Page 1

WASPADA Demi Kebenaran Dan Keadilan

Wanita Bakar Rumah Sendiri MEDAN (Waspada): Diduga mengalami gangguan kejiwaan, seorang wanita membakar rumahnya sendiri di Jalan Perjuangan No 88 Lingkungan XI, Kel Sei Kera Hilir I, Kec. Medan Perjuangan, Sabtu (24/8) sekira pukul 08.50. Akibatnya, rumah permanen tersebut nyaris tinggal puing. Untung mobil pencegah dan pemadam kebakaran Pemko Medan datang, sehingga tidak ada korban jiwa dan api tidak merembet ke rumah warga. Kapolsek Medan Timur Kompol Juliani Prihartini mengatakan diduga pelaku memiliki gangguan kejiwaan dan membakar sendiri garasi rumahnya. Kasus ini sudah kali kedua terjadi dengan pelaku yang sama. (h04)

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) MINGGU, Legi, 25 Agustus 2013/18 Syawal 1434 H z zNo: 24320 Tahun Ke-67

Terbit 20 Halaman

98 Napi Tg. Gusta Buron MEDAN (Waspada): Sebanyak 98 dari 212 narapidana (napi) Lembaga Pemasyarakatan (Lapas) Klas I Tanjung Gusta Medan yang melarikan diri 11 Juli lalu saat ini masih menjadi buron, sementara 114 lainnya sudah kembali berada di Lapas. Menurut Kepala Kantor Wilayah Kementerian Hukum dan HAM Sumatera Utara Budi Sulaksana, di Medan, Sabtu (24/8), jumlah napi yang bisa diamankan kembali bertambah setelah petugas Kepolisian Riau menangkap dua orang tahanan kasus terorisme yang kabur dari Lapas Tanjung Gusta. Menurut dia, polisi menangkap kedua napi itu di Kecamatan Kandis, Kabupaten Siak, Provinsi Riau, Kamis (22/8), sekitar pukul 05.30 WIB. Petugas masih mencari 98 napi lain yang belum berhasil ditangkap. “Seluruh napi yang belum tertangkap terus dicari petugas hingga dapat,” kata Budi. Jumlah napi yang menghuni Lapas Tanjung Gusta Medan tercatat 2.016 orang, padahal daya tampungnya hanya 1.050 orang. Menurut data yang diperoleh dari Kanwil Kementerian Hukum dan HAM Sumatera Utara, 118 napi Lapas Klas I Tanjung Lanjut ke hal A2 kol 3 Waspada/Hendrik Prayitno

TAMBAL SULAM: Dengan dioperasikannya Bandara Kualanamu International Airport (KNIA), jalan tol Medan-Tanjungmorawa semakin memiliki fungsi vital. Namun disayangkan perawatan jalan tol ini masih terkesan tambal sulam. Beberapa ruas jalan tol sedang diperbaiki. Namun perbaikan yang tidak menyeluruh dan hanya menambal hanya pada bagian-bagian tertentu ini membuat badan jalan jadi kurang rata, hingga akan menimbulkan getaran keras ketika dilalui kendaraan dengan kecepatan tinggi—bahkan bisa membahayakan. Foto diambil Sabtu (24/8).

umat Islam dalam politik. Kemudian, lanjutnya, kecenderungan saat ini masyarakat di Indonesia lebih tertarik pada Pemiliu Presiden dari pada Pemilu Legislatif. Padahal jika ingin mengubah sistem liberalisasi demokrasi, harus menang Pemilu Legislatif.

JAKARTA (Waspada): Komisi Pemilihan Umum (KPU) akan memberi sanksi peringatan bagi partai politik (parpol) dan calon anggota legislatif (caleg) yang melanggar aturan kampanye. KPU juga berkomitmen memublikasikan peringatan tersebut agar memberi efek jera bagi para pelanggar. “KPU akan memberi sanksi peringatan administratif. Peringatan itu kan punishment yang lebih kuat daripada dipidana. Peringatan akan dipublikasikan. Itu sanksi sosial yang membuat jera,” kata Komisioner KPU Ferry Kurnia Rizkiyansyah saat dihubungi, Sabtu (24/8). Dia mengatakan, dalam melakukan penertiban dan penegakan hukum atas pelanggaran kampanye, KPU akan bekerja sama dengan Komisi Penyiaran Indonesia (KPI), Dewan Pers, dan Badan Pengawas Pemilihan Umum (Bawaslu). Pelanggaran, ujarnya, termasuk soal isi, tempat, jumlah,

STABAT (Waspada): Kejari Stabat menetapkan dua mantan manager kebun di PTPN2 Kebun Sawit Seberang, Kab. Langkat sebagai tersangka. Sebelumnya, dua rekanan yang terlibat juga ditetapkan sebagai tersangka. Dengan demikian, penyidik sudah menetapkan empat orang sebagai tersangka dalam kasus tersebut. “Hari ini kita tetapkan DS dan AS sebagai tersangka karena turut bertanggungjawab atas pelaksanaan proyek

