Page 1

WASPADA Demi Kebenaran Dan Keadilan

Jamu MU Malam Ini

Partai Final Buat Arsenal DENGAN empat pertandingan tersisa, Arsenal saat ini tengah berjuang memperebutkan tempatnya di zona Liga Champions dengan menempati posisi empat besar. Untuk mewujudkannya, Arsenal harus bersaing dengan Tottenham Hotspur dan Chelsea. Arsenal saat ini di posisi ketiga dalam klasemen Liga Premier Inggris dengan torehan 63 poin. Sementara, Chelsea berada di urutan keempat dengan nilai 62 dan Tottenham di posisi kelima dengan selisih dua poin dari Arsenal. Kendati demikian, baik Chelsea maupun Tottenham memiliki satu pertandingan lebih sedikit dibanding The Gunners, julukan Arsenal. Sepantasnya laga melawan Manchester United (MU) di Emirates Stadium, Minggu (28/4) malam ini pukul 20:00 WIB Live MNCTV partai final buat Arsenal. Usai menghadapi MU, The Gunners menghadapi lawan-lawan dari papan bawah. Sabtu (4/5) bertandang ke Lanjut ke hal A2 kol 7

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) MINGGU, Pahing, 28 April 2013/17 Jumadil Akhir 1434 H l No: 24206

Tahuun Ke-67

Terbit 20 Halaman

Adiba Cerita Pengalaman Gaib Bersama Ayahnya JAKARTA (Waspada): Adiba Khanza Az-Zahra, anak sulung Almarhum Ustad Jefri Al Buchori, menceritakan pengalaman gaibnya ketika bersama sang ayah. Suatu waktu, dia pernah dikenalkan dengan pengawal ayahnya. Tanpa alasan yang jelas, kala itu Adiba diminta ayahnya untuk masuk ke kamar mandi. Karena tak menemukan apapun, dia akhirnya kembali dan menemui Uje lagi. “Pas aku keluar, aku bilang nggak ada apa-apa Abi,” ujar Adiba di kediamannya, Kawasan Rempoa, Tangerang Selatan, Banten, Sabtu (27/4). Lanjut ke hal A2 kol 1

Ibunda Merasa Didatangi Uje Saat Shalat Tahajud JAKARTA (Waspada): Lantunan doadoa masih terdengar di rumah duka Ustad Jeffry Al Buchori (Uje), di Jalan Narmada III Blok I Nomor 11, Rempoa, Jakarta Selatan. Begitu pula doa dari ibunda Uje, Tatu Mulyana. “Umi selalu berdoa, mudah-mudahan khusnul khotimah dan dalam kuburnya dijadikan taman surga. Amin,” kata Umi Tatu, Sabtu (27/4). Semalam pun, Umi Tatu mengaku tidak bisa tidur dan merasa didatangi Uje saat Shalat Tahajud. “Tadi malam Umi enggak bisa tidur, terus nonton tv, semua tayangkan Uje

semasa hidup dan saat meninggal. Umi shalat dan berdoa untuk Uje. Seketika tercium aroma minyak wangi yang biasa Uje pakai. Lama sekali tercium baunya, dan Umi selalu berdoa untuk beliau,” tuturnya dengan berlinang air mata. Umi Tatu pun bersyukur diberi waktu bersama suami Pipik Dian Irawati tersebut, sebelum kecelakaan di Pondok Indah merenggut nyawa sang ustad gaul itu.“Alhamdulillah, Allah kasih waktu dua malam ketemu beliau sebelum meninggal,” tandasnya.

Lanjut ke hal A2 kol 3


RATUSAN orang mengantar jenazah Ustad Jeffry Al Buchori saat tiba di Masjid Istiqlal untuk dishalatkan, Jumat (26/4).

Solar Masih Langka MEDAN (Waspada): Bahan bakar minyak (BBM) jenis solar masih langka di Kota Medan, Sabtu (27/4). Kelangkaan tersebut mengakibatkan antrean panjang kendaraan berbahan bakar solar di sejumlah Pengisisan Bahan Bakar Umum (SPBU).

Peringatan HPN Di Langkat Paling Semarak STABAT (Waspada): Peringatan Hari Pers Nasional (HPN) dan Hut ke 67 Persatuan Wartawan Indonesia (PWI) yang dipusatkan di Stabat, Kabupaten Langkat diwarnai dengan hadiah Jalan Sehat Bersama Haji Ngogesa berupa empat hadiah umroh dan dua unit sepedamotor serta ratusan hadiah-hadiah lainnya. Gubsu Gatot Pujo Nugroho diwakili Sekda Provsu H Nurdin Lubis SH MM memberikan hadiah umroh untuk Septianda Perdana anggota PWI Sumut dari LKBN Antara Biro Medan dan Ketua PWI Pusat memberikan hadiah umroh kepada Nurlaila Hafni seorang ibu rumah tangga warga Kelurahan Stabat Baru sementara Bupati Langkat H Ngogesa Sitepu SH memberian hadiah umroh ke tanah suci untuk Agil Tri Suwarno siswa SMA Negeri 1 Kecamatan Binjai Kabupaten Langkat, dan Adhetya Prabowo Putri siswi SMP Negeri 1 Stabat . Kedua remaja tersebut mengalihkan hadiah umroh kepada ibunya. Selain itu Bupati H Ngogesa juga memberikan sepedamotor yang diraih Laila Chintia siswa SMP Negeri 2 Stabat. Pencabutan nomor undian dilakukan oleh Ketua TP PKK

Lanjut ke hal A2 kol 6

Waspada/Arianda Tanjung

PLANG bertuliskan solar habis kerap terlihat di sejumlah SPBU di Kota Medan. Foto diambil Sabtu (27/4).

Pantauan Waspada di sejumlah SPBU di Medan, stok solar kosong. Pemasangan plang bertuliskan solar “habis” terpampang di pintu masuj sejumlah SPBU seperti di SPBU kawasan Ring Road, kawasan Jln. Sisingamangaraja, Jln. Krakatau, Jln. Setia Budi dan Jln. Brigjen Katamso. Seorang operator pengisian BBM di SPBU di Jln. Brigjen Katamso mengatakan, pasokan solar memang dikurangi, tetapi dia tidak tahu penyebabnya. “Biasanya dalam sehari pasokannya tiga tanki isi 18.000 kl, tetapi sekarang hanya 1 tanki saja,” katanya. Operator SPBU lainnya, M Jalaludin mengatakan, bebe-

rapa hari ini penjualan solar di SPBU tempatnya bekerja meningkat jika dibandingkan hari-hari sebelumnya. Akibatnya ketersedian solar menjadi kosong. “Sejak solar masuk ke SPBU kami, jumlah pembeli meningkat, sehingga BBM jenis solar tidak bertahan lama,” kata dia. Se o r a n g p e n g e n d a r a menggunakan solar, Budi A r i a n t o m e n g a k u re s a h dengan kelangkaan solar yang sudah terjadi beberapa pekan. Dia mengatakan, sering kehabisan solar, namun saat hendak mengisi ke SPBU, ternyata solar kosong.

Lanjut ke hal A2 kol 3

BBM Dinaikkan, Jatah Raskin Ditambah


BAKAL Calon Legislatif (Bacaleg) perempuan dari salah satu partai nasional mengikuti tes baca Alquran pada hari pertama di Asrama haji, Banda Aceh, Sabtu (27/4).

245 Bacaleg Dites Baca Alquran SABANG (Waspada): Sebanyak 245 bakal calon legislatif di dua daerah pemilihan di Kota Sabang mengikuti tes baca Alquran yang berlangsung di Masjid Babuttaqwa Ie Meulee Sabang, Sabtu (27/4). Sejak pagi pukul 09.00 peserta bacaleg dari Partai Nasional tuntas mengikuti tes baca Alquran hingga siang yang diuji oleh tim yang ditunjuk oleh Komisi Independen Pemilihan (KIP) Sabang. Nazamuddin, salah seorang anggota KIP Sabang, mengatakan kepada Waspada, Sabtu (27/4) siang, semua bacaleg dari Partai Nasional tuntas mengikuti tes baca Alquran, sedangkan dari Partai Lokal dilanjutkan siang hari dari pukul 14.00. Hasil tes baca Alquran akan diumumkan pada hari senin (29/4).

Lanjut ke hal A2 kol 1

Polisi Tembak Polisi Rampok Kantor BRI

MAKASSAR ( Waspada): Pemerintah menyiapkan program bagi rakyat miskin sebagai kompensasi dari rencana kenaikan harga bahan bakar minyak (BBM) bersubsidi. »Ada tiga kompensasi bagi rakyat miskin yang kami lakukan,” kata Menteri Koordinator bidang Kesejahteraan Rakyat Agung Laksono Agung Laksono saat mengunjungi Gudang Bulog Baru (GBB) Subdivre Makassar, Jalan Urip Sumuhardjo, Makassar, Sulawesi Selatan, Sabtu (27/4). Salah satunya adalah menambah jatah beras miskin (raskin) dari sebelumnya 12 bulan menjadi 16 bulan, bantuan siswa miskin (BSM), dan program keluarga harapan (PKH). Selain itu meningkatkan bantuan raskin kepada masyarakat dengan estimasi anggaran sebesar Rp16 triliun. “Untuk BSM kami akan bantu mulai dari sekolah dasar (SD) sampai ke tingkat perguruan tinggi, tapi tetap ada kriteria dan salah satunya dengan jalur beasiswa. Sementara untuk PKH, diperuntukkan bagi keluarga yang mempu-

nyai anak dan tingkat pendapatannya rendah. Inilah tugas dari BN3P dan BPS untuk melakukan pendataan,” katanya.

Agung menambahkan, tujuan pemerintah menyiapkan program tersebut, sebab dikhawatirkan ada dampak inflasi yang dapat berimbas


Zubeidat Tsarnaeva (kiri), ibu Tamerlan dan Dzhokhar.

Sang Ibu Terus Membela Anaknya Tak Bersalah ZUBEIDAT Tsarnaev punya alasan sendiri untuk terus membela anaknya dan menolak, jika anaknya disebut sebagai teroris. Pihak berwenang Amerika Serikat menuduh dua putranya, Tamerlan Tsarnaev dan Dzhokhar Tsarnaev, sebagai teroris karena telah meledakkan bom pada saat berlangsun Boston Marathon Rabu (17/4) lalu,

Lanjut ke hal A2 kol 6

pada rakyat kecil sebagai akibat dari kenaikan harga BBM bersubsidi. Selain itu, menghindari bertambahnya masyarakat miskin di Indonesia. Pemerintah, lanjut Agung, akan memberikan kompensasi bagi rakyat dalam bentuk bantuan langsung tunai bersyarat. “Jadi program ini tidak dalam Bantuan Langsung Tunai (BLT), seperti yang diperuntukkan pada tahun sebelumnya, melainkan BLT bersyarat sesuai dengan pembagian klaster di masyarakat nantinya,” katanya. Ia menyebut, implementasi BLT bersyarat tersebut antara lain program percepatan dan perluasan perlindungan sosial yang bertumpu pada program yang sudah ada selama ini, dan sejatinya menjadi tugas dan tanggung jawab pemerintah untuk menurunkan angka kemiskinan. “Kebijakan ini untuk rakyat sangat miskin, miskin maupun yang rentan miskin. Pemerintah fokus agar tidak terjadi yang rentan menjadi miskin dan yang miskin menjadi sangat miskin,” katanya. (

Unjuk Kebolehan Pada Ajang Perpisahan Siswa SMPN 1 Medan

PEKANBARU (Antara): Pelaku perampokan Bank Rakyat Indonesia (BRI) Pantai Cermin Kab. Kampar, Riau, adalah seorang anggota polisi berpangkat briptu. “Berdasarkan laporan yang saya terima, benar pelaku perampokan merupakan oknum anggota polisi yakni Briptu S yang bertugas di Satuan Polisi Perairan Polres Pelalawan. Pelakunya cuma satu ini, bukan tiga seperti yang diinformasikan sebelumnya,” kata Kepala Bidang Humas Polda Riau AKBP Hermansyah di Pekanbaru, Sabtu (27/4). Menurut Hermansyah, pelaku mengaku perbuatannya itu dilakukan seorang diri dengan menggunakan senjata organik laras panjang jenis V2. Perampokan terjadi pada Jumat (26/4) sekitar pukul 11.45 WIB, di Kantor BRI Cabang Pantai Cermin. Sejumlah karyawannya saat itu tengah bersiap untuk menjalankan shalat Jumat dan seroang anggota polisi tengah melakukan pengamanan yaitu Briptu Dedi. Hermansyah menjelaskan, pelaku masuk ke dalam kantor BRI dan menodongkan senjata api ke kepala belakang Briptu Dedi. Sejumlah warga nasabah BRI menyaksikan kejadian tersebut dan seorang di antaranya

USAI berjuang pada Ujian Nasional (UN) yang telah menyita waktu, tenaga dan pikiran selama empat hari, siswa-siswi SMPN 1 Medan di Jalan Bunga Asoka menggelar acara perpisahan di aula sekolah itu, Sabtu (27/4). Kegiatan bertajuk “Seize Your Britghter Future White Knowledge” atau merebut masa depanmu dengan ilmu pengetahuan ini terlihat begitu meriah diwarnai pertunjukkan pentas seni yang menampilkan kreativitas siswa-siswi kelas IX maupun kelas VII dan VIII, seperti tari dan nyanyi, pidato bahasa Inggris, puisi

Lanjut ke hal A2 kol 3

Lanjut ke hal A2 kol 3


DALAM suasana haru siswa-siswi SMPN 1 Medan saling berpelukkan dan bermaaf-maafan usai kegiatan perpisahan yang dilaksanakan di aula sekolah itu, Sabtu (27/4).

SALAH satu masjid di Swedia.


Pertama Kali Azan Berpengeras Suara Berkumandang Di Stockholm ISTANBUL (Antara): Akhirnya Dewan Kotapraja Botkyrka di Stockholm, Swedia, menyetujui permohonan pusat budaya Islam mengumandangkan azan melalui pengeras suara di Masjid Fittja, demikian kantor berita Turki Cihan, Sabtu (27/4). Untuk pertama kalinya, azan disiarkan melalui pengeras suara di menara masjid itu Jumat kemarin. Pusat Kebudayaan Islam Botkyrka telah menerima persetujuan dewan kotapara itu akhir Februari lalu. Botkyrka adalah kotapraja di Stockholm yang sebagian besar penduduknya imigran. Setelah persiapan teknis dirampungkan, azan pertama disiarkan Jumat. Sejumlah besar warga Muslim berduyun-duyun ke masjid itu untuk menyaksikan peristiwa yang belum pernah terjadi sebelumnya. Lanjut ke hal A2 kol 1

Enam Orangutan Dipelihara Masyarakat Di Aceh BANDA ACEH (Waspada): Fo r u m O ra n g u t a n Ac e h (FORA) dan Forum Konservasi Orangutan Sumatera (FOKUS) menuntut Balai Konservasi Sumber Daya Alam (BKSDA) Aceh bertanggungjawab untuk menyita orangutan yang dimiliki dan dipelihara secara ilegal oleh masyarakat di Aceh. Menurut Badrul Irfan dari FORA, Sabtu (27/4), pihaknya sudah beberapa kali mengirimkan surat kepada BKSDA Aceh terkait temuan orangutan yang dipelihara secara ilegal maupun mengenai penyitaan orangutan dari tangan masyarakat “Dalam tahun ini saja, kita sudah mengirimkan empat surat ke BKSDA Aceh,

Lanjut ke hal A2 kol 1

Souvenir Unik Jadi Incaran

Ayam Bebek Ganja Khas Aceh

Siswa YSPA Juara Kompetisi ICT

Mengais Dolar Di Objek Wisata Sabang






SALAH satu orangutan yang sampai saat ini masih dipelihara secara ilegal di salah satu obyek wisata di kawasan Mata Ie, Kab. Aceh Besar.

Berita Utama


WASPADA Minggu 28 April 2013

Pembobol ATM Bank Sumut Gol MEDAN (Waspada): Sepandai-pandai Tupai melompat, sesekali jatuh juga. Ungkapan ini mengena pada pelaku pembobolan mesin anjungan tunai mandiri (ATM). Dia akhirnya tertangkap petugas Polsek Medan Barat. Pria berinisial Tu, 48, asal Langsa, Kab Aceh Timur, Sabtu (27/4) dijebloskan ke dalam sel setelah tertangkap kamera CCTV ATM Bank Sumut di depan satu swalayan di Jalan Yos Sudarso, Kec Medan Barat, saat sedang memasukkan potongan lidi kecil ke dalam mesin ATM dan memasang sticker call center palsu di mesin ATM tersebut. Dalam aksinya, pelaku Tu

tidak sendirian. Pelaku dibantu oleh seorang lagi temannya yang seolah-olah sebagai operator bank setelah menerima nomor dari call center tersebut. Informasi yang diperoleh di kepolisian, tersangka Tu mendatangi ATM Bank Sumut di swalayan Maju Bersama Jalan Yos Sudarso. Begitu masuk ke dalam ruangan ATM, tersangka Tu langsung memasukkan potongan lidi kecil ke dalam ATM, selanjutnya dengan menggunakan kartu ATM, tersangka Tu mendorongkan lidi tersebut hingga masuk ke bagian tertentu. Setelah itu, tersangkaTu menempelkan kertas sticker call center palsu yang seolah-olah sebagai nomor pelayanan pengaduan milik bank pengelola kartu

Adiba Cerita ... Tapi kemudian Adiba tambah bingung. Kata dia, ayahnya mengatakan kalau di kamar mandi ada beberapa orang. “Katanya ada omom yang ngejagain Abi. Tapi kok nggak ada siapa-siapa ya,” ujarnya. Tak mau ambil pusing, dia punhanyamenurutiapayangdikatakan ayahnya. “Ya udah aku bilang saja makasih sudah ngejagain,” katanya dengan polos. Pastinya, saat itu Adiba merasa takut dan sempat punya firasat ayahnya akan meninggal. “ Abi kok ngomong begitu kayak mau meninggal, nggak enak obrolannya. Ya sudah, aku nggak berani nanya-nanya lagi,” tandasnya. Istri belum tahu Sementara itu, Istri mendiang Uje, Pipik Dian Irawati mengaku tidak tahu menahu soal sosok yang disebut sebagai penjaga Uje, sapaan gaul mendiang Jeffry. Bahkan dia baru tahu bahwa almarhum suami punya penjaga setelah dikasih tahu anak sulungnya, Adiba Khanza Az Zahra. “Saya juga enggak tahu, saya juga baru tahu kemarin, kaka (Adiba) mau menyampaikan kalau melihat ada yang jagain abi di kanan kiri,” kata Pipik Dian Irawati saat ditemui di rumahnya, Jalan Namada III blok I nomor 11, Perumahan Bukit Mas, Rempoa,Tangerang Selatan, kemarin. Pipik menambahkan, Adiba mengatakan kalau dia melihat penjaga Uje pada saat pemakaman. “Kaka bilang, dia melihat di makam dan di kamar baru-baru ini,” ujarnya dengan nada lirih. Sementara Pipik sendiri belum pernah diberitahu Uje soal penjaga-penjaganya tersebut. “Saya enggak pernah tahu. Uje enggak pernah kasih tahu,” katanya. Diberitakan sebelumnya, Uje memperkenalkan sesosok gaib kepada putri sulungnya, Adiba Khanza Az Zahra. Adiba mengaku diminta ayahanda tercinta untuk menemui ‘seseorang’ yang selama ini selalu menjaga ustaz yang akrab disapa Uje itu. “Ketemu Abi Minggu (21/4). Minggu kayak Abi mau pamit, kan Abi lagi sakit. Tiba-tiba disuruh ke toilet, katanya ada temennya. Aku ke dalam (toilet) gak ada apa-apa, tapi Abi maksa,” ujar Adiba di kediamannya, Rempoa, Bintaro, Tangerang, Jumat (26/4). (lip.6 sctv)

Pertama Kali Azan ... Ketua Masjid Fittja Ismail Okur mengatakan kepada wartawan bahwa mereka berterimakasih kepada kotapraja atas dikabulkannya permohonan mereka itu. Menurut dia, banyak jamaah sudah lama tak mendengar suara azan melalui pengeras suara seperti di negara-negara asal mereka. “Penyiaran azan pertama dimaksudkan untuk percobaan. Kepala Direktorat Urusan Agama, Meehmet Gormez, akan datang ke masjid kami pekan depan untuk merayakan pekan kelahiran suci,” kata Okur. Warga keturunan Turki menyelenggarakan Kutlu Do‘um Haftas (pekan kelahiran suci) untuk merayakan maulid Nabi Muhammad dalam satu pekan di bulan April. (bbc/vn/r-m10)

245 Bacaleg Dites Baca ... Dikatakannya, jumlah bakal calon legislatif untuk Daerah Pemilihan (Dapil) I Kecamatan Sukakarya Sabang sebanyak 123 orang terdiri dari 78 orang laki-laki dan 45 orang perempuan. Sedangkan Daerah Pemilihan (Dapil) II di Kecamatan Sukajaya Sabang terdiri dari 122 laki-laki dan 44 orang perempuan. Suasana sebelum mengikuti acara tes baca Alquran, semua bacaleg khususnya dari Partai Nasional sibuk belajar mengaji di sekretariat partainya masing-masing. Ada juga yang memanfaatkan rumah pengurus dijadikan sebagai markas untuk belajar mengaji. Salah seorang caleg dari PDI-P yang tidak mau disebutkan namanya mengatakan pihaknya sengaja mendatangkan guru mengaji ke markas PDI-P untuk menguji bacalegnya sebelum diuji oleh Tim penguji KIP. Komentar yang sama juga disampaikan salah seorang bacaleg PBB dan PAN. Dua Tak Hadir Di Langsa Bacaleg Dewan Perwakilan Rakyat Kota (DPRK) Langsa dari Partai PPP dan Partai Demokrat yang mendaftar di Komisi Independen Pemilihan (KIP) untuk Pemilu 2014 tidak hadir mengikuti tes uji mampu baca Alquran pada hari ketiga di sekretariat KIP, sedangkan 1 bacaleg lagi tidak hadir karena beragama Kristen. Demikian dikatakan Ketua KPU Kota Langsa Agusni AH, SE kepada wartawan, Sabtu (27/4). Menurutnya,padahariketigatesmampubacaAlquraninimeliputi Partai Amanat Nasional (PAN) sebanyak 25 bacaleg hadir, PPP satu orang tidak hadir dari 25 orang atas nama Zulkifli, kemudian dari Partai Demokrat sebanyak 24 orang, satu berhalangan hadir yakni Misdar dan Hardi Hutagalung beragama non muslim.(b31/m43)

Enam Orangutan Dipelihara ... namun masih saja belum ada tanggapan apa pun,” ujar Badrul yang didampingi Ketua FOKUS Panut Hadisiwoyo. Sebelumnya, FORA dan FOKUS telah menyurati BKSDA Aceh perihal temuan enam ekor orangutan yang diduga dipelihara secara ilegal oleh masyarakat, dengan rincian 2 ekor di Aceh Besar dan salah satunya telah disita tanpa ada tindakan hukum, 2 ekor di Aceh Selatan, 1 ekor di Aceh Tenggara, dan 1 ekor lainnya di Aceh Tamiang. Untuk itu, sebut Badrul, pihaknya mengharapkan bantuan dari berbagai pihak dalam upaya pelestarian orangutan di Aceh, serta menyayangkan praktik pembiaran oleh BKSDA Aceh yang terkesan tebang pilih dalam penyitaan orangutan ilegal. “Terbukti, hingga kini belum ada satu kasus pun yang masuk ke ranah hukum,” imbuhnya. Secara pribadi, dia mengapresiasi tindakan BKSDA Aceh yang baru-baru ini menyita orangutan yang dipelihara ilegal di Taman Wisata Sibreh. Namun langkah ini belum cukup, karena masih banyak orangutan lain yang dipelihara secara ilegal yang perlu disita dan proses hukum tanpa tebang pilih. Baik Badrul maupun Panut meminta agar orangutan-orangutan yang diJawaban Problem Catur, pelihara ilegal lainnya dan telah dilaporkan keberada-anya di Dari Halaman Sport. wilayahhukumBKSDAAcehagar segera disita dan bila perlu me1. Kf6xh5+, Rh8. lakukan tindakan hukum bagi pemilik orangutan atau peminat 2. Mf6+, Rg8. lain untuk memberi efek jera. “Apabila BKSDA tidak dapat 3. Mxg6+, Rh8. melakukan penyitaan secepat4. Kfg5, Mc7. nya, maka kami akan menyampaikan mosi tidak percaya atas 5. Be8+, BxB. kinerja BKSDA Aceh dan me6. MxB+mat. (Jika nuntut pihak Kementerian Kehutanan untuk mengevaluasi 3. ....., Rf8. kinerja BKSDA Aceh,” tegas Pa4. MxK+, Rg8. nut, sambil menyarankan kepada BKSDA Aceh untuk membu5. Mg6+, Rf8 atau Rh8. at koordinasi lintas lembaga agar kinerjanya dapat lebih kuat. 6. Mg7+mat. Jika Kedua aktivis perlindungan 1. ......, Rg8. orangutan ini menilai upaya penyelamatan orangutan mem2. Mxg6+, Rf8. butuhkan dukungan yang lebih. 3. MxK+, Rg8. Selain dari kepolisian dan militer, juga dibutuhkan keseriusan 4. Mg5+ atau Mg6+, dari seluruh SKPA terkait, juga dari unsur Komisi Peralihan Rf8 atau Rh8. Aceh (KPA) atau mantan kom5. Mg7+mat). batan GAM.(b04)

ATM tersebut. Namun, aksi jahat tersangka Tu ternyata terekam di layar kamera CCTV sehingga petugas security yang mengetahuinya langsung meringkus tersangka Tu. Petugas Polsek Medan Barat yang mengetahui aksi pembobol mesin ATM tersebut segera meluncur ke lokasi kejadian sekaligus memboyong tersangka Tu ke komando. Kepada petugas, tersangka Tubekerjatidaksendirian.Dirinya hanya bertugas memasukkan lidi ke mesin ATM. Setelah lidi masuk, maka pemilik kartu ATM yang akan mengambil uang di mesin ATM tersebut hanya bias gigit jari, karena setelah bertransaksi maka kartu ATM nya tidak bias keluar alias ‘nyangkut’ di dalam mesin ATM tersbeut. “Kalau mesin ATM sudah dimasukkanlidi,makakartuATM yang masuk tak bias keluar lagi usai mengambil uang,” sebut tersangka Tu.

Menurut tersangka Tu, biasanya setelah pemilik kartu ATM tidak bias mengeluarkan kartu ATM-nya,makaakanmenghubungi nomor call center palsu tersebut untuk mencari solusi kartu ATM yang ‘nyangkut’ tersebut. Setelah sambungan ke call center diterima, maka operator gadungan tersebut akan meminta nomor PIN pemilik ATM. Karena merasayakindanpercayadengan omonganoperatorgadungantersebut, pemilik kartu ATM langsung menyebutkan nomor PIN. Selanjutnya, operator gadungan akan menghubungi tersangkaTu agar mengambil kartu ATMyang‘nyangkut‘tersebut.Setelahmelihatkorbannyameninggalkan ruang ATM tersebut, tersangka Tu langsung mengambil kartu ATM milik korban dan selanjutnya pergi ke mesin ATM Bank Sumut lainnya untuk menarik uang dari ATM korban. Saat ditanya sudah berapa

kalimelakukanaksinya,tersangka Tu mengaku sudah sembilan kali melakukan aksinya namun baru kali ini ditangkap polisi. “Selama 2013 ini, aku sudah sembilan kali berhasil,” tutur tersangka Tu seraya menambahkan hasil yang baru diperolehnya paling banyak Rp. 1.700.000. Menurut pengakuan tersangka, dari setiap kali melakukan aksinya, dia mendapat 20 persen dari uang yang ada di dalam kartu ATM korbannya sedangkan mesin ATM yang paling mudah dibobol oleh sindikat ini adalah mesin ATM Bank Sumut.. Kanit Reskrim Polsek Medan Barat,IptuSyarifurRahmanmenjelaskan,tersangkaTumerupa-kan sindikatpembobolmesinATMyang sudah beraksi di sejumlah mesin ATM.“TersangkaTumasihmenjalani pemeriksaan sedangkan pihak pengelola ATM Bank Sumut sudah membuat laporan pengaduan,” sebut Syarifur. (h04)

Polisi Tembak Polisi ...

akibat hantaman senjata api milik pelaku,” katanya. Gagal Merasa rencana perampokannya telah gagal, pelaku Briptu S, melarikan diri dengan menggunakan mobil Toyota Avanza bernomor polisi BM 38 T warna silver. Aiptu Maryono yang tengah mengalami luka cukup parah di bagian kepala, nekat mengejar pelaku bersama-sama dengan Briptu Dedi dan masyarakat sekitar. “Tanpa harus menunggu bantuan dari petugas lainnya, Maryono dan Briptu Dedi serta sejumlah warga tetap saja mengejar pelaku,” kata Hermansyah menjelaskan. Tepat di jalur Kec. Tapung, di sekitar Desa Sungai Tibam,

mobil yang dikendarai pelaku terperosok ke parit dan pelaku keluar melarikan diri. Baku tembak pun terjadi antara pelaku dengan Briptu Dedi serta Aiptu Maryono. “Hingga pada akhirnya, sekitar beberapa menit kemudian, bantuan personel kepolisian terdekat datang membantu mengejar pelaku,” katanya. Pelaku yang terus melawan akhirnya dapat dilumpuhkan dengan timah panas yang menembus kedua kakinya. Pelaku kemudian dilarikan ke Rumah Sakit Bhayangkara untuk mendapatkan perawatan. Sementara korban, Aiptu Maryono, dilarikan ke RS Eka Hospital dan kemudian dirujuk ke RS Bhayangkara Polda Riau di Pekanbaru.

kannya sudah lancar meski masih satu truk tanki kapasitas 18.000 liter masuk setiap hari,” kata seorang petugas SPBU 142081160 Jalan Medan - Tanjungpura Kec. Wampu. Ditambahkannya, saat pasokan solar lancar sebelumnya dapat dua kali distribusi ke SPBU dalam sehari. Meski pasokan solar di SPBU mulai lancar, petugas belum mengizinkan warga membeli menggunakan jerigen, melainkan mengutamakan mobil pengguna bahan bakar tersebut. Namun yang terjadi di SPBU Jalan Thamrin Babalan Kab. Langkat, sepinya kendaraan membelisolardimanfaatkanpedagang eceran untuk membeli berulangulang menggunakan jerigen. Warning Pertamina Terkait itu, Gubsu Gatot Pujo Nugroho telah meminta Pertamina melakukan fungsi koordinasi kepada pemerintah pro-

PASOKAN solar di sejumlah SPBU di Langkat mulai lancar. Truk sedang mengisi bahan bakar tersebut di SPBU 142081160 Jalinsum Wampu, Sabtu (27/4) sore.

vinsi maupun kabupaten, kota untuk melakukan sosialisasi terkait kelangkaan solar dan rencana kenaikan harga BBM. Hal ini dijawab oleh GM Pertamina Region I, Gandhi Sri Widodo dengan mengatakan sudah mempersiapkan sosialisasi kenaikan harga BBM, termasuk SPBU yang ditunjuk melayani plat kuning dan plat hitam. Permasalahan antrian di SPBU, kata dia, hanya terbatas pada solar subsidi, sedangkan solar non subsidi ada di SPBU. “Persoalannya pembeli solar subsidi tidak hanya kendaraan angkutan penumpang atau sembako, tetapi truk-truk CPO, pertambangan dan angkutan kehutanan yang dalam Permen nomor 1 tahun 2013 dilarang mengisi solar subsidi,” kata dia menyebutkan, BPH Migas akan memasang truk-truk itu dengan stiker sebagai tanda tidak boleh menggunakan solar subsidi. Sementara Poldasu telah memerintahkan seluruh jajarannya mengantisipasi dampak kenaikan harga BBM dengan melakukan pengamanan di SPBU dan pendistribusiannya. “Rencana kenaikan harga BBM diperkirakan menimbulkan kerawanan, seperti aksi unjukrasa, pengrusakan dan penghentian paksa penangkut BBM,” kata Kabid Humas Poldasu Kombes Pol. Heru Prakoso. Sebab itu, seluruh jajaran diperintahkan melakukan antisipasi dampak yang timbul dengan melakukan pengawasan dan pengamanan di depo-depo SPBU, termasuk seluruh objek vital yang ada.(m27/m28/cat/a03/a02)

ngabisin bunga 50 kantong dan puluhan air melati,” ujarnya. Penziarah masih ramai Sampai saat ini, para peziarah silih berganti mendatangi makam dai kondang yang fenomenal itu, dengan berbondongbondong membawa bunga dan air melati. Tak hanya di Tempat Pemakaman Umum (TPU) Karet Bivak yang diziarahi warga dan jemaahnya. Lokasi kecelakaan Uje di JalanGedungHijauRaya,Pondok Indah, Jakarta Selatan, Kompleks AlamAsri,BlokPB38,didepanrumahNomor17,punramaidikunjungi warga. Banyak orang yang menabur bunga di pohon palem, dimanaUjemengalamikecelakaan. Mereka pun, memanjatkan doa untuk sang dai gaul tersebut. Di pohon palem tersebut tertera tulisan “Mohon doanya untuk Ustadz Jeffry Al Buchori. Mari

kita membaca surat Al Fatihah,” isi tulisan di sebuah bekas kardus. “Iya, saya ingin mendoakan beliau dan semoga dia mendapatkan tempat yang terbaik di alam sana. Jujur saya enggak nyangkadiapergisecepatitu,”ungkap salah seorang peziarah, Tuti. Tuti juga mengaku, merasa kehilangan sosok ustadz yang sangat peduli dengan anak-anak mudatersebut.Diasengajamampir untuk mendoakan almarhum Uje. “Ini kebetulan lewat. Mau pulang ke arah Bintaro. Saya tahu kabar Uje meninggal dari berita di TV,” tandasnya. Akibat banyaknya warga yang mengerumuni lokasi kecelakaan Uje, lalu lintas dari arah Pondok Indah menuju ke PondokPinangmenjadimacet.Pasalnya, banyak sepeda motor yang terparkir di bahu jalan dekat lokasi kejadian. (okz/m13)

yang menewaskan tiga orang dan mencederailebihdari170lainnya. Zubeidat beralasan pihak berwenang AS telah menjebak kedua putranya dan menurut dia amat sulit membuktikan keduanya benar-benar terlibat dalam aksi kejahatan tersebut. Apalagi, satu-satunyaorangyangakan‘dapat dipaksa’ mengaku saat ini adalah Dzhokhar, yang kondisinya saat inimasihdalamkeadaanlukaparah danbelumdapatmemberikanketerangan yang sebenarnya. Sementara itu, Dzhokhar yang menyadari akan haknya untukdiam,tidakmemberikanketerangan sehingga telah mempersulit pihak berwenang AS untuk mengetahui lebih jauh tentang posisianakChechenitu.Tindakan itu dilakukan Dzhokhar setelah mengetahuibahwadiapunyahak untuk tetap diam. Sebenarnya,setiappelakukejahatan yang ditahan oleh petugasdiASmemilikihakuntukdiam dan didampingi oleh pengacara. Hak-hak itu harus diberitahukan kepada tersangka pada saat penangkapannya. SaatpenangkapanDzhokhar, petugas mengaku tidak membacakan hak yang dikenal juga dengan nama Miranda Rights. Hal itu membuat kesaksian yang dibuat Dzhokhar sebelumnya dapat dianggap tidak sah dalam pengadilan, demikian The Associated Press, Jumat pekan lalu. Padahaldalamkesaksiannya, Dzhokar telah mengaku sebagai pelaku bom Boston. Pemuda itu mengatakan dia dan kakaknya, Tamerlan, melakukan aksi teror untuk membalas invasi AS di Irak dan Afghanistan. Saat ini proses pengadilan Dzhokhar sudah mulai berjalan. Jaksa penuntut umum menyatakan Dzhokhar kemungkinan besar akan diganjar dengan hukuman mati. Dzhokhar sendiri disebut bersikap tidak peduli ketika tahu dia terancam hukuman mati. Dia sama sekali tidak menunjukkan penyesalan selama proses pemeriksaan berlangsung. Pelaku bom Boston Dzhokhar Tsarnaev berhenti memberikan kesaksian kepada petu-

H Ahmad Siregar mengaku bangga dengan penampilan siswasiswinya, namun yang lebih membuat dia bangga adalah kedisipilinan dari pada siswa yang mau menerima dengan senang hati untuk menyelenggarakan kegiatan perpisahan di lingkungan sekolah ini. “Banyak di antara siswa dari sekolah lain yang protes menanggapi surat edaran dari Diknas untuk tidak melaksanakan kegiatan perpisahan di luar lingkungan sekolah, namun siswa SMPN 1 Medan dengan senang hati menerima dan mau untuk melaksanakan kegiatan di lingkungan sekolah, ini menandakan tingkat kedisiplinan siswa SMPN 1 Medan sudah semakin tinggi,” ucapnya. Ahmad Siregar berharap semoga kebahagiaan pada hari ini berlanjut hingga saat penerimaan hasil pengumuman UN nantinya, kita bertekad untuk tetap mempertahankan predikat lulus seratus persen dengan

nilai tertinggi dan bukan hanya itu, namun dia juga berharap agar siswa-siswi dapat diterima di sekolah-sekolah favorit di kota Medan ini. “Lulus seratus persen tapi tidak masuk sekolah favorit itu sama artinya dengan kegagalan, karena jika kamu lulus UN dan diterima di sekolah favorit, kamu pasti puas kami pun sebagai guru akan merasa bangga,” ucapnya. Pada kesempatan itu Ahmad Siregar meminta minta kepada seluruh siswa khususnya Kelas IX untuk saling bermaafmaafan antara sesama teman dan guru. Beliau berharap semoga tali silaturrahmi yang telah terjalin tidak terputus sampai disini, “Atas nama guru kami minta maaf jika selama ini dalam mendidik kalian ada tindakan kami yang kurang berkenan, dan semua kesalahan-kesalahan siswa juga sudah kami maafkan,” ungkapnya mengakhiri. Setelah itu para siswa dan guru beserta undangan yang

hadir meminta kepala sekolah untuk menyanyikan sebuah lagu yang disambut dengan senang hati. Beliau membawakan sebuah lagu yang yang dipopulerkan oleh Obbie Messakh berjudul “Kisah-Kasih di Sekolah” yang pernah populer di tahun 80 an dan diikuti oleh seluruh peserta yang hadir. Sementara itu koordinator pelaksana Malahayati, SPd didampingi panitia pelaksana kegiatan perpisahan SMPN 1 Medan Agus Salim mengatakan ini adalah agenda tahunan yang telah dirancang pihak sekolah, di mana dalam mengisi kegiatan ini melibatkan siswa-siswi kelas VII dan kelas VIII. Dalam pelaksanaanya kegiatan perpisahan diisi dengan penampilankreativitassiswayang selama ini dibina melalui kegiatan ekstrakurikuler, sehingga kegiataninijugasebagaiajangunjuk kebolehan siswa menampilkan bakat dan kemampuan mereka. **Erzil Markos

sempat menelpon anggota polisi yang dikenalnya yakni Aiptu Maryono yang bertugas di Polsek Siak Hulu, Kab.Kampar. Mendapat informasi masyarakat itu, Maryono berinisiatif datang ke Kantor BRI dengan menyamar sebagai nasabah. ia berhasil masuk dan mendekati pelaku yang tengah menodongkan senjata api Briptu Dedi. Mengetahui hal ini, pelaku kemudian juga menodongkan senjata api ke arah Maryono. “Pada saat itu, Aiptu Maryono mencoba merebut senjata api dari tangan pelaku hingga akhirnya terjadi perkelahian. Pada saat itu, Aiptu Maryono mengalami luka dibagian kepala

Solar Masih Langka ... Di Langkat mulai lancar Namun pasokan solar di Langkat mulai lancar setelah lebih sepekan mengalami kekosongan. Pantauan Waspada, Sabtu (27/4) sore di beberapa SPBU di Jalinsum Langkat, seperti SPBU 14208152 Kel. Perdamaian Stabat, SPBU 142081160 Kec. Wampu, SPBU Kel. Dendang, SPBU Kec. Hinai, SPBU 14208106 Jalan Thamrin Kec. Babalan dan SPBU di Tanjungpura, bio solar masih tersedia. Hanya di SPBU Simpang P. Susu solar habis. Pemilik kendaraan didominasi truk yang menggunakan bahan bakar solar terlihat tidak mengantri seperti terjadi di Medan. “Sebelumnya pasokan solar masih sulit sehingga ada beberapa truk yang bertahan di SPBU, tetapi mulai kemarin paso-

Waspada/Abdul Hakim

Ibunda Merasa ... Sementaraitu,TempatPemakamanUmum(TPU)KaretBivak, Kelurahan Karet Tengsin, Jakarta Pusat,mendadakmenjaditempat wisata. Pasalnya, masyarakat dari dari berbagai daerah terus berziarah ke makam mubaligh muda Indonesia, Uje, disemayamkan. Mereka membawa sanak keluarganyauntukberdoadimakam ustadzgaultersebut.Belasanpedagang pun nampak menjajakan makanan kepada para peziarah. “Alhamdulillah, dari pagi memang sudah ramai apalagi kemarin, Alhamdulillah berkah,” ujar Suwito penjual toge goreng tepat di gang makam Uje di Blok A II. Halserupapundiucapkanoleh pedagang bunga dan air melati, Sukron, penghasilannya melebihihari-haribiasanya.“Alhamdulillah, kemarin dan sekarang bisa

Unjuk Kebolehan ... dan band siswa. Meski ada insiden mati lampu (PLN) dua kali, tak menyurutkan antusias siswa-siswi beraksi. Hal ini terlihat dari tak henti-hentinya teriakan dan yel-yel penyemangat para siswa setiap kali teman-teman mereka tampil ke atas panggung bersama masing-masing grup pengisi acara itu. Suasana semakin meriah ketika grup band siswa dari Kelas IX Archimedes tampil dengan membawakan lagu The Beatles yang berjudul “Twist and Shout” semakin menambah heboh suasana di aula yang dihadiri sekira 300 siswa, guru dan orangtua siswa.Grupitutampilpadaakhiracara sehingga membius penonton untuk menyaksikan penampilan grup band yang digawangi Hang Kesturi tersebut. Suasana perpisahan SMPN 1 Medan itu pun menjadi berkesan bagi mereka. Kepala SMPN 1 Medan Drs

Waspada/Surya Efendi

KETUA PWI Pusat Margiono (kiri) menyerahkan nasi tumpeng kepada Bupati Langkat Ngogesa Sitepu disaksikan Sekda Provsu Nurdin Lubis (tengah) pada peringatan HPN dan HUT PWI ke-67 di Alun-alun T Amir Hamzah di Stabat, Langkat, Sabtu (27/4).

