

Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

12:31 12:44 12:32 12:39 12:38 12:35 12:31 12:27 12:34 12:33

15:57 16:11 15:58 16:06 16:05 16:01 15:58 15:54 16:01 16:00

Magrib 18:41 18:58 18:42 18:52 18:51 18:42 18:41 18:37 18:44 18:46



Shubuh Syuruq


19:56 20:13 19:57 20:07 20:06 19:56 19:56 19:51 19:59 20:01

04:47 04:56 04:48 04:51 04:52 04:55 04:49 04:44 04:50 04:48

04:57 05:06 04:58 05:01 05:02 05:05 04:59 04:54 05:00 04:58

L.Seumawe 12:37 L. Pakam 12:30 Sei Rampah12:29 Meulaboh 12:41 P.Sidimpuan12:28 P. Siantar 12:29 Balige 12:29 R. Prapat 12:26 Sabang 12:44 Pandan 12:30

06:18 06:28 06:19 06:23 06:24 06:27 06:20 06:16 06:22 06:20

Zhuhur ‘Ashar 16:04 15:57 15:56 16:08 15:54 15:56 15:56 15:52 16:11 15:57





Shubuh Syuruq


Zhuhur ‘Ashar




Shubuh Syuruq







Shubuh Syuruq

18:50 18:41 18:40 18:52 18:35 18:39 18:38 18:34 18:58 18:38

20:05 19:55 19:55 20:07 19:50 19:53 19:52 19:48 20:14 19:52

04:50 04:46 04:45 04:56 04:49 04:47 04:48 04:45 04:55 04:50

05:00 04:56 04:55 05:06 04:59 04:57 04:58 04:55 05:05 04:00

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:30 12:32 12:42 12:34 12:31 12:38 12:26 12:37 12:30 12:29

18:38 18:41 18:55 18:43 18:42 18:50 18:36 18:47 18:38 18:39

19:52 19:55 20:10 19:57 19:57 20:05 19:50 20:01 19:52 19:54

04:50 04:49 04:54 04:53 04:47 04:52 04:44 04:53 04:49 04:45

05:00 04:59 05:04 05:03 04:57 05:02 04:54 05:03 04:59 04:55

Panyabungan Teluk Dalam Salak Limapuluh Parapat GunungTua Sibuhuan Lhoksukon D.Sanggul Kotapinang AekKanopan

12:27 12:34 12:32 12:28 12:30 12:27 12:27 12:36 12:30 12:25 12:27

15:53 16:00 15:58 15:54 15:56 15:53 15:53 16:03 15:57 15:51 15:53

18:33 18:39 18:41 18:38 18:39 18:34 18:33 18:49 18:39 18:33 18:35

19:47 19:54 19:55 19:52 19:53 19:48 19:47 20:04 19:53 19:47 19:50

04:49 04:56 04:50 04:44 04:48 04:47 04:47 04:49 04:49 04:44 04:45

04:59 05:06 05:00 04:54 04:58 04:57 04:57 04:59 04:59 04:54 04:55

06:22 06:18 06:17 06:28 06:20 06:18 06:19 06:16 06:28 06:21

15:56 15:58 16:08 16:01 15:58 16:05 15:53 16:03 15:56 15:55

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

06:21 06:21 06:26 06:24 06:19 06:24 06:15 06:25 06:20 06:17

06:20 06:27 06:22 06:16 06:19 06:18 06:19 06:21 06:20 06:16 06:16

Pulau Jaring Halus Ditetapkan Kawasan Ekosistem Esensial MEDAN (Waspada): Dirjen Perlindungan Hutan dan Konservasi Alam (PHKA) Kementerian Kehutanan melalui Direktorat Kawasan Konservasi dan Bina Hutan Lindung, bersama dengan Balai Besar Konservasi Sumber Daya Alam (KSDA) Sumut, menetapkan kawasan lahan basah di Jaring Halus (Pulau Jaring Halus sekitarnya) di Kec. Secanggang, Langkat sebagai kawasan ekosistem esensial. “Jaring halus menjadi pilihan untuk dikembangkan sebagai kawasanekosistemesensiallahan basahdikarenakankawasanyang merupakan Areal Penggunaan Lain (APL) itu menjadi penghalang abrasi dan intrusi air laut.

Juga ekosistem mangrove yang memiliki nilai ekologis tinggi, di samping habitat alami bagi lumba-lumba air tawar,” kata Kepala Balai Besar KSDA Sumut, Ir. Istanto, M.Sc, Selasa (2/7) di Medan.

Tak Dapat BLSM Tiga Gelombang Warga Datangi Kantor BPS Sergai SEIRAMPAH(Waspada):KarenatakmendapatBantuanLangsung Sementara Masyarakat (BLSM), tiga gelombang masyarakat terdiri dari puluhan ibu-ibu dua kecamatan yakni Kec. Sei Rampah dan Silinda, Kab. Serdang Bedagai mendatangi Kantor Badan Statistik Kab. Sergai di Desa Firdaus, Selasa (2/7) siang. Lebih kurang 40 warga dari Dusun IV, Kampung Rambutan, Desa Sungai Buaya, Kec. Silinda itu datang menumpang truk colt DieseldidampingiCamatSilindaDrs.HaparuddinSaragihdanKapolsek Kotarih, diwakili Kanit Reskrim Ipda Rudolf Gultom serta beberapa personel Polsek. Mereka diterima KTU Kantor Badan Statistik Ahmad Hasibuan, S.Sos, didampingi Kasat Intelkam AKP Tarigan. Dari 40 warga kebanyakan kaum perempuan berusia senja, di antaranya Sumarni, 52, Nuraini, 55, Legia, 53, Sumiyem, 47,Tumpo, 76, Siti Murni, 77, Sairah, 75, Tutur, 42, Tukini, 60, Ngatinem, 65, Kalima, 75, Legiem, 60, Wagiem, 62, Tumini, 75, dan Musi, 62. Dalam pertemuan itu, Legiah yang tak punya suami mewakili rekan- rekannya mengatakan heran mengapa tak mendapat BLSM, padahal mereka benar-benar miskin. Anehnya, kata mereka, ada masyarakat yang senang tapi dapat bantuan. Legiah, mohon BPS Sergai membuat usulan kembali ke BPS pusat, agar aspirasi warga miskin bisa terbantu untuk mendapat bantuan. Menyahuti keluhan warga miskin, KTU BPS Sergai Ahmad Hasibuan mengatakan, dari data BPS BLSM pada 2008 Pendataan Program Perlindungan Sosial telah diperbaharui 2011, dengan pendataan di masing masing desa dari rumah ke rumah oleh petugas. “Tapi kita hanya bisa mengirim nama-nama tersebut, sedangkan yang menentukan adalah BPS pusat,” jelasnya sambil menambahkan, setelahnamanamadikirimkekantorPos,ternyatabanyakwargamiskin yang sebelumnya mendapat raskin, di program ini namanya tak ada. “Walaudemikiankitacobamengirimnama-namaitukembalikepusat, mudah-mudahan mendapat perhatian pemerintah,” kata Ahmad. Sebelumnya empat becak bermotor (Betor) kaum ibu ibu dari Desa Firdaus, Kec.Sei Rampah yang langsung didampingi Kepala Desanya Edicon Sinulingga dan Sekdes Jamuri juga mendatangi Kantor BPS Sergai, juga protes tidak mendapat BLSM. Sementara pada waktu hampir bersamaan becak bermotor bermuatan ibu-ibu dari Desa Penggalangan, mendatangi kantor BPS di Firdaus, mempertanyakan hal sama. KasatIntelkamPolresSergaiAKPTarigankepadaWaspadadikantor BPS,mengatakandari48.000KKnamawargamiskinSergaiyangdikirim pusat hanya 25% yang terealisasi, selebihnya tidak ada.(a08)

Jambret Tewas Terjatuh STABAT (Waspada): SU, 21, warga Kel. Dendang Stabat, Kab. Langkat tewas terjatuh dari sepedamotornya setelah menjambret ibu rumah tangga di ruas jalan kawasan Titi Penceng Stabat, Senin (1/7) malam. Informasi dihimpun, beberapa jam sebelum tewas pelaku menjambret dompet Tumini, 54, warga Banyumas Stabat yang juga mengendarai sepedamotor.Tapi korban berteriak sekaligus mengejar pelaku. SU pun langsung memacu sepedamotor Suzuki Satria BK 3617 PAHyangdikendarainya.Namundidugagugupdankarenaseringmenoleh ke belakang, pelaku terjatuh dengan luka serius di kepala. KapolsekStabatAKPZulkarnaenmengetahuikejadianitulangsung membawa pelaku ke Klinik Surya Stabat untuk perawatan, tapi beberapa jam kemudian SU tewas.(a03)

Peningkatan SDM Kesehatan Sangat Penting SERGAI (Waspada): Meningkatkan sumber daya manusia, khususnya bidang kesehatan sangat perlu dilakukan, guna lebih membangkitkan kembali kesadaran masyarakat akan pentingnya kesehatan. DemikiandikatakanKetuaDewanPembinaSMKKesehatanHikmah Husada, Sergai, Drs, Masdar Limbong, M.Pd didampingi Humas Drs H. Hasan Maksum Nasution, SH, MA, Selasa (2/7). Menurutnya, untuk membantu meningkatkan sumber daya manusia dibidang kesehatan tersebut, Yayasan Pendidikan Global Serdang Bedagai sejak setahun lalu telah mempersiapkan proses pendirian SMK Kesehatan Hikmah Husada. “Setelah kita berkoordinasi dengan Kepala Dinas Kementerian Pendidikan Kab. Sergai dan sejumlah tokoh masyarakat, termasuk anggota legislatif tentang rencana pendirian SMK kesehatan ini, mereka mendukung sepenuhnya. Itulah sebabnya pada 2013, SMK Kesehatan Hikmah Husada mulai melaksanakan kegiatan akademik pembelajaran dengan Izin Operasional No: 18.11/421.5/306/2013, tertanggal 01 April 2013,” ujar Masdar Limbong. Kegiatanakademik,termasukperalatanlaboratoriumdankegiatan praktikum peserta didik nantinya, pihak SMK telah menjalin kerjasama dengan sejumlah fakultas kedokteran di Medan. Selain praktikum di laboratorium juga akan dilaksanakan praktek lapangan melalui program magang ke sejumlah rumah sakit, puskesmas, apotek yang ada di Kab. Serdang Bedagai dan Medan.(m37)

Dia mengatakan, kawasan Jaring Halus merupakan pulau terluar di sisi Timur Pulau Sumatera, memiliki hutan desa yang ditumbuhimangrovesekira18ha. Hutan itu ditumbuhi berbagai spesies, di antaranya Api-api (Avicennia marina), Dadap/ bidara (Sonneratia casedoris), Lenggadai (Bruguiera parviflora), Bakau (Rhizophora apiculata), Nipah (Nypa fructicans), Nyirih (Xylocarpus granatum) dan Buta-buta (Exoecaria agallocha). Vegetasi mangrove itutumbuhdalamberbagaistrata, mulai dari fase semai, sapihan/ anakan, tiang dan pohon. “Laju regenerasi berlangsung secara alami, tidak perlu campur tangan manusia. Itu disebabkan kondisi ekologisnya masih cukup baik dan ketersediaan vegetasi yang produktif yang menjamin pemenuhan kebutuhan buah ataubenihuntukkeberlangsungan

proses regenerasi,” kata Istanto. Dia juga mengatakan, dari hasil analisis vegetasi diketahui tidak kurang 19 spesies mangrove (major mangrove) dan 11 spesies asosiasi mangrove (minor mangrove) tumbuh di Hutan Desa Jaring Halus. Sehingga kawasanitumenjadipusatpengembanganilmupengetahuanmelalui berbagai kegiatan riset, baik oleh peneliti individu maupun lembaga. “Beragam topik penelitian telah dilakukan, di antaranya penelitian tentang kualitas air, keberadaan hutan mangrove dan burung migran, persepsi masyarakat terhadap kawasan SM Karang Gading dan Langkat Timur Laut serta lainnya,” kata dia didampingi Pengendali Ekosistem Hutan (PEH) Balai Besar KSDA Sumut Syafruddin Perwira Negara dan Staf Sub Bagian Data, Evlap dan Humas

Balai Besar KSDA Sumut Evansus Renandi Manalu. Istanto berharap dengan kesadaran tinggi mempertahankan kelestarian hutan desa berimplikasi mendorong kepedulian yang sama untuk menjaga dan melindungi kawasan SM Karang Gading dan Langkat Timur Laut sebagaikawasanekosistemesensial. “Kedepannya diharapkan partisipasi berbagai pihak (stake holders),baikinstansipemerintah maupun elemen masyarakat untuk berkolaborasi mengembangkan berbagai kegiatan yang bermanfaat untuk kawasan itu, demi peningkatan taraf hidup masyarakat. Karena ekosistem berperan sebagai penyangga kehidupan yang memiliki keragaman fungsi hayati, pariwisata dan sosial budaya, sehingga potensinya sangat mendukung kehidupan manusia.”(m27)

Waspada/Ibnu Kasir

BUPATI Langkat H. Ngogesa ketika memberikan ucapan selamat kepada Terbit Rencana PA dan Amir Hamzah selaku Ketua dan sekretaris F-SPTI-SPSI Langkat.

Ngogesa Hadiri Pelantikan SPSI Langkat STABAT (Waspada): Terciptanya kondusivitas, diharapkan memberi peluang tumbuh kembangnya investor ke daerah (Langkat) dan imbasnya meningkatkan pendapatan masyarakat, di antaranya pekerja maupun buruh.Dengandemikian,terciptalah keharmonisan pekerja dengan pemilikusahasehinggakemajuan ekonomi daerah semakin baik. “Semangat kemitraan harus senantiasa terpelihara dengan baik,tujuannyademikepentingan masyarakat,” kata Bupati Langkat, H. Ngogesa Sitepu, SH pada pelantikan DPC Forum Serikat Pekerja Transportasi Indonesia Konfederasi (F-SPTI K) dan Seri-

kat Pekerja Seluruh Indonesia (SPSI), di lapanganTerminal Kec. Selesai, belum lama ini. Menurut Bupati H. Ngogesa, iklim kondusif yang diharapkan terusmembaiksehinggaberbagai perusahaan akan tumbuh dan besar yang memiliki kaitan langsung dengan kesejahteraan pekerja sebagai salah satu pahlawan penggerak roda ekonomi mampu menjamin kelangsungan hidup perusahaan. Sebelumnya Kadis Tenaga Kerja dan Transmigrasi (Nakertrans) Langkat, H Syaiful Abdi, di daerah ini telah diterbitkan Peraturan Daerah (Perda) yang menekankan setiap perusahaan

mempekerjakan 75% putra daerah. Karenanya diharapkan terus dukungan terciptanya kondusifitas pekerja di Kab. Langkatmelaluikomunikasiyang baik antara serikat pekerja harus tetap dijalin dalam mendukung visi misi Pemkab Langkat. Usai pelantikan, Terbit Rencana selaku Ketua didampingi Amir Hamzah P Sunda selaku Sekretaris DPC F-SPTI K dan SPSI Kab. Langkat menyampaikan terimakasih diamanahi jabatan tersebut dan berupaya memimpin15PUKberanggotakansekitar 4000-an, sekaligus berkeinginan membangkitkan kesejahteraan pekerja.(a01)

OK Arya, ‘Favorit’ Di Masyarakat SENGATAN matahari tidak menghalanginiatuntukmenerpa sosok mereka dukung. Bahkan saling bekejar ‘berebut’ cepat menyambutkedatangannyabaik kaum ibu, bapak, pemuda hingga anak-anak. Gambaran ini tercermin dari kunjungan Bupati Batubara H. OK Arya Zulkarnain, SH, MM yang juga Cabup perseorangan 2013-2018, dalam kunjungan silaturrahmi kepada kaum ibu pencarikerangdannelayandiseputaran Pajak Kerang, Desa Suka Jaya, Kec.Tanjungtiram, kemarin. Kunjungan dirangkai penyerahan bantuan besket dan baskom untuk digunakan sebagai pendukung aktivitas pencari buah laut. “Pak OK, pak OK, pak

OK…,” begitu ungkapan masyarakat menyambutnya, setelah turun dari Jeep Hardtop biru plat merah BK 1 BB. Bupati yang menjadi ‘favorit’ itu selanjutnya digiring ke kedai kopi tak jauh dari Pajak Kerang. Di sini kalangan bapak-bapak yang umumnya nelayan rupanya sudah menunggu, sekaligus mengajaknya minum kopi bersama. “Mari pak OK minum kito” sebut seorang lelaki lanjut usia, sambil mengulurkan tangan menyambutnya diikuti yel-yel ‘hidup OK’ yang secara sahut menyahut dilakukan masyarakat yang akhirnya memadati kedai. Setelah beberapa saat duduk bersama dan menerima berbagai masukan warga, bupati yang juga

melalui jalur perseorangan pada Pilkada2008dalamsekaliputaran, pamit untuk melanjutkan kegiatan. “Saya permisi dulu pak, buk, adik-adik,” ujarnya pamit sambil menyalami warga satu persatu. OK, selanjutnya menyeberang jalan menuju Pajak Kerang. Di tempat itu dan di tengahtengah warga yang mengerumuninya, OK Arya Zulkarnain menyerahkan bantuan. “Mudah-mudahan bantuan inidapatdigunakansebaikmungkin dalam upaya mendukung aktivitas sehari-hari,” tuturnya ketika menyerahkan peralatan pendukung aktivitas bagi pencari buah laut kerang, satu persatu. *Iwan Has

PNS Terhipnotis, Rp3 Juta Raib TEBINGTINGGI (Waspada): PNS di Bagian Keuangan Pemko Tebingtinggi Sulisna Ningsih, 35, warga Perumnas Bagelen, Kec. Padang Hilir, kehilangan Rp3 juta setelah mengambil uang di ATM Sekretariat Pemko Jalan Sutomo. Diduga ibu rumah tangga itu terkena hipnotis,sehinggamenurutisegalakeinginanorangyangbarudikenalnya. Suami korban, Basri, menuturkan peristiwa itu terjadi beberapa waktu lalu, saat istrinya didatangi dua pasangan pria-wanita, di ruko Jalan Sudirman depan Ramayana. Setelah ke empat orang itu memperkenalkan diri, mereka langsung akrab. Pelaku berpura-pura kehabisan uang dan meminjam uang korban. Entah bagaimana, korban setuju. Dengan naik sepedamotor dan pelaku menggunakan becak, mereka menuju ATM Bank Sumut di halaman Sekretariat Pemko Tebingtinggi. Uang Rp3 juta yang diambil korban dari ATM langsung diserahkan kepada pelaku. Setelah itu pelaku pun meninggalkan korban. “Diabarusadarwaktumeneleponsayadanbilangsudahmenyerahkan Rp3 juta kepada orang itu,” terang Basri. Mengetahui telah ditipu, korban bersama suaminya mengadu ke Mapolres Tebingtinggi. Namun di Mapolres, polisi justru menolak pengaduannya, dengan alasan tak ada saksi. (a09)

Waspada/Iwan Has

BUPATI H. OK Arya Zulkarnain, SH, MM yang juga Cabup Batubara periode 2013-2018 untuk perseorangan (sedang mengangkat tangan), di tengah-tengah kerumunan warga yang menyambutnya.

Waspada/HM Husni Siregar

BUPATI Drs H. Amri Tambunan bersama Wabup H. Zainuddin Mars menerima beras”Sipir ni tondi” yang dijunjung sejumlah kaum ibu pada pembukaan pameran Hari Jadi Ke 67 Kab. Deliserdang di Lapangan Segitiga, L. Pakam.

Pameran Pembangunan Warnai Hari Jadi Ke 67 DS LUBUKPAKAM (Waspada): Momentum peringatan Hari Jadi Ke- 67 Kab. Deliserdang 1Juli2013dimeriahkandengansepekanpameran pembangunan menyebarluaskan informasi kepada masyarakat tentang hasil-hasil pembangunan yang sudah dicapai, dan rencana ke depan Pemkab Deliserdang termasuk memamerkan hasil industri kecil dan menengah dan produk unggulan buah-buahan. Pameran pembangunan yang diawali karnaval mobil hias dan barisan masyarakat dibuka Bupati Drs H. Amri Tambunan bersama Wabup H. Zainuddin Mars, ditandai penekanan sirene dan pelepasan balon oleh Ketua TP PKK Ny. Hj. Anita Amri Tambunan didampingi Ketua GOPTKI Ny. Hj. Asdiana Zainuddin Mars, Ketua KCK/Bhayangkara. Hadir Ketua DPRD Hj. Fatmawati Takrim, unsur Muspida, Sekdakab Drs H. Asrin Naim, MM, para Asisten, pimpinan SKPD dan lainnya, di Lapangan Segitiga Lubukpakam, Senin (1/7) sore. Bupati Amri Tambunan mengatakan momentum Hari Jadi Ke- 67 Deliserdang diharap menjadi pendorong semangat membangun dengan terus berupaya mencari dan menggali peluangyangadabagipeningkatankesejahteraan masyarakat, yang merupakan bagian dari visi

misi pembangunan Deliserdang. Seperti dipertunjukkan pada pameran pembangunan ini, berupa hasil kerajinan dan pengembangan potensi daerah akan menjadi pendidikan dan diharap berkembang di masyarakat, sekaligus menjadi motivasi bagi pengembangan potensi yang dimiliki daerah ini sehingga lebih baik ke depan. Bupati menegaskan, setiap keberhasilan yang diraih sudah pasti timbul tuntutan kebutuhan baru yang tentu kita harus terus bergerak membangun. Kita tidak boleh berhenti mengembangkannya, ini diyakiniakanbisaterwujudsepanjangadakemauan. KadisInfokomDrsNekenKetarenselakuPanitia penyelenggara menjelaskan, pameran sepekan (1-7 Juli 2013) diikuti instansi pemerintah BUMN/ BUMD serta organisasi profesi dan kemasyarakatan di samping perusahaan swasta mengisi 48 stand pameran dengan menitikberatkan hasilhasil pembangunan dalam bentuk industri, data, foto, grafik dan lainnya. Sebelumnyadilaksanakanpemberianbingkisan ke 11 Panti Asuhan, gerak jalan santai dan senam bersama, lomba kebersihan dan penghijauan kantorcamatdanSKPD,penanaman20.000batang bibitpohonpenghijauandanbuah-buahan,sidang paripurna DPRD dan syukuran.(a06)

6 Juli Simulasi KNIA Beroperasi KUALANAMU, Deliserdang (Waspada): Kabag Humas PT Angkasa Pura II Pusat Kristanto menegaskan, simulasi yang dijadwalkan digelar 6 Juli merupakan sinkronisasi antar stakeholder dan instansi yang terlibat dalam pengoperasian Kualanamu International Airport (KNIA). “Terjalinnya sinkronisasi antar pihak terkait, jelasakanmendukungkelancaransoftoperational Bandara Kualanamu 25 Juli mendatang yang sudah mengantongi kode resmi sebagai identitas penerbangan atau three letter city code, yakni KNOdankodetersebutdigunakansebagaipenanda posisi wilayah bandara,” jelas Kristanto kepada Waspada via telefon selular, Selasa (2/7) siang. Sehari sebelumnya, hal senada dan lebih rinci diungkapkan Kasi Humas dan Hukum Project Implementation Unit (PIU) PT Angkasa Pura II Kualanamu,Wisnu Budi Setianto.Wisnu menyebutkan simulasi sinkronisasi itu ada dua season, pertama dalam situasi normal dan tidak normal,baikkeberangkatanmaupunkedatangan. “Simulasi ini melibatkan semua stakeholder mulai dari Custom Imigration Quarantine (CIQ), yakni Bea dan Cukai, dan imigrasi, para airlines, ground handling, kepolisian/security, dan penumpang untuk tiga pesawat sekitar 600

penumpang,” sebut Wisnu. Menurut Wisnu, simulasi ini untuk mengevaluasi seluruh kekurangan sebagai bahan masukan untuk kesiapan utuh pada launching soft operational25Julimendatang.Wisnumenjabarkan secara sistematis simulasi dimulai diantaranya dari daerah persiapan sebelum fly over dan stasiun kereta api yang akan berjejer 5 bus, 20 taxi, 20 mobil, dan 40 sepedamotor. “Kemudian masuk chek in area, tenan, dan barcode hingga perencanaan/pengaturan, penempatan parkir pesawat/penggunaan avio bridge, arivval hall domestik, bagagge claim dan pengambilantrolley,informasikedatanganpesawat, lokasi counter taxi/bus dan parkir kendaran penjemputan dan lainnya, dan keberangkatan kereta api serta penjemputan dari stasiun KA ke Polonia,” sebut Wisnu sembari menambahkan simulasi dalam situasi tidak normal diantaranya situasi mulai dari kemacatan gate utama karena salah satu bus macat di gate tersebut, hingga accident lainnya. Secara terpisah lewat pesan singkat, Ketua Simulasi Pengoperasian KNIA Jamal Amir, Senin malam membenarkan pihaknya akan melakukan simulasi 6 Juli mendatang.(m16/m32)

UN Paket C Tahap II Disdik T. Tinggi Jadi Ajang Pungli TEBINGTINGGI (Waspada): Ujian Nasional Paket C (setara SMA) di Dinas Pendidikan Kota Tebingtinggi, diduga beraroma pungutan liar alias pungli. Selain itu, ada pusat kegiatan belajar masyarakat (PKBM) yang baru setahun berdiri bisa ikut UN. Bahkan, ada PKBM yang sudah ikut UN Paket C tahap I, bisa ikut UN tahap II. Pantauan Senin (1/7), pelaksanaan UN Paket C Dinas Pendidikan dilaksanakan di SMPN 9 Jalan Pusara Pejuang, pukul 13.00.Tahap II diikuti empat PKBM, yakni PKBM Cahaya dengan 87 peserta, PKBM Wira Bangsa 20 peserta, PKBM Diponegoro 52 peserta dan PKBM Bhakti 40 peserta. Total peserta 199 orang menempati 12 ruangan. Informasi diperoleh, PKBM ikut mengutip dana peserta UN Rp2 juta - Rp2,6 juta. Modusnya, dengan istilah biaya swadana, PKBM mengutip dana bertahap, yakni Rp1 juta untuk ikut UN dan Rp1,6 juta ketika lulus menerima ijazah Paket C. Pelaksanaan UN Paket C sendiri, sesuai informasi, selama ini dibiayai APBN. Selain itu, dua PKBM, yakni Cahaya danWira Bangsa mengikutkan siswanya pada UN Paket C tahap I. Tapi pada UN tahap II, kembali mengikutsertakan siswanya. Sedangkan PKBM Diponegoro dan Bhakti, merupakan PKBM yang baru berdiri pada 2013, tapi sudah bisa mengi-

kutkan siswanya UN tahun ini juga. Terkait itu, pengelola PKBM Diponegoro Bambang, membantah mengutip dana peserta UN Paket C. “Tidak ada, malah dari kantong saya sendiriyangkoyak,”kilah dia.Alasannya,mengurus UN Paket C karena banyak tetangga yang ikut. Namun membenarkan PKBM yang dikelolanya baru berdiri setahun. Salah seorang guru PKBM Cahaya, saat dikonfirmasi, membenarkan PKBM mereka ikut juga tahap II. “Tahap I kami tak lulus tiga orang,” ujar guru itu, disela-sela UN. Sementara menurut Disdik Provsu, seharusnya PKBM yang baru berdiri tidak bisa ikut UN. Lazimnya, harus tiga tahun kemudian. Demikian pula soal PKBM yang sudah ikut UN tahap I, seharusnya tidak bisa ikut tahap II. Bisa juga PKBM ikut, kalau peserta didik menerima pembelajaran dari kelas III. Itu pun disesuaikan data yang ada di Disdik setempat. “Jadi tak asal ikut.” Kadis Pendidikan Drs. H. Pardamean Siregar, MAP saat dikonfirmasi, mengatakan tidak tahu ada kebijakan bawahannya soal itu. Harusnya memang sesudah tiga tahun baru bisa ikut. “Nanti saya klarifikasi,” kata dia. Sedangkan salah seorang Kasi, mengatakan meski satu hari berdiri, PKBM bisa ikut UN.(a09)

Sumatera Utara

B2 Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu Lusia Damayanti (Jakarta).

Wartawan Kota Medan: Umum: H. Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Hj. Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa, Avli Yarman. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Arianda Tanjung, Dio Utama. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebingtinggi: Muhammad Idris, Abdul Khalik. Pematangsiantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Tarutung: Parlindungan Hutasoit. Sibolga/Tapanuli Tengah: Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan/Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies, H. Rusli Ismail, Arman Konadi. Aceh Besar: Iskandarsyah. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanafiah. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar, Dedek Juliadi. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Jasvira Sautisa. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan WASPADA dilengkapi dengan kartu pers. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada yang mengaku wartawan WASPADA tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 13.000,-, berwarna Rp. 36.000,Halaman depan: hitam-putih Rp. 39.000,-, berwarna Rp. 108.000,Ukuran kolom: 40,5 mm. E-mail Iklan: Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Kapolres Batubara Pimpin Apel Perdana LIMAPULUH (Waspada): 20 Orang anggota Polres Batubara yang baru terbentuk, menerima kenaikan pangkat dalam satu acara pelantikan yang dipimpin oleh Kapolres Persiapan Batubara, AKBP JP.Sinaga S.Ik, Sabtu (29/6) di halaman Mapolsek Limapuluh. Acara corp raport ini, selain diikuti oleh personel yang naik pangkat, juga dihadiri olehWaka Polres, seluruh Kabag, Kasat, Kapolsek, PNS, dan anggota Polri dan anggota Bhayangkari sejajaran Polres Persiapan Batubara. Dalam amanatnya, Kapolres Batubara mengajak anggota Polri dijajaran Polres Batubara untuk bahu membahu meningkatkan kerjasamauntukmemberikanrasaamanditengahtengahmasyarakat. “Upacara ini hendaknya tidak sekedar rutinitas, karena di dalamnya terkandung nilai nilai perjuangan, rasa kebanggaan dan keberhasilan dalam pelaksanaan tugas pengabdian kepada masyarakat, bangsa dan negara,” kata Sinaga. Dalam keterangannya kepada wartawan, Kapolres Batubara AKBP JP.Sinaga yang didampingi Kabag Sumda, Kompol H. Ritonga, menjelaskan bahwa 20 orang personel yang naik pangkat setingkat lebih tinggi adalah 2 orang dari AKP ke Kompol, 6 orang dari Iptu ke AKP, 5 orang dari Aipda ke Aiptu, 2 orang dari Bripka ke Aipda dan 5 orang dari Briptu ke Brigadir. Kabag Sumda Polres Batubara, Kompol H. Ritonga, yang juga salahseorangpersonelyangnaikpangkat,menjelaskanbahwapersonel Polres Batubara terdiri dari 340 orang yang untuk sementara menempati kantor eks kantor KPUD Batubara, di Jl. Perintis Kemerdekaan, Limapuluh. (c05)

Rabu 3 Juli 2013

Warga Unjukrasa Di PKS PT TTI Perlabian


Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: H. Halim Hasan. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Zulkifli Harahap. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Promosi: Edward Thahir (Koordinator). Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Sinur Manik (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi).


Waspada/Rahmad F Siregar

JANDA dan duda miskin di Desa Baganasahan Baru, Kec. Tanjungbalai, Kab. Asahan tak terdata sebagai penerima BLSM.

Keluarga Miskin, Janda Dan Duda Tak Dapat BLSM

BAGANASAHAN (Waspada): Sedikitnya 600 keluarga miskin di Baganasahan Pekan dan Baru, Kec. Tanjungbalai, Kab. Asahan tidak terdaftar sebagai penerima Bantuan Langsung Sementara Masyarakat (BLSM). Pengakuanwarga,pendataan tidak tepat sasaran, dan mereka tidakdidata,sehinggamemprotes pembagian bantuan dari kompensasi kenaikan BBM. Selain minta didata ulang, warga miskin itu berharap penyaluran BLSM di Asahan ditunda sampai ada perbaikandatayanglayakmenerima. Seperti Aken Sirait, 80, warga Dusun V, Desa Baganasahan Pekan. Pria yang ditinggal mati istrinyaini,jelastermasukkategori warga miskin. Pasalnya, selain hidupbersamaanaknyadirumah tumpangan, dia tak mampu lagi bekerja karena usia uzur dan sebagiantubuhnyayanglumpuh. Kemana-mana, dia harus dipapah dan terpaksa memanfaatkan tongkat. Stroke yang dideritanya sejak lama, hanya dibiarkan begitu saja tanpa perobatan. Bukannyatakinginsembuh,tapiAken tak punya biaya untuk berobat.

Bayangkan saja, jangankan BLSM, program Jamkesmas, bahkan Jamkesda yang ditampung di APBD Kab. Asahan, tak pernahdinikmatinya.“Darimana duit untuk berobat, makan saja susah. Jangankan ke rumah sakit, berobat kampung pun tak ada duitku,” ujar Aken. Anaknya, Atan Aken Sirait, 34, hanya seorang nelayan yang berpenghasilan di bawah ratarata. “Ikut kapal orang, hasilnya pun kadang tak cukup untuk makankami,”ujarAkenterbata-bata. Maka itu, dia berharap, BLSM disalurkan kepadanya. Selain untuk kebutuhan sehari-hari, program itu sangat membantu untuk biaya perobatannya. Hal sama dialami Rohani Gultom, 67, warga DusunV, Desa Baganasahan Baru. Janda miskin ini juga hidup menumpang bersama anaknya. Jika Aken berjalan

harusdipapahdanmenggunakan tongkat, maka Rohani masih bisa memanfaatkan kursi roda yang lusuh. “Kamisangatmembutuhkan setiap bantuan dari pemerintah seperti BLSM ini sebab hidup kamiserbakekurangantapinyatanya kami tidak terdaftar sehingga tidak termasuk penerima dana bantuan itu,” kata Rohani. Jika fisiknya tak seperti itu, Rohani mungkin tidak begitu ambil pusing kendati tak memperolehBLSM.“Jalansajatakbisa, apalagi bekerja. Aku hidup menumpang sama anak,” ujar Rohani. Kendati dapat jatah beras miskin tiap bulan, namun Rohani tak pernah terdaftar sebagai peserta Jamkesmas ataupun Jamkesda. “Nggak pernah didata, baik untuk BLSM maupun program jaminan kesehatan. Tolonglah sampaikan kepada bupati, kami yang miskin ini kenapa seperti diabaikan. Bantuan kesehatan tak dapat, BLSM pun diabaikan, mananyajanjibupatiituyangkatanya ingin mensejahterakan masyarakatnya,” ujar Rohani. (a14)

Penerima BLSM Pakai Sepedamotor Dan Emas TANJUNGBALAI (Waspada): Sejumlah penerima Bantuan Langsung Sementara Masyarakat (BLSM) datang ke Kantor Pos Tanjungbalai menggunakan sepedamotor dan emas di jari. Kejadian itu memicu keprihatinan sejumlah pihak, karena bantuan kompensasi kenaikan hargabahanbakarminyak(BBM) dinilai tidak tepat sasaran. Kalangan menilai, orang yang sudah memiliki sepeda motor dan emas di jarinya seharusnya tidak layak memperoleh bantuan tersebut. “Kalau punya kereta, paling tidak pendapatannya itu rata-rata di atas satu juta rupiah per bulan. Kalausudahdemikian,makayang bersangkutan tidak layak memperoleh BLSM karena tidak masuk kategori miskin,” kata aktivis LSM M Robby MA kepada Waspada, Selasa (2/7). Pemerintah, kata Robby, seharusnya melakukan pendataan yang akurat dan terkini, sebab jika hanyamengacupadadataduatahunlalu,tentuhasilnyatidaklengkap. Sementara, banyak masyarakat miskin yang sangat butuh tetapi tidak tersentuh bantuan.

KAMPUNGRAKYAT (Waspada): Puluhan warga Dusun Labuhan, Desa Tanjung Medan, Kec. Kampungrakyat, Kab. Labusel, Selasa (2/ 7) unjukrasa di PKS PT. Tolan Tiga Indonesia (PT TTI) Perlabian. Merekamenuntutperusahaanyangtergabung dalam Sipef Group itu bertanggungjawab atas pencemaranSungaiTanjungMedanyangmenyebabkanmatinyaribuanekorikandankotornyaairsungai. Pengamatan Waspada, tidak kurang dari 80an warga yang terdiri dari mamak-mamak dan anak-anak datang ke PKS menggunakan truk. Mereka berorasi di depan pintu masuk PKS sambil membawa baliho berisi kecaman terhadap perusahaan. Akibatnya, aktivitas loading-ram PKS perusahaan yang telah menerima sertifikat RSPO itu sempat terhenti selama beberapa jam. Salah seorang pengunjukrasa, Rifi Hamdani mengatakan, mereka kecewa kepada pihak PKS PT TTI Perlabian yang berupaya mengelak dari tanggungjawabdanbersikerasbahwaperusahaan itu tidak mencemari Sungai Tanjung Medan. Padahal, kata dia, telah diketahui bahwa Kamis malam (27/6) lalu terjadi kebocoran pipa limbah PKS dan pihak perusahaan dalam beberapa hari ini melakukan pencucian drainase yang airnya dialirkan ke sungai. “Akibat pencemaran sungai, sebanyak 150 kepala keluarga warga tidak dapat menggunakan air sungai untuk kegiatan mandi, cuci, dan kakus. Bahkan warga yang bekerja sebagai nelayan kini tidak dapat lagi mencari ikan, karena ribuan ekor ikan bermatian di sungai,” kata Rifi.

Depriana,pengunjukrasalainnyamengatakan, sampai kini belum jelas kompensasi dari PT TTI Perlabian terkait kerugian yang dialami warga. Menurutnya, air bersih yangdiberikanperusahaan kepada warga tidak mencukupi untuk kebutuhan sehari-hari. “Anak kami sudah tiga hari nggak mandi, karena sumur kering. Sungai yang biasa digunakan untuk MCK airnya hitam dan berbau. Kami minta perusahaan tidak lagi membuang limbah ke sungai,” katanya. Pada kesempatan itu warga mendesak perusahaan untuk segera mencuci sungai yang telah tercemar limbah, membangun sarana air bersih permanen di perkampungan, memberikan kompensasi terkait kerugian masyarakat, dan tidak mengalirkan air limbah ke sungai. Aksi itu akhirnya diterima oleh Mill Manager PT TTI Perlabian, Harapan Ginting. Dia mengatakan, pihaknya sudah berupayasedapatmungkin mendistribusikan air bersih kepada warga. Sementara mengenai kompensasi lainnya akan disampaikannya ke pihak manajemen. “Truk tangki kami terbatas, meski begitu kita sudah distribusikan air bersih. Mengenai solusi lain masih kita bahas,” katanya. Hinggaberitainidilansirwargamasihbertahan di areal PT. TTI Perlabian menunggu kepastian dilakukannya pencucian sungai yang telah tercemar. Sementara itu pihak PT. TTI Perlabian masih mencari solusi sumber air untuk pencucian sungai tersebut. “Kita masih menunggu solusi terhadap sungai yang kini tidak dapat digunakan warga,” kata Rifi. (c18)

Waspada/Deni Syafrizal Daulay

MILL Manager PT. Tolan Tiga Indonesia (PT. TTI) Perlabian, Harapan Ginting memberikan penjelasan terhadap puluhan warga Dusun Labuhan, Desa Tanjung Medan, Kec. Kampungrakyat, Kab. Labusel, yang berunjukrasa di PKS PT. TTI Perlabian.