Lanjut ke hal A2 kol 3

Lanjut ke hal A2 kol 1

Lanjut ke hal A2 kol 1

Umat Islam Belum Mayoritas Di Politik MEDAN (Waspada): Meski umat Islam mayoritas di Indonesia namun belum mayoritas dalam politik sehinga tidak terakomodir. Untuk itu agar umat Islam yang mayoritas ini terakomodir dalam politik, maka harus memenangi Pemilu mendatang. “Makanya jika ingin mengubah sistem liberalisasi demokrasi, harus menang Pemi-

lu,’’ kata Ketua Komisi Pemilihan Umum (KPU) Pusat Husni Kamil Manik dalam seminar diselenggarakan Perhimpunan Keluarga Besar Pelajar Islam Indonesia (KB PII) di Hotel Madani Medan, Sabtu (24/8). Manik mengakui saat ini memang telah terbangun sistem liberalisasi demokrasi dan itu adalah fakta, sehingga mengeliminasi mayoritas


Empat Tersangka KPU Publikasi Pelanggar Kampanye Dugaan Korupsi

KASAD TNI AD Jenderal Moeldoko di dampingi Gubsu Gatot Pudjo Nugroho, Pangdam I/BB Mayjen Burhanuddin Siagian, Pangkosek TNI AU dan Bupati Deliserdang Amri Tambunan saat menandatangani prasasti peresmian perehaban 82 rumah lewat Program Bedah Kampung di Desa Regemuk, Kec. Pantailabu, Deliserdang, kemarin.

Kasad Resmikan Program Bedah Kampung Deliserdang D E L I S E R D A N G (Waspada): Kepala Staf TNI AD (Kasad) Jenderal TNI Moeldoko meninjau sekaligus meresmikan program bedah kampung diprakarsai Pangdam I/ BB Mayjen TNI Burhanuddin Siagian, Sabtu (24/8) di Dusun III, Desa Pesisir Pantai Rugemuk, Kec. Pantailabu, Deliser-

dang. Hampir 100 rumah para nelayan direhab, sehingga mengubah wajah dusun nelayan itu. Infrastruktur jalan menuju dusun juga sudah di aspal, hasil upaya jajaran Dinas PU Deliserdang melalui Lanjut ke hal A2 kol 6

Bayi Tanpa Tempurung Kepala Meninggal

Truk Bermuatan 4 Ton Ganja Terjungkal

MEDAN (Waspada): Bayi tanpa tempurung kepala Kania Rahmadani, 1 bulan, menghembuskan nafas terakhirnya di RSUP H. Adam Malik Medan, Sabtu (24/8) siang. Kemudian, bayi yang memiliki banyak kelainan itu dibawa ke kampung halamannya di Desa Pasar V, Kebun Kelapa, Dusun Sunda, Kecamatan Beringin, Deli Serdang untuk dikebumikan. Pihak keluar mengaku ikhlas dengan kepergian bayi Kania yang dirawat empat hari di RSUP HAM, karena mengalami kelainan yakni, tanpa tempurung kepala, jari tangan yang tidak ada dan bibir sumbing tersebut. “Kania meninggal jam 14 kurang 10 tadi. Saat ini kita lagi repot, mungkin ini saja yah yang bisa kami sampaikan. Kalau untuk keperluan di Adam Maliknya, alhamdulilah tidak dipersulit, kami diijinkan pulang, meski. Berkasberkas belum lengkap,” kata salah satu keluarga dari Ibu Kania, Radiah, 32. Lanjut ke hal A2 kol 1

KOTA JANTHO ( Waspada): Polres Aceh Besar mengamankan truk BK 8400 BU mengangkut ganja kering seberat 4 ton. Saat ditemukan, truk dalam keadaan terjungkal di bawah tebing kawasan Simpang Beutong, Pidie, Sabtu (24/8) pukul 03:00. Truk tersangkut di sebatang pohon, sementara di bagian depan truk rusak berat. Sejumlah aparat Polres Aceh Besar dan anggota Sat Narkoba menerima informasi itu segera mengamankan barang bukti. Namun sopir dan kernet truk berhasil kabur. “Lokasi kejadiannya masuk wilayah hukum Polres Pidie. Jadi, saya sudah minta Kasat Narkoba koordinasi dengan Polres Pidie,” kata Kapolres Aceh Besar AKBP Djadjuli kepada Waspada, Sabtu (24/8). Menurutnya, diamankannya barang bukti ganja berawal dari informasi masyarakat, menyebutkan akan ada mobil membawa ganja. Setelah menunggu beberapa lama, di kawasan Lamteuba sekira pukul 04:00 anggotanya

Waspada/Muhammad Riza


Kania Ramadhani saat masih dirawat di RSUP HAM Medan.