Peringatan HPN ... Langkat Hj Nuraida Ngpgesa. Sedangkan satu hadiah sepedamotor lagi merupakan sumbangan dari Pemimpin Umum Harian Analisa Supandi Kusuma yang diraih Decky Zulfrianto SE anggota PWI Perwakilan Kabupaten Asahan. Sebelumnya Ketua Umum PWI Pusat H Margiono disambut secara adat Melayu dengan memasangkan busana Melayu berupa selempang, sarung dan tengkuluk oleh Kejuruan Stabat Tengku Syah Djohan. Mengawali sambutannya H Margiono mengemukakan, peringatan HPN dan HUT PWI di Langkat yang dihadiri hampir 10.00 massa ini merupakan termeriah sepanjang yang pernah dilaksanakan di daerah-daerah se Indonesia. Dengan kemeriahan yang terjalin diharapkan sinergi yang terbangun antara PWI, pemerintah dan masyarakat dapat terus dibina untuk menciptakan harmoni kehidupan di segala bidang. Margiono berharap, untuk mendorong lahirnya karya-karya jurnalistik yang berkualitas diperlukan pendidikan dan latihan (Diklat) bagi wartawan secara terus-menerus. Untuk itu, katanya, dukungan pemerintah Provinsi Sumut maupun Bupati dan Walikota sangat diharap-

Sang Ibu Terus ...

kan membantu kegiatan-kegiatan Diklat bagi wartawan untuk mendorong lahirnya karya-karya jurnalistik berkualitas dan bermanfaat bagi masyarakat. Harapan-harapan besar atas peran Pers yang strategis juga dikemukakan Gubsu dalam sambutan juga disampaikan Sekda Provsu Nurdin Lubis. Sedangkan Bupati Langkat H Ngogesa Sitepu SH menyampaikan harapannya agar Pers dapat terus berkarya untuk menciptakantatananmasyarakatyang maju dan sejahtera, serta menciptakan suasana kondusif melalui pemberitaan-pemberitaan yang jujur, adil dan berimbang. Bupati H Ngogesa dalam kesempatan itu juga menerima piagam penghargaan dari PWI Pusat atas kepedulian dan perhartianya terhadap dunia pers. SebelumnyaKetuaPWISumut DrsMuhammadSyahrirmenyampaikanterimakasihkepadasemua pihakyangtelahmendukungsuksesnya seluruh rangkaian peringatanHPNdanHUTke-67PWI tingkat Provinsi Sumut sejak bulan Februari hingga puncaknya di Stabat Langkat 27 April 2013. Bersamaan diumumkan juara lomba karya tulis (LKT) dan foto pers dalam rangka peringatanharijadike-65ProvinsiSumut. Untuk LKT juara I Iwan Guntara (Medan Bisnis), juara II Teja Pur-

nama (Realitas), juara III Jumian Situmorang (Perjuangan), harapan I James Pardede ( dan harapan II Irma Yuni dari (Berita Sore). Foto pers, juara I diraih Irsan Mulyadi (LKBN Antara), Junaidi Gandi (Analisa) danI Khairul Umri Batubara (Analisa) sebagai juara II dan III sedangkan T Agus Khaidir (Tribun Medan) dan Rahmad Suryadi (Sindo) meraih juara harapan I dan II. Dalam kesempatan tersebut Ketua Umum PWI Pusat H MarfionojugamenyerahkanPressCard Number One (Kartu Pers Nomor Satu) kepada DR (HC) Drs. H. Ibrahim Sinik, Pemimpin Umum Harian Medan Pos serta menyerahkan sertifikat dan kartu kompetensi wartawan dan medali kesetiaan PWI 15 tahun kepada sejumlah anggota PWI se-Sumut. PWI Cabang Sumut juga menerima bantuan ribuan pohon penghijauan dari Astra Internasional. Sementara untuk tuan rumah HPN dan HUT ke-68 PWI tingkatProvinsiSumuttahun2014 ditetapkan di Kota Tanjung Balai diitandai dengan penyerahan pataka dan surat keputusan PWI diserahkandariKetuaPWIcabang Sumut Drs M Syahrir kepadaWali KotaTanjungbalai Dr. H.Thamrin Munthe MHum disaksikan Ketua Umum PWI Pusat Margiono. (a01/a03/c01)

gas.TindakanitudilakukanDzhokhar setelah mengetahui bahwa dia punya hak untuk tetap diam. Dzhokhar mendengar tentang hukumannya itu ketika sedang menjalani sesi persidangan khusus di rumah sakit. Saat itu diadidatangiolehHakimMarianne Bowler dan beberapa petugas. Tetapi pihak berwenang AS kaget Dzhokhar tidak mengalami perasaan apa pun ketika dia disebut menghadapi hukuman mati. Dzhokhar hanya termangu ketika mendengar kabar itu. Mesin pemonitor jantung yang pemudaitupakaijugatidakmenunjukkan perubahan apa-apa. Pemuda tersebut yang menjalani perawatan di rumah sakit setelah

mendapatkan luka parah ketika mencobakaburdarikejaranpolisi. Dia memiliki luka tembak di tenggorokan yang membuatnya sulit berkomunikasi. Usaha lain Pihak berwenang AS dalam usahanya menggiring Dzhokhar agar ‘bekerjasama’ dengan mereka, kini mereka mengungkapkanbahwaibupemudaitupernah dimasukkan dalam database terorisme18bulanlalu.Zubeidatdan anaksulungnya,TamerlandicatatkansetelahCIAdihubungiolehRusia pada 2011. Menurut Metro, Sabtu (27/4), pasangan ibu dan anak itu disebutkan adalah militan agama dan pernah melakukan perjalanan ke AS. (ap/bbc/cnn/ok/mujo)

Partai Final Buat Arsenal ... ke Quens Park Rangers, sepekan kemudian, Minggu (12/5) menjamu Wigan Athletic. Dan pertandingan akhir musim ini bertandang ke Newcastle United, Minggu (19/5). Untuk meraih nilai sempurna tentunya tidak mudah membalikkan telapak tangan bagi anak asuh Arsene Wenger. Laga tandang ke markas Arsenal ini akan menjadi partai pertama bagi MU, setelah memastikan gelar juara Liga Premier ke-20. Gelar juara dipastikan The Red Devils, julukan United, dengan membungkam Aston Villa 3-0 di Old Trafford, Selasa (23/4) dinihari WIB lalu. “Kami tak punya ruang untuk kehilangan poin. Ini merupakan partai lainnya yang vital bagi kami untuk mendapat poin yang kami inginkan. Kami sedang berlari kuat. Kami perlu keinginan total, komitmen dan fokus untuk meraih apa yang kami inginkan,” kata pelatih Arsenal Arsene Wenger dalam situs klub itu, Sabtu (27/4). Pertandingan ini juga akan menjadi kembalinya eks striker Arsenal, Robin van Persie.Van Persie, yang dijual ke United awal musim lalu, tampil spektakuler dengan mencetak hattrick saat United mengalahkanVilla. “Van Persie adalah talenta yang besar, pemain kelas dunia yang memiliki teknik fantastis dan banyak pengalaman. Anda selalu merindukan seorang pemain besar. Kami mengalami beberapa saat karena pemain kami banyak yang pergi, namun jika Anda melihat jumlah gol yang kami buat, itu mirip musim lalu,” imbuh Wenger. Namun sejarah masih berpihak kepada MU. The Red Devils selalu mampu mengalahkan Arsenal pada tiga pertemuan terakhir kedua tim di Liga Premier. MU menang 2-1 atas Arsenal pada pertemuan pertama musim ini di Old Trafford, diwarnai gol Van Persie ke gawang mantan klubnya. Terakhir kali kedua tim bertanding di Emirates Stadium, MU juga menang 2-1 atas Arsenal dan gol Arsenal dicetak olehVan Persie. Arsenal hanya mampu sekali mengalahkan MU dan menelan tujuh kekalahan pada delapan pertemuan terakhir kedua tim di semua kompetisi. Performa Arsenal belakangan ini sangat impresif, mampu meraih lima kemenangan dan sekali imbang pada enam laga terakhirnya di Liga Premier. Arsenal juga tak terkalahkan pada tujuh laga kandang terakhirnya dengan lima kemenangan. Sebanyak 18 dari total 65 gol Arsenal di Liga Premier, tercipta di 15 menit terakhir pertandingan. Santi Cazorla adalah topskor klub dengan 12 gol. Namun sebanyak 16 dari total 35 kebobolan Arsenal di Liga Premier, tercipta di 30 menit terakhir babak pertama. Gelandang Arsenal, Santi Cazorla berharap tamunya, MU akan bermain lebih santai dari biasanya. Hal tersebut diungkapkan Cazorla karena The Red Devils telah mengklaim gelar juara Premier League musim ini. “Kami selalu bersiap untuk pertandingan besar. Mereka (United) datang ke sini dengan gelar juara dan kami harap mereka lebih santai daripada bila mereka harus juara di kandang kami, tetapi ini akan menjadi pertandingan yang sulit,” kata Cazorla, seperti dilansir Give Me Football, kemarin. “Setiap pertandingan menjadi partai final bagi kami. Karena kami tengah berjuang untuk posisi ketiga dan keempat. Tiga poin menjadi vital pada Minggu nanti. Setiap pertandingan memiliki makna yang lebih besar sekarang dan mengalahkan United di kandang akan memberikan keamanan lebih pada posisi kami,” pungkasnya. MU tak terkalahkan dari 10 laga tandang terakhirnya di Liga Premier, dengan tujuh kemenangan dan tiga imbang. Lima kemenangan diantaranya berakhir clean sheet. Sebanyak 13 dari total 35 kebobolan MU tercipta di 15 menit awal babak pertama. Van Persie saat ini memuncaki daftar topskor Liga Premier dengan 24 gol, atau menyumbang nyaris sepertiga total gol MU di Liga Premier. Arsenal (1-4-2-3-1): Szczesny; Sagna, Mertesacker, Koscielny, Monreal; Ramsey, Arteta; Cazorla, Wilshere, Podolski; Walcott. MU (1-4-2-3-1): De Gea; Rafael, Ferdinand, Evans, Evra; Carrick, Giggs; Valencia, Rooney, Nani, Van Persie. (m18/euro/ok)

Lima Pertandingan Terakhir Kedua Tim 03/11/2012: MU 2-1 Arsenal (EPL) 22/01/2012: Arsenal 1-2 MU (EPL) 28/08/2011: MU 8-2 Arsenal (EPL) 01/05/2011: Arsenal 1-0 MU (EPL) 13/03/2011: MU 2-0 Arsenal (Piala FA)

Sumut - Aceh

WASPADA Minggu 28 April 2013


Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir

Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu Lusia Damayanti (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: H. Halim Hasan. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Armin R. Nasution. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Promosi: Edward Thahir (Koordinator). Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Sinur Manik (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi). Wartawan Kota Medan: Umum: Zulkifli Harahap, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Hajrul Azhari Ritonga, Arianda Tanjung. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebingtinggi: Muhammad Idris, Abdul Khalik. Pematangsiantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanafiah, Hasanul Hidayat. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar, Dedek Juliadi. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Jasvira Sautisa. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan WASPADA dilengkapi dengan kartu pers. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada yang mengaku wartawan WASPADA tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

2 Bacaleg PD P.Siantar Terlibat Judi PEMATANGSIANTAR (Waspada): Dua bakal calon anggota legislatif (Bacaleg) Partai Demokrat Kota Pematangsiantar yang terlibat perjudian dan saat ini masih dalam tingkat kasasi, masih akan dikonsultasikan KPUD setempat ke KPUD Sumut. “Akan dibicarakan dulu di tingkat KPUD Pematangsiantar dan selanjutnya dikonsultasikan ke KPUD Sumut,” papar Ketua KPUD Pematangsiantar Mangasitua Purba didampingi anggota KPUD Divisi Hukum

Mananjak Simanjuntak di kantor KPUD setempat, Jalan Porsea, Sabtu (27/4). Seperti diketahui, dua Bacaleg PD terdiri ES yang saat ini sebagai staf khusus wali kota dan RDT yang duduk sebagai anggota DPRDasalPartaiPatriotdanmaju melalui PD, tertangkap bermain judimenggunakankartujokerbersama dua pelaku lain pada 2012 laludansudahdihukumdiPengadilan Negeri Pematangsiantar sesuai dengan masa penahanan mereka. Namun, putusan majelis hakim itu di bawah tuntutan Jaksa Penuntut Umum mengajukan banding. Namun, Pengadilan

Tinggi menguatkan putusan PN Pematangsiantar hingga JPU kasasi ke Mahkamah Agung. Menurut Purba, pihaknya saatinimasihmelakukantahapan verifikasi terhadap dokumen Bacaleg dan masih mencek kelengkapan berkasnya serta meneliti apakah ada bacaleg bermasalah dengan hukum atau tidak. Begitu pula dengan ES dan RDP, menurut Purba, pihaknya belum mengetahui ancaman hukuman mereka apakah dikenakan Pasal 303 KUH Pidana yang ancaman hukumannya 10 tahun penjara atau denda paling Rp25 juta atau Pasal 303 bis KUH Pida-

na yang ancaman hukumannya paling lama empat tahun penjara dan denda Rp 10 juta. “Sesuai Peraturan KPU (PKPU) nomor 7 tahun 2013 Bab II tentang persyaratan Bacaleg, Pasal4hurufgmenyebutkanBacaleg tidak pernah dijatuhi pidana penjara berdasarkan putusan pengadilan yang telah mempunyai kekuatan hukum tetap, karena melakukan tindak pidana yang diancam dengan pidana penjara lima tahun atau lebih. Berdasarkan itu, kami belum mengetahui apakah ES dan RDT diancam hukuman lima tahun penjara atau lebih,” papar Purba. (a30)

Penetapan Pemenang Tender Langgar Perpres Kontraktor Protes Distan Aceh BANDA ACEH (Waspada) : Sejumlah asosiasi kontraktor mengajukan keberatan sekaligus protes atas penetapan pemenang tenderproyekpekerjaanpengembangan ubi kayu senilai Rp.685 juta di Dinas Pertanian Tanaman Pangan Provinsi Aceh. Mereka menilai panitia tender telah mengangkangi aturan yang ada. Pasalnya, rekanan yang dimenangkan dalam tender tersebut tidak memenuhi persyaratan, karena tidak lulus dalam evaluasi administrasi pemeriksaan dilakukan Kelompok kerja (Pokja) Pelelangan Pengadaan Barang, Konstruksi dan Jasa pada dinas tersebut. Karenanya sejumlah kontraktor menilai ada keanehan dalampenetapanpemenangtender di Distan Provinsi Aceh, dan jelasjelas melanggar aturan Perpres Nomor 54 Tahun 2010 tentang Pengadaan Barang dan Jasa yang terakhir diubah dengan Perpres Nomor 90 Tahun 2012. “Kami melihat proses dan

pemenang tender tersebut hanya akal-akalandariPokjaPengadaan Distan Aceh.Yakni dengan mencarai berbagai alasan untuk menggugurkan perusahaan yang telah dinyatakan lulus evaluasi administrasi dengan nilai penawaran sesuai tender. Kemudian memenangkan perusahaan lain yang tidak lulus evaluasi dan nilai penawaran jauh di atas tender,” ungkap Direktur CV Makmur Group, Mahdi H Usman di Banda Aceh, kemarin. Mahdi menyatakan, perusahaannya telah memenuhi semua persyaratan seperti spek teknis yang ditawarkan dan banyak brosur jenis varietas unggul ubi kayu yang dilampirkan dalam penawaran. Tapi, anehnya, kata Mahdi, yang ditunjuk dan ditetapkan sebagai pemenangnya CV TT dengan nilai penawaran Rp738,5 juta. Padahal, CV TT tidak lulus dalam evaluasi administrasi yang dilakukan Pokja pelelangan. Disebutkan Mahdi, berda-

sarkan pasal 82 Perpres 70 Tahun 2012, maka pihaknya terpaksa mengajukansanggahanbanding. Selain juga telah mengirimkan surat kepada Gubernur Aceh pada 22 April 2013 lalu. Diharapkan gubernur selaku pejabat yang berwenang menjawab,supayamenyatakansanggahan banding ini benar dan memerintahkan Pokja ULP di Distan Aceh untuk melakukan evaluasi ulang pakerjaan pengembangan ubi kayu tersebut. Wakil Ketua Kamar Dagang dan Industri (Kadin) Kota Banda Aceh, Mansurdin membenarkan kejanggalandankeanehanproses danpemenangantendertersebut yangtelahmenzalimi(mengalahkan) beberapa perusahaan yang memenuhisyaratdenganmemenangkan perusahaan yang tidak memenuhi persyaratan berdasarkan hasil periksa evaluasi administrasi. Disebutkan, dari hasil evaluasi administrasi, teknis, harga dankualifikasibadanusaha,hanya

tiga perusahaan yang lulus dan memenuhi syarat, masing-masing CV Makmur Group, CV BamaSempurnadanCVPugaAceh. Tapi anehnya yang ditetapkan sebagai pemenang oleh ULP Dinas Pertanian Aceh justru perusahaan yang tidak memenuhi persyaratan yakni tidak lulus evaluasi administrasi. Berdasarkan berita acara hasil pelelangan Nomor: 257/ DISTAN-APBA/B/2013 tanggal 11 April 2013, CV Makmur Group yang sudah lulus evaluasi administrasi justru dinilai panitia tender tidak memenuhi diskripsi varietas/brosur ubi kayu sesuai spek teknis yang ditawarkan. Kadis Pertanian Tanaman Pangan Provinsi Aceh Razali Adami mengaku sedang ada rapat. “Nanti coba dihubungi lagi ya, saya sedang ada rapat sebentar,” ujarnya. Namun, setelah dihubungi kembali beberapa kali, Razali Adami tidak lagi mengangkat telepon selulernya. (b09)

Anggota Dewan ‘Galau’ Tak Masuk DCS BLANGPIDIE (Waspada) : Pasca penyerahan Daftar Calon Legislatif Sementara (DCS) ke KIP oleh sejumlah partai politik pesertapemilutahun2014,membuat sejumlah anggota DPRK Abdya enggan masuk kantor, padahal banyak jadwal sejumlah materi pembahasan yang harus disusun seperti halnya paripurna hasil pansus beberapa waktu lalu yang dilaporkan masih terbengkalai. Banyak kalangan beranggapan terbengkalainya hasil pansus tersebut disebabkan banyak ang-

gota dewan tidak masuk dalam DCS. Selain itu juga banyak anggota yang masuk DCS sibuk mengurusi berkas kelengkapan pendaftaran. Amatan Waspada, Jumat (26/4) di gedung DPRK Abdya, terlihat ruang– ruang komisi tampaklengang,beberapaanggota dewan yang hadir hanya bisa duduk dan diam lantas pulang. Salah seorang tokoh masyarakat sekaligus mantan anggota DPRK Abdya periode 2004-2009 Syeh Marhaban Bargat mengatakan, kinerja anggota dewan saat

ini sangat tidak etis karena tidak mementingkan kepentingan rakyat. “Secara aturan hasil Pansus DPRK harus dipublikasikan ke publik sehingga tidak menimbulkan keresahan dalam masyarakat itu sendiri,” katanya. WakilKetuaDPRKAbdya,ElizarLizam,Jumat(26/4)mengakui, ketidakhadiran mayoritas anggota dewan di sejumlah komisi di DPRK Abdya yang semestinya sudah mulai melakukan pembahasan tim terkait temuan hasil pansus APBK tahun 2012 sangat

4 Pejabat Abdya Dilantik Ulang BLANGPIDIE (Waspada) : Pemerintah Kabupaten Aceh Barat Daya melantik kembali sebanyak empat pejabat struktural eselonIIIdanIVdalamlingkuppemerintahansetempatberlangsung di ruang Sekretaris Daerah Kantor Bupati Abdya, Kamis (25/4). Di ruang yang berkapasitas hanya menampung puluhan orang itu, Sekda Abdya Ramli Bahar mewakili Bupati Abdya Jufri Hasanuddin melantik ulang 3 pejabat eselon III dan satu pejabat eselon IV. Tiga pejabat eselon III yang dilantik ulang hari itu masing-masing Usman Adami sebelumnya menjabat sebagai staf pada Inspektorat Kabupaten Abdya dilantik menjadi Kabag Persidangan dan Risalah pada Sekretariat DPRK Abdya. Selanjutnya, Halimatussakdiah sebagai sebelumnya staf pada Sekdakab Abdya dilantik menjadi Sekretaris Majelis Pendidikan Daerah (MPD) Abdya, dan Misriadi sebelumnya menjabat Kasubbag Umum pada Bagian UmumSetdakabAbdya,selanjut-

nya dilantik menjadi Pj Kabag Umum pada Setdakab Abdya. Sementara untuk jabatan eselon IV yaitu Asnawi, jabatan lamaKasubbagHukumdanHubunganMasyarakatpadaSekretariat KIPAbdya,dilantikmenjadiKasubbag Kepegawaian dan Tatalaksana pada Bagian Organisasi dan Kepegawaian Setdakab Abdya. Pejabat eselon III dan IV tersebut dikukuhkan kembali ka-

rena saat pelantikan pada bulan yang lalu keempat pejabat itu tidak menghadiri ketika berlangsungnya pengambilan sumpah jabatan. Sekda Abdya Ramli Bahar dalam arahan singkatnya menyampaikankepadapejabatyang beru dilantik supaya senantiasa menjaga mobilitas dan tanggung jawab kerja sesuai dengan aturan yang berlaku. (b08)

KontraS Aceh: Jadikan Hukum Sebagai Panglima BANDA ACEH (Waspada): KontraS Aceh berharap seluruh pimpinan partai hendaknya dapat menghindari sikap saling tuding terhadap peristiwa kekerasan yang terjadi. Karena, tindakan itu justru semakin mempertajam gesekan antar pendukung di lapangan. “Alangkah bijaknya, kalau semua kontestan Pemilu men-

jadikan pelaku kekerasan sebagai musuh bersama,” tegas Koordinator KontraS Aceh, Destika Gilang Lestari, Kamis (25/ 4), terkait ancaman yang dialami Zuhra, 31, caleg perempuan dari Partai Nasional Aceh (PNA) Aceh Besar. Menurut Destika, peristiwa ini merupakan gejala awal munculnya praktik kekerasan dalam Pemilu Legislatif di Aceh dan harus disikapi secara serius oleh Pemerintah Aceh. Sebab, pemakluman terhadap satu praktik kekerasan akan melahirkan kekerasan susulan dan dikhawatirkan meluas. (b04)

merugikan anggota dewan dan masyarakat Abdya pada umumnya. “Tidak dipungkuri memang tidak hadirnya anggota dewan tersebut mungkin kesibukan masing-masing, terutama kesibukan mempersiapkan diri bagi anggta, dan itu harus kita maklumi,” imbuhnya. Namun demikian, pihaknya selaku koordinator tim pansus di daerah pemilihan III menegaskan,pihaknyasudahmenyiapkan laporan hasil pansus yang akan tetap diparipurnakan. (b08)

A3 Jabatan Wakapolres Dairi Diserahterimakan SIDIKALANG (Waspada): JabatanWakapolres Dairi dari peiabat lama Kompol Yafao Harefa diserahterimakan kepada pejabat baru, Kompol Santun Hutauruk, Sabtu (27/4) di Mapolres. Serah terima jabatan dipimpin Kapolres AKBP Enggar Pareanon selaku inspektur upacara.Waka yang baru, Santun Hutauruk sebelumnya bertugas sebagai Kabag Min Polres Dairi. Sedangkan Waka yang lama, Kompol Yafao Harefa mendapat tugas baru di Poldasu. Inspektur upacara dalam kata sambutannya mengatakan, Polri berperan selaku pemelihara Kamtibmas dan seiring dengan arah kebijakan strategi Kapolri yang mendahulukan tampilan selaku pelindung, pengayom dan pelayan masyarakat yang dimaksud bahwa dalam setiap kiprah pengabdian anggota Polri, guna sebagai pemeliharaKamtibmasharussejalandenganparadigmabarunyayangmengabdi bai kepentingan masyarakat. “Proporsional dan prosedural dengan tetap menjunjung tinggi HAM dan supremasi hukum sanat didambakan. Selanjutnya harus dilaksanakan dengan sungguh-sungguh apa yang telah diinstruksikan pimpinan Polri. Sasaran prioritas kebijakan dan strategi Kapolri yang meliputi pemberantasn segala bentuk perjudian, narkoba, korupsi, illegal logging, lllegal fishing, premanisme, terorisme, separatisme dan yang lain perlu penanganan secara serius dan profesional. (a20)

Anak Dicabuli Belasan Kali, Ortu Lapor Polisi SEIRAMPAH(Waspada):Tidakterimaputrinyayangmasihberstatus siswi di salah satu SMPN di Kec. Seirampah sebut saja Cempaka, 15, telah dicabuli PA, 17, belasan kali, warga DusunV, Desa Sei Rampah, Kec. Sei Rampah, Serdangbedagai, membuat orangtua Cempaka, Mia, 40, didampingi suaminya Kisno, 40, warga Dusun VII, Rampah Kiri, desa yang sama melaporkan PA ke Mapolres Sergai, Jumat (26/4). Informasi diperoleh Waspada, kasus pencabulan terbongkar saat Cempaka tidak pulang ke rumah Minggu lalu, dan menginap di rumahkeluargaPA diSeirampah,saat itu orangtuaCempakamerasa kehilangan putri bungsunya, ketika dicari Cempaka ditemukan saat bersama PA di rumah keluarganya tersebut. Merasa curiga, Cempaka didesak orangtuanya akhirnya Cempaka buka mulut dan mengaku telah dicabuli PA. Setelah mendengar pengakuan itu, Kisno sempat menunggu niat baik pihak keluarga PA untuk jalan damai, tetapi bukan perdamaian yang didapat, malah terkesan caci maki dari keluarga PA. Cempaka usai membuat pengaduan kepada wartawan mengaku pertama kali mahkotanya direnggut PA, Agustus 2012 lalu dan terakhir 8 Maret 2013, perbuatan terlarang itu dilakukan keduanya di rumah keluarga PA. Kasubag Humas Polres Sergai AKP ZN Siregar membenarkan laporan korban pencabulan telah diterima pihak Polres Sergai dan perkaranya akan segera diproses. (c03)

MPU Dukung Beut Alquran Ba’da Maghrib KOTA JANTHO (Waspada): Majelis Permusyawaratan Ulama (MPU) Kabupaten Aceh Besar mendukung kegiatan Beut (Mengaji) Alquran ba’da Maghrib (BABM) yang dilaksanakan Pemerintah Kabupaten Aceh Besar. Menurut MPU, kegiatan yang dicanangkan Bupati Aceh Besar Mukhlis Basyah itu merupakan kegiatan alternatif dalam memantapkan Aqidah dan pemahaman Syariah kepada anak-anak usia dini. Demikian salah satu kesimpulan yang dihasilkan dalam Lokakarya Ulama yang berlangsung di wisma Hijrah Center, Lambaro, Kamis (25/4). Ketua MPU Aceh Besar Muhammad MJ usai lokakarya yang dibukaWakil Bupati Aceh Besar Syamsulrizal menjelaskan, lokakarya yang diikuti 100 peserta itu juga mengajak semua elemen masyarakat untuk terus-menerus mengkaji lebih dalam guna mendapatkan pemahaman tentang Aqidah Ahlussunnah Wal Jamaah, serta mengetahui kriteria ajakan atau aliran sesat dan mensosialisasikan hasil kajian kepada umat atau masyarakat luas. (b05)

BPK Aceh Silaturahmi Dengan Pemkab Aceh Besar KOTA JANTHO (Waspada): Badan Pemeriksa Keuangan (BPK) PerwakilanAcehdipimpinketuanyaMamanAbdurrahmanbersilaturahmi dengan Bupati Aceh Besar Mukhlis Basyah dan jajarannya di Aula HT Bachtiar Panglima Polem Setdakab Aceh Besar, di Kota Jantho. Silaturahmiyangdirangkaidengansosialisasitugasdankewenangan BPK RI tersebut, Maman Abdurrahman menjelaskan, sesuai UndangUndangNomor15Tahun2006Pasal6ayat(1),BPKbertugasmemeriksa pengelolaan dan tanggung jawab keuangan negara yang dilaksanakan oleh pemerintah pusat, Pemda, lembaga negara lainnya, Badan Usaha Milik Negara, Badan Layanan Umum, Badan Usaha Milik Daerah. Bupati Aceh Besar Mukhlis Basyah mengemukakan, silaturahmi dengan BPK tersebut sangat penting untuk membenahi, memberi tambahan ilmu, dan wawasan kepada jajaran Pemkab beserta SKPK dan para camat, terkait tentang bagaimana pengelolaan keuangan negara yang baik dan tepat, sehingga pada tahun-tahun mendatang diharapkan Kabupaten Aceh Besar bisa meraih laporan keuangan dengan predikat Wajar Tanpa Pengecualian (WTP). (b05)

Hidup Sehat Dengan Lingkungan Bersih Terpidana Narkoba Ikuti Latihan Menulis BIREUEN (Waspada): Kegiatan gotong royong kiranya perlu ditumbuhkembangkan kembali di tengah masyarakat. Terutama dalam rangka menjaga kebersihan lingkungan sekitar kita. “Dengan menjaga kebersihan lingkungan, hidup menjadi lebih sehat,” tutur Kepala Puskesmas Juli II Yenni Solviani didampingi Camat Juli M Fuadi di sela-sela kegiatan gotong royong mas-sal di Lapangan Bola Kaki Juli di Desa Bunyet, Jumat (26/4). Gotong royong membersihkan lingkungan ini bekerjasama dengan unsur Muspika Plus Kec. Juli akan terus disosialisasikan. “Gotong royong semacam ini juga akan kita laksanakan hingga ke desa-desa,” ucap Yenni. Menurutnya, membersihkan lingkungan juga merupakan salah satu cara untuk mencegah penyakit demam berdarah dengan cara menutup tempattempat genangan air, menguras bak mandi secara rutin. (b17)

TAKENGEN (Waspada): Guna menggali potensi para terpidana, sebanyak 25 narapidana di RumahTahanan (Rutan) klas II BTakengen, Aceh Tengah mendapat latihan menulis kreatif. Kegiatan yang berlangsung 25-27 April ini diselenggarakan oleh pihak Rutan bekerjasama dengan sebuah lembaga menamakan diri ‘Gayo Kreative’ yang bergerak di sejumlah bidang, salah satunya sosial kemasyarakatan. “Pelatihan ini khusus diberikan untuk warga binaan pemasyarakatan. Ajang ini selain diharap memberi pemahaman tentang tehnik menulis, juga nantinya bisa menjadi bekal para napi untuk mandiri. Siapatahumerekanantinyabisamenjadipengarangdanpenulisberbakat,” sebut Rahmah, panitia pelaksana, Kamis (25/4) di Rutan Takengen. Menurut dia, dalam kesempatan tersebut pihaknya dengan dibantu para wartawan senior di daerah dingin itu akan memberikan pelatihan pengenalkan dasar-dasar ilmu menulis ke para Napi. Kepala Rutan Aceh Tengah, Said Syahrul menyebutkan pihaknya sangat merespon baik tentang kegiatan tersebut. Bahkan, program seperti ini sangat membantu para Napi sebelum nantinya dikeluarkan dari Rutan, setelah habisnya masa hukuman. (cb09)

UNIVA Medan Juara I Fahmil Quran

Pencuri Solar 2 Kali Divonis Hakim PN R.Prapat

MEDAN (Waspada)Tim Kafilah Universitas AlWashliyah (UNIVA) Medan cabang Fahmil Qur’an meraih juara I pada Musabaqah Tilawatil Quran dan Nasyid (MTQN) di Tanjungbalai, baru-baru ini. Ketua Tim Kafilah UNIVA Medan Drs H Alimuddin Siregar, SH,S.Pd.I, M.Hum dalam kegembiraannya mengatakan, diraihnya juara I cabang Fahmil Quran menunjukkan adanya peningkatan dari tahun sebelumnya, di mana UNIVA Medan meraih juara II cabang Nasyid. Dekan Fakultas Agama Islam didampingi 4 official Agusman Damanik,MA,Irwan,S.Pd,RahayuPujiAstutidanAlUstadzMuhyiddin Nasution menambahkan, selain cabang Fahmil Quran dengan peserta berprestasi Anwar Syukri Harahap, Ihyaur Rahmi dan Nidaul Husna Khairi, UNIVA Medan juga meraih juara II Cabang Khattil Quran golongan Dekorasi Putri oleh Kasih Setiani dan Syarhil Quran dengan nama peserta Khairunnisa Pulungan, Putri Gianti dan Fauziah Nur. Ketua Lembaga Pengembangan Tilawatil Quran dan Nasyid (LPTQN) UNIVA Medan Drs Ahmad Yani mengatakan, tahun ini UNIVA Medan meraih Juara I, II dan III pada tiga cabang, dengan kerjasama yang maksimal tahun depan akan meraih juara di semua cabang yang diperlombakan. (rel)

RANTAUPRAPAT(Waspada): Terdakwa pencuri minyak solar, Amran, 22, warga Kualuh Leidong, Kabupaten Labuhanbatu Utara, divonis 2 kali sehari dalam perkara serupa dan hukuman yang sama. Pertama, Amran disidangkan hakim tunggal, Taufik AH Nainggolan, lalu memvonisnya bersalah melakukan tindak pidana pencurian melanggar pasal 363 KUHP dan menghukum Amran dengan pidana penjara 6 bulan. Namun, entah kenapa, Amran disidang lagi oleh majelis (3 hakim) dalam perkaranya, Kamis (25/4). Dalam sidang kedua yang digelar, Amran tetap divonis penjara 6 bulan. Majelis hakim Taufik AH Nainggolan, Dewi Andriyani dan Anita Silitonga pada amar putusannya menyatakan Amran terbukti melanggar pasal 363 KUHP dan terdakwa disebut melakukan pencurian minyak solar 3 jerigen dari kapal Akiang di Leidong, Labura. Hal-hal yang memberatkan terdakwa, telah merugikan saksi korban (Akiang) dan meresahkan masyarakat. Sebelumnya, jaksa penuntut umum Lisa menuntut agar terdakwa Amran dihukum pidana penjara 8 bulan, karena telah melakukan tindak pidana pencurian, sebagaimana disebut dalam pasal 363 KUHP. Seusai sidang kedua, Amran saat ditemui wartawan merasa heran, kenapa dirinya 2 kali disidang. “Kenapa aku dua kali sidang ya? Padahal putusannya sama saja,” kesal Amran. (

PESERTA cabang Fahmil Quran Anwar Syukri Harahap, Ihyaur Rahmi dan Nidaul Husna Khairi sedang berfoto bersama setelah menerima piala dan hadiah.



A4 Banyolan Sepertinya Kayak Kenal Seorang lelaki bertampang pas-pasanterheran-heran ketika dipandangi seorang wanita cantik. Seperti menyelidik wanita tersebut berkata, “Kaya kenal ya?”. Si lelaki tersipu malu dan dengan sedikit sombong ia menjawab, “Ah neng.. mungkin neng salah lihat kali, saya tidak kenal neng?!”. “Nggak bang! Maksud saya, muka abang kayak KENALPOT!”, jawab si wanita itu

Tugas Pertama Seorang Polisi Seorang calon polisi menjalankan tugas pertamanya Sebuah panggilan meminta mereka untuk membubarkan beberapa orang yang mondarmandir di jalan. Di sebuah sudut jalan terlihat sebuah kerumunan kecil. Calon polisi itu membuka jendelanya dan berkata, “Ayo bubar, bubar.” Beberapa orang memandang saja, tetapi tak seorang pun bergerak, lalu ia berteriak lagi dengan suara yang lebih keras dan digalak-galakkan, “Ayo cepat bubar… sekarang!!!!” Karena merasa terancam, kumpulan orang itu mulai bubar, sambil melihatnya dan bertanyatanya dalam hati. Bangga dengan tindakannya, polisi muda itu menoleh pada rekannya dan berkata, “Bagaimana pendapatmu?” “Hebat!!!” kata seniornya, “Baru pertama kali ini aku melihat seorang polisi membubarkan orang-orang yang sedang menunggu bis di halte!”

Lomba Memanah

Guru: “Badu… ibu tanya sekarang, 6 dibagi 3 berapa?” Badu: “Ngak tau bu!” Guru:“Masa’ kamu gak tau, misalnya kamu punya mangga 6 buah trus kamu bagi dengan 2 temanmu, jadi kalian masing-masing dapat berapa?” Badu: “Tunggu dulu Bu, mangganya itu mangga muda atau mangga masak?” Guru: “Maksud kamu apa Badu?” Badu: “Kalau mangga muda yah Badu kasih ke mereka berdua, tapi kalau mangganya masak ngak saya kasih Bu!”

Murid: “Pak, mengapa rambut Bapak kian lama kok kian sedikit, sudah hampir-hampir botak nih.” Guru: “Hal ini menunjukkan bahwa diriku super pintar.” Murid: “Kalau begitu rambutku nanti kucukur plontos saja.” Guru: “Tindakanmu ini namanya sok pintar.”

“Tomi... Kamu gambar apa?” “Sapi makan rumput bu guru…..” “Trus rumputnya mana?” “Sudah habis buk dimakan sama sapi” “Trus sapinya mana?” “Udah pergi buk…. Kan rumputnya udah abis!”

Pasien sakit gigi Seorang dokter gigi menerima pasien sakit gigi di tempat prkteknya…. “Ada keluhan apa pak?” “Gigi saya sakit sekali nie dok….”

Kata Serba Sulit

Seorang terpidana mati kasus mutilasi,minta HP Baru singkong racun kepada salah seorang penjaga sel nya. Paijo : din...sini pinjem hpe kamu yang Napi :Pak Sipir,saya minta di carikan singkong baru beli kemarin.. racun. Udin : Niih Sipir:buat apa,nanti kamu bisa mati keraPaijo : waaah mantap cooy ...pake layar cunan. sentuh lagi.. Napi :biar saja mati keracunan Pak Sipir,dari Udin : Yoooi..... pada saya di hukum mati gengan cara di mutilasi Paijo : Din Gue heran deh ama kamu...kok daftar kontak kamu cowok semua ...gak ada ceweknya sama sekali.... Bilangan Bulat Udin : Dasar katro loe,,,, emang belum tau ya.. Guru Matematika menerangkan tentang Paijo : Belum tau apaan...? pembagian bilangan bulat. Udin : Kan...kalo telpon ke sesama tarifnya Guru: “Anak-anak siapa yang bisa jawab 8 murah coooy dibagi 2 berapa?” Paijo : ???!!!! Murid: (serempak menjawab)“4 buuuuuu…”

Gunakan angka 0 sampai 9 ditambah dua abjad -- A dan B -- untuk mengisi kotak-kotak kosong. Tidak boleh ada pengulangan angka dan huruf pada lajur mendatar dan menurun, serta di dalam kotak 4x3 bergaris tebal. Tingkat kesulitan: sedang (***). Tersedia hadiah Rp50.000,- untuk seorang pemenang. Antar kupon yang sudah terisi angka yang anda yakini benar ke kantor Waspada Jl. Brigjen Katamso 1 Medan paling lambat Jumat. Jawaban bisa juga dikirim ke faksimile (061) 4510025. Jawaban dan pemenangnya dimuat pada edisi Minggu (5/5). ------------------------------------------------------ potong di sini --------------------------------------------------------


2 B 3 1 3 B 8 6 9 8 2 6 B 7 A

7 6 8 4 3 0 9 B

3 7 1 6 B 5 B 0

2 5 B 9 A 8 7 1


8 1 A 4 5 0 2 8 5 7 9 A 1 4 B ***39



Alamat sesuai KTP :



.................................................... ---------------------------------------------- potong di sini ---------------------------------------------

“Yang mana? Coba buka mulutnya sebentar……” Pak dokter kemudian mengecek gigi pasien….. “Gimana pak dokter? Parah ya?” “Kalau sudah sampai sakit begitu ya sudah parah pak… Perlu dicabut….” “Aduh dok… Sakit ga tuh?” “Tidak pak… Kan sudah ada obat bius….” “Lama ga sih dok?” “Bentar kok…. Sepuluh menit aja sudah beres” “Biayanya berapa dok?” “Seratus lima puluh ribu….” “Mahal sekali padahal cuman 10 menit saja….” “Owh begitu… kalau bapak mau,,, saya bisa cabutnya pelan-pelan…..”


Ciri-Ciri Orang Pintar

A 9 1 B 6 3 4 7

Minggu 28 April 2013

Pada suatu perlombaan panahan, ada 3 peserta yang mengikuti. Peserta I dari Inggris meletakkan semangaka di atas kepala seseorang. Setelah dilepaskan anak panahnya semangakanya terbelah dua. Dengan bangganya si Inggris berkata : “I AM ROBIN HOOD !” Peserta II dari Amerika meletakkan jeruk di atas kepala seseorang. Plesh......., ternyata jeruk itu terbelah dua. Penonton bertambah kagum Si Amerika berkata : “I AM SUPERMAN” Peserta III dari Indonesia membuat penonton menahan napas, karena dia meletakkan sebuah duku di atas kepala seseorang. Anak panah ditarik, penonton terbelalak ... plesh.... ternyata anak panah itu mengenai jidat orang itu dan matilah dia. Lalu si Indonesia berkata: “I AM ........SORRY”


Bu guru: “Sumarni, cobalah membuat sebuah kalimat dengan menggunakan ungkapan ‘serba sulit’.” Sumarni: “Aku serba sulit saat sedang ujian.” Bu guru: “Apakah soal-soal ujiannya terlalu sulit bagimu, sehingga kamu tak mampu menentukan jawabannya yang tepat dan menyebabkan kamu merasa serba sulit?” Sama-Sama Gila Sumarni: “Bukan, Bu. Jawaban teman di Seorang suami mencari istrinya yang pergi sebelah kiriku dengan jawaban teman yang dari rumahnya sejak pagi hari,dan belum pulang duduk di sebelah kananku sama sekali tidak hingga sekarang. sama. Hal inilah yang menyebabkan aku serba Dia muter-muter kampung seharian dan sulit.” akhirnya dia menemukan istrinya berada di lapangan bola. Si suami memanggil istrinya dari Real Married pinggir lapangan Suami: “Istriku,ngapain kamu berada Linda: Mas ngefans ya sama Real Madrid? ditengah-tengah lapangan bola?” Ucok: Iya.. Istri: “Kamu enggak lihat toh, aku naik perahu Linda: Ngefans banget apa ngefans aja? ditengah laut…” Ucok: Ngefans banget nget nget nget! Suami: “Makanya kamu dibilang orang gila, Linda: Apa sih yg membuat Mas sampai ayo pulang istriku!” se-ngefans itu? Istri: “Nanti dulu,aku sedang asyik memanUcok: Mau tau? cing ikan paus…” Linda: Iya dong.. Suami:“Ayo pulang sekarang, nanti saya pukul Ucok: Mau tau banget apa mau tau aja? kamu.” Linda: Hih! Mau tau bangetlah! Istri: “Silahkan pukul,coba kesini kalau kamu Ucok: Emm... Kasih tau ga yaa? berani!” Linda: Kaan? Pasti deh ngerjain aku terus.. Suami: “Awas ya kamu, coba saja kalau saya Ucok: Hehe.. Gini lho Beb, aku ngefans Real bisa berenang…” Madrid, karena suatu saat aku akan Real Married sama kamu.. Linn: ??? Lebih Baik Mati



07.00 Tom & Jerry 07.30 Crayon Sinchan 08.00 Doraemon 09.00 Dahsyat 11.00 Infotainment Intens 12:00 Seputar Indonesia Siang 12.30 Penyegaran Rohani 13.00 X Factor Indonesia 16.00 Dua Sisi 16.30 Seputar Indonesia 17.00 Yang Muda Yang Bercinta 18.30 Cinta 7 Susun 19.30 Layar Drama Indonesia Tukang Bubur Naik Haji The Series 21.00 Berkah 22.30 Box Office Movie 00.30 Seputar Indonesia Malam

07.30 Gowes 08.00 Fenomania 08:30 Aku Ingin Sembuh 09:00 Haier Inspire Living 09:00 Properties In Harmony 09.30 Good Food Good Mood 10:00 Semua Bisa Plesir 10:30 Neo Planet Remaja 11:30 Topik Siang 12:00 Klik ! 13:00 Mantap 14:00 Total Football 14:30 Kampiun Sepakbola Nasional 15:00 ISL 17:30 Topik Petang 18:30 ISL 21.00 Crazy Sport 22:00 Sinema Spesial Nama: .................................................. Alamat: ................................................ No. KTP/SIM/Kartu Pelajar: ..............................

gunting di sini TTS Berhadiah Jawab dan gunting TTS Berhadiah di atas kemudian kirimkan ke PT Harian Waspada Jalan Brigjen Katamso No.1 Medan/Jalan Letjend Suprapto No.1 Medan. Tulis nama dan alamat lengkap serta nomor pengenal. Jawaban paling lambat diterima Jumat 12 April 2013, pukul 16:00. Bagi pengirim yang dapat menjawab semua pertanyaan dengan tepat dan benar akan diberi hadiah berupa uang tunai sebesar Rp50.000,-untuk satu orang pemenang. Semua jawaban yang benar akan diundi. Pengumuman pemenang akan diumumkan pada Minggu 14 April 2013 beserta jawaban yang benar di halaman yang sama. Hadiah dapat diambil di kantor Harian Waspada bagian Sekretaris Redaksi (jam kerja), setelah tiga hari pengumuman pemenang diterbitkan. MENDATAR


1. Air yang menggenang permukaan tanah 6. Penyakit kurang darah 11. Kulit bagian dalam yang sangat tipis 12. Ombak kecil 14. Bagian antara sendi dengan sendi/ pada buku dengan buku (pada jari, tebu, bambu) 15. Pasangan istri 17. Tidak bercahaya, tidak bening 19. Delapan 20. Makna, maksud 21. Hotel (Inggris) 23. Bagian yang keras dan runcing pada kaki ayam 25. Orang (regu) yang mendapat kemenangan 27. Alat bantu pendengaran 31. Pekan Olahraga Nasional 32. Sakit (Inggris) 33. Organisasi Buruh Internasional 34. Giat (bekerja, berusaha) 36. Berombak (ttg rambut) 37. Tiruan bunyi suling, burung yang dilakukan dengan mulut 39. Berdandan, bersolek 41. Bentuk ringkas dari promina persona pertama (aku) 42. Terjadi/berlaku pada waktu yang sama, serentak 45. Angkatan Udara 47. Mandi uap 49. Celurit 51. United States 52. (diulang) terburu-buru,lekas-lekas 53. Kakek 54. Bentuk terikat dari seperseribu

1. Mengandung air atau benda cair 2. Gerak air yang mengalir, aliran 3. Maksud atau tujuan suatu perbuatan 4. Cemburu 5. Republik Indonesia 6. Gawat 7. Kurun waktu dalam sejarah 8. Mayat yang diawetkan dengan cara dibalsem 9. Dia 10. Rasa garam 13. Angkatan Bersenjata Republik Indonesia 16. Indra penglihatan 18. Gerimis 20. Batas hidup yang telah ditentukan Tuhan 22. Baru atau yang diperbaharui 24. Bijaksana 25. Penunggang kuda pacuan 26. Buat 28. Gerakan badan untuk menguatkan dan menyehatkan badan 29. Ukuran kertas A-4 30. Nama pulau kecil yang terletak di sebelah barat pulau Sumatra 31. Sesudah 35. Khayalan 38. Desas-desus 40. Bebek yang bertubuh besar dan berleher panjang 43. Penyanyi yang diberi gelar ratu ngebor 44. Beras yang sudah dimasak 46. Gas yang keluar dari air yang dipanaskan 48. Anjungan Tunai Mandiri 50. Raden Ajeng