Warga Puri Minimalis Akan Laporkan Pengembang

Waspada/Rasudin Sihotang

SEORANG ibu penerima BLSM mengambil sepedamotornya yang diparkir di pintu masuk lokasi pencairan kompensasi BBM tersebut. “Contohnya di Teluknibung di mana keadilan di negeri ini,” ada dua janda miskinYusmaini, pungkas Robby. Sementara, masyarakat lain31danSitiKhadijah,56,yangsetiap hari banting-tulang menghidupi nyajugaprihatinmelihatkejadian tiga anaknya, mereka tak mem- di Kantor Pos tersebut. Dia meperolehBLSM.Tapimengapaibu- ngaku tak habis fikir banyak maibu dengan gaya berpakaian syarakat Kota Tanjungbalai yang fashionable dan punya sepeda- pura-pura miskin dan tega memotor malah mendapat BLSM, nerima hak orang lain. (a32)

AEKKANOPAN (Waspada):Warga perumahan Puri Minimalis Rantau Bangun. Desa Damuli Pekan, Kec. Kualuhselatan Kab. Labuhanbatu Utara akan melaporkan ke pihak berwajib PT Aresco Dharma selaku develover perumahan tersebut. Mereka merasa ditipu, karena sudah sembilan bulan menempati rumah itu, namun meteran listrik belum juga terpasang. “Kami warga di sini sudah sepakat akan melaporkan pihak pengembang (PT Aresco Dharma) ke pihak berwajib apabila dalam bulan ini meteran listrik belum juga terpasang di rumah kami,” kata Hermanto Saragih, warga perumahan Puri Minimalis kepada Waspada, Minggu (30/6). Dikatakannya, selama ini mereka hanya mendapatkan aliran listrik melalui tiang PLN langsung tanpa menggunakan meteran, yang dinilai sangat membahayakan keselamatan mereka. Selain itu, apabila terjadi konsleting arus pendek listrik akan dapat merusak barang barang elektronik dan lainnya. “Sayasudahduakalimenggantimesinpompa air akibat rusak dan hampir tiap bulan mengganti bola lampu akibat putus, karena arus listrik tidak stabil. Kami sudah berulang kali melaporkannya ke pihak pengembang namun mereka hanya

berjanji dan terus berjanji,” ucap Hermanto kesal. Hal senada dikatakanJohan,wargayangsama. Menurutnya hak mereka selaku konsumen sudah dikangkangi oleh developer, karena pada surat serah terima rumah yang di tandatangani oleh Jeptha T Gultom selaku pimpro dan Boy Alexander selaku kepala bagian teknik, tertuang fasilitas termasuk meteran listrik 900 wat, apabila rumah itu sudah ditempati. Sementara pihak PT Aresco Dharma Boy Alexander selaku kepala bagian teknik saat dikonfirmasi melalui telepon selularnya tidak menjawab dan saat di SMS juga tidak ada jawaban. Sedangkan Kepala PLN Aekkanopan Rajo Nasution menyebutkan, pihak perumahan Puri Minimalis Rantau Bangun Damuli Pekan telah mendaftarkan untuk pemasangan meteran listrik, namun belum bisa terealisasi karena gardu induk di Aekkanopan masih dalam pembangunan. “Pihak depelover membayar Rp5.750.000 per 15hariuntukmendapatkan7.000watuntukkeperluan proyek dan 7000 wat. Itu lah yang dibagikan ke 150 rumah di komplek perumahan itu. Namun kita tidak bertanggungjawab tentang keselamatan mereka, karena telah menyambung langsung kabel dari tiang listrik,” ujarnya. (c08)

Jawaban Bupati Asahan Dinilai Belum Memuaskan KISARAN (Waspada): Jawaban Bupati Asahan atas pandangan umum Fraksi DPRD, terhadap Laporan Pertanggungjawaban Pelaksanaan APBD 2012 dalam sidang paripurna, dinilai belum memuaskan, dan masih adayangkurangjelasdanberbeda dengan kenyataan di lapangan, Selasa (2/7). Seperti diungkapkan dari Fraksi PAN, Abdul Kholik Harahap, bahwa fraksi menanyakan tentang pendataan penerima BLSM, yang kini masih dalam masalah, karena banyak masyarakat yang layak tidak mendapat. Namun Bupati belum ada menjelaskan tentang hal itu. “Masih banyak yang kurang jelas, oleh sebab itu Bupati sebaiknyamemberipenjelasanterperinci seusai dengan dengan tanggapan fraksi di DPRD, sehingga mudah dimengerti,” jelas Kholik. Sementara dari Fraksi Nurani Keadilan, Syamsul Qodri Marpaung, mengatakan, bahwa jawaban Bupati di sektor pendidikan,terkaitdenganpenggunaan dana BOS pembelian angklung (alatmusik-red)yangdinilaiboleh. Itu masih rancu, karena dalam kenyataannyasekolahtidakdiberi kebebasan dalam menggunakan Dana BOS, namun mereka di-

paksamembeliangklung,padahal pelatih angklung belum ada di semua sekolah. “Ada perbedaan persepsi, karena di lapangan Sekolah dipaksa beli angklung. Sehingga mereka tidak bebas menggunakan Dana BOS, dan hal ini harus dikaji ulang,” jelas Syamsul. Sementara, jawaban Bupati Asahan atas pandangan umum Fraksi DPRD, terhadap laporan pertanggungjawaban pelaksa-

naan APBD 2012 yang dibacakan Wakil Bupati Asahan Surya, berdasrakan perhitungan Waspada, anggota DPRD hanya tersisa 22 orang yang mendengarkan. Dalam pidatonya Bupati membahas tentang Pengelolaan PendapatanDaerah,Pengelolaan aset, Piutang, Dana Bergulir, Kesehatan, Penata Ruang, Pendidikan dan Iman danTaqwa, hal itu terkait pandangan dari Fraksi DPRD Asahan. (a15)

Waspada/Nurkarim Nehe

PENGURUS ONIM (Orahua Nias Muslim) Asahan-Tanjungbalai-Batubara dan sejumlah jamaah usai melaksanakan pengajian bulanan sekaligus tausiah menyambut Ramadhan di Desa Sijabut Teratai, Kec. Airbatu, Asahan.

Memaknai Puasa Di Bulan Ramadhan


RAPAT Paripurna Jawaban Bupati Asahan atas pandangan umum Fraksi DPRD, terhadap Laporan Pertanggungjawaban Pelaksanaan APBD 2012, kursi di DPRD Asahan banyak kosong, karena anggota dewan ada yang tidak hadir.

AIRBATU(Waspada):Memaknaipuasasangat penting agar pelaksanaan ibadah dalam bulan Ramadhan mencapai sasaran meningkatkan kualitas keimanan dan ketaqwaan. Al Ustadz Sukidi SPd mengungkapkan hal itudidepanjamaahpengajianOrahuaNiasMuslim Asahan-Tanjungbalai-Batubara di Desa Sijabut Teratai, Kec. Airbatu, Asahan, Minggu (30/6). “Memahami makna puasa membuat kita tidak merasa terbebani dalam menyambut dan melaksanakan ibadah Ramadhan,” tukas Sukidi. Pengajian bulanan di kediaman Ketua ONIM Drs. H. A. Telaumbanua MPd, dihadiri dewan penasehat Salman Daely SH, Kapten Inf Atalu’o Zebua, Drs. M. Akhir Zebua, dan Safrin Zebua ini, juga mendefenitifkan jabatan Sekretaris ONIM

kepada Siddiq Daely dan beberapa jabatan lainnya hasil resufle. Sukidi berlogika bahwa selama bulan Ramadhan beban biaya hidup berkurang karena jadwal makan siang ditiadakan, namun untuk sementara orang justru memasuki bulan Ramadhan beban bertambah. “Salah satu ciri puasadibulanRamadhanyangidealadalahaktivitas berjalan seperti biasanya dalam melaksanakan ibadah Ramadhan,” ujarnya. Kapten Inf Atalu’o Zebua dari Dewan Penasehat ONIM dalam sambutannya mengingatkan organisasi kekeluargaan dan keagamaan yang didirikan 2 Juni 2012 ini harus berpegang teguh dengan tujuan ONIM mempererat silaturahami dalam mencapai ukhuwah Islamiyah. (a10)

WASPADA Rabu 3 Juli 2013

Sumatera Utara


Penerima BLSM Di Palas Banyak Keluarga Kades SIBUHUAN (Waspada): Pembagian Bantuan Langsung Sementara Masyarakat (BLSM) yang segera diberikan kepada warga miskin sebagai kompensasi kenaikan harga BBM di Padanglawas (Palas), amburadul. Banyak kroni dan keluarga perangkat desa dan kepala desa masuk dalam daftar penerima BLSM.

Ketua KPU Paluta Minta OKP Dan Ormas Independen GUNUNGTUA (Waspada): Ketua KPU Paluta M Ali Ansor menegaskan kepada OKP dan Ormas untuk bersikap independen, jangan sampai terlibat mengarah kepada salah satu kandidat. soalnya rawan mengganggu kondusifitas dan Pemilukada yang tidak jujur dan adil. Pernyataan itu disampaikannya saat sosialisasi Pilkada diselenggarakanKPUPalutadenganmerangkulOrganisasiMasyarakat (Ormas) dan Organisasi Kepemudaan (OKP) di wilayah Paluta, diselenggarakandiaulaYPIPL,Kel.PasarGunungtua,Kec.Padangbolak, baru-baru ini. Dikatakan, pihaknya berharap dan mengajak OKP, dan ormas ikut mensukseskan pelaksanaaan pemilukada nanti, sehingga berjalan lancar, aman dan tertib. Ketua Panitia H Sahabuddin Siregar di sela-sela acara kepada Waspada mengungkapkan, sosialisasi dengan merangkul sejumlah OKP dan Ormas adalah salahsatu upaya KPU mensosialisasikan penyelenggaraan pesta demokrasi 14 Agustus 2013. Dengan merangkul komunitas di sejumlah OKP dan Ormas ini, diharapkan sosialisasi bisa terarah dan tepat sasaran. “Sesuai dengan tema kegiatan ini, jadilah pemilih yang cerdas dalam pilkada nanti,” ujarnya. (a35)

Kapolres Madina Diminta Tindak Tegas Perusak Hutan PANYABUNGAN (Waspada): Kapolres Madina yang baru, AKBP.Mardiaz Kusin Dwihananto,S.Ik diminta tegas menangkap dan memproses para pelaku perusakan lingkungan dan juga kawasan hutan di Madina. DemikiandisampaikanaktivispemerhatilingkunganhidupMadina, Parwis Nasution kepada Waspada di Panyabungan, Selasa (2/7). Parwis Nasution berharap para pelaku yang sudah melanggar undangundang demi kepentingan pribadi atau kelompok, supaya diproses secara hukum dan dipenjara bila terbukti melakukan pelanggaran terhadap pengelolaan sumber daya alam. Menurutnya, banyak persoalan dan keresahan yang dialami masyarakat akibat ulang pribadi maupun kelompok terutama dalam masalah illegal mining dan perambahan hutan yang tidak hanya merusak lingkungan, tapi juga telah mengakibatkan bencana alam yang menelan korban jiwa. Dijelaskannya, perusakan lingkungan khusus kawasan hutan hingga saat ini masih marak terjadi, dan banyak pengusaha yang mengeksploitasi hutan dan melakukan kerusakan demi keuntungan pribadi. Sementara tindakan itu sudah jelas akan menyebabkan bencana. “Jangan biarkan perusakan lingkungan dan kawasan hutan terus terjadi, karena ini sudah meresahkan masyarakat luas. Ini menjadi PR dan tugas yang seharusnya menjadi prioritas bagi Kapolres yang baru,” ucap Parwis. Khusus di bidang illegal mining, Parwis juga meminta Kapolres Madina supaya mewanti-wanti keberadaan penduduk pendatang diduga dari Pulau Jawa yang terlibat dalam kegiatan tambang rakyat diberbagaiwilayahMadina.Karena,statusdanidentitasparapendatang tersebut tidak diketahui. Status dan keberadaan para pendatang itu harus diperjelas dan dipertegas untuk antisipasi Kamtibmas di Madina. (c14)

Caleg PKB Madina Tandatangani Pakta Integritas PANYABUNGAN (Waspada): Para calon legislatif Partai Kebangkitan Bangsa (PKB) untuk DPRD Kabupaten Mandailing Natal (Madina) menandatangani pakta integritas agar tetap komit pada partai dan rakyat Madina. Kegiatan ini dilaksanakan di aula hotel Rindang, Kel. Dalan Lidang, Panyabungan, baru-baru ini. Acara penandatanaganan sekaligus silaturrahmi itu diselenggarakan Lembaga Pemenangan Pemilu ( LPP ) PKB Madina. Selain komit pada partai dan rakyat, dengan adanya pakta integritas tersebut, para calon legislatif PKB Madina diharapkan harus lebih dekat dengan kalangan ulama, pesantren serta guru mengaji. Ketua LPP PKB Madina H Darwis Bilah mengungkapkan silaturahmi dan penandatanganan pakta integritas ini sangat penting bagi PKB Madina. Selain berarti secara internal, juga merupakan penegasan tekad bagi setiap caleg untuk mengedepankan kepentingan partai dan kepentingan rakyat Madina. Ketua DPC PKB Madina Khoiruddin Faslah Siregar, menyebutkan setiapkaderPKB Madina harus berani pasangtarget rasional. “Menjadi pimpinan DPRD dan Bupati adalah obsesi masuk akal,” ujarnya. (a28)

Irwansyah Lubis Menjadi Anggota DPRD Madina PANYABUNGAN (Waspada): M. Irwansyah Lubis, SH, peserta pemilu legislatif 2009 dari Partai Persatuan Pembangunan (PPP) Kab. Mandailing Natal, dilantik menjadi anggota DPRD Madina Pengganti Antar Waktu (PAW), menggantikan H. Ahmad Huzein Nasution yang resmi mundur melepaskan status keanggotaan legislatifnya dari PPP karena pindah ke Partai Golkar. Pelaksanaan pergantian anggota itu dilakukan melalui rapat paripurna khusus yang dipimpin wakil ketua DPRD Madina Syafaruddin Ansyari Nasution, dan dihadiri 17 dari 40 anggota dewan, Sekdakab M. Daud Batubara, Kapolres AKBP Mardiaz Kusin Dwihananto, Kajari Panyabungan Satimin, SH, Ketua Pengadilan NegeriWendra Rais, SH, pimpinan SKPD serta undangan terkait lainnya, Rabu (26/6). Wakil ketua DPRD Madina Syafaruddin Ansyari Nasution dalam kesempatan itu berharap agar Irwansyah yang baru saja dilantik dapat bergabung untuk mengemban tugas sebagai wakil rakyat, kemudian ke depannya dapat memberikan kontribusi bagi negara dan daerah. Sekdakab Madina M. Daud Batubara dalam sambutannya mengatakan, selamat bergabung dalam tim pemerintah, jika selama ini masih pribadi akan tetapi untuk sekarang selama 24 jam sudah menjadi milik masyarakat. Ketua DPC PPP Madina H. Dahler Nasution kepada wartawan mengungkapkan, Irwansyah Lubis merupakan salahsatu kader terbaik partai, sehingga diharapkan mampu mengemban tugas legislatif secara baik. (a28)

Disdik P. Sidimpuan Monitor Awal Belajar P. SIDIMPUAN (Waspada): Mulai 1 Juli 2013, seluruh SD, SMP, SMA, dan SMK negeri dan swasta se-Kota Padangsidimpuan masuk sekolah. Demikian dikatakan Kadis Pendidikan (Kadisdik) Kota Padangsidimpuan, Drs H Abdul Rosad Lubis. Dia beserta jajarannya akan menggelar peninjauan ke sekolah sejak awal pekan depan untuk memonitor jalannya pelaksanaan upacara dan belajar di 80 sekolah negeri dan swasta di seluruh Kota Padangsidimpuan. “Monitoringnantinyadilakukanuntukmemantaudanmengawasi berbagai kendala yang diperkirakan ditemui sekolah,” ucap H Abdul Rosad kepada Waspada, Kamis (27/6) di ruang kantornya, Palopat Pijorkoling. Kadis menambahkan, sudah membuat jadwal monitoring awal belajarsesuaisurattugaskepadapejabatDisdikkotaPadangsidimpuan. “Setiap hari pihak dinas datang ke sekolah-sekolah negeri dan swasta di Kota Padangsidimpuan melihat proses awal belajar,” ujarnya. (c13)

Penerimatidaktepatsasaran, pensiunan, sekdes yang sudah PNS hinggapenerimayangsudah meninggal dunia. Pemkab Palas melalui Kabag Ekonomi Bustanul Fauji mengatakan,Pemkabtidakmemilikidata penerima.“Hinggakini,informasi siapa saja yang menerima BLSM belum kita terima dari Badan Pusat Statistik (BPS) Palas,” ujar Kabag Ekonomi Sekretariat KantorBupatiPalasBustanulFauji di Sibuhuan, Senin (1/7).

Dikatakan,Pemkabtidakbisa mengambil sikap terkait adanya penerimayangtidaktepatsasaran maupun yang sudah meninggal yang turut terdaftar. Katanya, Pemkab juga tidak tahu data statistik tahun berapa yang dipakai. Plt Sekda Drs H Irfan Soaduon Hasibuan nembenarkan hal tersebut. Dia mengatakan, BPS tidak berkordinasi dengan pihakkecamatansaatpendataan, sehinggaparacamatdiPalastidak mengetahui data penerima

BLSM tersebut. Sementara mengenai keamburadulan data penerima BLSM, Sekda menduga adanya rekayasa dalam pendataan, hal ini terlihat dengan banyaknya kroni dan keluarga perangakat desa dan kepala desa(Kades)masukdalam daftar penerima. Kepala Badan Pusat Statistik Padanglawastidakberadadikatornyasaatdijumpai.Menurutstafnya, yangbersangkutansedangberada diMedanhinggaRabu(3/7).(a34)

BATANGTORU (Waspada): DuaribuanwargamuslimdiKab. Tapanuli Selatan larut dalam tausiyah dan zikir akbar dipimpin ustadz kondang dari Jakarta, Zacky Mirza, di Lapangan PTPN III Kebun Batangtoru, Senin (1/7). Dalam tausiyahnya, Ustadz Zacky Mirja mengajak seluruh kaum muslimin untuk lebih meningkatkan keimanan, ketakwaan, dan rasa syukur kepada Allah SWT. Karena apa yang kita rasakan saat ini merupakan pemberian-Nya. “Allah ciptakan manusia sebagai mahluk paling sempurna di bumi ini. Menciptakan segala sesuatu untuk memenuhi kebutuhan kita, dan tidak pernah minta bayar atas semua itu. Sungguh naif jika kita tidak mensyukuri nikmat ini, maka

jauhilah larangan Allah dan kerjakan perintah-ya,” pesan Ustadz Zacky. Disebutkannya, Rasulullah saja meski sudah dijamin masuk surga, ritme ibadahnya tetap tinggi. Bahkan kaki Rasullah pernah bengkak akibat seringnya menjalankan shalat sunat. “Kita, kakimemangbengkaktapibukan karena shalat dan melainkan karena asam urat,” ujarnya. Selain itu Ustadz Zacky juga mengingatkanjamaahyanghadir tentang kematian, karena semua manusia di dunia pasti akan mengalaminya. Kapan waktunya akan tiba, tidak satupun yang tahu. Tausyiah dan zikir akbar dipimpin Ustadz Zacky Mirza ini diikuti Bupati Tapsel, H. Syahrul M Pasaribu,WabupTapsel, Aldinz

Rapolo Siregar, anggota Forum Komunikasi Pimpinan Daerah (FKPD), managemen PTPN III dan PT Agincourt Resources, puluhankelompokpengajiandan wirid se Kec. Batangtoru dan Muara Batangtoru. Bupati Tapsel H. Syahrul M Pasaribu menyambut baik kegiatan digelar dalam rangka memperingati Israk Mikraj Nabi Muhamad SAWdan penyambutan bulan suci Ramadhan ini. “Semoga kegiatan ini bermanfaat bagi kita semua dalam menjalani kehidupansehari-hari,”kataSyahrul. Ketua MUI Batangtoru, Bachtiar Siregar mengharapkan kegiatan ini menjadi sugesti dan pendorong bagi kita dalam meningkatkan ukhuwah Islamiyah dan ketakwaan kepada Allah SWT. (a27)

Waspada/Sukri Falah Harahap

BUPATI Tapsel Syahrul M Pasaribu melantik sekaligus mengukuhkan kepengurusan LKMM periode 2013-2015.

Bupati Tapsel: PT AR Ribuan Warga Tapsel Zikir Akbar Jangan Tenang-tenang Saja Bersama Ustadz Zacky Mirza BATANGTORU (Waspada): Bupati Tapanuli Selatan Syahrul M Pasaribu mengingatkan manajemen PT Agincourt Resources (AR) jangan justru merasa tenang-tenang saja karena sudah dikukuhkan dan dilantik pengurus Lembaga Konsultasi Masyarakat Martabe (LKMM) periode 2013-2015. “Terus bekerja keras, komunikasi dengan masyarakat sekitar, berikan informasi yang seterang-terangnya tentang aktivitas Anda di perusahaan ini,” tegas bupati saat pengukuhan lembaga ini di areal Tambang Emas Martabe Batangtoru, baru-baru ini. Lembaga ini berfungsi untuk menjembatan komunikasi dua arah antara PT AR dengan masyarakat 15 desa/kelurahan lingkar tambang di Kec. Batangtoru dan Muara Batangtoru. “LKMM dibentuk dari, untuk, dan oleh rakyat 15 desa kelurahan di Kec, Batangtoru dan Muara Batangtoru. Lembaga ini berfungsi menjembatani komunikasi dua arah anatra masyarakat dengan pihak perusahaan,” kata Syahrul dalam sambutannya. Hadir Wakil Bupati Tapsel Aldinz Rapolo

Siregar, Kapolres Tapsel AKBP Abdu Rizal A Engahu SIK.MSi, Dandim 0212/TS, Letkol Inf AT Crhis Hardjoko, Kajari Nadda Lubis SH.MH, Ketua PN Syahlan, SH, MH, Dansu POM Letu CPM Tari, Ketua PA, mewakili Danyon 123/RW dan lainnya. Presiden Direktur PT AR, Peter Albert, didampingiDeputyPresdir,LindaSiahaan,anggota Dewan Direksi, Washington Tambunan, Senior Manager Corporate Communications, Katarina Siburian Hardono, menyatakan pembentukan LKMM merupakan hasil inisasi mereka untuk menggantikan MC3. PengurusLKMM2013-2015, Ray Hidayah Batubara (ketua), Rahmad Efendy Harahap(wakilketua),SulaimanPasaribu(sekretrais), H. AbdulWahab (wakil sekretrais), dan ditambah 17 orang anggota. Pengurus dan anggota LKMM ini berasal dari 15 desa dan kelurahan di wilayah Kec. Batangtoru dan Muara Batang-toru.Yakni,Wek I,Wek II,Wek III, Wek IV, Aek Pining, Napa, Telo, Hapesong Baru, Sipenggeng, Sumuran, Perkebunan Batangtoru, Bandar Hapinis, Batu Hula, Hutaraja, dan Muara Hutaraja. (a27)

Pengurus PGRI Sibolga Ikuti Kongres Besar

FPG DPRD Madina Investigasi Bagi-bagi Proyek Dinas PU

SIBOLGA (Waspada): 10 Pengurus PGRI (Persatuan Guru Republik Indonesia) berangkat untuk mengikuti Kongres Besar PGRI yang akan digelar mulai tanggal 1 hingga 5 Juli di Gelora Bung Karno Jakarta. Pengurus PGRI Kota Sibolga diharap mampu mengikuti se-

PANYABUNGAN(Waspada): Informasi bagibagi proyek di Dinas Pekerjaan Umum (PU) Madina menyeruak ke mana-mana.Wakil rakyat di DPRD Madina pun angkat bicara, bahkan Fraksi PartaiGolkar(FPG)PlusDPRDMadinadikabarkan sedang melakukan serangkaian investigasi. JurubicaraFraksiGolkarPlusArsidinBatubara, SE mendesak Dinas PU segera memberikan penjelasan terkait paket proyek penunjukan langsung (PL). “Harus ada penjelasan terkait paket PL yang telah dibagi-bagikan. Di ujung pelosok sana ada persoalan kehidupan masyarakat yang butuh segera dituntaskan dan memanggil-manggil kita,” ujarnya saat menyampaikan pandangan fraksi, baru-baru ini. Mengenai bagi-bagi proyek di Dinas PU Madina, Fraksi Golkar Plus berharap kepada pemerintah memberikan penjelasan dengan pendekatan hukum dan urgentitas yang ada. Ditegaskan, Fraksi Golkar akan terus

jumlahagendapentingyangakan dilaksanakan pada perhelatan diikuti 12 ribuan para guru se Indonesia itu. Demikian dikatakan Ketua PGRI kota Sibolga Drs H NurdiswarJambakMScpadaacararapat persiapan keberangkatan yang digelar di salahsatu retoran di kota

Sibolga Jumat (28/6) sore. Hadir pada pertemuan tersebut para Pengurus PGRI kota Sibolga di antaranya para Wakil Ketua M. Yazid SPd MAP, Hotmarimba Siregar SPd MAP dan sejumlah pengurus lainnya. Kongres Besar PGRI dijadwalkan dibuka Presiden RI. (cpol)

PKS Padanglawas Siap Menangkan TSO-Jarnawi SIBUHUAN (Waspada): Dewan Pimpinan Daerah (DPD) Partai Keadilan Sejahtera (PKS) Kab. Padanglawas siap berjuang untuk pemenangan pasangan calon Bupati dan wakil Bupati H. Ali Sutan Harahap dan drg. H. Ahmad Jarnawi Pasaribu CHt dalam pemilihan umum kepala daerah (Pemilukada) periode 2014-2019 yang akan diselenggarakan 11 September2013. Ketua DPD PKS kabupaten Padanglawas Ustadz H. Puli Parisan Lubis, LC, Senin (1/7) kepadaWaspadamenyampaikan, seluruh kader PKS, baik di tingkat DPD hingga ke tingkat ranting masihmengharapkankepemimpinan TSO bisa berlanjut lima tahun ke depan. Maka, lanjut dia, DPD PKS akanterusmelakukankonsolidasi dengan seluruh kader partai,

termasuk di tingkat kabupaten, kecamatan maupun tingkat ranting di desa. “Hal ini kita lakukan untuk memastikan para kader partai tetap solid untuk memberi dukungan terhadap pasangan TSO-Jarnawi.” Apalagi, lanjut dia, PKS merupakan salahsatu partai pengusung, selain Partai Golkar dan Partai Patriot Pancasila untuk pasanganTSO-JarnawiatauSutan Oloan Bersama Ahmad Jarnawi (SOBAR) akan bersama-sama dalam tim untuk pemenangan pasangan SOBAR. KataustadPuli,sekalipunPKS tidak memiliki kursi dan perwakilan di lembaga DPRD Kab. Padanglawas, tetapi dengan soliditas kader partai akan dapat menjalankan mesin partai untuk mendorong simpatisan dalam memperjuangkan pemenangan

TSO-Jarnawi. Bahkan periode sebelumnya juga PKS bersama Partai Golkar telah berhasil dengan baik memperjuangkan pemenangan pasangan Basyrah-TSO sebagai Bupati danWakil Bupati Padanglawas periode 2009 2014. “Maka hal yang sama juga diharap akan bisa diperjungkan dalam pesta demokrasi Kabupaten Padanglawas 11 september ini,” katanya. Terlebih lagi, lanjut dia, kali ini tidak hanya mendapat dukungan dari Partai Golkar dan PKS, tetapi juga Partai Patriot Pancasila, sekaligus mendapat mendukungan penuh dari sejumlah organisasi kemasyarakatan, termasuk Laskar Merah Putih, KNPI, OKP seperti IPK, Pemuda Pancasila, dan Pemuda Panca Marga. (a33)

Aktivis Padanglawas Siap Menangkan Rahmad-Andri MEDAN (Waspada): Sejumlah aktivis mahasiswa dan aktivis lembaga di Medan berasal dari Padanglawas(Palas)menyatakan siap bergerak ke Palas untuk memenangkan Drs H Rahmad P Hasibuan-H Andri Ismail Putra Nasution, SE menjadi Bupati dan Wakil Bupati Palas periode 20142019. “Terus terang, RahmadAndri adalah pemimpin yang dirindukan banyak warga Padanglawas saat ini. Dengan adikadik mahasiswa dan masyarakat lainnya, kita akan bergerak ke lapangan untuk memenangkan pemimpinmasadepanPalasini,” ujar Kamil Lubis, tokoh pemuda Padanglawas yang juga Wakil Sekretaris KNPI Medan kepada Waspada di Medan, kemarin. Dia melihat, sosok Rahmad PHasibuanyangpernahmalangmelintang di dunia birokrasi,

politikus yang memiliki akses ke mana-mana, berjiwa kerakyatan yang sangat kental, sangat pas dipadukan dengan Andri Ismail Putra Nasution yang merupakan pengusaha berdedikasitinggidan anakmantanBupatiTapselRasyid Nasution (Allah Yarhamhu). “Kami melihat, Bang Haji Rahmad adalah tokoh Sumatera Utara multitalenta. Beliau berpengalaman di pemerintahan, pernah juga menjabat sebagai Ketua Fraksi Demokrat di DPRD Sumut. Dari pejalanan Bang Rahmat ini, di samping dua hal ini, juga relasi, koneksi dan jaringan beliau untuk membangun Padanglawas, saya pikir akan menjadi kekuatan luar biasa jika diberdayakan untuk memajukan Padanglawas,” ujar Kamil Lubis. Karena, lanjut dia, untuk mengejar ketertinggalan Padanglawas, tidak cukup dengan meng-

gali potensi sumber daya alam Padanglawas semata, juga harus ditopang dengan aliran dana dari pemerintah pusat, pemerintah provinsi dan peran investor. Dia berharap, Rahmat P Hasibuan bisa memanfaatkan koneksi dan jaringan yang dia punya untuk memajukan Padanglawas. Dikatakan, harus dilakukan gerak cepat melalui konsep yang jelas untuk mengejar ketertinggalan Padanglawas. Karena, Padanglawas diinginkan menjadi daerah maju dengan masyarakatnya yang lebih sejahtera dan religius. “Kita tidak berharap Palas hanya dibangun sebatas mengandalkanPAD.Tapibisamembuka link keluar. Saya percaya Bang Rahmat mampu melakukan ini, karena kita tahu dia memang sangat pandai berkawan,” kata Kamil Lubis. (ihn)


CALON Bupati dan calon Wakil Bupati Padanglawas Drs H Rahmad P Hasibuan-H Andri Ismail Putra Nasution, SE ketika diantar warga mendaftar di KPU Palas, beberapa waktu lalu.

menginvestigasi persoalan paket proyek PL yang di kelola Dinas PU dengan hipotesa konkrit bahwa kebijakan tersebut diambil bukan karena desakan pihak yang sudah terlanjur ikut berpartisipasi secarafinansialdarisebuahsistemyangdinilaikorup. KetuaInvestigasiLSMReaksiMadinaM.Saima Putra mengutarakan, Komisi 3 DPRD Madina dan aparat penegak hukum diminta jangan diam saja terkait pembagian paket proyek PL dibakarkansenilaiRp20miliar,karenaadainformasi bagi-bagi proyek tersebut telah ‘dikondisikan’. “Kita melihat banyak indikasi kejanggalan dalam pembagian paket, sebab informasi diperoleh di lapangan, pembagian paket tersebut tidak mempunyai kriteria siapa yang berhak mendapatkannya,” ujar M.Saima Putra. Ketua LSM. Merpati Putih Tabagsel Khoirunnisyah kepada wartawan via selular, mengaku telah mendapat informasi, yang membagi-bagi paketproyekadalahoknumyang pernahdiperiksa KPK di Kejatisu beberapa waktu lalu. (ihn)

MPC PP Siap Kawal Pemilukada Palas SIBUHUAN (Waspada): Majelis Pimpinan Cabang (MPC) Pemuda Pancasila (PP) siap mengawal pelaksanaan pemilukada Kab. Padanglawas (Palas), kata Afner Azis Ketua MPC PP Palas terpilih untuk periode 2013-2015. Kata Afner Azis Siregar, ia siap mengemban amanah ketua MPC PP Palas hingga akhir periodesiasi organisasi tahun 2015 mendatang, sekaligus membesarkan PP hingga ke tingkat basis ranting. Selain tetap solid mendukung dan memenangkan Ketua H Ali Sutan Harahap (TSO) selaku ketua majelis Pertimbangan Organisasi (MPO)dalampemilukadaPalasmendatang,untuk itu ditekankan agar tidak ada kader PP yang menyimpang dan menyalahi aturan organisasi. HalitusesuaiintruksiMajelisPimpinanWilayah (MPW) PP agar tetap memberi dukungan dan memenangkanKetuaMPOPPPalas,H.TSOdalam pemilukada Padanglawas yang pelaksanaannya tinggal beberapa bulan lagi. Maka seiring pelantikan MPC PP kabupaten

Padanglawas oleh ketua MPW PP Sumut Anuarsyah alias Aweng, Sabtu (29/6) di lapangan Merdeka Sibuhuan, ia menyampaikan apresiasi kepada Ketua MPO PP Padanglawas H. Ali Sutan Harahap selaku kader PP telah mampu bersaing dan berkompetisi dalam memperebutkan kursi Bupati Padanglawas. Ketua MPW Sumut, Aweng juga menyampaikan agar seluruh kader PP harus turut berjuang mendukung pemenanganan H. TSO, sekaligus mengawal pelaksanaan pemilukada. Jika perlu, kader PP ditugaskan di setiap TPS dengan seragam PP untuk mengawal dan mengawasi Pemilukada. Sebelumnya ketua panitia pelantikan MPC PP Palas Adi Safran Harahap mengucapkan terima kasih kepada ketua MPO PP Palas yang telah banyak berkontribusi dalam kesuksesan acara pelantikan tersebut. Turuthadirdalamkesempatantersebutsekitar seribukaderPPdiKab.Palasdalampelantikantersebut. Sekretaris MPC PP Palas dijabat H Fahmi Nasution dengan Bendahara Aminuddin Harahap. (a33)

Jangan Pilih Caleg Karena Uang PANYABUNGAN (Waspada):Warga MandailingNatal diajaktidaksalahmenetapkanpilihannya dalam Pemilu Legislatif (Pileg) 2014. Jangan pilih calon anggota legislatif (Caleg) karena uang. Warga diingatkan menentukan pilihan terhadap Caleg berasal atau berdomisili sesuai daerah pemilihan(Dapil)danberkomitmenmembangun dapilnya,bukanmembangununtukdirinyasendiri dan hanya memikirkan kepentingan partai. “Pilihlah caleg baik itu DPR RI, DPRD provinsi ataukabupatenyangdomisilinyaberasaldaridapilnya dan benar-benar mengetahui kondisi wilayah dan Calegpunyakomitmenmembangundaerah,”ujar Wakil Ketua KNPI Mandailing Natal Lokot Husda Lubis, S. Ag kepada Waspada, Kamis (27/6). Menurutnya, ada beberapa anggota DPRD Mandailing Natal yang saat ini masih menjabat kurang maksimal berbuat untuk dapilnya, bahkan di antara mereka masih juga mencalon lagi di pileg ini. Caleg seperti ini, menurut dia, perlu menjadiperhatianmasyarakatagarjangansampai salah dalam menentukan pilihan. “Untuk itu, kita berharap kepada masyarakat agar memilih calon yang berasal dari dapilnya dan paling tidak tahu tempat tinggalnya. Sehingga saat ada permasalahan bisa cepat membantu,” ujarnya. Untuk caleg yang saat ini masih menjabat sebagai anggota DPRD, lanjut dia, masyarakat diminta melihat kinerjanya selama ini. “Kalau memang yang bersangkutan bisa memperjuang-

kan dapilnya selama duduk di DPRD, silakan pilih. Tapi kalau tidak, bagusan pilih yang baru,” ujarnya. Dikatakan, lebih baik kita berikan kesempatan untuk wajah baru, namun dengan catatan punya dan mau berkomitmen membangun dan berjuang untuk rakyat yang diwakilinya. Begitu juga, kalau caleg yang bersangkutan tinggal di luar dapil yang diwakilinya, menurut dia,adakemungkinaniatidakbisaberbuatbanyak. Biasanya, dengan masyarakat ia akan kurang dekat,dantidakadabebanmoraluntukmembantu memperjuangkanaspirasimasyarakatdiwakilinya. Dikatakannya, saat ini caleg di Madina masih banyak yang didominasi muka lama. Sedangkan kredibilitasdankomitmennyadalammembangun daerah yang diwakilinya masih diragukan. “Harapan kita akan muncul caleg-caleg wajah baru yang niat tulus membangun. Kita sudah bosan dengan wakil kita yang hanya mementingkan dirinya sendiri, kepentingan golongannya dan partainya, bahkan lupa kepada warga yang telah mendudukkannya sebagai anggota DPRD,” ketusnya. Untuk itu, warga Madina diimbau untuk tidak memilih caleg karena‘amplopnya’ dan caleg yang bermental proyek. Pilih karena komitmennya mau membangun dan mendengarkan aspirasi warga di dapilnya. Jika memilih karena ‘amplop’, maka caleg tersebut ketika duduk tidak akan mau membantu rakyatnya karena merasa sudah membeli suara rakyat. (c15)

Sumatera Utara


WASPADA Rabu 3 Juli 2013

Penerima BLSM Di P. Siantar Datang Naik Mobil Pribadi Janda Lumpuh Di Dairi Tak Dapat BLSM PEMATANGSIANTAR (Waspada): Bantuan Langsung Sementara Masyarakat (BLSM) untuk warga di Kota Pematangsiantar dan Kab. Simalungun mulai dilaksanakan di seluruh kantor pos di ke dua daerah itu, Senin (1/7). Ada yang datang naik sepedamotor, tapi ada pula warga penerima BLSM datang naik mobil pribadi. Di Kantor Pos Besar Jalan Sutomo Pematangsiantar, warga penerima dana BLSM tampak sudah datang berduyun-duyun sejak pagi. Mereka kebanyakan datang menggunakan sepeda-

motor, ada beberapa datang menggunakan mobil pribadi membawa teman-teman sekampung. Pantauan Waspada di lapangan, seusai memarkirkan sepedamotor dan mobil pribadi di halaman Kantor Pos Besar, mereka ikut antrean untuk menerima dana BLSM. Karena banyaknya kendaraan milik warga penerima BLSM dan mobil pribadi yang diparkirkan di halaman Kantor Pos Besar, petugasparkirkewalahan.Sejumlah warga yang akan berurusan di kantor pos tampak mengurung-

kan niat. Untuk melayani warga yang ingin mengambil BLSM di Kantor Pos Besar, pihak Kantor Pos sengaja membagi beberapa tempat pelayanan. Setiap kelurahan juga dibagi menurut jadwal,Pembagian BLSM di Kab. Simalungun juga dibuat jadwal dan lokasi tempat pelayanan. Kepala Kantor Pos Besar Pematangsiantar Khairil Anwar mengungkapkan, penerima BLSM di Pematangsiantar 12.882 rumah tangga sasaran (RTS), sedangkan di Simalungun 46.000 RTS.