SEJUMLAH anggota polisi berpakaian preman dari Aceh Besar, dibantu masyarakat mengamankan barang bukti ganja empat ton yang ditinggalkan pemiliknya setelah truk terbalik di lintas Banda Aceh-Sigli, Pidie, Kec. Muara Tiga. Sabtu (24/8).

Lanjut ke hal A2 kol 1


Berita Utama

WASPADA Minggu 25 Agustus 2013

Pria Bersenpi Culik Dua Warga Labuhan Deli BELAWAN (Waspada): Dipicu perebutan lahan garapan eks PTPN2, dua warga Pasar VI, Kampung Banten, Desa Manuggal, Kec. Labuhan Deli, H. Syuef, 43, dan M. Arif, 17, diculik belasan pria bersenjata api jenis pistol dan senjata tajam jenis kelewang, Sabtu (24/8) siang sekitar pukul 13.00.

Bandara Ngurah Rai Ditutup Tiga Hari Selama KTT NUSA DUA, BALI (Antara): Bandar Udara Internasional Ngurah Rai, Bali, ditutup untuk umum saat pelaksanaan Konferensi Tingkat Tinggi Kerja Sama Ekonomi Asia Pasifik (KTT APEC) karena digunakan delegasi perwakilan negara-negara anggota konferensi. “Hanya sementara, yaitu selama tiga kali dan setelah pelaksanaan KTT APEC, kegiatan penerbangan untuk umum akan berjalan seperti biasa,” kata Ahmed Kurnia selaku panitian nasional APEC seusai memberikan pengarahan pada wartawan di Nusa Dua, Kabupaten Badung, Sabtu (24/8). Rincian penutupan bandara itu pada Minggu (6/10) pukul 10:00-20:00 WITA, pukul 13:00-20:00 WITA, Selasa (8/10), dan 07:00-14:00 WITA, Rabu (9/10). Penutupan bandara tersebut sudah disebarkan kepada pihak terkait, di antaranya seluruh bandara di Indonesia yang akan dijadikan tempat transit, serta operator penerbangan. Pada jam, hari dan tanggal itu agar tidak mendarat dan lepas landas dari dan menuju Bandar Udara Internasional Ngurah Rai. 21 Kepala negara atau kepala pemerintahan, 5.000 jurnalis mancanegara, sekitar 2.500 anggota delegasi, ribuan panitia pelaksana dan pendukung, pengamat, para ahli, tim teknis, tenaga pengamanan umum dan khusus, akan hadir pada KTT APEC 2013 di Nusa Dua itu nanti.

Truk Bermuatan 4 Ton Ganja ... menangkap dua orang membawa ganja menggunakan sepedamotor. “Tersangka dan barang bukti dibawa ke Mapolres Aceh Besar. Beberapa saat kemudian ada informasi truk terbalik berisi ganja,” kata Djadjuli di dampingi Kasat Narkoba Ipda Andi Cakra Putra. Sedangkan Kapolres Pidie AKBP Sunarya, Sik melalui Kasat Reserse Narkoba AKP Aiyub ditemui di lokasi kejadian mengatakan truk mengangkut 4 ton ganja, diduga diambil dari kawasan Aceh Besar. Diakuinya truk merupakan target operasi Sat Reserse Narkoba Polres Aceh Besar. Truk mengalami kecelakaan tunggal di kawasan hukum Polres Pidie dalam usahanya kabur dari kejaran petugas kepolisian. (b05/b10/cb06)

Sudah Empat Tersangka ... pengerasan jalan tahun 2011 senilai Rp21 miliar tersebut,” kata Kajari Stabat Hendri, kemarin. Tersangka DS merupakan mantan Manager PTPN 2 Kebun Sawit Seberang, sedangkan AS merupakan mantan Manager Distrik Rayon Utara PTPN 2. Kajari menambahkan keduanya dalam waktu dekat akan dipanggil untuk dimintai keterangan. Sementara dari pihak PTPN 2 menyebutkan kepada Waspada sudah menerima surat panggilan penyidik untuk nama DS dan AS sebagai tersangka. Mereka mengemukakan tetap kooperatif memenuhi panggilan kejaksaan dalam kasus tersebut. Proyek pengerasan jalan yang dipecah sembilan di sembilan afdeling tersebut sebelumnya disampaikan Kajari banyak terdapat penyimpangan, karena tidak sesuai bestek dan kontrak kerja serta volume pembangunan jalan menyimpang. “Masing-masing proyek bernilai sekitar Rp2 miliar dan pengerjaan selesai tahun 2012, padahal proyek dimaksud anggaran tahun 2011,” katanya. Penyidik telah menghitung kerugian negara dalam kasus tersebut diatas Rp1 miliar, meski masih menunggu hasil audit Badan Pemeriksa Keuangan Pembangunan (BPKP) Sumut untuk lebih detailnya. Dua tersangka yang ditahan sebelumnya SE dan AEK warga Medan, merupakan rekanan pelaksana kegiatan. (a03)