Pemenang Sudoku Berhadia Minggu Lalu

Pemenang TTS Berhadia Minggu Lalu

Mhd Iman Sentosa Hsb, Jln Ir H Juanda No 176 Kisaran 21 221 KTP 1209201807700004

JAWABAN SUDOKUMINGGU LALU 0 8 3 1 6 7 A 4 2 9 A 0 2 5 4 6 1 B 3 B 8 7 9 A 5 0 1 4 2 6 8 3 5 A B 7 9

9 B 5 8 3 7 4 2 6 0 1

1 5 B 4 A 2 0 6 8 7 9 3

2 9 7 B 6 3

A 4 6 7 5 B 0 8 A 3 4 2

3 7 9 8 A 5 1 B 4 2 8 1 0 6 5 4

8 0 9 5 2 6 B 1 7 9 A 0 1 6 2 4 5 8 7 B 3 3 9 A A 2 4 B 2 0 8 1 6 1 0 5 7 3 9 B

1 3 8 4 9 0


5 7 6

07:00 Ultraman Max 07:30 Dufan The Defender 08:00 Metal Fight Beyblade Baku 08:30 Scan2Go 09:00 Dragon Ball Z Kai 09:03 Sinema Pagi Akhir Pekan 11.00 Live Patroli 12:00 Sinema Pintu Taubat 14.00 Hot KiSS 14.30 Live Fokus 15.00 Tukar Nasib New Season 16.00 Sinema TV 18:00 Drama Seri Indonesia 19.00 Sinema Indonesia 20.00 The Voice Indonesia 22:00 Sinema Unggulan

07.00 Mozaik Islam 07:30 Semangat Pagi 08.00 Benu Buloe 08:30 Buah Hati 09.00 Ceriwis 09:45 Ala Chef 10:30 Ngulik 11.00 Insert Siang 12:00 Bioskop Indonesia 13:30 Bosan Jadi Pegawai 14:00 Sketsa 15.00 Bingkai Berita 15:30 Gengges 16: 00 Insert Investigasi 16.45 Reportase Investigasi 17:15 Lollylove 18:00 Indonesia Mencari Bakat 3 20.00 Bioskop TRANS TV SPesial 21:00 Bioskop Trans TV 22:00 Bioskop Trans TV

07.00 Inbox 09.00 Liputan 6 Terkini 09:00 Hot Shot 10:00 SCTV FTV Pagi 11.00 Liputan 6 Terkini 12:00 SL Liputan 6 Siang 12:30 Usaha Anda 12.34 Little Miss Indonesia 15.00 Liputan 6 Terkini 16.03 Little Nuss Indonesia 17.30 Liputan 6 Petang 18.00 Si Biang Kerok Cilik 19.30 SCTV SInetron : Ustad Fotocopy 21.30 SCTV Music Karnaval

07:00 Pelesir 07:30 Upin & Ipin 08:30 Kisah Unggulan 10.00 Ayo Main 10:30 Grebek Nusantara 11:30 Mata Pancing 16.00 Amazing Bollywood 17.00 Jendela 17:30 Inspirasi Sore 18:00 Somad 19.00 Legenda MD The Series 21.00 Raden Kian Santang 22:30 BPL 01.00 BPL

07.05 Jalan Jalan Asyik 08.05 Menu And Venue 08.30 Agung Sedayu 09.30 Agung Sedayu 10.05 Dulux Inspire 11.05 Sudut Pandang Woman On Top 12.00 Pas 13.30 Muslim di Xin Jiang 14.30 Lestari 15.30 Kick Andy 17.05 Metro Hari Ini 18.30 Metro This Week 19.05 Mario Teguh 20.05 Just Alvin! 21.05 Love Me As I Am 22.05 Musik + 23.00 Headline News 23.05 Destroyed in Seconds 23.30 Metro Sports

TRANS 7 07.00 RNB 07.30 Selebrita Pagi 08.30 Party 09:00 Kaca Mata 09:30 Gak Nyangka 10:00 Wollipop 10:30 Spotlite 11:00 RAN 11:30 Redaksi Siang Akhir Pekan 12:00 Selebrita Siang 12:30 Galeri Sepak Bola Indonesia 13:00 One Stop Football 14:30 Mancing Mania 15:00 Sing n Run 15:30 Iseng Banget 16:30 Redaksi Sore 17.30 Breaking World 18.00 Sebelas Dua Belas 19.00 Hitam Putih 20:30 PAS Mantab 22.00 Mister Tukul 00.30 Vamos Liga

M. Rifki Al Hafiz, SMA Kartika I-2 Kelas X-4 Medan No. Pelajar/NISN 9970787247

JAWABAN TTS MINGGU LALU 09:00 MLS Soccer 09:30 Tinju Legendaris 10:00 Soccer One 10:30 Hot Sport 12:00 Live News Kabar Siang 12.30 Globe Trackker Season 13:00 Damai Indonesiaku 15:00 Nama & Peristiwa 16:30 Live News Kabar Petang 17:00 Apa Kabar Indonesia Malam 19.00 Indonesia Lawyers Club 21:00 Live News Kabar Malam 22:00 Nama & Peristiwa 23:00 Radio Road Show

08:00 Tingker Bell 10:00 Obsesi 11:00 Buletin Siang 12.00 Kungfu Chef 12:30 Super Boy 13.00 Fun Teenlicious 13:30 Tamu Gokil 14:00 Naruto 16:00 Fokus Selebriti 16:30 Kemayu 17:00 Eneng Dan Kaos Kaki Ajaib 18:00 Komeng AcakAdul 19.00 Big Movies 21.30 Big Movies


Medan Metropolitan

WASPADA Minggu 28 April 2013


Pencuri Rumah Mewah Ditembak MEDAN (Waspada): Dua pelaku pencurian di toko kaca dan gypsum Jln. Denai No. 221, Kel. Tegal Sari Mandala II, Kec. Medan Denai, ditangkap petugas Polsek Medan Area. Seorang di antaranya terpaksa ditembak karena berusaha melawan petugas saat hendak ditangkap. Kedua tersangka berinisial SL alias Rizal, 33, warga Jln. Pancasila Gang Keluarga, Kel. Tegal Sari Mandala III, Kec. Medan Denai, dan BS, 21, warga Jln. Ikhlas, Kel. Binjai, Kec Medan Denai. Tersangka SL alias Rizal saat ini masih dirawat di Rumah Sakit Bhayangkara Medan akibat menderita luka tembak. Dari kedua tersangka, polisi menyita barang bukti berupa perhiasan emas dan cincin 150 gram, uang tunai Rp81 juta, 5 jam tangan berlian, 3 hand-

phone, 5 ekor burung Murai Batu. Selain itu juga disita peralatan untuk mencuri yakni gunting besar pemotong besi, linggis, obeng, dan tang. Informasi yang diperoleh di kepolisian, Kamis (25/4) mengatakan, kedua tersangka membobol rumah merangkap toko kaca dan gypsum milik Sukimin alias Kimin, 41, Senin (21/4) dinihari. Untuk memuluskan aksinya, kedua tersangka menaburkan dua genggam tanah kuburan ke atap rumah korban yang diduga dipercayai bisa membuat penghuni rumah tertidur lelap. Selain itu, pelaku juga memakai baju hitam mirip rompi yang telah dihiasi dengan tulisan mantra-mantra. Dari rumah tersebut, kedua pelaku mengambil harta benda korban berupa gelang dan cin-

cin emas seberat 150 gram, handycam, 5 jam tangan berlian, 3 handphone, 5 ekor burung Murai Batu serta uang tunai Rp81 juta. Ditaksir korban mengalami kerugian mencapai Rp228 juta. Setelah berhasil mengumpulkan harta benda korban, kedua tersangka langsung kabur menggunakan sepedamotor Yahama Mio BK 6387 XG warna biru. Sedangka korban langsung membuat laporan pengaduan ke Polsek Medan Area. Petugas Reskrim Polsek Medan Area yang mendapat laporan korban melakukan penyelidikan dan meringkus kedua tersangka saat berada di satu rumah Jln. STM Gang Sukabudi, Kec. Medan Johor, Rabu (24/4) malam. Ketika dilakukan penangkapan, tersangka SL alias Rizal berusaha melawan petugas dengan menggunakan pisau dapur. Akhirnya, petugas menem-

bak kaki kanan tersangka Rizal untuk melumpuhkannya. Sedangkan tersangka BS tidak melakukan perlawanan. Kapolsek Medan Area Kompol Rama Samtama Putra mengatakan, tersangka SL alias Rizal dan BS ini sudah berkalikali melakukan aksi pencurian dan memiliki perlengkapan serta ilmu hitam. Dari barang bukti milik tersangka berupa 2 tang potong ukuran besar, 5 linggis, puluhan obeng dan tang kecil, satu pisau dapur dan cutter memang menggambarkan kedua tersangka ini spesialis pembobol rumah mewah dan rumah toko. “Sebelum memulai aksinya, tersangka SL alias Rizal ini melemparkan tanah kuburan ke bagian atap rumah korban agar bisa leluasa mengambil harta benda korban. Tersangka ini mempercayai bisa melancarkan aksinya karena penghuni rumah akan tertidur lelap. Kedua

tersangka sudah dua kali membobol rumah. Lokasi pertama di kawasan Jln. Bromo dan yang kedua Jln. Denai ini. Di lokasi pertama mereka berhasil menggasak harta benda korban senilai Rp140 juta dan kedua ini senilai Rp228 juta,” ujar Rama Samtama Putra. Sehari sebelumnya, petugas Reskrim Polsek Medan Area meringkus dua pelaku pencurian di dua lokasi terpisah. Kedua tersangka Ru, 30, warga Jln. Pinangbaris, Kec. Medan Sunggal, dan FN, 29, warga Asrama Polri Pasar Merah Blok R, Kel. Binjai, Kec. Medan Denai. Tersangka Ru ditangkap karena mencuri sembilan unit baterai SBS dan kawat tembaga di Jln. Tanggukbongkar X, sedangkan tersangka FN ditangkap karena mencoba mencuri sepedamotor milik Asmah, 50, di Jln. Ikhlas Gang Setia, Kec. Medan Denai. (h04)

MEDAN (Waspada): Kapolresta Medan Kombes Pol. H Monang Situmorang SH, MSi diwakili para stafnya berkantor di Polsek Delitua, Jumat (26/4). Kunjungan tersebut untuk mendengar keluhan dan berdialog dengan masyarakat setempat, sekaligus memberikan masukan kepada personel Polsek Delitua. Kedatangan staf dari Polresta Medan di antaranya Kasat Binmas Kompol A Hutauruk, Kasiwas AKP Torang Niari Sinaga, Kasubag Humas Polresta AKP Toni Simanjuntak,Wakasat Intelkam dan beberapa perwira

terlihat diterima Kapolsek Delitua Kompol Bakhtiar Marpaung dan Kanit Reskrim AKP S Sembiring. Menurut Kasubag Humas AKP Toni Simanjuntak, biasanya setiap Jumat, Kapolresta Medan Kombes Monang Situmorang berkantor di Polsek. “Tapi karena tadi pagi ada tugas mendadak mendampingi Kapoldasu, tidak bisa hadir dan diwakilkan stafnya ke Polsek Delitua,” katanya. Dalam kesempatan itu, Kasiwas AKP Torang Niari Sinaga didampingi Kapolsek Kompol Bakhtiar Marpaung menin-

jau ruangan tahanan dan berdialog dengan para tahanan menanyakan menu makanan yang diberikan. Setelah itu, staf dari Polresta Medan melakukan pertemuan dengan Kapolsek dan para stafnya untuk memberikan masukan apa saja yang diperlukan untuk pelayanan masyarakat. Kapolsek Delitua Kompol Bakhtiar Marpaung mengatakan, kunjungan para staf dari Polresta Medan itu, selain bertemu dengan warga yang membuat pengaduan ke polisi, juga memberikan masukan kepada stafyangbertugasdiPolsek.(m39)

Waspada/Andi Aria Tirtayasa

KAPOLSEK Medan Area Kompol Rama Samtama Putra menginterogasi tersangka BS (tengah) diduga menggunakan ilmu hitam saat melakukan aksi pencurian di rumah korbannya.

Mahasiswa Dharmawangsa Kuliah Umum Staf Polresta Berkantor Di Polsek Delitua Internasionalisasi Pemerintahan Daerah


PIMPINAN dan Pengasuh Utama Pesantren Modern Al-Mukhlishin ustad Amir Panatagama, S.Pd.I bersama official Kaligrafi ustad Choirul Amri, S.Pd.I melepas santri terbaiknya M. Darun Hafis mengikuti Pospedasu di Medan.

Santri Terbaik Al-Mukhlishin Ikuti Pospedasu Di Medan MEDAN (Waspada): Santri terbaik Al-Mukhlishin, Tg. Morawa Muhamammad Darun Nafis, kelahiran Bengabing, Serdang Bedagai mengikuti Pekan Olahraga dan Seni Santri Daerah Prov. Sumatera Utara (Pospedasu) 26 s/d 30 April 2013 di Asrama Haji, Medan. Putra dari Irwan dan Sakdiah ini sekarang sebagai santri kelas X atau IV Pesantren Modern Al-Mukhlishin Tanjung Morawa, mewakili Kabupaten Deli Serdang Cabang Seni Kaligrafi Kontemporer. Prestasinya cukup membanggakan, selain menjadi Duta Perdamaian Nasional, Nafis juga berprestasi dalam berbagai kegiatan formal maupun non formal seperti rangking 1 selama 4 (empat) tahun berturut-turut di Pesantren, penghafal Alquran terbanyak 10 (sepuluh) juz melebihi standar kopetensi minimal pada kelasnya, juara Badminton pada Porseni Madrasah 2012, aktif dalam seni beladiri, dan seni kaligrafi. Amir Panatagama, S.Pd.I selaku Pengasuh Utama Pesantren Modern Al-Mukhlishin kepada wartawan kemarin, menyampaikan harapannya pada prosesi keberangkatan Kontingen Deli Serdang Rombongan III yang menggunakan fasilitas bus Holiday Pariwisata transportasi bantuan dari pengusaha muda Bapak Musdalifah, SE bersama santri Nurul Hakim, Mawaridussalam dan Hidayatullah, agar dapat kiranya mereka meraih juara umum pada Pospedasu di Medan. Selain itu Ustad Ari Handoko, MA, wakil pimpinan yang mendampingi pengasuh utama bersama Ustad Sutrisno alias Muhammad Hafiz, S.Pd.I pengasuh Pesantren Nurul Hakim, memberikan motivasi dengan mengalunkan takbir 3 (tiga) kali dalam bus.(m39)

Waspada/Rudi Arman

KAPOLSEK Delitua Kompol Bakhtiar Marpaung (kiri) menerima kunjungan Kapolresta Medan diwakili para stafnya di ruang kerjanya, Jumat (26/4).

MEDAN (Waspada): Fenomena liberalisasi pemerintah daerah dalam era globalisasi, merupakan konsekuensi logis dalam menginternasionalisasikan peranan pemerintah daerah secara demokratis dan efektif dalam penyelenggaraan pemerintahan yang baik (good governance). Era liberalisasi ekonomi mendorong terjadinya kontrak sosial terbuka yang memberikan keleluasaan pemerintah daerah membangun dengan institusi global yang secara kompetitif bersaing dengan daerahdaerah lainnya di Indonesia. Untuk menang dalam kompetisi sebuah bangsa harus berevolusi dalam mendekati sebuah permasalahan dan dalam melakukan relasi dengan berbagai pihak penyelenggara. Hal itu disampaikan Dr Teddy Hikmat Fauzi MSi, salah seorang dosen pasca sarjana Universitas Pasundan, dalam kuliah umum yang mengambil tema Internasionalisasi pemerintahan daerah di era reformasi birokrasi, dihadapan sekira 200 mahasiswa Universitas Dharmawangsa Medan, baru-baru ini. Teddy menjelaskan, dalam era reformasi birokrasi saat ini diperlukan penyelenggaraan pemerintahan yang efisien dan berkualitas dalam pelayanan akuntabel, transparan, serta mampu beradaptasi dengan turbulensi perubahan lingkungan nasional. Sehingga dengan demikian tujuan utama dari pelaksanaan otonomi daerah dapat tercapai

seperti menciptakan efisien dan pelaksanaan sumber daya, meningkatkan kualitas pelayanan umum dan kesejahteraan masyarakat, serta memberdayakan dan menciptakan ruang bagi masyarakat untuk ikut serta dan berpartisipasi dalam proses pembangunan. Sementara itu, Wakil Rektor I Universitas Dharmawangsa Jhon Simon kepada wartawan mengatakan, kuliah umum diberikan kepada mahasiswa bertujuan agar mampu memberikan pengembangan dan menambah wawasan mahasiswa, sehingga diharapkan mahasiswa dapat lebih kritis dalam

melihat persoalanpersoalan bangsa yang berkembang di masyarakat, terutama di bidang birokrasi pada era reformasi seperti saat ini. Menurut dia, kuliah umum tersebut merupakan program universitas yang dilaksanakan minimal dua kali dalam satu semester, dengan menghadirkan nara sumber beberapa dosen pasca sarjana dari beberapa univesitas terkenal di Indonesia, selain diikuti oleh mahasiswa Universitas Dharmawangsa juga dihadiri oleh undangan lainnya seperti para pengusaha, akademisi, birokrasi, dan lainnya sebagai. (cwan)

80 Mahasiswa, Dosen Pulmed Studi Banding Ke LN MEDAN (Waspada): Sebanyak 80 mahasiswa dan dosen Politeknik Unggul LP3M (Pulmed), melakukan studi banding ke sejumlah perguruan tinggi di Kuala Lumpur dan Singapura, selama empat hari. Rombongan yang dipimpin Ketua Yayasan Pulmed HM Nasir Mahmud SE, MSi, MBA, berangkat melalui Bandara Polonia Medan ke Kuala Lumpur, Malaysia dengan penerbangan Malaysia Airlines System (MAS) MH-861, Rabu (24/4). Selama di Kuala Lumpur, mereka akan melakukan studi banding di University Multi Media Cyber Jaya. Meninjau pabrik elektronik perangkat lunak komputer Western Digital dan studi ekskursi (memban-

dingkan) pengalaman dibangku kuliah dengan pasar kerja. Nasir Mahmud didampingi Drs H Amhar Nasution MA, dosen mata kuliah emosional spiritual quotion (ESQ) Pulmed mengatakan, setiap tahun mahasiswa Pulmed melakukan studi banding ke luar negeri dan lokasinya berpindah-pindah. Kata Nasir, studi banding ke luar negeri banyak menambah wawasan, terutama sistem pemberdayaan perguruan tinggi yang berkaitan dengan bidang studi digeluti mahasiswa. “Seperti di negara maju Singapura, banyak sekali keunggulan dan manfaat bagi mahasiswayangmelakukanstudibanding, sekaligus ke objek wisata Pulau Sentosa,” kata dia.(m32)



WASPADA Minggu 28 April 2013

Meriahnya Perpisahan SMPN 1 Medan

Hang Kesturi nomor dua dari kanan tanpil dengan grup band siswa kelas IX Archimedes SMPN 1 Medan .

Waspada/M. Hidayat

Waspada/M. Hidayat

Siswa SMPN 1 Medan foto bersama dengan para guru dan orangtua saat kegiatan perpisahan siswa kelas IX sekolah itu.

Waspada/M. Hidayat

Diakhir acara siswa SMPN 1 Medan bersalam-salam dan saling bermaaf-maafan dengan teman dan para guru

Foto Kiriman Warga

Kirim Foto Anda ke:

Waspada/M. Hidayat

Siswa SMPN 1 Medan bernyanyi sambil bersukaria bersama dengan para guru dalam kegiatan perpisahan siswa sekolah itu

Waspada/M. Hidayat

Vokal group siswa kelas IX Archimedes SMPN 1 Medan yang tampil dalam kegiatan perpisahan siswa kelas IX sekolah itu, Sabtu (27/4). atau

GAYA NELAYAN Dua orang nelayan berpose seperti foto model dengan latar belakang berupa timbunan ikan hasil tangkapan mereka di laut Batubara.

Foto Kiriman: Adnan Jl. Gang Suka Maju No.54 Tanjung tiram Kab.Batubara

KEMAH Pramuka Madrasah Aliyah Negeri Binjai (Pramanbi) mengadakan perkemahan di Sibolangit baru-baru ini.

TENUN ULOS Teknik dan alat pembuatan tenunan kain ulos yang dipamerkan dalam acara Pekan Raya Sumatera Utara (PRSU) menarik perhatian pengunjung.

Foto Kiriman: Atika Arfan Fakultas Sastra Unimed

DI SIBOLANGIT Suasana istirahat siswa SMA Unggulan CT Foundation di Bumi Perkemahan Sibolangit.

Foto Kiriman: Herman Syah Lubis fotografer SMA UnggulanCTFoundation

Empat siswi MAN Kisaran bergaya didepan kamera setelah berjemur dipanas matahari untuk melakukan latihan pengibaran bendera.

OLIMPIADE MATEMATIKA Sejumlah siswa mengikuti olimpiade matematika digelar Institut Teknologi Sepuluh Nopember seIndonesia mulai dari SD sampai SMA. OLIMPIADE

Foto Kiriman: Ramajani Sinaga Mahasiswa Syiah Kuala Banda Aceh

Foto Kiriman: Reni Anggraini Sisiwi SMA Unggulan CT Foundation

Foto Kiriman: Zakiyah Rizki Sihombing Ilmu Komunikasi USU Jl.SeiPadangGgLanggarMedan



28 April 2013


Percasi Langsa Mulai Babak Baru Surip Terpilih Jadi Ketum


GANDA campuran Indonesia Tontowi Ahmad/Liliyana Natsir melaju ke final India Open Superseries 2013, setelah meraih kemenangan mudah atas Robert Mateusiak/Nadiezda Zeba (Polandia) 21-5, 21-10, Sabtu (27/4).

Ganda Campuran Harapan Gelar India Open Superseries NEW DELHI (Waspada): Pebulutangkis ganda campuran, Tontowi Ahmad/Liliyana Natsir, membuka harapan bagi Indonesia untuk meraih gelar juara di ajang India Open Superseries 2013. Hal itu menyusul keberhasilan Tontowi/Liliyana melaju ke partaipuncakseusaimengalahkan pasangan Polandia, Robert Mateusiak/Nadiezda Zeba 21-5 2110, Sabtu (27/4). Dalampertandinganyangdigelar di Siri Fort Indoor Stadium,

New Delhi, unggulan pertama itu nyaris saja tak berkeringat. Tontowi/Liliyana hanya membutuhkan 20 menit untuk menyingkirkan lawannya. Di set pertama, pasangan yang akrab disapa Owi/Butet langsung unggul jauh 16-2 sebe-

lum akhirnya telak menang 215. Statistik dari Tournament Software menunjukkan mereka melesakkan 11 smes berbanding 0 milik Mateusiak/Zeba. Pada set kedua, beberapa kali smes Tontowi/Liliyana kembali meneror lawan. Mereka akhirnya menang 21-10, di mana 12 angka di antaranya diraih dari pukulan smes. Di partai puncak, juara All England 2013 ini akan menghadapi pemenang antara Chris Ad-

Safety Riding MHD Medan MEDAN(Waspada):Kegiatan Safety Riding yang digelar Mabua Harley Davidson (MHD) Medan di Lapangan Benteng Medan, Sabtu(27/4),dengantajuk‘Mabua Harley Davidson Medan Safety Riding & Sunday Destination to the Hill” diharapkan bisa menjadi pelopor untuk tertib berlalulintas, khususnya bagi pengendara sepeda motor di Sumatera Utara. “Kita tahu sendiri para pengendarasepedamotordidaerah ini masih banyak yang melanggar aturan. Makanya kita berharap agar event yang digelar temanteman dari MHD Medan ini menjadipeloporbekendaratertib lalu lintas,” ujar Kapolda Sumut, Irjen Pol Wisjnu Amat Sastro. Wisnju menjelaskan, acara MHDMedaninimemilikibanyak manfaat. Pertama, banyak masyarakathobimengendaraimotor besar, tetapi tidak disertai teknik berkendara yang baik. Akibatnya, mereka ugal-ugalan di jalan raya dan merugikan orang lain. “Nah, dengan adanya acara seperti ini, mereka bisa mempelajari cara

berkendara yang baik di jalan raya,” ungkapnya. Bukan hanya pemilik motor besar, masyarakat Kota Medan dikatakan juga belum semuanya memahami teknik berkendara yangbaik.Sikapasal-asalanmembuat jalan raya menjadi macet. “Para pengendara sepada motor di Sumatera Utara, khususnya Kota Medan sulit diatur. Para pengendara seenaknya memakaikendaraan,tanpamemakai perlengkapan seperti helm dan sebagainya,” paparnya. Karena itu, melalui acara MHD Safety Riding ini, para pengendara bisa memahami pentingnya berkendara dengan benar.“Kita tidak pernah melarang masyarakat menggunakan sepeda motor, tapi harus dengan baik danbenar.Sebab,gunanyabukan kepada polisi, tapi kepada pengendara itu sendiri. Kalau kecelakaantanpahelm,akibatnyabisa fatal,” ungkapnya. Ketua Pengprov Harley Davidson Club Indonesia (HDCI) Sumut, Ijeck, mengatakan MHD

Medan Safety Riding ini diikuti para rider Harley Davidson di Medan, sebagai program rutin dari HDCI Sumut. “Kita menggelar secara rutin dua kali dalam setahun,” katanya. Ijeck menjelaskan, acara ini bertujuan memberi semacam coaching clinic bagi para pengendara motor Harley Davidson. Dikatakan,selamainibanyakpara pengendaradiKotaMedanbelum mengetahuicaraberkendarayang baik,terutamauntukmotorbesar. Mereka hanya sekadar berkendara.“Banyaktemanasalbekendara saja, karena belum tahu tekniknya,” ucap Ketua Pengprov IMI Sumut itu. Kegiatantersebuttidakhanya diikuti para penggemar sepeda motor Harley Davidson, tetapi juga pihak kepolisian dan Dinas Perhubungan. “Pihak kepolisian dan petugas Dishub juga kita undang untuk mengakuti acara ini, sehingga mereka bisa berkendara dengan baik ketika menjalankan tugas di lapangan,” harap Ijeck. (m47)

dock/Gabrielle White (Inggris) dan Kim Ki Jung/Kim Sa Rang (Korsel). Hingga berita ini diturunkan, masih ada dua wakil Merah Putih yang bertanding di babak semifinal. Mereka adalah Aprilia Yuswandari yang berhadapan dengan tunggal putri Juliane Schenk (Jerman) dan Angga Pratama/ Ryan Agung Saputra yang bakal ditantang ganda putra China Liu Xiaolong/Qiu Zihan. (m42/oz)

LANGSA (Waspada): Olahraga catur di Kota Langsa akan memulai babak baru setelah digelarnya Musyawarah Kota (Muskot)PercasiLangsadiWisma Ramelee, Langsa, Sabtu lalu. Muskot yang pertama kali dilaksanakan sepanjang sejarah keberadaanolahragainidiLangsa, berhasil memilih ketua umum baru, yakni Surip Hs, setelah melalui proses voting yang cukup ketat. Surip yang sekaligus ditunjuk sebagaiketuatimformaturdibantu dua anggotanya, Herdian dan Helmi, diberi waktu dua minggu oleh peserta Muskot untuk menyusun personalia Pengkot PercasiLangsamasabakti2013-2017. MuskotPercasiLangsadiikuti sembilan klub yang berhak berbicara dan memiliki hak suara ini berlangsung alot dan sedikit tegang, tetapi tetap dalam suasana demokratis dan penuh kekeluargaan. Nara sumber dari Pengprov Percasi Aceh, Muhammad Hamzah, menyatakan Muskot harus sesuai AD/ART Percasi. “Jika ada yangingindirubah,harusdibahas di Munas Percasi, tidak bisa di Muskot ini,” katanya. Dalam Muskot tersebut muncul dua nama yang akan memperebutkan kursi ketua

Putih melangkah, mematikan lawannya enam langkah. Jawaban di halaman A2.

Waspada/Rudi Arman

AUDIENSI: Pengurus KONI Kecamatan Medan Johor, Kota Medan, beraudiensi ke Polsek Deli Tua diterima Kapolsek Kompol Bakhtiar Marpaung di ruang kerjanya, Jumat (26/ 4). Dalam audiensi tersebut, Pengurus KONI Medan Johor menyampaikan beberapa program kerja ke depan dan mendapat dukungan Polsek Deli Tua yang menyatakan siap bersinergi.

MEDAN (Waspada): Rapat Kerja Daerah Ikatan Pencak Silat Seluruh Indonesia (Rakerda PengprovIPSI)Sumut2013diAula KONI Sumut, JlWillem Iskandar, Sabtu(27/4),mengevaluasipelaksanaan program kerja tahun 2012 dan membahas program tahun ini. Program kerja tahun 2013 yang dibahas di antaranya melaksanakan pelatihan wasit dan juri

Lisnobel Tembus Semifinal Kejurnas Muaythai BANDA ACEH (Waspada): Atlet muaythai Aceh, Lisnobel, melaju ke babak semifinal Kejuaraan Nasional (Kejurnas) Senior dan Junior I tahun 2013 yang berlangsung 26-29 April di Denpasar, Bali. Lisnobelyangturundikelas54KgSeniorAmatir,melajukesemifinal setelah di babak pertama, Sabtu (27/4), secara meyakinkan menundukkan Ari Wisnu (Jatim) dengan skor telak 5-0. “Kemenangan ini sangat membanggakan bagi Aceh yang merupakan Pengprov Muaythai termuda di Indonesia,” lapor Ketua Umum Pengurus Provinsi Muaythai Indonesia (Pengprov MI) Aceh, Edy Achyar (foto), kepada Waspada, Sabtu (27/4) Saat ini, kata dia, Lisnobel masih menunggu siapa lawan di semifinal. “Kita berharap Lisnobel bisa meraih gelar juara di Kejurnas ini, sekaligus membuktikan muaythai Aceh sudah bisa berbicara di tingkat nasional,” tutur Edy. Menurut dia, Kejurnas ini merupakan keikutsertaan yang pertama bagi Aceh. Pasalnya, olahraga asal Thailand ini masih baru di Aceh dan Pengprov-nya pun belum dilantik. “Kita juga akan mempersiapkan pelantikan agar bisa segera membentuk pengurus kabupaten/kota,” ujarnya. Sekum Pengprov MI Aceh, Agussani, menyampaikan pelatih muaythai Aceh, Irwantoni, yang mengikuti pelatihan di Bali pada 24-25 April lalu, juga terpilih menjadi salah seorang wasit terbaik dan dipercaya memimpin pertandingan di Kejurnas. “Sebagai Pengprov yang baru terbentuk, keberhasilan ganda ini menjadi sebuah kebanggaan tersendiri bagi muaythai Aceh. Mudah-mudahan ke depan bisa lebih baik lagi,” kata Agussani. Dalam Kejurnas tersebut, Lisnobel didampingi Wakil Ketua Binpres dan Kepelatihan Pengprov MI Aceh, Syarwan Saleh, selaku manajer dan pelatih Irwantoni. Seperti diketahui, cabang olahraga asal Negeri Gajah Putih ini sudah diterima menjadi anggota KONI Pusat pada Rakernas beberapa waktu lalu, sehingga secara otomatis menjadi anggota KONI provinsi di seluruh Indonesia. (b04)

PEUSANGAN (Waspada): Regu Perkasa Banda Aceh berhasil menjinakkan tim Beruang VC Aceh Utara dalam pertandingan hari kedua Turnamen Bola Voli HUT Pasifik Darul Aman di Lapangan Darul Aman Peusangan Selatan, Sabtu (27/4). Laga yang dipimpin wasit Asri SPd itu berlangsung seru. Perkasa Banda Aceh menurunkan pemain-pemain andalannya seperti Aris Munandar dan Majid meraih kemenangan susah payah 26-24 di set pertama. Set kedua, Perkasa relatif lebih mudah memenangkan laga dengan keunggulan 25-21. Namun Perkasa harus menunda kemenangannya, karena Beruang VC berhasil bangkit untuk unggul 25-17 di set ketiga. Perkasa akhirnya memenangkan laga setelah mengakhiri set keempat dengan keunggulan mencolok 25-19. Minggu (28/4) ini, Tunas Muda Aceh Besar akan menghadapi PBVSI Aceh Timur. Pertandingan sehari sebelumnnya, regu AVC Arun mengatasi ACDCPidie3-0.DalampertandinganyangdipimpinwasitMaimun dan Munawar itu, AVS Arun diperkuat pemain andalannya seperti Darmawan, Pon, Codel, dan Bobo menang mudah di set pertama 25-12. Memasuki set kedua, ACDC Pidie yang diperkuatTaufik dan Mursal cs berjuang keras untuk menebus kekalahan di set pertama. Namun usaha itu belum berhasil, di mana Arun kembali tampil perkasa memimpin 25-13 dan mengakhiri set ketiga 25-21. (b12)

TKIT Azkya Peduli Olahraga Tradisional BIREUEN(Waspada):Taman Kanak-kanak Islam Terpadu (TKIT) Azkiya Bireuen menggelar perlombaan olahraga tradisonil Indonesia antar-murid TK se Kecamatan Kota Juang, Kabupaten Bireuen,diLapanganTKITAzkiya, Sabtu (27/4). Kegiatan yang dibuka resmi Kabid Keagamaan dan Pendidikan non Formal Dinas P dan K Bireuen, Sayuti Adam SH, turut dihadiriKasiPAUD,PengawasTK, dan Pengurus Ikatan Guru TK

Indonesia, Drs Din Zalali. Sayuti Adam mengucapkan terima kasih kepada TKIT Azkiya yang peduli terhadap perkembangan olahraga tradisional. Dia menilai kegiatan itu sangat positif dalam mendukung melestarikan olahraga tradisional bagi negerasi bangsa. Kepala TKIT Azkiya Biruen, Sari Dewi SE Ak, mengatakan digelarnya perlombaan olahraga tradisioniltersebutsebagaibentuk kepedulian pihaknya dalam

Percasi Langsa untuk masa lima tahun ke depan. Ketua Umum Pengprov Percasi Aceh, Aldin NL, dalam arahannya mengharapkan Muskot bisa menyusun pengurus yang solid, kompak, dan penuh kekeluargan, sehingga pembinaan catur bisa berjalan baik dan menghasilkan prestasi maksimal. “Terlebih untuk menghadapi Pra Pora pada 5 -11 September 2013 dan Pora 2014, pengurus

baru nantinya harus mampu bekerja mempersiapkan atlet dan kegiatan program pembinaan,” tegasnya. Wali Kota Langsa,Tgk Usman Abdullah, dalam sambutan tertulisnya dibacakan Kadisbudparpora, Karnaini SPd, mengatakan regenerasi atlet catur Langsa harus dilakukan pembinaan yang terencana dan terukur, sehingga menghasilkan prestasi maksimal. (b04)


PARA peserta Musyawarah Kota Percasi Langsa diabadikan bersama di Wisma Ramelee, Langsa, baru-baru ini.

Rakerda IPSI Sumut 2013 Bahas Pelatihan, Kejurda

Perkasa Jinakkan Beruang VC

Problem Catur

umum, yaitu Nurdin dan Surip. Karenaitu,untukpenentuansiapa yang berhak menjadi ketua umu harus dilakukan melalui proses voting. Setelah dilakukan voting, Surip berhasil meraup enam dari sembilan suara yang diperebutkan, sedangkan Nurdin hanya mendapat tiga suara. Surip yang juga mantan Ketua Harian Percasi Langsa masa bakti 2009 -2013 ini pun terpilih sebagai Ketum

mempopulerkan kembali permainan rakyat bagi murid-murid TK yang selama ini kurang mengenalnya. HumasTKIT Azkiya, Fauziah, menyebutkan event tersebut diikuti 132 peserta yang berasal dari 10 TK se Kecamatan Kota Juang. Sedangkan cabang olahraga tradisional yang dipertandingkan adalahtariktambang,ulartangga, balap tempurung, balap karung, gasing, engklek, kelereng, dan lompat tali. (b12)

yang dijadwalkan pada Juni dan KejuaraanDaerah(Kejurda)pada Oktober mendatang. Di samping itu, Pengprov IPSI Sumut pimpinanHjDahlianaturutmembahas pelaksanaan tuan rumah Pekan OlahragaWilayahSumateraUtara (Porwilsu). Untuk itu, IPSI Sumut menetapkan empat wilayah. Untuk wilayah I antara Kota Medan dan Langkat. Sedangkan wilayah II dipercayakan kepadaTebingtinggi.Wilayah IV digelar di Nias dan Mandailing Natal. Seusai Rakerda, Hj Dahliana, mengatakan penataran wasit dan juri nantinya sekaligus menyosialisasikanperaturan-peraturanbaru sesuaihasilMusyawarahNasional (Munas) PB IPSI tahun 2012.“Ada beberapaperaturanbaruyangharus

diketahui,sehingganantinyapara pelatih dan atlet dapat menerapkannya,” kata Dahliana. Mantan juara dunia pencak silat ini mengakui tanpa adanya koordinasi dan sinergi antara IPSI Sumut dan pihak terkait, program-program IPSI Sumut akan sulit berjalan. Untuk itulah IPSI Sumut akan melayangkan surat ke Dispora, Dinas Pendidikan, dan Departemen Agama untuk berkoordinasi dalam membua suatu kejuaraan tingkat provinsi maupun kabupaten/kota. Dahliana mengingatkan Pengkab dan Pengkot IPSI se Sumut untuk berkoordinasi dengan IPSI Sumut dalam mengikuti suatu kegiatan di tingkat provinsi. “Kita juga meminta jadwal kegiatandimasing-masingwilayahagar

disusun dan dirumuskan,” tambahnya. Pada kesempatan itu, IPSI Sumut juga menyosialisasikan program kerja melalui koordinatorwilayahsampaiempatwilayah. “Koordinator Wilayah nantinya diharapkan dapat membantu program kerja Pengprov IPSI Sumut. Segala pembiayaan pelaksanaan kegiatan Korwil ditanggung oleh Pengprov IPSI Sumut,” tambahnya. Rakerda selama satu hari ini dihadiri 17 Pegkab/Pengkot IPSI di antaranya Sibolga,Tanah Karo, Madina, Tanjungbalai, Simalungun,Tapteng,Tebingtinggi,Dairi, Samosir, Deliserdang, Binjai, Pakpak Barat, Pematangsiantar, Paluta, Batubara, Nias, dan Labura. (m18)

Waspada/Setia Budi Siregar KETUA Umum IPSI Sumut, Hj Dahliana (2 kanan) memberi penjelasana kepada peserta Rakerda IPSI Sumut di Aula KONI Sumut, Jl Willem Iskandar, Sabtu (27/4).