Kepala SDM Kantor Pos daerah itu, Gilbert Sirait, di Kab. Simalungun ada 18 kantor pembantucabangkantorposdan untuk Kota Pematangsiantar ada tiga kantor pembantu pos yang tersebar di berbagai wilayah. Janda Lumpuh Sedangkan Jeronemia Br Manullang, 63, salahseorang warga miskin Dusun Sandidin, Desa Jumantuang, Kec. Siempat Nempu, Kab. Dairi, janda penderita sakit lumpuh menahun, justru tidak terdafta sebagai penerima BLSM, walaupun tempo hari dia menerima kucuran dana

Bantuan Langsung Tunai (BLT). Padahal, menurut warga setempat marga Manullang, ada penerima BLSM yang ekonominya justrujauhlebihbaik. Bahkan, dia mengungkapkan, ada warga memiliki mobil terdaftar penerima BLSM. Ketika hendak dikonfirmasi kepadaKepalaDesaJumantuang, Kec. Siempat Nempu, Jumat (28/ 6), tidak berhasil. Kades dikabarkan sedang di luar kota. Sedangkan Sekdes Herlina Br Simamora juga juga disebut sedang berpergian ke Tebingtinggi. (crap/ckm)

Camat Tiganderket Persulit Safari Ramadhan KABANJAHE (Waspada): Keinginan Tim Safari Ramadhan Universitas Al Washliyah (Univa) Medan untuk menggelar Safari Ramadhan di Kec. Tiganderket Kab. Karo mendapat hambatan. Pasalnya, Camat Tiganderket, Baron Kaban, dituding mempersulit kegiatan rutin mahasiswa Univa yang digelar setiap Ramadhan tersebut. “Kami menilai bahwa Camat Tiganderket, Baron Kaban, mempersulit upaya dakwah melalui Safari Ramadhan dengan membuat peraturan yang tidak lazim yang sebelumnya tidak pernah ada,” ujar Koordinator Lapangan Tim Safari Ramadhan Univa,WaisAlQornykepadaWaspada di Kabanjahe, Senin (1/7). Melalui surat dikeluarkan PemerintahKecamatanTiganderket Nomor 335/313/2013 pada 28

Juni 2013 disebutkan, untuk menggelar Safari Ramadhan di Tiganderketharusterlebihdahulu meminta izin kepada Bupati Karo melalui Dinas Kesatuan Bangsa dan Linmas Kabupaten Karo sebelum mengadakan Safari Ramadhan. Selanjutnya, surat izin tersebut diserahkan ke Pemerintahan KecamatanTiganderket.Padahal, kataWais,kegiataninimerupakan salah satu program dakwah dan

atas permintaan umat Islam setempat. “Kalau tadi kedatangan kami untuk KKN, kami sudah terlebih dahulu mendatangi Kesbangpol Linmas Pemkab Karo. Tapi, ini kegiatan dakwah. Kami sudah bertahun-tahunmenggelarSafari Ramadhan di kecamatan ini, tapi kebijakan ini baru keluar saat camat yang baru ini,” katanya. Wais menambahkan, kejadian ini berlangsung sejak tahun lalu saat Baron Kaban mulai menjabat sebagai Camat Tiganderket. Padahal, camat sebelumnya tidak pernah mengeluarkan kebijakan seperti itu. Tim Safari Dakwah Univa dan MUI Karo sempat berupaya menemui Baron Kaban, namun gagal. Sebelumnya, berbekal surat pengantar dari Dekan Fakultas Agama Islam Univa 20 Juni 2013, Univa bermaksud mengadakan kegiatansafaridakwahbertepatan dengan bulan suci Ramadhan

pada tiga desa di Tiganderket, yaitu Desa Perbaji, Desa Susuk dan Desa Penampen. Rencananya, kegiatan itu digelar dua gelombang, pertama 11-22 Juli 2013 dan gelombang kedua 22 Juli-2 Agustus 2013. Masing-masing gelombang menghadirkan 75 dai. Kasi Pemerintahan Kecamatan Tiganderket, Zainal Aswad, saat dihubungi Waspada melalui ponselnya, membenarkan peraturan ini hanya berlaku di Kec. Tiganderket. “Sepengetahuan saya, memang di kecamatan lain tidak ada dan hanya berlaku di Kecamatan Tiganderket setelah camat yang baru ini,” katanya. Camat Tiganderket, Baron Kaban, saat dikonfirmasi Waspada justru berkilah. Ia mengatakan, tim Safari Dakwah tersebut hanya perlu mengirim surat pemberitahuankeDinasKesbang dan Linmas Karo. Selanjutnya, tim diminta membuat tembusan

kepadanya. Baronjugatidakmembantah kalau hal tersebut merupakan kebijakannya sendiri. Hal ini, imbuhnya, juga berlaku bagi setiapelemenmasyarakatlainnya yang akan melakukan kunjungan dakwah ke daerahnya. “Saya belajar dari pengalaman ketika masih menjadi Sekcam di Barusjahe saat ada kunjungan mahasiswa dari Singapura yang melakukan kegiatan sosial,” katanya tanpa merinci. Ironisnya, Kadis Kesbangpol Linmas Pemkab Karo, Ronda Tarigan, justru tidak mengetahui hal tersebut. Pihaknya juga tidak pernah meminta dibuatkan surat pemberitahuan dalam kegiatan dakwah, khususnya Safari Ramadhan. “Tidak pernah. Dari dulu kita tidak pernah meminta hal tersebut. Kalau pun ada yang berhubungan dengan kegiatan keagamaan, itu ke Bagian Sosial,” pungkasnya. (a36)

Ribuan Warga Pakpak Hadiri Pepalum Nteddoh

Waspada/Natar Manalu

KAPOLRES Dairi AKBP Enggar Pareanom (kiri) sedang memasang tanda jabatan kepada Kasat Reskrim yang baru AKP Hasian Panggabean.

Kasus Pembunuhan, Perkosaan Belum Terungkap Kasat Reskrim Polres Dairi Diganti SIDIKALANG (Waspada): Di jajaran hukum Polres Dairi masih ada beberapa kasus yang belum terungkap, di antaranya kasus pembunuhan Novalina br Purba, siswi kelas III SMAN 1 Sidikalang, kasus pemerkosaan di jalan Maholi Sidikalang menimpa seorang siswi kelas II SMP yang terjadi di rumah kosnya pada pagi subuh dua bulan lalu. “Juga kasus pembongkaran brankas Stasiun Pengisian Bahan Bakar Umum (SPBU) di Jalan SM.Raja Sidikalang dan kasus lainnya yang belum tuntas,” ujar Kapolres Dairi AKBP Enggar Pareanom saat serah terima jabatan Kasat Reskrim di aula Kamtibmas dihadiri Waka Kompol Santun Hutauruk dan beberapa perwira di jajaran Polres, Selasa (2/7). Kasus pembunuhan terhadap siswi SMA tersebut, menurut Kapolres, sudah lama terjadi. Diharapkan semua kasus itu dapat segera dituntaskan dan menjadi pekerjaan bagi Kasat Reskrim yang baru, dengan kerjasama dengan masyarakat. Jabatan Kasat Reskrim diserahterimakan dari AKP Demak Oppusunggu kepada pengantinya AKP Hasian Panggabean yang sebelum bertugas sebagai Kapolsek Bunturaja Dairi. Sedangkan AKP Demak Oppusunggu mendapat tugas baru di Poldasu. Kemudian, Kapolsek Bunturaja menjadi AKP Sabar Pinem sebelumnya bertugas di Poldasu. Selain itu jabatan Kabag Sumba juga diserahterimakan dari pejabat lama Kompol Santun Hutauruk kepada Kompol Kamal Hutauruk merangkap Wakapolres. (a20)

MEDAN (Waspada): Dewan Pimpinan Pusat Himpunan Masyarakat Pakpak (DPP Himpak) menggelar acara pepalum nteddoh atautemukangendipelataran Mess Pemkab Pakpak Bharat, Jalan Ngumban Surbakti Medan, Sabtu (29/6). Seribuan masyarakat Pakpak perantauyangberdomisilidiKota Medan, Deliserdang, Serdang Bedagai (Segai), Binjai, Langkat, Labuhanbatu, Batam, Subulussalam, Singkil (Aceh), Jakarta dan daerah lainnya menghadiri acara temu kangen tersebut. Mereka menjadikan acara itu sebagai tempat saling melepas kerinduan dan silaturahmi. Mereka juga menikmati pagelaran kesenian dan budaya Pakpak seperti odong-odong dengan pakaiankhasnya, sulim(seruling), tari-tarian Pakpak tradisional oleh Sanggar Tari Nantampuk Emas

diiringi alat musik genderang. Juga ada tarian Pakpak modern oleh Sanggar Tari Immuda, lagu-lagu Pakpak oleh Paduan Suara Simatah Daging GKKPD. Acara makin meriah ketika artis Pakpak Sohia Group mendendangkan lagu-lagu daerah Pakpak. Pengurus DPP Himpak, di antaranya Ketua Umum Drs H Citra Effendi Capah MSP, Sekjen Drs Lister Berutu MA, Bendahara Umum Kasiman Berutu, SE, MSi, Ketua Dewan Pembina Himpak Fahruddin Kudadiri, SH, tokoh masyarakat Pakpak Bachtiar Revenala Ujung, Jenni Brutu, Syamsudin Angkat SE, SH, dr H Reinfil Capah, M Kes, Agus Ujung, SH, Mochtar Berampu, dan Marjan Lingga, tampak larut dalam kemeriahan acara pepalum nteddoh itu. Tampak hadir dalam acara

Waspada/Rudi Arman

KETUA Umum DPP Himpak Drs H Citra Effendi Capah MSP berbaur dengan seribuan masyarakat Pakpak yang menghadiri acara pepalum nteddoh, di pelataran Mess Pemkab Pakpak Bharat Jalan Ngumban Surbakti Medan.

itu, mewakili Bupati Dairi Naik Kaloko SP, MM dan mewakili Bupati Pakpak Bharat P Sinamo (Kabag Kesra). Ketua Umum DPP Himpak H Citra Effendi Capah dalam sambutannya menyerukan kepada masyarakat Pakpak di manapun berada agar bersatu dan saling membantu demi meningkatkan harkat martabat masyarakat Pakpak. “Kalo bukan kita siapa lagi yang diharapkan untuk melestarikan budaya dan kesenian Pakpak. Karena itu, semua masyarakatPakpakharusbersatu meningkatkan harkat dan martbat masyarakat Pakpak,” kata Citra. Sedangkan Penasehat DPP Himpak Syamsuddin Angkat yang juga Direktur RSUP Adam Malik Medan meminta pemerintah si lima suak, yakni Dairi, Pakpak Bharat, Humbang Hasundutan (Humbahas),Tapanuli Tengah, Aceh Singkil dan Kota Subulussalam, berperan serta dalam memajukan masyarakat Pakpak. Sementara Ketua Ikatan Masyarakat Pakpak Jakarta Bachtiar Renavala Ujung memberikan motivasi kepada masyarakat Pakpak agar terus berjuang memajukan etnis Pakpak. “Etnis Pakpak harus maju seperti etnis lainnyadiSumut,”katabakalCaleg DPR RI ini. Ketua Panitia Mulia Banurea SAg MSi dalam laporannya menyampaikan ucapan terimakasih dan apresiasi kepada berbagai pihak yang mendukung acara pepalum nteddoh ini. (m39)

Kisah Sedih Di Balik Rekor MURI Simalungun PEMKAB Simalungun, Sabtu (29/6), kembali sukses meraih rekor MURI (Museum Rekor Indonesia) kategori menari (manortor) massal terbanyak dengan jumlah 9.000 penari. Namun sangat disayangkan, ternyata nikmat kesuksesan itu hanya dapat dirasakan penguasadanpejabattertentu semata, sedangkan bagi beberapapimpinanSKPD,camat hingga pangulu (kades), kesuksesan meraih rekor MURI merupakansebuahderitadan pengorbanan. Setidaknya,halinitergambar pada saat digelarnya penutupan PRB ke-28 yang sekaligus dilangsungkannya tortor haroan bolon (tari gotong royong) yang melibatkan sedikitnya 10.000 orang berasal dari 31 kecamatan seKab. Simalungun plus pegawai di sekretariat dan SKPD Pemkab Simalungun. Merujuk dari laporan panitia kegiatan yang juga seba-

gai Sekdakab Simalungun, Drs GideonPurba,danauntukmenghadirkan sekira 15.000 pengunjung pada hari itu sekaligus pengadaanhadiahluckydrawberupa 10unitsepedamotor,televisi,kulkas, kipas angin, sepeda mini dan lainnya,berasaldarikantongmereka (parapejabat).Artinyapejabattektekan (patungan), anggarannya bukan dari APBD. Bila dikalkulasikan dana yang dibutuhkan untuk membeli hadiah saja diperkirakan mencapai ratusan juta rupiah. Itupun belumdihitungbiayauntukmendatangkanmassayangjumlahnya mencapai puluhan ribu orang. Sekretaris Daerah Gideon Purba, dengan suara keras, lantangdanbangga mengumumkan siapa-siapa saja pejabat yang memberi bantuan atas hadiahhadiah yang ada. “ Hadiah utama lucky draw, 10 unit sepedamotor, masing-masing dua unit sumbangan Bupati JR Saragih, dua unit sumbangan Dirut PTPN V. Meskipun PTPNV itu ada di Riau, tapi mereka mau menyumbang

ke Simalungun. Kemudian satu unit sumbangan dari Dispenda, sedang selebihnya sumbangan dari SKPD,” tegas Gideon menyampaikansiapa-siapasajayang menyumbangkan sepedamotor hadiah lucky draw tersebut. Terkait dengan kehadiran massa mencapai 15.000 orang ke lokasi itu seiring dengan keinginan Pemkab Simalungun untuk memecahkan rekor MURI denganjumlahpenari9.000orang, panitia mengemas acara tarian Haroan Bolon dengan menghadirkan ribuan massa dari 31 kecamatan.Minimalsetiapkecamatan mengutus 200 orang, bahkan kecamatan terdekat harus menghadirkan massa di atas 200 orang. Nah,yangparahnya,bebanuntuk memobilisasimassakePamatang Raya menjadi beban para camat dan kepala UPTD. Sebagaimana pengakuan salah seorang warga yang istrinya (PNS) ikut mewakili salah satu kecamatan mengakui, biaya membeli/menyewapakaianadat Simalungunditambahbiayasalon

setiap peserta mencapai Rp300 ribu per orang. Bagi pegawai negeri sipil diwajibkan ikut dan biaya ditanggung sendiri. “Artinya apa, semua PNS (guru dan pegawai) baik yang punya jabatan maupun tidak, wajib menjadi peserta dan harus rela mengeluarkan biaya sendiri untuk membeli atau menyewa pakaian adat serta biaya salonnya sendiri. Sedangkan camat harus mengeluarkan biaya mobilisasi massa mencapai puluhan juta,” sebut warga. Kehadiran puluhan ribu massa pada hari itu memang berhasil memecahkan rekor MURI sebagaimana diharapkan Pemkab Simalungun. Usai melakukan tortor massal, pihak MURI yang sengaja sudah hadir di tempat mengumumkan pemecahan rekor MURI kategori penari k 9.000 orang, berhasil mengalahkan rekor yang pernah dicapai penari di Gelora Senayan 7.000 penari pada 2007. Setelah pengumuman itu, para pejabat teras dan peserta

penari terlihat bangga dan bersorak gembira karena berhasil meraih MURI. Namun di balik kegembiraan itu, di balik keberhasilan itu, ada sebersitcahaya yangtidakikhlaspadawajahsebagianpejabat. Ironisnyalagi,usaimenari, para penari dan massa yang hadir sepertinya tidak diabaikan. Panitia tidak menyediakan minuman dan makanan. Padahal,panitiadiketahuimemotong kerbau dan sebelumnya diinformasikan bahwa massaakanmendapatmakan. Tetapi apa yang diharapkanmassatakkunjungdatang, apalagi panitia asyik dan sibuk membagi-bagi hadiah lucky draw. Apakah keadaan ini disengaja atau mungkin hanya sebuah trik agar massa lupa terhadap makanan yang sudah dijanjikan. Entahlah. Tetapiyangpasti,puluhanribu massa akhirnya bubar tanpa mendapat makanan sebagaimana dijanjikan. * Hasuna Damanik

Waspada/ Rap.Negara Siregar

SEPEDAMOTOR milik warga penerim BLSM tampak memadati halaman kantor Pos besar Pematangsiantar di hari pertama pembagian dana BLSM. Malah ada penerima BLSM datang menggunakan mobil.

Puluhan Ribu Keluarga Miskin Di Nias Belum Terima BLSM GUNUNGSITOLI (Waspada): Walaupun sudahhampirduaminggudimulainyapenyaluran dana Bantuan Langsung Sementara Masyarakat (BLSM) bagi keluarga miskin sebagai kompensasi naiknya harga bahan bakar minyak (BBM) oleh pemerintah, namun sampai saat ini puluhan ribu keluarga miskin yang ada di lima kabupaten/ kota se Kepulauan Nias belum menerima dana tersebut. Para keluarga miskin ini merasa kecewa karena di daerah lainnya di Indonesia sudah lama disalurkan. Bahkan, sejumlah keluarga miskin dari berbagaidesadiKotaGunungsitolisudahbeberapa kali mendatangi Kantor Pos Gunungsitoli untuk mencari tahu kapan dana BLSM tersebut dicairkan. Namun mereka terpaksa kecewa dan pulang ke rumahnya tanpa mendapat penjelasan kapan dana bantuan itu cair. Kepala Kantor PT Pos Gunungsitoli yang berulang kali hendak ditemui wartawan tidak berhasil. Namun Kepala Satgas Penyaluran BLSM KantorPTPosGunungsitoli,F.Tariganyangberhasil

dikonfirmasi wartawan, Senin (1/7) secara singkat mengatakan dana BLSM belum dicairkan karena harus menunggu intruksi dari Provinsi Sumatera Utara, serta data penerima BLSM tersebut harus diverifikasi kembali. Menurutnya, dana tersebut rencananya Selasa (2/7) disalurkan. Ditanya jumlah Kartu Perlindungan Sosial (KPS) yang akan dibagikankepadakeluargamiskin penerima BLSM melalui PT Pos Gunungsitoli, Tarigan tidak bersedia menjelaskan termasuk jadwal pencairan dana dimaksud dan langsung meninggalkan wartawan dengan alasan sibuk. Sementara itu sesuai informasi yang didapatkan menyebutkan penerima dana BLSM berdasarkan data penerima Raskin yang ada di masing-masing daerah. Data penerima Raskin di Kota Gunungsitoli tahun 2013 mencapai 13.612 kepala keluarga. Namun jika data penerima Raskin tersebut digunakan sebagai data penerima BLSM dikhawatirkan masih banyak keluarga miskin yang bakal tidak menerima BLSM serta tidak tepat sasaran. (a25)

Penerima BLSM Di Karo 21.158 RTS KABANJAHE (Waspada): 21.158 Rumah Tangga Sasaran (RTS) di Kab. Karo menjadi penerima Bantuan Langsung Sementara Masyarakat (BLSM). Bantuan tersebut disalurkan secara bertahap 11 hari sejak Senin (1/7). “Dana ini akan dibagikan melalui delapan kantor pos di Kabupaten Karo,” ujar Penanggungjawab Pendistribusian BLSM Kantor Pos Pemeriksa Kabanjahe, Hasbullah, kepada Waspada di ruang kerjanya, Selasa (2/7). Penerima BLSM tersebut didominasi Kecamatan Berastagi dengan 2.225 RTS, diikuti Kabanjahe 2.017 RTS, Mardinding 1.973 RTS, Munthe 1.689 RTS, Barusjahe 1.447 RTS, Lau Baleng 1.310 RTS dan Kecamatan Tigabinanga 1.213 RTS.

Kemudian, Kecamatan Merek 1210 RTS, Juhar 995 RTS, Tiganderket 915 RTS, Kutabuluh, 796 RTS, Merdeka 703 RTS, Payung 548 RTS, dan Kecamatan Dolat Rakyat 453 RTS. Jumlah penerima cenderung menurun dibanding penerima Bantuan Langsung Tunai (BLT) pada 2008 lalu yang berjumlah 31.665 RTS. Selama dua hari pertama penyaluran, Hasbullah tidak menampik pihaknya beberapa kali didatangi warga penerima BLT lalu untuk mempertanyakan tidak diikutsertakannya mereka pada BLSM kali ini. “Tapi itu memang bukan wewenang kami. Kami kemarin hanya menyerahkan Kartu Perlindungan Sosial (KPS) dan kali ini hanya menyalurkannya,” katanya. (a36)

Dua Tersangka Pengadaan Perlengkapan e-KTP Di Karo KABANJAHE (Waspada): Kejaksaan Negeri Kabanjahe, Kab. Karo menetapkan dua tersangka pengadaan barang e -KTP dan sistem informasi administrasi kependudukan (SIAK) dengan anggaran Rp4,3 miliar dari APBN 2011. “Kejari Kabanjahe telah menetapkan tersangka pegawai Dinas Kependudukan dan CatatanSipil(Capil)selakuPPK,AbrS,danrekanan CV Putra, H, atas pengadaan barang e-KTP dan SIAK senilai Rp4,3 miliar. Pengadaan barang ini berupakamera,komputerdanlain-lainnyasebagai perlengkapan membuat e-KTP serta SIAK di setiap

kantor Camat,” terang Kajari I DG Wirajana, S.H.M.H kepada Waspada, Kamis (27/6). Kejari juga telah melakukan pemeriksaan kepada tiga pegawai Capil sebagai pemberi barang langsung setiap kecamatan. Diharapkan, akan hadir tersangka baru. Juga 17 camat di Karo dipanggil untuk dimintai keterangan. Kadis Disdukcapil Karo Mbaga Ginting ketika dikonfirmasi di tempat terpisah, tak mau berkomentar banyak. “Biarlah pengadilan yang memutuskan,” ujarnya. (c19)

Personel Polres P. Siantar Dapat Bintang Bhayangkara Polres Simalungun Musnahkan Sitaan Narkoba PEMATANGSIANTAR (Waspada): Dua personel Polres Pematangsiantar masing-masing mendapat penghargaan Bintang Bhayangkara ataspengabdiandiatas24tahundanSatyaLencana atas pengabdian di atas 16 tahun. Sementara, Polres Simalungun memusnahkan barang bukti narkoba serta meresmikan penggantian nama aula Mapolres menjadi Kompol Anumerta Andar Siahaan. Penyerahan penghargaan dilaksanakan saat peringatan dan syukuran HUT ke-67 Bhayangkara atauPolritahun2013diMapolresPematangsiantar, Senin (1/7), sedang pemusnahan barang bukti narkoba dan peresmian secara simbolis nama aula Mapolres Simalungun dilaksanakan di lapangan Rambung Merah, Kec. Siantar. Personel yang mendapat Bintang Bhayangkara Kasubbag Humas AKP Efendi Tarigan dan Satya Lencana KBO Sat Narkoba Ipda Resbon Gultom, SH. Selain itu, Kapolres Pematangsiantar AKBP Albert TB Sianipar, S.Ik, MH juga menyerahkan penghargaan kepada empat personel Sat Reskrim terdiri Kanit Resum Iptu Sugeng Wahyudi S, SH, Kanit Tipiter IpdaYuken Saragih, Penyidik Bripka Erikson Siahaan dan Briptu Eriwan Sutardodo Simarmata atas keberhasilan mereka mengungkap kasus pembunuhan seorang nenek baru-

baru ini. Sedangkan peringatan dan syukuran HUT BhayangkarayangdilaksanakanPolresSimalungun ditandai dengan pembacaan sambutan Kapolri yang dilakukan Kapolres AKP Andi Syahriful Taufik, S.Ik, M.Si, penyerahan tali asih kepada purnawirawan dan warakawuri Polri, penyerahan mobil almarhum Kompol Anumerta Andar Siahaan secara simbolis kepada keluarga, peresmian nama aula Mapolres, penyerahan hadiah kebersihan Mako, cerdas cermat, personel terbaik, memasak nasi goreng, kuliner, tarik tambang, sepakbola, tangkap belut, balap karung, makan kerupuk dan mirip tokoh. Selain itu, pemberian piagam penghargaan kepada sembilan personel yang memasuki masa purnabhakti atau pensiun, pemberian penghargaan kepada enam personil dalam pelaksanaan tugas. Menurut Kapolres, pemusnahan barang bukti narkoba terdiri 773 kg ganja dan 31 gram shabushabu serta lainnya merupakan hasil penegakan hukum 2012-2013 dan sudah berkekuatan hukum tetap serta berkaitan dengan Hari Anti Narkotika Internasional, sedang penggantian nama aula Mapolres menjadi Andar Siahaan sebagai wujud penghormatan terhadap jasa Andar Siahaan yang tewassaatmelaksanakantugasbaru-baruini.(a30)

Waspada/Edoard Sinaga

PENGHARGAAN terhadap empat personel Polres Pematangsiantar atas keberhasilan mereka mengungkap kasus pembunuhan baru-baru ini diberikan Kapolres AKBP Albert TB Sianipar, S.Ik, MH saat peringatan dan syukuran HUT Bhayangkara atau Polri ke-67 di Mapolres setempat.

Ekonomi & Bisnis

WASPADA Rabu, 3 Juli 2013


Petani Tambak Budidaya Sistem Polikultur BLANG MANGAT ( Waspada): Petani tambak di Kecamatan Blang Mangat, Kota Lhokseumawe, melakukan budidaya sistem polikultur. Yakni antara ikan nila dengan udang windu. Ikan nila memiliki nilai ekonomi lebih tinggi dibanding dengan jenis ikan lainnya. Ketua kelompok tani tambak di Blang Mangat Azhar, Selasa (2/7), mengatakan tambak di sana cocok untuk budidaya sistem polikultur. Air tambak sesuai untuk udang dan ikan nila. ‘’Sehingga sangat bagus untuk budidaya polikultur windu dan nilai,’’ katanya. Apalagi, tambahnya, petani Blang Mangat telah menerapkan budidaya ramah lingkungan

tanpa penggunaan pestisida. Sehingga nila berkembang dengan baik bersama udang dalam satu areal tambak. Sesuai dengan programWorld Wildlife Fund (WWF) di Lhokseumawe, tambak tidak lagi menggunakan pestisida agar hasil budidaya memiliki kualitas ekspor. Petani setempat memiliki cara tersendiri dalam menjalankan metode polikultur. Dalam satu hektare tambak ditebarkan 30.000 benur udang. Ketika udang berumur 1,5 bulan, baru ditebarkan 1.000 bibit ikan nila. Namun, menurut petani setempat, pembudidayaan sistem polikultur sering dilakukan ketika air tambah bercampur, antara air laut dengan air tawar mengalir melalui sungai. (b15)

Petani GaramAceh Utara Dapat Bantuan ACEH UTARA (Waspada): Pemerintah pusat melalui Kementerian Kelautan dan Perikanan (KKP), Selasa (2/7), mengucurkan bantuan Rp400 juta untuk 300-an petani garam di empat kecamatan di Aceh Utara. Bantuan tersebut diberikan melalui Program Usaha Garam Rakyat (PUGAR). Pejabat Pembuat Komitmen Dinas Kelautan dan Perikanan Aceh Utara Mukhlis, Selasa (2/ 7) di BRI Ranting Syamtalira Aron menyebutkan, daerahnya mendapatkan bantuan sebanyak dua kali. Tahap pertama diterima pada 2012 dan tahap di 2013. Petani garam yang mendapat bantuan berasal dari Kecamatan Seunuddon, Lapang, Syamtalira Bayu, dan Kecamatan Dewantara. Ke 300-an petani garam tersebut terbagi dalam 30 kelompok usaha garam. Dari 30 kelompok tersebut, 15 di antaranya merupakan kelompok lama dan 15 kelompok

Petani Blang Mangat, Lhokseumawe sedang memanen ikan nila bersama udang windu, beberapa waktu lalu

Waspada/Zainal Abidin

Meski Dipungut Pajak UKM Diyakini Mampu Bangkit JAKARTA (Antara): Usaha Kecil Menengah (UKM) diyakini akan mampu bangkit, meskipun pemerintah telah memutuskan untuk memungut pajak bagi usaha yang memiliki omzet kurang dari Rp4,8 miliar per tahun. Direktur Jenderal Industri Kecil dan Menengah Kementerian Perindustrian Euis Saedah, di Jakarta, Selasa (2/7), mengatakan pihaknya sangat yakin akan hal itu. Diakuinya, memang beban yang dialami UKM dan industri kecil menengah (IKM) cukup berat dengan adanya pungutan pajak tersebut. ‘’Namun mereka termasuk yang sangat fleksibel dan mudah untuk menyesuaikan,” katanya. Berbicara saat membuka Pameran Gelar Produk Unggulan Jawa Timur, Euis, juga menambahkan bahwa UKM dan IKM akan mampu bangkit dari tantangan tersebut. “Mereka juga telah menghadapi tantangan berat dengan kenaikan harga bahan bakar

minyak, namun saya yakin mereka akan mampu untuk bangkit kembali,” ujarnya. Menurut Euis, UKM dan IKM akan dengan cepat mengatur barisan untuk mampu berproduksi kembali. Juga dengan adanya pungutan pajak tersebut, akan memunculkan rasa bangga dengan adanya kontribusi terhadap bangsa. Namun, menurut Euis, sesungguhnya harus ada pemisahan antara pungutan pajak terhadap UKM dan IKM. Karena keduanya memiliki perbedaan dalam melakukan kegiatan usaha. “Harus ada pemisahan, karena untuk industri, mereka harus melakukan pengolahan sementara untuk usaha kebanyakan hanya berdagang saja tanpa melakukan proses produksi,” ujarnya lagi. Euis, menjelaskan, UKM memiliki strata yang berbedabeda, dan tidak sama antara jenis usaha satu dengan yang lainnya, yang susungguhnya harus disikapi dengan perlakuan yang berbeda. “Tiap sektor memiliki karakteristik yang berbeda, sehingga sesungguhnya perlakuannya juga harus berbeda,” ujar Euis, yang juga mengatakan bahwa hingga saat ini masih belum ada UKM yang melaporkan keluhan terkait kebijakan pemerintah tersebut.

Daftar Harga Bahan Pokok Di Medan, Selasa (2/7) Beras KKB Beras Jongkong IR64 Gula Pasir Minyak Goreng Curah Kuning Minyak Goreng Bimoli 1000 ml Terigu Segi Tiga Biru Terigu Cakra Kembar Terigu Kunci Daging Sapi Murni Daging Ayam Broiler Daging Ayam Kampung Telur Ayam Broiler Telur Ayam Kampung Garam Bata (250 gr) Garam Halus Cabai Merah Cabai Rawit Cabai Hijau Bawang Merah Bawang Putih Tomat Kol Kentang Ikan Asin Teri Ikan Kembung Kacang Hijau Kacang Tanah Kacang Kedelai Minyak Tanah Susu KM Bendera 357 gr Susu KM Indomilk 390 gr

: Rp9.800 per kg : Rp9.000 per kg : Rp12.000 per kg : Rp9.500 per kg : Rp12.000 per btl : Rp7.500 per kg : Rp7.500 per kg : Rp7.000 per kg : Rp85.000 per kg : Rp26.000 per kg : Rp50.000 per kg : Rp1.100 per butir : Rp1.500 per butir : Rp4.000 per btg : Rp4.000 per kg : Rp27.500 per kg : Rp17.500 per kg : Rp20.000 per kg : Rp22.000 per kg : Rp15.500 per kg : Rp7.000 per kg : Rp3.000 per kg : Rp8.000 per kg : Rp80.000 per kg : Rp28.000 per kg : Rp12.500 per kg : Rp20.000 per kg : Rp8.000 per kg : Rp9.000 per liter : Rp7.600 per kaleng : Rp8.200 per kaleng


Harga Emas LM Lokal (99,99%)


Emas (99,5%)


Emas Perhiasan (70%)


Emas Putih (75%)



210.000 (m41)

Pemerintah telah mengeluarkan Peraturan Pemerintah (PP) Nomor 46 Tahun 2013 tentang Pajak Penghasilan (PPh) atas Penghasilan dari Usaha yang Diterima atau Diperoleh Wajib Pajak yang memiliki Peredaran Bruto Tertentu. Peraturan ini mendasari pengenaan pajak kepada usaha kecil menengah (UKM) yang memiliki omzet kurang dari Rp 4,8 miliar per tahun, yang mulai berlaku pada 1 Juli 2013. Sosialisasi Sementara itu , Wakil Ketua Kadin Bidang UKM dan Koperasi Erwin Aksa, menyarankan pemerintah untuk mengintensifkan sosialisasi pengenaan pajak usaha kecil dan menengah (UKM) yang berlaku pada

1 Juli 2013. Karena sebagian besar pelaku UKM belum paham dengan pajak yang bernaung di Peraturan Presiden (Perpres) No.46/2013 tersebut. Selain itu, masih terdapat banyak hambatan dalam penerapan Perpres tersebut. Menurutnya, 60-70 persen pelaku UKM belum tahu pengenaan pajak sebesar 1 persen dari omzet per bulan tersebut. Sosialisasinya masih sangat kurang. Menurut Erwin, pemerintah sebaiknya mengintensifkan sosialisasi pajak UKM terutama terkait administrasi pencatatannya.“Seperti apa pembukuan dan pencatatan macam yang dibutuhkan. Saya khawatir pelaku UKM-nya kaget-kaget dikenakan pajak,” katanya. Erwin, memperkirakan

aturan ini akan terkendala beberapa hal. Utamanya pada penjaringan dan pendataan nasabah pajak UKM yang saat ini datanya tersebar di beberapa instansi. Menurutnya, sebagian besar pelaku UKM belum memiliki pembukuan dan pencatatan transaksi yang rapi karena biasanya hanya mencatat jumlah barang yang masuk dan keluar. Erwin, mengusulkan agar Dirjen Pajak bekerjasama dengan pemerintah daerah, utamanya dengan birokrasi pada tingkat kecamatan dan Dispenda, untuk melakukan collection dan pendataan wajib pajak UKM karena kecamatan dan Dispenda ini yang lebih dekat dengan UKM dan memiliki kemampuan administratif dalam melayani wajib pajak. (ant)

Penyaluran BLSM Amburadul, Pemprov Sumut Lepas Tangan M E D A N ( Wa s p a d a ) : Pemerintah Provinsi Sumatera Utara mengaku tidak ikut bertanggung jawab terhadap amb u ra d u l n y a p e n y a l u ra n Bantuan Sementara Langsung Masyarakat (BLSM) kepada warga miskin yang terdampak kenaikan harga BBM bersubsidi. Namun begitu, Pemprov Sumut menyatakan siap memfasilitasi masyarakat yang berhak menerima BLSM, namun belum dipenuhi haknya oleh pemerintah. “Ini bukan kewenangan kami. Kewenangannya ada di pemerintah kabupaten kota. Jadi misalnya ada yang belum mendapatkan BLSM padahal berhak, itu ada formulir untuk diisi, untuk penggantian. Dan yang mengajukan itu perangkat pemerintah di jajaran kabupaten/kota. Kalau kita hanya bisa membantu mengisi formulirnya, dan mekanisme

penggantian formulirnya,” terang Asisten II Bidang Ekonomi dan Pembangunan Pemprov Sumut, Sabrina kepada Okezone, Selasa (2/7). Sabrina menambahkan, selain membantu mekanisme pengisian formulir revisi penerima BLSM, Pemprov Sumut juga siap memberikan surat edaran kepada bupati dan walikota se-Sumut, untuk melakukan pembaruan terhadap data penerima BLSM. “DPRD melalui Ketua Dewan, sudah merekomendasikan kepada Gubernur untuk segera menyurati bupati dan walikota, untuk segera melakukan updating data penerima BLSM. Ini akan kita siapkan, untuk segera dikirim. Tapi pastinya baru akan efektif di pembagian BLSM selanjutnya,” tambahnya. Sementara itu, Ketua Komisi E DPRD Sumut, Zulkifli

Husein menuturkan, pemerintah provinsi harus sesegera mungkin mengirimkan surat kepada pemerintah kabupaten/kota, agar proses pembaruan data penerima BLSM dapat segera dilakukan. Tidak harus menunggu proses administrasi terbitnya surat rekomendasi DPRD. Sebagai pimpinan tertinggi di provinsi, gubernur harusnya dapat berinisiatif dan membantu secara maksimal, ketimpangan yang terjadi dalam penyaluran BLSM. “Ini kan persoalan di kabupaten/kota, jadi jangan di lempar ke kita. Kalau pemerintah daerahnya enggak respon, Gubernur harus ambil langkah cepat. Lagipula ini harusnya diantisipasi sejak awal. Karena kalau datanya diperbaharui secara berkala. Kondisi ini kan enggak perlu terjadi,” tukasnya.(okz)

Harga Minyak Mentah RI Nyaris Tembus 100 Per Barel J A K A RTA ( Wa s p a d a ) : Minyak mentah Indonesia (Indonesia Crude Price/ICP) selama Juni 2013 mengalami kenaikan. Berdasarkan perhitungan, ICP naik 0,96 dolar AS per barel menjadi 99,97 dolar AS per barel, dibanding Mei 2013 sebesar 99,01 dolar AS per barel. Sedangkan harga Minas/ SLC selama Juni 2013, naik 2,66 dolar AS per barel menjadi 102,75 dolar AS per barel dari sebelumnya 100,09 dolar AS per barel pada Mei 2013. Seperti dikutip pada situs Ditjen Migas, Jakarta (2/7) Tim Harga Minyak Indonesia menyatakan perubahan harga minyak tersebut, disebabkan beberapa hal. Faktor yang me-

ningkatkan harga minyak antara lain perekonomian dunia diindikasikan membaik. Hal ini tercermin dari perekonomian Amerika Serikat (AS) mulai menguat, ditandai dengan peningkatan pasar perumahan, dan penurunan angka pengangguran. Selain itu, meningkatnya kegiatan manufaktur di Jerman juga memberikan senimen positif perekonomian global. Sementara berdasarkan publikasi Organization of Petroleum Exporting Countries (OPEC) pada Juni 2013, diperkirakan terjadi peningkatan permintaan minyak mentah dunia pada 2013 sebesar 0,8 juta barel per hari sehingga mencapai 90,2 juta barel per hari pada triwulan

III-2013. Proyeksi kenaikan ini disebabkan oleh naiknya permintaan minyak mentah oleh China sebesar 0,35 juta barel per hari, dimana rata-rata pada 2012 sebesar 10,1 juta barel per hari, menjadi 10,45 juta barel per hari pada 2013. Selain itu, terdapat pertumbuhan permintaan minyak mentah negara-negara Amerika Latin sebesar 0,2 juta barel per hari menjadi 6,5 juta barel per hari. Di sisi lain, berdasarkan publikasi International Energy Agency (IEA) pada Juni 2013, dilaporkan adanya penurunan produksi minyak mentah dari North Sea sebesar 0,4 juta barel per hari akibat kegiatan perawatan fasilitas produksi. (okz)

dibentuk pada 2013. Jumlah bantuan diberikan antara kelompok lama dan kelompok baru sangat berbeda. “Untuk kelompok lama mendapat bantuan antara Rp7 juta hingga Rp10 juta, tergantung jumlah anggota dimiliki. Sedangkan untuk kelompok baru antara Rp17 juta hingga Rp22 juta. Bantuan tersebut diberikan untuk membeli berbagai sarana dan prasarana yang dibutuhkan untuk produksi garam,” kata Mukhlis. Mukhlis, mengatakan, bantuan tersebut diberikan setelah adanya usulan dari petani ke Dinas Kelautan dan Perikanan Aceh Utara. Kemudian, dinas menuangkan dalam bentun Rancangan Usaha Bersama (RUB), selanjutnya dinas berupaya mencarikan dana sesuai dengan jumlah anggota kelompok. Kata Mukhlis, bantuan PUGAR sangat bermanfaat bagi petani garam dan dinilai cukup efektif. (b18)

Pameran Fasilitas Promosi UMKM MEDAN (Waspada): Kegiatan Pameran dan Pasar Usaha Mikro, Kecil dan Menengah (UMKM) Sumatera Utara 2013 yang digelar Dinas Koperasi dan UKM Provinsi Sumatera Utara mulai 24-30 Juni 2013 merupakan sebuah fasilitas untuk mengembangkan UMKM. Hal tersebut disampaikan Ketua Panitia Penyelenggara UMKM Kepala Dinas Koperasi dan UKM Provinsi Sumatera Utara Drs. Masri dalam penutupan kegiatan pameran tersebut, Minggu (30/6) malam. Puncak acara dilaksanakan dengan pemberian hadiah bagi para pemenang lomba antara lain lomba bunda pariwisata, lomba memasak, lomba mewarnai ibu dan anak, lomba fashion show anak-anak. “Kegiatan UMKM ini merupakan sebuah fasilitas kegiatan pemerintah untuk mengembangkan UMKM yang diadakan setiap tahunnya dengan harapan para pelaku UMKM dapat saling sharing, saling berkomunikasi, saling bertukar informasi antar UMKM,” katanya.