KPU Publikasi Pelanggar ... dan kampanye di luar jadwal yang ditetapkan. Adapun dugaan pelanggaran pidana pemilu dalam pelaksanaan kampanye akan ditindaklanjuti Bawaslu dengan menyampaikannya kepada kepolisian. “Kalau pidana, Bawaslu memproses ke kepolisian. Kalau Bawaslu mengindikasikan ini sanksi administratif, baru sanksi teguran. KPU ingin menciptakan suasana kampanye yang sehat,” tutur Ferry. Anggota Bawaslu Nelson Simanjuntak mengungkapkan, pelaksanaan kampanye di luar jadwal yang ditetapkan merupakan tindakan pidana.(kcm)

Bayi Tanpa Tempurùng Kepala ... Kania Rahmadani merupakan anak ketiga dari pasangan suami istri Radiah, 32, dan Ricu, 31. Kania lahir pada 8 Juli 2013, di Rumah Sakit Grand Medistra Pakam. Namun, buah hatinya tersebut didiagnosa menderita Multiple Congenital Anomali dan Hydrocephalomeningocele atau bayi dengan banyak kelainan. Sebelumnya, Radiah juga menyampaikan jika anak pertamanya, Niki Tania, 10, dan anak keduanya, Ciki Ananta, 4, lahir dengan normal. Namun, ada banyak kejadian yang tidak biasa yang ia rasakan saat mengandung bayi ketiganya. “Waktu saya hamil, suami saya ada nabrak ayam sampai mati, tapi dibiarkannya. Kejadiannya dua kali, ditempat yang sama. Saat usia 4 bulan, saya juga pernah jatuh naik kereta. Tapi pas USG gak ada kelainan. Hanya saja saat hamil tua pas periksa lagi, dibilang anak saya kepalanya kecil,” ujarnya. Lanjutnya, melihat kondisi sang bayi, ia dan suami mengaku trauma dan tidak ingin menambah anak lagi. Namun, ia juga mengharapkan agar anaknya tersebut dapat cepat di operasi dan kembali seperti anak lainnya. “ “Ini terakhirlah, gak mau punya anak lagi. Trauma, abis ini saya KB. Saya berharap agar anak saya bisa cepat di operasi dan cepat sembuh,” katanya. Sementara itu, Wakil Kepala Instalasi Rawat Inap RSUP-HAM Misrah Panjaitan M Kep membenarkan, bayi Kania telah meninggal karena gagal pernafasan. “Ia meninggal sekitar jam 2 kurang karena gagal pernafasan. Sebelumnya memang sudah dilakukan foto pada jantung, namun belum menyeluruh, belum selesai. Pemeriksaan fisik yang sudah dilakukan,” katanya. Sebelumnya ia juga menyampaikan, bayi malang tersebut ditangani dr Johannes Saing SpA dan Prof dr Adril SpBS (K). “NaJawaban Problem Catur, ma penyakitnya dari diagnosa yaitu Multiple Congenital AnoDari Halaman Sport. mali dan Hydrocephalomeningocele atau banyak kelainan yang dibawa lahir, seperti di ke1. Ke7+, GxK. pala, tanpa tempurung kepala, bibir sumbing dan tanpa jari2. Bxf7, Kf6. jari tangan,” ujarnya. Tindakan yang telah dilaku3. BxK+, Gd-e6. kan, jelasnya, masih penjajakan tindakan penunjang seperti me4. GxGe6+, Rh8. ngambil darah, foto dan bila keadaan memungkinkan dilaku5. Bf8+mat (Jika kan CT Scan. “Akan dilihat dulu hasil pemeriksaan, kalau baik 2. ....., Bf8. dan bagus sarafnya, baru ditentukan tim apakah layak di ope3. Bg7+, Rh8. rasi atau tidak,” ujar Misrah. 4. Bg8+mat. Jika Tambahnya, surat Jamkesda masih dalam tahap pengurusan. 2. ....., Gd-e6. “Masih tahap atau calon pasien Jamkesda, tapi pengurusan 3. GxGe6, Kf6. surat-surat bisa dilakukan nanti saja. Terpenting, bayi tersebut 4. BxK+, Rh8. dibawa pulang dahulu untuk dimakamkan oleh keluarga,” 5. Bf8+mat). katanya. (h02/marwan)