Wali Kota Tinjau Stadion Langsa LANGSA(Waspada):WaliKota Langsa, Usman Abdullah, bersama Ketua DPRK M Zulfri dan unsur Muspida, Sabtu (27/4), meninjaupersiapanakhirStadion Langsasebagaitempatdigelarnya pertandingan Kompetisi Divisi Utama Liga Prima Indonesia Sportindo (LPIS) 2013. Seperti diketahui, Stadion Langsa merupakan home base PSBL. Musim kompetisi 2013 ini, PSBL akan menyelenggarakan sembilan laga kandang, masingmasing menjamu PSMS (28/4), Persitara(12/5),LampungFC(15/ 5), Persipon (6/6), PSSB (19/6), Persikab (3/7), PSIS (6/7), Persika (25/8), dan Persipasi (28/8). Usman Abdullah yang juga

Ketua Dewan Pembina PSBL mengharapkanpenyelenggaraan KompetisiDivisiUtamaLPIS2013 di Langsa berjalan baik dan sukses. Dalam peninjauan tersebut, Usman pun langsung melihat lebih dekat keadaan lapangan. Wali Kota memberikan apresiasi kepada Panitia Pelaksana Pertandingan PSBL yang telah bersungguh-sungguh melaksanakan persiapan. Dia berharap PSBL nantinya meraih sukses ganda, yakni sukses sebagai tuan rumah dan sukses meraih kemenangan di kandang. Minggu (28/4) ini, PSBL akan menjamu PSMS Medan. Bagi PSBL, laga petang nanti merupakan partai kedua di musim ini,

Waspada/Syahrul Karim

WALI KOTA Langsa, Usman Abdullah (5 kiri), didampingi Kajari Langsa berbincang dengan Abuyan (Pengurus PSBL) disaksikan Wakil Manajer Tim Ayah Din dan Sekum Hasan Basri saat meninjau Stadion Langsa, Sabtu (27/4).

setelah sebelumnya melakoni laga tandang di Stadion Cot Gapu menghadapi PSSB. Dalam laga itu,PSBLmenelankekalahantipis 1-0. (b21)

Apresiasi Senam Sehat Askes Cabang Sibolga SIBOLGA (Waspada): Olahragasenamsehatmassalyangdigelar PTAskesCabangSibolgamendapat apresiasidariparapeserta.Kegiatan yang digelar setiap Jumat pagi itu dinilai sangat positif dalam mengajak masyarakat untuk menerapkan pola hidup sehat. “Kegiataniniperludiapresiasi, di mana PT Askes Sibolga tidak bosan-bosannya mengajak peserta Askes untuk menjaga pola hidup sehat,” ujar Musliani Tanjung, salah satu pesera senam kepadaWaspadaseusaiacaradiLapangan Simare-mare, Jumat (26/4). PNS staf kantor Kelurahan Pancuran Bambu ini mengaku tidakpernahabsendalammengikuti kegiatan senam yang diadakan PT Askes Cabang Sibolga itu. Selain untuk menjaga kebugaran tubuh, juga sebagai ajang mempererat tali silaturahim.(a24)


A8 Bale Bertahan Jika Spurs Ke Liga Champions LONDON (Waspada): Gareth Bale belum akan ke mana-mana. Setidaknya jika Tottenam Hotspur mendapatkan kepastian bermain di Liga Champions musim depan. Bale yang tampil impresif musim ini pernah satu atau dua kali disebut bakal meninggalkan Spurs. Salah satu klub yang disebut tertarik dengannya adalah Real Madrid, kendati itu baru sebatas kabar. Namun, Andre Villas-Boas menjamin bahwa Bale belum akan berpindah klub. Tetapi, seperti yang sudah disebut di atas, ada syarat untuk hal itu. “Begitulah informasi yang saya dapat dari klub. Klub ini berkomitmen mempertahankan aset terbaik mereka.” “Dan satu-satunya cara melakukan itu adalah finis di empat besar setiap musim,” ujar manajer asal Portugal ini di Sky Sports. Bale sudah mencetak 18 gol di Premier League musim ini. Catatan itu membuatnya jadi pemain tersubur di klub dan pemain ketiga tersubur di daftar top skor, di bawah Robin van Persie dan Luis Suarez, meski Bale bukanlah seorang penyerang. “Gareth adalah bagian dari proyek kami dan dia sangat luar biasa musim ini.” “Saya harap, kami bisa mengembangkannya menjadi lebih baik lagi,” kata Villas-Boas. (ss/ds/m47)

Lewandowski No Comment Soal Rumor Transfer DORTMUND, Jerman ( Waspada): Striker klub Bundesliga Borussia Dortmund, Robert Lewandowski memilih untuk tidak mengomentari spekulasi soal masa depannya saat ini. Ia hanya fokus untuk membawa klubnya melaju ke final Liga Champions. Pasca aksi hebatnya saat mencetak empat gol ke gawang Real Madrid di leg pertama semifinal Liga Champions lalu, Lewandowski langsung diisukan akan hengkang dari Dortmund musim panas nanti menyusul kontraknya yang habis tahun depan. Sederet nama klub sudah mengantre tanda tangannya seperti Bayern Munich, Manchester United dan Juventus. Bahkan Bayern diberitakan sudah mencapai kata sepakat dengan penyerang internasional Polandia itu meski akhirnya dibantah. Isu ini kian menguatkan bahwa Lewandowski memang ingin mencari tantangan baru setelah tiga musim memperkuat klub asal Lembah Ruhr. Akhirnya Lewandowski pun angkat bicara menyoal isu yang tengah meliput dirinya. Lewandowski memilih tak mengomentari isu tersebut karena memang ia pun tak tahu soal masa depannya seperti apa. Baginya saat ini yang terpenting adalah bisa membawa Dortmund ke final Liga Champions. “Aku tidak akan mengomentari spekulasi seperti ini. Media banyak menulis cerita soal diriku, tapi itu adalah pekerjaan mereka. Sulit bagiku saat ini mengatakan apa yang akan terjadi ketika musim berakhir,” ungkap Lewandowski seperti dikutip Sky Sports. “Aku hanya fokus pada laga terdekat ini dan lalu leg kedua semifinal lawan Real. Kita lihat seperti apa jalan hidup akan membawaku selanjutnya,” demikian Lewandowski. (ss/ds/m47)

City Bekap West Ham MANCHESTER, Inggris ((Waspada): Manchester City berhasil meraih poin maksimal di lanjutan kompetisi Liga Premier Inggris, setelah membekap tamunya West Ham United 2-1 di Manchester, Sabtu (27/4) malam. City tampil begitu dominan dalam laga yang digelar di Stadion Etihad. Meski menguasai jalannya pertandingan, City hanya mampu mencetak masingmasing satu gol di setiap babak. Sergio Aguero membuat City memimpin 1-0 di babak pertama, sebelum pemain gelandang Yaya Toure menambah keunggulan di 10 menit terakhir. SementaraWest Ham memperkecil ketinggalan gol lewat Andy Carrol di saat-saat akhir pertandingan. Hasil ini membuat City kokoh di posisi kedua klasemen dengan total poin 71 dari 34 kali bertanding, atau selisih 13 angka dari Manchester United 84 poin dan telah memastikan titel juara. Sedangkan West Ham, tetap terpaku di urutan 10 klasemen dengan nilai 42 dari 35 kali bermain. Pelatih Roberto Mancini menurunkan dua penyerang Argentina Carlos Tevez dan Sergio Aguero di lini depan yang ditopang oleh dua gelandang lincah Samir Nasri dan David Silva. Dengan unggul materi pemain, City kerap mengurung pertahanan West Ham lewat alur serangan yang diatur oleh

Suarez Tak Mau Banding LIVERPOOL, Inggris (Was-pada): Bomber Liverpool, Luis Suarez akhirnya mengakui kesalahannya setelah menggigit bek Chelsea, Branislav Ivanovic. Dia pun tidak akan mengajukan banding kepada FA mengenai hukumannya. Gigitan itu dilakukan Suarez ketika Liverpool menjamu Chelsea pada me-nit ke-66 pada laga yang berakhir dengan skor 2-2 di Stadion Anfield, Minggu (21/4). Suarez mungkin kesal tak bisa lolos dari kawalan ketat Ivanovic, penyerang Liverpool itu menggigit lengan Ivanovic setelah gagal mendapatkan bola sepak pojok rekannya. FA yang melihat rekaman video tersebut memberikan hukuman tegas untuk Suarez. Pemain berusia 26 tahun itu dihukum FA dengan larangan bermain sebanyak sepuluh pertandingan. Menurut FA, hukuman itu masih terlalu ringan. Suarez tampak menyesal dengan perbuatannya itu, dia pun tidak mengajukan banding atas kelakuan konyonya itu. Dia menilai, sanksi yang dijatuhkan FA bisa mengubah prilaku buruknya di atas lapangan. “Saya memutuskan untuk tidak melakukan banding dan menerima larangan tampil sebanyak sepuluh pertandingan. Saya mengakui tindakan itu tidak patut diterima,” kata Suarez di aku Facebook miliknya, dikutip dari Sky Sports. Dalam kesempatan itu juga, mantan penyerang Ajax Amsterdam tersebut menyampaikan permohonan maafnya kepada Ivanovic. Suarez tampak menyesali perbuatannya. “Saya berharap semua orang mengampuni perbuatanku. Sekali lagi saya ulangi permintaan maaf yang tulus untuk Branislav (Ivanovic),” ucap Suarez menyesal. (ss/ic/m47)

Nasri dan Silva. Keduanya secara bergantian menggempur pertahanan West Ham dari sektor sayap. Sementara West Ham, memainkan duet Andy Carroll dan Ricardo Vaz Te sejak menit pertama. Untuk menyuplai bola kepada dua penyerang tersebut, Allardyce menempatkan Mohammed Diame sebagai pengatur irama permainan. West Ham tidak banyak melakukan pergerakan di babak pertama. Mereka sering dikurung City dan hanya sesekali melakukan serangan balik. Peluang didapat City pada menit ke-17. Berawal dari sepak pojok yang dilakukan Nasri. Bola diarahkan ke tengah kotak penalti, Carroll berhasil menanduk bola ke luar kotak. Tapi bola malah mengarah ke Silva, pemain asal Spanyol itu langsung menyambar bola dengan kakinya. Namun sayang sepakan mendatarnya masih melenceng di samping kanan Jaaskelainen. City kembali mendapat peluang emas di menit ke-21. Tevez berniat melakukan tendangan jarak jauh dari luar kotak penalti, tapi bola malah berbelok arah. Bola mengarah


Sergio Aguero, usai mencetak gol pertama Manchester City saat menjamu West Ham di Manchester, Sabtu (27/4) malam. City menang 2-0. kepada Aguero yang bebas di dalam kotak penalty. Dia melakukan tendangan ke arah kanan gawang, tapi bola hanya menyentuh mistar. Menit ke-25 giliran West Ham mengancam. Tendangan Diame dari luar kotak penalti

mengarah ke gawang City. Beruntung bola masih lengket di tangan Joe Hart. Aguero membawa City unggul di menit ke-29. Nasri melakukan pergerakan berbahaya di sektor sayap kanan pertahanan West Ham. Dia berhasil

merangsek ke kotak penalti dan memberi umpan silang. Aguero berhasil mencocor bola ke gawang Jaaskelainen, yang membuat City unggul 1-0 di babak I. Di babak kedua, City mampu menambah keunggulan di menit ke-83, ketika tendangan

keras yang dilepaskanYayaToure dari luar kota kembali gagal diantisipasi Jaaskelainen. Namun, memasuki menit ke-4 masa injury time, Caroll berhasil mencetak gol penghibur untuk membuat skor menjadi 2-1. (ap/m47)

M’Baye Niang Ingin Lebih Baik dari Messi

Neymar Siap Tinggalkan Santos SANTOS . Brazil (Waspada): Teka-teki masa depan bintang muda Brasil, Neymar kemungkinan akan segera terbuka pada jendela transfer musim panas pertengahan tahun ini. Neymar, kabarnya sudah menyatakan siap untuk pergi dari Santos. Selama dua musim terakhir, nama Santos kerap digadang-gadang sebagai talenta muda yang menjanjikan. Sejumlah klub Eropa, dikait-kaitkan dengan pemain yang pernah tampil dengan cukuran rambut mohawknya. Namanya muncul pertama kali saat Chelsea getol mengejarnya pada 2010. Chelsea batal mendapatkannya karena klub masih mempertahankan Neymar. Sejak itu namanya selalu dibicarakan mengisi daftar isu panas di bursa transfer. Barcelona, Real Madrid, Manchester United ada di antara tim yang kabarnya berniat membawa Neymar ke Eropa. Setelah sekian lama, isu transfer Neymar berkembang, pihak klub akhirnya membuka jalan kepada Neymar untuk melanglang buana ke Benua Biru. Wakil Presiden Santos, Odilio Rodriguez mengungkapkan Neymar kini sudah siap pindah berlaga di Eropa. Neymar kabarnya juga sudah tidak berniat memperpanjang kontraknya. Kontrak Neymar berakhir musim panas 2014. Sebenarnya, Santos ingin Neymar bertahan hingga Piala Dunia 2014, tapi Neymar rupanya ingin membuktikan diri di kompetisi yang lebih menantang. “Neymar mengungkapkan kepada kami dia tidak akan memperbarui kontraknya karena masanya di Santos akan diakhiri,” ujar Wakil Presiden Santos, Odilio Rodriguez, seperti dikutip Goal. Kemana Neymar akan berlabuh. Raksasa Spanyol, Barcelona disebut ada di deretan terdepan dalam perburuan striker berumur 20 tahun ini. (go/m47)

WASPADA Minggu 28 April 2013

MILAN, Italia (Waspada): M’Baye Niang termasuk pemain yang beruntung karena di

usianya yang baru menginjak 18 tahun, dia sudah masuk dalam pasukan utama AC Milan. Niang diproyeksikan akan menjadi penyerang hebat Rossoneri di masa yang akan datang. “Saya ingin bekerja untuk menjadiyangterbaikdidunia.Saya selalu bermimpi untuk meraih Ballon d’Or,” kata Niang, seperti dilansir Goal, Sabtu (27/4). “Saya ingin memenangkan itu. Saya ingin menjadi lebih kuat dari (Lionel) Messi. Saya bekerja sangat keras, dan saya tahu bahwa suatu hari saya akan mencapai impian saya,” tambahnya. Pemain kelahiran 19 Desember 1994 ini mengaku merasa terhormat direkrut AC Milan dan ingin membalas kebaikan Milan dengan mengembangkan

talenta sehingga bisa berkontribusi lebih baik. “Milan adalah tim besar yang telah memenangkan banyak gelar. Untuk pemain muda seperti saya, itu adalah suatu kehormatan untuk menjadi bagian dari klub ini. Sekarang saya hanya ingin membayar kepercayaan orang telah ditunjukkan pada saya,” paparnya. Pemain bernama lengkap M’baye Babacar Niang ini didatangkan Milan dari klub Perancis, Caen, pada Agustus 2012, dengan kesepakatan kontrak berdurasi lima musim. Sepanjang musim 20122013, Niang tampil sebanyak 16 kali di Serie-A dan dua kali di Liga Champions, tetapi belum mencetak gol maupun assist. (go/m47)

Carrick Lebih Pantas Raih PFA Player Of The Year LONDON ( Waspada): Musim ini striker Manchester United Robin van Persie dan Gareth Bale dari Tottenham Hotspurs jadi kandidat terkuat peraih PFA Player of The Year. Namun, pelatih Arsenal, Arsene Wenger menilai, Michael Carrick lebih pantas ketimbang kedua pemain itu. Karena Luis Suarez tengah terlibat masalah akibat insiden gigitan pada Branislav Ivanovic

yang berbuah skors 10 laga, dia pun sepertinya tak akan terpilih untuk jadi yang terbaik tahun ini, yang membuat Van Persie dan Bale lah yang kini di urutan terdepan. Van Persie dengan 24 golnya musim ini adalah salah satu sebab mengapa Manchester United bisa jadi juara. Sementara Bale tak usah ditanya lagi bagaimana kontribusi winger asal Wales itu.

Bagi Wenger, Carrick lah yang pantas menjadi pemain terbaik Liga Inggris musim ini. Carrick sendiri memang termasuk satu dari lima nama kandidat nominator. Wenger menilai peran Carrick begitu luar biasa bagi MU musim ini dan memang gelandang 31 tahun itu kerap dianggap sebagai “underrated player” di kubu ‘Setan Merah’. (ds/sn/ m47)

Pedrosa Berang Karena Diremehkan AUSTIN, AS (Waspada): Pebalap Repsol Honda Dani Pedrosa amat berang kepada Kevin Schwantz. Pedrosa menyebut kritikan Schwantz yang amat meremehkan dirinya sudah keterlaluan. Seperti diketahui, Schwantz menyebut bahwa Pedrosa takkan pernah bisa menjadi juara dunia. Delapan tahun tanpa gelar di Repsol Honda sudah mengatakan segalanya. “Saya kecewa dengan komentar tersebut. Padahal, dia menganggap saya sebagai pria baik-baik. Saya selalu berkata ‘halo’ kepada Kevin,” kata Pedrosa seperti dikutip Motorcycle News. Diremehkan seperti itu membuat pebalap 27 tahun asal Negeri Matador ini jelas kecewa. Pedrosa pun kehilangan rasa respeknya kepada juara dunia 1993 asal Amerika Serikat tersebut.

“Bagi saya, dia merupakan salah satu pembalap terhebat sejak saya mulai menonton balap motor. Dia mengenal olahraga iniluardandalam.Diajugapernah menang serta kalah. Tapi kali ini dia sudah melewati batas,” tutur Pedrosa. Di bagian lain komentarnya, Pedrosa mengaku meski dirinya belum jadi juara dunia tapi raihan tiga besar sebanyak enam kali, kemenangan di 22 seri dan 72 kali podium tak bisa dinafikan begitu saja. “Lihatlah statistik karier saya dulu, baru kita bisa ngobrol. Saya mungkin belum pernah menyabet gelar juara dunia. Tapi saya sudah mencetak rekor-rekor lain di olahraga ini yang orang lain belum mampu raih,” kata Pedrosa. “Jumlah kemenangan saya juga hampir menyamai perole-

hannya (Selama sembilan tahun kariernya, Schwantz menang 25 kali). Jangan lupa (kemenangankemenangan itu) diraih dengan Valentino (Rossi) dan lain-lain ada ditrekmelawansaya,”cetuspembalap 27 tahun asal Spanyol ini. Pedrosa dikontrak Repsol Hondapada2006setelahmenjadi juara dunia 250 cc pada 2004 serta 2005 dan juara dunia 125 cc pada 2003. Selama delapan tahun di pabrikan raksasa tersebut, Pedrosa menorehkan tiga kali runner-up, 22 kali kemenangan, 72 kali podium, 24 kali pole position, 35 kali fastest lap dan 1.769 poin. Tanpa titel MotoGP, otomatis Pedrosa akan selalu berada di bawah bayang-bayang Nicky Hayden, Casey Stoner,Valentino Rossi hingga Jorge Lorenzo yang pernah jadi juara dunia. (mn/oz/ m47)


Dani Pedrosa



Aksi pemain Los Angeles Lakers (kiri) dan San Antonio Spurs saat klub mereka berlaga di game ketiga play off NBA di Los Angeles, Sabtu (27/4). Spurs menang 120 – 89.

Spurs Hanya Butuh Satu Kemenangan Lagi LOS ANGELES, AS (Waspada): Los Angeles Lakers terancam tersingkir dini di babak playoff setelah kembali kalah dari San Antonio Spurs 89-120. Hasil itu membuat Spurs kini memimpin 3-0. Spurs hanya butuh satu kemenangan lagi dalam sistem best-of-seven untuk lolos ke semifinal Wilayah Barat. Laga keempat akan digelar di Los Angeles Senin (29/4). Meski bertanding di Staples Center, Los Angeles, Sabtu (27/ 4), Lakers justru jadi bulan-bulanan Spurs. Absennya empat point guard andalan mereka,

Kobe Bryant, Steve Nash, Steve Blake dan Jodie Meeks yang semuanya sedang cedera benarbenar membuat tuan rumah menderita. Di kuarter pertama saja, Lakers yang mengandalkan Pau Gasol, Metta World Peace, Dwight Howard, Andrew Guedolock dan Darius Morris sudah jauh tertinggal 18-30. Lakers akhirnya kalah 89-120 dan ini merupakan kekalahan di kandang sendiri paling telak sepanjang sejarah klub pada babak playoff. Di usianya yang 37 tahun, Tim Duncan masih sanggup

melesakkan 26 angka plus 9 rebound. Point guard All-Star Tony Parker menambah 20 angka dan 7 assist bagi Spurs. Dari kubu Lakers, tripledouble yang dicetak Pau Gasol dan double-double yang dicatat Dwight Howard belum cukup menghindarkan Lakers dari kekalahan. Gasol mencetak 11 poin, 13 rebound dan 10 assist, sementara Howard mengemas 25 angka dan 11 rebound. Hasil pertandingan lain: Denver Nuggets - Golden State Warriors 108 - 110 (Warriors unggul 2-1) (ap/m47)

Inter Masih Optimistis Finish 3 Besar MILAN, Italia (Waspada): Kompetisi Serie A Liga Italia, musim ini tinggal menyisakan lima pekan lagi, dengan menempatkan Inter Milan masih berada di peringkat kelima klasemen. Begitupun, fakta yang ada tak menyurutkan optimisme Nerazzurri untuk bisa finish tiga besar dan lolos ke Liga Champions. Inter punya 53 poin dari 33 laganya, selisih enam angka dari AC Milan di posisi ketiga. Peluang untuk bisa menyalip rival sekotanya itu memang masih ter-

buka, namun dengan kondisi skuat saat ini terbilang berat. Hantaman badai cedera tak hentinya mendatangi Inter dan terakhir Walter Samuel harus kembali masuk ruang perawatan karena masalah pada otot tendonnya di sesi latihan. Di sisa laga Inter masih ha-rus menghadapiPalermoMing-gu(28/ 4), Napoli (tandang), La-zio (kandang), Genoa (tandang) dan Udinese(kandang).CumaPalermo danGenoayangterhi-tungringan, sementara tiga si-sanya adalah penghuni papan atas.

Hal ini yang bikin peluang Inter lolos ke Liga Champions diragukan tapi bek La Beneamata, Juan Jesus, yakin timnya bisa finis di posisi tiga besar. “Ini adalah musim yang sulit. Kami sudah kalah beberapa kali, tapi kami masih ada di sini (papan atas),” ujar Juan di Football Italia. “Kami percaya bahwa kami bisa finis di posisi ketiga. Kami akan melakukan apapun untuk bisa capai ke sana dan kami harus tampil baik di sisa laga ini,” sambungnya. (fi/ds/m47)


WASPADA Minggu 28 April 2013

Lebih Trendy B erbusana Casual


BUSANA Casual yang tidak mengandalkan warna cerah, menjadi pilihan kaum muda untuk bergaya. Tampil dengan make up sederhana tetapi lebih nyentrik karena memadukan beragam assesoris memberikan nuansa sendiri bagi pengguna busana ini. Berbahan chiffon dan perpaduan tille menjadi unsur yang membuat busana ini nyaman dikenakan. Ada juga kombinasi jeans dan lejing berwarna gelap serta menggunakan stocking. Adalah siswa SMKN 10 Medan yang memeragakan busana casual ini, dalam event Pameran dan Bazar berlangsung Sabtu kemarin. Acara bertemakan Karyaku, prestasiku, cintailah produk sendiri. Koleksi busana yang dirancang oleh siswa di program keahlian Busana ini mendapat dukungan penuh dari Kepala Sekolah Dra Dahlia Purba. “ Event ini berlangsung setiap tahun. Kreasi siswa bisa diandalkan dan sudah mendapatkan pangsa pasar,� kata Dahlia. Acara dihadiri juga oleh Kepala Dinas Pendidikan Kota Medan, diwakili Drs Zulhanif. Naskah dan foto : Anum Saskia

Souvenir Unik Jadi Incaran SAAT pergi berlibur biasanya orang identik membeli beragam pernakpernik khas daerah ataupun negara yang mereka kunjungi. Selain sebagai kenang-kenangan untuk pribadi, souvenir yang dibeli juga diberikan kepada orang terdekat seperti keluarga, sahabat, kekasih, maupun rekan kerja. Namun ada yang harus diperhatikan didalam membeli souvenir yaitu seberapa uniknya souvenir tersebut sehingga dapat menjadi sebagai buah tangan kepada orang-orang terdekat dengan kita.

10 Scarf Hermes Bikin Wanita Makin Cantik

EKSOTISME HUTAN TROPIS Selendang yang dihiasi dengan keindahan satwa dari hutan tropis mengantarkan sang model yang berumur 20 tahun ini bak putri Amazon lengkap dengan sandal bertalinya.


Salah satu model Victoria’s Secret, Karlie Kloss bergerak dinamis untuk pemotretan koleksi selendang terbaru dari rumah mode Hermes. Tubuh indahnya kali ini hanya dibalut dalam selendang artistik nan optimis. Sepertiapahasilbidikanfotografer David Sims ini? Simak fotofotonya.

MISTERIUS GEOMETRIS Alis matanya menikung tajam seakan menyimpan sejuta rahasia untuk segera diceritakan dalam balutan motif sketsa geometrisnya.

Khas daerah tentunya berbeda dengan daerah lainnya, namun tentunya khas ini dapat dibawa dengan mudah tidak sulit dan modif yang indah dipandang menjadi fashion sehingga dapat dikenakan bagi penerima souvenir tersebut. Seperti halnya gelang, cincin, bando, bros, gantungan kunci, tali pinggang, kaos, dan lainnya. Nah namun yang paling penting adalah seberapa uniknya souvenir yang dijadikan buah tangan tersebut. (H)

SEKSI KONTEMPORER Sebagai model yang sudah mempunyai jam terbang tinggi, menjaga ukuran tubuh adalah hal yang sangat penting. hal ini terlihat dari ukuran kakinya yang tetap jenjang dan indah. Sehingga aura kontemporer dapat dengan mudah membaur dalam selendang yang dibawakannya.


Gerakan-gerakan dinamis yang dihasilkannya berpadu pas dengan motif print monokrom yang segar dalam sentuhan corak bunga.

SEMANGAT WARNAWARNI Seiring dengan semangat yang dibawakan pada motif selendangnya, karier modelnya yang berawal dari pemotretannya untuk majalah Scene tahun 2006.

Penata gaya Beat Bolliger sukses menampilkan kecantikan sang model dari berbagai angle, salah satunya angle samping ini.

SILUET SEDUKTIF Dengan siluet yang menggambarkan tubuhnya secara samar, ekspresi dengan smokey eyesnya memberikan aura seduktif.



B7 A2 B2

Mardiana Siregar

Gigih Kelola Usaha Agar Bisa Membangun Sekolah MEMASUKI bulan pendidikan nasional 2 Mei mendatang, Mardiana Siregar pengelola usaha biro jasa perjalanan wisata dan umroh, yang juga mengelola lembaga Bimbingan Belajar Quantum di Jalan Garu VI, Medan mengaku terpacu semangat dan tekadnya untuk membangun sekolah. “Ya, sekolah sebagai tempat menuntut ilmu dan tempat menyenangkan bagi anak, karena ada sarana belajar dan bermain yang layak serta guru-guru sebagai orang tua kedua mereka. Alangkah baha-

gianya,” kata perempuan akrab disapa Ana yang pernah mengecap pendidikan tinggi di Jakarta. Menurutnya, sekolah dengan berbagai fasilitas dan biaya murah akan memberi kesempatan pada anak dari berbagai kalangan. “Itu mimpi dan angan-angan saya sejak kecil,” sebutnya. Untuk itu, kata Ana, diperlukan dana yang tidak sedikit. Karenanya dia berusaha mengumpulkan dana lewat berbagai usaha yang dia rintis. “Usaha yang saya kelola selalu mengalami pasang

surut, pernah membuat usaha kuliner jamur, bahan bakunya langsung dari Bandung, tapi terhenti karena prospeknya kurang. Kemudan beralih pada biro jasa dan travel. Lewat usaha ini mudah-mudahan bisa mengumpulkan pundi-pundi rupiah agar bisa buka sekolah,” katanya penuh semangat. Dia mengakui dalam menjalankan bisnis banyak sekali kendala, terutama modal yang harus disiapkan. Tetapi dana saja belum cukup tanpa mengetahui prospek pasar dan peluang yang dicapai dari produk yang akan dibisniskan. “Saya beralih ke biro perjalanan karena yakin pertumbuhan ekonomi masyarakat Sumut semakin membaik, karenanya berwisata lokal maupun internasional dan religi seperti umroh akan menjadi trend di masyarakat. Peluang inilah yang saya tangkap, meskipun masih kerjasama dengan biro perjalanan lainnya,” ujarnya menambahkan, dalam merintis dan menjalankan usaha sangat perlu jejaring sosial lewat berbagai cara. Apakah akun facebook, twitter, BBM dan sebagainya yang memudahkan kita dikenal orang lain. Dia menambahkan, pasang surut keuntungan dalam berusaha hal biasa, tapi yang paling penting bagaimana kita mempunyai tekad kuat agar usaha yang dirintis bisa memberikan keuntungan. Kini, Ana yang mempunyai kiat dalam berusaha harus gigih dan selalu berdoa kepada Allah SWT , semakin memupuk kemampuan kependidikannya dengan beragam cara. Salah satunya mengumpulkan bahan ajar untuk anak melalui dunia maya. Dia langsung mempraktekkan pada peserta didik di lembaga bimbingan belajar yang dia kelola. “Hasilnya maksimal, peserta didik banyak yang betah belajar dan menganggap saya bukan hanya sebagai guru tapi orang tua kedua,” sebut isteri Rizal Reza Harahap itu. Ibu dari Sabrina Silmi Harahap, Diva Farhaini dan Alfian Ziad berharap apa yang dia cita-citakan tercapai. *Anum Saskia

Batikmark, Cegah Pembajakan Batik Indonesia Berbatik ria kini sudah jadi tren di masyarakat luas. Beraneka ragam jenis dan corak batik nusantara, sangat indah dan memilikiciri khas masing-masing. Tua dan muda, pria dan wanita sudah tidak canggung menggunakan batik dalam berbagai kesempatan. Tapi bagaimana kalau batik Indonesia dibajak pihak lain? Hal itu tentu sangat disayangkan dan perlu dicari jalan keluarnya. Untuk itu, sebanyak 106 pengrajin batik dari sekitar 50 ribu pengrajin di seluruh Indonesia sudah bersertifikat dan teruji sebagai batik yang berkualitas. “Sertifikat batik atau Batikmark merupakan tanda yang menunjukkan identitas atau ciri batik buatan Indonesia,” kata Kepala Balai Besar Kerajinan Dan Batik, Zulmalizar dalam Jumpa pers Gelar Batik Nusantara(GBN) bertajuk ‘Batikmark, Batik Berkualitas’ di Gedung Kementrian Perindustrian, Selasa (23/4). Ada tiga jenis penggolongan dalam batikmark. Pertama adalah katagori emas untuk batik tulis. Perak untuk batik campuran tulis dan cap, serta putih untuk batik cap. Batikmark mulai berlaku di Indonesia sejak tahun 2007 dan merupakan inisiasi dari Kamar Dagang Indonesia, Yayasan Batik Indonesia, Kementerian Pariwisata dan Kementerian Perindustrian. Dalam kesempatan yang sama, Menteri Perindustrian, M.S Hidayat mengatakan, ancaman pembajakan terhadap batik Indonesia masih sangat kental. “Karena itu, batikmark ini digalakkan sebagai langkah menghadapi kompetisi dan pembajakan. Saya berharap dengan adanya Batikmark praktek pemalsuan oleh Negara lain berkurang,” kata Hidayat. Menurut Euis Saedah, Direktur Jendral Industri Kecil dan Menengah Kementerian Perindustrian, sosialisasi Batikmark harus dilaksanakan oleh semua pihak sehingga para pengrajin mau mendafatarkan produk mereeuka. Banyak pengrajin yang merasa tidak penting disertifikasi karena sudah memiliki

banyak pelanggan. “Mindset seperti itu yang harus kita ubah,” ucap Euis. Untuk mendapatkan Batikmark, pengrajin harus mendaftarkan produknya pada Kepala Balai Besar Kerajinan dan Batik Yogyakarta kemudian akan dilakukan serangkaian tes untuk menguji kualitas batik tersebut. Tes berupa uji bahan, kelunturan, dan ketahanan warna. Ginarjiah Kartasasmita Industri Batik Dan Wanita Pameran batik GBN sendiri berlangsung hingga 26 April 2013 di Plaza Pameran Industri, Kementrian Perindustrian. Ketua Ketua pelaksana GBN, Ginarijah Kartasasmita mengatakan, sebanyak 44 pengrajin dari Jawa Barat, Jawa Tengah, D.IYogyakarta dan Papua mengikuti pameran ini. Sebagian besar usaha batik ini dilakoni perempuan. Termasuk yang mengerjakan, kebanyakan perempuan. Dengan demikian, lanjut Ginarijah, perempuan dan industri batik tidak dapat dipisahkan. Batik telah lama menghidupkan roda perekonomian di berbagai wilayah, khususnya sentra-sentra batik terkemuka di negeri ini. Dan andil kaum perempuan sangat besar di dalamnya. Tapi sayangnya, tidak semua pengusaha batik, khususnya perempuan, mendaftarkan karyanya sebagai hak cipta. “Mungkin karena ketidaktahuannya. Maka sosialisasi batikmark dalam ajang GBN ini mengemuka,”kata Ginarijah. Dia berharap ke depan akan lebih banyak pengusaha batik perempuan dari daerah yang ikut serta dalam ajang GBN. Cegah Pembajakan Berbatik ria kini sudah jadi tren di masyarakat luas. Beraneka ragam jenis dan corak batik nusantara, sangat indah dan memilikiciri khas masing-masing. Tua dan muda, pria dan wanita sudah tidak canggung menggunakan batik dalam berbagai kesempatan. Tapi bagaimana kalau batik Indonesia dibajak pihak lain? Hal itu tentu sangat disayangkan dan perlu

dicari jalan keluarnya. Untuk itu, sebanyak 106 pengrajin batik dari sekitar 50 ribu pengrajin di seluruh Indonesia sudah bersertifikat dan teruji sebagai batik yang berkualitas. “Sertifikat batik atau Batikmark merupakan tanda yang menunjukkan identitas atau ciri batik buatan Indonesia,” kata Kepala Balai Besar Kerajinan Dan Batik, Zulmalizar dalam Jumpa pers Gelar Batik Nusantara(GBN) bertajuk ‘Batikmark, Batik Berkualitas’ di Gedung Kementrian Perindustrian, Selasa lalu. Ada tiga jenis penggolongan dalam batikmark. Pertama adalah katagori emas untuk batik tulis. Perak untuk batik campuran tulis dan cap, serta putih untuk batik cap. Batikmark mulai berlaku di Indonesia sejak tahun 2007 dan merupakan inisiasi dari Kamar Dagang Indonesia, Yayasan Batik Indonesia, Kementerian Pariwisata dan Kementerian Perindustrian. Dalam kesempatan yang sama, Menteri Perindustrian, M.S Hidayat mengatakan, ancaman pembajakan terhadap batik Indonesia masih sangat kental. “Karena itu, batikmark ini digalakkan sebagai langkah menghadapi kompetisi dan pembajakan. Saya berharap dengan adanya Batikmark praktek pemalsuan oleh Negara lain berkurang,” kata Hidayat. Menurut Euis Saedah, Direktur Jendral Industri Kecil dan Menengah Kementerian Perindustrian, sosialisasi Batikmark harus dilaksanakan oleh semua pihak sehingga para pengrajin mau mendafatarkan produk mereeuka. Banyak pengrajin yang merasa tidak penting disertifikasi karena sudah memiliki banyak pelanggan. “Mindset seperti itu yang harus kita ubah,” ucap Euis. Untuk mendapatkan Batikmark, pengrajin harus mendaftarkan produknya pada Kepala Balai Besar Kerajinan dan Batik Yogyakarta kemudian akan dilakukan serangkaian tes untuk menguji kualitas batik tersebut. Tes berupa uji bahan, kelunturan, dan ketahanan warna. (dianw)

Waspada/ Dian

Minggu 28 April 2013


Pengurus Dharma Wanita PD Pasar Kota Medan berpose bersama usai kegiatan perayaan Hari Kartini di halaman kantor PD Pasar Kota Medan.

DWP PD Pasar Rayakan Hari Kartini Persatuan DharmaWanita PD Pasar Kota Medan dalam rangka memperingati Hari Kartini Tahun 2013 menggelar Lomba Busana Kebaya dan Menyanyi yang diikuti ratusan karyawan/ti dan Petugas Harian Lepas (PHL) Kebersihan PD Pasar Kota Medan. Kegiatan ini dirangkai dengan bhakti sosial dengan memberikan bingkisan kepada puluhan PHL Kebersihan Wanita PD Pasar Kota Medan, di Halaman Kantor Pasar Petisah, Jalan Razak Baru Medan, Kamis lalu. Ketua Persatuan Dharma Wanita PD Pasar Kota Medan, Ny Duma Benny H Sihotang mengatakan kegiatan ini dalam rangka memperingati Hari Kartini yang menjadi simbol gerakan bahwa wanita pun harus mampu berperan ganda serta dapat berbuat untuk melahirkan proram yang dapat menampung dan menyalurkan potensinya dalam kreativitas melestarikan seni dan budaya bangsa. Menurutnya, ini momentum sebagai mempererat persatuan dan kesatuan istri karyawan PD Pasar kota Medan dalam kebersamaannya guna memberikan semangat dan dukungan buat para suaminya agar tetap mampu bertanggungjawab untuk kemajuan PD Pasar Medan ke depan. “Sebagai kodrat seorang wanita kita jangan hanya tampil sebagai ibu rumah tangga saja namun bagaimana kita juga harus memberi motivasi semangat kerja suami dan para istri dapat pula berbuat aktif dan bersama membangun dalam persatuan

Dharma Wanita PD Pasar Kota Medan yang diharapkan dapat tetap berperan untuk PD Pasar yang maju dan sejahtera karena sama-sama kita sadari perusahaan secara bertahap sudah mampu mengangkat taraf kehidupan yang mulai layak buat kehidupan keluarga karyawan PD Pasar,” katanya. Memberi Apresiasi Sementara Ketua Tim Penggerak Dharma Wanita Pemko Medan, Ny Hj Hurhaidah Pardamean Siregar mengatakan memberi apresiasi yang tinggi buat Persatuan Dharma Wanita PD Pasar Kota Medan, yang sangat luar biasa mampu berbuat dalam menghidupkan program kerja seperti pelaksanaan acara peringatan Hari Kartini. Kemudian mampu menyatukan semua karyawati dan PHL kebersihan dalam kebersamaan dan melestarikan budaya dan seni meneruskan cita-cita pahlawan wanita Indonesia Ibu Kartini yang telah berjuang mengangkat harkat wanita jauh lebih baik dan mandiri. Direktur PD Pasar, Benny H Sihotang, SE menyampaikan kemajuan PD Pasar Koa Medan jauh lebih baik. Hal ini juga berkat dukungan Kartini-kartini yang tergabung dalam Persatuan Dharma Wanita PD Pasar Kota Medan yang terus berperan aktif mendukung melalui saran dan programnya “Mari demi kemajuan, kita sama-sama berbuat untuk PD Pasar Medan yang lebih baik,”ujarnya. *Anum

Kepala sekolah Dra Ratna (kanan) bersama para guru berdendang saat kegiatan Hari Kartini di rayakan belum lama ini

Antusiasnya Para Guru Rayakan Hari Kartini HARI KARTINI yang diperingati setiap bulan April, sebagai sarana mengenang perjuangan RA Kartini yang memperjuangkan hak-hak perempuan. Guru-guru di SDN 104186 Tj Selamat menggelar Perayaan Hari Kartini. Beragam acara dilaksanakan oleh guru dan siswa. Busana Kartini diperagakan siswi yang nampak sangat semangat. Kepala Sekolah Dra Ratna menyebutkan acara ini dimeriahkan juga dengan tampilan siswa atraksi karate kala hitam dojo. “ Tahun ini perayaan Hari Kartini lebih meriah dari tahun lalu. Kegiatan berjalan lancar, semua semangat mengikuti kegiatan. Alhamdulillah, semua unsur mendukung kegiatan, terutama para guru yang sangat semangat mengikuti kegiatan,”

kata Ratna. Dia menambahkan semangat Kartini perlu diketahui kalangan pelajar sejak usia dini, pembelajaran kemauan dan semangat menuntut ilmu RA Kartini begitu penting. Buku berjudul Habis gelap terbitlah terang, diharapkan menjadi cerminan bagi generasi muda untuk giat menuntut ilmu demi cita-cita dan masa depan mereka. “Saya melihat kemauan peserta didik untuk membaca sangat tinggi. Apalagi di sekolah ini banyak kegiatan ekstrakurikuler. Saya berharap dengan perayaan Hari Kartini semakin tumbuh minat siswa menuntut ilmu,”kata Ratna. Naskah & Foto Anum Saskia

Tips Mengajarkan Anak Cinta Lingkungan HARI Bumi 22 April lalu hendaknya menjadi pelajaran bagi semua keluarga untuk mengajarkan anak cinta pada lingkungan. Mengajak anak cinta lingkungan secara tidak langsung telah menanamkan rasa cinta dan pentingnya menghargai lingkungan hidup. Kebiasaan ramah lingkungan yang ditanamkan sejak dini diharapkan dapat menjadi gaya hidup anak di usia dewasa. Bagaimana cara mengajak dan menanamkan cinta lingkungan pada anak?. Berikut beberapa tips sederhana yang bisa dipraktekkan di rumah. 1. Matikan TV TV, game player, dan aneka peralatan elektronik membutuhkan konsumsi listrik yang besar. Ajari anak-anak untuk mematikan dan mencabut gadget elektronik setelah menggunakan peralatan tersebut untuk mengajari mereka hemat energi. Kurangi aktifitas anak pada alat-alat tersebut. Gantilah dengan memperbanyak kegiatan-kegiatan lain semisal membaca, bersepeda, membuat kerajinan, dan berbagai kegiatan di luar rumah yang membuat anak tetap aktif secara fisik dan melatih imajinasi mereka. 2. Hemat Air Mengajari anak untuk menghemat air bisa ditanamkan dengan membiasakan menutup keran air, atau menggunakan gelas ketika sedang menyikat gigi. Begitu juga saat anak mandi, batasi air yang digunakan. 3. Ajak Berkebun Mengajak anak berkebun atau memelihara taman selain menyehatkan juga menanamkan rasa cinta pada lingkungan.

Ketua penyelenggara pameran Gelar Batik Nusantara (GBN), Ginarijah Kartasasmita, saat membuka acara GBN di Kementerian Perindustrian belum lama ini.


Jika tidak memiliki ruang untuk membuat taman, coba siasati dengan membuat taman mungil di beranda atau teras sekalipun dengan pot. 4. Daur Ulang Barang Mendaur ulang sampah rumah tangga bisa dilakukan dengan mengajak serta si kecil. Selain itu menangani sampah tanpa proses penghancuran (repurposing) akan bagus lagi. Caranya, misalnya, ajari anak-anak untuk menyumbangkan barangbarang bekas seperti buku dan mainan, yang kondisinya masih baik, untuk tetangga atau kegiatan amal. 5. Rekreasi ke Alam Mengajak anak melihat obyek-obyek wisata alam akan sangat berpengaruh dalam sikap menghargai kekayaan alam dan lingkungan hidup. Jika lantaran keterbatasan waktu yang tidak memungkinkan, melakukan jalan-jalan di sekitar rumah untuk mengenalkan lingkungan yang asri maupun sebaliknya yang kotor, bisa dilakukan sesering mungkin. 6. Jadilah Panutan Bagi Anak Point terakhir ini yang sangat penting. Agar anak mempunyai sikap menghargai dan mencintai lingkungan tentunya tidak bisa dipisahkan dari sikap dan perilaku orang tuanya. Akan percuma, meskipun kita berteriak-teriak meminta anak mencintai lingkungan tetapi perilaku kita sendiri tidak. Tips mengajak anak cinta lingkungan ini bukan hanya untuk ibu dan bapak yang telah mempunyai anak.Yang belum pun bisa. Karena tips ini bisa dipraktekkan kepada adik, keponakan, atau mungkin anak mantan pacar sekalipun. (

Rubrik Konsultasi Perkawinan & Hukum Kewarisan Karena sesuatu hal rubrik ini berhalangan terbit, akan menemui pembaca kembali Minggu depan. -Redaksi-


WASPADA Minggu 28 April 2013


Aku, Ayah Dan Kenangan Cerpen: Febrina R Pasaribu

ANGIN sunyi bertiup memenuhi ruang yang penuh dengan kenangan. Suara-suara ringan dalam dekapan harapan masih saja menggema bersama cahaya siang. Sudut-sudut ruang ini tidak juga memberikan isyarat jika kuputar kembali memori itu. Langit-langit rumah menjadi saksi keseharian aku dan Ayah. Ayah sesekali melirik ke arahku. Mungkin di dalam benaknya berkata bahwa putri bungsunya telah menginjak usia dewasa. Aku duduk manis di sampingnya. Menikmati acara berita bersamanya. Ayah memegangi remote tv. Beliau mungkin tak memperbolehkanku mengganti channel tv. Dikiranya nanti-nanti aku akan menonton sinetron dan menjadi anak yang nakal. Oh, ayah. Sejak kecil aku tidak begitu dekat dengan ayah. Kami, pribadi yang sama pendiam. Ibu bilang suasana rumah tak ubahnya seperti kuburan. Seram. Sepi. Abang-abangku sudah tidak di rumah lagi, mereka memiliki keluarga sendiri di kota yang dirantauinya. Hanya beberapa tahun sekali kembali pulang, tentunya bersama keluarga kecil. Dahulu saat semuanya belum pergi, kami adalah keluarga yang menyukai tertawa. Abang-

ku, Dicky, senang sekali menjahili aku, adik bungsunya. Dia reseh,gokil, dan terkadang membuat aku sebal. Dulu, aku sedang tertidur di sofa lalu pelan-pelan ia mencoreti hidungku dengan pena bertinta hitam. Aku terbangun di tengah kejahilannya. Sentak aku menjerit dan meluapkan emosi, melemparkan bantal-bantal atau apa yang ada di dekatku, ke arahnya. Aku merasa kesal dan ingin menjauh darinya. Namun, saat dia duduk di pelaminan bersama istrinya, aku merasa sedih. Bahkan saat acara tepung tawar aku menunduk menahan tangis. Aku akan kehilangan sosok seorang abang. Tak akan ada lagi canda itu. Tetapi, inilah kedekatan seorang adik dengan abangnya. Ketika aku memiliki seorang kekasih, abangku turut ambil bagian seperti seorang wasit. Ia yang mengatur dan selalu memantau setiap hubunganku dengan kekasihku. Yah, walau-

Karya: Mirsan Simamora

Nyanyian Orang Pinggiran Wahai penebar janji-janji manis Jamur kini bersarang di pakaianku Dan debu kendaraan mengiris tipis Daya tahan tubuh ku. Di tubuhku bersarang kuman-kuman sipilis Meracuni udara di sekelilingku. Adakah pancaindramu menghiraukan aku? Sebab keluargaku telah diledek impian. Setiap matahari terbit Perutku selalu menjerit Mengulum perih yang menyayat-nyayat Ku telan seluruh air liur yang serasa pekat Aku hanyalah orang pinggiran Yang selalu menjamur sepanjang zaman Tumbuh menjadi rumput di jalanan Dan selalu berjalan kalangkabutan.

Dayung Hulu Nelayan Resah rintik hujan di lautan Tak berhenti menemani. Angin menari-narikan sulang Mengingatkan daratan dan atap atap jerami Perahu membelah tirai hujan Pada lautan lepas. Harapan terbentang pada jaring lautan Gelombang mempermainkan ketegaran. Asinnya air laut melebur pada alur hidup Yang tak kunjung berujung makmur Pun pada lembaran wajah hulu petang Mengukir impian si buah hati di pasir pantai.

Karya: Mega Yudia Tobing

Ketika Malam Ketika malam menjamu sunyi Wajahmu berbayang di langit-langit sepi Kemarin duka itu masih pagi Kini, wajahmu mendekap sendi Hembus napas kusudahi Di belaian angin yang mulai mati

Jalanan Kota Kita simpan gambar kota dalam dada Sesak, semak berserakan Jalan-jalan melahirkan kekesalan Debu, asap, menjilati peraba Gersang, suram tanpa wibawa Ada gumpal nanah bersarang Kita sama-sama mengambil kuas Mengecatnya putih semua Tapi tetap sama saja Seperti duka di ruang dada

Karya: Fakhrunniza AR

Pengulangan Di ucapan kita benci pengulangan Di perbuatan yang berkebalikan Malah dilakukan Kita benci melakukan kesalahan Di perbuatan malah tidak dihindarkan Orang lain dan keadaan Selalu jadi alasan Meski sampai akhir zaman Kita benci pengulangan kesalahan Itu pula yang kita singgahi lakukan

Live Map Mencari cahaya lilin Di sungai yang terpilin dingin Mencari suara yang membahana mengguncang telinga, percuma ada cahaya yang engkau hiraukan jua ada suara yang kau abaikan iba cahaya itu selalu menuju mu untuk kebenaran satu suara itu dari hatimu

pun ia sudah memiliki keluarga, ia masih peduli dengan bocah ingusan satu ini. Saat aku menunjukkan kekasihku kepadanya, ia menilai. Tak cocok, abangku mengangkat tangannya memperlihatkan selembar kartu merah untukku. Itu artinya mulai besok aku harus menyekat diri dari kekasihku. Alias putus hubungan. Kehidupan tak selamanya akan tetap. Pastilah manusia hidup dan berkembang. Mereka kecil kemudian tumbuh menjadi dewasa. Mereka menikah dan hidup bersama orang lain yang menjadi pilihan mereka. Selembar demi selembar tisu pun turut mengantar mereka ke pintu gerbang kehidupan yang baru. Ibu dan saudarasaudara mereka melantunkan tangis haru bercampur sedih. Tak terkecuali ayah mereka. Tinggallah ayah, ibu dan aku. Jika nantinya aku akan memiliki kehidupan sendiri sama seperti abang-abangku, mereka akan tinggal berdua? Tidak. Aku takut menjadi durhaka. Ayah. Ibu. Izinkan aku tetap terus memandang dan membantu menata hidup kalian hingga maut memisahkan kita. Ibu berkata bahwa ayah pernah menderita tumor di lehernya. Hingga saat ini sudah terhitung beberapa kali ayah

menjalani operasi. Ayah mengeluh dan sejak saat itu wajah ayah menjadi murung. Suasana rumah pun semakin berubah. Ayah mungkin sudah lelah dengan penyakit yang dideritanya. Hingga suatu hari ayah memilih untuk tidak operasi dan menggunakan obat tradisional. Entah mengapa tumor ayah semakin membesar dan berisikan cairan. Oh, Tuhanku. Ada apa ini sebenarnya? Dokter bilang ayah tengah mengidap

penyakit tumor ganas. Cairan itu hampir memenuhi paruparunya. Itulah sebab ayah tak dapat bernafas dengan baik. Ya, Allah. Aku melihat ke arah ayahku. Aku renungkan wajah serta kisah hidupnya di benakku. Semenjak penyakit ayah kembali, aku tidak pernah melihat raut wajah bahagianya seperti dahulu. Dahulu aku sering melihat bibirnya menyudut menarik kumis di sekitar bibirnya ketika

ayah tertawa. Lesung pipinya juga turut ambil bagian dalam perwujudan kebahagiaannya. Alamak, hatiku hanyut. Dan saat itulah aku merasakan bahwa ayahku adalah cinta pertamaku. Ayah sudah menjalani beberapa pengobatan alternatif. Namun, angin segar tak bertiup ke arahnya. Hingga suatu hari ayah terbaring lemah di rumah sakit. Salah satu abangku pulang dari rantauannya. Sedangkan abangku yang satunya kerja


Karya: Ilham SP

Sorotan Mata Itu Petir begilang hendak memecah ruang Sayatan waktu melintas begitu rentang Adakah gerangan yang hendak memekik bintang..? Bukan angin ataupun elang Nyawa wanita tua hendak segera hilang Awan terseduh menari-nari Kala rembulan menjadi saksi Terlahirlah bocah kecil tiada berarti Menangis terisak sepi Mencari dada dari pelukan sang peri

Kini Dan Dulu Aku yang dulu belajar darimu Aku yang dulu mendambakanmu Aku tak harap sedetik tuk kembali mengulang waktu Mempelajari kembali isyarat hati yang kau taburkan Aku yang kini sudah tahan tanpamu. Aku sudah mulai tumbuh. Sudah mulai berbunga. Mekar. Aku yang tau bagaimana semua berarti bermakna Aku yang dulu mencintaimu. Aku yang dulu menyayangimu Selamat tinggal.