Masri menyebutkan, dengan banyaknya peserta UMKM datang dari berbagai daerah selain Sumatera Utara yakni Kalimantan,Jakarta, DIYYogyakarta dan sebagainya, diharapkan para peserta dapat saling bertukar informasi sehingga dapat meningkatkan jumlah produksinya. “Karena ini merupakan program yang membuka peluang untuk penyaluran lebih luas di samping penjualan,” jelasnya seraya mengatakan, bagi Dinas Koperasi, UMKM bisa sukses bukan hanya dalam hal penjualan tetapi juga komunikasi antar pelaku untuk pengembangan usahanya. Kegiatan yang setahun sekali dilaksanakan ini dilakukan oleh pemerintah untuk memberi fasilitas promosi, karena bentuk promosi dilakukan oleh pelaku UMKM sendiri cenderung kecil. Pameran UMKM kali ini telah sukses memfasilitasi dan memberi penyegaran terhadap pelaku UMKM yang ada di Sumut, sehingga akan semakin dapat mengembangkan usaha dan membuka lapangan kerja. (m41)

Penduduk Miskin Sumut 1,3 Juta MEDAN (Waspada): Saat ini 1,3 juta penduduk di Sumatera Utara masih hidup di bawah garis kemiskinan. Itu berarti 10,06 persen dari total penduduk Sumut lebih kurang 13 juta jiwa. Data ini berasal dari Hasil Survei Sosial Ekonomi Nasional dilaksanakan pada Maret 2013. Kepala Bidang Statistik Sosial, Badan Pusat Statistik (BPS) Sumut Sukardi, mengungkapkan, kondisi ini lebih baik jika dibandingkan dengan kondisi September 2012 yang jumlah penduduk miskin sebanyak 10,4 persen. Dengan demikian, ada penurunan jumlah penduduk miskin sebanyak 39.200 orang, atau 0,35 persen. “Selama periode September 2012 hingga Maret 2013, penduduk miskin di daerah pedesaan berkurang 24.000 orang, menjadi 685.100 orang. Sedangkan di perkotaan berkurang 15.200 orang menjadi 654.100 orang. Maka, persentase penduduk miskin di daerah perkotaan sebesar 9,98 persen dan perdesaan sebesar 10,13 persen,” katanya di kantor BPS

Sumut, Senin (1/7). Menurutnya, penurunan jumlah dan persentase penduduk berkaitan dengan sejumlah faktor, diantaranya terjadi deflasi sebesar 2,25 persen, perekonomian Sumut triwulan I 2013 tumbuh sebesar 2,84 persen terhadap triwulan III 2012, sedangkan pengeluaran konsumsi rumah tangga meningkat sekitar 3,39 persen. Serta tingkat pengangguran terbuka mengalami penurunan 0,19 persen. Sementara itu, lanjutnya, pada Maret 2013, garis kemiskinan Sumut memiliki rata-rata pengeluaran sebesar Rp284.853 per kapita perbulan. Untuk daerah perkotaan, garis kemiskinannya sebesar Rp307.352 per kapita per bulan dan untuk perdesaan sebesar Rp263.061 per kapita per bulan. “Dibanding September 2012, garis kemiskinan Sumut pada Maret 2013 naik 4,83 persen. Garis kemiskinan di perkotaan naik 4,16 persen dan garis kemiskinan di pedesaan naik 5,58 persen,” terangnya. (m41)

Saham Perkebunan Dan Manufaktur Melemah JAKARTA (Waspada): Indeks Harga Saham Gabungan (IHSG) Selasa (2/7), ditutup melemah 48,75 poin atau 1,02 persen menjadi 4.728,70. Indeks LQ45 pun tercatat melemah ke 786,33. Pelemahan terjadi di beberapa sektor utama. Yakni, sektor perkebunan ke 1.978,54, sektor sektor infrastruktur ke 1.005,26 dan sektor manufaktur melemah ke 1.282,05. Nilai transaksi tercatat sebesar Rp4,1 triliun dengan volume 3,750 miliar lembar saham. Sebanyak 197 saham melemah, 85 saham menguat dan 79 saham stagnan. Saham-saham yang bergerak melemah (top losers), antara lain PT Goodyear Indonesia Tbk (GDYR) melemah Rp1.700 menjadi Rp21.100, PT Lion Metal Works Tbk (LION) melemah

Rp1.500 menjadi Rp13.000 dan PT Indocement Tunggal Prakasa Tbk (INTP) melemah Rp800 menjadi Rp22.800. Sementara saham-saham yang bergerak menguat (top gainers), antara lain PT Sarana Menara Nusantara Tbk (TOWR) menguat Rp3.550 menjadi Rp28.050, PT Mayora Indah Tbk (MYOR) menguat Rp400 menjadi Rp30.750 dan PT Ultra Jaya Milk Industry & Trading Compa (ULTJ) menguat Rp350 menjadi Rp5.100. Berikut adalah pergerakan saham-saham di Asia. Indeks Hang Seng melemah 144,64 poin atau 0,70 persen ke 20.658.65. Indeks Nikkei tercatat menguat 246,24 poin atau 1,78 persen ke 14.098,74 dan indeks Straits Times pun tercatat menguat 29,86 poin ke 3.170,79. (ant)

Mnc Skyvision Tambah Saluran Baru JAKARTA (Waspada): PT MNC Skyvision Tbk, melalui brand Indovision, TopTV dan Okevision , sebagai operator TV berbayar terbesar di Indonesia memberikan tambahan pilihan hiburan beberapa saluran baru dengan kualitas dunia, yakni Sundance Channel. Saluran baru ini ditujukan untuk pelanggan yang memiliki minat pada genre film independen. Berbagai ragam program pilihan dan menarik dari penayangan perdana drama lokal , pemenang penghargaan film independen dan dokumenter. Di Asia, beberapa tayangan perdana serial pada saluran ini menjadi hits , seperti “Breaking Bad,”“Rectify,”“Mr Selfridge”, juga film-film lainnya yang mendapat perhargaan dari kritikus film independen pada acara Sundance Film Festival tahun ini. Bruce Tuchman, Presiden, AMC / Sundance channel, berkomentar: “Kami sangat gembira untuk kehadiran pertama kalinya saluran ini di Indonesia ada pada Indovision, sebagai pelopor dalam industri tv berbayar dan menjadi salah satu operator televisi berlangganan terbesar di Asia. Kami berharap dapat memberikan hiburan yang terbaik bagi para pemerhati independen program di seluruh wilayah Indonesia. “ Handhi S. Kentjono sebagai Wakil Presiden Direktur PT MNC Sky Vision Tbk, juga mengungkapkan kegembiraan nya mengenai kerjasama yang baru terjalin dengan saluran Sundance ini , “PT MNC Skyvision, Tbk terus mencari cara untuk menawarkan programprogram yang terbaik dan berkualitas pada

para pelanggannya (Indovision & Okevision), dan dengan bangga bersama ini kami mengumumkan kerjasama baru dengan AMC / Sundance , saluran eksklusif untuk penggemar setia film Independen di Indonesia, kami percaya memiliki Sundance saluran akan menjawab permintaan pasar akan kebutuhan pelanggan pada genre ini. Kerjasama baru yang terjalin dengan saluran Sundance akan lebih meningkatkan ikatan yang lebih kuat dengan semua pemirsa kami di Indonesia. “ Sundance Channel akan ditawarkan dalam bentuk single ala carte untuk pelanggan Indovision dan akan dikenakan iuran sebesar Rp. 15,000 / bulannya. Untuk pelanggan Okevision dapat menyaksikan di paket Basic Free Preview dari channel diberikan dari tanggal 22 Juni – 2 Juli 2013 untuk seluruh pelanggan Indovision. Pelanggan Indovision dapat menyaksikan tayangannya di chn no. 23 dan pelanggan Oke Vision dapat menyaksikan di chn. No. 16. Selain Sundance chn, Indovision juga memberikan 2 tambahan saluran baru yaitu : MNC Kids Indovision & Top TV (Chn. No. 42), Oke Vision (Chn. No. 64) Dapat disaksikan oleh seluruh pelanggan Indovision untuk paket mars, venus, galaxy dan super galaxy. Juga ada M Channel Indovision (Chn. No. 166). Ditujukan untuk pecinta musik pop Korea alias K-Pop & K-Entertainment , yang menayangkan musik pop Korea , dengan ragam genre seperti musik, drama, film, gaya hidup, variety show dan sejumlah program Korea lainnya. (rel)



Budaya Pop & Jati Diri


Reformasi Rakyat Mesir Tidak Seperti Indonesia


ltimatum pimpinan militer pada Senin (1/7) memberi waktu 48 jam pada Presiden Mesir Mohammed Mursi untuk berkompromi dengan pihak oposisi, yang mengadakan demonstrasi massal sejak akhir pekan lalu. Situasi di Mesir semakin genting. Besar kemungkinan terjadi perang saudara besar-besaran jika militer tidak tegas atau mengambil alih kekuasaan (kudeta). Tuntutan kubu oposisi hanya satu Presiden Mursi mundur dari jabatannya dan melakukan pemilu dipercepat untuk membentuk pemerintahan baru. Sudah barang tentu tuntutan oposisi itu ditampik mentah-mentah oleh pemerintahan Mursi. Sebab, cara-cara oposisi bertentangan dengan perundangan. Umur pemerintahan Presiden Mursi baru saja setahun. Adalah janggal kalau dalam tempo sesingkat itu Mursi dapat mengatasi berbagai masalah yang terjadi di Mesir akibat pemerintahan diktator Presiden Hosni Mubarak yang represif selama tiga dekade. Hemat kita, pasti ada pihak yang sengaja mengompori dan merekayasa rakyat Mesir untuk turun ke jalan, memanipulasi data seakan pemerintahan Mursi gagal membenahi permasalahan hukum, ekonomi, sosial, termasuk pemberantasan korupsi. Pada pemilu 2012 Mursi menang tipis dengan perolehan 51 persen suara dan berhasil mengalahkan seterunya, mantan Perdana Menteri Ahmed Shafiq yang menyabet 49 persen suara. Menurut data, dari 80 juta penduduk Mesir, sebanyak 25 juta pemilih potensial dilaporkan belum menggunakan hak suara mereka. Oleh sebab itu Mursi tidak menang mutlak dengan meraih perolehan mayoritas suara. Kondisi itulah yang diklaim kelompok oposisi penentang pemerintahan Mursi tidak legalitimed.Maka anggota kelompok oposisi kemudian ramai-ramai membuat sebuah petisi menuntut pengunduran diri Mursi, yang mereka klaim sudah ditandatangani oleh 22 juta rakyat Mesir itu. Memang apabila jumlah itu benar, maka angka tersebut sembilan juta lebih banyak dibandingkan perolehan suara yang diraih Mursi dalam pemilu 2012 dengan pencapaian 12 juta suara. Justru itu, maraknya unjuk rasa menentang dan mendesak Presiden Mursi mundur jelas rekayasa pihak-pihak yang kalah dalam pemilu tahun lalu. Mereka tidak puas dengan cara Mursi memimpin Mesir dan tidak yakin Mesir bisa maju melihat setahun kinerja Mursi yang di bawah harapan rakyat Mesir. Tidak hanya pendukung Capres yang kalah Intisari Ahmed Syafiq saja yang melakukan unjuk rasa turun ke jalan, memenuhi lapangan Tahrir di pusat kota Kairo, tapi juga pendukung Capres ‘Perkembangan Mesir yang kalah lainnya, seperti Amr Musa dan mengkhawatirkan peElbaradai. Ketiganya dikabarkan mendapatkan suplai dana secara langsung dari domerintahan Mursi di nator untuk menggulingkan Mursi. Maraknya ujung tanduk’ kelompok penentang Mursi juga didukung partai-partai yang menikmati privilage di era Hosni Mubarak. Oleh karena itu, aksi penggulingan Presiden Mursi bisa disebut bagian dari agenda Amerika dan Zionis Israel untuk menyingkirkan suara kejayaan kaum Islamis, khususnya kemenangan Ikhwanul Muslimin. Reformasi di Mesir 2011 tidak beda dengan reformasi di Indonesia tahun 1998. Rakyat di kedua negara muak dengan sistem pemerintahan yang zalim, itu ke itu juga, dan memakan waktu panjang berpuluh tahun dengan hasil maraknya KKN di segala bidang. Bedanya, rakyat Indonesia cukup puas dengan menjatuhkan Presiden Soeharto yang berkuasa 32 tahun dan terlihat tidak lagi mengawal jalannya pemerintahan baru. Sedangkan rakyat Mesir pasca menumbangkan rezim Mubarak lewat gebrakan ‘people power’ terus mengawal jalannya pemilu dan tidak membiarkan Presiden Mursi untuk berleha-leha di kursi empuknya. Setahun dinilai gagal lalu dimosi tidak percaya oleh oposisi untuk didesak mundur. Hampir pasti pertumpahan darah besar-besaran akan terjadi kalau Presiden Mursi bertahan dan memobilitasi massa pendukungnya dari kalangan Ikhwanul Muslimin. Tapi, melihat sikap militer yang mengultimatum Presiden Mursi untuk berkompromi dengan pemimpin oposisi besar kemungkinan militer akan mengambil alih kekuasaan, seterusnya membentuk pemerintahan sementara untuk menyelenggarakan pemilu yang dipercepat sesuai keinginan oposisi. Apalagi komunikasi Mursi lewat telepon dengan Presiden Amerika Serikat Barack Obama pada Senin (1/7) lalu tidak jelas hasilnya. Kalau saja Amerika mendukung pengunjuk rasa maka posisi Mursi di ujung tanduk. Apalagi sejumlah menterinya sudah mundur, itu pertanda buruk buat Mursi. Perkembangan di Mesir tampaknya semakin mengkhawatirkan. Jumlah korban bisa meledak jika pemerintahan Mursi menggunakan cara-cara represif. Tapi, cara kekerasan itu tidak dilakukan Mursi karena dia yakin mayoritas rakyat Mesir masih di belakangnya. Itu pula sebabnya Mursi tidak merespon desakan mundur dari oposisi. Sebab, dasarnya lemah dan tidak demokratis. Bahaya jika presiden bisa diganti seenaknya di tengah jalan. Sebaiknya rakyat Mesir sabar dan memberi peluang Mursi lima tahun memimpin Mesir, dan dijatuhkan saat pemilu dengan tidak lagi memilihnya jika dianggap gagal. Sehingga tidak terjadi pertumpahan darah.+


Faks 061 4510025

Facebook Smswaspada

+6282370451241 Banyaknya aksi perampokan, pencurian dan pembunuhan di area Sumatera Utara, maka diharuskan para Kepala Lingkungan, Kepala Lorong memberlakukan Sistem Keamanan Lingkungan (Siskamling) atau ronda keamanan kampung bagi warga lingkungannya. Dengan adanya Siskamling atau ronda keamanan kampung dapat menghindari terjadinya aksi kejahatan manusia biadap yang tak berprikemanusiaan. +6281375629692 Air Pam kami berlumpur dan berminyak. Kami sudah melapor ke cabang PDAM terdekat, tapi sepertinya tidak ada tanggapan. Kami harus bayar mahal untuk air limbah seperti ini. Mohon perhatian dank e profesionalannya. +6285277850101 “TERJEBAK”. Presiden SBY berhasil dijebak oleh penganut agama sempalan dunia khususnya di Indonesia dengan memberikan piagam penghargaan toleransi (award) di Amerika.Toleransi kehidupan umat beragama (mayoritas dan minoritas) di Indonesia berlangsung sangat indah dan harmonis. +6287767400564 MAHASISWA yg dri pge mpek mlam krjany ggk karuan... dri Putra Tapsel. +6285276248596 Saya sangat mendukung sekali..kepada bapakWH.mengenai razia pakaian muslim. jilbab. jangan bosan2 nya adakan razia secara rutin. karena siapa lagi kalau bukan kita semua yg jaga.krnatanyasudahmggakadasopannyacaraberpakaian.yglaki-lakisopankokyangperempuan malah nampakkan aurat. +6281385066033 “PARADIGMA BARU PEMBANGU NAN KABUPATEN TAPANULI SELA TAN BERBASIS KELAUTAN” mhn dukungannya Pak Gubernur, trims +6281264100513 Majelis Ulama Indonesia (MUI) brsama Pimpinan Ormas Islam , Alim Ulama , Intelectual Muslim , Para Rektor Perguruan Tinggi Islam Negeri/Swasta , para Pimp Pondok Pesantren , para Pimp Ormas Perempuan Islam (POPI) para Pimp Partai Politik berbasis Islam diminta utk mmenyikapi kebijakan Pimpinan Polri yg MELARANG POLISI WANITA MUSLIMAH INDONESIA MENGENAKAN JILBAB SAAT MENJALANKAN TUGAS , krn kebjkan sprti ini adlh KEBATHILAN YANG NYATA yg terang2an dialakukan dihadapan Allah SWT yg menciptakannya. Wahai Kapolri : “ BERSEGERALAH PD KEAMPUNAN ALLAH YG MENCIPTAKANMU “. Na’uzu billahi min zaliq. +6285260910703 Hampir 1 Tahun pasangan ZIKIR meminpin di Aceh janji apa yang sadah di tepatin untuk Rakyat Aceh ? . . . . , +6282160731505 Maju terus...PKS Jangan takut ‘Out dari Setgab’nya SBY Berjuanglah demi Lillahi Taala Pasti Allah SWT akan memberikan bonus Pada pemilu 2014 elektabilitas PKS akan melonjak meng’KO’ kan parrai ber kuasa PD...Insya Allah PKS membela rakyat miskin bukan BLSM yang diharapkan rakyat +6285270019745 Untukmu ASAHANKU INGATKAN 1.KPU publikasi anggotamu sebelum mempublikasikan kekayaan CALEG = KPU CALEG 2.TNI/POLRI :Aman/ Tertib KAMUPLASE 3.PARTAI/PARTY +6281262018727 MELIHat situasi polisi yg salah tangkap sja rakyat korban. Truus. DPR komisi 3 tiga sgr menyatukan kembali TNI polri. Ini tdk bisa rakyat makin korban. Panglima. Dan pangdam harus turun tangan. Segera.

WASPADA Rabu 3 Juli 2013

Oleh Dr Drs H.Ramli Lubis, SH, MM Masuknya budaya popular telah menguasai perilaku anak bangsa adalah realitas atas berkuasanya budaya asing


alah satu fundamen berbangsa dan bernegara adalah nilai budaya yang difahami sebagai akar pemersatu dan jati diri bangsa itu sendiri. Tapi sudah lazim difahami bahwa budaya bangsa Indonesia telah tergerus budaya popular yang datang dari bangsa-bangsa lain. Akselerasi media massa menjadi indikator utama bagi transfer budaya baru yang difahami oleh khususnya generasi muda bangsa ini. Kondisi seperti ini dengan cepat bisa difahami ketika membandingkan produk budaya asing melalui media massa, disampaikan kepada khalayak di negeri ini. Film Hollywood atau film Korea misalnya, berapa kali disiarkan televisi kita dalam sehari? Secara bergantian, hampir setiap hari khalayak Indonesia menyaksikannya. Lantas bandingkan dengan produk budaya lokal yang ditonton publik di Amerika ataupun di Korea misalnya. Dengan segera kita akan menemukan ketimpangan data yang mencolok tajam. Kecenderungan publik sering menjadi kambing hitam dari kondisi seperti ini. Meluasnya gelombang pembuatan film-film di Hollywood, mendorong para pakar sosial untuk mengeluarkan peringatan tentang dampak negatif film tersebut terhadap institusi keluarga. Peran penting media sinema dalam mengubah moral masyarakat dan keluarga telah sedemikian strategisnya—jika metode itu mengarah pada keruntuhan masyarakat, maka tidak ada lagi yang bisa dilakukan. Budaya popular itu, sayangnya bukanlah suatu produk yang bebas nilai. Sebut saja kepentingan ideologi feminisme, liberalisme, sekularisme, pluralisme, multikulturalisme dan lainnya. Ambil contoh pemikiran tentang feminisme— mengalami perluasan seiring tuntutan legalisasi perkawinan sesama jenis di beberapa negara, terutama di Amerika Serikat. Acara televisi seperti The Kids Are All Right, ABC’s Modern Family and Fox’s Glee, menganggap hubungan seperti itu sebagai hal yang wajar. Atau seperti film yang telah pula masuk ke Indonesia seperti Brokeback Mountain dan beberapa judul lainnya, adalah serangan

budaya yang terang-terangan memromosikan kehidupan gay. Ideologi Pancasila Masuknya budaya popular telah menguasai perilaku anak bangsa adalah realitas atas berkuasanya budaya asing memermainkan menggerakkan jiwa dan pikiran. Padahal di negeri ini telah memiliki ajaran agama dan budaya lokal sebagai basis dan ideologi Pancasila yang ditanamkan melalui sistem pendidikan yang berlaku. Namun kencangnya hantaman globalisasi dengan segala bentuknya telah melemahkan jati diri bangsa ini. Identitas keindonesiaan sedikit banyak telah dipengaruhi perilaku masyarakat kapitalis. Bahkan tidak sedikit yang berpendapat bahwa perilaku masyarakat telah meleceng dari yang digariskan ideologi Pancasila. Berbagai macam ketimpangan yang berkembang di tengah masyarakat hingga menimbulkan lunturnya jati diri bangsa itu berdampak pada keterpurukan bangsa ini ke dalam krisis multidimensi, bahkan sudah mengarah ke krisis ideologi bangsa. Padahal, sebagai ideologi bangsa, Pancasila mesti selalu diaplikasikan ke dalam perilaku kehidupan dalam rangka berbangsa, bernegara dan bermasyarakat. Pada kenyataannya Pancasila memang menjadi hal yang lazim diteriakkan dalam retorika maupun dalam pernyataan-pernyataan yang bernada “tegas”. Kita kerap mendengar bahwa ideologi Pancasila sudah final, siapapun yang mencoba mengutak-atik Pancasila akan berhadapan dengan seluruh elemen bangsa dan negara, dan semboyan lainnya. Tapi tidak jarang perilaku orang yang akan memerjuangkan Pancasila itu justru tidak sesuai atau malah bertentangan dengan nilai-nilai Pancasila. Ini juga sebuah ironi, karena secara sadar orang mengetahui Pancasila sebagai dasar negara, namun tanpa sadar ia telah melakukan penyimpangan nilainilai Pancasila. K-Pop Di samping budaya Barat yang digawangi Amerika Serikat, belakangan muncul pula serangan budaya Korea

Selatan atau yang disebut K-Pop. Produk-produk industri hiburan negeri gingseng itu seperti film, sinetron, penyanyi, video game, animasi, sampai makanan telah menjadi idola baru di negeri ini. Hallyu atau serangan gelombang kebudayaan Korea Selatan ini memang bukan kepada Indonesia saja, tapi merambah ke seluruh dunia. Dari data yang ada, ekspor industri hiburan Korea dimulai sejak akhir tahun 1990-an ke berbagai negara di Asia, seperti Jepang, China hingga negara-negara di Asia Tenggara. Kita mungkin ingat drama Korea seperti Winter Sonata, Endless Love, My Sassy Girl Choon hyang, Full House, atau Boys Before Flower, yang diputar di stasiun televisi lokal telah menandai datangnya hallyun. Tahun 2011 Korean Creative Content Agency mencatat nilai target ekspor konten hiburan mencapai nilai US$3,8 miliar atau sekitar Rp32,5 triliun. Jumlah itu meningkat tajam dibandingkan tahun 2007, yang mencatatkan ekspor konten hiburan sekitar US$1,4 miliar atau sekitar Rp12 triliun. Serangan budaya Korea ini akan lebih berdampak pada negara-negara yang memiliki pondasi budaya yang lebih rapuh. Indonesia adalah salah satu contohnya. Dengan serta merta demam Korea melanda remaja neger ini. Lihatlah potongan ala Korea, telah demikian cepat mewabah. Korea pun menjadi negeri tujuan orang-orang Indonesia yang beruit. Vice President Cor-

porate Comunication Garuda Indonesia, Pujo-broto mengatakan, rute perjalanan Ja-karta-Seoul meningkat tajam, lebih dari 90 persen. Seiring semakin dikenalnya budaya Korea, maka budaya lokal semakin dilupakan. Akar budaya yang semestinya menjadi pondasi berbangsa dan bernegara telah berganti dengan pondasi yang didatangkan dari luar negeri. Tak jarang pijakan budaya anak bangsa saat ini adalah budaya Barat ataupun Korea. Penutup Untuk menjadi bangsa yang maju dan berkembang, Indonesia mesti memiliki karakter yang kuat yang membedakannya dengan negara-negara lain. Tapi karakter yang bersandar pada budaya lokal itu pula yang tergerus oleh serangan budaya asing yang apabila terus berlangsung maka kita akan kehilangan jati diri. Efektivitas serangan budaya asing itu hanya akan terjadi apabila pondasi kebangsaan yang ada memang rapuh dan gampang tergantikan. Karena sepanjang akar budaya yang kita miliki tertanam kuat, maka serangan budaya asing hanya akan menjadi selingan belaka. Oleh karenanya ketika budaya popular sebagai produk asing telah menjadi “ideologi” baru bagi generasi muda, tentu ada yang salah dalam penyemaian ideologi dasar bangsa ini. Penulis adalah Mantan Wakil Wali Kota Medan.

Mengembalikan Trust Yang Hilang Oleh Zulkarnain Lubis Tidak ada jalan lain, untuk mengembalikan trust kecuali dengan membuat kita menjadi orang yang layak dipercaya, sehingga masing-masing kita menjadi saling percaya.


eberapa hari lalu saya dimintai komentar oleh wartawan salah satu media massa di Medan tentang demo kelompok masyarakat khususnya mahasiswa yang menolak dinaikkannya harga BBM. Jawaban saya adalah bahwa kita sudah kehilangan trust atau hilangnya rasa saling pecaya. Banyak orang sudah tidak percaya lagi apapun yang diucapkan pemerintah karena diyakini bukanlah apa yang sesungguhnya terjadi. Sama halnya dengan kenaikan harga BBM atau lebih tepat lagi adalah pengurangan subsidi BBM. Apapun dalih, argumen, statemen, alasan, rasionalitas, ataupun pembenaran terhadap pengurangan subsidi tersebut, masyarakat pendemo tidak memercayainya. Akibatnya muncul ungkapan penolakan dengan melakukan demo yang sayangnya berbuntut tindakan anarkis, perusakan dan pembakaran terhadap sarana publik dan milik warga masyarakat. Saya tidak akan membahas aksi anarkis dan perusakan tersebut, karena menurut saya jika ada unsur pelanggaran hukum dalam aksi ini, sebaiknyalah diselesaikan melalui jalur hukum. Saya lebih berminat membahas hilangnya rasa percaya yang menurut saya menjadi latarbelakang munculnya aksi besar-besaran menentang kebijakan tersebut. Saya sangat meyakini inilah yang semakin menipis di negeri ini— hilangnya rasa percaya dari yang dipimpin terhadap pemimpinnya, pemimpin terhadap yang dipimpinnya, antar sesama pemimpin, antar sesama rakyat, rakyat terhadap pemerintahnya, pemerintah terhadap rakyatnya, antar sesama unsur pemerintahan, antar sesama anggota legislatif, dan antara pemerintah dengan legislatifnya. Apa yang diucapkan pejabat publik kurang dipercaya karena sering kali lain di hati, lain yang dimaksud, lain yang diucapkan dan lain lagi yang dilaksanakan. Alasan yang disampaikan yang katanya melandasi sebuah kebijakan sering kali dianggap berbeda dengan alasan yang sesungguhnya. Seringkali dalih yang diungkapkan dianggap tidak sesuai kenyataan. Inkonsistensi, hipokrit, munafik, kebohongan, kecurangan, janji-janji palsu adalah hal biasa dipertontonkan dan dipertunjukkan yang digunakan untuk mengelabui motivasi sesungguhnya, niat dan tujuan sebenarnya. Inilah yang jadi penyebab hilangnya rasa saling percaya atau trust sebagaimana diuraikan di atas. Lembaga-lembaga yang mestinya layak dipercaya, semakin hari semakin

kurang dipercaya. Lembaga pendidikan tidak begitu dipercayai sebagai tempat mencari ilmu, tidak diyakini sebagai tempat ideal mendidik manusia berkarakter, beretika, bermoral, dan berbudi luhur. Lembaga agama dan organisasi keagamaan mulai diragukan keikhlasannya membimbing umat taat terhadap ajaran agama. Banyak yang menilai lembaga keagamaan telah ternodai kepentingan politis, ekonomis, maupun pragmatis. Lembaga peradilan yang semestinya menjadi tempat yang dipercaya mencari keadilan, justru sering dirasakan sebagai tempat diperjualkannya keadilan. Seringkali rakyat menyaksikan yang salah dibenarkan, yang benar menjadi disalahkan, yang harusnya menang dikalahkan, serta yang mestinya kalah dimenangkan. Untuk sebuah kesalahan kecil, seseorang harus menerima ganjaran berat, sementara pelaku penyimpangan berat hanya dijatuhi hukuman ringan. Demikian juga di legislatif kita, lembaga yang semestinya menyuarakan suara rakyat, lebih sering tampil menyuarakan kepentingan pribadi dan kelompoknya. Lembaga yang mestinya tampil membela rakyat tak berdaya, justru lebih sering garang mengurus dan membela kelompok yang punya kuasa dan dana. Suara rakyat dijadikan sekedar komoditas yang diperjualbelikan sesuai keperluan. Ketika pemilihan tiba, rakyat dibujuk dengan berbagai fasilitas dan sarana, namun ketika usai pemilihan, dan mereka telah berjaya, rakyat dilupakan. Jadi jika ada demo BBM sampai anarkis, karena demikianlah yang dipertontonkan kepada mereka, tindak kekerasan dimana-mana, kebohongan menjadi hal biasa, dan kepalsuan menjadi perilaku yang semakin kentara. Ketika wartawan menyanyakan apakah ada kaitannya pola rekrutmen mahasiswa dengan tindakan anarkis yang dilakukan saat demo, saya katakan tidak setuju dengan statemen tersebut. Mahasiswa adalah bagian dari masyarakat dan sumbernya juga berasal dari masyarakat, mahasiswa bukanlah komunitas khusus yang terlepas dari masyarakat secara keseluruhan. Jadi apa yang dilakukan mahasiswa adalah juga cerminan dari perilaku masyarakat. Karena itu, mahasiswa juga tidak bisa diistimewakan dan seolah mendapatkan perlakuan khusus terhadap tindakan yang dilakukannya. Saya juga tidak setuju jika anarkisme yang dilakukan mahasiswa terkait tidak

efektifnya masa perkenalan kampus dalam membina mental dan karakter mahasiswa. Masa perkenalan kampus yang waktunya paling lama satu minggu, tidak akan bisa mengubah watak mahasiswa baru, apapun kurikulum dan silabus dari materi yang diberikan. Faktor penyebabnya adalah perilaku dan tindakan yang mereka lihat di sekelilingnya. Lingkungannyalah yang memberi contoh kekerasan dan pemaksaan kehendak yang dipertontonkan para orang tua mereka termasuk para pemimpinnya. Jadi tidak ada jalan lain, untuk mengembalikan trust kecuali dengan membuat kita menjadi orang yang layak dipercaya, sehingga masing-masing kita menjadi saling percaya. Tentu saja syarat untuk bisa dipercaya, tiada lain kecuali menjadikan kita orang yang jujur pada diri sendiri dan kepada orang lain. Jadi dengan membangun kepercayaan melalui gerakan kejujuran, diharapkan terwujud rasa saling percaya. Untuk itulah diperlukan pemimpin jujur, pejabat jujur, anggota legislatif jujur, penegak hukum jujur, pendidik jujur, mahasiswa jujur, pengusaha jujur, tenaga medis jujur, pelayan publik dan birokrat jujur, pekerja jujur, petani jujur, yang akhirnya rakyat jujur. Jika demikian halnya, rakyat akan sami’na wa ato’na terhadap kebijakan pemerintah, demo memrotes keputusan pemerintah juga akan hilang karena diyakini apapun yang dirancang pemerintah adalah terbaik untuk rakyat. Kebijakan yang dibuat adalah kebijakan tulus untuk kepentingan rakyat, sehingga jika rakyat diminta berkorban, maka rakyat akan bersedia karena yakin bukan hanya mereka saja yang berkorban tapi semua berkorban termasuk pemimpin dan pejabatnya. Jadi akan ada perasaan senang samasama senang dan susah sama-sama susah. Jika ada yang menderita, semua merasa menderita, dan jika ada yang berbahagia, semua juga merasa bahagia. Tentu saja jika kondisi ini yang sudah didapatkan, maka semua elemen akan berjalan sesuai tugas dan fungsinya, mahasiswa akan lebih fokus dan serius belajar dan mempersiapkan dirinya untuk menata masa depannya, mereka tidak terlalu risau lagi akan masa depannya karena yakin lapangan pekerjaan akan tersedia yang akan diperebutkan secara fair dan jujur. Para guru dan dosen akan bekerja dengan sebaik-baiknya karena kesejahteraannya akan betul-betul diperhatikan dan haknya tidak dipersulit dan disunat lagi. Para penegak hukum akan menjalankan tugasnya secara adil dan tegas, sehingga semua elemen masyarakat diposisikan sama kedudukannya di hadapan hukum. Pelayan publik dan birokrat juga akan bekerja secara profesional dengan kesejahteraan terja-

min, sehingga tidak berpikir lagi untuk korupsi dan kolusi karena jika ketahuan berbuat menyimpang akan ditindak tegas. Pengusaha juga akan bekerja jujur dengan tidak memainkan takaran dan kualitas barang dan jasa, pengusaha tidak lagi berbuat curang dan tidak berkolusi dengan pejabat pengambil keputusan untuk mendapatkan proyek yang diinginkannya. Dengan demikian, melalui gerakan kejujuran, diharapkan akan tumbuh kepercayaan dan dengan tumbuhnya kepercayaan, pada gilirannya kita akan terhindar dari segala hal negatif yang selama ini membelenggu dan menyandera bangsa ini. Mulai dari inefisiensi, ekonomi biaya tinggi, mutu SDM kelas teri, tindakan diskriminasi, praktek manipulasi, janji-janji yang selalu diingkari, buruknya layanan transportasi, lambannya birokrasi, proyek fiktif yang mengelabui, markup anggaran untuk komisi, politik dagang sapi, demonstrasi anarki, sampai kepada korupsi dan kolusi. Jadi, berdayakan hati nurani. galakkan kejujuran, dan kembalikan kepercayaan! Penulis adalah Guru Besar UMA Dan UISU.