“Mereka datang menggunakan dua mobil minibus. Dua pakai pistol dan lainnya bawa kelewang,” kata M Nur, Sekretaris Karang Taruna, Desa Manunggal saat mendampingi warga melapor ke Polsek Medan Labuhan, kemarin. Menurut M Nur, siang itu H Syuef baru saja pulang shalat dari masjid. Dalam perjalanan menuju pulang, korban dihadang seorang pelaku yang telah menunggu di TKP. Pelaku yang belakangan diketahui bernama Saipal, berteriak dan mengatakan “ini orangnya”, kepada sejumlah pria yang telah menunggu di dalam mobil. “Beberapa

pria yang keluar dari mobil itu di antaranya: Sawek, Simatupang dan Ismi, anggota Satnarkoba Podasu yang mengacungkan pistol ke warga. Korban, H Syuef ditangkap pelaku secara beramai- ramai dengan mengguanakan pistol dan sajam. Melihat keadaan itu, keponakan korban, Arif berusaha melerai, namun belakangan dia juga ikut dibawa penculik yang kabur entah kemana. “Arif ketika itu sedang ngecet dan seandainya Asmi dan kawannya tidak bawa pistol, kami pasti melawan.Tapi karena kami takut kena tembak, kami hanya bisa berteriak saat keduanya dinai-

Waspada/ Rustam Effendi

WARGA Pasar VI Desa Manunggal Kec. Labuhan Deli, melapor ke Polsek Medan Labuhan terkait penculikan dua warganya yang dilakukan belasan pria bersenpi, Sabtu (24/8).

kan dan dibawa pelaku pakai mobil,” ujar M Nur diampingi puluhan warga. Semantara itu istri H Syuef, Rostina, 34, warga Pasar VI, Kampung Banten Desa Manunggal Duseun 3, Kec. Labuhan Deli mengatakan tidak tahu kenapa suaminya diculik pelaku. “Aku tidak tahu kenapa suamiku diculik. Apalagi dia bilal mayit di kampung kami,” sebetnya saat melapor di Polsek Medan Labuhan. Hingga, Sabtu sore, belum diketahui keberadaan H Syuef dan Arif. Warga berharap polisi segera mengejar pelaku yang beberapa orang di antaranya telah diketahui. “Empat pelaku yang kami kenal itu cepat ditangkap. Karena mereka pasti tahu dimana paman dan sepupuku ditahan penculik,” tegas M Nur. Kapolres Pelabuhan Belawan, AKBP Aswin Sipayung, mengatakan pihaknya sedang melakukan penyelidikan masalah itu dan sejumlah personil berpakaian dinas dan preman telah ditempatkan di lokasi. “Kita sedang menyelidiki apakah masalah ini penculikan atau tidak,” sebut Aswin. Sementara itu, keterangan dari lokasi kejadian menyebutkan, perebutan lahan garapan itu telah lama terjadi dan sekitar dua hari lalu juga sudah ada pengrusakan terhadap lahan warga yang disebut- sebut dilakukan Saipal cs yang terkenal diduga suruhan mafia tanah. (h03)

Warga Bireuen Temukan Mayat Lelaki BIREUEN (Waspada): Sesosok mayat laki-laki tanpa identitas berusia sekitar 30 tahun ditemukan di aliran Krueng Peusangan Teupin Mane, Kec. Juli, Kab. Bireuen, Aceh, Sabtu (24/8) sekira pukul 07.30. Saat ditemukan mayat lelaki itu dalam posisi terlungkup, memakai celana jeans dan baju kemeja. Kondisi korban masih utuh tetapi mengalami luka di bibir dan kening serta matanya memar. Kaki terikat dan terba-

lut kain sprai dan leher terjerat kain selendang. Jasad korban awalnya dilihat oleh Nur Asiah dan Rosmani, warga Gampong Balee Panah, Kec. Juli, saat hendak mencuci pakaian di aliran sungai PeusanganTeupin Mane. Warga kemudian meneruskannya ke Polsek Juli. Warga setempat yang turut menyaksikan temuan mayat tersebut mengaku tidak mengenal mayat tersebut. Polres Bireuen dan PMI pun mengeva-

kuasi mayat korban ke RS dr Fauziah Bireuen. Menurut dugaan warga, korban tewas setelah dianianya karena pakaian yang dikenakan korban masih utuh. Bahkan di saku baju korban ditemukan selembar uang pecahan Rp50 ribu dan satu lembar foto wanita. Apalagi saat diangkat dari sungai, darah korban masih segar.Wajah korban juga belum terlihat berubah dan sengaja dibalut kain sprai dan selendang.(b12)