Tanya Diri

Karya: Yundari

Pancaran Pelangi Kuberjalan setapak demi setapak Di kala pagi gerimis datang Datang menemani sang mentari Aku lihat di seberang u fuk timur hingga barat Bersama dinginnya embun pagi Sinar pelangi melingkar di langit Betapa elok nan indah ciptaan Tuhan Pancaran sinarnya menorehkan hiasan di kala pagi Hingga semua orang kagum Melihat pancaran pelangi Karya: Hesti Sartika

Warna Pelangi Menyelimuti bumi sehabis hujan mengendus warna yang bercampur asa beraneka dan sukar diterka sesekali samar bahkan tak ada warna pelangi yang cepat sekali pergi ku menanti hingga hujan kembali meniduri.

Karya: Siti Fatimah Sitepu Karya: Neni Marsela Sinaga

Aku Dan Malam

Kehidupan Pecundang

Gerimis merongrong keramaian hati yang dilanda gundah Kesenyapan perlahan menghampiri lalu mendekap Hingga raga pun lemas dan terlelap pulas Berharap Surya tak keluar dari peraduannya Tatapi terbit sajalah di ufuk timur basuh malamku karena aku pun tak mau berlindung pada gelap Pintaku biarlah semuanya tertinggal di sini Aku akan beranjak dan segera melakoni cerita baru.

Kegilaan kini meruap Citra birahi mengalahkan kekerasan yang kalap Perlahan datang Tapi mendekam Ayo... cepat lari Cindaku kini mengejar Lagi dan lagi Hingga terperosok kedalam jurang kehidupan pecundang

Karya: Eva Rosanti Halawa

Ingin Pulang Telah lama kaki menjejaki kota perantauan mencari arti perjuangan hidup menemu bangga di wajahmu meski harus menelusuri terjalnya kehidupan Tapi, lelah kini menghampiri senja telah menjelma rupamu hasrat hati ingin pulang memandang wajahmu secara nyata

Karya: Khairil Miswar

Si Yatim Piatu Matanya redup seredup gerhana Pandanganya kelam bak gulita malam Terduduk lesu terisak merana Masa depannya suram, buram Rindu tak pudar meski masa tenggelam Ayah ibunya pergi lama Menghadap khalik di kubur terendam Takdir hidup di alam fana Bait doa tak pernah hilang Berharap di kubur pelita terang Dia si yatim piatu Hidup dijalan berdebu… Karya: Ria Ristiana Dewi

Langkah Bila ada langit Dengan kompas di hatimu Pergilah ke samudera Kita mesti bertemu Bila ada langkah Maka katakan langkah Nanti kakimu akan tergerak Menjumpaiku di pengakuan Awal Dan akhirnya Akuilah...

Karya: Deliyana Siagian

Karya: Hadijah Handayani

Biar Biar Biar aku jadi penonton sandiwara mahabrata Bersila tahta asmara fatamorgana Berkelok indah seolah seluet senja Indah, nyata indah Tapi nyata tinggal rasa Mengalir magma dari kawah yang menggema Ah, sandiwara mahabrata Masih saja berkelok di pentas sandiwara Karya: Arif Sinaga

Rantai Kita seperti rantai sepeda dikayuh waktu yang rapuh. tiap rantai berputar-putar, sama merasakan atas bawah. kita yang rapuh seperti rantai bergelut pada hujan. mengering terbantai panas terik, berkarat dan sekarat. hingga berbunyi nyaring mencumbu angin menunggu terburai lalu diabai.

Jejak Yang Kalah Gemericik air hujan membuyarkan pikiranku Semangat 45 kini pecah membungkah keringat yang basah Perlahan tapi pasti Cahaya suci menembus tubuh yang lelah Menghapus jejak yang kalah Karya: Yessi Ening Dalis LE

Sebutir Kejujuran Senin pagi menunjuk kecerahan Mentari berdiam pada titik tertingggi Menguji sebuah peristiwa langka Sejujur atau berbongkah kosong Anak-anak melawan tradisi Kertas kecil dijalankan Sebutir jujur tersimpan rapi Terselubung kertas putih

Tragedi Takdir Subuh tadi sebercik mimpi menyilang hati Berdetak pada titik nadi, tepat setelah iqamah muazin Sajadah telah kuyup Terserap bait-bait ampunan Zikirku terhempas Ingatku sebuah jalan ampunan Baikku terbalas sayatan nadi Rabb, engkau Maha Segala Takdir ini setetes peristiwa uji

Di Atas Kapas Datang dan pergi seperti arah angin Yang tak beraturan Kurasakan buntu dalam kehidupan Terkadang pilu, terkadang girang Tak mudah bagiku tertawa sendiri Kujatuhkan tetesan air mata Di atas kapas... Dengan berharap aku bisa menemukannya lagi

Sampai Akhir Mentari cerah hadir menyapaku Rembulan terang hadir menghampiriku Indah dan bahagia menerpa Tersorot indah di benak jiwa Relungku bersamamu Butiran nafasku, lahir dan batinku Hanyut dalam pelukmu Menusuk hingga ke rusuk Canda dan tawa terus menerpa Abadi untuk selamanya... Karya: Rusyda Nazhira

Di Sudut Kota Meliuk mengitari jalanan tua tadi sore Terbentur mataku menyaksikan anak manusia Terlantar menyeruput bau kota Bising nanah menyatu dalam keharuan Terjerembab menyayat pilu hati yang melihat Entah sampai kapan nestapa anak itu menjauh

Karya: Alda Muhsi

Lepas Dan sudah kulepaskan segala belenggu rasa selain pengikat atasmu tentang malam yang begitu pekat pun aroma pagi yang menyengat aku lumpuh akan langkah hanya bisa menetap padamu jua

Nisan Aku tertidur beralas kata-kata merebah dalam pelukan beragam makna terpenjara jeruji-jeruji pikiran diam seperti tertikam tak mampu bangkit tertimbun puisi-puisi keabadian yang terpacak nisan

Badai Berhentilah menyiksa Bumi sungguh negeri tak tahan saban waktu kau terus melanda hingga kemarin sore derasnya udara yang berhembus menghantam segalanya pepohonan kalah telak melambai-lambai meminta pertolongan di tengah gemuruh suaramu yang sangar

lahku di ujung letihku. Duduk di atas kasur sekelak. Setelah ragaku siap, aku beranjak dari kasur dan mengganti pakaianku. Lalu aku keluar dari kamar. Aku lihat ayah melambaikan tangannya ke arahku sembari memanggil namaku dan disusul dengan kata “sayang” di belakangnya. Saat itu dan seterusnya, aku menjadi anak yang paling disayang oleh ayah. Aku memeluk bantal berwarna biru kesayanganku di kamar. Aku lihat dari pintu kamarku, ayah sedang menikmati acara tv bersama ibu yang selalu setia mendampingi. Kini sudah pukul 02.00 dini hari. Setelah nanti matahari terbang tinggi, aku harus sudah di perjalanan menuju sekolah. Mataku sudah berat minta dijatuhkan di lembah mimpi. Aku coba turuti saja kemauannya. Aku tarik sedikit selimutku agar aku tak diganggu oleh vampire-vampire kecil. Alam bawah sadar menggerayangi jiwa. Pukul 07.15, aku tersadar dari tidurku oleh suara ibu yang memanggil namaku dengan suara yang agak keras. Kepalaku masih ditarik-tarik oleh dewa mimpi. Aku tutup kepalaku dengan bantal. Sedikitnya aku mulai sadar bahwa ibu memanggilku dengan nada suara yang panik. “Uh, ibu. Aku masih mengantuk.” Sahutku. Aku mencuri pandangan ke arah ibuku. Dan aku dapati ayah melirik kearahku dengan mata yang berkaca-kaca. Mulutnya menganga seperti ingin mengucapkan sesuatu kepadaku. Aku bersegera bangkit dan duduk di sebelah ayah. Pagi itu hujan mengantarkan suasana duka. Dan detik itu ayah telah tiada. Ayah....

Karya: Abdul Azis Pane

Karya: Araska Sinulingga

Terhempas Tak Berujung Terkatung-katung, di bahu asongan kugantung. Teriak di terik sampai senja menungkik. Belum bernafas, nafasku berhenti. Mencari hanya sesuap nasi sehari. Itupun belum dapat hingga malam ini.

Karya: Marwadah Aku pulang dari bungkaman kelam Menuju jurang senda tawa Tapi hambatan hampir ketukan hati Bersemayam ragu dalam diri Yang tiada ujung henti diam Tanya ….. Aku siapa..? Mengapa ini? Di mana ini? Siapa yan merekam ke punahan kegelapan Tanya, mengitari di sendauan hati Gemuruh telah menegur Akan hati Tanya diri yang berujar ragu Untuk meyakini akan itu

masih terikat dengan kontrak. “Ayah,” kata abangku dengan pelan. Tubuhnya gemetaran. Ia mencoba untuk terlihat tegar di hadapan ayah. Ayah menyahut dengan sedikit suaranya yang tersisa. Lalu digenggamnya tangan ayah. “Kenapa engkau pulang?” kata ayah dengan suara samar. “Aku ingin melihat keadaan ayah,” jawab abangku dengan singkat. Sedikitnya jawaban itu terdengar gemetar tak kuasa menahan sedih. “Bukankah ayah sudah bilang....” kata ayah lagi. Suaranya masih saja terdengar samar. Ayah berbicara dengan sepenuh nafasnya. “Iya, aku tahu, ayah. Tapi,” abangku tetap berusaha menjaga sikap di depan ayah. Aku lihat mata ayah mulai kemerahan. Tetes demi tetes air mata mulai mengalir. Selanjutnya aku tak tahu apa yang terjadi karena aku dipanggil oleh ibu. Setelah aku kembali, aku mendapati abang sedang berdiri di balik pintu menutup mulutnya dengan tangannya. Matanya merah, berair dan menyipit. Ia merasakan hal yang paling membuatnya menyesal karena menuruti perkataan ayah yang tidak memperbolehkannya pulang. Beberapa hari sesudah abang kembali ke kota asuhnya, ayah ingin pulang. Ayah tidak betah dengan suasana rumah sakit. Namun, sepulangnya dari rumah sakit, kejiwaan ayah tidak seperti biasanya. Dokter bilang bahwa ayah dalam kondisi halusinasi karena penyakitnya. Lambat laun ayah semakin aneh. Terkadang ayah tidak mau tidur, tidak mau berhenti berbicara, bahkan ingin selalu duduk di teras rumah saat dini hari. Aku membanting tas seko-

Buat Ayah Aku igin pulang ayah Sesak sudah menahan kerinduan Tetes air mata tak kuasa tertahan Mendengar kabar tentang engkau Berbaring Menjerit kesakitan Kuatkanlah ayah Anakmu pasti kembali Menggenggam seribu harapan Yang kita impikan Di kala sawah menyaksikan cerita kita

Aku Hanya Pergi Sementara Aku tak akan jauh pergi Aku hanya terhela pada panggilan Pangilan yang tak mungkin aku tinggalkan Aku ingin mengembalikan kedua telapak tangan Yang telah orang coreng pena hitam Aku harus merubah tentang kita Aku tak akan lama Untuk kembali membawa genggaman Antara kita bersama Karya: Riska Wahyuni

Kebimbangan Hati Hatiku bergoncang Di tengah lautan Aku takut terjatuh Aku takut salah Aku dipaksa memilih Di antara dua hati Si ini dan si itu Aku resah di tengah Lautan luas Terombang-ambing Ingin menyepi Karya: Ratih Kumala Sari

Memoar Samudra Indonesia Aku menatap deburan ombak Menyaksikan mentari pulang ke peraduan Menggoda burung camar yang berterbangan Merasakan semilir angin menggelitik kulitku Di sini aku terpaku dalam lamunan Bagai kepincangan waktu yang menghadang Teringat semua masa lalu Yang pernah kita lewati di sini Bergetar menghadapi persepsi kehidupan Mengenang masa indah di sisi Nyanyian alam pantai Menyisakan kerinduan berkepanjangan Karya: Juliarni Hasibuan

Jani Terakhir saat ku tatap rembulan Terlintas janji yang kau rangkai kala itu Senyum dan tangis tampak dalam rona wajah ku Hanya deret luka yang masih mengantri dalam hati Ku coba basuh lembaran pahit itu Tapi noda itu tetap menempel di relung batin ini Mencabik pinggiran hati yang tak tahu kapan akan berakhir Sementara kau masih saja sibuk dengan angan mu Sadar kah kau akan janji itu? Menoreh luka yang tak mampu terhapus oleh waktu Ku terus menanti meski batin selalu bergejolak untuk pergi Dan berharap angin menyadar kan mu



WASPADA Minggu 28 April 2013

Hai teman-teman Namaku Keisya Aliffa Nabilah. Ayah dan Mama memanggilku Keisya. Aku lahir lima tahun silam ya tepatnya tahun 2008. Keisya berdoa agar Keisya, Ayah, Mama dan temanteman senantiasa diberikan kesehatan panjang umur dan murah rezeki. Sayang Mama Yanti, sayang Ayah Adi dan sayang semuanya dan khususnya untuk Opung Harris Nainggolan semoga selalu dijaga kesehatannya oleh Allah. Saat ini Keisya tinggal di Jl. Pelita 3 No. 19 Medan, kalau ada waktu teman-teman mampir ya. Sudah dulu. Terima kasih. (H)

SD Taman Harapan Khataman Al Quran Perdana SEBANYAK 61 siswa dan siswi Kelas VI SD Taman Harapan menggelar khataman Al Quran untuk pertama kalinya (perdana) di halaman sekolah Jalan Ibrahim Umar No 11 Medan, Sabtu (27/4). Acara tersebut juga dihadiri siswa-siswi kelas I hingga V, orang tua siswa, guru dan Plh Yayasan Taman Harapan Drs H Kusri. Pelajaran Iqra dan Al Quran sekarang sudah menjadi bagian tersendiri di sekolah ini sejak dipimpin Kepala Sekolah Drs Ahmad Dairobi. Dalam satu minggu ada dua jam disediakan untuk pelajaran tersebut. Taman Harapan pun menjadi sekolah yang islami dan menjadi nilai tambah bagi sekolah ini karena salah satu kurikulumnya ada pelajaran Iqra dan Al Quran. “Insyaallah, mulai tahun depan setiap kali mengakhiri tahun pelajaran ditutup dengan khataman Al Quran,” kata Kepala Sekolah SD Taman Harapan Drs Ahmad Dairobi di selasela acara itu. Dairobi yang menjabat kepala sekolah di SD Taman Harapan sejak 2010 ini menjelaskan, mulai Tahun Ajaran 2012/2013 pihaknya memasukkan pelajaran membaca Iqra bagi siswa kelas 1 dan 2, dan Al Quran bagi kelas selanjutnya. Dia menilai saat ini anak-anak banyak yang tidak bisa membaca Al Quran. Berdasarkan itulah sekolah yang dipimpinnya merasa perlu memasukkan pelajaran membaca Al Quran sebagai salah satu mata pelajaran. Program ini menurutnya untuk memberantas buta membaca Al Quran sehingga setiap lulusan Yayasan Taman Harapan tentunya sudah harus mampu membaca Al Quran. “Ini salah satu upaya sekolah agar anak bisa membaca Al Quran sejak dini. Dengan demikian tiap tahun nanti bakal ada acara khatam Al Quran seperti ini,” ujarnya. Kepsek mengingatkan siswa-siswi membaca Al Quran tak pernah mengenal istilah tamat. Maksudnya, walau hari ini siswa telah khatam

Al Quran namun harus tetap melanjutkan membaca Al Quran sampai kapan pun. Dia pun berharap melalui kegiatan ini dapat mengajarkan anak didik agar tetap mencintai Al Quran dan mampu mengamalkan isi kandungannya dalam kehidupan sehari-hari. Plh Yayasan Drs H Kusri mengapresiasi panitia, guru dan orangtua siswa sehingga acara ini terselengara dengan baik meski sederhana. “Apa yang kita rintis akan kita lanjutkan pada masa-masa yang akan datang,” ujarnya. Yayasan juga mengapresiasi kinerja kepala sekolah yang menggagas memasukkan Iqra dan Al Quran sebagai salah satu mata pelajaran di SD Taman Harapan. Pada kesempatan itu, Plh yayasan meminta siswa, guru dan orang tua membacakan surah Al Fatihah untuk mengenang jasa Pendiri Yayasan alamarhumah Hj Nurhayati Siregar. Ketua Panitia Saudah S.Ag menyebutkan pelajaran Iqro dan Al Quran dibimbing guru agama Syafrida dan Junita S.PdI. Kendati baru berlangsung satu tahun, dia bersyukur anak-anak sudah lancar membaca Al Quran dan mengkhatamkannya hari ini. Saudah mengaku prihatin siswa belum bisa membaca Al Quran karena kesibukan atau kelalaian orang tua. Dia menyayangkan orang tua yang hanya memberikan les tambahan bahasa Inggris, matematika dan ilmu sains lainnya bagi anak, tetapi pelajaran mengaji tak masuk daftar prioritas pelajaran penting. Usai khataman siswa-siswi SD Yayasan Taman Harapan juga berdoa memohon hati diterangkan Allah SWT agar mampu menjawab soal -soal Ujian Nasional pada 6 Mei mendatang. Kegiatan diisi dengan membaca Al Quran, hiburan penampilan siswa-siswi kelas V, dan penyerahan bale dari siswa didampingi orangtua kepada kepala sekolah, Plh Yayasan, dan para guru.(Hamzah)

CERIT A ADIK Adik-adik, berikut Redaksi memuat cerita-cerita berkaitan tentang malaikat. Malaikat adalah makhluk Allah yang taat dan setia kepada Nya. Semoga bisa menambah wawasan dan menambah keimanan kita pada kekuasaan Allah SWT.

Malaikat Memuji Insan Yang Bersujud Kepada Allah MALAIKAT berkata : “Wahai Tuhan kami, dia berhak mendapatkan rahmatMU.” “Kemudian apa lagi?” Tanya Allah kembali. “Wahai Tuhan kami, dia berhak mendapat surgaMu.” “Lalu apa lagi?” “Wahai Tuhan kami, dia berhak mendapatkan naunganMu yang meliputi segala sesuatu.” “Lalu apa lagi?” Kemudian Malaikat menyebutkan anugerah Allah satu persatu yang berhak diperolehi hamba ini. Setelah selesai. Allah menjawab, “Wahai malaikatKu. Aku akan bersyukur (berterima kasih) padanya sebagaimana dia bersyukur padaKu. Aku akan limpahkan kepadanya nikmat-nikmat-Ku dan akan Kuperlihatkan kepadanya rahmatKu.”

m31/Darul Nu’man


WASPADA Minggu 28 April 2013


Ayam Bebek Ganja Khas Aceh

GANJA (Ganas rasanya jawara nikmatnya). Ini yang menjadi ikon seorang pengelola usaha kuliner Cikendak ayam bebek ganja, bernama Zulfikar. Resto yang dia kelola di Jalan Ringroad Medan menawarkan aneka makanan khas Aceh. Sajian menu dengan konsep rempah dan olahan asli Aceh membuat citarasa makanan ini terasa berbeda. Bebek cabai hijau misalnya, yang di goreng kemudian ditabur cabai hijau. Ternyata, olahan cabai pada bebek ini telah dipadukan dengan sedikit rempah seperti jahe dan sere. “ Agar lebih harum dan rasanya beda,”kata Zulfikar yang menangani sendiri olahan masakannya. Rasakan juga sajian bebek lada hitam yang warnanya sedikit pekat. Lumuran bumbu khas Aceh juga disisipkan pada masakan yang terasa sedikit pedas karena lada yang sedikit lumat. Jika Anda suka dengan cita rasa yang sedikit asam, cobalah sensasi rasa dari bebek asam . Jangan keburu memikirkan asam suntinya dulu, karena sajian ini dipadukan dengan sambal terasi yang diolaah secara khusus, yakni dengan menyertakan sedikit kecombrang hingga rasanya berbeda. Aneka minuman yang ditawarkan di warung ini juga beragam. Es longan jagung sampai es buah diberi sedikit soda sehingga rasanya lebih segar. Sangat cocok menghilangkan rasa dahaga. Zulfikar mengakui jika warung kulinernya, pernah ada di kota Langsa dengan nama Chikendak (ayam bebek bakar ) tahun 2010. Kini setelah hijrah ke Medan, dia berharap usaha yang dikelola lebih maju lagi. “ Saya ingineksisdibisnisini,”kataZulfikaryangmenyebutkanpengalamannya berbisnis kuliner saat di Langsa menggembirakan, diapun berharap hal yang sama berlaku di Medan. Apalagi, kata dia, makanan yang dia sajikan asli berkonsep kedaerahan yang perlu dilestarikan. Naskah & Foto Anum Saskia

Sajikan untuk pengunjung

Pengunjung nikmati sensasi es buah soda yang segar

es buah soda Bebek cabai ijo

Bebek Asam sunti

Proses pembuatan dorayaki

Dorayaki Nan Lembut

MENGANDALKAN bahan tepung terigu dipadu dengan telur serta perpaduan keju dan taburan seres cokelat membuat panganan ini terasa lezat. Lembut dan sedikit manis, menjadi pilihan yang menggoda untuk cemilan yang mengeyangkan. Dorayaki sangat terkenal di Jepang, tapi di Medan, sekelompok mahasiswa di USU mencoba mempopulerkan makanan

Tips Membuat Roti - Pilih tepung yang berprotein tinggi supaya serat roti bagus hasilnya. - Masukkan margarin/mentega dan garam terakhir ketika campuran bahan lain sudah rata betul. - Menguleni roti harus sampai elastis betul supaya roti mengembang sempurna. Untuk mengecek elastisitas, ambit sejumput adonan, tarik selebar mungkin. Kalau adonan tidak robek ketika ditarik, artinya adonan sudah cukup elastis. - Perhatikan waktu fermentasi. Ketepatan waktu penting, tetapi kalau adonan belum mengembang hingga dua kali lipat, waktu fermentasi boleh ditambah. Penyebab pengembangan belum sempurna adalah ragi yang tidak bekerja sempurna atau udara kurang hangat. - Selama fermentasi, adonan harus ditutup rapat supaya tidak terjadi penguapan yang mengakibatkan roti menjadi kering. - Pengovenan roti harus pas temperatur dan lamanya. Roti yang kelamaan dioven Akan kering dan keras hasilnya.

ini kepada masyarakat. Bentuknya yang mungil tetapi rasanya yang enak dan lembut membuat makanan ini jadi pilihan. Kiki, yang mengolah makanan ini mengakui jika Dorayaki adalah makanan cemilan pilihan saat ini. “Sehat dan bergizi,”kata Kiki yang ditemui di arena pameran Lapangan Merdeka Medan kemarin.

Dorayaki sudah siap untuk disajikan


Martabak Manis Bahan Kulit: 500 gram tepung terigu protein sedang 1 sendok teh baking powder 150 gram gula pasir 1 butir telur, kocok lepas 2 kuning telur, kocok lepas 1/4 sendok teh vanili bubuk 1/2 sendok teh garam 650 ml air Bahan Taburan (per Loyang): 50 gram margarin 1 sendok makan mentega asin 1 sendok makan gula pasir 2 sendok makan meises 2 sendok makan kacang tanah kupas, sangrai, cincang kasar 1/2 sendok wijen sangrai 100 gram keju parut 50 gram susu kental manis Cara membuat: Kulit, ayak tepung terigu dan bakingpowder.Masukkangula pasir. Aduk rata. Tambahkan telur kocok, vanili bubuk, dan

garam. Aduk rata. Tuang air sedikit - sedikit sambil dikocok dengan kecepatan rendah sampai lembut. Diamkan 1 jam. Adonan siap digunakan. Timbang 250 gram adonan. Tambahkan 1/4 sendok teh baking powder. Aduk rata. Tuang di cetakan martabak manisyangsudahdipanaskan dengan api sedang selama 15

menit. Biarkan berbusa. Kecilkan apinya. Biarkan sampai berlubang.Taburgulapasir.Tutupsampai matang. Angkat. Oles margarin dan mentega. Tabur meises, kacang tanah, dan wijen sangrai. Di satu sisi. Satu sisi lainnya tabur keju parut. Tuang susu kental manis diatasnya. Potong dua. Tumpuk. Oles kulitnya dengan margarin. *******



Konsultasi Teknologi Informasi

Dari : 0878914xxxxx Hai codealgo..mau nanya lagi donk :D nama software yang bisa memotong sebuah lagu/ video dan digabung dengan lagu/video yang lain apa ya? Dan bagaimana caranya? Dari : 0853339xxxxx Malam codealgo, saya Fazri. Saya mau nanya, apa ya nama file yang bisa digunakan untuk memotong lagu atau musik. Makasih. Jawab : Sehubungan dengan pertanyaan yang sama, maka kami menggabungkan jawabannya untuk anda. Memodifikasi lagu atau video seperti memotong dan menggabungkan lagu atau video bisa dilakukan dengan bantuan software seperti coolEditPro, windows movie maker, pinnacle, adobe premiere, dan lain sebagainya. Cara pemakaiannya biasanya cukup mudah dimengerti, file atau video akan muncul dalam panel timeline, dan kamu bisa menggunakan cut tool untuk memotong file tersebut. Untuk menggabungkan file satu dengan lainnya, buka file baru dan masukkan potongan file yang telah kamu modif ke file baru tersebut. Kami sarankan agar kamu membaca petunjuk manual (Help) tiap aplikasi tersebut. Semoga dapat membantu. Terima kasih. Dari : 0853592xxxxx Hai codealgo, mau tanya ni. Dimana sih situs yang benar

BUAT yang punya problem, khusus remaja atau pelajar tapi susah buat dipecahkan, seperti masalah sekolah, pacar, ortu yang suka ngomel atau teman yang nyebelin, jangan bingung dulu. Tim Remaja Waspada dan Mbak Fifi yang nama lengkapnya Fidia Rizki, S.Psi, psikolog lulusan Universitas Medan Area akan mencoba membantu kamu mencari jalan solusinya. Silahkan kirim pertanyaan melalui SMS ke

No 0823 6476 6027 Jawaban akan dibalas melalui Harian Waspada, jadi dimohon sabar menunggu.

untuk mendownload program format factory yang mudah dan gampang? Soalnya udah beberapa kali mendownload di internet gak ada yang bener? Mohon solusinya? Thanks codealgo, semoga makin jaya. Jawab : Hai, program format factory adalah program yang digunakan untuk mengubah jenis-jenis file yang kita miliki ke bentuk lain. Program format factory dibuat oleh independen developer bernama Chen Jun Hao. Untuk mendownload aplikasi ini, kami sarankan kamu mendownloadnya langsung dari situs developer yang mengembangkan aplikasi ini. Situs developer resmi pembuat program ini bisa dilihat di http://www. Semoga dapat membantu, terima kasih. Dari : 085663xxxxx Met malam codealgo saya mau tanya bagaimana cara menyimpan dokumen microsoft word? Thank you atas jawabannya.. Dari : 0823703xxxxx Assalamualaikum nama saya Farel. Selamat malam codealgo saya mau nanya bagaimana cara menyimpan dokumen microsoft word. Mohon jawabannya. Trims. Jawab : Waalaikumsalam, sehubungan dengan pertanyaan yang sama dari dua pengirim yang berbeda, kami akan menggabungkan jawabannya disini. Untuk menyimpan file microsoft word sangat mudah sekali. Bisa dilakukan secara manual atau melalui shortcut, untuk penyimpanan secara manual, ka-

PEMBERITAHUAN : NB : Kirimkan pertanyaan kamu ke codealgo melalui nomor 081370311355 atau ke email Setiap pertanyaan yang masuk akan kami jawab menggunakan metode FIFO (First In First Out). Codealgo hanya akan menjawab pertanyaan konsultasi melalui rubrik konsultasi Waspada. Kunjungi website kami untuk mengetahui produk dan jasa yang kami tawarkan di yang akan segera dilaunching dalam waktu dekat.

mu harus mengklik tombol ms.word (File), pilih menu “Save” atau “Save as” dan simpan dengan format file yang hendak kamu simpan. Sedangkan dengan cara shortcut, bisa dilakukan dengan cara menekan dua tombol keyboard secara bersamaan yaitu tombol “Control (ctrl)” dan tombol “S”. Semoga dapat membantu, terima kasih. Dari : 0831993xxxxx Assalamualaikum codealgo… aku Dana di deli tua mau nanya ni..Kenapa dilaptopku disaat mau membuka game online flash itu tiba-tiba jadi lambat semua..bahkan saat mouse digerakkan pun jalannya lambat saat membuka tab lain pada browser… Jawab : Waalaikumsalam Dana, flash, atau adobe flash, merupakan perangkat lunak yang memang telah dikenal sangat boros konsumsi energi CPU dan memori. Tidak mengherankan apabila kejadian tersebut terjadi pada kamu. Lambat tidaknya game online berbasis flash saat dibuka dikomputer sangat tergantung sekali dengan spesifikasi laptop yang kamu miliki dan bagaimana cara developer games tersebut mengoptimisasi games mereka sehingga bisa mengurangi konsumsi energi CPU dan memori komputer kamu. sebagai perbandingan untuk kamu, Tanpa games saja, konsumsi energi CPU saat membuka flash player sudah cukup besar, antara 10-25% dari kemampuan CPU, apalagi kalau menggunakan games. Hal inilah yang menyebabkan komputer kamu menjadi sangat lambat, selain kamu sudah menggunakan browser yang juga membutuhkan alokasi memori, kamu menambahnya lagi dengan membuka games flash, sehingga alokasi energi CPU dan memori habis untuk kedua aplikasi tersebut dan menyebabkan alokasi memori dan CPU untuk sistem operasi berkurang drastis, akibatnya komputer kamu menjadi sangat lambat untuk

merespon perintah yang kamu berikan. Semoga dapat membantu, terima kasih. Dari : 0821688xxxxx Codealgo bantu aku..namaku Uki..bagaimana cara menghapus virus dalam laptop..virusnya selalu muncul tiap laptonya dihidupkan..aku tunggu ya jawabannya codealgo. Terima kasih. Jawab : Hai Uki, virus sebenarnya bisa dihindari apabila kita tau cara mengatasi dan mencegahnya menginfeksi sistem operasi kita. Apabila komputer kamu telah terserang virus sangat parah, dimana untuk menghidupkan komputer saja membutuhkan waktu lebih dari 10 menit, respon komputer sangat lambat dalam menjalankan aplikasi, atau untuk membuka task manager, registry editor, atau system management tidak bisa karena didisable oleh virus, maka kami sangat menganjurkan agar komputer kamu direpair atau lebih baik lagi diinstall ulang karena sistem kamu sudah mengalami kerusakan. Install ulang juga bukanlah sesuatu yang menakutkan, selama kita sering melakukan backup rutin terhadap data-data kita pada removable media. Namun apabila komputer kamu hanya terserang virus yang menyembunyikan dokumen, atau malware lainnya, maka kami merekomendasikan agar kamu menggunakan antivirus yang update agar virus tersebut bisa dibersihkan. Rekomendasi kami, gunakanlah antivirus seperti MSE, Kaspersky yang biasanya memiliki update regular setiap minggunya. Biasakanlah untuk selalu menscan semua removable device yang masuk ke dalam komputer kamu, pasanglah firewall saat kamu terkoneksi ke internet dan jangan membuka linkpadainternetyangkamutidak kenal atau mencurigakan. Dengan begitu, maka mudah-mudahan laptop kamu bisa aman dariseranganvirus.Semogadapat membantu, terima kasih.

Konsultasi Sumber Daya Manusia Diasuh oleh Thoga Sitorus

Syarat Menjadi Pekerja Tetap Selamat pagi, Pak Thoga. Nama saya Jalasman S, bekerja di sebuah perusahaan plastik di Kabupaten Simalungun. Saya telah bekerja selama hampir tiga tahun dengan sistem perpanjangan kontrak per tahun. Apakah saya bisa mengubah status saya menjadi pekerja tetap, dimana saya sudah mengalami perpanjangan kontrak sampai dua kali, padahal yang saya dengar tidak boleh diperpanjang lebih dari satu kali. Tolong informasikan, Pak kalau memang ada UU, PP, atau ketentuan lainnya. Kalau memang ketentuannya membenarkan, apakah perusahaan harus mengubah status saya menjadi pegawai tetap setelah dua kali masa perpanjangan kontrak? Atas penjelasan Bapak, saya ucapkan terima kasih. Jawab : Selamat pagi Sdr Jalasman. Mengenai status pekerja kontrak, yang menjadi dasarnya adalah

Minggu 28 April 2013

Bantuin Aku, Dong?!

Diasuh oleh Codealgo Dari : 0812607xxxxx Assalamualaikum selamat sore saya mau tanya, HP saya LG Optimus L3 tiba-tiba di media picturenya terdapat beberapa folder yang tidak bisa dihapus. Ini lumayan sangat memakan memori internal saya. Kira-kira apa ya penyebabnya dan bagaimana cara menghapusnya. Jawab : Waalaikumsalam. Terima kasih atas pertanyaan yang diajukan. Biasanya, apabila terdapat file atau folder yang tidak bisa dihapus pada memori, hal ini disebabkan karena terjadi corrupt pada memori anda sehingga file tersebut nyangkut dan tidak bisa dihapus. Selain itu, bisa saja karena folder tersebut terproteksi sehingga tidak bisa dihapus, jadi, pastikan terlebih dahulu, file atau folder tersebut tidak bisa dihapus karena apa? Kalau karena diproteksi, buka terlebih dahulu proteksi file/folder kamu lalu hapus, sedangkan bila yang terjadi adalah memori kamu corrupt, cara mengatasinya cukup mudah, paling gampang dengan cara memformat memori kamu, atau dengan cara mengubah status file/folder tersebut menggunakan aplikasi seperti blueftp agar file tersebut bisa dihapus. Semoga dapat membantu, terima kasih.


hubungan antara pengusaha dan pekerja berdasarkan perjanjian kontrak. Untuk jenis pekerjaan yang jangka waktunya tertentu, kesepakatan yang dibuat antara pengusaha dan pekerja dituangkan dalam perjanjian kerja waktu tertentu (PKWT)/pekerja kontrak. Terdapat persyaratan dan ketentuan dalam perjanjian itu yang harus dipenuhi oleh kedua pihak (pengusaha dan pekerja). Berdasarkan pasal 59 ayat (4) – ayat (6) UU No.13 Tahun 2003 tentang Ketenagakerjaan (UUK), PKWT diadakan untuk paling lama dua tahun dan hanya dapat diperpanjang satu kali untuk jangka waktu paling lama satu tahun. Pengusaha yang ingin memperpanjang PKWT harus memberi tahu secara tertulis kepada pekerja bersangkutan paling lambat tujuh hari sebelum PKWT itu berakhir. Selain perpanjangan, dikenal pula pembaruan PKWT. Pengusaha yang ingin membaharui PKWT dapat mengajukannya 30 hari setelah PKWT berakhir. Pembaruan ini hanya boleh dilakukan selama 1 kali untuk jangka waktu paling lama 2 tahun. Di dalam pasal 59 ayat

(7) UUK sebenarnya sudah mengatur mengenai konsekuensi pelanggaran terhadap syarat dan ketentuan PKWT ini, yaitu demi hukum berubahnya status pekerja kontrak dari PKWT menjadi perjanjian kerja waktu tidak tertentu (PKWTT)/pekerja tetap. Dalam kasus pada saat Sdr sudah bekerja hampir tiga tahun, berarti Sdr sudah membuat sekali PKWT pada awal masa kerja. Selesai tahun pertama, ada perpanjangan PKWT hingga tahun kedua. Memasuki tahun ketiga, ada perpanjangan PKWT lagi untuk kedua kalinya. Perlu dicermati adalah apakah ketika pada saat perpanjangan pertama di tahun kedua, ada pemberitahuan secara tertulis kepada Sdr dalam waktu 7 hari sebelum PKWT berakhir? Kemudian ketika masuk tahun ketiga, ada jeda 30 hari sebelum Sdr membuat perpanjangan PKWT kedua? Jika jawabannya tidak ada, status Sdr demi hukum berubah menjadi PKWTT alias pekerja tetap. Saat status Sdr berubah menjadi pekerja tetap, Anda berhak meminta surat pengangkatan dari perusahaan. Jika perusahaan tak mau melakukannya, berarti

timbul perselisihan. Untuk menyelesaikannya, Anda harus menyelesaikannya secara bipartit terlebih dulu. Artinya, upayakan untuk menyelesaikan secara kekeluargaan dengan pihak perusahaan. Jika perundingan secara bipartit menemui jalan buntu, Sdr bisa melanjutkannya ke perundingan secara tripartit. Di tingkat ini, ada beberapa lembaga yang berwenang. Pertama adalah mediator di dinas tenaga kerja, baik tingkat kabupaten/kota, konsiliator, maupun arbiter (bila sudah ada). Jika perundingan di tahap ini masih gagal, maka Sdr bisa membawa persoalan ini ke Pengadilan Hubungan Industrial (PHI). Untuk lebih lengkapnya, silakan baca UU No 2 Tahun 2004 tentang Penyelesaian Perselisihan Hubungan Industrial yang membahas prosedur penyelesaian perkara ketenagakerjaan.

Peranan Serikat Pekerja di Perusahaan Selamat pagi, Pak Thoga. Saya Juliardi P, pekerja di perusahaan dan menjadi anggota Serikat Pekerja (SP) di daerah Kabupaten Asahan. Yang ingin saya tanyakan kepada Bapak,

Tanya: Sandra – Hp 6281375431xxx Dear mbak Fifi yang baek.. aku Sandra pelajar SMA… aku lagi sebel banget lihat ulah temanku yang suka banget mau tahu segala urusan pribadiku.. dia suka pinjam HP dan isi sms ku dibacanya.. dan orangnya juga suka marah-marah gak jelas. Gimana ya mbak menghadapi teman seperti itu? Makasi uda baca sms dan jawabannya.a Jawab: Dear Sandra Memang nyebelin punya teman yang suka baca sms orang tanpa permisi.. kesannya kurang sopan kecuali memang sudah dibolehkan yang punya. Menghadapi teman seperti ini.. kamu harus tegas dan belajar bilang ‘tidak’ karena merasa area pribadimu sudah dilanggar atau sudah diperlakukan tidak pantas oleh orang lain. Tentu caranya dengan ngomong bahwa kamu keberatan karena merasa tidak nyaman isi isms-mu dibaca orang lain. Ungkapkan bukan berarti kamu tidak senang ketika dia mau tahu tentangmu, tapi tidak semuanya tentang kamu harus diketahui atau dibagi dengan orang lain, sama seperti ketika kita lebih suka mandi atau ganti pakaian sendiri daripada rame-rame dengan teman. Dengan berani terbuka dan mengungkapkan apa yang kamu rasakan, tentu akan lebih mudah buat menghadapi sifat-sifat teman yang kurang berkenan di hati. Asal tahu caranya menegur orang tanpa dia merasa dikecam atau disalahkan… semuanya akan merasa lebih enak,..Dicoba ya smoga berhasil, salam Tanya: Kiki – Hp 6281378405xxx Mbak Fifi , aku punya teman dekat.. tapi ngeselin. Aku suka membantu dia ngerjain PR yang dia belum siap.. tapi kalau aku minta bantuan.. dia selalu ngasi jawaban yang hasilnya salah. Koq dia seperti itu? Gimana mbak? Jawab: Dear Kiki yang baik Sebelum menduga dia sengaja memberi jawaban yang salah ada baiknya dicari tahu.. siapa tahu jawaban yang salah itu bukan kesengajaan.. tapi menurutnya itu jawaban yang benar yang ia miliki. Tapi kalau dia sengaja melakukannya.. sebaiknya sebagai teman dekat.. kamu dan dia sudah lebih terbuka buat ngomongin hal itu. Katakan kenapa jawaban yang dia berikan berbeda dengan miliknya. Sebagai sahabat.. kalian perlu terbuka buat mengungkapkan isi hati dan fikiran padanya. Tentunya dengan memperhatikan kepentingan kalian berdua.. Semoga setelah kejadian ini .. kamu dan dia semakin terbuka buat menguji kedalaman persahabatan diantara kalian, salam Tanya: Anita – Hp 62852787621xxx Assalamualaikum, Halo mbak Fifi … Aku punya teman, dia lagi sedih karena baru putus dengan pacarnya. Gimana ya cara menghiburnya? Thanks ya mbak Tanya: Siswanto – Hp 6281381325xxx Mbak aku punya teman, dia suka marah kalo nama mantannya disebut..padahal bukan maksud membuka luka lamanya.. gimana donk mbak? Makasih Jawab: Waalaikumsalam, Dear Anita dan Siswanto.. Senang rasanya punya teman seperti kalian… sahabat sejati, disaat teman lagi susah turut empati. Teman yang baru putus cinta dan patah hati kudu ditemenin.. karena mereka butuh orang yang mau menampung curhatnya. Jadi cukup didengerin dan tunjukkan empatimu.. ajak mereka untuk kembali mengisi hari-harinya yang kosong dengan aktifitas seperti jalan atau nonton bareng… tujuannya buat menghibur agar dia tidak merasa kesepian. Kalau dia masih anti mendengar nama mantannya disebut.. ya wajarlah.. namanya masih patah hati .. Minta maaf dan katakan kamu tidak bermaksud mengungkit luka lama.. Semoga dia segera bangkit dan bisa menguasai perasaannya. Tanya: Ranie – Hp 6285272356xxx Assalamualaikum.. Dear Mbak Fifi.. aku bingung nee, punya pacar tapi jauh banget.. ketemunya kalo pas liburan aja.. Sebenarnya gak ada masalah karena dia baik, tapi aku suka kangen . makanya kadang aku punya TTM (teman tapi mesra).. tapi sebenarnya karena aku kesepian. Trus aku juga berfikir disana dia berbuat hal yang sama sepertiku. Mbak.. gimana donk.. apakah pacaran jarak jauh bisa dipertahankan? Plizz help me.. thanks Tanya: Dian – Hp 628528653xxx Hai mbak Fifi yang baik .. kenalkan aku Dian seorang pelajar mau curhat, aku lagi bingung.. aku pacaran jauhan seperti ini bisa dilanjutin.. aku takut dia selingkuh disana.. makasih

apa peranan dan fungsi SP di perusahaan terhadap kami anggota-anggotanya terutama lagi bila tejadi permasalahan yang harus kami hadapi para pekerja dan bagaimana hubungan antara SP dan pengusaha di perusahaan. Mohon pencerahan dari Bapak agar menjadi jelas bagi kami sebagai anggota SP di perusahaan dan atas jawaban Bapak saya ucapkan terima kasih. Jawab : Selamat pagi, Sdr Juliardi. Pertanyaan Sdr tentang peran dan fungsi SP di perusahaan adalah sangat penting sebagai wakil dari para pekerja yang fungsinya diatur dalam UU No.21 Tahun 2000 tentang Serikat Pekerja/Serikat Buruh, yaitu a. sebagai pihak dalam pembuatan perjanjian kerja bersama dan penyelesaian perselisihan industrial; b. sebagai wakil pekerja/buruh dalam lembaga kerja sama di bidang ketenagakerjaan sesuai dengan tingkatannya; c. Sebagai sarana menciptakan hubungan industrial yang harmonis, dinamis, dan berkeadilan sesuai dengan tingkatannya; d. sebagai sarana penyalur aspirasi dalam memperjuangkan hak dan kepentingan anggotanya; e. sebagai perencana, pelaksana, dan penanggung jawab pemogokan pekerja/

buruh sesuai dengan peraturan perundangundangan yang berlaku; f. sebagai wakil pekerja/buruh dalam memperjuangkan kepemilikan saham di perusahaan. Kemudian tentang hubungan antara SP dan pengusaha dapat dijelaskan sebagai berikut : 1. Pengusaha dan SP/pekerja, sama-sama mempunyai kepentingan atas keberhasilan dan kelangsungan perusahaan. Oleh karena itu, pengusaha dan SP/pekerja harus samasama memberikan upaya yang maksimal melalui pelaksanaan tugas seharihari untuk menjaga kelangsungan perusahaan dan meningkatkan keberhasilan perusahaan. 2. SP/pekerja adalah mitra pengusaha untuk kelangsungan dan mengembangkan perusahaan. Perusahaan tidak mungkin berkembang tanpa pengusaha atau tanpa SP/pekerja. 3. Pengusaha dan SP/pekerja mempunyai hubungan fungsional dan masing-masing mempunyai fungsi yang berbeda dengan pembagian kerja atau pembagian tugas dan tanggung jawab dengan tujuan yang sama untuk kemajuan perusahaan dan

Konsultasi Remaja

Jawab: Waalaikumsalam, Dear Ranie and Dian Pacaran long distance atau jarak jauh… butuh di-maintain karena perlu ada rasa saling percaya maklum jauhan jadi tidak tahu keseharian dia disana. Juga perlu diomongin kapan ketemuannya dan gimana ngatasi rasa kangen kalau lagi jauhan.. dan sejauhmana boleh dekat dengan teman lawan jenis. Jadi pastikan dulu perasaanmu.. apakah kalian suka atau butuh karena kesepian? Kalau kamu merasa kesepian dan butuh pacar yang selalu bisa nemenin.. tampaknya pacaran JJ perlu dipertimbangkan kembali. Kalian masih remaja.. pacaran buat kalian untuk mengenal lawan jenis dan pendewasaan buatmu tentunya..jangan sampai melakukan perbuatan yang tidak boleh dilakukan sebelum kalian menikah. jadi jangan dibuat susah deh. Kembangkan saja pertemanan kalian sebanyak-banyaknya.. makin banyak teman .. makin asyik. Nah.. kalau nanti ada yang cocok dan tentunya jarak yang dekat, baru berfikir buat dijadikan teman dekat. Jadi pilihan tetap ada pada kalian.. salam Tanya: Dea – Hp 6287801045939 Assalamualaikum,,,mbak Fifi… mbak aku Dea, aku punya mantan, dulu kami putus karena dia sering selingkuh.. dan sekarang aku punya pacar,, tapi setiap lihat mantanku berpapasan aku teruz lemah,, dan dia smpat minta ma’af dan minta balikan, tapi aku menolak gak mau lagi, bagaimana agar aku tidak terus-terusan sedih kalau ngeliat dia mbak...wassalam Jawab: Waalaikumsalam, Dear Dea… Sedari awal kamu sudah mengetahui alasan yang membuat kamu dan mantan memutuskan untuk tidak bersama lagi.. kalau kalian putus artinya sudah ada alasan yang tepat untuk tidak bersamanya. Apalagi saat ini kamu sudah menemukan penggantinya.. jadi tidak usah melihat ke belakang lagi.. ada kalimat lucu yang bisa kamu kutip .. “Mantan itu engga usah diingat-ingat… gak guna juga dan gak penting, namanya juga sudah mantan, jadi kasi saja sama yang lebih membutuhkan..” Supaya engga kefikiran dia terus.. baiknya kamu batasi pertemuan dan pertemanan dengannya, bukan memusuhi tapi supaya lebih mudah bagimu buat melupakan segala sesuatu yang berhubungan dengan dia. Fokus kepacarmu yang sekarang supaya tidak ada celah buat si mantan masuk kembali ke kehidupanmu. salam Tanya: Raymah – Hp 6285760233312 Assalamualaikum,nama saya Raymah dari Singkil saya mau bertanya kepada mbak, gimana mengatasi sifatku yang tidak percaya sama cowok, karena ketidakpercayaan saya kepada cowok saya sulit serius kepada cowok tersebut,,? Terimakasih ya mbak ,saya tunggu jawabannya wasalamualaikum Jawab: Waalaikumsalam,Dear Raymah… Kamu bingung ya dengan perasaanmu padanya.. coba deh kamu jujur dengan perasaanmu, terlepas dari apapun kamu suka atau tidak dengannya.. kalau suka tunjukin kamu suka.. kalau ragu katakan apa yang membuatmu merasa kurang yakin agar dia bisa memberi ketenangan padamu. Tapi kalau kamu merasa engga sreg.. kamu terus terang dan fair menolak, jangan setengah-setengah agar dia tidak merasa bingung dengan sikapmu. Biasanya yang bikin kita merasa ragu dan kurang yakin saat menjalin hubungan karena dimulai tanpa alasan yang jelas. Kalau Cuma sekedar iseng biar punya pacar.. atau supaya engga kesepian.. pasti merasa ragu dan susah serius.. ujung-ujungnya merasa bosan. Jadi yakini dirimu, apakah dia memang orang yang tepat buat dijadikan teman special atau hanya sekedar teman. salam Tanya: Someone – Hp 6281934279480 Mbak saya mau bertanya tentang solusinya ,bagaimana ya ,supaya cewek saya mau percaya sama saya, ,bahwasannya apa yang kita lakukan hanya cobaan bagi dia. .thanks. . Jawab: Helo Dear.. Mbak kurang paham maksud apa yang dilakukan hanya cobaan bagi dia..? Apakah kamu sengaja melakukan sesuatu untuk melihat reaksinya? Pacaran engga perlu diuji-uji.. kalau niatnya baik, jalani saja. Kalau kamu ingin dia mempercayaimu.. dimulai dari kamu membuka dirimu dan membiarkan dia tahu tentang dirimu. Kamu mempercayainya karena kamu berharap dia juga belajar mempercayaimu. Dan kenalkan dia dengan orang-orang terdekatmu.. agar dia merasa kamu peduli dan menghargainya. Mudah-mudahan dia bisa mempercayaimu.. salam

peningkatan kesejahteraan. 4. Pengusaha dan SP/pekerja merupakan anggota keluarga perusahaan. 5. Tujuan pembinaan hubungan industrial adalah menciptakan ketenangan berusaha dan ketentraman bekerja dengan demikian

Bagi para pembaca yang ingin menanyakan seputar tentang ketenagakerjaan dapat mengirimkan pertanyaan melalui, HP:0811632554

dapat meningkatkan produktivitas perusahaan. 6. Peningkatan produktivitas perusahaan harus dapat meningkatkan kesejahteraan bersama, yaitu kesejahteraan pengusaha dan kesejahteraan SP/ pekerja.