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengandisertaiCDataumelaluiemail: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkandiMediamanapun.Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Gubsu: Utang Pemprovsu dibayar cicil - Kapan lunas nya mas, he...he...he * Peserta Konferensi APEC dirampok - Bertambah buruk citra kota awak! * Penduduk miskin Indonesia turun 0,52 persen - Penerima BLSM membludak


D Wak


WASPADA Rabu 3 Juli 2013


Menyelamatkan Taman Beringin SambunganSombongDanBid’ah Kepada Yth Dokter Arifin Siregar Menurut saya yang dikatakan Bid’ah itu adalah sbb: 1. Ia mengaku Nabi dan Rasul 2. Ia mengaku sudah di Isra’ Mikrajkan Allah ke langit. 3. Ia mengubah bahasa Alqur’an ke bahasa Indonesia. 4. Ia mengubah cara shalat. 5. Ia mengubah shalat dengan bahasa Indonesia. 6. Ia mengubah penafsiran Alquran menurut kemauannya. 7. Ia mengingkari sunnah dengan mengubah syahadat 8. Ia membolehkan beristri lebih dari 4 orang dan lainnya. Inilah yang disebut Bid’ah di atas Bid’ah, ataupun sesat lagi menyesatkan, bahkan sudah dicap murtad keluar dari agama Islam, masuk neraka, kekal selama-lamanya. Dan mudah-mudahan dokter Arifin Siregar, tidak lagi bersikeras membid’ahkan pada edisi 15 Mei 2013, yang berjudul Sombong dan Bid’ah dan disitu sudah tercantum malam-malam yang di bid’ahkan Arifin Siregar, termasuk tambahan 23 rakaat shalat sunat tarawih dan witirnya, dan lainnya. Ataupun dokter mudah-mudahan tidak dicap sebagai orang yang sombong, seperti iblis. Karena merasa paling tinggi ilmunya, melebihi, ulama, Kiai, Ustadz, tokoh agama, tokoh masyarakat dan lainnya. Wallahualam. Sipenulis hanya berpendidikan tingkat Tsanawiyah tahun 1970 Madrasah Musthafawiyah Purba, Kabupaten Tap. Selatan sebelum di mekarkan menjadi Kabupaten Madina. Medan, 28 Juni 2013 Nama dan alamat ada pada Redaksi

Pernyataan Sikap Sejak ditetapkannya Bupati Tobasa KS sebagai tersangka dugaan korupsi pelepasan lahan untuk akses pembangunan pusat listrik tenaga air (PLTA) Asahan III di dusun batu Mamak, Desan Meranti Utara, Kecamatan Pintu Pohan Meranti, Kabupaten Tobasa oleh penyidik ditreskrimsus Poldasu. Masyarakat percaya dalam waktu yang tidak terlalu lama, tersangka akan segera ditahan di sel Poldasu dengan ukuran kamar 2 x 2 meter. Harapan ini merupakan hadiah yang diberikan Kapolda Lama kepada masyarakat. Namun hingga sampai aksi unjuk rasa ini dilakukan, tersangka masih berkeliaran dengan bebasnya, tanpa rasa bersalah sehingga wajar bila rakyat kecil mengatakan bahwa hukum tumpul keatas, tetapi tajam kebawah. Lembaga pemantau dan pengawasan pembangunan Sumatera Utara (LP3SU) menduga ada kekuatan partai penguasa yang menekan penyidik Poldasu untuk tidak menahan tersangka dugaan korupsi pelepasan lahan PLTA Asahan III, baik secara langsung maupun tidak langsung. Padahal ketika penyidik Poldasu menetapkan bupati Tobasa KS sebagai tersangka dugaan korupsi pelepasan lahan yang telah merugikan negara Rp. 5.903.884.164 (hasil Audit BPKP Sumut), rakyat sangat gembira dan salut mendengar keberanian Kapoldasu menetapkan seorang pejabat daerah sebagai tersangka. Namun keberanian Kapoldasu untuk menahan tersangka, ternyata belum sebesar ketika menetapkannya sebagai tersangka, sehingga tersangka masih dapat menghirup udara bebas dan menikmati lemahnya penegakkan hukum di negara ini. Rakyat pesimis terhadap penegakan hukum di Sumatera Utara, yang cenderung tebang pilih, dan hukum, keadilan dan kebenaran masih kalah oleh penguasa yang jahat dan korup. Menyikapi belum ditahannya tersangka dugaan korupsi, lembaga pemantau dan pengawasan pembangunan Sumatera Utara (LP3SU) mendesak kepada: 1. Kapolda Sumatera Utara untuk segera menangkap dan menahan tersangka bupati Tobasa KS dalam kasus dugaan korupsi pelepasan lahan untuk akses pembangunan PLTA Asahan III, yang telah merugikan keuangan negara miliaran rupiah. Penahanan ini bertujuan memberi efek jera kepada setiap pejabat yang diduga melakukan korupsi dan penyalahgunaan wewenang. Selain itu juga, penyidik dapat menjaga agar tersangka tidak menghilangkan barang bukti dan tidak mempengaruhi saksi-saksi selama belum ditahan. 2. Kapolda Sumatera Utara untuk menyita seluruh harta tersangka yang berasal dari hasil korupsi dan pencucian uang. Baik dalam bentuk harta bergerak dan tidak bergerak, terkhusus uang tersangka yang berada di Bank pemerintah dan Bank Swasta untuk di blokir secepatnya agar tidak dapat dipindahtangankan kepada orang lain. 3. Kapolda Sumatera Utara terkhusus penyidik Ditreskrimsus Poldasu untuk menerapkan pasal berlapis kepada tersangka dugaan korupsi dengan mengacu kepada UU tindak pidana pemberantasan korupsi nomor 31 tahun 1999 yang telah dirubah dan diperbaharui dengan UU nomor 20 tahun 2001, UU Kehutanan dan UU tindak pidana pencucian uang. 4. Menteri Dalam Negeri (MENDAGRI) untuk menonaktifkan atau memberhentikan sementara Bupati Tobasa KS dari jabatannya, agar lebih fokus menyelesaikan masalah hukum yang dihadapinya. Sikap ini juga sesuai dengan etika dan norma yang selalu di sampaikan oleh Presiden SBY kepada pimpinan pemerintah daerah provinsi dan kabupaten, bahwa pejabat pemerintah dan pimpinan partai politik yang statusnya telah menjadi tersangka di minta secara sukarela untuk mengundurkan diri atau nonaktif dari jabatannya, dan lebih fokus mengurusi kasus hukum yang menimpanya, sehingga pelayanan pemerintahan tidak terganggu. 5. Demikianlah pernyataan sikap ini dibuat, kiranya hukum dapat ditegakkan sehingga kebenaran terungkap dan keadilan dapat dirasakan oleh semua orang yang mencintai pemberantasan korupsi tanpa tebang pilih. Salam Anti Korupsi Korlap LP3SU Sahala Saragi

PDAM Tirtanadi Medan Mengirim AirBerlumpurDanBeraromaBauk Sungguh menyedihkan dalam satu tahun belakangan ini PDAM Tirtanadi Medan, mengirimkan air lumpur, busuk dan berbau ke rumah penduduk sebagai pelanggan PDAM. Saya tidak tahu kemana hati nurani mereka yang mengelola air minum yang jauh dari hygenis sehingga sampai hati mengirimkan air yang kotor, busuk dan berlumpur itu. Kamar mandi dan bak air mandi tiap malam berkarat dan berlumpur, dan harus setiap hari di bilas dan dicuci yang akan menguras air habis, padahal air hanya datang dari jam 23-24 malam sampai jam 5 pagi. Kami melaporkan dan mohon bantuan kepada Bapak Gubernur SUMUT, Walikota Medan sebagai yang berwenang di SUMUT, agar mengganti para Direksi PDAM Medan yang tidak peduli pada kebersihan, kesehatan, kwalitas dan kwantitas dari air minum di kota Medan, karena sudah sangat keterlaluan. Kami juga menghimbau agar ketua BPKP Provinsi benar-benar mengaudit pengelolaan air minum, baik distribusi, pemakaian bahan baku pembersih air dan membandingkannya dengan Singapura yang harus membeli dua sungai (pipa) besar dari Malaysia sebagai bahan baku air minum tetapi masih dapat mensuplai air “murah” dan melimpah di Singapura. Yang terakhir kami juga mengadukan hal ini kepada Dinas Kesehatan Kota Medan, Dinas Kesehatan tingkat I Sumatera dan Ketua YLKI agar sungguh-sungguh mengawasi dan memperhatikan akan kebersihan, kesehatan, kelancaran dan kwalitas air di kota Medan. Jangan hanya duduk-duduk atau tinggal diam saja, rutin misalnya sekali atau dua kali sebulan adakan pengecekan kwalitas air minum PDAM Medan di semua Kecamatan Kota Medan. Pertanyaan saya kepada YLBH, apakah PDAM Tirtanadi dapat dilaporkan kepada POLRI dengan delik aduan penghinaan atau penipuan karena mengirim air busuk, kotor dan berbau ke rumah pelanggan yang taat membayar rekening airnya pada hal yang dibayar adalah air bersih bukan air kotor?? Terima kasih bapak redaksi. Medan, 22 Juni 2013 Pelanggan PDAM Tirtanadi Medan, NPA/NPAL: 2012100003 Philips Sitanggang Jln. P. Banting II/Mestika gg. Amal 06/28 B Medan

Oleh Budi Agustono Belum lama ini ada upaya mengalihfungsikan hutan kotaTaman Beringin menjadi tempat ibadah.Mendengar ini,para pecinta keindahan dan lingkungan kota menolak rencana itu.


i penghujung Juni lalu hutan kota Taman Beringin Medan tidaksepertibiasanya.Padahari Minggu 30 Juni lalu suasana taman yang berlokasi depan rumah dinas Gubernur Sumatera Utara di Jalan Sudirman ini tampak meriah, ramai dan sumringah. Pelataran salah satu hutan kota Medan ini dipenuhi lelaki dan perempuan muda memakai kaus hijau yang bagian depannya bertulis, save hutan kotaTaman Beringin. Di saat yang sama ada pembacaan puisi, musik dan jajanan lokal yang menjual dagangannya untuk memeriahkan dan berpartisipasi dalam rangkaian acara. Di pojokTimurTaman Beringin kaum muda yang tergabung dalam Komunitas VespaTua (Congo) memamerkan kendaraanrodaduanyasambilmenikmatimusik dan pembacaan pusi yang ditampilkan Komunitas Sastra Indonesia. Seorang perempuan muda lulusan FISIP USU menyandang gitar melantunkan tembang apik Michael Jackson dan Jessie J, PriceTag. Penampilan perempuan muda berkerudung dengan jaket hitam yang menutup tubuhnya memukau pengunjung. Ia memeroleh tepuk tangan setelah menyelesaikan lagu hits dari kedua penyanyi terkenal itu. Di tempat yang sama ada pengunjung yang ingin tahu memutar-mutar alat pembuatbiogorimenusukbumi.Bioforiadalah lubang di dalam tanah yg terbentuk akibat berbagai aktivitas organisme di dalamnya,seperti cacing, tanaman,dan fauna tanah lainnya. Lubang-lubang yang terbentuk akan menjadi tempat mengalirnya air di dalam tanah. Bila lubang ini dibuat dalam jumlah banyak akan menyerap air sehingga mengurangi bahaya banjir. Alat pembuat biofori ini ditampilkan dan dipraktikkan pengunjung tidak lain untuk

menggedor kesadaran pengunjung tentang pentingnya pencegahan banjir. Acara ini rupanya tidak berhenti di sini, tetapi masih ada pembagian payung pemberian warga sebanyak 423 payung yang diorganisir komunitas warga peduli lingkungan dan keindahan kota. Angka 423 adalah usia Kota Medan yang jatuh hari kelahirannya 1 Juli lalu. Pada saat yang sama lelaki dan perempuan muda yang berkaus hijau itu berlalulalang mengatur, membimbing dan memotret berbagai aneka kegiatan di taman ini. Mereka adalah penggiat penghijauan kota Medan yang tergabung dalam KomunitasTamandan Komunitas Hijau. Komunitas ini berkolaborasidenganbelasan komunitas warga nirlaba meng-gelar Medan Community Festival dalam kaitannya dengan Hari Kelahiran Kota Medan ke 423 di hutan kota Taman Beringin.Tujuan festival, selain warga kota berpartisipasi merayakan hari kelahiran kota Medan, juga ingin mem-bahanakan, mewartakan dan menyam-paikan pesan mulia bahwaTaman Be-ringin di jantung kota harus diperhatikan, dihijaukan dan dirawat untuk kesehatan dan estetika kota. Taman kota adalah simbol kesehatan danestetikakota.Simbolkesehatankarena dengan terawatnya taman kota yang di sekelilingnya ditanami aneka macam tumbuhan hijau dapat menjadi sumber perbaikankualitasoksigenbagikehidupan. Manusiamemerlukanoksigen.Jikakualitas oksigen terdisrupsi maka kesehatan

manusia akan menurun. Estetika terkait keindahan. Keindahan kota berdekatan dengan keberadaan taman kota. Makin banyaktumbuhanhijauditamankotamaka keindahan dan kenyamanan kota akan dirasakan warganya.Warga yang merasakan denyut kesehatan dan estetika kota akan mengapresiasi pemerintahnya. Tumpulnya Estetika Belum lama ini ada upaya mengalihfungsikan hutan kota Taman Beringin menjadi tempat ibadah. Mendengar ini, para pecinta keindahan dan lingkungan kota menolak rencana itu. Penolakan ini bukan didasarkan tidak senang atas berdirinya tempat ibadah, tetapi karena Taman Beringin tidak layak dan di luar akal sehat publik jika dijadikan tempat ibadah.Tempat ibadah dapat didirikanditempatlaintetapi tidak taman kota. Jika Taman Beringin dialihfungsikanmenjadi tempat ibadah, Jalan Sudirman akan mengalamikemacatan luar biasa. Kota Medanakankehilangan paru-paru kota. Saat ini hampir setiaphariTamanBeringin didatangi pengunjunguntukberekreasi, melepaskan lelah, berkumpul dan berdiskusi. Taman yang didirikan tahun 1971 ini lokasinya cukup strategis dan publik mudah mengunjunginya. Layaknya taman kota, Taman Beringin tidak terlalu luas, tetapi di sekelilingnya bertumbuhan tanaman hijau. Untuk merawat penghijauan Taman Beringin ini Komunitas Taman berinisiatif membuat sangkar burung Merpati di atas pepohonan dengan mengajak warga kota membeli sepasang burung Merpati. Burung Merpati yang merupakan lambang perdamaian ini dikumpulkan dan dilepas beramai-ramai di taman ini. Dalam waktu tertentu Merpati akan pulang ke sangkar yang dibuat di atas pepohonan hijau di sekitar taman. Mereka lakukan ini tanpa

mengiba bantuan keuangan pemerintah kota Medan. Inilah ekspresi pelibatan komunitas kota atas keberlangsungan hidup Taman Beringin. Kecintaan warga kota Medan, yang tergabung dalam komunitas pecinta lingkungan dan keindahan kota, terhadap TamanBeringincukuptinggi.Merekaingin menyaksikan Medan menjadi kota hijau yangmemproteksiruanghijaudariincaran kepentingan modal besar. Secara kasat matapublikseringmenyaksikanalihfungsi ruang hijau bukan untuk memperindah dan menghijaukan kota, tetapi justru malah memroduksi kesemrawutan tata ruang kota akibat kong kalikong antara pemerintah kota dengan pemilik modal yang menubruk cetak biru pembangunan kota. Karena itu dapat dimengerti jika komunitas warga yang menjadi bagian penting komponen masyarakat sipil kota menolak hutan kota Taman Beringin dialifgungsikan dalam bentuk apapun. Dengan terselenggaranya Medan CommunityFestivalyangmerupakanlaku protes puluhan komunitas warga. Kiranya dapat membuka nurani dan mata hati pemerintah kota yang mengalami penumpulan budaya dan estetika akibat lebih mementingkanlogikapragmatissesatyang tidak futuristik ini untuk tidak meneruskan rencana alihfungsi hutan kotaTaman Beringin. Seperti fungsi payung yang melindungi terik matahari dan hujan, pembagian 423 payung kepada pengunjung menyiratkan hendaknya pemerintah kota harus memproteksi hutan kota Taman Beringin agar tetap hijau, terawat dan terlindung dari sesat pikir yang mengutamakankepentingantransaksional.Makinkuat mengalihfungsikan hutan kota Taman Beringin makin keras pembangkangan kultural komunitas warga terhadap pemerintah. Meletupnya pembangkangan kultural menunjukkan pemerintah lalai, abai dan tak mampu menyelamatkan hutan kota Taman Beringin dari cengkeraman kepentingan pragmatis dan ekonomis yang menghancurkan kemolekan kota Medan. Penulis adalah Sekretaris Program Studi Magister Sejarah, Fakultas Ilmu Budaya USU.

Islam & Budaya Populer Di Indonesia Oleh Faisal Riza Dampak budaya populer ini berupa semacam banalitas agama.Apapun yang selama ini dianggap profan,nafsu rendah, remeh-temeh, banal dan sampah menurut Islam, kini menjadi bagian wacana kegaamaan itu sendiri.


ekitar lima belas tahun terakhir Indonesia mengalami perkembangan yang menjanjikan secara gradual terutama soal meningkatnya demokratisasi perkembangan ekonomi, dan teknologi informasi. Ini merupakan syarat penting dalam berkehidupan di era globalisasi. Indonesia dikenal sebagai negeri dengan penduduk mayoritas Muslim. Karena itu wajar jika tuntutan terhadap penyelenggaraan kehidupan bernegara dan bermasyarakat dengan nilai-nilai Islam selalu didengungkan. Persoalannya adalah bagaimana menjalankan nila-nilai Islam yang dipahami tersebutjikadihadapkandenganfenomena modernisasi. Keadaan ini memunculkan ragam fenomena lanjutan yang menuntut pendefenisian ulang terhadap kehidupan Islam seperti apa yang diinginkan. Budaya populer yang menggejala di masyarakat kita seiring perkembangan teknologi informasi dan media jejaring sosial yang merambah ke dimensi yang sangat privat di ruang-ruang dalam rumah tangga Muslim. Media Dan Jejaring Sosial Budaya popular terkait dengan apa yang disebut dengan budaya massa, yaitu budaya yang diproduksi untuk massa, mengikuti pola produksi massa. Budaya popular menyiratkan akan kebaradaan budayanonpupulersebagailawannya,yaitu yang dibangun oleh pendekatan nonpopular yang sering disebut budaya luhur. Perkembangan media dan jejaring sosial di Indonesia merupakan fenomena menarik yang tidak serupa didapatkan di negeri Muslim lain di dunia. Misalnya, Januari lalu, menurut data statistik, pengguna Facebook di Indonesia mencapai 51,515,480 orang. Di bulan April ini, jumlah tersebutmenyusut.TercatatdibulanJanuari lalu,penggunaFacebookdiIndonesiamencapai 51 juta pengguna lebih. Namun, SocialBakers sebuah lembaga pengukur memberikan satu analisis barunya yang menampilkan bahwa untuk bulan April ini, pengguna Facebook tanah air menyusut menjadi 48,134,040 orang.Walaupun mengalami penyusutan, namun Indonesia tetap menjadi negara dengan pengguna Facebook terbanyak keempat di bawah Amerika Serikat, Brasil dan India setidaknya tercatat mulai dari tahun 2012 lalu. Peningkatan pengguna Facebook terjadi pada bulan Januari lalu namun terus menurun setiap bulannya (sampai April). Penetrasi pengguna Facebook di Indonesia saat ini adalah 19,91 persen dibandingkan dengan total pengguna internetnya yang mencapai 202,69 persen. Situs Sycomos melaporkan bahwa penggunaTwitter dari negara-negara Asia mencapai 7.74 persen dari total penggunaTwitter di berbagai belahan dunia. Peringkat pertama pengguna Twitter di Asia diduduki oleh Indonesia dengan 2.34 persen, diikuti Jepang 1.47 persen dan India 0.97 persen. Dalam perspektif global, lebih dari setengahnya berada di AS, disusul Inggris Raya (8.09 persen), Brazil (6.73 persen), Kanada (4.36 persen) dan Autralia (2.63 persen). Data ini berdasarkan hasil analisa terhadap 13 juta pengguna Twitter untuk rentang 16 Oktober 2009

hingga 16 December 2009. Situs comScore melaporkan, total pengguna unik dariTwittersecaraglobalmencapai60jutapengguna. Asosiasi Penyelenggara Jasa Internet Indonesia (APJII) secara resmi telah menyatakan bahwa pengguna internet di Indonesia tidak hanya berjumlah 63 juta orang. Bila ditanya, seorang tukang sayur atau pembantu pasti tidak akan bilang bahwa dia merupakan pengguna internet. Pernyataan dari beberapa praktisi internet di atas, bukan tidak mungkin jika pengguna internet di Indonesia sekarang sudah mencapai atau melebihi angka 120 juta orang. Perkembanganitujugadidukungolehperkembangan media lainnya di Indonesia sekitar hampir 50 saluran televisi nasional, lokal, TV satelit dan kabel berlangganan, ribuan stasiun radio dan ratusan media cetak nasional dan lokal. Besaran jumlah pengguna tersebut tidak diiringi penciptaan budaya lokal yang bisa diajukan sebagai budaya tandingan terhadap budaya luar popular. Ekspansi budaya asing popular lainnya adalah lewat musik. Indonesia akhir-akhir ini juga kebanjiran konser musisi asing. Kedatangan musisi dari negeri seberang merupakan magnetbagimasyarakatyanghaushiburan. Ada lebih dari 50 musisi asing yang menggelar konser musik di Indonesia. Sejumlah nama kondang yang menghibur publik Indonesia sepanjang tahun lalu seperti Big Bang, Sting, Guns N’ Roses, Katy Perry, dan Maroon 5. Tahun ini, rangkaian konser musik dari musisi mancanegara masih belum putus. Selama bulan Januari–Maret saja tercatat sudah ada 27 konser musik asing dari berbagai aliran musik.Weezer, grup musik rock alternatif asal Los Angeles, California, Amerika Serikat (AS), menjadi artis impor pertama yang tampil di tahun ini. Sedang mereka yang masih dinantikan untuk manggung tahuninisepertiBlur,Aerosmith,danRussell Peters. Gelombang Korea di Indonesia belum juga reda. Setelah diramaikan dengan berbagai konser di tahun 2012, Maret 2013 konserterbesardariKoreadihelatdiIndonesia. Setelah menghelat konser di Jepang, Perancis,HongKong,Chili,acarayangdiberi nama ‘KBS Music Bank -World Tour 2013 in Jakarta’ itu dihelat di Gelora Bung Karno pada 9 Maret 2013. Kita pun dapat menyaksikan bagaimana kaum muda Muslim, para wanita Muslim lengkap dengan jilbabnya dengan gegap gempita, histeris berteriak menyambut kedatangan idola mereka menciumi, memeluk dan menangisi artis kegemaran itu. Sungguh suatu fenomena menarik, ketika kebudayaan popular hidup berkembang di komunitas Muslim di Indonesia. Di sinilah, festival jazz terbesar di Asia berangsung, festifal music rock terbesar juga ada, dan lain sebagainya. Semua itu tentu saja dikonsumsi oleh kaum Muslim mesti tidak seluruhnya. Hidup Populer? Budaya populer yang dibangun oleh imajinasi populer kini telah merasuki masyarakat Islam. Imajinasi-imajinasi ini dibentuk secara sadar oleh orang atau sekelompokorang,biasanyaprodusen,kapitalis,

dan para elit untuk membedakan mereka denganoranglain.YasrafAmirPiliangdalam bukunya Bayang-bayang Tuhan: Agama danImajinasimenjelaskanbahwaimajinasi popular semacam ini dibangun setidaknya ada empat ranah. Pertama, cara berpikir popular, yaitu caraberpikirjalanpintasyangpentingmendapatkan kesenangan, kalau perlu tanpa berpikir. Itulah cara berpikir yang mengutamakan penampilan ketimbang kualitas jiwa, popularitas ketimbang spiritualitas, kedangkalan ketimbang kedalaman. Hal ini bisa kita lihat misalnya, banyaknya buku atauforumseminarhow toyangmenawarkan cara cepat menjadi milarder, cepat menjadi pintar, dan bahkan instan mempelajari Islam. Masyarakat Islam yang terperangkap cara berpikir popular ini akan menjadi masyarakat yang malas berpikir, cari enak dan jalan pintas. Kedua, komunikasi popular. Komunikasi popular ini dicirikan dakwah yang dihiasi oleh imajinasi dan fantasi-fantasi yang biasa hidup di dalam budaya popular, berupa bahasa, tindakan, dan penampilan populer. Misalnya dakwah Islam yang mengandungunsurkomedi,lawakan,banyolan yang kerap muncul di TV. Tidak hanya itu, para dai, ustadz, kiai pun berperan sebagai bintang iklan atau superstar di hadapan massa penggemar. Massa pada akhirnya“secara pasif” meniru kebiasaan, penampilan,dangayadaisuperstarmereka (busana, peci, model rambut) dan membuat mereka berhasrat untuk mengoleksi barang-barang“dai idola” mereka, bahkan sampaimemburutandatangan.Da’ibagaikan selebritis yang diidolakan. Ketiga,ritualpopular.Ritualinibiasanya dilakukan dengan mengikuti paradigma budaya poluler bermotif komoditas. Ritualritualituditatasedemikianrupasesuaiprinsip perbedaan sosial dan pencapaian prestise, kelas dan status. Misalnya umrah bareng artis idola, ritual ini diasosiasikan berdasarkan kelas sosial, demikian halnya dengan zikir akbar yang diselenggarakan pemerintahdaerahataukotadengantematema khusus, berbuka puasa bersama yang diorganisasikan berdasarkan kelas-kelas sosial di dalam masyarakat, seperti paketpaket berbuka yang diadakan di hotel-hotel berbintangdandikaitkandengankehadiran selebritas di dalamnya. Di sana terdapat proses pergeseran nilai kesucian ibadah dengan hadirnya selebrasi ritual. Akhirnya, bukan kedalaman spiritual yang didapat, justru selebrasi keagamaan yang dekat dengan logika komoditi. Keempat, simbol populer. Simbol atau penampilan populer ini mengarahkan pada penampilan yang mencakup nilai dari pakaian atau aksesoris yang menekankan efek kesenangan, simbol, status, tema, prestise, daya pesona dan berbagai selera populer lainnya. misalnya menjadi pengikut atau peniru dari model penampilan para elit agama (ustadz, kiai, da’i), di mana model-model baju yang dikenakan oleh pak ustadz menjadi trend setter dan menciptakan gaya hidup baru. Banalitas Agama Dampak masuknya budaya populer ke ranah Islam ini berupa semacam banalitas agama. Di sana kita menyaksikan apapun yang selama ini dianggap profan, nafsu rendah, remeh-temeh, banal dan sampah menurut pandangan Islam, kini menjadi bagian wacana keagamaan itu sendiri. Batas suci/rendah dan sakral/ profan, kini dikaburkan dan digiring pada logika budaya baru, yaitu logika banalitas agama. Di dalam ritual keagamaan, sesuatu dulu yang dianggap tidak penting

(seperti penampilan, gaya lelucon, gaya pakaian, gaya penampilan) kini menjadi sangat dibutuhkan, dan mendominasi ruang dan waktu umat Islam serta menjadi jantung kehidupan keberagamaan umat Islam. Dalam kehidupan sehari-hari kita bisa menjumpaimisalnya,paraustadzditelevisi, meski tidak semuanya, terlihat lebih mementingkan gaya penampilannya ketimbang penguasaan subtansi ajaran Islam yang diajarkannya. Lebih mementingkan gaya bicara, ketimbang esensi ajaran Islam. Inilah banalitas agama yang merayakan penampakan luar atau performance tanpa peduli dengan makna atau nilai-nilai spiritualitas-ketuhanan di baliknya. Dan tentunya, gaya hidup telah mencabut ritual keagamaan dari ruang sucinya, dan kini menjadi semacam ekstasi (kesenangan puncak) ketidaksadaran semu. Greg Fealy dan SallyWhite dalam Expressing Islam: Religious Life and Politics inIndonesia(2008)diterjemahkankedalam bahasa Indonesia dengan judul; “Ustadz Seleb, Bisnis Moral, dan Fatwa Online”, menangkapgejalakomersialisasiIslamyang menggejala. Agama Islam yang dianut oleh dua ratusan juta masyarakat Indonesia menjadi pasar dan komoditas yang menggiurkan dan selalu diincar banyak pedagang. Greg mengatakan dengan kemajuan ekonomi dan meningkatnya kelas menengah secara signifikan di Indonesia, meningkatnya derajat demokrasi dan keterbukaan akses informasi yang massif maka inilah masa yang ia sebut sebagai “the turning of faith and its symbols into commodity capable of being bought and sold for profit”. Inilah saat di mana komersialisasi keyakinansebagaiusahamenjadikanajaran agama atau simbol-simbolnya yang kasat mata sebagai komoditi yang bisa diperjualbelikan untuk meraih keuntungan. Sebelum Islam di Indonesia, kapitalis-me barangkali sudah terlebih dahulu mengomersialisasikan agama-agama besar dunia. Indikasi komersialisasi bisa ditandai dengan rayuan dan jaring populer yang ditebarkan terlebih dahulu lewat iklan di banyak media massa. Kemudian juga diamini dengan bagaimana menciptakan produk-produk baru untuk memenuhi kebutuhan artifisial Muslim Indonesia. Komersialisasi menyelubungi paham, pandangan, dan pola pikir Muslim Indonesia yang akan menjelma jadi budaya populer Islam. Bagi seorang yang populer, tindak-tanduk, fashion, gaya, dan modenya akan menjadi panutan para khalayak ramai. Seringkali, kepopuleran itu lebih dipakai sebagai ekses komoditas per-laba-an, menjadi bisnis yang menjanjikan. Di sinilah, perkara populer itu sangat menggiurkan siapa saja, tak hanya milik para selebritis, namun juga menjadi incaran kita. Penutup ProyekIslamisasidiruang-ruangpublik yang digaungkan sejak tahun 70-an tengah mengalami transformasi sedemikian rupa. Kali ini keyakinan Muslim dihadapkan dengan objektifikasi keberagamaan di ranah sosial kebudayaan. Secara lebih arif dapat dikatakan bahwa inilah konsekuensi logis dari pertemuan Islam dan budaya, ketika keyakinan bertemu dengan modernitas, ketika kesalihan bertemu dengan globalisasi.Persoalannya,apakahkeduanya saling melengkapi atau secara diametral berpunggungan. Penulis adalah Dosen Filsafat Politik Islam Fakultas Ushuluddin IAIN-SU.


B8 07.00 Dahsyat 09.00 Sinema Pagi 11:00 Infotainment : INTENS 12:00 Seputar Indonesia Siang 12:30 Si Doel Anak Sekolahan 14.30 Cek & Ricek 15.00 Silet 15.30 Yang Muda Yang Bercinta 16.30 Seputar Indonesia 17.00 Tangan Tangan Mungil 18.15 Berkah 21.00 Tukang Bubur Naik Haji 23.00 Sinema RCTI


07:00 Inbox 09.00 Liputan 6 Terkini 09:03 Halo Selebriti 10:00 SCTV FTV 12:00 SL Liputan 6 Siang 12:30 SCTV FTV Siang 14.03 SCTV FTV Siang 14:30 SL Eat Bulaga Indonesia 16.00 Liputan 6 Terkini 16:03 SL Eat Bulaga Indonesia 16:30 SL Liputan 6 Petang 17.00 Heart Series 18.13 Monyet Cantik 19.30 Pesantren Rock n Roll 21.00 Love in Paris 22.30 Liputan 6 Terkini 23.00 SCTV FTV Utama

07.00 Upin Ipin 07.30 Serial Pilihan 03.30 Pose 09:00 Layar Unggulan 11.00 Diantara Kita 11:30 Lintas Siang 14.00 Lintas Petang 14.30 Drama Spesial 15.30 Top Pop 16.30 Tuntas 16.00 Animasi Spesial 18.00 Bola Bolu 19:00 Tendangan Si Madun 3 20.30 Raden Kian Santang 22:00 Musik Spesial 00.00 Lintas Malam 00.30 SportMania 01.00 Sidik

07:30 Perempuan Hebat 08.00 Seleb @ Seleb 09.00 Kilk! 10. 00 Ngobrol Asyik 11.00 New Friends 11:30 Topik Siang 12:00 Seputar Obrolan Selebriti 13:00 Selebriti Sehari 13.30 Chhota Bheem Aka Bima Sakti 14.00 Tom & Jerry 14.30 Duckula 15:00 Tom & Jerry 15.30 Curious George 16.00 Mr Bean 16:30 Topik Petang 17.00 Catatan Si Olga 18:00 Pesbukers 19:30 RT Sukowi 20:30 Follow Cagur 21:30 Sinema Spesial 23:30 Cakrawala

07:00 KISS Pagi 08:00 Pagi Pagi Bagi Bagi 09.30 Sinema TV 10:30 FTV Siang 12:00 Patroli 12:30 Sinema Drama Indonesia 14:00 Hot KISS 15:00 Fokus 15.30 Jangan Anggap Aku Kecil 17.00 Knock Out 18.00 Bukan Mawar Tapi Melati 19:00 Sinema Indonesia :Aku Benci Anakku 20:00 Drama Seri Keluarga Brama Kumbara 22:00 Sinema Unggulan

07:05 WIB Bedah Editorial Media Indonesia 08:05 WIB 8 Eleven Show 11:30 WIB Metro Siang 13:05 WIB Wideshot 16:30 WIB Java Overland 18:05 WIB Metro Hari Ini 19:05 WIB Suara Anda 20:30 WIB Otoblitz 21:05 WIB Top Nine News 21:30 WIB Mata Najwa 22:30 WIB Stand Up Comedy 23:05 WIB Metro Realitas 23:30WIB Metro Sports

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

WASPADA Rabu 3 Juli 2013

07:30 New Ranking 1 08.30 Bagi Bagi Berkah 09.00 Mozaik Islam 09:30 Makin Jail 10.00 Bos Sejati 10:30 Reportase Siang 11.00 Insert Siang 12:00 Bioskop Indonesia 14:00 Sketsa 15.15 Show Imah 16:30 Reportase Sore 17:00 Insert Investigasi 18:00 Super Trap 19:00 Oh Ternyata 20.00 Bioskop TransTV 22:00 Bioskop TransTV 00.00 Sportvaganza 00:30 Reportase Malam

07.00 Live News Apa Kabar Indonesia Pagi 09.00 Tempo Hari 09.30 Live News Kabar Pasar Pagi 10:00 Coffee Break 11.30 Live News Kabar Pasar Pagi 13:30 Ruang Kita 14.30 Live News Kabar Siang 15:00 Indonesia Super League 17:30 Live News Kabar Petang 19:30 Meja Bundar 20:30 Apa Kabar Indonesia Malam 21:30 Live News Kabar Malam 22:30 Menyingkap Tabir 23.00 Kabar Arena 23:30 Live News Kabar Hari Ini

22:30 Gone in Sixty Seconds 07.30 The Penguin Of Madagascar 08:00 Thomas and Friend 08:30 Sketsa Tawa 09.30 Kungfu Chef 10:00 Obsesi 11:00 Buletin Indonesia Siang 12:00 Serasi 13.00 Dimas Dan Raka 14:00 100 % Ampuh 15:30 Fokus Selebriti 16.00 Arjuna 16:30 Si Kriwil 18.30 Big ovies 20.00 Big Movie 22:30 Big Movie

07:30 Selebrita Pagi 08:00 Makan Besar 08:30 Gak Nyangka 09:00 Ups Salah 09:30 Spotlite 10:30 Warna 12:00 Selebrita Siang 12:30 Si Bolang 13:00 Laptop Si Unyil 13:30 Dunia Binatang 14:30 Tau Gak Sih 15:00 Fish N Chef 16:00 Redaksi Sore 17:00 Orang Pinggiran 18:00 Hitam Putih 19:00 On The Spot 20:00 Opera Van Java 22:00 Bukan Empat Mata 23:30 Dua Dunia


Rhoma Irama:Tirulah Goyangan Elvi Sukaesih

Rhoma Irama/

Musisi dangdut Rhoma Irama mengimbau kepada penyanyi-penyanyi dangdut saat ini untuk meniru cara goyangan Elvi Sukaesih ketika tampil meski dalam acara on air maupun off air di panggung. “Bergoyang di panggung itu punya estetika, seperti dilakukan Elvi Sukaesih maupun Camelia Malik,” ujar Rhoma Irama kepada wartawan di sela penutupan workshop artis dan musisi dangdut se-jatim dalam rangka meningkatkan profesionalitas digelar Persatuan Artis Musik Melayu-Dangdut Indonesia (PAMMI) di Surabaya, Senin.

Menurut dia, bergoyang tidak harus menunjukkan kesan erotis untuk menarik daya pikat penonton. Selama berpuluhpuluh tahun, kata dia, Elvi dan Camelia serta penyanyi dangdut senior lainnya tidak pernah bergoyang seperti itu. Namun, tetap membuat penonton nyaman dan ikut bergoyang menikmati alunan musik. “Meski sudah lama bergoyang di panggung dan tampil di mana-mana, namun tidak pernah ada kontroversi tentang goyangan melibatkan artis-artis senior,” kata legenda hidup musik dangdut Indonesia tersebut.

Rhoma Irama juga mengaku masih prihatin dengan masih banyaknya penyanyi-penyanyi yang mengumbar dan mempertontonkan bagian lekuk tubuh maupun goyangan vulgarnya. Mayoritas,pertunjukanmusikdangdut seperti itu ada di daerahdaerahyangkurangpengawasannya. Tidak hanya itu saja, penyanyi berjuluk “Raja Dangdut” itu juga mengingatkan agar pencipta tidak menulis lagu yang lirik-liriknya bernada erotis. Lagu-lagu liriknya seperti itu, akan mengundang kontroversi dan merugikan banyak pihak.

“Musisi itu seniman dan diidolakan masyarakat. Kalau idolanya kontroversi maka hal itu berakibat tidak baik secara luas. Hal-hal kontroversi ini yang menjadi pekerjaan rumah bagi PAMMI untuk menghilangkannya,” kata musisi mengaku siap maju sebagai calon presiden tersebut. Mengantisipasinya, PAMMI bekerja sama dengan Komisi Penyiaran Indonesia (KPI) untuk mengawasi dan memberikan teguran kepada televisi atau pihak yang melanggar dan menayangkan goyangan kontroversi.(ant)

Rahasia Kecantikan Jennifer Lopez

Moga Bunda Disayang Allah Tayang 2 Agustus Film Moga bunda Disayang Allah, diadaptasi dari novel karya Tere Liye, akan mulai tayang di bioskop pada 2 Agustus mendatang. Film disutradarai Jose Poernomo berkisah tentang perjalanan emosional seorang pemuda bernama Karang mengalami trauma setelah tragedi kapal tenggelam. “Film ini bisa dibilang epik karena syutingnya luar biasa, banyak adegan action serta spesial efek,” kata Jose saat memberikan keterangan pers di Jakarta, Senin. Jose mengaku mendapat bantuan khusus dari ahli Hollywood, Adam Howard yang pernah membantu menggarap film Saving Private Ryan dan Merah Putih, dalam menangani efek visual untuk adegan di bawah air. “Kamera kami gunakan juga tidak main-main yakni kamera yang sama dengan digunakan untuk syuting film Pirates of the Carribean dan Spiderman,” katanya. Film akan mulai ditayangkan di bioskop pada 2 Agustus 2013 itu bercerika tentang pertemuan Karang dengan Melati, gadis berusia sembilan tahunan yang bisu, tuli dan buta sejak kecil. Melati semula terlihat sebagai sosok liar, sikapnya berubah setelah bertemu Karang, yang menjadi pemabuk serampangan kapalnya tenggelam.(ant)

Meskipun sudah berusia 43 tahun, Jennifer Lopez tetap cantik, muda dan segar. Apa rahasia kecantikan Lopez yang sebenarnya ? Penyanyi ini menjawab sering berolahraga, jangan stress, selalu gembira, mengkonsumsi makanan dan minuman sehat. Selain berguna agar kulit tetap putih, mulus dan segar , mengkonsumsi makanan dan minuman sehat juga menghindari berbagai jenis penyakit. Seperti dilansir, penyanyi cantik ini memasuki usia 40 tahun sudah sangat riskan akan ter-serang berbagai penyakit. Lo-pez yang sering dipanggil J-Lo ini mengakui, banyak piki-ran akibat berbagai masalah yang dihadapi sangat berpe-ngaruh bagi penampilan ka-rena apa yang ada di dalam hati dan pikiran tentu saja ter-pancar ke wajah. Wajah mu-ram banyak dipengaruhi be-ban pikiran yang berat dan wa-jah cerah, cantik dan segar merefleksikan bahwa semua masalah mampu diatasi dan semuanya berjalan dengan mudah.