Rupiah Diprediksi Terus Melemah JAKARTA (Antara): Nilai tukar rupiah diprediksi akan terus melemah dan berpotensi menyentuh level Rp12.000 per dolar AS. “Saya perkirakan akan terus melemah bahkan bisa sampai Rp12.000 perdolar kalau kita tidak hati-hati,” kata pengamat ekonomi Sri Adiningsih di Jakarta, Sabtu (24/8). Ia mengatakan, jatuhnya nilai tukar rupiah dan runtuhnya Indeks Harga Saham Gabungan (IHSG) dalam beberapa hari

terakhir harus menjadi perhatian serius pemerintah dan otoritas ekonomi di Indonesia. Sri menyarankan Presiden dan jajaran tim ekonominya termasuk Bank Indonesia berikut Otoritas Jasa Keuangan (OJK) bekerja keras untuk meredam dampak situasi tersebut. “Dalam hal ini mereka harus bekerja keras melalui forum ekonomi yang sudah ada,” katanya. Menurut ekonom UGM itu, pondasi ekonomi Indonesia ter-

98 Napi Tg. Gusta … Gusta Medan dipindahkan ke rumah tahanan lain di Sumatera Utara dan Lapas Nusakambangan di Jawa Tengah. Masih di Markas Brimob Riau Sementara itu, Kapolres Riau AKBP Sugeng Putut Wicaksono mengatakan dua narapidana perkara terorisme yang kabur dari Lapas Tanjung Gusta Sumatera Utara yang ditangkap telah dibawa ke Markas Korps Brimob Polda Riau di Pekanbaru. “Keduanya saat ini masih dalam pemeriksaan intensif oleh Tim Densus 88 di Mako Brimob Polda Riau,” kata Kepala Polres Siak Ajun Komisaris Besar Polisi Sugeng Putut yang dihubungi dari Pekanbaru, kemarin. Ia mengatakan, Tim Densus 88 Mabes Polri menangkap dua narapidana teroris, Agus Sunyoto alias Syafaruddin alias Gapek, 28, dan Ridwan alias Ismail, 52, dilakukan Kamis (22/8) pukul 05:30 di Jln Bambu Kuning, Pasar Minggu, Kel. Kandis, Kec; Kandis, Kabupaten Siak, Riau. Keduanya sempat ditahan dan diperiksa di Polsek Kandi sebelum akhirnya digiring ke BEIRUT, Lebanon (AP): Mako Brimob Polda Riau. Agus Sunyoto alias Syafa- Pasukan keamaman Lebanon ruddin alias Gapek dan Rid- menangkap tersangka pelaku wan alias Ismail adalah dua serangan bom Sabtu (24/8) sewarga terduga teroris yang hubungandenganseranganbom terlibat dalam perampokan ganda sehari sebelumnya yang Bank CIMB Niaga, Medan dan menewaskan sekurang-kupenembakan di Polsek Ham- rangnya 47 orang tewas di kota utara, Tripoli, demikian menuparan Perak. Kapolres mengatakan, se- rut kantor berita pemerintah. Kantor berita nasional (Najauh ini pihaknya juga masih terus melakukan pengembangan tional News Agency) menyebutdengan menyisir tempat per- kan tersangka sebagai Sheik sembunyian dua warga terdu- Ahmad al-Ghareeb dan katanya ga teroris tersebut. (ant/m13) polisi menciduknya di rumahnya

golong rapuh karena cadangan devisa lebih banyak dikontribusi oleh dana-dana jangka pendek. Selain itu, kondisi perekonomian global juga semakin tidak mendukungtermasukutamanya disebabkandolarASyangmenguat dan menunjukkan sikap dari Bank Sentral Amerika The Fed terkait dengan kebijakan stimulusmoneter.“Apalagikitamenghadapi tahun-tahun politik yang jelasakanberpengaruhpadakondisi makro ekonomi kita,” katanya. Bank Indonesia (BI) menyatakan sejak akhir Desember 2012 hingga 23 Agustus 2013 nilai tukar rupiah mengalami depresiasi sebesar 10,9 persen (year to date) yang disebabkan penguatan nilai tukar dolar AS. BI mencatat defisit transaksi berjalan meningkat dari 5,8 miliar dolar AS (2,6 persen dari PDB) pada triwulan sebelumnya menjadi 9,8 miliar dolar AS (4,4 persen dari PDB) pada triwulan II-2013 akibat menyusutnya surplus neraca perdagangan nonmigas serta melebarnya defisit neraca jasa dan pendapatan.

EVAKUASI truk roda sepuluh yang terguling, Sabtu (24/8).