Kupon Konsultasi


WASPADA Minggu 28 April 2013

Konsultasi Seputar Diabetes Bersama:

DR. Dr. Dharma Lindarto, SpPD, KEMD (Dokter Internis – Konsultan Endokrin, Metabolik, Diabetes)

Beda Diabetes Tipe 1 DanTipe 2? Dokter Dharma YTH, Saya mahasiswi di salah satu perguruan swasta di Medan, di majalah saya ada membaca tentang penyebab diabetes. Disebutkan penderita diabetes disebabkan beberapa hal.Terdapat diabetes tipe 1 dan tipe 2. Tipe 1 sering pada anak, sedangkan tipe 2 sering pada orang dewasa. Mohon penjelasan lebih lanjut tentang kedua tipe pada diabetes ini ? Apakah terdapat perbedaan dalam pengobatannya? Terima kasih dokter. (Manda, 20 tahun, Medan-Jl. Sisingamangaraja Gg. Sado) Adik Manda yang baik, Diabetes Mellitus Tipe 1 disebut juga IDDM (Insulin Dependent Diabetes Mellitus), diabetes mellitus yang tergantung insulin. Penyebab utama Diabetes Mellitus Tipe 1 terjadinya kekurangan hormon insulin diakibatkan kerusakan sel beta pada organ pankreas. Fungsi utama hormon insulin dalam menurunkan kadar glukosa secara alami dengan cara meningkatkan jumlah gulayangdisimpandalamhati,merangsangseltubuhagarmenyerap gula dan mencegah hati mengeluarkan terlalu banyak gula. Jika insulin berkurang, kadar gula dalam darah meningkat. Gula dalam darah berasal dari makanan yang diolah secara kimiawi oleh hati. Sebagian gula disimpan dan sebagian lagi digunakan untuk tenaga. Disinilah fungsi hormon insulin sebagai “stabilizer” alami terhadap kadar glukosa dalam darah. Jika terjadi gangguan sekresi (produksi) hormon insulin ataupun terjadi gangguan pada proses penyerapan hormon insulin pada sel darah maka potensi terjadinya Diabetes Mellitus sangat besar. Untuk diabetisi tipe 1 diberikan terus insulin dalam pengobatannya, dengan dosis disesuaikan. Diabetes Mellitus Tipe 2 atau NIDDM (Non Insulin Dependent Diabetes Mellitus), diabetes mellitus yang tidak tergantung insulin dalam pengobatannya. Jika Diabetes Mellitus Tipe 1 penyebab utamanya adalah dari kerusakan kelenjar pankreas, maka pada Diabetes Mellitus Tipe 2, gangguan utama terjadi pada volume reseptor (penerima) hormon insulin disebut resistensi insulin. Artinya, jumlah insulin ada tetapi tidak berfungsi baik, sehingga kadar gula darah tetap meningkat. Untuk diabetisi tipe 2 tidak selalu tergantung pada insulin tetapi diberikan tablet penurun gula darah. Dibawah ini terdapat beberapa faktor yang memiliki peranan penting terjadinya resistensi insulin yang dapat berujung kepada diabetes mellitus tipe 2 di antaranya obesitas. diet tinggi lemak dan rendah karbohidrat, kurang gerak badan (olahraga), faktor keturunan. Selain tipe diatas terdapat juga tipe lain yang menyebabkan diabetes yaitu defek genetik fungsi sel beta, defek genetik kerja insulin, penyakit eksokrin pankreas, infeksi, karena obat atau zat kimia, sindrom genetik lain yang berkaitan dengan diabetes mellitus. Mudah-mudahan jawaban saya bermanfaat, terima kasih. „ Rubrik Konsultasi Seputar Diabetes: Kerja sama PERSADA CABANG MEDAN dan Harian WASPADA Medan, untuk menjawab segala pertanyaan seputar Diabetes dan Komplikasi „ Pertanyaan dapat dikirim tertulis ke Harian Wasapada, sms ke HP. 08126505336 / 081263852525, dan email : atau dan , Sekretariat PERSADIA MEDAN (KLINIK DIABETES DHARMA) Jl. Beringin Raya No. 1 A-B Telp. 06177688850.

Malaria Masih Jadi Ancaman Di Sumut


alaria masih menjadi ancaman cukup serius bagi masyarakat di Sumatera Utara, apalagi beberapa kabupatan di daerah ini merupakan endemis penyakit yang bersumber dari nyamuk Anopheles. Penyakit ini salah satu yang menjadiperhatian,karenapenderitanya cenderung terus bertambah.SejakJanuarihinggaSeptember 2010 sedikitnya 6.932 warga terserang malaria. Di Sumut, beberapa daerah yang endemis malaria di antaranya kabupaten Langkat, Deli Serdang, Labuhan Batu, Serdang Bedagai (Sergei), Asahan, Samosir, TapanuliTengah (Tapteng),Tapanuli Utara (Taput),Tapanuli Selatan (Tapsel). SelanjutnyaMandailingNatal (Madina), Nias, Nias Selatan (Nisel), Batu Bara, Padang Lawas (Palas), Padang Lawas Utara (Paluta) dan Kabupaten Labuhan Batu Utara (Labura). Kabupaten Nias Selatan merupakan daerah tertinggi kasus malaria di Sumut dengan 1.163 kasus (3,73 persen), Madina dengan 1.225 kasus (3,12 persen),

Batu Bara dengan 785 kasus (2,07 persen), Labuhan Batu Utara (Labura) dengan 658 kasus (1,97 persen). Seperti diketahui malaria, salah satu penyakit menular yang disebabkan protozoa parasit dari golongan plasmodium dan ditularkan gigitan nyamuk anopheles melalui kelenjar ludahnya. Dengan perantara nyamuk anopheles, plasodium masuk ke dalam darah manusian dan berkembang biak dengan membelah diri. Malaria merupakan penyakit sangat berbahaya. Penderita malaria mengalami anemia atau kekurangan darah. Hal ini karena sel-sel darah merah banyak yang hancur,dirusakataudimakan parasit. Selain itu pembuluh darah otak penderita malaria tersumbat sehingga dapat menyebabkan kematian.

bisa menurunkan risiko depresi. Saat sedang stres ada baiknya menghindari makananmakanan yang menjadi pemicu stres dan dianjurkan mengkonsumsi makanan pereda stres. Hal yang perlu diketahui tentang chicken nugget. Bagi banyak orang, makanan bernutrisi merupakan makanan yang baik untuk kesehatan, terutama kesehatan fisik. Sebenarnya makanan bernutrisi juga dapat mempengaruhi kesehatan psikologis seseorang. Selama ini, banyak orang menganggap stres diakibatkan adanya masalah dalam pekerjaan atau hidup. Namun, banyak orang yang tidak mengetahui bahwa beberapa nutrisi pada makanan yang dikonsumsi dapat menyebabkan seseorang mengalami stres. Makanan memiliki kadar garam dan lemak tinggi dapat memicu produksi hormon kortisol. Hormon kortisol ini menghambat kerja serotonin yang berfungsi sebagai penenang dan

“Tentang Malaria” (Hari Malaria Sedunia, 25 April 2013) Malaria berasal dari bahasa Italia (mala+aria) berarti “udara yang jelek/salah”, sekitar tahun 1880 Charles Louis Alphonse Laveran membuktikan malaria disebabkan adanya parasit dalam sel darah merah. Sehingga malaria suatu penyakit disebabkan protozoa obligat intraseluler dari genus Plasmodium. Malaria pada manusia disebabkan P. malariae, P.vivax, P.palcifarum dan P. ovale. Penularan malaria dilakukan oleh nyamuk betina dari tribus Anopheles. Dari sekitar 400 spesies nyamuk anopheles telah ditemukan 67 spesies yang dapat menularkan malaria, 24 di antaranya ditemukan di Indonesia. Selain gigitan nyamuk, malaria ditularkan secara langsung melalui tranfusi darah atau jarum suntik yang tercemar darah serta dari ibu hamil ke bayinya. Malaria Di Dunia Malaria, penyakit dengan penyebaran sangat luas yakni antara garis bujur 60p di Utara dan 40p di Selatan meliputi lebih dari 100 negara beriklim tropis dan sub tropis. Penduduk berisiko terkena malaria berjumlah sekitar 2,3 miliar atau 41% dari penduduk dunia. Setiap tahun jumlah kasus malaria berjumlah 300-500 juta dan mengakibatkan 1,5 s/d 2,7 juta kematian, terutama di Afrika SubSahara.Wilayah di dunia yang kini sudah bebas dari malaria adalah Eropa, Amerika Utara, sebagian besar Timur Tengah, sebagian besar Karibia, sebagian besar Amerika Selatan, Australia dan Cina.

dioleskan di tubuh atau membunuhnyamukdenganmenggunakan racun serangga seperti fogging. Tidur di dalam kelambu, membersihkan tempat-tempat hinggap/istirahat nyamuk dan memberantas sarang nyamuk, membunuh nyamuk dewasa dengan menyemprot rumah-rumah dengan racun serangga, membunuhjentik-jentiknyamuk dengan menebarkan ikan pemakan jentik, membunuh jentik nyamukdenganmenyempotobat anti larva (jentik) pada genangan air dan melestarikan hutan bakau di rawa-rawa sepanjang pantai Selain itu kebersihan lingkungan juga harus terjaga. Membersihkan genangan air yang ada disekitar rumah, mengusahakan keadaan didalam rumah tidak ada tempat yang gelap dan lembab, membersihkan baju baju kotor yang ada digantungan dan menjauhkan kandang ternak dari pemukiman penduduk. Pencegahanpenyakitmalaria yang lain adalah menghindari kontak langsung dengan penderita malaria.*dr Lily

Ketika Gigi Geraham Paling Belakang Tumbuh Saat Dewasa Bagi yang belum tahu tentu aneh ketika gigi paling belakang baik di atas maupun bawah tumbuhsaatusiadewasa,bahkanbisa tumbuh saat umur sudah 25 tahun. Mungkin kita akan mengira kalaupunyakelebihangigi,karena pada umur yang sudah cukup ada gigi yang nongol lagi. Namun jangan khawatir karena itu hal wajar. Gigi paling belakang akan tumbuh kira-kira pada usia 17 sampai24tahunbahkanadayang lebih. Mungkin banyak juga yang bertanya-tanya, kenapa gigi tersebut tumbuh saat seseorang menginjak dewasa dan apa guna gigi tersebut? Pasalnya, gigi geraham paling belakang dirasa tidak membantu fungsi kunyah. Saat gigi geraham paling belakang tumbuh, siapa pun akan mengeluhkan nyeri yang hebat. Bahkan tidak jarang pertumbuhan gigi tersebut bisa mengganggu aktivitas makan, karena sakitnya.

Selain itu gigi yang tumbuh sehat,normalnyaakankeluarmelewati gusi dan terlihat utuh sempurna. Bagaimana jika gigi yang seharusnyatumbuhtersebutmengalami kegagalan ? Artinya, gigi mengalami gagal tumbuh, sehingga hanya bisa terlihat sebagian atau bahkan tidak dapat terlihat tumbuh sama sekali. Hal itu kerap terjadi pada gigi geraham paling belakang. Gangguan gigi seperti itu diistilahkan dengan gigi impaksi. Faktanya, gangguan semacam ini sering luput dari perhatian. Karena, perhatian kita lebih terkuras jika masalah itu terlihat nyata dan begitu mengganggu. Misalnya, jika timbul rasa sakit yang tidak dapat ditahan. Termasukrasasakityangditimbulkan akibatpertumbuhangigigeraham belakang ini. Jika pertumbuhan gigi tersebut hanya menimbulkan rasa sakit yang dapat ditahan, sangat besar kemungkinan seseorang akan mengabaikannya, meski

Stres Karena Uang Pemicu Orang Makan Berlebihan Dampak krisis ekonomi tidak hanya berdampak pada keadaan finansial, tapi juga kesehatan dan kenaikan berat badan. Stres yang disebabkan oleh permasalahan uang menjadi pemicu utama orang makan berlebihan. Peningkatan kekhawatiran terhadap biaya hidup menyebabkan orang beralih ke junk food. Orang yang kekurangan uang biasanya lebih memilih makanan murah daripada makanan sehat. Keadaan krisis ekonomi bisa membuat banyak orang mengalami kenaikan berat badan (obesitas) karena lebih cenderung mengonsumsi makanan tinggi kalori untuk mengurangi stres dan memuaskan tubuh lebih lama. Namun perlu diwaspadai, mengonsumsi makanan tinggi kalori saat stres justru bisa memperburuk stres itu sendiri. Konsumsi diet kaya makanan olahan bisa meningkat depresi, sebaliknya orang yang mengonsumsi banyak sayuran, buah dan ikan

Penularan penyakit malaria melalui gigitan nyamuk dimana bibit penyakit malaria dalam darah manusia terhisap oleh nyamuk, kemudian berkembang biak dan ditularkan kembali kepadaorangsehatyangdigigitnyamuk tersebut. Gejala penyakit malaria ini berupa demam tinggi dan sakit kepala. Penderita menggigil atau gemetar selama 15 menit sampai satu jam. Penderita malaria lemah dan nafsu makan menurun, mual mual yang disertai muntah, kulit menjadi kemerahan, hilangnya tingkat kesadaran atau mengiggau.Padatingkatlanjutdisertai kejang-kejang. Seseorang yang terkena malaria dapat mengalami anemia. Pada kasus malaria berat dapat menyebabkan koma, kegagalan multi organ serta menyebabkan kematian. Namun malaria dapat dicegah. Caramencegahpenyakitmalaria dapat dilakukan dengan menghindari gigitan nyamuk, yaitu memakai obat anti nyamuk, memakai krim anti nyamuk yang

pengontrol rasa gelisah, sehingga dapat dikatakan kerja serotonin dapat mempengaruhi suasana hati. Selain menghambat kerja serotonin, hormon kortisol memiliki efek terhadap pelepasan hormon neuropeptide Y dan galanin, yang dapat mengakibatkan orang ingin mengonsumsi makanan manis dan berlemak, sehingga orang akan memiliki rasa bad mood. Beberapa makanan yang dapat memicu stres, dimana makanan ini mengandung kadar garam dan lemak tinggi antara lain makanan siap saji, seperti nugget, bakso, sosis. Makanan kaleng olahan, makanan mengandung karbohidrat sederhana, seperti roti atau mie, makanan mengandung lemak trans. Selain makanan, beberapa minuman yang juga menyebabkan stres yaitu minuman beralkohol, minuman berkafein tinggi. Orang yang terbiasa minum minuman tersebut agar menghindarinya, karena dapat menyebabkan stres.

Sedangkan makanan yang menjadi pereda stres adalah makanan yang memiliki kandungan nutrisi vitamin B, terdapat pada alpukat, pisang, ikan tuna, ikan salmon, ikan sardin, susu dan yoghurt. Asam folat, terdapat pada oatmeal, jeruk atau asparagus. Magnesium, terdapat pada sayur bayam, tofu dan kacang almond. Makanan tersebut dapat membantu tubuh memproduksi dopamin yang dapat membantu anda tidur nyenyak. Vitamin C, terdapat pada buahbuahan seperti kiwi, strowberi atau jeruk. Kombinasi dari makanan yang mengandung protein, karbohidrat kompleks dan lemak sehat dapat membuat stabil gula darah dan menghindarkan seseorang makan camilan, sehingga manfaatnya lebih terasa. Terlebih jika minuman yang diminum air putih dan teh. Hal tersebut memiliki banyak manfaat, karena minuman itu juga dapat meredakan stres. *Arifah Siregar, S.Psi

kenyataannya gigi tumbuh tidak sempurna. Mulai saat ini sebaiknya kita lebih memperhatikan kesehatan gigi, baik yang menimbulkan keluhan atau tidak. Kesehatan gigi sangat penting untuk kesehatan tubuh. Dalam hal ini gigi impaksi adalah gigi yang gagal tumbuh atau tidak mencapai permukaan dan terpendam di dalam gusi. Gangguangigiimpaksidibagimenjadi dua jenis yaitu impaksi total dan impaksi sebagian. Untuk impaksi total (total impacted), gangguan tidak terlihat hanya dengan menggunakan mata telanjang. Melainkan impaksi total dapatterlihatdenganmenggunakan pemeriksaan foto rontgen. Dari foto akan terlihat jelas bagian gigi mana yang mengalami impaksi total. Pada gangguan gigi impaksi sebagian,badangigihanyaterlihat sebagian muncul di permukaan gusi. Sedangkan setengahnya lagi masih terpendam di dalam. Dari keduajenisgangguangigiimpaksi tersebut, impaksi sebagian yang banyak menimbulkan masalah. Jika hanya setengah badan gigi yang keluar, maka dapat menyediakantempatyangrawan dihinggapi kuman dengan banyaknya tersimpan sisa makanan. Maka dari itu untuk impaksi sebagian rawan terjadi perikoronitis atau pembengkakan jaringan lunak yang menutupi gigi yang akan tumbuh. Perubahan pola hidup masyarakatataucaramakanmenjadi salah satu penyebab terjadinya gigi impaksi. Orang-orang zaman dulu sering makan dengan bahan makanan yang keras, sehingga mereka mengunyah dengan maksimal. Pengunyahan maksimal tersebut mampu merangsang pertumbuhan tulang geraham secara maksimal pula dan memberikan tempat cukup untuk semua gigi. Sebaliknya, gaya hidup atau pola makan kebanyakan orangorang saat ini lebih menyukai makanan serba instan dan empuk.Perilakutersebutmalahtidak memberikan kesempatan pada tulangrahanguntukberkembang maksimal. “ Tulang rahang kekurangan tempatuntuktumbuhnyasemua gigi. Alhasil ada sebagian gigi yang terpaksa tidak bisa tumbuh.

Gigi yang biasa terkena gangguan gigi impaksi yaitu empat gigi gerahamterakhiratasdanbawah. Namunbukanberartigigilain tidak dapat terkena gangguan ini. Pada urutan kedua ditempati gigi taring yang sering terkena gangguan impaksi. Selanjutnya, gigi premolar atau gigi kecil sebelum geraham. Meski gigi impaksi bukan merupakan kondisi berbahaya, namun komplikasinya harus diwaspadai. Misalnya pada komplikasi impaksi sebagian seperti perikoronitis, gusi meradang, abses gigi, peradangan kelenjar limfa, serta kemungkinan besar terkena karisen gigi atau gigi berlubang. Jika kondisi tersebut terus dibiarkan, maka kemungkinan keluhan semakin meningkat parah. Untuk impaksi total, jika tidak ada keluhan mungkin saja tidak menjadi masalah. Namun pada sebagian kasus, impaksi total memberikan keluhan, seperti nyeri dan sakit kepala ataumigrain.Posisigigiyanggagal tumbuh jika tidak dalam keadaan posisi bagus, terkadang dapat menjepit saraf. Maka dari itu bisa memicu migrain atau juga nyeri di belakangrahangbawahyangditandai dengan bunyi khasnya “klik” saat kita mengatupkan rahang atau disebut juga dengan clicking,” tuturnya. Namun hingga saat ini, kebanyakan pasien dengan gigi impaksi datang ke dokter gigi ketika memperoleh keluhan. Kebanyakan orang tidak menyadari jika gigi mereka dalam kondisi impaksi jika tidak ada keluhan. Pada impaksi total kebanyakan tidak menimbulkan keluhan. Akan tetapi, impaksi total bisa menjadi salah satu sebab kenapa seseorang menderita migrain.Atautandalaindariimpaksi total bisa ditunjukkan dengan bunyi “klik” saat kita membuka atau menutup rahang. Saat timbul masalah segera periksakan ke dokter gigi. Perawatan yang biasa dilakukan dokter gigi yaitu mempertahankan atau cenderung mengangkat gigi tersebut. Untuk kasus impaksi gigi seperti diatas kebanyakan dicabut, kadangpadabeberapakasusyang sulit bisa jadi akan dilakukan operasi kecil (odontectomi/pencabutan gigi paling belakang dengan jalan operasi).*drg Linda


Melirik Manfaat Daun Sirsak Negeri kita sangat kaya tanaman tradisional, sayangnya tak dimanfaatkan maksimal. Produk itu kebanyakan jadi komoditas ekspor untuk dikemas dan dijual ke negara sumbernya. Ada benarnya, namun permasalahan utama di bidang medis seringkali riset yang sebenarnya sudah dilakukan berbagai dinas terkait tidak dipublikasikan. Sistem pengobatan ‘back to nature’ kenyataannya masih banyak dipertentangkan di dunia medis sendiri dibalik banyak pandangan skeptis selain juga penelitian medis memerlukan lebih banyak bukti empiris untuk menyetujui penggunaan sumber tradisional. Jadinya seringkali masyarakat sebagai pengguna malah mendapat penerangan simpang-siur, sementara mudahnya mengakses informasi dari berbagai media membuat mereka kerap mencoba mengkonsumsi produk olahan tanpa mengetahui cara pengolahan yang benar dan sesuai dengan aturan menurut hasil penelitian yang bisa dipertanggungjawabkan. Satu yang populer dan banyak dibicarakan sekaligus digunakan adalah daun sirsak. Selain dalam bentuk rebusan, banyak pula produk yang menggunakannya dalam bentuk obat-obatan yang dipasarkan melalui berbagai jalur berdasarkan berbagai riset di negara luar, yang sebenarnya sudah sangat lama dimulai, namun publikasinya baru populer belakangan ini. Buahnya memiliki banyak manfaat. Sebaiknya mengetahui dulu apa manfaat dari berbagai zat yang terkandung di dalamnya, jangan lupa selalu menanamkan kewaspadaan termasuk dalam penggunaan bahan tradisional. Bila ada efek yang tak diinginkan karenakesalahanpengolahan,segeraberkonsultasidenganahlinya. Sekilas Sirsak Sirsak berasal dari daerah tropis sekitar Amerika Tengah. Banyak juga tumbuh Indonesia. Nama latinnya Annona muricata. Banyak digunakan dalam bentuk buah atau jus, buahnya mengandung banyak jenis vitamin, selain enak, mudah didapat. Sejarah risetnya sebagai obat herbal, sirsak sering digunakan untuk mencegah berbagai penyakit dari asam urat, hipertensi, osteoporosis dan meningkatkan daya tahan tubuh. Belakangan, khasiat daunnya berkembang sangat populer dalam pengobatan herbal, apalagi berbagai riset manfaatnya terhadap pencegahan kanker banyak dipublikasikan. Buahnya sangat mudah didapat, namun daunnya diolah dan dikemas dalam bentuk suplemen berbasis herbal. Zatt Yang Terkandung Dalam Sirsak Sirsak dikenal mengandung banyak zat gizi dari kalori, protein, lemak, vitamin dan mineral. Selain betakarotene, vitamin paling dominan dalam sirsak adalah vitamin C sekitar 20 mg per 100 gram daging buahnya, karena itu memiliki khasiat antioksidan untuk meningkatkan daya tahan tubuh dan pilihan konsumsi untuk mencegah proses penuaan. Mineralnya kaya akan fosfor dan kalsium, masing-masing sebesar 27 dan 14 mg/100 gr juga banyak dinilai berfungsi untuk pembentukan massa tulang buat mencegah osteoporosis atau pengeroposan tulang. Seratnya cukup tinggi sebagai serat pangan (dietary fiber) dalam mencegah sembelit dan memperlancar pencernaan, selain juga memiliki banyak senyawa fitokimiawi. Senyawa fitokimiawi ditemukan banyak sekali terkandung di daunnya. Selain tanin dan berbagai jenis alkaloid, ada acetoginin, muricapentoin, gigantetronin, linoleic acid, anomurine, gentisic acid, annomuricin, caclourine, annonacin dan banyak lagi masing-masing memiliki manfaat berbeda bagi kesehatan. Manfaat Senyawa Dalam Daun Dari berbagai riset yang dilakukan, ada banyak manfaat daun sirsak termasuk dalam pengobatan diabetes, diare, rematik, alergi dan sebagainya. Peranan utamanya dalam riset terdahulu terbukti bekerja menghambat perkembangan kuman seperti bakteri, virusdankumanlain,berfungsimenekanperadangan,menurunkan kadarguladarah,meredakannyerihinggameningkatkanketahanan sistem persyarafan. Namun paling menarik perhatian dari daunnya adalah beberapa senyawa seperti acetoginin yang bisa mencegah proses keganasan dengan menghambat mutasi gen yang bisa menyerang sel. Bahkan, beberapa laporan menyebutkan dalam pengobatan antikanker,khasiatnyajauhlebihkuatdarikemampuankemoterapi terhadap kanker. Penelitian lain tentang ekstrak dari sebagian senyawa proaktif itu juga efektif menyerang serta memperlambat pertumbuhan kanker. Sebuah penelitian di Korea juga pernah menemukan proses senyawa kimia ini dalam memerangi kanker lebih selektif dan tidak memiliki efek merusak jaringan serta sel-sel lain yang sehat seperti pada tindakan kemoterapi. Efek ini juga meliputi efek minimal terhadap rasa mual, kehilangan berat badan dan kerontokan rambut akibat sel-sel sehat yang ikut diserang. Riset tentang hubungan senyawa kimia dengan efek antikanker sudah pernah dilakukan di Indonesia meski hasilnya masih beragam. Begitupun, sejauh ini belum ada konsensus secara medis tentangcarapengolahannyayangbenar,menyangkutjenis,jumlah, cara serta dosis pemberiannya dalam berbagai bentuk gangguan yang berbeda. Riset serta penelitian lain masih diperlukan sebagai penelitian pendukung atau lanjutan yang bisa menemukan formula pas untuktiapefekyangdiinginkan.Halinijugaharusmemperhitungkan berbagai pola atau teknik yang digunakan dalam risetnya agar diterima lebih luas termasuk dalam kaitannya dengan farmakologi medis yang harus didasari penelitian berbasis bukti ilmiah. Paling tidak, penelitian ini sudah membuka celah lebih lebar untukperkembangankedepan.Untuksementara,takadasalahnya untuk mengkonsumsi sebagai suplemen tradisional dan sumber alamiah akan lebih baik ketimbang produk yang sudah diproses tanpa kejelasan resmi. (dr. Daniel Irawan)

Sedangkan penduduk dunia paling berisiko terkena malaria adalahBalita,wanitahamildanpenduduknon-imunyangmengujungi daerahendemikmalariasepertipekerjamigran(khususnyakehutanan, pertanian, pertambangan), pengungsi, transmigran dan wisatawan.

gusi atau saluran cerna, nafas cepat atau sesak nafas, muntah terus menerus, warna air seni seperti teh tua, telapak tangan sangat pucat, sering disetai pembesaran organ tubuh yaitu limfa (splenomegali) dan hati (hepatomegali)

Malaria Di Indonesia Laporan pertama mengenai malaria dibuat dokter militer pada permulaan abad ke-19. Laporan kemudian tentang adanya wabah malaria seperti di Cirebon pada 1852-1854. Pemberantasan dilaksanakan dengan obat kina. Studi mengenai malaria lebih lengkap berasal dari permulaan abad ke-20, khususnya mengenai malaria pekerja perkebunan di Sumatera Utara. Sebelum tahun 1925, Jakarta dan sekitarnya, kota-kota di pantai Utara Jawa merupakan endemik malaria. Tahap awal (1919-1927) pemberantasan malaria dilaksanakan dengan perbaikan sanitasi lingkungan untuk mengurangi perindukan nyamuk anopheles dan pengobatan dengan kina. Untuk keperluan ini dibentuklah Biro Malaria Pusat bersama Dinas Pekerjaan Umum mengadakan program pemberantasan malaria melalui pengaturan irigasi dan saluran air (drainase). Saat ini Departemen Kesehatan yang dipimpin Menteri Kesehatan terus melaksanakan program pemberantasan malaria dengan tujuan menurunkan angka kesakitan dan kematian. Sampai sekarang masih banyak kantung-kantung malaria di Indonesia, khususnya kawasan Timur (Irian, Maluku, Timor Timur, Kalimantan dan sebagian besar Sulawesi), beberapa daerah Sumatera (Lampung,Riau,Bengkulu,SumateraBarat,SumateraUtara),sebagian kecil Jawa (Jepara, sekitar Yogya dan Jawa Barat). Lihat tabel “peta malaria di Indonesia tahun 2013”

Program Pencegahan Malaria Di Indonesia Program secara umum terus dilaksankan pemerintah melalui DepartemenKesehatanadalahmenghindariataumengurangikontak/ gigitan nyamuk anopheles (pemakaian kelambu, penjaringan rumah, repelen, obat nyamuk dsb), membunuh nyamuk dewasa (dengan menggunakan insektisida), membunuh jentik (kegiatan antilarva) baik secara kimiawi (larvasida) maupun biologik (ikan, tumbuhan, jamur, bakteri, mengurangi tempat perindukan (source of reduction), mengobati penderita malaria, pemberian pengobatan pencegahan (profilaksis), vaksinasi (masih dalam riset dan studi uji klinis).

Gejala dan Tanda Malaria Manifestasi klinik malaria tergantung pada daya tahan tubuh penderita, tingginya transmisi infeksi malaria. Berat dan ringannya infeksi dipengaruhi jenis plasmodium (P.Falciparum sering memberikan komplikasi), daerah asal infeksi (pola resistensi terhadap pengobatan), umur (usia lanjut, bayi sering lebih berat), ada dugaan konstitusi genetik, keadaan kesehatan dan nutrisi dan pengobatan sebelumnya. Gejala klasik yaitu terjadinya “Trias Malaria” secara berurutan: periode dingin (15-60menit):mulaimenggigil,penderitamembungkus diri dengan selimut dan pada saat menggigil sering seluruh badan bergetar dan gigi-gigi saling terantuk, diikuti dengan meningkatnya temperatur, periode panas : penderita muka merah, nadi cepat, dan panas badan tetap tinggi beberapa jam, diikuti dengan berkeringat, periode berkeringan: penderita berkeringat banyak dan temperatur turun, dan penderita merasa sehat. Gejala dan tanda lainnya gangguan kesadaran, kejang-kejang, panas sangat tinggi, mata dan tubuh menguning, perdarahan hidung,

Kemoprofilaksis Malaria Kemoprofilaksis bertujuan mengurangi resiko terinfeksi malaria sehinggabilaterinfeksimakagejalaklinisnyatidakberat.Kemoprofilaksis ini ditujukan kepada orang yang bepergian ke daerah endemis malaria dalamwaktutidakterlalulama,sepertituris,peneliti,pegawaikehutanan dan lainnya. Sedangkan individu yang bepergian dalam jangka waktu lama sebaiknya menggunakan personal protection, seperti pemakaian kelambu, kawat kassa dan lainnya. Doksisiklin menjadi pilihan kemoprofilaksis. Doksisiklin diminum satu hari sebelum keberangkatan dengan dosis 2 mg/kgbb setiap hariselamatidaklebihdari12minggu.Doksisiklintidakbolehdiberikan kepada anak umur < 8 tahun dan ibu hamil. *M. Aron Pase (Dokter Spesialis di Departemen Ilmu Penyakit Dalam FK USU/RSHAM)


Remaja Siswa Medan Ikut OSN Tingkat Nasional WASPADA Minggu 28 April 2013

Di Mana Letak ‘Mata Sahara?’


Struktur Richat


“Mata Sahara” seperti terlihat dari Stasiun Angkasa Internasional.

Samudera Hindia

Samudera Atlantik


ormasi bebatuan besar berbentuk bulat yang penuh warna berlokasi di barat Mauritania dikenal sebagai “Mata Sahara.” Dengan lebar kira-kira 40 kilometer dan terdiri dari lapisan endapan batu dan kwarsa, bentukan unik itu juga dikenal sebagai Struktur Richat. Ketika pertama kali ditemukan, Richat sempat disebut sebagai bekas tubrukan asteroid kuno. Berbagai penelitian kemudian menunjukkan struktur itu lebih mirip sebagai kubah geologi akibat erosi geotermal.

Di bebatuannya batuannya tak ditemukan mukan bukti kerusakan fformasii akibat kib t gelombang kejut yang disebabkan tubrukan asteroid. Juga tak ditemukan bentukan kawah akibat tekanan dari tubrukan asteroid besar. Struktur Richat menjadi tujuan populer wisatawan dan penggemar kendaraan off-road. Namun pemandangan paling mengesankan hanya bisa disaksikan para angkasawan dan ilmuwan yang mengelilingi bumi dengan Stasiun Angkasa Internasional (ISS).

Bill Bil ilP Piitz itzerr - wmpi it mp pittzzzeer@ r@i @info @ nfoaarr tz.c m • Copy opy op pyrig right h © 2013 Th T e New ew Y Yor orrk Time im mes Synd me ndica icate ica te e

ENAMorangsiswaSMPyang menang lomba Olimpiade Sains Nasional (OSN) masing-maing dari dari Sutomo 1 , Methodis 2, Methodist 3, Sutomo 1 dan Perguruan Wahidin Sudirohusodo audiensikeDinasPendidikanKota Medan. Mereka adalah EdwinWinata Hartanto siswa SMP Swasta Sutomo1,BellaGodivasiswaSMP Sutomo 1,Adinata siswa SMP Methodist 3 dan Dody Senputra SMP Methodist 2, M Raihan Fadhillah SMP DR Wahidin Sudirohusodo serta Monica Maharani SMP Sutomo 2. Kadisdik Kota Medan Parluhutan Hasibuan menyambut gembira para siswa yang akan mengikuti OSN tingkat nasional diBatampada15Meimendatang. “Saya merasa bangga atas prestasiyangmampudiraihsiswa yang seluruhnya sekolah di swasta. Artinya, persaingan yang kompetitif antar siswa membuk-


SMAU CTF Taklukkan UN 2013 Dengan Percaya Diri BANYAKNYA kendala dalam pelaksanaan Ujian Nasional (UN) tahun ini, tidak menyurutkan semangat 51 siswa kelas XII SMA Unggulan CT Foundation (SMAU CTF) untuk tetap melaksanakannya dengan penuh percaya diri, Senin (15/4) “”Ini adalah waktu yang Anda tunggu selama tiga tahun, dan saya yakin Anda siap untuk itu” seru Hendri Bahrul Alam, S.H.I,Wakasek Kesiswaan dan Ketenagaan mengawali motivasinya saat upacara pembukaan, sebelum seluruh peserta masuk ke ruang ujian. “Ada tiga ruangan yang telah kami siapkan untuk pelaksanaanUNkaliinisesuaiPanduanOperasional Standar (POS) yang berlaku. Mereka kami buat senyaman mungkin dilengkapi dengan audio speaker sebagai sarana tes Bahasa Inggris” ujar Ricky Prayogi, S.Si, Ketua Panitia UN 2013 SMAU CTF. Selama empat hari, UN di SMAU CTF berjalan lancar.“30 paket soal yang disediakan Kemendikbud memang sangat luar biasa, namun saya merasakan soal-soalnya lebih mudah dibandingkan soal-soal simulasiUNyangdisediakanguru-gurutiapharinya” ungkap Aplia Belina Siregar, siswi kelas XII asal Tapanuli Selatan. Di hari terakhir, UN ditutup sujud syukur, berdoa bersama, dan ucapan terima kasih kepada


20 Apr – 20 Mei

BIAR masalah lagi banyak, selesaikan aja satu persatu. Ada kejutan istimewa menunggu di akhir pekan. LO VE : Mundur teratur, deh. MONEY : Bikin buku catatan TES : 23, 11. pengeluaran. LUCKY DA DATES


21 Mei – 21 Jun

RENCANA bakal berjalab mulus. Banyak kegiatan seru yang akan dilakukan kalau tugas-tugas kita selesai tepat waktu. LO VE : Kok jadi ribut? MONEYY : Tahan diri. LUCKY DA DAYY : 2, 7, MONE 13.

para panitia dan pengawas yang telah turut serta mensukseskannya. “Selama lebih dari 20 tahun saya menjadi guru dan pengawas ujian di sekolah, baru kali ini saya melihat siswa selama ujian tidak menengok kiri dan kanan, tidak meminta bantuan temannya, dan sangat tertib dan jujur, “ ungkap seorang pengawas saat sharing di ruang panitia, dan dibenarkan pengawas lainnya. “Kami yakin siswa lulus 100 persen karena persiapan UN dilakukan sejak awal, mulai dari persiapan akademik dengan mengadakan try out secara rutin, simulasi, bimbingan belajar guru, instruktur bahkan trainer skala nasional dari Surya Institute. TidakhanyakesiapanmateriUN,tetapipersiapan mental spiritual juga telah dibekali. Target kita tidak hanya UN tetapi juga lulus 5 besar PTN favorit di Indonesia” ungkap Drs. Daulat Siregar M.Pd., M.Si. selaku Kepala SMAUnggulan CTFoundation. SMAU CTF berharap untuk tahun-tahun yang akan datang, pelaksanaan UN di Indonesia bisa lebih baik dan lancar. Meskipun tidak mengalami penundaan, namun SMAU CTF turut kecewa dan prihatin dengan pelaksanaan UN tahun ini. * Erzil Markos


22 Jun – 23 Jul

HARI HARI-hari berat menguras stamina. Tapi tetaplah sabar, sebentar lagi beban pikiranakan terangkat, kok. LO VE : Biar kita lagi pusing, tapi pacar tetap sayang. MONE MONEYY : Hemat! LUCKY DA TES : 1, 6, 25 DATES


24 Jul – 23 Agt

SEBEL UM mengambil SEBELUM keputusan ada baiknya dipikir seribu kali . Jangan gegabah, ya! LO VE : Kendalikan emosi. MONEY : Belajar bikin prioritas, TES : 3, 8, 12. yuk! LUCKY DA DATES


SISWA SMAYayasan Shafiyyatul Amaliyyah (YPSA) Rizki Akbar Wirasandi meraih juara pertama dalam kompetisi Information and Communication Technology (ICT) Skills Challange Award yang digelar Synergy Internasional Testing dan LCCI, Minggu lalu. Kompetisi yang diikuti puluhan siswa SMA dari sebelas SMAdiKotaMedansepertisiswasiswa dari SMA Negeri 1 Medan, SMA Negeri 3 Medan, SMA Imanuel, SMA Methodist 1, SMA Cinta Budaya, SMA WR Supratman 1, SMA Harapan 1, SMA Shafiyyatul Amaliyyah, SMA I Raffles, SMA Global Prima Internassional dan

SEDIKITNYA 200 peserta unjuk kebolehan dalam ajang lomba fashion show bertajuk Sophie Happy Family 2013 yang digelar Sophie Paris BC Rosida Medan di Palldium Mall Medan, Minggu (21/4) lalu. Event dalam suasana Hari Kartini itupun mendapat sambutan hangat dari pengunjung mall. Seakan tak ingin ketinggalan moment, ratusan pengunjung mall merengsek ke depan panggung untuk menyaksikan satu persatu peserta lomba menunjukkan kepiawaiannya berjalan di atas catwalk. Busana glamor yang membalut peserta lomba menambah kemeriahan acara. Lomba yang rutin digelar ini memperlombakan delapan kategori sekaligus, mulai dari anak putra-putri, remaja pemula putra-putri, remaja umum putra-putri, lomba kebaya kartini, hingga kategori happy family yang pesertanya member BC Rosida Medan. Setelah melewati tahap demi tahap lomba, akhirnya tampil sebagai juara kategori bergengsi remaja umum putri adalah Wulan Louse. Remaja cantik ini berhasil menyisihkan puluhan peserta lainnya. Posisi kedua diraih Anggi Rafila dan ketiga Eca. Untuk kategori remaja umum putra, gelar juara diraih Dolly Putra, disusul Imam dan Teguh. Hasil lomba lainnya, Anak Putra: Djibril, Haikal, Redly. Anak Putri: Tarisa, Afifah Louse, Keisha. Remaja Pemula Putri: Silvy Yank, Ami Namira, Riri. Remaja Pemula Putra: Leo Magsi, Dandy, Michael. Kebaya Kartini: Hesty, Katarina Purba, Nova Lubis. Happy Famili: Mama Sonia, Lumbanraja, dan Noviana. “Kita bangga karena lomba kali ini mendapat antusiasme yang tinggi dari peserta. Kami akan terus mengadakan event serupa sebagai wadah pengembangan minat bakat remaja di bidang fashion show,” ujar Rosida, owner Sophie Paris BC Rosida Medan, Sabtu (27/4). *m42 24 Agt – 23 Sep

tikan bahwa kota Medan mempunyai siswa yang memiliki prestasi dan patut dibanggakan. Harapan saya mereka semua bisa ikut lomba dan berhasil membawa kemenangan, agar kota Medan sukses mencetak pelajar berprestasi,”kata Parlu-

hutan kemarin. Hal yang sama disampaikan Kabid PPD, Syarial MPd dengan diutusnya siswa dari Medan ke Batam untuk lomba tingkat nasional memberikan bukti bahwa mutu akademik di Medan semakin bisa diperhitungkan.