Jennifer Lopez/ Sebagai penyanyi yang ia mengenakan make up merk sudah dua dekade karirnya mahal, namun J-Lo tidak suka tetap bersinar, J-Lo tetap ber- gonta-ganti make up. Jika supenampilan sederhana. Kendati dah sesuai dengan make up

Dewi Supernova Beberkan Resep Sukses

Dewi Lestari

FilmLaTahzanTayangLibur Lebaran

yang satu, ia sulit mengganti dengan produk lainnya. Hal ini dilakukan Lopez agar tidak bermasalah pada kulit wajah dan tubuhnya bila mengenakan make up berganti-ganti. Setiap orang melihat Lopez mengakui, penyanyi cantik ini memiliki kulit sangat mulus dan lembut. Jennifer menerima penghargaan Hollywood Walk Of Fame bagi kontribusinya pada industri hiburan selama lebih 20 tahun masa karirnya di bidang tari, akting, menyanyi dan semua bisnis hiburan. J-Lo mengenakan baju putih tanpa lengan, rambut pirangnya diikat ke belakang dengan poni tipis bertaburan di dahinya. Make up J-Lo sangat sederhana, tak ada warna yang mencolok di wajahnya termasuk bibirnya hanya diwarnai dengan lip-gloos tipis warna orange terang. Namun pada berbagai kesempatan, penampilan Lopez menunjukan kesan seksi. Ketika menembangkan lagu Live It Up pada even pencarian bakat Inggris, ia mengenakan gaun putih metalik motif bunga-bunga kecil warna biru dan hijau.* Nur

Film karya sutradara Danial Rifki, La Tahzan (Jangan Bersedih) akan tayang di bioskop seminggu sebelum Hari Raya Idul Fitri tahun ini. “Tayang tanggal 2 Agustus,” kata Danial Rifki, saat mengadakan jumpa media di Falcon Pictures, Jakarta Selatan. Film tersebut diangkat dari novel karya Lisman Suryanegara dan kawan-kawan berjudul La Tahzan for Student. Dari kumpulan cerita yang ada di buku tentang pengalaman orang Indonesia tinggal di Jepang, kata Danial, ia mengangkat kisah berjudul Pelajar Setengah TKI karya Ellnovianty Nine. “Dari cerita itu, kami terjemahkan menjadi sosok Hasan dan Viona. Lalu ada juga tokoh orang Jepang, Yamada,” kata Danial. Ia pun menggandeng Atiqah Hasiholan menjadiViona, pelajar Indonesia di Jepang; Ario Bayu sebagai Hasan seorang tenaga kerja; dan Joe Taslim menjadiYamada. La Tahzan (Jangan Bersedih) bercerita seputar hubungan antara Viona, Yamada, dan Hasan. Membuat film diangkat dari novel tidak membuat Danial merasa terbebani. Penulis naskah film Tanah Surga..Katanya berpendapat buku dan film memiliki sisi yang menarik dengan caranya masing-masing. “Bagi saya, ini menantang membuat film dengan rasa yang sama di buku,” katanya. Untuk membuat film ini, Danial dan 20 pendukung film ini terbang ke Jepang selama 12 hari untuk melakukan pengambilan gambar. Film garapannya ini, menurutnya, seperti film klasik Indonesia yang memadukan kekuatan cerita dan keindahan alam. Selebihnya, mereka melakukan syuting di Jakarta selama tiga hari. “Proporsinya 80 persen di Jepang, 20 persen di Indonesia,” katanya. Tayang saat libur hari raya, aktris Atiqah Hasiholan berharap film tersebut bisa menjadi pilihan pecinta film untuk mengisi liburan. “Pinginnya membekas di hati penonton, nggak sekedar lewat,” tutupnya.(ant)

BIDUANITA kini lebih eksis dan berkibar sebagai novelis, Dewi Lestari mengingatkan – jangan sekali-sekali meremehkan istirahat malam. Pasalnya, bila tidur kurang dari tujuh jam – selain bakal mengurangi kualitas hidup seseorang dengah hadirnya beragam penyakit, juga berpotensi mengurangi produktivitas dan prestasinya dalam melakoni profesi sehari-hari. “Resep sukses saya melahirkan novel-novel Best Seller sebenarnya cukup sederhana yakni sedapat mungkin menjaga kualitas tidur keseharian. Kalau waktu tidur malam cukup – minimal tujuh jam, biasanya esok atau hari berikutnya saya bakal menuai banyak inspirasi bagus dan mengalir deras dalam merampungkan sebuah Novel,” beber Dewi Lestari kepada Waspada selepas jumpa pers Comforta - Comfort Your Life di Sleep Center – Mal Taman Anggrek Jl. S. Parman – Jakarta Barat, baru-baru ini. Novelis kelahiran Bandung, 20 Januari 1976 akrab disapa Dee dan popularitasnya langsung meroket hebat lewat novel Supernova lansiran tahun 2001 ini membenarkan sambil menambahkan bahwa masing-masing penulis biasanya mempunyai cara tersendiri dalam mencari dan mendapatkan inspirasi. “Berdasarkan pengalaman, saya kerap mendapat banyak inspirasi materi tulisan bagus untuk novel biasanya pasca tidur nyenyak malam sebelumnya. Sayangnya, ketika mood menulis datang – terkadang sering lupa waktu hingga kualitas tidur kurang terjaga dengan baik. Tapi, begitu novel rampung – saya biasanya langsung membayar lunas hutang kurang tidur yang berjamjam,” kilah mantan istri penyanyi Marcell Siahaan mengaku beruntung ditopang Matras Comforta sesuai dengan postur tubuh dirinya dan Reza Gunawan – sang suami baru yang menikahinya di Sydney Australia – 11 November 2008 silam. Pendapat Dee bahwa kurang tidur malam mendatangkan beragam penyakit, didukung penuh dr Andreas Prasasdja, RPSGT – pakar Sleep Physician Disorder Clinic Rumah Sakit Mitra Kemayoran Jakarta. “Tak ada satu pun obat tidur di dunia yang mampu mengganti efektifitas restorasi tidur. Kurang tidur, obatnya ya tidur lebih banyak. Apalagi berdasarkan data peneltian, wanita aktif yang tidur kurang dari 7 jam setiap harinya, mempunyai resiko 47 persen lebih besar untuk menderita Kanker Payudara. Sedangkan orang yang tidur kurang 5 jam sehari, memiliki resiko dua kali lipat menderita penyakit Jantung, Diabetes, Stroke dan Disfungsi Ereksi,” tandas dr Andreas Prasasdja. * (AgusT)

Atiqah Hasiholan

Atiqah Hasiholan Cerita Puasa Dan Es Blewah Aktris Atiqah Hasiholan mengenang bulan Ramadan saat ia masih duduk di bangku sekolah dasar. Saat itu Atiqah kecil yang baru kelas satu SD untuk pertama kalinya puasa penuh hingga Maghrib. Di hari terakhir berpuasa, ia sibuk di dapur membantu persiapan berbuka. “Pas udah dekat waktu berbuka, aku minum, lupa,” kenangnya. Atiqah kecil pun menangis sejadi-jadinya. Meski kedua orang tuanya telah memberi tahu minum karena lupa tidak membuat puasanya batal, ia tetap menangis. “Aku nangis lama banget, merasa bersalah,” katanya dan tertawa. Putri Ratna Sarumpaet itu juga mengenang semasa kecil ia tidak pernah diiming-imingi hadiah agar berpuasa penuh. Puasa tahun ini, ia tetap bekerja menyelesaikan beberapa proyeknya. Untuk menjaga staminya agar tetap fit selama berpuasa, Atiqah banyak mengonsumsi air saat sahur. “Vitamin, buah, pokoknya segala sesuatu yang bernutrisi,” katanya. Ia pun selalu berbuka dengan makanan yang manis seperti kurma dan es teh manis. “Aku suka banget es blewah,” katanya tentang hidangan puasa favoritnya.(ant)

Fedi Nuril/

Lemang Dan Rendang Menu Berbuka Favorit Fedi Nuril Aktor sekaligus musisi, Fedi Nuril, menyebut lemang dan rendang sebagai makanan favorit saat berbuka puasa. “Favorit saya lemang dan rendang, biasanya kan lemang dimakan dengan sate, tapi saya sukanya dimakan pakai rendang,” kata Fedi Nuril di Jakarta, Senin. Pria yang baru merayakan ulang tahun ke-31 itu juga mengaku suka makan kolak dan risoles selama Ramadhan. Ia berharap bulan Ramadhan kali ini membawa berkah tersendiri. “Doa saya untuk puasa kali ini adalah diberi ketenangan, jadi kalaupun saya belum diberi jodoh juga, tapi hati saya tetap bisa tenang,” katanya serta tertawa. Mengenai jodoh, Fedi mengaku tidak terlalu ngoyo dan lebih pasrah. “Kalau mau jadi istri saya gampang kok, asal siap berkomitmen. Hubungan saya yang terakhir gagal karena memang dia jauh lebih muda dan belum siap serius, jadi saya enggak maksain,” katanya.(ant)

1 CM 2 CM

Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000


AUTOMOTIVE Informasi Pembaca

Bursa Automotive


: : : : :

Air Condition Ban Radial Central Lock Nippon Denso Double Blower


: Power Stearing : Power Window : Radio Tape : Velg Racing :Electric Window

CHEVROLET Troper Diesel 4 x 4 Thn 86 Ls. Bk Medan, W. Biru Lengkap, Pw, Ps, Pr, Br, Ban Tebal, Jok kulit, Siap Pakai, Tampa Kropos, Di Jual Cepat. B.U. Hub. Hp 0821 6177 6086 MDN

DAIHATSU Minbus Gran Max -D. Silver, Ass ALL Risk. H. Rp 73 Jt. Mulus. Hub. 0852 9618 4745 DAIHATSU ZEBRA PRIMA 21 Biru Met Th 95, Mulus, Siap Pakai, Vr, Br, Rtp, Hrg 25 Jt Nego, Hub : 0823 6156 7527 DIJUAL Sedan Charade Kalasi Th 94. W. Abu - Abu Tua. Presing Masih Satu Tangan, Masih Orisinil. H. 32 Jt Net. Siapa yang Minat HB. Hp. 0821 6552 2533

HONDA ACCORD Prestige Thn “88” Ac, Dvd, Vr, Br, Pwr Steering, Bk Medan, Mulus, Harga Rp 33 Juta/ Nego. Hub : 0813 7748 8088. Komp. Flamboyan Island Blok K No. 6 Medan ISUZU PANTHER Pick Up Thn 2004. W. Hitam, Bk Mdn, Bak Lebar, Ps, Jok kulit, Mbl Sehat, Body / Cat Mulus (Lempang), Siap Pakai, Hrg 65 Jt. Hub : 0852 1080 4566 OPEL BLAZER LT INJECTION IRIT Minyak Th 97. Biru Met, Sgt Orisinil Siap pakai, Mesin Sehat, Ac DIngin, Hrg 44 Jt Nego. Hub : 0813 9789 9711 Mitsubishi Pajero Sport Dakkar Solar Th’11Matic, Bln 12. Wrn Hitam, Pakai Sundrop. Double Gerdang. 2 Tongkat, Mls Sekali, Luar Biasa, Assuransi Allrisk, Rp 405 Jt. Depan Sekolah. Eria no. 200. 0821 6767 7000 / 7851402 MITSUBISHI Kuda Diesel 2000 Hitam. Mobil Mulus, Jarang Pakai, Bk Asli Medan, No Cantik Bk 9 Zw, Jok Baru, Pelak Asli, Tape Dvd, Siap Pakai. Harga 83 Jt/Nego. Hub : 0812 6568 818 / 77305875

SUZUKI KARIMUN OVER KREDIT HITAM MET Th 2003. Sudah Bayar 17 x Sisa 19 x 2.499.000, Balik Dp 35 Jt Nego, Full Sound Pake TV, Sgt Orisinil. Hub : 0823 6452 5302


CARRY PU, DP 15 JT-AN/ANGS. 2,5JT-AN MEGA CARRY..DP 23JT-AN/ANGS. 2,8JT-AN ERTIGA...DP 35JT-AN/ANGS. 3 JT-AN Bisa Dijemput Hub : 0853 5923 2531

DIJUAL SUZUKI BALENO 97. Warna Abu Rokok, Ac, Dvd, Tv, Cd. Harga 65 Jt Nego. Hub 0813 6141 1112 SUZUKI CARRY Relvan Tahun 2000 GRV Warna Biru Metalik, Bk Medan Asli, Satu Nama Dari Baru, Pajak Hidup Setahun Penuh, Cat Original, Sangat Mulus, Siap pakai. Hp 0813 9610 1939

5 CM 6 CM

Rp. 65.000 Rp. 78.000

SUZUKI Realvan Thn 2000. W. Merah, Bk Mdn Asli, Ac, Db, Br, Vr, Rt. Hub : 0852 7784 1799 TOYOTA HIACE Pick up Hijau Model L 300 Th 76. Sgt Orisinil, Antik dan Sehat Semua, Siap pakai, Hrg 30Jt Nego, Hub : 0823 6432 0052




WASPADA Rabu 3 Juli 2013

AVANZA VELOZ ETIOS YARUS RUSH INNOVA FORTUNER Proses Cepat & Serba MANTAB Hub, Hery Mutia 0852 6297 5555

TOYOTA AVANZA G /08/ Hitam, BPKB 1 Nama. Siap Pakai. H : 126Jt, Dp 29 JT (Nego), Angs 3 JT-AN. Hp : 0812 6035 889. Jl. Gagak Hitam Medan

7 CM 8 CM

Rp. 91.000 Rp. 104.000


Spesialis Surat Rumah dan BPKB. Proses 5 Jam Cair, Tanpa Usaha, 3 Juta - 1 Milyar. Jaminan, SHM, SK Camat, HGB. BPKB Mobil, Spd. Mtr, Truk, Mobil kredit. Dan Bantu Pelunasan BPKB. Hub. Family Finance. 0813 7044 6668 - 0813 7044 6633

# TOYOTA DEALER # Dapatkan Penawaran Terbaik Dari Kami Seputar Toyota Anda. Untuk Informasi Hub. 0823 7088 0815 ANWAR DAMANIK. #SELAMAT MENUNAIKAN IBADAH PUASA # TOYOTA FORTUNER Bensin 2009. Warna Hitam, Pajak Panjang, Hub. FERY 0852 6113 7592 DIJUAL

1 Unit Mobil Toyota Kijang Super G. Thn 95, Warna Biru. Hub : 0813 7717 1715, 0857 6098 8044 TOYOTA FORTUNER G Diesel Th’12 Manual. Wrn Hitam Metalik, Balik Dp Rp 150 Jt, Sdh Byr 15 Kali, Sisa 21 Bln x Rp 11.150.000, Pelunasan 214 Jt Assuransi Allrisk. Jl. Sm. Raja no. 200 (Dekat Kampus UISU). 0812 6038 5555 / 7851402 TOYOTA KIJANG KRISTA Diesel 2000. Silver, Mobil Mulus Sekali, Jarang Pakai, BPKB 1 Nama, Pelak Standart, Jok, Tape Dvd Flasdisk, Siap Pakai, Harga 118 Jt/Nego. Hub. 0812 6568 818 / 77305875

TOYOTA KIJANG Green Long Bk Mdn, Warna Abu - Abu Met, Cat Dan Mesin Mulus, Siap Pakai. Harga Nego. Hp. 0821 6021 0957 TOYOTA KIJANG KAPSUL LGX Solar, Bk Mdn, Ada Tv, Cidi, Warna Silver Met, Cat Mulus, Siap Pakai. Hrg Nego. Hp. 0852 7650 6242 TOYOTA AVANZA G Th 2006. Bk Medan, Warna Biru Met, Cat Dan Mesin Mulus, Siap Pakai, Hrg Nego. Hp. 0811 652 506

Tercecer Sertifikat Hak Milik No. 492. An. TENGKU THALIB. S. Luas Tanah : 1520 M2 Terletak : Di Jalan Nenas II Dusun III Kelurahan Suka Ramai Binjai (Sumut) (Kepada yang menemukan harap mengembalikannya Kpd Bp. H. TENGKU THALIB. S. Jln. Air Bersih No. 127 A Medan)



STUK. Bk 8691 DT. No uji : MDN 17716 B. A/N : PT. Megamas Plaza Bangunan. Alamat : Jl. Gatot Subroto No. 102 Medan. Merk : Mitsubishi




Surat Keterangan Tanah A/N H. LIMIN AMNAS NST. Uk 9 M x 25 M di Jl. Pelita VI Gang Pertolongan No. 41 Kel Sidorame Barat II. Kec. Medan Perjuangan TERCECER

STUK. Bk 8964 CD. No uji : MDN 38588 B. A/N : Banta Ahmat. Alamat : Jl. B. Katamso Komp Risda No. 28 Medan. Merk : Daihatsu

TERCECER Telah Hilang Surat Ganti Rugi Tanah No : 593.83/67/2002 Atas Nama : Hj. T. DARFAH, Jenis Kelamin : Perempuan, Umur : 54 Tahun, Alamat jln. Sirandorung No. 17 A, Hilang diseputaran Kota Rantau Prapat pada bulan Mei 2013. Bagi yang menemukan harap hubungi pemnilik diatas, Hp : 0823 6955 5765. Bagi yang menemukan tidak akan dituntut dan akan diberikan hadiah sepantasnya


IZIN MENDIKNAS RI No. 14/D/O/2009 Tanggal 2 Maret 2009

STUK. Bk 9433 CA. No uji : MDN 68530 A. A/N : Erawati. Alamat :Jl. Gurami No. 7 D .M. Area Medan. Merk : Mitsubishi








IKLAN KHUSUS 6x1,5 kolom Rp. 120.000


STUK. Bk 8964 CD. No uji : MDN 38588 B. A/N : Banta Ahmat. Alamat : Jl. B. Katamso Komp Risda No. 28 Medan. Merk : Daihatsu STUK. Bk 7898 Do. No uji : AB.01.018224. A/N : Po. Medan Jaya .Alamat :Jl. Sm Raja Km 5. Medan. Merk : Mercedes Benz

Rp. 1.350.000,Jok (model press) + Alas

11 CM Rp. 165.000 12 CM Rp. 180.000




TOYOTA KIJANG Super MB 89 Long, Abu Metalic, Power Steering, Ac Dingin, Vr, Br, Mesin Halus, 6 Speed, Medan Asli, Harga Rp 35 Jt. Hub : 0823 7688 8808 TOYOTA COROLLA Se Saloon 87. Hitam Metalic, Ac Dingin, Cl, Vr, Br, Doktrin Original, Harga Rp 35 Jt. Hub : 0823 7688 8808

9 CM Rp. 126.000 10 CM Rp. 140.000

1 Unit Honda Scoopy Dan 4 Buah BPKB Asli. 1. Honda Scoopy Bk. 3270 ABO. An. Nurhafni Hsr Jl. Abd. Hamid No. 61 Medan 2. Mobil Toyota Avanza Bk. 1091 Kj An. Sudiarto, S. Sos Jl Gaperta Gg. Sekata No. 2-A 3. Honda Supra X 100 D. Bk. 2451 GF. An. Sudiarto, S.Sos Jl. Gaperta Gg. Sekata No.2-A 4. Yamaha Mio Bk 4277 CV. An. Sudiarto, Sos. Jl. Gaperta Sekata No. 2-A. Hilang Pd Tgl 26-6-2013 Jam 09.00 - 10.00 Wib TELAH HILANG

Tercecer Surat Keterangan Sebagai Pedagang An. Ukur Ginting No. 136 L. Terbuka Pasar Desa Lalang Medan. di Sekitar Jalan Klambir V Medan


Menerima Mahasiswa/i Baru T.A 2013/2014 PROGRAM STUDI:

S-1 Keperawatan Angkatan V DIII Keperawatan Angkatan XXI DIII Kebidananan Angkatan XII Pendaftaran mulai bulan April s/d Agustus 2013 Informasi dan Pendaftaran

Kampus STIKes Flora Medan: Jl. Rajawali No.24 Medan Telp. 8454407, 8454408, 8454409 Hp. 0812 650 6377 website:



Spring Bed 6 kaki 2 lapis Rp. 1.150.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun





TELP. 061-4576116 FAX 061-4512319 HP. 0813.6137.2321 - 0812.6495.8456


LOWONGAN KERJA DIBUTUHKAN Beberapa Orang Staf : 1.Pengajar B. Inggris (sesuai jurusan) 2.Pengajar Matematika (sesuai jurusan) 3.Administras (Sarjana/SMU/sederajat) Hub : Lembaga Pend. Bahasa Plus Matematika PROSPECT LEARNING CENTRE JL. Mandala By. Pass No. 108-E Telp.(061) 7354994 JL. Pasar VII No. 32 Telp. (061) 738 3025 (Lamaran Diterima paling lambat1 minggu setelah iklan ini terbit) # LOWONGAN #

Menerima Cepat P / W Usia (17 - 38 Thn) Posisi di Kantor. Pengalaman Tdk di Utamakan. Pend : SMU / SMK dan Mahasiswa. Penghasilan Rp. 2.500.000/bln. Hub : IBU TINA SE / BPK RUDI SE. Hp : 0821 6081 8211. Alamat Kantor : Samping Medan Plaza ( Belakang Macan - Mart ) No. 120. NB : Menerima Cepat



Ketua Yayasan






Untuk Informasi dapat Menghubungi:

HP. 0852 6181 5907 - 0852 6181 5807


- Tambah panjang 3,4,5,6 cm - Hernia/ Turun Bro, dll TERAKREDITASI BAN PT DAN DEPKES RI




Pengobatan dengan menggunakan cara ditotok/ kusuk, syarat-syarat yang berhubungan dengan keluhan masingmasing pasien, dan diberikan ramuan-ramuan tradisional yang telah kami olah secara alami sehingga bebas dari efek samping, Hasil Permanen. Khusus Wanita Khusus Pria : Reaksi Langsung dibuktikan - Mengencangkan - Penyakit Gula Bisaditempat Payudara - Impotensi - Mempersempit Vagina - L. Syahwat/ Mani Encer - Menurunkan berat badan - Tambah Ukuran 3,3-3,4-3,5 - Sulit Punya Keturunan, dll

Hub Telp. (061) 661.8116 - (061) 661.6802 - 7653.2188

LOWONGAN Hubungi Dealer



Ditangani Langsung M.Syamsudin, Anak Pertama Ibu Hj. IROH

Jl. Pancing/ Wilem Iskandar 116 Tel. (061) 6621202 MEDAN

JL. JEND. G. SUBROTO 18-20-22 Depan Air Mancur Petisah TEL. 4522619 - 4146757 MEDAN - JL. GURU PATIMPUS 11-D SIMPANG JL. KELAPA TEL. 4151018 - 4535762 MEDAN

Info Iklan Hub. 0821 60 126688



TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 7653.2188




Rabu, 3 Juli 2013


IZIN DIKNAS No. 249/D/O/2002 dan 73/E/0/2013 IZIN DEPKES No. BK -----------------------------

Menerima mahiswa baru :

1. AKBID angkatan ke XII t.a 2013/2014 bagi tamatan SMA/SMK/ALIYAH/SPK 2. STIKES : P.S KESEHATAN MASYARAKAT A.JALUR REGULER Bagi tamatan SMU sederajat. B. JALUR KHUSUS bagi tamatan D-3 Bidang kesehatan Testing Gel I: 1 Juli 2013 Informasi lengkap : 1. DR.Dr.H.Wirsal Hasan, MPH HP. 0812 639 88388 2. Dr.Hj.Sundari Syarif, HP. 0811 61 8011





845.8996 0812.631.6631 Bergaransi/ Jl.Kpt. Muslim



Informasi Pembaca Bursa Property

G R : Garasi LB : Luas Bangunan KM : Kamar Mandi LT : Luas Tanah KP : Kamar Pembantu RM : Ruang Makan KT : Kamar Tidur RT : Ruang Tamu SHM: Sertifikat Hak Milik DIJUAL CEPAT Rumah Dan Tanah Ukr 15x30M Jl. Abdul Rukun Komp. Satelit Graha/BTN (SAMPING KTR DPR) Kp. Baru. Kwala Simpang - Aceh Tamiang. Hp 0823 6886 0437

Alamat : Jl Sm Raja, Masuk Jl. Utama No. 18 Medan (+/- 100m dibelakang Toko Roti Majestik) Hp. 0813 1868 4589



Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041

Dengan H. TEJA SAEFUL Cucu Asli Mak Erot Bersama Ust. M. OTONG

Bila anda ingin perkasa ingat jangan sampai salah masuk, carilah yang benar-benar pewaris ilmu mak Erot sejati, karena keahlian H. Teja Saeful sudah tidak diragukan lagi dalam menangani keluhan seputar alat vital bahkan pengobatan H. Teja Saeful sudah terkenal di seluruh Indoneisa dan kota-kota besar di Indonesia, sudah ribuan pasien tertolong dipengobatan Mak Erot ini yang aman tanpa efek samping, bahkan dimanca negara sekalipun pengobatan Mak Erot SUDAH TIDAK DIRAGUKAN LAGI KEBERHASILANNYA, INGAT untuk kaum pria jangan sampai anda terhina kaum wanita karena kondisi alat vital yang kurang sempurna KHUSUS WANITA: KHUSUS PRIA: - Ingin punya keturunan - Ejakulasi dini - Memperkencang & - Impotensi memperbesar payudara - Memperpanjang “Alvit” - Keras dan tahan lama, dll - Memperbesar “Alvit” DIJAMIN 100% KONSULTASI UMUM: HANYA TEMPAT - Buka aura KAMI KLINIK - Cari jodoh MAK EROT - Pelaris - Mencari orang hilang JL. LAKSANA NO. 55 J MASUK DARI JL. AMALIUN YUKI SIMPANG RAYA MEDAN (PRAKTEK TETAP) HP: 0812 4038 333 -

Ad : “Perhatian untuk Developer Ingin dan Investor Property : Promosikan P roduk Dijual Tanah di Wilayah Emas Ring Anda Road, Jl. Pasar 1 Ring Road 8.000 m2 SK Camat, Harga Pasaran Rp. 1,5 Juta/ Harian

m2 kami jual Rp. 1,3 Juta/m2 saja WASPADA (nego). Anda sudah langsung untung Media +/- Rp.200.000/m2 pada waktu beli. yang Tepat untuk Hub 0823 - 6448 - 8189. NB : Kami terima penjualan melalui agen Iklan Anda




Turun 15 KG - 2 Gratis 1. 0813 3207 7899 MEISSY Message

Berpengalaman dari malaysia, ahli urut urat segala penyakit pria (alat vital pria loyo + ukuran ) Hub : 0812 6540 7033. Jl. Aksara Simpang Sejati Medan (Depan Bank Bri )






RMH Jl. Sei Musi No. 42. Hubungi: 0813 7539 4228 DIKONTRAKKAN




Berbagai Model dan Warna Jl. Prof. H.M. Yamin SH. No. 344/Jl. Serdang Depan Gg. Sado Medan, HARI MINGGU TETAP BUKA



1 BH Rumah Jl. Dr Mansur Gg. Berdikari. Kompleks PLN No. 5. KMT 5 BH, KM M 2 BH. Garasi 1 BH, Air PDAM, Listrik PLN. Telp : 021 9065 0863. Hp : 0815 5567 803

RUMAH DIJUAL 3 TKT, 3 KT, 3 KM, LT 4 x 14 = 56 m2, Komp Millineum Town House 1 No. 7, Jl. Bakti Luhur. Harga 375 Nego. Hub. 0853 7020 7520


Besar & Mewah Halaman Luas. Uk. Tanah 30 x 36 M, SHM, Luas 30 x 50 m, Tembok Keliling, 6 KT, 3 KM, 3 Teras, 2 garasi, Air PAM, 2200 Watt, Cocok Buat Tempat Tinggal, Home Industri Jl. Purwosari No. 131 Medan Dekat Perumahan Cemara Asri, Siap Cepat Dapat Harga 3,6 M. Hp. 0853 6189 0150 Nego.


Uk. Tanah 30x36m, SHM, Luas 30x50m, Tembok keliling, 6 KT, 3 KM, 3 Teras, 2 Garasi, Air PAM, 2200 Watt, Cocok buat tempat tinggal, Home industri Jl. Purwosari No. 131 Medan dekat Perumahan Cemara Asri, Siapa cepat dapat Harga 3,6 M HP: 0853 6189 0150 Nego


Dijual Sebidang Tanah dan Bangunan diatasnya U 30m x 30m. Terdiri dari 3 bangunan. Bangunan utama permanen u 10m x 20 m. Jl. H. Iwan Matsum Rantau Prapat (Belakang Kantor Bupati). Harga Nego. Hub : 0812 6333 5688

CUCI GUDANG LAPTOP TERMURAH - Toshiba 14’ - Hp 14 - Dell 14’ - IBM 14’ - Fujitsu 14’ - Toshiba 10’ - Infokus Proyektor - Hp 12

= 1,9 Jt - Merek Terkenal Terjamin = 1,7 Jt -- Kwalitas Digaransi = 1,7 Jt Hubungi : = 1,8 Jt 0813 7508 3972 = 1,7 Jt 0852 6076 2430 = 1,6 Jt Pondok Kelapa No. 9 Ringroad = 1,9 Jt B Medan Tersedia Cicilan = 1,9 Jt 12 Bulan


FOTO COPY Siap pasang lebih hemat dari besi beton

KOLOM PRIMA ® Baja U-50 Siap pasang lebih hemat dari besi beton Produksi:

PT. HARI REZEKI KITA SEMUA Jl. B. Katamso No. 533 (Simp. Jl. Pelangi) Medan Tel. (061) 7878777-7878666 Fax. 7863433



LHOKSEUMAWE (Waspada): Pasca kenaikan harga Bahan Bakar Minyak (BBM) per 17 Juni lalu, tarif angkutan umum antar provinsi naik sekitar 20 persen di Kota Lhokseumawe. Kenaikan ini dinilai dinas terkait dilakukan sepihak oleh Organisasi Angkutan Darat (Organda). Pantauan Waspada, harga tiket bus tujuan Lhokseumawe-Medan kini dijual Rp80 ribu per tempat duduk. “Ongkos bus sekarang sudah naik pasca kenaikan bensin. Kalau dulu harga tiket Lhokseumawe ke Medan Rp70 ribu, sekarang naik menjadi Rp80 ribu,” ujar salah satu petugas loket bus di terminal bus Mon Geudong. Kadis Perhubungan Budaya dan Pariwisata melaui Kasi Angkutan, Musliadi mengatakan, kenaikan tarif angkutan itu dilakukan oleh

BIREUEN (Waspada) : Peringatan HUT Bhyangkara ke67 di Mapolres Bireuen Senin (1/7) pagi berlangsung khidmat. HUT Bhayangkara di jajaran Polres Bireuen dilaksanakan di Mapolres Bireuen dengan IrupWaka Polres Kompl Eko Sulistiyo. Sementara di Desa Kubu, Kecamatan Peusangan Siblah Krueng dengan Irup Kapolres Bireuen AKBP Yuri Karsono SIK. Peringatan HUT Bhayangkara di Mapolres Bireuen turut dihadiri Bupati Bireuen H Ruslan M Daud, unsur Muspida Plus, Ulama kharismatik H Abu Tumin Blang Bladeh, para Kadis, Badan, kantor, para pimpinan Bank, para Dan Ramil, para Camat serta sejumlah undangan lainnya. Sementara peserta upacara turut dimeriahkan, POM,Yonif113/JS, Polri, Dishub, Satpol PP/WH, Satpam, dan Pramuka. (b12)

287 Siswa SMKN 1 Jeunieb Bersihkan Masjid JEUNIEB (Waspada) : Menyambut kedatangan bulan suci Ramadhan 1434 Hijriah, 287 siswa SMKN 1 Kelautan Jeunieb melaksanakan bhakti sosial membersihkan Masjid Baiturrahim Kota Jeunieb dan Meunasah Blang Me Barat. Kepala SMKN 1 Jeunieb Fadli, Senin (1/7) mengatakan, bhakti sosial membersihkan masjid Baiturrahim kota Jeunieb dan meunasah sebagai memotivasi para siswa dalam menyambut kedatangan bulan suci Ramadhan. Dikatakan, bhakti sosial dilaksanakan dua hari penuh Jumat dan Sabtu, 5-6 Juli 2013. Sejumlah siswa dibagi dua kelompok dipandu para dewan guru. (b12)

Sakti: Banyak Keberkahan MTQ SUBULUSSALAM (Waspada): Wali Kota Subulussalam Merah Sakti menilai sejumlah keberkahan selaku tuan rumah Musabaqah Tilawatil Quran (MTQ) ke-31 Provinsi Aceh. Salah satunya, 150 warga ikut operasi katarak dan 13 operasi bibir sumbing gratis, kerjasama Persatuan Dokter Spesialis Mata Indonesia (Perdami) dan Ikatan Dokter Indonesia (IDI) Wilayah Aceh dengan RSUD Subulussalam. Merah Sakti, mengatakan itu saat membuka Bhakti Sosial Operasi Katarak dan Bibir Sumbing di RSUD Subulussalam, Sabtu (29/6), dihadiri Dirut RSUD, Asman. Sementara Gubernur Aceh, Zaini Abdullah, hadir pada acara penutupan, Minggu (30/6), sembari memuji kinerja Merah Sakti mengatakan, Pemerintah Aceh mengusung berbagai program, yakni pemberdayaan masyarakat, pelayanan kesehatan gratis, bantuan sosial, beasiswa pendidikan dan sebagainya. Dikatakan, Aceh akan memiliki ambulan udara untuk mengangkut pasien miskin yang tinggal di daerah terpencil, sumber anggaran dari Pemerintah Aceh gratis. Pada kesempatan itu, Zaini Abdullah juga menyerahkan sejumlahbantuankepadamasyarakatkurangmampudansimbolis kendaraan roda dua kepada Kepala Kampong di sana. (b28)

Festival Kilometer Nol Rateb Peu Ayun Aneuk Dan Lagu Aceh SABANG (Waspada): Memeriahkan HUT ke-48 Kota Sabang, Dinas Kebudayaan Parawisata Kota Sabang mengadakan Festival Lagu-lagu Aceh dan Rateb Peu ayun Aneuk dari 27 – 30 Juni 2013 di lapangan Play Ground Kuta Ateh, Kota Sabang. Kadis Kebudayaan dan Pariwisata Sabang, Zulfipurnawati mengatakan, Festival Nol Kilometer diikuti ratusan peserta yang datang dari berbagai daerah termasuk dari luar Kota Sabang. Peserta lagu-lagu Aceh berjumlah 100 orang dan Rateb Peu Ayun Aneuk (lagu-lagu mengayun atau menina bobokkan anak) lebih dari seratus peserta. Acara dibuka Asisten II Setda Kota Sabang, M Daud. (b31)

290 Peserta Ikut Ujian Paket C LHOKSEUMAWE (Waspada): Sebanyak 290 peserta dari binaan Sanggar Kegiatan Belajar (SKB) dan Penyelenggara Kelompok Belajar Masyarakat (PKBM) mengikuti ujian Paket C setara SMA di gedung SMKN 1 Lhokseumawe, Senin (1/7). Dikatakan Kepala UPTD SKB, Jaswadi kepada Waspada, Senin (1/7), paket C yang digelar kemarin adalah gelombang kedua pada tahun ini. Gelombang pertama dilaksanakan pada April lalu, dan sisa yang tidak lewat diberi kesempatan untuk ikut kembali. Sehingga peserta ujian kemarin berjumlah 290 orang, tidak termasuk siswa gagal Ujian Nasional (UN). UjianakandilaksanakanselamaempatharimulaiSenindengan tujuh mata pelajaran yang diujiankan. Untuk paket B setara SMP juga diujiankan bersamaan kemarin. Namun pelaksanaannya di SMPN 1 Lhokseumawe, dan diikuti sekitar 20 orang. Sementara paket A setara SD, tahun ini tidak ada perserta. Tambahnya perserta ujian paket C sejak dimulai sejak 2005, per tahun rata-rata diikuti oleh 150 perserta. “Kami sebagai penyelenggara pada Unit Pendidikan Teknis Dinas (UPTD) Dinas Dikpora telah melaksanakan pendidikan luar sekolah (PLS), sehingga tahun ini juga melaksanakan ujian secara serentak,” ujar Jaswadi. (cmk)

Waspada/Mustafa Kamal

SALAH seorang peserta ujian Paket C mengerjakan soal di ruang kelas SMKN 1 Lhokseumawe, Senin (1/7).

Penerbangan Di Bandara SIM Banda Aceh Garuda Indonesia

GA 0278 Medan GA 0142 Jakarta/Medan GA 0146 Jakarta/Medan

Lion Air

JT 304 Jakarta JT 306 Jakarta/Medan JT 396 Jakarta/Medan

Sriwijaya Air

SJ 010 Jakarta/Medan

Air Asia

QZ 8023 Medan AK 1305 Kuala Lumpur *

Fire Fly

FY 3401 Penang* * Setiap Senin, Rabu, Jumat dan Minggu.

Rabu 3 Juli 2013

Tarif Angkutan Naik 20 Persen

HUT Bhayangkara Di Polres Bireuen Khidmat

Tiba (flight, asal, waktu)


Berangkat (flight, tujuan, waktu)

07:05 10:45 14:50

GA 0279 Medan GA 0143 Medan/Jakarta GA 0147 Medan/Jakarta

07:45 11:3 0 15:45

11:35 15:55 21:30

JT 397 Medan/Jakarta JT 307 Jakarta JT 305 Medan/Jakarta

06:00 12:15 16:35


SJ 011 Medan/Jakarta


12:00 11:20

QZ 8022 Medan AK 1306 Kuala Lumpur*

12:25 11:45


FY 3400 Penang*


Waspada/Mustafa Kamal

ANAK-anak bermain layang-layang di tanah kosong di Kota Lhokseumawe saat mengisi liburan panjang. Libur sekolah tingkat SD, SMP dan SMA pada semester II tahun pelajaran 2013-2014 ini berlangsung 24 Juni hingga 14 Juli 2013.