Kontainer Terguling Dekat Rumah Dinas Bupati Asahan KISARAN (Waspada): Truk kontainer roda sepuluh “memanjat” median jalan lintas Sumatera, tepatnya di depan rumah dinas bupati Asahan. Kemudian sekitar 10 meter, truk itu terguling, Sabtu (24/8) pagi. Truk yang disebutkan

Umat Islam Belum ... Sementara mantan Ketua Umum PAN yang kini Ketua Umum Perhimpunan KB PII Sutrisno Bachir yang juga tampil sebagai pembicara mengemukakan, saat ini tidak hanya terjadi liberalisasi politik, namun juga liberalisasi ekonomi. Namun, kata Sutrisno, berkaitan dengan keadaan itu umat Islam yang mayoritas jangan merasa rendah diri. Apalagi diperkirakan pada Pemilu 2014 para tokoh Islam (Partai Islam) masih belum pada posisi semestinya. ‘’Tokoh-tokoh Islam kita hanya masih terposisi pada level menunggu ‘dilamar’,’’ katanya. Dalam konteks perekonomian, menurut Sutrisno Bachir, Indonesia masih dalam posisi pengimpor, terutama yang terbesar produk dari China. Namun hingga kini masih hanya bisa mengekspor TKI. Sedangkan pembicara lain, Prof. Dr. Katimin, M.Ag mengatakan, di Indonesia kepala daerah memang mayoritas dari ka-

langan umat Islam, tapi sangat disayangkan banyak pula yang tersangkut masalah hukum. ‘’Hal itu merupakan tantangan sangat hebat,’’ujarnya. Sedangkan Pemilihan Umum di Indonesia, menurut Katimin, masih prosedural dan bukannya untuk memperjuangkan kesejahteraan masyarakat. Dalam makalahnya dia juga mengemukakan, Indonesia saat ini mengalami krisis, terutama kepemimpinan. Terbukti bahwa sebagian besar gubernur/wakil gubernur, bupati, wali kota tersangkut masalah hukum, termasuk aparatur penegak hukum seperti kepolisian, kejaksaan dan kehakiman. Juga di DPR, menteri serta di semua tingkatan masyarakat dari yang paling rendah hingga yang tinggi tersangkut masalah hukum. ‘’Berdasarkan hal tersebut mari kita jadikan nilai-nilai kepemimpinan politik Islam yang sangat luhur sebagai acuan dalam berbenah diri dan membenahi sistem politik Indone-

sia,’’ kata Katimin. Selanjutnya, guru besar Unimed Prof. Usman Pelly, Ph.D pada seminar itu juga mengemukakan, pada Pemilu pertama partai-partai Islam mampu memenangkannya. Masyumi dan NU bersama partai-partai Islam kecil berhasil meraup suara pemilih lebih dari 45 persen. Akan tetapi setelah itu, suara yang diperoleh partai-partai Islam terus melorot, dan pada Pemilu 2009 hanya mampu meraih 20 persen. Dikemukakan, sampai sekarang masih diperdebatkan apakah partai Islam di Indonesia harus satu (unifikasi) atau banyak (plural). Apajah dia harus berasaskan Islam atau berbasiskan massa Islam. Teken MoU Serangkaian seminar tersebut juga ditandatangani Memory of Understanding (MoU) sosialisasi Pemilu antara KPU Sumut- Perhimpunan KB PII Sumut, masing-masing oleh Ketua KPU Sumut Surya Perdana dan Ketua Perhimpunan KB PII Ahmad Ghazali.(m34)

membawa muatan pakan ternak tujuan Kisaran, selepas Jalinsum depan Makodim 0208 Asahan, melewati jembatanYudhawastu Pramuka. Seharusnya sopir mengambil jalur kiri, akan tetapi melihat kondisinya truk justru mengarah ke tengah

badan jalan, sehingga naik ke median jalan sepanjang sekitar sepuluh meter sebelum terguling ke kiri dan sepasang roda depannya tertinggal di median jalan. “Tidak ada korban jiwa,” kata petugas saat mengevakuasi truk. (a10)

Lagi, Seorang Pendukung Moursi Tewas, 25 Luka KAIRO, Mesir (AP): Pertumpahan darah kembali terjadi di Mesir. Satu orang dilaporkan tewasdan25orangterlukasetelah pendukung presiden terguling, Mohammed Moursi, kembali melancarkan aksi menntang pemerintahan militer di sana. Menurut Shanghai Daily, Sabtu (24/8), kerusuhan baru ini terjadisetelahratusanpendukung Moursi unjuk rasa di penjuru Mesir dalam bentuk pawai. Korban tewas bernama Mohamed Abdullah, loyalis Moursi, ditemukan di kota Tanta dekat delta sungai Nil. Unjuk rasa berdarah ini diketahui bermula setelah shalat Jumat. Diindikasikan, peristiwainihanyasebagaipemanasan dari kelompok IkhwanulMusliminpendukungMoursi, untuk menekan otoritas yang ingin mengakhiri protes berdarah Mesir. Kerusuhan tak berujung di Mesir ini sudah lebih dari sebulan menemui jalan buntu. Ratusan anggota dan 100 anggota inti kelompok Ikhwanul Muslimin sudah ditahan. Lebih dari ribuan orang juga dilaporkan telah tewas dalam kerusuhan pekan lalu. Hampir 200 pengunjuk rasa berkumpul untuk demonstrasi di Nasr jalan Kairo distrik selatan Maadi. Sebagian dari mereka membawa gambar Moursi dan spanduk dari ‘tangan Rabaa,’ sikap empat jari yang mengutuk para pendukung Morsi itu. Keadaan Mesir diperkirakan akan menuju ke krisis lebih besar setelah mantan diktator Hosni Mubarak resmi dibebaskan, dan juga menandakan bahwa militer Mesir ingin mengembalikan rezim lama. Belum perlu dievakuasi Sementara itu,Warga Negara Indonesia (WNI) dinilai belum perludievakuasidariMesirkarena keadaan di negara tersebut mulai