“Disdik memberikan apresiasibagisemuasekolahyang mampu mencetak siswa berprestasi dan bisa bersaing tingkat nasional. Utusan dari Sumut ada 9 orang, enam di antaranya dari Medan,”kata Syahrial. Anum Saskia

Siswa YPSA Juara Kompetisi ICT

Wulan Juara Fashion Show

Kepala SMA Unggulan CT Foundation (SMAU CTF) Drs Daulat Siregar, M.Pd., M.Si. saat melaksanakan rapat dengan para guru pengawas di usai pelaksanaan UN di sekolah itu belum lama ini.


Siswa yang akan ikut lomba tingkat nasional berpose bersama Kadisdik Medan usai audiensi di Kantor Dinas Pendidikan Medan.


SMA Santo Thomas 1 Medan. Rizki AkbarWirasandi, siswa kelas XI Upper Secondary YPSA mengatakan, ada dua sesi ujian yang harus dikerjakan dalam lomba tersebut. Sesi pertama yakni tes microsoft access. Di sini peserta diminta mengerjakan administrasi seorang sekretaris dalam menyusun daftar member club.Sesikeduayaitutesmicrosoft excel. Di mana peserta berperan sebagai bendahara, yang harus mampu menulis secara detil masukan yang didapat dari dua seller dan dibuat ke dalam grafik. “Saya sangat senang dengan prestasi ini, karena sebelumnya tidak terpikir menang, karena menurut saya lawan berat-berat semua. Namun saya berusaha terus,” tambah Rizki. Kepala SMA YPSA Rudi Sumarto, S.Si, mengaku sangat senang atas prestasi yang diperoleh Rizki. “ Semoga dapat terus ditingkatkan, jangan cepat puas” tambah Rudi. Education Consultant, Ulfi Syafri menyatakan kompetisi ini digelar sebagai bentuk program persiapanLCCIpadabidangstudi ICT. Selain itu lewat kompetisi ini juga para siswa di kota Medan memiliki bekal dan keterampilan


Kepala SMA Rudi Sumarto, S.Si, Kabag Umum Arizal, SH dan Irsal Efendi PKS III SMA YPSA bersama Rizki Akbar Wirasandi siswa yang berhasil meraih juara pertama di ajang kompetisi Informatika and Communication (ICT Skills Challege Award di kota Medan baru-baru ini. di bidang ICT khususnya pada word processing, spreadsheets, databases, presentation software, email, internet dan IT security. Ia menambahkan puluhan siswa dari sebelas SMA se-Kota Medan yang bersaing dalam kompetisi ini semuanya telah melalui seleksi yang cukup ketat. “Dari masing-masing sekolah yang kita tunjuk, diseleksi selama dua minggu, sehingga didapat dari masing-masing sekolah mengirimkanempatdelegasinya,” sebutnya. Ke-empat siswa yang mewakili masing-masing sekolah ini merupakan siswa kelas 10 dan 11 yang memiliki keunggulan

dibidangmicrosoftofficedanexel. Seusai terpilih, mereka bersaing untuk uji kemampuan di bidang ICT bersama perwakilan siswa dari sekolah lainnya. Dari kompetisi tersebut, maka didapat siswa dari YPSA, Rizki Akbar Wirasandi sebagai juara pertama, disusul juara kedua Kartini dari SMA WR Supratman1 dan juara ketiga Albert Evan Eugene Purba dari SMA Santo Thomas 1. Ketiganya mendapat penghargaan sertifikat yang langsung diserahkan dari PSB Academy, uang tunai dan tropy dan Schoolarship khusus ICT yang diserahkan langsung dari Synergy. Erzil Markos

Siswa SMKN 5 Dapat Dukungan Wali Kota Medan SEBAGAI sekolah yang mencetaksiswamemilikikeahliandan keterampilan berbagai bidang antaralain,teknikotomotif,teknik bangunanmaupun teknikinstalasi listrik . Menjadi sekolah yang patut diperhatikan dalam berbagai skala prioritas. “Lulus sekolah, kemudian bekerja tentu sebagian anak menginginkannya. Dengan berbagai keahlian yang didapatkan di sekolah kejuruan seperti SMKN

5 ini tentunya perlu terus didukung,”kata Wali Kota Medan, Rahudman Harahap saat meninjau pelaksanaan Ujian Nasional di sekolah itu Senin lalu. Kepala Sekolah H Maraguna MAP mengakui jika lulusan sekolah itu sudah menempati posisi pekerjaansesuaidenganketerampilan yang dimiliki. Apalagi, kata dia, tujuan dari SMK tak lain menyiapkan siswa untuk memasuki lapangan kerja dan mengem-

bangkan sikap profesional sesuai dengan bidang keahliannya. Menyiapkan siswa agar menjadi manusia yang produktif dan kreatif.Menghasilkantenagakerja tingkat menengah untuk mengisi kebutuhan DU/DI saat ini dan masa akan datang. “Kami bangga mendapat dukungan dari berbagaipihak,agarSMKmenjadi sekolah pilihan bagi lulusan SMP sederajat,”kata Maraguna. Anum Saskia


Wali Kota Medan, Drs H Rahudman Harahap saat meninjau pelaksanaan UN di SMKN 5 Medan bersama kepala sekolah dan guru sekaligus pihak Yayasan SMK Tri Tech yang ujian di sekolah ini.

23 Okt – 22 Nov


22 Des – 20 Jan


20 Feb – 20 Mar

KALAU lagi ada ide, laksanakan segera. Kalaupun belum bisa, tulis ide di buku catatan kita. LO VE : Stop mikir yang belum tentu terjadi. MONEY : TES : 12, 13, 16. Lancar jayaaa. LUCKY DA DATES

MESKI banyak masukan dari temanteman dan keluarga, coba rasakan dengan hati apa yang benarbenar kita inginkan. LO VE : BerbungaTES bunga. MONE MONEYY : Aman. LUCKY DA DATES : 17, 28, 30.

BERBAGAI usaha mulai berbuah manis. Tapi, teruslah cari info baru dan berkreasi. Banyak peluang bagus nih. LO VE : Kok bosan ya? MONEY : Menyisihkan uang buat kado TES : 4, 9, 12. teman yuk. LUCKY DA DATES

BIAR nilai-nilai di sekolah lagi banyak yang tinggi, tetap rajin belajar ya. Kalau lengah, bisa-bisa turun lagi. LO VE : Coba ngobrol lagi. MONE MONEYY : Bawa bekal, deh. LUCKY DA TES : 16, DATES 29, 31.





24 Sep – 22 Okt

BANY AK dukungan dari ANYAK teman, nih. Manfaatkan yuk, untuk bikin proyek baru atau rencana kegiatan liburan seru. LO VE : Sapa dia di socmed dong. He eh. MONEY : Nabung dong. TES : 4, 22, 25. LUCKY DA DATES

23 Nov – 21 Des

TEMAN TEMAN-teman banyak yang ngajak kita main terus. Enggak apa sekalikali menolak mereka. Ingat tugas menumpuk. LOVE : You get what you give. MONEY : Aman kalau enggak kebanyakannongkrong. He – eh. LUCKY DA TES : 4,8 27. DATES

21 Jan – 19 Feb

K AL AU sabar, pasti yang ALA ditunggu-tunggu akhirnya kesampaian OVE : Aman. juga. LLO MONEY : Banyak pemasukan tapi kok TES : 13, 17, 20. bikin pusing? LUCKY DA DATES

21 Mar – 19 Apr

PUJIAN datang bertubitubi. Tapi tetap rendah hati. Tetap tekun dan pertahankan semangat. LOVE : Move on dong. MONEY : Sisihkan TES : 8, sedikit aja setiap hari. LUCKY DA DATES 12, 13. m31/ KW **m31/KW

B9 Remaja Hindari Aksi Coret-coret Siswa Gelar Kegiatan Amal WASPADA Minggu 28 April 2013

EUFORIA siswa usai pelaksanaan Ujian Nasional (UN) dilakukan dengan berbagai cara, salah satunya aksi coret-coret pakaian yang jadi salah satu trend di kalangan pelajar di tanah air. Aksi ini dibarengi dengan konvoi kendaraan yang bisa berujung tawuran, bahkan di beberapa wilayah aksi tersebut telah menimbulkan korban jiwa. Untuk meredam aksi tersebut, beberapa sekolah di kota Medan berusaha mengarahkan siswa pada kegiatan positif yang lebih mendidik. Seperti di SMA Harapan 3 Jalan KaryaWisata Ujung, Medan Johor usai Ujian Nasional susulan bagi siswa SMA jurusan IPS, Kamis (25/4), mereka ramai-ramai melakukan aksi coret-coret. Namun aksi ini bukan di pakaian

sekolah melainkan pada sebuah spandukukuran1x10meteryang telah mereka sediakan. Di sana mereka bebas melakukan aksi coret-coret dan membubuhkan tandatangan. KepalaSMAHarapan3Abdul Jalil melalui wakil kepalaWahyu, SPd mengatakan spanduk yang dicoret-coret tersebut nantinya akan disimpan di sekolah sebagai kenang-kenangan jika nanti me-


Lilia Sarifatamin Damanik

Ada Kesan Berbeda Aksi coret pakaian, menurut Lilia Sarifatamin Damanik masih menjadi trend bagi siswa. Karena itu merupakan salah satu cara mengungkapkan rasa senang setelah melaksanakan UN, karena mungkin ini saat terakhir setelah tiga tahun kami bersama-sama menuntut ilmu di sekolah ini, dan ini jadi satu kenang-kenangan. Namun Lilia sapaan akrab gadis manis siswa kelas XII SMA Harapan 3 ini, “Jika coret-coret dipakaian mungkin tidak semua teman bisa melakukan atau menorehkan tandatangannya di baju kita. Namun jika di spanduk semua teman bisa menorehkan tandatangannya di sana, sehingga suatu saat kita reunian ini akan menjadi kenang-kenangan, jadi kesannya lebih berbeda,” ucapnya. Walau mengaku tidak melakukan aksi coret, tapi menurutnya coret-coret pakaian usai UN oke-oke saja, asal tidak menganggu keamanan dan merugikan orang banyak, apa lagi sampai menyebabkan tawuran. “Karena coret-coret pakaian merupakan satu ungkapankebahagiaanyangmungkininihariterakhirkitamemakai pakaian seragam sekolah bersama-sama, ungkapnya. Erzil Markos

Waspada/Erzil Markos

SISWA SMA Harapan 3 melakukan aksi coret-coret di sebuah spanduk yang telah disediakan sebagai wujud rasa bahagia usai melaksanakan UN di sekolah itu, Kamis lalu.

Membangun Rasa Peduli Lewat Sumbangan Seragam Sekolah KAMIS lalu saat Ujian Nasional (UN) berakhir, ratusan siswa SMPN 3 Medan menyerahkan seragam sekolahnya kepada guru dan kepala sekolah. Mereka ingin seragam yang telah mereka pakai selama menimba ilmu di sekolah memberi manfaat pada orang lain. Kepala Sekolah Hj Nurhalimah Sibuea MPd menyahuti keinginansiswadenganmenyiapkan kotakkardussebagaipenampung pakaian siswa tahap awal. Setelahnya, siswa bisa memberikan pakaiannya langsung kepada pihaksekolahyaknigurumaupun wali kelas. “Ya, kami merasa bangga dengan inisiatif siswa. Saya lihat pakaian yang mereka sumbangkan masih cukup layak pakai. Nanti akan disumbangkan pada siswa yangmemerlukan.Sayaberharap apa yang mereka lakukan jadi contohbagisiswaberikutnyayang akanlulus.Sehinggapengetahuan

tentang kepedulian sosial yang diberikan oleh guru kepada mereka benar-benar bisa teralisasi dengan baik,”kata Nurhalimah yang berharap sikap ini masih bisa dilanjutkan di lingkungan tempat tinggalnya. Ahmad, pelajar yang turut serta menyumbangkan seragam sekolahnya mengakui jika pemberian seragam ini bentuk kepedulian siswa terhadap siswa yang memerlukanpakaianuntuksekolah. “ Kalau secara umum, semua orang tua pasti bisa membelikan seragam sekolah anaknya. Tapi bagi kami sebagai siswa, memberikan seragam ini daripada kami coret-coret bagian dari pendidikan sosial dan kepedulian terhadap sesama. Bagaimanapun memberi adalah pekerjaan mulia, jika kami mengotori dengan mencoretberartikamimelakukan pekerjaan yang mubazir,”kata Ahmad yang mengaku semua materi UN bisa dijawab dengan

Waspada/Anum Saskia

reka mengadakan reuni. Selain melakukan aksi coret di spanduk, siswa juga melakukan aksi mengumpulkan seragam sekolah, sepatu, buku, alat tulis dan lain sebagainya. Menurutnya kegiatan ini dinilailebihbermanfaatdanmendidik dibanding jika anak-anak melakukan aksi coret-coret di luarsekolah,“Kamimengarahkan anak-anak untuk melakukan tindakan lebih bernilai positif dan lebih bermanfaat bagi orang banyak,”ungkapnya. Wahyu menjelaskan pakaian bekas layak pakai yang disumbangkan siswa ini nantinya akan disalurkan kepada warga sekitar yang kurang mampu, mudahmudahan dapat memberi manfaat bagi mereka. SMP Al-Azhar Halyangsamajugadilakukan siswa SMP Al-Azhar Medan. Usai pelaksanaan UN mereka menggelar berbagai kegiatan di antaranya aksi mengumpulkan pakaian sekolah bekas, shalat dhuha berjamaah, dirangkai dengan doa dan sujud syukur atas terlaksananya UN dengan baik. Kemudian sore hari dilanjutkan dengan menggelar kompetisi sepakbolaantarkelasdilapangan sepak bola sekolah itu. Sebelumnya para siswa dikumpulkan di area lapangan basket untuk mendengarkan arahan Kepala SMP Al-Azhar Agustono. MM kemudian mereka diminta menyerahkan surat pernyataan untuktidakmelakukanaksicoretcoret yang ditandatangani siswa dan orangtua. Kemudia siswa mengumpulkan pakaian sekolah bekas yang terdiri dari baju seragam, sepatu dan buku yang rencananya akan diserahkan ke panti asuhan. Setelah itu siswa diarahkan menuju masjid sekolah untuk shalat dhuhadandoabersamasebagaisujud syukur telah terlaksananya UN.

Pada siang menjelang sore kegiatan dilanjutkan dengan pertandingan sepak bola antar kelas di lingkunganSMPAl-AzharMedan. Kepala SMP Al-Azhar Agustono.MM menjelaskan, kegiatan ini sengaja digelar dari siang usai UN hingga sore hari agar siswa tidak berkeliaran di luar sekolah, sebabdikhawatirkanmerekaakan terlibat aksi coret-coret dan konvoi kendaraan. Kemudian besok harinyaJumat(26/4)semuasiswa akandiberangkatmenujuParapat untuk acara perpisahan. “Dengan demikian tidak ada kesempatan bagi siswa untuk melakukan kegiatan-kegiatan yang tidak bermanfaat,” ungkapnya. SMP YPSA Lakukan Aksi Sosial Siswa-siswi kelas IX SMP YPSA usai pelaksanakan UN melakukan aksi sosial dengan mengumpulkan perlengkapan sekolah seperti seragam sekolah, sepatu sekolah, tas sekolah, buku pelajaran,pulpen,pensil,danlainlainuntukdisumbangkankesalah satu panti asuhan di Kota Medan,

Waspada/Erzil Markos

SISWA SMPYPSA mengumpulkan seragam sekolah bekas, sepatu, buku dan alat-alat tulis lainnya untuk disumbangkan kepada panti asuhan usai UN di halaman masjid Shafiyyatul Amaliyyah sekolah itu. Kamis (25/4). Kepala SMPYPSA Indra Suardi,M.A., mengatakan, aksi sosial ini dilakukan untuk memerangi aksi coret-coret selama ini sudah membudaya dan untuk meningkatkan rasa kepedulian kepada sesama yang kurang beruntung.

Waspada/Erzil Markos

SISWA SMP Al-Azhar Medan melaksanakan shalat dhuha dan melakukan sujud syukur dan doa bersama usai melaksanakan UN di Masjid sekolah, Kamis (25/4).

“Insyaallah hasil pengumpulan sumbangan anak-anak ini, akan disumbangkankesalahsatupanti asuhan di kota Medan,” ungkapnya. Faradiba, siswi kelas IX mengatakan, “Kegiatan ini bentuk rasa syukur kepada Allah SWT yang telah memberi kesehatan dan keselamatan kepada kami semua dalam menjalankan UN selama4hariini.Semoganantinya kamidapatlulus100persen,amin ya rabb”. “Aksi ini juga kami lakukan untuk menghindari kegiatan coret-coret yang biasa dilakukan siswa usai hari terakhir UN. Kiranya apa yang kami berikan, walaupun sedikit namun dapat bermanfaat kepada yang menerima”, ungkap Faradiba. Aksi sosial ini didukung sepenuhnya oleh PembinaYPSA Drs. H. Sofyan Raz, Ak.M.M., dan Ketua UmumYPSA Hj. Rahma-waty serta guru-guru lainnya. Di SMP YPSA sebanyak 88 siswa-siswi mengikuti Ujian Nasional tahun ini. Erzil Markos

Pesantren Ar-Raudlatul Hasanah Buka Pendaftaran Belajar Bahasa Arab BAHASA Arab adalah bahasa Universal karena Islam diturunkan di Mekkah dan Alquran di turunkan dengan menggunakan bahasa Arab dan salah satu cara untuk memahami Alquran adalahdenganmenguasaibahasa Arab. Pesantren Ar-Raudlatul Hasanah sebagai pesantren wakaf yang mendidik santri/santriwati untuk dapat memahami dan berbicara dengan Bahasa Arab, dan untuk mewujudkan hal itu

dengan terus bekerjasama denganpihak-pihakluarnegeriyang berdialog menggunakan bahasa tersebut dalam kesehariannya. Tahun ini, Pesantren Ar-Raudlatul Hasanah diamanahi untuk menyelenggarakan Daurah Bahasa Arab dan Muqabalah UniversitasIslamMadinahTahun 1434 H/2013 M. Acara ini bertajuk al-Daurah al-Tadribiyah Li Mu‘allimi al-Lughah al-Arabiyah wa al-Tsaqafah al-Islamiyah.

Acara yang akan digelar 1 Juni hingga 15 Juni 2013 tersebut bertempat di area kampus Pesantren Ar-Raudlatul Hasanah. Pendaftaran dimulai 26 April 2013., Kuota pendaftar yang diterima untuk tahun ini hanya 250 orang. Untuk itu, pendaftaran akan ditutup bila kuota yang mendaftar telah terpenuhi. Ust.MiftakhuddinSS,sebagai ketua panitia menuturkan bagi mereka yang berminat, dapat mendownload formulir yang kini

dapat diakses melalui web pesantren ( untuk kemudian mengembalikan kembali dengan mengirimkannya via email ke Error! Hyperlink reference not valid. dengan melampirkan surat tugas yang telah discan dari lembaga masing-masing. Setiap peserta diharapkan mengirim melalui satu email pribadi. Tidak diperkenankan mengirim dalam satu email secara bersama. Erzil Markos

PARA Siswa nampak bergembira saat kepala sekolahnya, Hj Nurhalimah Sibuea MPd menerima secara simbolis seragam sekolah yang diserahkan usai UN Kamis lalu di SMPN 3 Jalan Pelajar Medan. sempurna dan yakin nilainya cukup bagus saat pengumuman nantinya. Sebelumnya, semua siswa dikumpulkan di tanah lapang, selanjutnya mendapat pengarahan dari kepala sekolah. Selanjutnya para siswa memberikan seragam

kepadapihaksekolahuntukdiberikan pada yang berhak menerimanya.Adajugayanginginmemberikannya langsung sebelum mengambiltandakelulusanpada bulan Juni mendatang. Anum Saskia

Siswa SMP Muhammadiyah I Dididik Berdakwah MENGHADAPI perubahan zaman yang sedemikian cepat dantelahmelindasbudayaandan nilai-nilai agama, bahkan dalam perkembangannya telah membuatgenerasimudahbanyakyang meninggalkanajaranagama.Halhal yang dulunya dianggap tabu, saat ini sudah menjadi biasa sehingga rasa takut pada hukum Allah pun semakin berkurang. Untuk mengantisipasi hal itu sekaligus untuk membentengi diri dengan ilmu-ilmu agama siswa-siswiSMPMuhammadiyah 1 yang berlokasi di Jalan Demak, Medan setiap pagi Jumat melaksanakankegiatankeagamaanyang semua penyelengaraannya dilaksanakan sendiri oleh siswa mulai dari protokol, pembacaan ayat suci Alquran hingga yang menjadi penceramahpun siswa-siswi sendiri secara bergiliran.

Dinda Mutiara

Dinda Mutiara, siswa kelas IX Unggul SMP Muhammadiyah 1 Medan dalam tausiahnya pada ceramah agama pagi yang dilaksanakan di halaman sekolah itu, Jumat (19/4) lalu mengajak selu-

ruh teman-teman siswa untuk belajar sungguh-sungguh. “Sebagai generasi muda tugas tanggungjawabkitaadalahbelajar,jadi jangan sia-siakan waktu dan kesempatan yang kita miliki saat ini, manfaatkanwaktukitauntukmenuntut ilmu demi kebahagiaan kita di masa yang akan datang,” ungkapnya. KepalaSMPMuhammadiyah I Medan, Paiman SPd mengaku bangga dengan penampilan siswanya yang mampu menyampaikan tausiah dengan baik. “Sebagai seorang muslim, dakwah merupakan kewajiban, karena tanpa proses dakwah Islam akan sulit berkembang, keadilan, dan kebenaran tidak akan bisa tegak di muka bumi ini,”ungkapnya. Untuk itu siswa perlu mengetahui seluk beluk berdakwah, mulai dari hakekat dasar hukum,

materi, sistematika, hingga metode dakwah. Semakin baik pemahan terhadap dakwah, maka seseorang dapat memposisikan diri dalam dunia dakwah. “Ini merupakan suatu sistem pembelajaran di mana siswa dituntut mampu berbicara dihadapan orang banyak, sehingga merekabisamenyampaikandakwahnyamelaluikebiasaan-kebiasaan yang telah kita tanamkan sejak dini, hal ini bertujuan agar umat Islam terus melahirkan generasi-generasi pendakwah,”ungkapnya. Paiman berharap kegiatan inimampumendorongsiswauntuk tetap berdakwah setidaknya dakwahuntukdirinyadankeluarganya dan selanjutnya mungkin merekaakanbisaberdakwauntuk masyarakat di sekitarnya. Erzil Markos

7 Siswa As-Syafi’iyah Study Banding Ke Malaysia UNTUK meningkatkan kerja sama yang telah dirintis sejak tiga tahunlaludenganbeberapasekolah di negara Malaysia, sekaligus meningkatkan dan menambah wawasan, 7 siswaYayasan Pendidikan As-Syafi’iyah Internasional Medan,akanmelaksanakanstudy banding ke negara Jiran itu 29 hingga 1 Mei mendatang. Dalamstudybandingtesebut para siswa akan berkunjung ke Sekolah Menengah Kebangsaan (SMKak) Melaka dan Maahad Kajang, Selangor, ke tujuh siswa itu adalah satu orang dari SD yaitu Danisha Humaira, tiga dari SMP yaitu Elfahrah Casanza Amalda, UtamiHandayanidanFairuzZahra Amani, dari SMA Halimatussakdiah, Muhammad Hariadi Prabowo, Eka Rara AyuTri Pratiwi dan dua guru pendamping yaitu Miftahuddin SPdi dan Lindayani. Ketua Majelis Pendidikan Perguruan As-Syafi’iyah Internasional Drs Ridan Riska Putra, M.Pd didampingi ketua rombonganstudybandingMiftahuddin, SPdImengatakankegiataninimerupakan program yayasan yang


ROMBONGAN siswa As-Syafi’iyah Internasional Medan yang akan study banding ke Malaysia bersama Ketua Majelis Pendidikan Drs Ridan Riska Putra, M.Pd di sekolah itu, Sabtu (27/4). dilaksanakan setiap tahunnya. “Selama ini kita telah menjalin hubungan kerja sama dengan beberapa sekolah di Malaysia dan siswayangdiberangkatkan adalah mereka yang berprestasi atau mendapat rangking di kelas ma-

sing-masing, mulai dari SD, SMP, dan SMA,” ujarnya. Menurutnya, dalam hubungan kerja samaYayasan PendidikanAs-Syafi”iyahdenganbeberapa sekolah di Malaysia tidak hanya sebatas melaksanakan study

banding. Namun dalam waktu dekat juga akan dilaksanakan pertukaran pelajar, di mana pada bulanJuninantisebanyak20orang siswa akan berlajar di Malaysia dan begitu juga sebaliknya siswa dari Malaysia juga akan belajar di As-Syafi’iyah. Ridanmenjelaskan,diberangkatkannya siswa berprestasi ini diharapkan dapat memotivasi siswa lainnya untuk bersaing secara sehat, selain itu untuk melihat-lihat secara langsung sistem pendidikan serta sarana dan prasarana di sekolah itu sehingga diharapkan dapat menjadi perbandingan bagi As’Safi’iyah nantinya. Dalam kesempatan itu Ridan berpesan kepada seluruh siswa dan rombongan yang akan berangkat untuk tetap menjaga kesehatan khususnya selama dalam perjalanan, sehingga study banding ini dapat berjalan dengan lancardandilaksanakandenganbaik sehinggadapatmemberimanfaat serta pembelajaran bagi siswa dan rombongan. Erzil Markos


TIM Robotik STMIK Potensi Utama berhak tampil di ajang Kontes Robot Indonesia dan Kontes Robot Pemadam Api Indonesia Divisi Beroda 2013 di Semarang, 13-16 Juni mendatang.

Tim Robotik Potensi Utama Lolos KRI-KRPAI Nasional KERJA keras tim robotik STMIK Potensi Utama Medan berbuah manis.Ya, mereka kembali sukses melaju ke tingkat nasional Kontes Robot Indonesia (KRI) dan Kontes Robot Pemadam Api Indonesia (KRPAI) Divisi Beroda 2013 di Semarang, 1316 Juni mendatang. Tim Robotik STMIK Potensi Utama yang akan bertanding ke tingkat nasional nanti adalah tim SARAF PU untuk (KRI) dan GAR PU untuk (KRPAI) Divisi Beroda. Tim SARAF PU dan GAR PU saat KRI Regional I Sumatera pada 18-19 April 2013 di GOR Saburai, Bandar Lampung, berhasil menduduki posisi kedua dan ketiga. Kontes tersebut diikuti 66 tim dari 27 perguruan tinggi di Sumatera. Rinciannya 10 tim kategori KRI, tujuh tim KRSBI (Kontes Robot Sepak Bola Indonesia), enam tim KRSI (Kontes Robot Seni Indonesia), 24 tim KRPAI Divisi Beroda, dan 19 tim KRPAI Divisi Berkaki. Koordinator Potensi Utama Robotik Club (PURC), Iwan Fitrianto MKom didampingi Kabag Humas Asbon Hendra SKom, menjelaskan ajang nasional ini sudah ke-5 kalinya akan

diikuti tim robotik STMIK Potensi Utama untuk KRI dan yang ke4 untuk KRPA Divisi Beroda. Ditambahkan, masingmasing divisi sudah mempersiapkan diri kembali bertanding dengan matang, karena ajang bergengsi tingkat nasional ini dapat meningkatkan pengetahuan mahasiswa mengenai teknologi robotic terbaru. “Trial Eror yang selalu dilakukan dalam proses pembuatan robotik yang bisa menghabiskan waktu hingga tiga bulan lebih itu, sangatsesuaidenganprestasiyang akhirnya diraih. Sebab di wilayah regional saja, banyak pesaingpesaing tangguh untuk dikalahkan,apalagiditingkatnasional, mahasiswa akan semakin bersemangat dan terpacu memperlihatkankemampuanmereka,” ujar Iwan, Sabtu (27/4). Dijelaskan, prestasi pernah diraih tim robotik STMIK Potensi Utama berawal dari KRI 2008, di mana Club Robotik STMIK Potensi Utama mengirim robot dengan nama “Siluman” dan mendapat juara III serta Best Design tingkat Regional I Sumatera di Poltek Caltex Riau. Selain itu, pada tahun yang

sama KopertisWilayah I SumutAceh mengadakan kontes robot pengikut garis atau Growth Centre Following Robot Competition 2008 dan Club Robotik STMIK Potensi Utama menjadi pemenangpertamadengannama robotnya “D-Batax”. Pada 2009, Club Robotik STMIK Potensi Utama mengirim robot untuk Divisi KRI dengan nama Climb PU, Divisi Beroda (Savior), Divisi Berkaki (Laskar PU), dan Divisi Expert Single (DRIM THRU). Untuk Divisi Expert Single, PotensiUtamamenjadijuarapertama tingkat Regional I Sumatera yangdiselenggarakandiPoltekCaltexRiau.PotensiUtamajugamenjadijuaraumumGrowthCentreLine Following Robot Competition II 2009 Piala KopertisWilalayah I. Selanjutnya pada 30 April1Mei2010mengikutikontesrobot tingkat Regional 1 di Pangkalpinang., di mana tim Potensi Utama untuk KRI meraih juara pertama dengan nama robotnya ANTS PU dan berhak bertanding ke tingkat nasional di Malang pada Juni 2010. Untuk Kontes Robot Cerdas Indonesia (KRCI), Potensi Utama juara kedua dengan

robotnya Laskar PU. Tahun 2012, Potensi Utama juara II KRI dan KRCI Regional I Sumatera di Politeknik Negeri Batam, juara I dan II Kontes Line Following Robot Competition, juara I Robot Kreatif USU, serta Desain Terbaik Minangkabau Robot Contest Politeknik Negeri Padang. Berikut di tahun 2012, tim STMIK Potensi Utama tampil sebagai juara harapan KRI, juara II Kontes Robot Cerdas Indonesia, Desain Terbaik Robot Cerdas Indonesia Divisi Beroda Regional 1SumateradiSTMIKPotensiUtama,sertajuaraIdanIIDiesNatalis Line Follower Contest Politeknik Negeri Medan. “Dari tahun ke tahun, potensi dan prestasi mahasiswa STMIK Potensi Utama di bidang robotik terus meningkat. Hal ini tidak terlepas dari dukungan penuh semua pihak, khususnya pihak yayasan yang senantiasa memberi dukungan penuh bagi setiap mahasiswayanginginmelakukan ujicoba dan pembuatan robot serta mengikuti kompetisi tingkat regional maupun nasional,” ujar Kabag Humas STMIK Potensi Utama, Asbon Hendra. *m42



WASPADA Minggu 28 April 2013

Sastra Dan Kotak Hitam Sejarah Oleh: Jones Gultom


EBAGAI nusantara, Indonesia menyimpan banyak sekali “kotak hitam” sejarah yang hingga saat ini tidak pernah dibuka. Atau memang, barangkali sudah tak ada lagi yang mampu membukanya. Boleh jadi, karena sang juru kunci terakhir telah tiada. Tetapi banyak pula yang memang sengaja ditutupi, demi berbagai alasan. Padahal, sepahit apapun sejarah, mestinya tetap harus dibuka demi kepentingan pembelajaran di masa depan. Pertanyaannya, siapakah yang paling berkompeten untuk mengungkap “kotak hitam” itu? Secaraumum,kitaakanlangsung menunjuk para sejarawan. Namun pada prinsipnya setiap orangbolehsajamengambilperan itu, termasuk para sastrawan. Tetapi segera pertanyaan-pertanyaan muncul. Apakah konsepsi sejarah bagi sastrawan? Sejauh mana sastra mampu menegaskan dirinya terhadap peristiwa sejarah? Binhad Nurohhmat, pernah menulis di Kompas, beberapa waktu lalu. Ia menyuguhkan kekhawatiran atas peran imajinatif

sastrawan ketika akan membuka “kotakhitam”sejarah.Sayangnya, Binhad terburu-buru menyerahkanjawabankepadamoralitas sastrawan. Menurut saya, untuk mengungkap“kotak hitam” itu, seorang sastrawan harus mengawali kerjanya sebagai sejarawan.Yakni setidak-tidaknya menggunakan metode penelitian sejarah yang standart. Pengumpulan dan konfirmasi data digunakan untuk memastikan fakta yang terjadi. Termasuk pula proses triangulasi yang bebas nilai. Dalam hal ini, sastrawan harus benar-benar meletakkan dirinya sebagai sejarawan. Inilah biasanya yang palingsulit,ketikasastrawanmesti melepas ciri dasarnya, yakni egosentris. Harus diakui, cara kerja sastrawan dengan sejarawan

adalah dua hal yang sangat berbeda,bahkandisatusisi,sangat bertolak belakang. Sastrawan biasanya bekerja berdasarkan metode empiris. Dengan begitu, satu-satunya yang menjadi standart bagi karya-karyanya adalah dirinya sendiri. Jika kemudian ia menggunakan datafakta, semata-mata diselaraskan dengan ide dan kebutuhan imajinasi. Demi pemenuhan itu, ia rela mengintervensi atau bahkan “memelintir” sesuatu yang faktual. Bagi sastrawan hal itu adalah wajar, mengingat orientasinya adalah ide. Sangat berbeda dengan sejarawan. Dalam sejarah, datafakta adalah harga mati yang tabu untuk dikemas ulang, baik dalam bentuk ide, apalagi imajinasi. Sekalipun pada kasus tertentu, di mana data-data sejarah itu masih kabur, sastrawan harus tundukdenganpakemyangdikukuhkan sejarawan. Yang terjadi selama ini adalah sastrawan sering memanfaatkan “kekuasaannya” dengan dalih ide dan imajinasi. Sehingga justru ia semakin mempurukkan “kotak hitam” sejarah itu sendiri. Latah sastrawan yang me-

nyamakandirinyasebagaipengarang, seolah-olah menghadirkan pemakluman,bahwaruangsastra memiliki batas yang tak terbatas, termasuk menerabas sejarah. Sastra Sebagai Media Sastra adalah media, tetapi data-fakta adalah bukti sejarah yang mendekati kebenaran terhadap suatu peristiwa. Mengutip Hans Robert Jauss bahwa karya sastra membawa semangat zamannya. Semangat zaman ini sering memengaruhi faktualitas sejarah. Inilah yang sering terjadi kemudian. Ketika sastra memasuki wilayah sejarah, seringkali menjadi bias dan tak terkendali. Begitulah diskursus yang berkembang terhadap novel berseri; Gajah Mada (Langit Kresna Hariadi) atau Dyah Pitaloka: Senja di Langit Majapahit (Hermawan Aksan). Novel lain yang turut meramaikan kategori itu adalah, Pangeran Diponegoro (Remy Silado), Pelangi di Atas Glagahwangi (S Tidjab). Kisah Gajah Mada maupun Pitaloka sendiri belum diakui kevalidan sejarahnya. Di sejumlah daerah, kasus-kasus semacam ini juga muncul. Di Sumatera Utara sendiri buku Tuanku Rao

karya Onggang Parlindungan Siregar (1964 dan terbit kembali 2006) sempat menuai polemik. Masing-masing kelompok “bersiteru” dengan mengusung argumennya yang pada dasarnya lebih bersifat memori kolektif. Celakanya,perdebataninitakselesai, bukan hanya karena tidak ada refrensisejarahyangbisadipercaya, tetapi lebih pada ketidakrelaan menerima semacam fakta baru. Hal ini berbeda dengan novel Rara Mandut, Genduk Duku, dan Lusi Lindri. Karya-karya Mangunwijaya ini, tidak mengulas sejarah Rara Mandut, tetapi sekadar meminjam judul. Boleh jadi Mangunwijaya“meminjam” nilai atas foklor itu yang dikembangkannyamelaluibahasasastra. Perspektif itu akan sangat berbeda jika melihat karya-karya Pram, semisal Anak Semua Bangsa, Rumah Kaca, Jejak Langkah. Judul tetralogi Pram, sama sekali tidak bersinggungan dengan idiom-idiom sejarah. Tetapi novel-novel Pram sendiri adalah sebuah ulasan sejarah akan suatu peristiwa di masa tertentu. Pendekatan sastra-sejarah yang lebih halus, tampak dalam karyakarya Suparto Brata. Antara lain;

Catatan Budaya

Nurani Oleh: S Satya Dharma

November Merah, Gadis Tangsi dan SurabayaTumpah Darahku. Sebagai bangsa dengan sejarahyangsamar,masyarakatIndonesia sering terperangkap ke dalam apa yang disebut Pram sebagai“remah-remah” sejarah. Kegamanganitubersumberdaripsikologi masyarakat yang sejak dulu dipaksa untuk lebih percaya kepadadogmadaripadakegairahan membuktikan suatu fenomena. Alhasil masyarakat tidak terbiasa menggugat. Kemapanan budaya terjadi di mana-mana. Daya kritik tidak tumbuh. Sejarah pun menjadi“kotam hitam” yang tak pernah dibuka. Ia layaknya mirip harta karun yang tak tahu di mana keberadaannya. Sementara ketidakrelaan untuk out of the box, terutama pada masyarakat yang diuntungkan dalam sejarah itu, semakin mengkristal. Padahalseringkalidoktrinisasi itu dilakukan demi kepentingan politispenguasatanpamempertimbangkanefekyangdimunculkannya. Lebih seringnya lagi dipakai untuk pencitraan kelompokkelompoktertentuyangberharap akandicatatkandalamsejarahdemi motif-motif tertentu pula. *Penulis adalah penyair dan esais

Menyaksikan Puisi Di Kemewahan Mal Oleh: Syafrizal Sahrun DI mal, paling sering kita menjumpai fashion show atau pertunjukkan musik yang lagi tren di masyarakat. Pertunjukan semacam itu sudah menjadi semacam event wajib di setiap mal untuk menarik simpati pengunjungnya. Baik itu pihak mal sendiri yang memprakarsai acara tersebut atau ada pihak lain yang bekerjasama pihak mal untuk melakukan event sebagai usaha memperkenalkan produk promosi. Tapi bagaimana jika event tersebut menawarkan puisi?Ya. Kedengarannya agak sedikit janggal jika puisi dipertunjukkan di mal, dengan mayoritas pendudukperkotaanyangmengganggap puisiitumembingungkandengan bahasanya yang‘aneh’. Mungkin mereka menganggap, hanya orang-orang ‘gila’ saja mau berurusan dengan puisi. Terus apa untungnya pertunjukkan puisi itu ada di mal? Hal ini terjawab ketika saya datang ke pertunjukkan itu. TepatnyadiFlazaMedanFairpada 23-25 April 2013, saban pukul 13.00 WIB sampai 14.00 WIB. Sejatinya, event ini adalah program Bank Indonesia untuk mempromosikan sejumlah Bank Syariah.Ternyata bukan mal-nya saja yang bergengsi, tetapi yang punya program juga. Mengapa tidak? Pastilah pertunjukan puisi yang disajikan sudah menjadi pertimbangan masak-masak. Ini bukan saja menjadi ajang promosi tapi juga media memasyarakatkan puisi ke tengah manusia urban yang konsumtif. Saya memandang bahwa pertunjukan puisi yang disajikan adalah salah satu cara mengatakan kepada masyarakat bahwa puisi yang diajarkan di dunia pendidikan di negeri ini

punya ruang untuk disajikan di mal. Puisi tidak hanya sebagai materi ajar di sekolah/di perguruan tinggi, tetapi juga untuk disajikan ke tengah masyarakat di mana pun ia berada—tanpa terkecuali di mal. Tak tanggung-tanggung, penyair yang diundang untuk membacapuisipadakesempatan ini ialah sastrawan nasional yang karya-karyanya sudah muncul di media cetak ternama di negeri ini. Ia juga sebagai salah satu sastrawan mewakili Sumatera Utarauntukikutmenandatangani hasilmusyawarahpenentuanhari puisi Indonesia di Riau beberapa bulan lalu bersama penyairpenyair ternama negeri ini. Ialah Hasan Al Banna. Sastrawan yang beberapa tahun belakangan sedang tekun mempromosikan sastra ke tengah masyarakat bersamarekan-rekankomunitasnya. Di samping puisi-puisinya seperti “Mantra Negeri yang Pukang”, “Sepenggal Novel tentangmu dan Anak-anakmu”, ia juga membacakan puisi-puisi karya penyair lain seperti “Sajak Palsu” karya Agus R Sarjono, “Celana” karya Joko Pinurbo. Selain Hasan Al Banna, turut pula Sanggar Rumput Hijau Binjai mengisi rangkaian acara pertunjukan puisi. Sanggar ini


SASTRAWAN nasional asal Kota Medan, Hasan Al Banna, bersama Sanggar Rumput Hijau SMA 2 Binjai ketika menyuguhkan puisi di Plaza Medan Fair, 23-25 April lalu. menyajikan musikalisasi puisi yang digarap dari puisi “Aku”, “Cintaku Jauh di Pulau (Chairil Anwar), “Akulah Medan” (Teja Purnama), “Ceracau Sebongkah Kota”, “Sungai Deli” (Hasan Al Banna), “Gugur” (WS. Rendra), “Teratai” (Sanusi Pane), “Torsa ni Namora Pande Bosi”, “Sebab Pahlawan Namaku” (M. Raudah Jambak), DiTiti Gantung Kuasah Rindu (A Rahim Qahhar), “Jalan Telah Jauh Ditempuh” (Abdul Jalil Sidin), “Sepisaupi” (Sutardji Calzhoum Bahri) dan “Lukisan Binjai” (Saripuddin Lubis). Perlu dikabarkan, sanggar ini pernah menjadi jawara nasional lomba musikalisasi puisi tahun 2011. Ketika saya duduk di bangku

yang disediakan untuk menyaksikanpertunjukkanpuisitersebut, saya memperhatikan sekeliling. Ternyatabanyakjugapengunjung yang mau menujukan pandangannya ke pentas pertunjukan itu. Di lantai dua (kebetulan event itu di lantai satu), saya lihat ada tiga orang remaja yang mengenakan pakaian seragam SMA mengamati pertunjukkan itu. Lalu dengan iseng, saya tanya tanggapan mereka mengenai pertunjukkan puisi di mal. Salah satu dari mereka menjawab bahwa pertunjukkan seperti ini sangatbagusuntukmembuktikan kalau pelajaran puisi di sekolah tak sia-sia diajarkan kepada siswa. Buktinya pertunjukkan puisi bisa

masuk mal dan bergengsi. Saya mengartikan maksud daripertunjukanpuisibisamasuk mal itu tak lain bukan karena pertunjukan puisi tidak boleh di mal atau puisi tidak layak, melainkan pertunjukan puisi semacam itu hanya sedikit saja mungkin penggemarnya. Di sisi lain, pelajar kita menikmati pertunjukkan semacam ini sebab puisi adalah mata ajar yang digabung dengan pelajaran Bahasa Indonesia mulai dari SD sampai SMA/sederajat, serta di perguruan tinggi juga ada program studi khusus yang mengkaji puisi (sastra). Jadi pelajar kita merasa bangga ketika puisi juga dipelajarinya tak kalah tenar

denganpertunjukan-pertunjukan seni lainnya. Dengan demikian, pertunjukkan puisi sangat dibutuhkan oleh pelajar kita sebagai wawasan ilmu pendidikan. Pertunjukkan semacam ini juga mesti digalakkan untuk memasyarakat puisi dan mengembalikan puisi kepada masyarakat. Bukankah sastra yang khususnya puisi adalah berupa ungkapan perasaan masyarakat dan diciptakanuntukmasyarakat?Semoga dengan mengilhami puisi kita menjadi masyarakat yang lebih baik. *Penulis adalah penyair, esasi dan guru SMK Citra Harapan Percut.