Dua Mahasiswa Akper Diringkus Diduga Jadi Kurir SS GANDAPURA (Waspada): Jajaran Polsek Gandapura, Bireuen, Senin (1/7) sore, meringkus dua mahasiswa Akper asal Aceh Utara, saat transaksi sabu kepada seorang anggota Polsek yang menyaru sebagai pembeli di kawasan sekitar komplek sebuah Masjid Desa Lapang Timu, kecamatan setempat. Darinya ikut diamankan dua paket sabu seberat 10 gram, 1 timbangan elektrik kecil serta satu sepedamotor. Kini keduanya mendekam dalam hotel prodeo polsek tersebut. Adapun kedua tersangka itu yakni, S, 21, dan F, 21, keduanya asal kecamatan Dewantara, Aceh Utara dan masih aktif sebagai mahasiswa sebuah Akper di wilayah kabupaten asalnya. Demikian Kapolres Bireuen, AKBP Yuri Karsono, melalui Kapolsek Gandapura, Iptu Syarifah Chaira Sukma, kepada Waspada, Selasa (2/7) di kantornya. “Beberapa hari sebelumnya, kami mendapat informasi dari masyarakat, sekarang ini ada pemasok shabu dari Aceh Utara sangat meresahkan masyarakat,” kata Kapolsek Gandapura Kanit Reskrim, Briptu Miswari dan anggotanya yang lain. Setelah mendapat informasi itu, sambung Syarifah, pihaknya berusaha mengembangkannya dan mencoba mengin-

Waspada/Abdul Mukthi Hasan

KAPOLSEK Gandapura, Iptu Syarifah Chaira Sukma (kanan) bersama Kanit Reskrim, Briptu Miswari (kiri) mengapit dua tersangka kurir sabu sambil memperlihatkan barang bukti di kantornya, Selasa (2/7). tai aktifitas orang yang dicurigainya. Pada suatu hari seorang anggotanya mencoba memancingnya dengan cara menyaru sebagai pembeli, sehingga kedua tersangka mengantar barang haram itu kepadanya. “Sat tersangka menimbang barang haram tersebut, keduanya langsung diringkus tanpa bisa berkutik,” terangnya. “Pengakuan tersangka shabu itu milik temannya juga seorang mahasiswa Akper berinisial Z asal Aceh Utara lain kecamatannya, sekarang ini masih kita kejar,” tambah Miswari yang dibenarkan tersangka, seraya menambahkan, kepada tersangka akan akan dijerat dengan psalnarkobaayat112,114dan115.

Tersangka S mengatakan baru sebulan menjalankan profesi ini itupun untuk kebutuhan menyelesaikan kuliahnya yang hanya tinggal semester terakhir. “Saya tidak ada lagi orang tua lakilaki, makanya saya bingung saat butuh biaya, makanya saya melakukan ini (kurir shabu-red),” katanya sambil menunduk. Tersangka F mengaku dirinya hanya diajak tersangka S dan dalam perjalanan baru diberitahu temannya pergi untuk mengantar narkotik. Dia mengaku dirinya juga akan mendapat bagian setelah barang tersebut laku. “Saya hanya ikut saja, namun bila berhasil saya juga akan diberikan bagian,” katanya santai. (cb02)

3.000 Ha Sawah Baru Butuh Irigasi, 800 Ha Terlantar LHOKSEUMAWE ( Waspada): Sekitar 3.000 hektare lahan sawah baru di pedalaman Lhokseumawe dan Aceh Utara membutuhkan saluran irigasi teknis. Bahkan sekira 800 ha lahan di bekas Rawa Cot Trieng, Kecamatan Muara Satu, Pemko Lhokseumawe, kembali ditumbuhi belukar karena sudah lama tidak digarap. Geusyik (kepala desa) Cot Trieng, Badaruddin kepada Waspada, Minggu (30/6) menjelaskan, bekas rawa Cot Trieng dibuka menjadi sawah baru sejak tahun 2007. “Kami sudah pernah menanam padi ketika air sawah masih digenangi air rawa,” ungkapnya. Namun setelah itu, sawah baru semakin sulit diperoleh air, sehingga lahan tidak produktif lagi. Menurutnya, rawa Cot Trieng merupakan bekas lokasi gerilya GAM yang telah dijadikan areal sawah. Sekira 800 ha sawah dibuka oleh warga Gam-

pong (desa) Cot Trieng dan sekitarnya. Sebagian lahan di Dusun-B memaanfatkan pengairan pompanisasi dari Kabupaten Aceh Utara. “Namun sekarang suplai air dari Aceh Utara telah diputuskan,” tambah Kepala Dusun-B, Bustami. Akibatnya, petani setempat juga mengalami nasib yang sama dengan ratusan petani dari dusun lain di Cot Trieng. Afuadi, Ketua Kelompok Tani Rimba Cot Bruek Kreing, Cot Trieng menjelaskan, petani membutuhkan irigasi teknis. Sumber air sangat mendukung, karena sepanjang rawa dilintasi sungai yang bermuara ke Kuala Krueng Geukuh. “Debit air sungai sesuai untuk membangun irigasi,” tambahnya. Bahkan irigasi diprediksi mampu mengairi sawah sampai ke Ujong Pacu dan Kecamatan Nisam, Aceh Utara. Untuk mengairi air ke seluruh areal di Cot Trieng dan

Ujong Pacu yang luasnya mencapai 1.500 ha , dibutuhkan saluran leaning sampai 3.000 meter. “Selain itu untuk pembuangan air ke sungai kembali, bisa dibangun empat unit pintu air,” tambah Afuadi. Sedangkan untuk memudahkan petani menjangkau lahan yang berada jauh dari perkampungan, telah dibangun jalan usaha tani. Akan tetapi, menurutdiamasihperlulanjutan penimbunan sekitar 200 meter. Sementara itu, bagian sayap kiri irigasi dapat dimanfaatkan petani Aceh Utara. Menurut Ketua Kelompom Tani Rimba Raya, Marzuki M.Diah sekitar 1.500hasawahdikawasanitujuga membutukan pengairan. Diantanya dari Gampong Krueng, Blang Croh, Ketapang dan Cot LienTeung.“Selama ini kami memanfaatkan air ketika sungai meluap,”jelasMarzuki.Namunkarena luapan air tidak teratur, sehinggasawahwargaseringmengalami kekeringan. (b15)

Organda. Sementara untuk menertibkan, pihaknya tidak bisa melakukan karena belum ada surat ederan wali kota. Ketua Organda Lhokseumawe, Azhar Mahmud menyebutkan, pihaknya menaikkan tarif angkutan arahan dari Dewan Pengurus Pusat (DPP) di Jakarta. Sementara Dewan Pengurus Cabang (DPC) di kabupaten/kota hanya menjalankan atau menyesuaikan. Disebutkan, tarif naik ada dua tingkatan. Tarif bawah untuk angkutan bus lama, naik antara 20-25 persen atau dari Rp70 menjadi Rp80 ribu. Sedangkan tarif atas untuk angkutan baru, naik 25-35 persen atau dari Rp80 menjadi 100 ribu. Tarif ini berlaku untuk bus dan minibus. (cmk)

Korban Tower Diminta Melapor Ke BLHK Lhokseumawe LHOKSEUMAWE ( Waspada ): Komunitas Peduli Lingkungan Bumoe Aceh Lestari ( KPL – Bal ) meminta kepada warga Desa Hagu Teungoh, Kecamatan Banda Sakti yang menjadi korban imbas tower Protelindo melapor ke Badan Lingkungan Hidup dan Kebersihan (BLHK) Kota Lhokseumawe. Demikian juga KPL – BAL juga meminta BLHK untuk berperan aktif atas kasus radiasi tower Protelindo di Desa Hagu Tengoh, Kecamatan Banda Sakti Lhokseumawe. Hal itu disampaikan Ketua KPL – BAL M. Agam Khalilullah kepada Waspada , Senin (1/ 7) terkait banyaknya barang elektronik milik warga Desa Hagu Teungoh yang rusak terkena radiasi atau sambaran petir dari tower Protelindo. Karena kenyamanan hidup masyarakat harus lebih diutamakan, maka sebaiknya masyarakat juga harus membuat laporan secara resmi kepada BLHK Lhokseumawe, tentang efek buruk tower tersebut. Apalagi hasil pantauan KPL – BAL dilapangan, masih banyak terdapat warga yang menjadi korban tidak mendapat ganti rugi dan bagi yang mendapat ganti rugi dirasa tidak memuaskan atau tidak layak diterima. Lantaran sebagian warga yang mendapat ganti rugi hanya diberikan uang bervariasi antara Rp200 ribu hingga Rp300 ribu untuk memperbaiki kerusakan barang elektronik. Tentu warga merasa nilai ganti rugi tidak layak terima, mengingat ada barang elektonik yang rusak justru tidak bisa diperbaiki lagi. “Maka BLHK juga harus serius menganggapi persoalan ini. Karena masyarakat yang dirugikan akibat keberadaan tower Protelindo. Apalagi ganti ruginya dilakukan tanpa ada koordinasi dengan pihak BLHK,” ujar M Agam Khalilullah. Apabila tegangan akibat sambaran petir yang

melewati sistem pengetanahan akan semakin tinggi. Efek medan listrik yang timbul akibat adanya sambaran petir pada tower BTS akan semakin besar sehingga dapat merusak piranti elektronik, jaringan kabel telekomunikasi, jaringan data, dan keselamatan manusia yang ada di sekitarnya. Maka untuk persoalan ini, BLHK Lhokseumawe tidak boleh bertindak lambat. Karena apabila persoalan ini semakin dibiarkan, maka keselamatan warga setempat akan menjadi terancam. Agam juga berharap Pemerintahan Kota Lhokseumawe melalui instansi terkait juga harus mengecek tentang keberadaan izin tower tersebut, apakah memiliki izin pendirian tower atau tidak. Agam menambahkan, Pemerintahan Kota Lhokseumawe juga harus berani memberi sanksi tegas kepada perusahaan tersebut, kalau memang radiasi masih terulang kembali maka lebih baik izin pendirian tower dicabut saja. KPL-Bal juga meminta kepada BLHK Kota Lhokseumawe, untuk mengkaji kembali tentang efek bahaya radiasi tower Protelindo di Desa Hagu Tengah itu. Sementara itu Kepala Badan Lingkungan Hidup dan Kebersihan (BLHK) Kota Lhokseumawe Nofendi kepada Waspada juga meminta warga yang menjadi korban tower Protelindo segera melapor ke BLHK untuk didata kembali. Nofendi menjelaskan berdasarkan laporan masyarakat, maka petugas Amdal BLHK akan turun untuk mengcross chek ulang. Apabila keberadaan tower Protelindo sudah sangat merugikan masyarakat sekitarnya, maka bukan tidak mungkin izinnya akan dicabut. “ Saya juga mengajak LSM KPL – BAL bisa bekerjasama untuk membantu keluhan masyarakat di lapangan. Kami tetap menanggapi berbagailaporanpengaduanmasyarakat,”tegasnya. (b16)

Penangkap Pembantai Keluarga Dapat Penghargaan LHOKSUKON (Waspada): Faizan Abdullah, 40, pria pemberani yang berhasil melumpuhkan amukan pemuda terduga sakit jiwa, yang membantai keluarganya sendiri dengan pedang, di Desa Arongan, Lhoksukon, Aceh Utara, 26 Juni 2013 lalu, dapat penghargaan dari polisi. Penghargaan berupa piagam, bingkisan dan sejumlah uang tunai tersebut, diserahkan Kapolres Aceh Utara, AKBP Gatot Sujono, SIk, seusai upacara HUT ke- 67 Bhayangkara, di Mapolres Aceh Utara, di Lhoksukon, Senin (1/7) pagi. “Keberanian Faizan patut kita beri apresiasi. Jika bukan karena keberaniannya, bisa jadi, akan jatuh korban lebih banyak lagi,” kata AKBP Gatot Sujono. Seperti diketahui Munazir alias Nyak Di, 28, pemuda yang diduga sakit jiwa, mengamuk di desa tempat tinggalnya, Arongan, Kec. Lhoksukon, 26 Juni 2013. Dia membacok ibu, kakak, dua keponakan dan seorang tetangganya sendiri dengan pedang, hanya gara-gara mie cepat saji yang ia suruh masak sama ibunya, telat masak. Pelaku membabibuta. Kebanyakan warga

sekitar, tak berani mendekat untuk menolong. Beruntung, Faizan, juga warga setempat, berhasil memukul korban dengan balok kayu, lalu menamparnya hingga tersungkur. Tak lama berselang, warga lain, mengikat pelaku dengan tali, lalu diserahkan ke polisi. Akibat aksi brutal Nyakdi, kakak kandungnya, Juarah, 40, dan anaknya, Maizar, 22 (keponakan pelaku-red), meninggal di tempat. Sedangkan ibu pelaku, Maimunah, 60, adik Maizar—Zalzahbari, 20 dan tetangganya, Nurjannah, 60, kritis, dan sampai kemarin masih dirawat intensif di dua rumah sakit. Zalzahbari dirawat di Rumah Sakit Umum Cut Meutia Aceh Utara. Sementara tiga korban kritis lain, dirawat di Rumah Sakit Bunda, Lhokseumawe. “Proses penyidikan terus berjalan. Saat ini kita sudah memeriksa lima saksi. Saksi korban kita ambil keterangan di rumah sakit. Setelah semua saksi ini selesai kita periksa, baru kita minta keterangan saksi ahli dari Psikiater atau dari RSJ, untuk memastikan pelaku sakit jiwa atau tidak,”pungkas Gatot.(b19)

Jelang Ramadhan, Pemkab Bireuen Cairkan Anggaran Rp100 M BIREUEN (Waspada): Menjelang Ramadhan 1434 H, Pemerintah Kabupaten Bireuen mencairkan anggaran mencapai Rp100 miliar. Anggaran terserap untuk keperluan jerih aparatur desa (gampong) hingga gaji ke-13 Pegawai Negeri Sipil (PNS). Bupati Bireuen Ruslan M Daud dalam arahannya pada acara silaturahmi para pimpinan daerah Kabupaten Bireuen dengan masyarakat di Lapangan Sepakbola Keude Jeunib, Senin (1/ 7) antara lain mengatakan, penyaluran dana tersebut sesuai anggaran yang telah ditetapkan dalam APBK dan harus dicairkan pada beberapa hari menjelang Ramadhan ini. Menurutnya, selain honor aparatur peme-

rintahan gampong dan gaji ke-13 PNS, Pemkab Bireuen juga menyalurkan untuk Bantuan Alokasi Dana Gampong (BADG), bantuan balai pengajian. Di tempat terpisah, Selasa (2/7) di halaman kantor Camat Juli, Rusla M Daud antara lain menyerahkan secara simbolis bantuan dana pembinaan untuk balai pengajian. Di mana, tiaptiap balai pengajian mendapatkan Rp6 juta. Disebutkan, jumlah balai pengajian yang mendapat bantuan ini mencapai 609 balai pengajian yang tersebar di 609 desa di Kabupaten Bireuen. Selain itu, Bupati Bireuen juga menyerahkan bantuan lembu dan kambing untuk kelompok ternak dalam masyarakat. (b17)

“Darah Saja Kami Berikan, Apalagi Yang Lain...” AJUN Komisaris Besar Polisi (AKBP) Joko Surachmanto, Kepala Polisi Resort Kota Lhokseumawe, Senin (1/7) pagi, usai peringatan Hari Ulang Tahun (HUT) Bhayangkara ke-67 di Mapolres setempat, menyempatkan diri untuk berbincang dengan Waspada tentang sejumlah kegiatan yang dilaksanakan pihaknya beberapa waktu menjelang HUT Bhayangkara dilaksanakan. Beberapa kegiatan yang dilaksanakan antara lain ziarah ke makam pahlawan di Blang Panyang, Muara Satu, Kota Lhokseumawe, kegiatan olah raga berupa main futsal dan bola voli, juga melaksanakan kegiatan gotong royong (kebersihan), serta melaksanakan kegiatan donor darah di Pelabuhan Krueng Geukueh, Dewantara, Aceh Utara. Ditanya apa makna yang

dapat diambil di balik peringatan HUT Bhayangkara ke-67, Joko Surachman mengatakan, sesuai dengan tema yang diambil dalam HUT Bhayangkara kali ini yaitu melakukan sinergisitas kemitraan dan anti korupsi, kolusi dan nepotisme (KKN), pelayanan prima, penegakan hukum, dan menyukseskan Pemilu 2014. Artinya, kata Joko, dalam HUT Bhayangkara ke-67, polisi berupaya sinergisitas terhadap instansi terkait dan instansi lainnya termasuk tokoh agama, tokoh masyarakat, tokoh adat, dan warga masyarakat secara keseluruhan. Diharapkan dalam penyelenggaraan Pemilu 2014 bisa berjalan dengan lancar, kondusif tanpa adanya hal-hal negatif. Yang ke dua, selaku aparat penegakkan hukum tentunya apabila ada hal-hal yang berkai-

tan dengan pelaksanaan Pemilu terjadi pelanggaran tindakpidana dan sebagainya akan diselesaikan dengan hukum secara profesional, disamping juga menjaga keamanan dalam negeri, sesuai dengan amanat Kapolri. Untuk menindaklanjuti amanat Kapolri, Kapolres Lhokseumawe mengaku berkewajiban untuk mendata potensi konflik dan sejumlah permasalahan yang bisa menimbulkan potensi konflik. Ini penting untuk dilakukan agar dapat mencegah hal-hal tersebut dengan cara persuasis dan preventif, dan tentunya jika sudah kelihatan ada pidananya maka akan segera diselesaikan sesuai jalur hukum. Ditanya, apakah masih ada potensi konflik di wilayah kekuasaannya, Joko Surachman dengan sigap menjawab, yang

namanya potensi konflik itu pasti ada, karena ada banyak kepentingan dan dorongan memaksakan kehendak dan ingin menjadi nomor satu, dan tentunya hal itu harus dicegah sedini mungkin dengan pendekatan Polmas. Ditanya tentang peristiwa pembakaran mobil Herlina, salah seorang calon legislatif dari PNA di Samudera, Aceh Utara, orang nomor satu di Mapolres Kota Lhokseumawe mengatakan, untuk sementara kasus itu masih disebut sebagai kriminal murni dengan tidak mengesampingkan persoalan politik, tetapi sesuatu perbuatan perusakan, pembakaran itu merupakan pidana. “Kita akan lakukan penangkapan, kita sudah melaksanakan Lidik, dan mudah-mudahan dengan adanya bantuan masyarakat, kita dapat segera menang-

kap pelakunya. Masyarakat harus membantu polisi agar orang-orang yang sengaja ingin menciptakan situasi Lhokseumawe dan Aceh Utara tidak kondusif dapat segara ditangkap. Kepada orang tersebut harus diberikan penindakan,” kata Joko Surachmanto. Ditanya pada peringatan HUT Bhayangkara telah dilaksanakan MoU antara Mapolres Lhokseumawe dengan PMI Lhokseumawe tentang donor darah, Kapolres membenarkan hal tersebut. Kata dia, MoU itu dilaksanakan selama 2 tahun, dan jika terbukti bermanfaat, kegiatan sosial akan diteruskan untuk selama-lamanya. MoU ditandatangani setelah dilaksanakan donor darah pada tanggal 28 Juni 2013. Pada kesempatan itu, Ketua PMI mengatakan, persediaan darah di PMI Aceh Utara dan Lhokseu-

mawe sangat minim, karena partisipasi masyarakat dalam donor darah masih sangat kurang, sehingga timbul kepedulian pihaknya sebagai polisi sesuai dengan tugas yang dibebankan sebagai pengayom, pelayan, dan pelindung. “Maka kami kemarin telah menandatangani MoU dengan PMI untuk melaksanakan kegiatan donor darah rutin setiap tiga bulan sekali. Darah hasil donor petugas akan disumbangkan untuk kebutuhan masyarakat melalui PMI. Ini sudah sewajarnya kami lakukan karena kami ini merupakan pelindung, pengayom masyarakat. Kami pikir kegiatan ini dapat meringankan beban masyarakat. Darah saja kita berikan, apalagi yang lain...,” katanya. Maimun Asnawi, SH.I


WASPADA Rabu 3 Juli 2013

Ketua DPRK Simeulue Diperiksa

Cut Lem, Juara Lomba Layang Tradisional Simeulue SIMEULUE (Waspada) : Cut Lem alias Jundi dengan layangan jagoannya Kuyu 1 keluar sebagai juara pertama dari 765 peserta lomba Layang-layang Anak Hulu Sinabang, Senin (1/7). Bendahara sekaligus Ketua Pertandingan Jon Kanaidi didampingi sejumlah peserta di Semifinal, Padang luas, Jalan SMP/ Jalan Baru Sinabang, Senin menuturkan pada acara grand final hanya lagi diikuti oleh 15 peserta. Untuk juara dua direbut Anto TL, dengan layangan T.O 1, sedangkan juara III disabet Yel dengan nama Layang KOPAN. Sedangkan juara IV sampai XV juga mendapat hadiah. Tapi tidak ada tropi, melainkan piagam dan uang pembinaan. Sedangkan untuk juara satu dua dan tiga, selain piagam dan tropi, mereka diberikan uang tunai Rp5 juta, juara dua Rp3 juta dan juara III Rp1 juta. Pertandingan sendiri berlangsung lebih dari dua pekan. Pada awal pertandingan masing- masing peserta untuk satu layangan yang ikut bertanding dikenakan administrasi Rp25.000. (cb08)

DPRK Sabang Terima LPJ APBK 2012 SABANG (Waspada): Semua fraksi di DPRK Sabang menerima laporan pertanggungjawaban APBK 2012 dengan angka penutup, pendapatan Rp 405 miliar lebih, belanja Rp 401 miliar lebih, surplus Rp 3,8 miliar lebih, pembiayaan Rp 61,4 miliar lebih dan Sisa Lebih Pembiayaan (Silpa) sebesar Rp 65,2 miliar lebih. Ketiga fraksi menyampaikan pendapatnya dalam rapat paripurna ke 5 DPRK Sabang yang dihadiriWakilWali kota Sabang, Nazaruddin di gedung dewan, Sabtu (29/6) siang. Wakil Ketua DPRK Sabang, Abdul Muthalib yang memimpin rapat paripurna ke 5 mengatakan, rapat paripurna untuk mendengar pendapat gabungan komisi dan kata akhir fraksi terhadap laporan pertanggungjawaban pelaksanaan APBK 2012 dan rancangan-rancangan qanun (Perda) Kota Sabang tahun 2013.(b31)

Kemenpera Rehab 575 Rumah Duafa Di Abdya BLANGPIDIE (Waspada) : Kementerian Perumahan Rakyat Republik Indonesia (Kemenpera RI) akan melakukan rehab sedang terhadap 575 rumah kaum duafa di Kabupaten Aceh Barat Daya untuk tahun 2013 ini. Rehab rumah kaum duafa yang dipusatkan di Kecamatan Babah Rot berdasarkan Surat Keputusan (SK) Menteri Perumahan Rakyat Nomor : 147/M/RS.01.01/05/2013 tanggal 17 Mei 2013 yang ditandatangani Menteri Djan Faridz itu meliputi 6 Desa masing-masing Desa Ie Mirah sebanyak 131 uni, Desa Blang Dalam 105 unit, Desa Teladan Jaya 128 unit, Gunung Samarinda 141 unit, Pantee Cermin 51 unit dan Pantee Rakyat 91 unit. Kepala Bidang (Kabid) Cipta Karya Dinas Pekerjaan Umum Abdya Azra’ie ditemui Waspada, Senin (1/7) mengungkapkan, pada awalnya alokasi rumah duafa di Abdya yang akan direhab oleh Kemenpera sebanyak 50 unit, namun alokasi itu berubah sebanyak 2 kali perubahan, perubahan pertama yakni 650 unit, akan tetapi diubah kembali dan sudah final menjadi 575 unit yang akan direhab. “Perubahan alokasi itu murni dari Kemenpera, bukan dari kita di sini,”ungkapnya. Sementara rumah duafa yang direhab itu lanjutnya, merupakanyangtermasukdalamrumahMasyarakatBerpenghasilanRendah (MBR) berdasarkan survey yang telah dilakukan, dimana katanya jenis yang akan direhab yaitu atap, lantai dan dinding. (b08)

Enam Rumah Kios Hangus Terbakar BlANGKEJEREN (Waspada): Enam Unit rumah toko di Pajak Pagi Tebelang, Desa Kutelintang, Kecamatan Blangkejeren, Kabupaten Gayo Lues, Minggu (30/6) sore, sekira pukul 17 : 30, hangus dilahap api. Rumah berkonstruksi setengah permanen yang sehari-hari dihuni pedagang di sekitar itu, hangus terpanggang sehingga banyak harta benda milik para pedagang tak berhasil diselamatkan. Menurut beberapa sumber menyebutkan, api pertama kali terlihat menyala dari salah satu rumah warga sekira pukul 15 : 45. Dalam hitungan menit api membesar, karena sebagian dinding rumah berkonstruksi dari bahan kayu, akibat tiupan angin yang sangat kencang, membuat api semakin cepat menjulang dan dengan cepat merambat dari rumah ke rumah, sehingga sulit dipadamkan. “Hingga saat ini, sumber api belum diketahui dan masih dalam penyelidikan pihak kepolisian,”jelas Kapolres Gayo Lues, AKBP Achmadi,Sik, Minggu (30/6). (cjs)

HUT Bhayangkara Di Polres Abdya Khitmad BLANGPIDIE (Waspada) : Polres Aceh Barat Daya (Abdya) menggelar upacara dalam rangka Hari Ulang Tahun (HUT) Bhayangkara Ke-67 di halaman Mapolres setempat, Senin (1/7) pagi. Upacara gabungan antara Polri, TNI, Satpol PP dan sejumlah instansi keamanan lainnya itu dipimpin Kapolres Abdya AKBP Eko Budi Susilo S,Ik, sementara bertindak sebagai Komandan Upacara Kapolsek Kota Blangpidie Iptu Erjan Dasmi. HUT Bhayangkara tahun ini bertema “Sinergitas Kemitraan dan Anti KKN, Wujudkan Pelayanan Prima, Gakum, Kamdagri Mantap Sukseskan Pemilu 2014”. Upacara yang dihadiriWakil Bupati Abdya TgkYusrizal Razali, Kasdim 0110 Abdya Mayor Inf M. Ramdhan, Mewakili Kajari Blangpidie Fahmi, SH, Dansubdenpom Blangpidie Lettu (CPM) Joko MS dan sejumlah perwira tinggi jajaran Polres Abdya berikut sejumlah Ibu Bhayangkari, tamu undangan dan segenap peserta upacara gabungan dihalaman Mapolres setempat. (b08)

Tiga Personil Polres AB Terima Penghargaan KOTA JANTHO (Waspada): 16 personil Polres Aceh Besar menerima penganugerahan tanda kehormatan Satya Lencana Pengabdian dari Presiden RI Susilo Bambang Yudhoyono. Penghargaan tersebut diserahkan Kapolres Aceh Besar AKBP Djadjuli, SIK, MSi kepada tiga perwakilan, masing-masing Aiptu Dhuha Rahmat Fataha untuk Satya Lencana Kesetiaan 24 Tahun (dua personil), Aiptu Hamdani untuk Satya Lencana 16 Tahun (dua personil) dan Bripka Rusman untuk Satya Lencana 8 Tahun (12 personil). Penyerahan penghargaan berlangsung pada upacara peringatan HUT Bhayangkara Ke 67, 1 Juli 2013 di Lapangan Upacara Mapolres Aceh Besar di Kota Jantho. Dalam kesempatan itu, Kapolres Aceh Besar AKBP Djadjuli, SIK, MSi juga menyerahkan hadiah kepada para pemenang aneka lomba dalam rangka HUT Bhayangkara Ke 67, di antaranya pertandingan Futsal, perlombaan Babinkamtibmas, perlombaan Kebersihan Polsek, Pos siskambling dan perlombaan Memancing. Untuk perlombaan Futsal, Juara I diraih Satlantas Polres Aceh Besar, Juara II Satsabhara dan Juara III Polsek Jantho. Sementara lomba Kebersihan Polsek Juara I Polsek Kuta Cot Glie, Juara II Polsek Simpang Tiga, Juara III Polsek Lhong dan Juara IV Polsek Pulo Aceh. Untuk perlombaan Pos Kamling Juara I Polsek Sukamakmur, Juara II Polsek Lhong dan Juara III Polsek Indrapuri. Untuk memancing yang dilaksanakan Satreskrim Polres Aceh Besar, Juara I Aiptu Sumartono, Juara II Aiptu Zulkifli dan Juara III Aiptu Toni L. Sehari sebelumnya, di tempat yang sama, Kapolres Aceh Besar AKBP Djadjuli menerima Korps Raport 39 personil Polres Aceh Besar. Dari jumlah itu, delapan di antaranya naik pangkat dari Inspektur Dua (Ipda) Polisi menjadi Inspektur Satu (Iptu) Polisi, tiga personil naik pangkat dari Ajun Inspektur Dua (Aipda) ke Ajun Inspektur Satu (Aiptu) dan selebihnya kenaikan pangkat dari bintara. (b05)


Waspada/Muhammad Rapyan

BENDAHARA Panitia Layang-layang Tradisional Anak Hulu Sinabang, Jon Kanaidi menyerahkan hadiah kepada Anto TL, pemenang dua lomba layang, Senin (1/7)

KPID : Matikan TV-Radio Saat Magrib BANDA ACEH (Waspada): Komisi Penyiaran Indonesia Daerah (KPID) Aceh mengimbau masyarakat untuk senantiasa mematikan pesawat televisi dan radio saat berlangsungnya shalat maghrib. “Ini sebagai dukungan gerakan maghrib mengaji yang dicanangkan Gubernur Aceh Zaini

Abdullah di Aceh,” ujar Said Firdaus, Ketua KPID Aceh, Selasa (2/7) di Banda Aceh. Selain di rumah-rumah, kata Said, mematikan televisi dan radio saat maghrib itu termasuk di kedai-kedai, warung kopi, kafe, pusat-pusat pelayanan umum maupun pusat perbelanjaan. “Imbauan ini juga ditujukan kepada lembaga-lembaga penyiaran televisi dan radio di Aceh, agar senantiasa menghormati pelaksanaan Syariat Islam

di Aceh,” jelas Said Firdaus. Ketua KPID Aceh menyebutkan, seperti penayangan program azan lima waktu tiap hari, dan konten syiar Islam lain yang mengarah pada peningkatan pendidikan dan ketaqwaan masyarakat. Gubernur Aceh Zaini Abdullah telah melakukan pencanangan gerakan maghrib mengaji (Gema Mengaji) pada 1 Juli 2013 lalu di Alun-alun Suka Makmue, Kabupaten Nagan Raya. (b06)

Reformasi Birokrasi Aceh Harus Mulai Tahun Depan BANDA ACEH (Waspada): Menteri Pendayagunaan Aparatur Negara dan Reformasi Birokrasi (PAN-RB) Azwar Abubakar mengatakan, dalam reformasi birokrasi perlu rekrutmen pegawai yang transparan serta promosi jabatan yang terbuka dan objektif. “Rekrutmen pegawai yang fair dan promosi jabatan yang objektif merupakan prioritas dalam reformasi birokrasi,” ujar Azwar Abubakar pada peluncuran roadmap reformasi birokrasi pemerintah Aceh 20132017, Selasa (2/7) di Banda Aceh. Pencanangan dan peluncuran roadmap (peta jalan) reformasi birokrasi pemerintah Aceh 2013-2017 itu, dilakukan Gubernur Aceh Zaini Abdullah di ruang serbaguna Setda Aceh

yang dihadiri bupati/wali kota dan Sekda kabupaten/kota seAceh. Azwar menambahkan juga menjadi prioritas penting dalam reformasi birokrasi adalah kinerja berbasis teknologi informasi dan komunikasi. “Reformasi birokrasi Aceh harus mulai tahun depan untuk memberikan pelayanan yang terbaik kepada masyarakat,” paparnya. Menurut mantan Wagub Aceh ini, seluruh mata dunia dan nasional saat ini semua tertuju ke Aceh. “Ada apa di Aceh, dengan harapan keamanan di Aceh tetap terjaga, keadilan terbina serta masyarakat makmur dan sejahtera,” katanya. Gubernur Aceh Zaini Abdullah saat pencanangan dan peluncuran road map Pemerintah

Aceh itu mengakui reformasi birokrasi penting karena program tersebut berkaitan dengan kinerja aparatur pemerintahan, transparansi serta kebutuhan masyarakat. “Untuk menjalankan reformasi birokrasi di Aceh, butuh kerja keras kita semua karena bersentuhan langsung dengan masyarakat,” kata Zaini yang mengimbau elemen masyarakat di Aceh agar ikut aktif memantau kinerja aparatur pemerintahan di daerah ini. Country Director UNDP Indonesia, Beate Trankmann mengatakan, UNDP melalui program penguatan tata kelola provinsi telah membantu Provinsi Gorontalo, Bangka Belitung dan Aceh untuk menyusun roadmap reformasi birokrasi. (b06)

KIP Buka Pendaftaran Pilkada Subulussalam SUBULUSSALAM (Waspada): Ketua Komite Independen Pemilihan (KIP) Subulussalam Syarkawi Nur melalui suratnya No.270/598/VI/2013, tertanggal 28 Juni 2013 mengumumkan pendaftaran pasangan bakal calonWali Kota/WakilWali Kota Subulussalam tahun 2013. Pengumuman itu ditengarai menjadi jawaban kisruh pro dan kontra Pilkada Subulussalam yang sempat mengemuka pra dan pasca penggantian anggota KIP. Selain dua surat DPRK kepada Ketua KIP Subulussalam, satu di antaranya klarifikasi, juga digelar pertemuan KIP yang melibatkan Ketua KIP dan Asisten I Setdaprov, Wali Kota dan Ketua DPRK Subulussalam pekan lalu, nyaris tak menghasilkan kesepakatan. Padahal DPRK telah mengirim surat No. 270/060/DPRK/ 2013 tanggal 14 Juni 2013 kepa-

da KIP setempat perihal pemberitahuan DPRK Subulussalam tentang masa berakhirnya jabatan Wali Kota dan Wakil Wali Kota Subulussalam Periode 2009-2014 ditandatangani dua Wakil Ketua DPRK Siti Ansari Bancin dan Karlinus bersama 11 anggota (Ansari Idrus Sambo, Syarifuddin Padang, Fajri Munte, T Maswarli, HM Sugito, Syarifuddin, Sultan Bagindo, Erlinawati, Darwinsyah, Marzuki dan Mukmin). Anehnya, selang empat hari, 18 Juni 2013, DPRK kembali menyurati KIP perihal klarifikasi terhadap surat DPRK Subulussalam No. 270/060/DPRK/ 2013 ditandatangani tunggal oleh ketua, Pianti Mala. Dalam suratnya, Pianti Mala menyarankan KIP Subulussalam tidak menetapkan tahapan pilkada untuk sementara, sampai batas waktu yang diberikan UU,

UUPA dan Qanun Aceh. Pada agenda pertemuan KIP Subulussalam silam tampak ketidaksinergian antara eksekutif dengan legislatif tentang Pilkada Subulussalam 2013. Bahkan Ketua DPRK, Pianti Mala memastikan belum menyurati KIP, terkait pemberitahuan berakhirnya masa jabatanWali Kota danWakilWali Kota Subulussalam periode 2009-2014. Pengumuman KIP tentang Pendaftaran Pasangan Balon Wali Kota dan Wakil Wali Kota, 28 Juni 2013, jadwal pengambilan dokumen/formulir bagi Parpol dan perseorangan serta penyerahan dukungan perseorangan dan melengkapi jumlah dukungan minimal, 26 Juli 2013 dan pendaftaran, 2329 Juli 2013 di Sekretariat KIP, kompleks perkantoran Pemko Subulussalam. (b28)

SIMEULUE (Waspada): Kapolres Simeulue AKPB Supriadi membenarkan isu yang beredar bahwa pihaknya telah memanggil Ketua DPRK Simeulue Aryaudin berkaitan aliran dana dugaan korupsi yang menimpa mantan Dirut PDKS yang nilainya mencapai lebih Rp700 juta. “Ya betul, “ jawabnya saat ditanya Waspada, Selasa (2/7). Lebih lanjut Kapolres baru Simeulue itu menyatakan, pemeriksaan Ketua DPRK Simeulue Aryaudin dalam kapasitas sebagai saksi, untuk melengkapi berkas P21 Dirut PDKS berinisial AU. Selain Ariaudin, menurut Supriadi, ada lagi sejumlah saksi lain. Adapun dugaan korupsi AU alirannya dinikmati sejumlah orang besar di Simeulue tak kecuali Ketua DPRK setempat. Awalnya disampaikan AKBP Parluatan, beberapa waktu lalu saat masih mejadi Kapolres di sana. Berita semakin heboh setelah turut dilansir beberapa kali oleh media. Mantan Kapolres Simeulue AKBP Parluatan Siregar yang kini pindah ke Mapolda Sumut, ketika dicek, Selasa (2/7) menyatakan, pihaknya tidak pernah menghentikan kasus dugaan korupsi oknum Dirut PDKS berinisial AU.

Dia juga tidak pandang bulu saat memeriksa kasus itu, selain juga sudah memintai keterangan Ketua DPRK setempat sebagaimana dibeberkan oleh oknum tersangka AU. Dia juga mengaku waktu itu dia juga telah mengirim surat permin-taan ke Gubernur Aceh untuk izin memeriksa ketua dan beberapa anggota DPRK setempat. “Dan surat itu, sudah keluar,” ujar Parluatan Siregar. Meskipun secara aturan sesuai keputusan MK terbaru sebenarnya untuk memeriksa pejabat sebagai saksi tak perlu lagi izin atasan. Apalagi menyangkut kepentingan publik. Ketua Aryaudin sendiri kemarin sedang berada di luar daerah. Melalui seluler membenarkan telah diperiksa ulang oleh Kapolres Baru Simeulue AKBP Supriadi. Kata Ariudin, dalam kaitan penyelewangan dana perjalanan Dinas PDKS yang dituduhkan mantan Dirut PDKS turut dinikmati. Padahal, kata Ariaudin, dia tidak menerima uang dari Aliuhar dan juga mengaku tidak pernah melaksanakan perjalanan dinas yang dilontarkan mantan Dirut PDKS berinisial AU itu. (cb08)

Mobil Kafilah AB Kecelakaan KOTA JANTHO (Waspada) : Mobil Toyota Innova yang mengangkut kafilah Kabupaten Aceh Besar pulang dari MTQ ke-31 tingkat Provinsi Aceh mengalami kecelakaan di Aceh Jaya. Peristiwa itu terjadi di Dusun Cot Balam, Gampong LuengGayo,KecamatanTeunom,KabupatenAceh Jaya, Selasa (2/7) sekira pukul 04:00. Pada saat kejadian, di dalam mobil yang disopiri Effendi, pegawai Dinas Syariat Islam Aceh Besar ada tiga penumpang, masing-masing Takdir Feriza, juara I Golongan Dewasa Putra, Ikhwan, juara I Cabang Tafsir Quran Bahasa Indonesia serta seorang ofisial bernama Masrul. “Mobil itu membawa tiga penumpang dan seorang sopir, melaju dalam kecepatan tinggi. Setiba di jalan yang sedang diperbaiki, mobil heleng sehingga tidak dapat dikendalikan dan

menabrak rambu jalan, kemudian masuk dalam saluran air dan menabrak sebuah gubuk,” kata Kabag Humas dan Protokol Pemkab Aceh Besar Muhammad Iswanto. Kabag Humas memastikan, sopir dan semua penumpang mobil selamat dalam kejadian itu. “Mereka semuanya baik-baik saja, tidak ada yang terluka serius. Mereka semua sudah tiba di rumahnya masing-masing,” ujarnya lagi. MuhammadIswantomenyebutkan,kecelakaan yang terjadi dini hari itu diduga akibat sang sopir kelelahan sehingga kejadian itu tidak terelakkan. Kapolres Aceh Jaya AKBP Galih Sayudho mengaku, pihaknya belum mendapat laporan tentang kecelakaan yang dialami mobil pengangkut kafilah Kabupaten Aceh Besar saat pulang dari MTQ di Subulussalam. (b05)

Lomba Foto Budaya Di Gayo Peserta Tuan Rumah Juara TAKENGEN (Waspada): Peserta tuan rumah, Mahyadi berhasil keluar sebagai juara lomba foto bertajuk ‘Gayo Dalam Bingkai’ 2013,29-30 Juni di Takengen, Aceh Tengah. Kepada Waspada, Senin (1/7) setelah keluarnya pengumuman hasil penilaian dari dewan juri, Mahyadi, 37, menyebutkan, prestasi yang diraih sebelumnya tidak pernah diduga dapat diraih. “Melihat tingginya animo peserta, ditambah munculnya fotografer yang ternama dan lebih senior dari berbagai daerah, semula saya tidak yakin bisa jadi terbaik. Namun, puji syukur ketatnya persaingan telah saya lalui dan hasilnya terbaik,” ucap Mahyadi yang juga merupakan wartawan dari sebuah media lokal di Aceh.