KARTINI, Bunda Theresa, Dewi Sartika, Nyi Iroh, boleh mati, memang. Demikian juga dengan ribuan, jutaan, perempuan hebat yang telah menorehkan sejarah emas dengan nuraninya. Tapi perjuangan membangun martabat kemanusiaan, perjuangan menyelamatkan kehidupan umat manusia tanpa harus membedakan ras, suku, agama, golongan, status sosial, harus terus berjalan. Dulu, bagi perempuan, betapa tertutupnya ruang untuk satu dialog. Apalagi untuk satu tindakan. Suara dan gerak mereka terbatas oleh dinding kamar, sekat ruang tamu dan tembok rumah. Jendela kamar yang terbuka tidak memperluas cakrawala. Jarak terbentang oleh tirai-tirai. Dan yang namanya perempuan cukup hanya mengintip lewat sela-sela gordeyn pintu. Menguping dan diam. Selanjutnya, tanpa diketahui ujung pangkalnya, datang pinangan dan hari pernikahan pun ditentukan. Dulu perempuan hanya sekedar objek. Suaranya terbenam dan hanya berputar-putar dari kamar tidur, dapur dan sumur. Yang pasti Marah Rusli lantas protes. Lahirlah kemudian roman “Siti Nurbaya” yang mengejek adat itu. Hamka pun tak mau tinggal diam. Lewat romannya, “Tenggelamnya Kapal Van Der Wijk” Sastrawan Ulama itu pun berontak. Hamka bahkan sempat dikucilkan oleh masyarakatnya karena roman tersebut. Ia dikucilkan dari lingkungan sosialnya karena berani melawan adat warisan nenek moyang. Dalam catatan sejarah, kita kemudian mengenal ada banyak perempuan pejuang di berbagai belahan planet bumi ini. Mereka bahkan dikenal sebagai pejuang emansipasi yang gigih. Hingga sekarang, setelah puluhan tahun era Kartini berlalu, di negeri ini bahkan ada banyak sekali perempuan yang muncul dan total dalam memperjuangkan martabat kemanusiaan secara universal. Ini bisa dimaklumi. Sebab, dengan nuraninya perempuan lebih bisa melihat bahwa di bagian lain dari dunia pribadi setiap orang yang hidup berkecukupan, jutaan orang lainnya masih bergelut dengan realitas tak menguntungkan dalam takdirnya. Terlebih dalam jaman yang mengusung semangat konsumerisme yang demikian besar sekarang ini. Dalam situasi itulah, kehadiran perempuan yang lebih memilih berbicara dengan hati nuraninya ketimbang dengan lidahnya, menjadi amat penting.

Dengan nuraninya mereka mengkritisi keadaan, menjawab setiap persoalan, tanpa mau berpanjangpanjang melontarkan keluhan.

Selain Kartini, sejak beberapa tahun lalu kita mengenal sejumlah perempuan hebat lainnya di negeri ini. Mereka, para perempuan itu menunjukkan semangat perjuangan dengan caranya sendiri. Mereka tak memilih bicara di media massa atau di forum-forum seminar. Mereka pun tak menggalang massa untuk melakukan unjukrasa. Apa yang mereka lakukan adalah bertindak, beraksi, berbuat dengan kelembutan kasih seorang ibu. Dengan hati nuraninya, para perempuan itu menyuarakan rasa empati dan kepedulian sosial pada sesamanya. Dengan nuraninya mereka bicara dan mengajak setiap orang untuk bersama-sama membangun harkat kemanusiaan warga masyarakat yang tak berdaya. Dengan nuraninya mereka mengkritisi keadaan, menjawab setiap persoalan, tanpa mau berpanjang-panjang melontarkan keluhan. Tapi, sebagaimana upaya-upaya kemanusiaan lainnya yang dilakukan banyak orang di belahan dunia ini, selalu saja usaha seperti itu terasa tak cukup karena besarnya jumlah orang yang membutuhkan uluran tangan karena ketidakberdayaan itu. Apalagi di banyak negara, terutama di Indonesia, pemerintahnya tak cukup peduli terhadap realitas ketidak berdayaan warga masyarakat yang tak beruntung itu. Namun demikian, apapun hasilnya, aksi para perempuan itu telah mewujud sebagai “oase” di padang gersang. Apa yang dilakukan para perempuan hebat itu, betapa pun tidak bisa dianggap sebagai pekerjaan yang mudah dan sederhana. Bisa jadi tindakan kemanusiaan yang mereka lakukannya demi penghormatan atas martabat kemanusiaan itu, baik dalam masalah sosial, pendidikan, ekonomi dan kebudayaan, adalah cikal bakal dari sebuah gerakan kemanusiaan yang lebih besar lagi di kemudian hari. Sebab, siapapun manusia yang masih berpikir waras di republik ini, sesungguhnya sangat menyadari bahwa untuk menjadi aktivis kemanusiaan yang bercita-cita menyelamatkan harkat kemanusiaan, dibutuhkan sangat banyak energi, sangat kesabaran dan daya tahan fisik yang prima. Tanpa punya tiga hal itu, bisa dipastikan aktivitas sosial kemanusiaan tersebut, sehebat apapun idenya, hanya akan menjadi kegiatan “seremonial” belaka dan bahkan terjebak pada tujuan-tujuan politik praktis semata. (*) *) Penulis adalah Sekjen Multiculture Society

Mendefinisikan Ulang Novel Sastra Indonesia Oleh: Yulhasni SEJAK dimulainya penulisan roman pertama sekali pada masa Balai Pustaka oleh Merari Siregar dan Mas Marco Kartodikromo, maka ranah penulisan sastra bergenre novel mulai mewarnai perkembangan khazanah sastra Indonesia. Meski sebelumnya pada abad ke-19 Abullah bin Abdulkadir Munsyi telah meletakkan dasar-dasar penulisan prosa dengan teknik bercerita lewat pengumpulan data historis biografis, akan tetapi tetap saja roman Azab dan Sengsara karya Merari Siregar diletakkan sebagai awal mula penulisan roman (novel) di Indonesia. Perkembangan penulisan novel sastra dari masa ke masa memiliki tema-tema yang menyentak ruang publik dan selalu

menjadi buah bibir. Tidak sedikit kritikus sastra (ahli sastra) memberi peran penting ketika novel sastra muncul untuk jadi jembatan ke pembaca. Berbagai polemik sastra ikut andil meramaikan perbincangan sebuah novel sastra karena tema, jenis, dan unsur yang membangun karya tersebut pantas diperbincangkan. Sejalan dengan perkembangan penerbitan buku di tanah air, maka khazanah buku berbentuk novel pun ramai bermunculan. Sejak

Pramudya Ananta Toer melahirkan sejumlah novel sastra berkelas, nyaris tidak ada pengarang yang melewati masa emas seperti itu. Meski nama seperti Andrea Hirata, Habiburrahman El Shirazy, Asma Nadia, Dewi Lestari, Anwar Fuadi hingga (Darwis) Tere Liye mampu memberi warna tersendiri dalam novel-novel mereka, akan tetapi perbincangan tentang karya mereka justeru muncul tidak dari kalangan kritikus sastra malainkan karena proses promosi lewat film yang memang lagi trend berkembang saat sekarang. Atas dasar itulah jika kemudian nama Pram selalu diusulkan sebagai nominator Hadiah Nobel. Kondisi ini menjadi tanda tanya besar berkait mendefenisi ulang novel sastra di Indonesia. Apakah

karya mereka layak diletakkan sebagai bentuk karya sastra? Seberapa kuatkah karya seperti itu jika dibandingkan dengan Ronggeng Dukuh Paruh-nya Ahmad Tohari, HarimauHarimau Mochtar Lubis atau Ladang Perminus Ramadhan KH yang membongkar praktik korupsi di Pertamina? Mendefenisi ulang novel sastra sangat penting dirumuskan untuk meletakkan akar penting dari konsep sastra di berbagai genrenya. Pengakuan sebuah fiksi sebagai karya sastra sama sama sulitnya dengan mendefenisi puisi sastra dan drama sastra. Dulu ketika Remy Silado dkk. menggagas puisi ‘mbeling’ orang mencibirnya sebagai bentuk ketidaksanggupan membuat puisi yang serius sebagaimana angkatan

Chairil Anwar telah melakukannya. Terbukti, gerakan puisi mbeling itu tenggelam dengan sendirinya. Polemik tentang novel sastra dan non sastra juga pernah terjadi ketika terbit novel Cintaku di Kampus Biru karya Ashadi Siregar. Novel ini dinilai dikategorikan sebagai novel pop alias picisan sama seperti novel Karmila dan Badai Pasti Berlalu karya novelis Tionghoa Marga T. Bahkan jika merujuk era 80an, maka novel pop laris seperti kacang goreng. Kita mengetahui nama Eddy D. Iskandar, Freddy S., dan Mira W. Abdullah Harahap menempatkan dirinya sebagai spesialis penulis novel misteri. Pada saat itu muncul istilah sastra pop dan sastra non-pop yang juga diikuti kemudian dengan polemik

soal sastra picisan. Sebutan sastra picisan adalah bentuk yang dipakai sejumlah ahli sastra untuk menyebut sastra populer. Istilah ‘picisan’ sendiri muncul karena isi dari karya tersebut tidak ada yang dapat memberikan pesan moralitas dan hanya memberi efek hiburan belaka. Konon kabarnya, karya jenis ini diletakkan dalam ‘kasta sudra’ dalam khazanah sastra Indonesia. Hal yang patut dicatat dalam perkembangan penulisan novel saat sekarang yakni kecenderungan untuk ‘menjual’ nama-nama tertentu yang dianggap sebagai pakar sastra. Catatan kecil dari mereka di sampul belakang sejumlah novel mengindikasikan satu trik baru untuk meletakkan novel jenis ini sebagai karya sastra. Apakah sebuah karya

memerlukan hal ini agar dikategorikan sebagai sebuah karya sastra? Pertanyaan penting ini tentu saja menarik jika diperbincangkan mengingat adanya kecenderungan hal itu mengemuka dalam khazanah munculnya novel di tanah air. Mendefinisi ulang novel sastra perlu dijadikan catatan penting untuk perbincangan sastra yang lebih menukik. Bukankah sudah terlalu gampang orang mengklaim sebagai sastrawan hanya bermodal satu atau dua novel yang telah diterbitkan? Seiring dengan itu kemudian makin menjamurnya komunitas dan lembaga yang memposisikan diri sebagai penjaga sastra. Hal ini tentu saja sangat baik dalam rangka menghindari proses legitimasi yang keliru dan cenderung tidak berkeadilan

terhadap penciptaan karya sastra. Namun pada bagian yang patut dikuatirkan yakni semakin tidak jelasnya nilai sastra yang terkandung pada sebuah novel. Makanya dalam berbagai literatur teori sastra telah disebutkan tentang batasan tentang karya yang bernilai sastra. Batasan tersebut tidak serta mereta muncul dengan sendirinya dari para ahli sastra, melainkan telah mengalami berbagai pengkajian. Penelitian sastra yang dilakukan ahli sastra bertujuan untuk mendefenisikan ciri-ciri penting nilai sastra yang melekat pada pada novel. Dengan demikian tidak akan dengan sembarangan kita kemudian ‘mengklaim’ novel seseorang sebagai karya sastra. *Penulis Dosen FKIP UMSU dan Bergiata di Komunitas Diskusi Sastra FOKUS UMSU


WASPADA Minggu 28 April 2013


Mengais Dolar Di Objek Wisata Sabang

Penari Sambut Turis Mancanegara.

Kapal Pesiar singgah di pelabuhan Sabang. SIAPA yang tak tahu objek wisata Sabang yang terletak di ujung Pulau Sumatera. Sabang sebuah daerah tingkat II di Aceh mempunyai otoritas sebagai Pelabuhan Bebas dan Perdagangan Bebas Sabang yang mempunyai payung hukum UU No. 37 tahun 2000. Meskipun denyut nadi pere-

konomian masyarakat melalui otoritas Pelbas belum begitu menggeliat dan belum dapat dirasakan manfaatnya secara langsung oleh masyarakat Sabang yang berjumlah 36 ribu jiwa itu. Sudah 13 tahun Sabang menyandang status free port, tapi kondisi perekonomian masyarakat di sana biasa-biasa

saja bahkan yang lebih cepat menggenjot perekonomian masyarakat melalui sektor pariwisata. Pemko Sabang kelihatannya sangat fokus mengembangkan kawasan wisata Sabang, sebab masyarakat daerah ini dapat mengais dolar dari pengunjung mancanegara dan tak kurang

pula mengais rupiah dari pelancong domistik yang datang dari berbagai daerah di nusantara ini. Sektor pariwisata sudah menjadi sektor unggulan bagi masyarakat Pulau Weh dan sebagai sumber mata pencarian masyarakat disana. Untuk meramaikan arus kunjungan wisata ke kawasan Sabang perlu dukungan sarana dan prasarana penunjang. Walikota Sabang, Zulkifli H Adam sering sekali mengatakan pada setiap pertemuan, Sabang akan dijadikan sebagai ikon wisata unit dan menarik sehingga perlu kerja keras. Program pembangunan di sektor pariwisata menyentuh langsung sector riil. Sebab itu program pariwisata harus dilaksanakan secara terpadu, tidak mungkin dilakukan oleh Dinas Kebudayaan dan Pariwisata saja, harus melibatkan seluruh SKPD.

Walikota Sabang mengharapkan dengan dibukanya jalur penerbangan langsung Sabang – Medan arus kunjungan wisata baik nusantara maupun mancanegara akan bertambah banyak lagi. Selama lima tahun terakhir ini arus kunjungan wisata ke Sabang mencapai 200 ribu orang dan ke depan diharapkan akan meningkat dua kali lipat lagi. Kunjungan kapal pesiar ke teluk Sabang biasanya hanya satu kapal dalam setahun. Mulai tahun 2012 lalu kapal pesiar mewah berukuran besar sudah mencapai 6 kapal pesiar dan tahun ini ada beberapa kapal pesiar yang akan masuk ke objek wisata seribu benteng ini. Sampai akhir Maret 2013 sudah dua kapal pesiar singgah di pelabuhan BPKS Sabang yaitu MS Silver Whisper pada tanggal 12 Maret dan Seabourn Pride pada 22

Maret lalu, kedua kapal mewah tersebut berbendera Bahamas. Tugu Kilometer Nol Di Kawasan Wisata Sabang ada sebuah Tugu Kilometer Nol yang telah dijadikan sebagai objek wisata di ujung barat laut Pulau Weh (Sabang). Jaraknya dari pusat kota Sabang sekitar 30 km dan dapat ditempuh dalam waktu 45 menit. Untuk menuju ke objek wisata tugu kilometer nol bisa menggunakan mobil penumpang dan bisa juga dengan merental mobil biayanya murah dapat dinego. Di tugu Km Nol terletak di desa Iboih Kecamatan Sukakarya Sabang di sana tertulis dengan jelas “ Tugu Kilometer Nol Indonesia/The Monument of Zero Kilometer Indonesia”. Di lantai dua tugu terdapat prasasti menunjukkan posisi geografis kilometer nol. Posisi Lintang : 05 54’ 21.42" LU, Bujur 95 13’ 00.50" BT, Tinggi : 43,6 meter. Pengukurannya dilakukan oleh pakar BPPT dengan teknologi satelit Global Posotioning System (GPS). Tugu ini diresmikan oleh Bapak BJ Habibie waktu itu menjabat sebagai Menristek di era Orde baru tahu pada tanggal 9 September 1997. Bagi setiap pengunjung yang datang ke Tugu Kilometer Nol Sabang diberikan Sertifikat untuk kenang-kenangan sudah menginjakkan kaki di titik nol kilometer Indonesia. Sertifikat tersebut dapat diperoleh pada Dinas Kebudayaan dan Pari-

wisata Sabang. Taman Laut Pulau Rubiah Potensi wisata taman laut Pulau Rubiah merupakan sektor unggulan untuk menjual objek wisata sampai ke mancanegara. Posisi Pulau Rubiah berhadapan dengan pantai Tepe laye Iboih. Untuk menuju Pulau Rubiah dan menikmati keindahan bawah laut bisa menggunakan boat ukuran sedang dan besar serta boat kaca yang bisa melihat aneka ikan hias bawah laut. Banyak pengunjung ketika melihat air laut yang jernih seperti magnet langsung terjun ke laut untuk kegiatan snorkel dan ada juga yang ingin diving (menyelam). Wisata Pantai Untuk menikmati keindahan wisata pantai, anda dapat mengunjungi Pantai Gapang yang juga masih di sekitar desa Iboih. Di Pantai Gapang juga bisa menyewa alat snorkle dan alat diving serta perahu/boat dengan harga terjangkau. Demikian pula di pantai Sumur Tiga di mana lokasinya berada di pinggiran kota Sabang. Di sana banyak tersedia tempat penginapan dengan tarif yang terjangkau. Pantai Kasih terletak di pusat kota Sabang, pasir putihnya sangat indah karena pantainya landai, airnya bersih dan jernih, setiap hari ramai dengan pengunjung dan Pantai Kasih sudah sangat terkenal. Dari namanya saja Pantai Kasih, mungkin di lokasi ini banyak muda-mudi menikmati keindahan alam

sambil bercengkrama memadu kasih. Air Terjun Di Kota Sabang sangat lengkap objek wisatanya, disamping ada kolam air panas di desa Kenekai 20 km dari pusat kota, ada gunung berapi, wisata gunung, hutan wisata, ada juga air terjun. Meskipun fasilitas perhubungan darat menuju objek wisata air terjun belum memadai, tapi pengunjung tetap ramai. Pemko Sabang sudah memikirkan untuk membuka akses jalan sampai ke lokasi air terjun dan membangun berbagai fasilitas umum di sana seperti kamar tukar pakaian, MCK, tempat istirahat, warung dan berbagai fasilitas pendukung lainnya. Seribu Benteng Sabang dahulu sebagai pulau tempat pertahanan Belanda dan tahun 1940 Belanda menduduki Sabang membuat benteng-benteng sekeliling Pulau Weh yang dilengkapi dengan meriam, makanya terkenal Sabang dengan seribu benteng. Untuk mengenang sejarah masa lalu, Pemko Sabang bersama TNI-AL menempati meriammeriam itu di Taman hiburan Sabang Fair. Bagi anda yang sudah pernah ke Sabang kalau belum ke lokasi Taman rekreasi Sabang Fair maka belum lengkap, meskipun hanya sekedar melihat pajangan meriam tua yang moncongnya diarahkan ke laut. Naskah dan foto oleh T.Zakaria Al Bahri

Air Terjun Halambingan Di Parapat Pulau Sikandang salah satu sudut keindahan pariwisata yang ada di Pulau Banyak Kabupaten Aceh Singkil.

Pulau Banyak Itu Ternyata Bernama “Tuangku“ ADA 99 pulau terletak di paling ujung Pulau Sumatera tak salah kalau masyarakat menyebutnya sebagai Kepulauan Banyak , padahal nama Pulau Banyak itu tidak pernah ada dalam sejarahnya. Pada jaman penjajahan Belanda yang ada dalam peta adalah Pulau Baguk (bukan Desa Pulau Baguk saat ini –red) begitu juga dengan Pulau Balai yang sekarang menjadi Ibukota Kecamatan Pulau Banyak tidak pernah tersebut karena pemerintahan pertama berada di Haloban . Lalu benarkah Pulau Banyak berasal dari nama Tuangku? Cerita jaman Belanda dulu berawal dari seorang penduduk yang bermukim di Haloban sekarang sebagai Ibukota Kecamatan Pulau Banyak Barat (PBB) bernama Tuangku menurut sumber Waspada Yazid, 60. Tuangku adalah orang yang paling disegani pada jamannya pernah kalah bermain judi, akibat kekalahannya itu Tuangu tak bisa tidur karena terus berpikir. Lalu untuk mengobati kesusahan tidurnya dia memanggil seorang penduduk untuk mengobati agar bisa tertidur. Menurut cerita apabila perintahnya tidak diindahkan maka penduduk yang dipanggil harus menggulung tikar dan menggali tanah di bukit Haloban sebagai sanksi atas dilanggarnya perintah tersebut . Di saat ituTuangku memanggil warganya yang bernama Pawang Gembung (nama orang-red) pada tengah malam agar datang ke rumahnya, karenatakutdenganganjaranyangdiberikanPawang GembungpunmenghadapTuangku “SayaTuangku dipanggil untuk meng-hadap ada apa gerangan yang harus saya lakukan,” tanya Pawang Gembung pada Tuangku saat itu . Lalu Tuangku menjawab “ saya baru saja selesai main judi dan saya kalah, kini saya tidak bisa tidur tolong saya diberi obat,” ujarnya. Tanpa pikir panjang Pawang Gembung pun bersiap untuk mengobatinya padahal saat itu perasaan

Pawang Gembung bercampur takut dan ragu serta terus berpikir apa obat yang harus diberikan agar Tuangku bisa tertidur. Tak lama Pawang Gembung pun menarik suara nya dengan melantunkan lagu – lagu sikampang ( berpantun-red) dibantu alat yang bisa mengindahkan suara yaitu “Pitunang “ yang menurut cerita dengan bersikambang pitunang itu siapa saja anak perempuan yang mendengar nya pasti tertarik dan mau dinikahi oleh orang yang mengalunkannya . Akhirnya untuk mengobati agar Tuangku bisa tidur Pawang Gembung pun bersikambang , alhasil tiga kali bersikampangTuangku pun tertidur dan sangking lelapnya Tuangku tak tau kapan Pawang Gembung pulang dari rumahnya. Sehingga keesokan harinya Tuangku kembali memanggil Pawang Gembung untuk menghadapnya lagi ke rumah karena perintah itu hati Pawang Gembung pun kembali ragu di pikirannya akan diberi hukuman untuk menggali tanah , Namun setelah sampai di rumah Tuangku lalu bertanya kepada Pawang Gembung “kapan saya tertidur dan mengapa saya tidak tau kapan Pawang Gembung pulang dari rumah saya,” tanyanya. Dengan kepala tertunduk Pawang Gembung pun menjawab “di saat saya bersikambang sebanyak tiga kali Tuangku pun tertidur setelah itu saya langsung meninggalkan Tuangku “ kata Pawang Gembung Mendengar itu Tuangku pun lantas senyum dan berkata mulai hari ini saya akan memberikan hadiah kepada mu Pawang Gembung yaitu berupa Balesting atau upah Bulanan. Sejak itulah nama tempat Tuangku bermukim disebut sebagai Pulau Tuangku yang saat ini telah dijadikan pusat Ibukota Pemerintahan Kecamatan Pulau Banyak Barat yang dipimpin oleh M.Hasby sebagai Camat yang juga menurut warga di sana adalah anak dari sesepuh pemimpin Pulau Tuangku masa lalu yang saat ini berpusat di Haloban . Naskah dan foto oleh Mansurdin

LOKASI Wisata Batu Gantung, Marsuse (Tempat wisata kera) dan Pantai Danau Toba, Kota pariwisata Parapat, masih punya ekowisata alam lain yakni Air terjun Halambingan, yang berada di Girsang Dua Lingkungan Tiga, Kelurahan Girsang Kecamatan Girsang Sipangan Bolon Parapat. “Air Terjun Halambingan ini posisinya alami dan tingginya kurang lebih 125 Meter dan kondisinya tujuh tingkat dan keberadaannya diapit oleh dua liang (2 gua), di sebelah kanan Liang Bolon dan sebelah kiri Liang Majontik, yang kononnya kedua Liang (Gua) ini dulunya dipergunakanuntukbertapa(Orangyang ingin memohon sesuatu). “Air terjun Halambingan ini bertingkat tujuh dimana airnya langsung dari gunung yang mengalir ke Halambingan menuju Mual Bolon Sera - sera dan bertemu di sungai Binanga Naborsakan Ajibata Kabupaten Tobasa,” Terang Lurah Girsang Boas Manik. Menurut Boas Manik pada tahun 1980, lokasi Air Terjun Halambingan ini sudah dikunjungi oleh wisatawan lokal maupun manca negara dan untuk ke lokasi air terjun, bisa ditempuh melalui jalan bendungan tali air Halambingan, kira - kira 2 Km dan melalui jalan keliling Girsang dari jalan besar, lebih kurang 5 Km ke lokasi air terjun. Lokasi air terjun Halambingan ini masih alami, dimana di lokasi masih banyak ditemukan banyak jenis hewan, seperti Siamang, bermacam jenis burung, Gopul (Beruang Madu), babi Hutan dan sekali - sekali hewan buas Harimau juga masih sering menampakkan dirinya di atas air terjun ini, katanya. Ditambahkan Dharma Silalahi dan Boas Manik bahwa jalan menuju ke lokasi air terjun Halambingan sudah dibuka melalui dana PNPM PISEW dengan tiga paket, dengan memberdayakan masyarakat setempat. Pertama tahun 2011, Jalan

dibuka sepanjang 500 Meter dan tahun 2012 dengan dua paket sepanjang 1000 meter. “Keberadaan Air Terjun Halambingan ini masih butuh sentuhan dari Pemerintah Propinsi Sumatera Utara (Pempropsu) dan Pemkab Simalungun,” Ungkap Staf Kantor Camat Girsang Sipangan Bolon, Bidang Pemberdayaan Masyarakat Desa (PMD) Girsang Dharma Dodi Silalahi diamini Lurah Girsang Boas Manik dan Kepala Seksi Pemerintahan (Kasipem) Kelurahan Girsang Edy Frens Silalahi kepada wartawan di lokasi Air Terjun Halambingan. Saat ini lokasi air terjun Halambingan masih membutuhkan sentuhan untuk penataan jalan dan penataan lokasi air terjun agar lebih asri, di mana warga setempat sangat merespon, kiranya air terjun Halambingan menjadi ekowisata alam yang memberdayakan masyarakat setempat, jelas kedua PNS ini. Ramses Sinaga (47) warga Kelurahan Girsang Kecamatan Girsang Sipangan Bolon, salah satu warga pemilik tanah yang ada di lokasi air terjun Halambingan mengaku untuk mendongkrak ekonomi dan mengembangkan wisata alam air Terjun Halambingan ini, warga di sana siap bekerjasama dengan pemerintah untuk mewujudkan lokasi ini menjadi lokasi wisata, seperti Wisata Kolam Pemandian, kemping dan Gantole (Terbang Layang). “Kami sebagai warga yang memiliki tanah di sini siap untuk diberdayakan,” ucap Sinaga. “Kepemilikan tanah di sini, diperoleh dari keluarga turun menurun, sudah 7 generasi kami di sini dan sebelum sampai ke lokasi air terjun, para wisatawan yang nantinya ingin berwisata ke lokasi air terjun Halambingan ini, nanti di pintu masuk akan menemukan dua tempat pemandian pangir (Mandi air jeruk purut untuk membersihkan

diri), 1 untuk laki dan 1 untuk perempuan, selanjutnya para wisatawan akan melihat sebuah sopo bolon, di mana sopo bolon ini dulunya tempat untuk pemujaan dan beberapa

buah patung yang terbuat dari batu sebelum ada Agama. dan setelah melewati air pancur, wisatawan baru menemukan Air Terjun Halambingan dan jika naik ke atas air terjun ini, para

Air Terjun Halambingan di Parapat.

wisatawan akan melihat dua buah liang (Gua) yang mengapit keberadaan air terjun Halambingan ini,” imbuhnya. Naskah dan gambar oleh Rolike Napitu




Nike Ardilla


Ustadz Jeffry Al Buchory

DUNIA selebritis kembali diselimuti kabut duka. Peristiwa tragis yang dialami Ustadz Jeffry Al Buchory, menambah panjang daftar pesohor yang meninggal dunia akibat kecelakaan lalulintas. Kini, cerita kehidupan mereka telah berakhir di jalan raya. Ustad Jeffry Al Buchory yang akrab disapa Uje mengalami kecelakaan lalulintas pada Jumat, 26 April 2013 dinihari sekira pukul 02:00. Motor gede jenis Kawasaki yang dikendarainya, menabrak pohon di Jln. Gedung Hijau Raya, Pondok Indah Jakarta, dalam perjalanan menuju rumahnya. “Helmnya cukup bagus. Tapi, mungkin karena laju sepedamotornya cukup


Taufik Savalas


Sophan Sophiaan


Virginia Anggraeni


Valia Rahma

Akhir Cerita Di Jalan Raya tinggi, jadi membuat helm tersebut terlepas,” kata Kasubdit Gakkum Dit Lantas Polda Metro Jaya, AKBP Sudarmanto, di Mapolres Metro Jakarta Selatan, Jumat (26/4). Menurut Sudarmanto, kondisi luka almarhum Uje parah sehingga membuat jiwanya tidak tertolong lagi. “Beliau mengalami luka fatal pada muka sehingga mengeluarkan darah dari telinga, hidung dan mulut,” jelasnya. Nike Ardilla Kecelakaan lalulintas yang dialami Nike Ardilla di Bandung, pada 19 Maret 1995 pukul 06:00, telah merenggut nyawa penyanyi pop ini. Mobil Honda Civic biru yang dikendarainya menabrak tempat sampah beton di pinggiran Jln. RE Martadinata. Kejadian itu menyebabkan Nike menderita luka berat pada kepala. Adi Firansyah Pesinetron Adi Firansyah meninggal dunia di Bekasi, Jawa Barat pada 23 Desember 2006 setelah mengalami kecelakaan lalulintas.

Bintang sinetron ‘Gengsi Gede-gedean’ itu meninggal dunia setelah sepedamotornya bertabrakan dengan sepedamotor lain. Adi mengalami benturan keras di dada dan kepala. Meski sempat dibawa ke RSU Bekasi, namun jiwa Adi tidak tertolong lagi. Taufik Savalas Komedian Taufik Savalas termasuk salah seorang pesohor yang meninggal dunia akibat kecelakaan lalulintas. Peristiwa tragis itu terjadi di Bagelen, Purworejo, Jawa Tengah, pada 11 Juli 2007. Toyota Kijang yang membawanya dari Yogyakarta menuju Purbalingga bertabrakan dengan truk. Saat itu, Taufik yang duduk di belakang supir, mengalami luka serius pada kepala karena terjepit. Meski sempat dilarikan ke rumah sakit, namun nyawa komedian bertubuh tambun itu tidak tertolong lagi. Sophan Sophiaan Aktor senior Sophan Sophiaan tewas dalam kecelakaan lalulintas saat mengikuti

touring Harley Davidson. Kecelakaan itu terjadi saat rombongan melintasi jalanan berlubang. Roda motor gede yang dikendarai Sophan Sophiaan terperosok ke dalam lubang. Akibatnya, sepedamotor itu terguling dan tubuh Sophan Sophiaan tertimpa motor gede jenis Harley Davidson. Saat itu, Sophan Sophiaan mengikuti rangkaian kegiatan mengendarai motor gede dengan tema ‘Jalur Kebangkitan’. Kegiatan ini dalam rangka menyemarakkan 100 Tahun Kebangkitan Nasional. Sophan menghembuskan nafas terakhir pada Sabtu, 17 Mei 2008 sekira pukul 10:00 di RS Sragen, Jawa Tengah. Virginia Anggraeni Kecelakaan maut yang dialami pedangdut Saipul Jamil di Tol Purbaleunyi KM 97, Sabtu, 3 September 2011, menyebabkan sang istri Virginia Anggraeni meninggal dunia. Virginia meninggal dunia setelah mobil yang ditumpanginya hilang kendali hingga terguling sejauh 35 meter. Virginia tewas setelah terjepit

WASPADA Minggu 28 April 2013

di dalam mobil. Saat itu, Virginia duduk di belakang Saipul Jamil yang mengemudikan mobil. Valia Rahma Presenter dan bintang FTV, Valia Rahma meninggal dunia setelah mengalami kecelakaan lalulintas di Denpasar, Bali, pada 5 Januari 2012. Saat kecelakaan terjadi, Valia duduk di boncengan sepedamotor yang dikemudikan adik iparnya. Ketika sepedamotor tersebut hendak memasuki pelataran parkir sebuah hotel, datang sepedamotor dari arah berlawanan dengan kecepatan tinggi sehingga terjadi tabrakan. Akibat peristiwa itu, Valia terlempar dan kepalanya membentur aspal. Meski menggunakan helm, namun Valia mengalami luka pada bagian dalam akibat benturan keras tersebut. Dalam kondisi tidak sadarkan diri, Valia dibawa ke rumah sakit terdekat. Meski sempat menjalani perawatan medis, Valia akhirnya meninggal dunia pada Jumat, 13 Januari 20012.(ant/inc/tv/m25)

X Factor Indonesia Gala Show 10


Vivik, 30, istri almarhum Uje memeluk foto suaminya.

“Selamat Jalan Ustadz Jeffry...” KEPERGIAN Ustadz Jeffry Al Buchory tidak hanya meninggalkan menyisakan duka di kalangan keluarga dan sanak saudara. Jutaan umat Islam di Indonesia menyampaikan belasungkawa dan merasa kehilangan sosok dai muda ini. Presiden Susilo Bambang Yudhoyono menyampaikan belasungkawa atas wafatnya Ustaz Jeffry Al Buchori. Ucapan duka Presiden disampaikan melalui akun Twitter resminya, @SBYudhoyono. “Kita kehilangan lagi orang baik yg mencerahkan. Selamat jalan Ustadz Jefri, semoga nilai yg disebarkan bisa menginspirasi kita semua. *SBY*,” demikian isi tweet Presiden SBY. Wakil Menteri Agama Nasaruddin Umar mengatakan, generasi muda sekarang tidak perlu malu mengikuti jejak almarhum Uje, sapaan akrab Ustaz Jeffry Al Buchory. “Uje adalah ustadz multitalenta. Selain jadi, Uje merupakan seniman, qori dan mampu bergaul mulai dari lapisan atas hingga “akar rumput”. Karena itu, jika generasi muda memiliki kemampuan, apakah sebagai pebisnis atau artis, maka tidak perlu malu untuk menjadi ustadz,” ujarnya. Menurut Nasaruddin, Uje merupakan sosok ustadz yang memiliki karakter. “Kita berharap di masa datang tumbuh generasi baru yang memiliki karakter, tidak minder dan mampu bergaul dengan siapa pun,” katanya. Anggota DPR RI Nurul Arifin mengatakan, Uje dikenang sebagai seorang penceramah dengan gaya yang unik dan orisinal. Selain itu, Uje juga termasuk pendakwah muda yang tidak munafik dan dekat dengan siapa pun. “Saya senang sama Uje karena gayanya yang unik dan orisinal. Tausiah bahasanya sangat egaliter dan mudah dimengerti, juga tidak sombong, diterima semua anak muda, anak gaul,” ujar Nurul. Sementara itu, sifat terpuji yang Uje begitu membekas di hati dua personel band Ungu, Enda (gitar) dan Rowman (drum). Mereka hadir saat prosesi pemakaman jenazah Uje di TPU Karet Bivak, Jakarta Pusat, Jumat (26/4) siang. Bagi Enda, sosok Uje merupakan guru dan sahabat. Uje adalah sosok Islam sebenarnya. “Dia baik hati dan enggak membeda-bedakan,” kata Enda. Rowman juga memuji sosok almarhum. “Uje adalah hamba yang disayangi-Nya dan semoga diterima di sisi-Nya,” kata Rowman. Dorce juga punya pandangan tersendiri terhadap almarhum Uje. Selain menjadi ustadz, Uje juga berbisnis pakaian muslim. Dia telah mengenalkan apa yang disebut Baju Koko Uje. “Uje tidak gengsi berjualan pakaian muslim meski sudah terkenal sebagai ustadz,” kata Dorce saat melayat ke rumah duka. Dalam kenangan Dorce, Uje bersama sang istri, Pipik Dian Irawati, biasa ke Pasar Tanah Abang, Jakarta Pusat, untuk urusan bisnis pakaian muslim. “Dia dengan istrinya ke Tanah Abang, masukkan (dagangan) ke (bungkus) plastik, dan jadi nge-tren bajunya itu,” kisah Dorce. Sedangkan presenter Tya Ariestya menyimpan banyak kenangan saat bekerjasama dengan Uje di salah satu program stasiun televisi. “Bener-bener kehilangan banget, sosok ustadz yang aku suka dan nyaman banget untuk tanya-tanya soal agama dan kehidupan,” ujar Tya. Selama berada dalam satu program dengan Uje, Tya banyak mendapat masukan soal agama. Tapi wanita yang menjadi Duta Taekwondo Indonesia itu tidak pernah merasa digurui oleh Uje. Di situlah menurut Tya kelebihan Uje dalam menyampaikan dakwahnya.(k/tv)

Bus Rombongan Justin Bieber Digeledah

Shena Tersingkir, Novita Mulai Terancam Polisi

DIWARNAI perang urat syaraf para mentor yang kian sengit dan terbuka terutama antara Bebi Romeo versus Ahmad Dhani dan Anggun, finalis Shena Malsiana, 23, akhirnya benar-benar tersingkir di babak lima besar ajang X Factor Indonesia (XFI). Dalam pertarungan hidupmati di panggung megah Gala Show 10 dengan tema “”Movie’s Soundtrack” di studio 8 RCTI Kebon Jeruk Jakarta Barat, Jumat (26/4) malam hingga Sabtu (27/ 4) dinihari, biduanita asuhan Rossa ini kalah bersaing dengan Novita Dewi Marpaung. Sementara, Novita untuk kali pertama masuk dua posisi terbawah dalam akumulasi perolehan voting SMS dan telefon selama dua pekan. Kendati Shena mampu menyuguhkan aksi memukau dan mendapat pujian pasca dua penampilan mengusung tembang “Aku Rindu Padamu” milik Evie Tamala dalam nuansa Jazz dan lagu Soundtrack film berjudul “Skyfall” milik Adele, na-

mun komentar positif kwartet juri tak berbanding lurus dengan selera musik mayoritas pemirsa RCTI. Sebagai “panglima tertinggi” ajang XFI pasca vote dewan juri ditiadakan, mulai babak lima besar, masyarakat lebih banyak mendukung Fatin, Nu Dimension, Mikha dan Novita. Alhasil, Shena tersingkir dan gagal masuk empat besar. Novita Terancam Perang urat syaraf antara Bebi Romeo versus Ahmad Dhani yang pada Gala Show 10 bersekutu dengan Anggun, agaknya mulai berdampak negatif pada Novita Dewi. Kendati lolos ke empat besar, langkah mulus biduanita berdarah Batak kelahiran Jakarta, 15 November 1979 ini mulai dihadang kendala bernuansa non-teknis termasuk usia berkepala tiga. Indikasinya, walau tanpa cela melantunkan Bukan Cinta Biasa milik Afgan, Anggun yang mengawali komentar dengan memuji kepiawaian dan tehnik

vokal Novita yang prima namun pada akhirnya mengkritik ending bernyanyi yang selalu sama – mengumbar suara serak dan teriak-eriak hingga mudah ditebak. Bahkan, ketika pembawa acara XFI Robby Purba meminta prediksinya siapa di antara finalis bottom two - Shena dan Novita yang harus pulang atau tersingkir? Penyanyi asal Bandung bereputasi internasional ini, menunjuk putri penyanyi dan musisi legendaris Jack Marpaung, kampiun International Song Festival di Kazakhtan, Rusia 2005 itu. “Saatnya Novita bertarung di luar sana,” ujarnya enteng tanpa memperhitungkan kelebihan faktor teknik olah vokal Novita Dewi. Sementara Ahmad Dhani, Pentolan Dewa 19 dan Mahadewa Band yang sebelumnya berkoar Novita paling jago bernyanyi dan dirinya rela Novita jadi juara, seperti mendukung komentar Anggun. Dia menilai Novita mulai tampil membosankan pasca mengusung lagu

Decode milik Paramore. “Seandainya kita ini sepasang kekasih dan aku boleh jujur, sebagai pacar aku mulai bosan dengan kamu. Komentar ini tolong dicermati agar minggu depan aku tak lagi bosan dengan kamu. Aku sangat merindukan Novita yang dulu tampil sangat memukau seperti saat melantunkan lagu Langit Tak Mendengar milik Peterpan,” harap Ahmad Dhani. Langkah mulus lagi-lagi diukir Fatin Shidqia Lubis, 16. Siswi kelas 2 SMA 97 Jakarta Selatan bergelar “Champion of the People” ini melenggang ke babak empat besar lewat lagu Pelan-Pelan Saja milik Kotak Band dan Lovefool dari The Cardigans yang cocok dengan karakter vokalnya. Gala Show 10 dibuka penampilan lima kontestan membawakan lagu Ain’t No Mountain High Enough milik Marvin Gaye & Tammi Terrel. Dilanjutkan sesi Mentor’s Choice diawali Mikha Angelo mengusung Separuh Aku milik Noah

Band serta Novita Dewi membawakan Bukan Cinta Biasa milik Afgan. Lalu Shena Malsiana melantunkan Aku Rindu Padamu (Evie Tamala), Fatin Shidqia dengan Pelan-Pelan Saja (Kotak Band). Nu Dimension dengan Masih Ada (2D). Pada penampilan kedua mengusung tema Soundtrack film-film popular, diawali Mikha Angelo dengan A Thousand Years (Christina Perri), Novita Dewi membawakan Decode (Paramore). Shena Malsiana dengan Skyfall (Adele). Disusul Fatin Shidqia membawakan Lovefool ( The Cardigans), diakhiri penampilan Nu Dimension dengan Supermassive Black Hole milik Muse. Tampil pula bintang tamu penyanyi Internasional Haley Reinhart. Top 3 American Idol Season 10 tahun 2011, pelantun Soundtrack The Step Up Revolution yang menggoyang panggung XFI dengan tembang Bennie And The Jets milik Elton John. (AgusT)

Fatin Lubis Bersyukur



HINGGA memasuki babak empat besar X Factor Indonesia, Fatin Shidqia Lubis merupakan satu-satunya kontestan yang tidak pernah berada pada posisi bottom two atau posisi dua terbawah akibat minimnya dukungan SMS. Dalam Gala Show 5 Besar X Factor Indonesia, Jumat (26/ 4) malam hingga Sabtu (27/4) dinihari, nama Fatin disebut paling awal sebagai peserta yang lolos ke babak selanjutnya. Fatin pun mengaku sangat bersyukur masih bisa bertahan dan tidak pernah berada di posisi bottom two. Dia berjanji akan selalu memberikan yang terbaik dalam setiap penampilannya. Jika memang bisa menjadi nomor satu, menurut Fatin, itu hanyalah bonus dari apa yang diberikannya selama ini. “Aku

berikan yang terbaik aja dan terimakasih untuk semua yang telah mendukung aku,” ujarnya. Bukan mudah bagi Fatin untuk bisa memposisikan diri menjadi yang terbaik. Sebab, masih ada penyanyi-penyanyi talenta lainnya yang juga punya peluang sama. Ada Mikha Angelo, Novita Dewi dan Nu Dimention yang berebut untuk menjadi nomor satu dalam ajang menyanyi tersebut. Setelah Shena tersingkir, masing-masing mentor menyisakan satu anak didiknya. Tetap Bangga Sementara itu, tereliminasi di babak lima besar X Factor Indonesia, tidak membuat Shena Malsiana merasa kalah. Meski sempat haru harus mengakhiri penampilannya, Shena menganggap momen tersebut tak

akan pernah dia lupakan semasa hidupnya. Di akhir penampilannya itu, Shena berujar bahwa perhelatan yang digelar RCTI tersebut sangat keren. Shena tidak lupa mengucapkan terimakasih kepada seluruh fans yang mendukungnya. “Aku nggak bisa ngelupain momen ini. X Factor (Indonesia) keren banget. Makasih untuk fans, kru-kru yang sudah mendukung dan Kak Rossa,” kata Shena, Sabtu (27/4) dinihari. Rossa, yang jadi juri sekaligus mentor Shena, sempat memeluknya dengan perasaan haru. Meski Shena tidak lolos ke babak selanjutnya, Rossa merasa bangga dengan kiprah Shena di X Factor Indonesia selama ini. “Saya salut. Saya puas dengan yang Shena lakukan selama ini,” ujarnya.(k/tv)

Temukan Narkoba

KABAR tidak baik kembali menghampiri penyanyi remaja, Justin Bieber. Bus yang digunakan untuk membawa rombongan turnya dihentikan pihak kepolisian Swedia, Rabu (24/4) malam. Menurut laporan media lokal Swedia, Aftonbladet, polisi pertama kali mencium bau mariyuana yang sangat kuat berasal dari bus milik rombongan Bieber yang parkir di depan Grand Hotel. “Saat bus meninggalkan hotel menuju Globe Arena, petugas menghubungi unit spesial narkotik, yang diminta untuk melakukan pencarian di bus Bieber,” ujar juru bicara kepolisian Stockholm. Saat polisi memeriksa bus itu, tidak ada seorangpun yang sedang berada di dalam bus. Polisi menemukan sejumlah kecil narkoba, tapi tidak menyebutkan secara spesifik jenis narkobanya. “Kepolisian belum mengidentifikasi pelaku dan bus juga tidak ditahan,” tambahnya. Sebelum pergi ke Globe Arena untuk melakukan pertunjukkan di sana, Bieber terlihat keluar bersama temannya Lil Za. Untuk diketahui Lil Za adalah teman Bieber yang kedapatan merokok ganja bersama dengan Bieber di rumahnya awal tahun ini. Meski begitu polisi menegaskan tidak akan menahan siapapun karena mereka tidak tahu siapa yang kecanduan narkoba. “Tidak ada orang di dalam bus itu. Ditemukan narkotik di lantai bus, tapi tidak diketahui siapa yang membawanya,” alasan polisi. (k/m25)


Waspada, Minggu 28 April 2013  

Waspada, Minggu 28 April 2013

Read more
Read more
Similar to
Popular now
Just for you