Menurutnya, ada 57 peserta yang ambil bagian dalam lomba itu. Bukan saja dari kabupaten/kota di Aceh, namun sebagian berasal dari Medan (Sumut). “Ada beberapa kategori lomba yang kami lakukan sebelumnya yakni mengambil jepretan foto di empat tempat di sini: Pantan Terong, Bebesen, Pabrik Kopi Baburrayan, Pegasing, Toweren dan Pante Menye, Bintang,” tuturnya. Adapun nama peserta yang berhasil meraih lima besar dan berhak mendapat hadiah dan tropi daripanitiakegiatanadalah:Mahyadi,AcehTengah (juara 1). Irwandi, Banda Aceh (juara 2). Yuzar Alamsyah, Banda Aceh (III). Ferdi Siregar, Medan (IV)danChaidirMahyudin,BandaAceh(V). (cb09)

Jumlah Wisman Ke Aceh Meningkat 15,50 Persen BANDA ACEH (Waspada); Jumlah wisatawan mancanegara (wisman) yang berkunjung ke Aceh pada bulan Mei 2013 sebanyak 1.140 orang atau terjadi peningkatan sebesar 15,50 persen dibandingkan dengan bulan April 2013 lalu. “Namun secara kumulatif pencapaian jumlah wisman Januari-Mei 2013 menurun sebesar 14,79 persen terhadap periode yang sama tahun 2012,” ujar Hermanto, Kepala Badan Pusat Statistik (BPS) Aceh, Senin (1/7) di Banda Aceh. Hermanto merincikan jumlah wisman terbanyak berkunjung ke Aceh pada bulan Mei 2013, berasal dari Malaysia sebanyak 832 orang atau mengalami peningkatan dari bulan April 2013 sebesar 43,20 persen. Lima besar wisman pada Mei 2013 yakni Amerika Serikat 35 orang, RRC 38 orang, Jerman 29 orang dan Singapura 29 orang. Secara kumulatif, wisman terbanyak Malaysia (3.401 orang), Perancis (158 orang), Australia (156 orang) AS (156 orang) dan Inggris (155 orang). Bila dilihat jumlah wisman menurut wilayah, sebut Hermanto, pada bulan Mei 2013 terbanyak dari ASEAN yang berjumlah 889 orang, disusul

Eropa sebanyak 97 orang dan Asia (tanpa ASEAN) sebanyak 78 orang. “Jumlah wisman dari wilayah ASEAN dan Eropa pada Januari-Mei 2013, masing-masing sebesar 70,52 persen dan 15,11 persen terhadap total wisman yang berkunjung ke Aceh pada tahun 2013 ini,” tandasnya. Turun Sementara itu, tingkat hunian kamar (TPK) hotelberbintangdiAcehpadabulanMei2013turun 0,20 poin dibandingkan keadaan bulan April 2013. Namun jika dibandingkan dengan bulan Mei 2012 mengalami peningkatan 6,24 poin. Sedangkan TPK akomodasi lainnya pada bulan Mei 2013 mencapai 30,04 persen dan mengalami penurunan sebesar 0,99 poin terhadap bulan April 2013. Tapi mengalami peningkatan sebesar 2,63 poin terhadap bulan Mei 2012. Pada sisi lain, sebut Hermanto, secara keseluruhan rata-rata lama menginap tamu pada hotel berbintang bulan Mei 2013 di Aceh menurun dibandingkan bulan April 2013. Namun akomodasi lainnya meningkat jika dibandingkan bulan April 2013. (b06)

Pemuda Tionghoa Sigli Masuk Islam SIGLI (Waspada): Kevin, 25, seorang pemuda warga keturunan Tionghoa, berdomisili di Desa Keramat Dalam, Kota Sigli, Pidie, Senin (1/7) memeluk agama Islam, disaksikan Asisten I Setdakab Pidie HT Anwar ZA. “Saya memeluk Islam, karena keinginan dan kesadaran sendiri dan direstui abang saya yang duluan sudah memeluk Islam,” kata Kevin, yang kini bernama Firdaus. Ia mengatakan, sebelum masuk Islam, sudah lama mempelajari agama yang dibawa Nabi Muhammad, SAW itu. Pensyahadatan Kevin itu, selain disaksikan Asisten I Anwar Ishak, juga dihadiri anggota Muspika setempat serta disaksikan geuchik dan masyarakat Desa Keramat Dalam. Kevin dalam memeluk Islam proses pensyahadatannya dibimbing Bustami Dahruddin. Dalam melafalkan pensyahadatan Firdaus sangat lancar sehingga tidak perlu dilakukan berulang-ulang. Geuchik Keramat Dalam, Kota Sigli, M Zaini A Karim mengungkapka niat Kevin sudah lama berniat masuk islam. Singkat cerita, sekira tiga


WAKIL Bupati Aceh Tenggara H Ali Basyrah, SPd.MM dan pengurus Ikatan Pelajar dan Mahasiswa Aceh Tenggara (IPMAT) Medan seusai pelantikan di Kampus IAIN Sumatera Utara di Medan.

Wakil Bupati Agara Lantik Pengurus IPMAT Medan Waspada/Muhammad Riza

BUSTAMI Dahruddin membimbing pensyahadatan terhadap Kevin, 25, warga keturunan di Sigli, Pidie yang resmi memeluk agama Islam, Senin (1/7). hari lalu, dalam tidurnya ia bermimpi telah disyahadatkan oleh seseorang dengan mengucapkan dua kalimah syahadat. Lalu dia terbangun, sejak itu ia merasa tubuhnya kurang enak dan gelisah. “ Kemudian, Kevin menjumpai saya, dan meminta saya untuk segera mengislamkan dia, karena dia sangat ingin mengucapkan dua kalimah syahadat di depan umum. Lalu saya beritahukan pada ketua KUA dan ulama setempat supaya dapat

melakukan proses pengsyahadatan terhadap Kevin. Alhamdulillah, ia telah mengucapkan syahadat dengan baik,” kata M Zaini. Asisten I Setdakab Pidie T Anwar ZA mengatakan, Firdaus telah resmi menjadi mu’alaf. Anwar mengajak seluruh komponen masyarakat di Pidie untuk peduli terhadap para mu’alaf, sebab di antara mereka banyak juga yang telah disingkirkan dari keluarga dan komunitasnya. (b10)

MEDAN (Waspada): Wakil Bupati Aceh Tenggara (Agara) H. Ali Basyrah, SPd, MM melantik kepengurusan Ikatan Pelajar dan Mahasiswa Aceh Tenggara (IPMAT) Medan periode 20132015 di aula Kampus IAIN Sumatera Utara di Medan, Minggu (30/6). Mereka yang dilantik adalah Syaji Harun (Ketua Umum), Pimpin Nur Solihin (Wakil Ketua I), Kuswoyo Hardi Skd (Wakil Ketua II), Sudiansyah (Wakil Ketua III), Rahmad Afrizal B (Sekreraris), Imron Gunawan (Wakil Sekretaris I), Juli Meliana (Wakil Sekretaris II), Tri Rasyid Desky (Wakil Sekretaris III), Masriani (Bendahara Umum), Rina Novia (Wakil Bendahara I), Lusia Nandalita (Wakil Bendahara II), Fardilah Sandi (Wakil Bendahara III). Kepengurusan ini dilengkapi 11 bidang, dengan koordinator di berbagai kampus di Medan. Wakil Bupati Aceh Tenggara H Ali Basyrah, SPd.MM mengharapkan kepengurusan IPMAT Medan yang baru dilantik segera menyusun program kerja dan dapat mengaplikasikannya di lapangan untuk kepentingan anggota IPMAT pada khususnya dan masyarakat Aceh Tenggara pada umumnya.

Ketua IPMAT Medan 2013-2015 Syaji Harun mengungkapkan, pihaknya akan melakukan inventarisasi jumlah pelajar dan mahasiswa Aceh Tenggara di Medan, yang diharapkan ikut bersama-sama membesarkan IPMAT . ”Karena, yang kita tahu, ada ribuan pelajar dan mahasiswa Aceh Tenggara di Medan, yang tentu merupakan potensi yang luar biasa. Kepada Pemkab Aceh Tenggara, kami berharap agar memberi perhatian maksimal kepada pelajar dan mahasiswa berprestasi misalnya pemberian beasiswa, pengadaan sekretariat IPMAT dan asrama untuk mahasiswa Aceh Tenggara di Medan. Alhamdulillah, asrama untuk mahasiswi sudah ada di Jalan Pelajar Gang Alas Medan, tapi untuk mahasiswa belum ada,” ujar Syaji Harun kepada Waspada di Kinaya Café Jalan Pancing Medan, kemarin. Ketua Sepakat Segenap Keluarga Kutacane Aceh Tenggara (SKKAT) Drs Syamsul Bahri mengharapkan pengurus IPMAT Medan yang baru dilantik mampu mengembangkan image positif dengan melaksanakan berbagai program kerja yang manfaatnya langsung dirasakan mahasiswa. (ihn)



WASPADA Rabu 3 Juli 2013

Rapai Dari Al Muslim Bireuen Getarkan Jepang


TIM Kesenian dari Universitas Al Muslim Bireuen tampil di Universitas Doshisha Kyoto pada Senin (1/7) di Jepang. Mereka menampilkan beberapa tarian Aceh seperti rapai geleng, saman dan lain-lain yang mendapat sambutan hangat

Ferry Langsa-Penang Berhenti Beroperasi Ada Penumpang Terlantar Di Malaysia LANGSA (Waspada) : Pelayaran kapal penumpang dengan penggunakan ferry melalui Pelabuhan Kuala Langsa tujuan Pulau Penang, Malaysia dan sebaliknya sekarang terhenti operasionalnya.

147 Honorer K-I Terima SK IDI (Waspada): Sebanyak 147 tenaga honorer yang termasuk dalam Katagori Satu (K-1) dalam lingkungan Pemkab Aceh Timur terima Surat Keputusan (SK) pengangkatan sebagai Calon Pegawai Negeri Sipil (CPNS). Prosesi penyerahan SK Pengangkatan dan Penempatan dipusatkan di Aula SKB Aceh Timur di Idi Timur, Senin (1/7). Sementara empat tenaga honorer K-1 lainnya masih dalam proses penyelesaian di Kantor Regional IV Badan Kepegawaian Negara (BKN) Medan, Sumatera Utara. “Pengangkatan honorer menjadi CPNS merupakan tindaklanjut dari PP No 56/ 2012tentang perubahan kedua atas PP No 48/2005 sebagaimana diubah dengan PP No 43/2007, dimana pengangkatan dilakukan secara bertahap mulai tahun 2005 dan paling lambat selesai tahun anggaran 2009,” kata Bupati Aceh Timur Hasballah M.Thaib dalam sambutan Penyerahan Keputusan Pengangkatan dan Penempatan CPNS Formasi Honorer K-I di Aula SKB Aceh Timur. Para kepala SKPK juga diharapkan terus memantau kinerja para tenaga CPNS yang telah diangkat formasi honorer K-I dan jangan segan-segan memberikan sanksi terhadap para PNS yang melanggar. (b24)

Rocky Minta Komplek SKB Difungsikan IDI TIMUR (Waspada): Dihadapan Kepala Dinas Pendidikan dan Kepala Badan Kepegawaian, Pendidikan dan Pelatihan (BKPP) Aceh Timur, Bupati Hasballah M.Thaib atau Rocky meminta Komplek SKB di Desa Seuneubok Teungoh, Kecamatan Idi Timur. Hal itu dinilai penting untuk menyelamatkan bangunan pemerintah. “Kita harapkan komplek ini dimanfaatkan, karena beberapa gedung layak dijadikan ruang kelas untuk belajar, seperti Diklat Prajabatan,” pinta Rocky saat meninjau Komplek SKB Aceh Timur di Idi Timur, Senin (1/7). Tak hanya itu, sambung dia, komplek itu kini telah tersedia kursi dan meja, namun halaman yang ditumbuhi semak-semak perlu dibersihkan segera, sehingga tidak terkesan terbengkalai. “Tapi yang perlu dibenahi adalah jalan didalam Komplek SKB dan jalan tembus ke pusat perkantoran harus dibangun, sehingga memiliki akses yang mudah dalam pemanfaatan kompek yang hari ini kita nilai kurang dalam pemeliharaan dan pemanfaatan,” sebut Rocky. (b24)

SMPN 10 Juara III Tari Kreasi BNN Langsa LANGSA (Waspada): SMP Negeri 10 Langsa berhasil meraih juara III lomba tari kreasi Aceh tingkat umum yang diselenggarakan Badan Narkotika Nasional (BNN) Kota Langsa dalam peringatan Hari Anti Narkotika Internasional (HANI) di Lapangan Merdeka Langsa, Sabtu (29/6). Demikian Kepala SMP Negeri 10 Langsa, Tarmizi Putra, SPd di sekolahnya, Senin (1/7). Menurutnya, keberhasilan ini merupakan prestasi yang kesekian kalinya setelah sebelumnya berhasil meraih juara III di tingkat provinsi Aceh dalam lomba FLS2N dan berhasil meraih juara umum pada pekan kreativitas seni siswa se Kota Langsa tingkat SD, SMP dan SMA pada 12-14 Juni lalu. Di samping itu pula, grup tari ini juga diundang oleh Pemerintah Kabupaten Aceh Tamiang untuk memeriahkan HUT Tamiang pada Sabtu kemarin. Dijelaskan Tarmizi, grup tari yang beranggotakan 7 personil ini membawakan Tarian Panglima Perang yang merupakan grup tari dalam ekstrakurikuler di sekolah. (m43)


GRUP tari SMPN 10 Langsa foto bersama ketika meraih juara di tingkat provinsi belum lama ini.

Dinas Syariat Bekali 450 Guru Seumeubeut LANGSA (Waspada) : Dinas Syariat Islam kota Langsa membekali 450 guru Seumeubeut di wilayah kota Langsa dimulai, Senin-Kamis (1-4/7) di aula Hotel Ramile Langsa. Kadis Syariat Islam Kota Langsa Ibrahim Latif, Selasa (2/ 7) menjelaskan, 450 guru Seumeubeut yang terdiri dari guru pengajian Balee Pengajian, guru pengajian TPA/ TPQ (Taman Pendidikan Alquran) di lima kecamatan di Kota Langsa dalam lima angkatan. “Guru Seumeubeud dibekali dengan materi qanun Syariat Islam, manajemen pengelolaan balai pengajian, TPA/ TPQ, peranan guru Seumeubeud dalam menghidupkan balai pengajian, TPA/ TPQ, dan kurikulum dan metode pengajaran Alquran yang narasumbernya dari Kemenag, MPU, LPTQ dan lembaga STAIN Zawiyah Cot Kala Langsa,” katanya. Ibrahim berharap, kepada 450 guru TPA/TPQ dapat menjadi pendekar pelaksanaan Syariat Islam di gampong-gampong. Dengan demikian guru-guru tersebut dapat menjadi perpanjangan tangan Dinas Syariat Islam dalam pelaksanaan syariat di gampong-gampong. (m43)

Kabid Perhubungan Laut Dinas Perhubungan Kota Langsa, Mustafa Ahmad, di kantornya, Selasa (2/7) mengatakan, sudah satu minggu kapal ferry yang biasa mengangkut penumpang itu tidak jalan. Penyebab terhentinya pelayaran itu Mustafa Ahmad tidak mengetahui secara pasti. Karena pelaksananya bukan Dinas Perhubungan, melainkan pihak swasta dan pengawasan langsung berada di bawah Tim Percepatan Fungsionalisasi Pela-

buhan Kuala Langsa. Bahkan Mustafa Ahmad mengakui pihaknya juga kelimpungan menjawab berbagai pertanyaan mengenai hal itu. Yang sayangnya, kata dia, ada penumpang yang sudah membeli tiket PP dan sekarang sudah berada di Malaysia dan visanya hampir habis, tetapi mereka tidak bisa pulang karena kapal tidak berlayar. Ketua Tim Percepatan Fungsionalisasi Pelabuhan Kuala Langsa Alaidin Mahmud,

ketika didatangi ke kantornya tidak berada di tempat dan saat dihubungi melalui telepon selular tidak aktif. “Bapak sudah dua hari tidak masuk kantor,” kata salah seorang karyawatinya yang biasanya juga bekerja sebagai penjual tiket. Menurut karyawati itu, terhentinya pelayaran kapal ferry Langsa – Penang hanya untuk sementara karena sedang ada sedikit masalah, nanti akan beroperasi kembali. (b20)

Perwal Parkir Di RSUD Langsa Beratkan Warga LANGSA (Waspada) :Warga Kota Langsa dan keluarga pasien yang berobat di Rumah Sakit Umum Daerah (RSUD) merasa keberatan dengan keluarnya PeraturanWali Kota (Perwal) Langsa No. 55 tahun 2013 tentang perubahan tarif retribusi pelayaan parkir dalam wilayah Kota Langsa sebesar Rp2.000. Sementara dalam Qanun Kota Langsa No.7 Tahun 2008 masih Rp500. Pantauan wartawan di lokasi, kertas retribusi parkir yang diberikan kepada pengendara sepedamotor tertulis Rp500, sementara ketika dilakukan pembayaran ternyata Rp2.000. Ketika ditanyakan kepada penjaga parkir, itu sesuai dengan Peraturan Wali Kota Langsa No.55 tahun 2013 tentang perubahan tarif retribusi pelayaan parkir dalam wilayah Kota Langsa, khususnya di Rumah Sakit Umum Daerah sebesar Rp2.000. Seorang warga Kecamatan Langsa Kota, Raja, yang ditemui wartawan saat membawa anaknya berobat ke RSUD Langsa, mengatakan, kebijakan Wali Kota Langsa tentang retribusi parkir ini tidak pro rakyat. Bagaimana tidak, semua pasien yang datang berobat selalu hilir mudik untuk berobat ke RSUD ataupun membeli kebutuhan pasien. Jika dalam sehari terkadang bisa sampai 3-5 kali hilir mudik ke RSUD, jadi sudah bisa dipastikan berapa sehari mengeluarkan duit Rp6.000 hingga Rp10.000. Sementara, jika parkir hingga sore hari pihak pengelola parkir membebankan pembayaran retribusi Rp3.000.

Dalam peraturan wali kota itu tertera kalau retribusi parkir di RSUD sebagai tempat parkir khusus yang harganya khusus Rp2.000. “Apa RSUD ini mall atau plaza, sementara di tempat ini berkumpul semua elemen masyarakat lemah yang sedang berobat dan keluarga kurang mampu. Berobat pun harus menggunakan Jaminan Kesehatan Aceh (JKA). Masa orang sudah susah, semakin dibuat susah,” katanya. Hal yang sama juga terjadi di tempat parkiran umum. Pengendara juga dikenakan Rp1.000, sesuai Perwal. Tapi yang ironisnya lagi, sudah dibayar sekali baru pindah ke tempat lain sudah dikenakan retribusi parkir Rp1.000. Sementara masih di lokasi yang sama, bagaimana ini bisa terjadi. Padahal dalam peraturan itu, setiap karcis parkir berlaku untuk 12 jam. Sementara warga lainnya, Fahrid, warga Gp.Sungai Pauh menambahkan, pengelolaan parkir ini sangat tinggi sekali untuk kaum papa (miskin) yang ingin berobat di RSUD. Bahkan sudah seharusnya harus digratiskan sebagai bentuk pelayanan yang baik. “Kalau kita cermati, retribusi parkir di Kota Langsa tertinggi di Indonesia,” katanya. Koordinator Parkir Cut Ali yang ditemui wartawan mengaku hanya menjalankan tugas sesuai PeraturanWali Kota Langsa No. 55 tahun 2013 tentang perubahan tarif retribusi pelayaan parkir dalam wilayah Kota Langsa. Di mana struktur dan besaran iuran parkir khususnya di Rumah Sakit Umum Daerah

yakni untuk roda enam Rp10. 000 (untuk 12 jam), roda empat Rp3.000 (untuk 12 jam) dan sepeda motor Rp2.000 (untuk 12). Anggota DPRK Langsa Komisi A, Muhammad Nur, yang membidangi permasalahan Qanun mengatakan, sesuai Undang-Undang No.28 tahun 2009 tentang retribusi daerah dan pajak daerah bisa dilakukan perubahan qanun oleh kepala daerah berdasarkan evaluasi eksekutif dengan berbagai pertimbangan. Diakui Muhammad Nur, mengenai retribusi parkir Rp2. 000 di RSUD Langsa sesuai PeraturanWali Kota No.55 tahun 2013 tentang perubahan tarif retribusi pelayaan parkir Kota Langsa, dirinya tidak mengetahui ada keluarnya peraturan wali kota itu. “Sejauh ini dewan tidak ada dilibatkan dalam perubahan retribusi itu,” katanya. Kabid Perhubungan Darat Yanis Prianto mengakui Perwal tentang tarif retribusi baru tentang parkir. Sejauh ini memang belum disosialisasikan, begitu juga tentang karcis masih belum dibuat DPKA Langsa. Sementara terkait tarif retribusi khusus dan umum, itu memang ada dibuat perbedaan. “Kalau retribusi khusus Rp2.000, bagi pengendara yang mengalami kehilangan kendaraan di RSUD akan ditanggung pihak pengelola sekira 30 persen dari harga kendaraan saat itu. Sementara untuk umum Rp1.000 tidak ada pertanggungjawaban, tugas kita hanya mengatur kendaraan saja,” tegasnya. (m43)

SUNGAI RAYA (Waspada): Gampong Labuhan Keude, Kecamatan Sungai Raya, Kabupaten Aceh Timur kini menjadi salah satu gampong model kawasan rumah pangan lestari dari Kementerian Pertanian Badan Penelitian dan Pengembangan Pertanian Balai Pengkajian Teknologi Pertanian (BPTP) Aceh. Wakil Ketua I Tim Penggerak PKK Aceh Timur, Mariani Binti Sulaiman pada launching modelkawasanrumahpanganlestari (M_KRPL) dan workshop pengolahan serta diversitasi pangan gampong Labuhan Keude, Kecamatan Sungai Raya, Selasa (2/7) mengatakan, konsep rumah pangan lestari sejalan dengan program PKK, di mana beberapa konsepnya yaitu kemandirian pangan dalam rumah tangga. “Masih banyak kita lihat pekarangan di sekitar rumah yang cukup luas, tetapi tidak dimanfaatkan pemiliknya,” ujarnya seraya mengatakan, padahal lahan pekarangan dapat dijadikan sebagai lahan produktif serta mempunyai nilai ekonomis baik untuk memenuhi kebutuhan keluarga sehari-hari maupun dijual ke pasar. Mariani mengimbau tim penggerak PKK di setiap tingkatan baik di tingkat kecamatan dan gampong untuk mendukung dan berperan aktif dalam pelaksanaan program kawasan rumah pangan lestari ini. Hal itu penting agar program di-

maksud bisa berjalan dengan baik dan mampu memberikan progres nyata bagi peningkatan kualitas kesejahteraan keluarga serta masyarakat gampong ini sendiri terutama kaum perempuan di gampong harus bisa berperan aktif menjadi agen pembaharu. Wakil Ketua I Penggerak PKK Aceh Timur mengharapkan untuk ke depan dapat terbentuk model tersebut minimal satu gampong di setiap kecamatan dalam kabupaten ini. “Sehingga nantinya akan terdapat 24 model kawasan rumah pangan lestari di Aceh Timur dan untuk terwujudnya program dimaksud agar semua sektor terkait dapat mendukung kegiatan ini serta partisipasi aktif

dari masyarakat gampong,” papar Mariani. Ketua Kelompok Tani Nelayan Andalan (KTNA) Kecamatan Sungai Raya, Aceh Timur, Agus seusai acara tersebut mengatakan, untuk Aceh Timur hanya ada dua gampong yang menjadi model ini yakni gampong Labuhan Keude dan Gelanggang Merak di Kecamatan Paureulak Timur. “Kami berterimakasih juga kepada Balai Penyuluh Kecamatan Sungai Raya yang telah membina dan memotivasi warga dalam menjalankan program ini,” papar Agus sembari menambahkan, untuk berjalannya program tersebut warga mendapat bantuan bibit selama 5 kali panen dari BPTP Aceh. (cri)

Labuhan Keude Jadi Model Kawasan Rumah Pangan Lestari


WAKIL Ketua I Tim Penggerak PKK Aceh Timur, Mariani saat memanen perdana hasil pertanian rumah pangan lestari di gampong Labuhan Keude, Kec Sungai Raya, Selasa (2/7)

JAKARTA (Waspada): Tim Kesenian Muhibah Universitas Al Muslim Bireuen tampil menggetarkan penonton di Universitas Doshisha Kyoto pada Senin (1/7) sore. Penari dari Sanggar Merah Delima mengawali penampilan di hadapan puluhan penonton di Kambaikan Hall dengan Tari Pakarena (Sulawesi Selatan). Kolaborasi Seurune kalee dan rapai mengalirkan nuansa Aceh dengan lagu Bungong Jeumpa yang dilanjutkan dengan Tari Garapan Tsunami, Saman dan Rapai Geleng. “Penonton terkesan dengan penampilan dua tim kesenian tersebut. Bahkan ada yang berderai air mata ketika penari dari Bireuen mengingatkan tsunami Aceh tahun 2004 dan tsunami Jepang tahun 2011,” jelas dosen Fakultas Teknik Universitas Syiah Kuala Banda Aceh Wina Sanusi Wahab, Selasa (2/7) melalui surat elektronik. Wina menambahkan, penonton semakin terpukau ketika paduan tarian Meuseukat dan Likok Pulo yang mirip Saman disajikan. Penari

yang terdiri dari 7 penari perempuan dan 5 penari laki-laki dan pemusik, tampil kompak dan dinamis. Wina mengutip komentar penonton Nakamura Satoshi mahasiswi Universitas Doshisha yang menyatakan sungguh luar biasa penampilan tarian dari Aceh tersebut. “Kalau tari Bali, dia sudah beberapa kali menonton. Kalau Aceh baru sekarang dan sungguh beda nuansanya,” ungkap Wina yang juga seniman Aceh. Rektor Universitas Al Muslim Amiruddin Idris menjelaskan, sebelumnya tim ini sukses tampil di UniversitasWaseda, Tokyo. Tinggal satu penampilan lagi di Kyotamba, Propinsi Kyoto, pada 3 Juli. Tim muhibah ini terselenggara setelah Khairul Hasni, dosen Al Muslim dan lulusan Ritsumeikan University Kyoto menghubungi Natsuko sahabatnya itu untuk memperkenalkan misi ini. Berkat Natsuko, warga Jepang yang mahir bahasa Aceh ini, tim ini bisa tampil di Waseda dan Doshisha. (cmh)

3.000-an Warga Minta Ubah Status Dusun Glee Madat Jadi Gampong Defenitif DEWANTARA (Waspada): 3.000-an warga meminta Pemerintah Kabupaten Aceh Utara untuk segera mengubah status Dusun Glee Madat menjadi gampong defenitif. Selama ini warga dusun tunduk ke Gampong Paloh Lada, Kecamatan Dewantara, Aceh Utara. Hamidansyah, Tuha 4 Glee Madat, Senin (1/7) sore kepada Waspada mengatakan, para warga Glee Madat telah berjuang untuk memisahkan diri dari Gampong Paloh Lada sejak tahun 1993. Namun usaha itu tidak membuahkan hasil dan baru dilanjutkan kembali dengan melengkapi berkas usulan ke Pemkab Aceh Utara pada tahun 2002. Usaha juga tidak berhasil dan perjuangan kembali dilanjutkan pada tahun 2007, dengan data usulan pemekaran yang lebih lengkap, perjuangan pemekaran kembali digaungkan pada Juli 2013 dengan menggunakan pola baru. “Kita meminta dimekarkan karena yang pertama jumlah penduduk sudah melebihi dari 3.000-an jiwa dengan luas wilayah 95 km persegi dengan 5 lorong, disamping Glee Madat selama ini kurang mendapat perhatian dari gampong (desa) induk,” kata Hamidan. Selain itu, berbagai fasilitas yang dimiliki oleh Glee Madat lebih lengkap dibandingkan Paloh Lada, seperti adanya meunasah (surau), masjid, SD, TK, PAUD, dan balai pengajian untuk ibu-ibu, anak-anak, remaja, dan orang tua. Yang paling membanggakan, Dusun Glee Madat dapat dikatakan jauh lebih maju dari desa induk. Pembangunan yang dilaksanakan di Glee Madat semuanya dilakukan dengan cara bergotong royong tanpa menimbulkan anggaran APBK.

“Dusun Glee Madat juga memiliki aturan tambahan di gampong seperti kedisiplinan, keamanan dan lain sebagainya. Intinya, semua yang kita lakukan jauh lebih baik dari yang dilakukanm oleh desa induk. Permintaan pemekaran ini merupakan hajat hidup 3.000-an jiwa masyarakat Glee Madat. Untuk sementara waktu, jika memang belum dapat diberikan status gampong devinitif, disebut sebagai desa non statuspun tidak jadi masalah sambil menunggu desa defenitif,” kata Hamidansyah. Pada dasarnya, kata Hamidan, Glee Madat merupakan sebuah seuneubok yang tunduk langsung ke Kecamatan Dewantara, namun pada tahun 1986, Glee Madat dileburkan dalam Gampong Paloh Lada. Pada waktu itu, permintaan pemekaran ditidak dipenuhi Aceh Utara karena pada saat itu jumlah gampong telah melebihi dari 800 gampong. Sementara dalam aturan disebutkan, setiap kabupaten hanya diperbolehkan memiliki 440 gampong saja. “Karena itulah Pemkab Aceh Utara tidak dapat meluluskan keinginan masyarakat Glee Madat, namun begitu mari kita berjuang secara bersama-sama dengan terus menyuarakan tuntutan itu hingga ke Provinsi Aceh dengan meminta dukungan DPRK dan DPRA. Semoga saja dengan cara seperti ini keinginan rakyat Glee Madat terpenuhi,” kata Mustafa, Asisten I Pemkab Aceh Utara. Mendapat masukan itu, belasan tokoh Glee Madat kepada Waspada mengatakan dalam waktu dekat melasakan saran-saran itu, dengan berharap, cara seperti itu akan membuahkan hasil, karena perjuangan pemekaran telah dilakukan sejak tahun 1993. (b18)

DPRK Aceh Timur Sesalkan Lambannya Penanganan Gizi Buruk IDI(Waspada): Dewan Perwakilan Rakyat Kabupaten (DPRK) Aceh Timur menyesalkan lambannya penanganan oleh dinas terkait dilingkungan Pemerintahan Aceh Timur terhadap Muhammad Sambina bayi kurang gizi anak keempat dari pasangan Hasbi Shaleh,63, dan Nursiah,39, warga Desa Pante Rambong Dusun Alue Nek, Kecamatan Pantee Bidari, Kabupaten Aceh Timur yang kini masih dirawat di RSUD Idi. Pernyataan dilontarkan Ketua Komisi D DPRK Aceh Timur Abdul Hamid didampingi anggota dewan lainnya yaitu Tgk Kamaruddin, Cut Lismariati, Nazaruddin dan Tgk. Hamzah Sulaiman dalam pertemuan dengan unsur terkait yakni dari RSUD Idi diwakili dr Sondang, Kabid Pelayanan, Nasrullah SKM Kabid Pelayanan Dinas Kesehatan, Adnan Kabid Keluarga Berencana (KB) pada BPMPKS serta Sekretaris Dinas Sosial Leni Roziana bertempat di ruang kerja Komisi D, Senin (1/7). Abdul Hamid menegaskan, dalam hal ini Dinas Kesehatan tidak bergerak cepat untuk penanganan gizi buruk dan setelah dibawa ke rumah sakit baru melakukan penanganannya, namun, menjadi persoalan di desa tidak ada petugas kesehatan baik itu Bidan Desa (Bides) maupun tenaga medis lainnya. “ Saya menilai dalam hal ini kinerja sejumlah Kepala SKPK di Aceh Timur sangat bobrok dikarenakan tidak mengetahui tugas dan fungsinya khususnya dinas kesehatan, RSUD Idi serta rumah sakit rehap medik Peureulak,” ujarnya. Padahal, di sana terdapat bangunan Posyandu plus, akan tetapi tidak ada petugas kesehatan yang ditempatkan digedung itu. “ Semestinya ini tidak boleh terjadi dan bila ada petugas kesehatan di desa itu maka Dinas Kesehatan bisa memperoleh data awal dilapangan untuk penanganan kasus gizi buruk bukan seperti saat ini sudah di rumah sakit baru diketahui adanya kasus,” pungkas Abdul Hamid. Ironisnya lagi, dana untuk penanganan ka-

sus gizi buruk di Aceh Timur sudah tersedia yaitu sekitar Rp.60 juta untuk 10 orang anak. “ Jelas ini kesannya seperti kurang respon dari dinas terkait, termasuk juga Dinas Sosial dan BPMPKS,” ungkap Abdul Hamid sembari menegaskan yang sekaligus meminta kepada Dinkes Aceh Timur agar dapat melaporkan segera mungkin ke DPRK desa-desa mana saja yang saat ini tidak ada petugas kesehatan. Dirinya mengimbau kepada tenaga kesehatan yang ditempatkan di desa-desa agar dapat melaporkan instansi terkait bila ada keluhan yang diterimanya dari masyarakat setempat. “ Bila pelayanan tidak berjalan secara maksimal, maka kesejahteraan rakyat juga akan tercapai dan siasia saja dana yang telah dianggarkan,” pungkas Hamid lagi. Nasrullah Kabid Pelayanan Kesehatan pada Dinas Kesehatan Aceh Timur terkait kasus bayi kurang gizi tersebut menjelaskan, pada awalnya Muhammad Sambina lahir dengan normal, namun oleh orang tuanya langsung memberikan makanan yang seharusnya belum boleh diberikan. “ 21 hari kemudian bayi ini mengalami penurunan berat badan dan sempat berobat ke Puskesmas yang selanjutnya dirujuk ke RSUD Idi, tetapi satu hari orang tua bayi langsung minta pulang,” sebutnya. Menurutnya, bahkan ada petugas dari Puskesmas berkunjung ke rumah bayi itu, akan tetapi saat itu pasien dan orang tuanya tidak ada dirumah. Selang dua pekan kemudian petugas berkunjung lagi dan pasien sudah terkena diare yang selanjutnya dan akhirnya pasien dibawa ke RSUD Idi. Lanjutnya, menyangkut dengan bangunan Posyandu Plus yang dibangun tiga tahun lalu itu di Desa Pante Rambong tidak ditempatkan karena keterbatasan tenaga bidan desa. “ Sementara Bides untuk desa tersebut saat ini masih dirangkap Bides yang ada di Desa Buket Bata karena kedua desa itu berdekatan,” pungkas Nasrullah lagi. (cri)

Aceh Timur Gagal Rebut Juara Umum MTQ Aceh IDI (Waspada): Kafilah Kabupaten Aceh Timur akhirnya harus puas pada urutan keempat setelah panitia mengumumkan hasilnya pada Minggu (30/6) malam dan gagal meraih juara umum sebagaimana diharapkan pada MTQ Ke-31 Provinsi Aceh di Subussalam. Sekretaris kontingen kafilah Aceh Timur Tgk Amiruddin S.Ag.MAP kepada Waspada, Senin (1/7) mengatakan, juara umum MTQ Ke 31 Provinsi Aceh ini berhasil diraih oleh Aceh Besar, juara dua Aceh Utara, Subussalam sebagai tuan rumah, juara tiga dan juara empat Aceh Timur. Namun, dari 42 peserta yang ikut dalam ajang tersebut sebanyak 30 peserta mendapat juara yaitu mulai juara satu sampai harapan 3, sedangkan 12 orang peserta lainnya gagal raih hasil maksimal. Dijelaskan, 11 orang peserta dari Aceh Timur yang masuk final dan 1 didiskualifakasi atas nama Nurhayati dari cabang tilawah cacat putri dengan alasan sudah pernah meraih juara di tingkat nasional. Namun yang disayangkan

mengapa sudah masuk final baru didiskualifikasi panitia. Disebutkannya, dimana kafilah Aceh Timur ungguln dicabang Mufasir bahasa Inggris kategori putra dan putri berhasil menjadi juara I atas nama M Khaidir dan Nurul Husna, cabang Hifdil 5 jus putri Hikmatul Husna juga tampil sebagai juara I, serta cabang Tahtil Quran dekorasi putra Fakhrullah juga raih juara I, kemudian cabang Tahtil putra M.Rifki rebut juara II dan putri juara III yaitu Syaula Rusli. Untuk Qira’ah Sab’ah putri kafilah Aceh Timur meraih juara II atas nama Salmawati Hasyim, cabang Fahmil Quran putri Mutia Ramli peroleh juara II, Khartil Quran naskah putri juara III atas nama Mahyani serta cabang MK2IQ yakni Mawaddah Idris harus puas diuratan ke III. Amiruddin menambahkan, apapun hasil yang telah diperoleh oleh kafilah Aceh Timur tersebut adalah yang terbaik dan sudah berupaya semaksimal mungkin demi mengharumkan nama daerah. (cri)

Waspada, rabu 3 juli 2013  

Waspada Daily

Waspada, rabu 3 juli 2013  

Waspada Daily