Korban Ledakan Bom, 47 Tewas di kawasan Miniyeh di luar Tripoli. Al-Ghareeb yang punya hubungan dengan satu organisasi Sunni yang memiliki hubungan baik dengan kelompok militan berpengaruh, Hiuzbullah dari Syiah. Dia ketahuan berdasarkan rekaman video pengintai di salah satu lokasi kejadian. Ledakan terkoordinasi terjadi di luar dua masjid di Tripoli, satu kota yang mayoritas berpenduduk Sunni, Jumat. Ledakan itu makin meningkatkan kekhawatiran negara itu dapat

Waspada/Nurkarim Nehe

terjerumus ke kancah serangan balasan antara komunitas Sunni dan Syiah. Bagi kebanyakan warga Lebanon, pengeboman itu juga terlihat sebagai bukti terakhir bahwa perang saudara Syria makin menyeret tetangganya yang lebih kecil itu. Para pejabat kepolisian Lebanon mengatakan Sabtu (24/8), 47 orang terbunuh dan lebih dari 500 orang cedera dalam serangan tersebut. Kira-kira 300 orang masih berada di rumah sakit sehari setelah serangan itu, 65 orang di antaranya berada dalam kondisi kritis. (m10)

membaik.“Alhamdulillahkeadaan membaik. Sampai hari ini tampaknya belum ada keperluan pemerintah melakukan evakuasi atasWNI, terutama mahasiswa. Kecualiadamahasiswayangingin kembali, tentu kita akan membantu,” kata Presiden Susilo Bambang Yudhoyono, di Istana Ne-

gara, Jakarta, Jumat. Kendati demikian, pemerintah sudah menginstruksikan jika situasi memburuk,WNI di Mesir bisa dievakuasi. Sebagaimana yang terjadi ketika Indonesia mengevakuasi mahasiswa dari Libya, Tunisia, dan Mesir.(vn/m10)

Pasukan AS Bergerak Dekati Syria WASHINGTON (AP): Pasukan Angkatan Laut AS bergerak makin mendekati Syria ketika Presiden Barack Obama mempertimbangkan opsi militer untuk merespons dugaan penggunaan senjata kimia oleh pemberontak Presiden Bashar Assad. Presiden Assad menegaskan intervensi cepat dalam perang saudara di Syria merupakan problematik, mengingat pertimbangan internasional yang harus mendahului serangan militer. Menteri Pertahanan AS Chuck Hagel menolak untuk membahas setiap gerakan pasukan tertentu, dan dia mengatakan Obama telah meminta Pentagon untuk mempersiapkan opsi militer bagi Syria. Para pejabat Kementerian Pertahanan AS memberitahu The Associated Press Sabtui (24/8) bahwa AL Amerika Serikat telah mengirimkan satu kapal perang keempat yang dilengkapi senjata misil balistik ke Laut Tengah Timur, namun tanpa perintah segera luncurkan misil ke Syria. Tindakan Pentagon itu ke Syria seiring digelontorkannya opsi agresi militer oleh Presiden Obama. Sebelumnya, intelijen AS telah membuktikan adanya penggunaan senjata kimia, dan kemungkinan besar dilakukan oleh rezim Bashar Assad. Menurut majalah Time Jumat yang mengutip Menteri Pertahanan AS Chuck Hagel, Pentagon dilaporkan telah merapatkan kapal perang mereka ke Syria, siaga jika ada perintah serang dari Gedung putih. Reuters yang mengutip sumber tidak resmi di Kementerian Pertahanan AS mengatakan, Pentagon mengirimkan kapal perang USS Mahan yang baru saja menyelesaikan misi mereka di Timur Tengah dan hendak bertolak pulang ke pangkalan di Norfolk,Virginia. Komandan Armada Keenam memerintahkan kapal itu tetap berada di tempat. Sampai saat ini, kata sumber, mereka belum menerima perintah apapun dari pusat terhadap Syria. (m10)

Helikopter Jatuh 4 Tewas Dan 14 Selamat LONDON, Inggris (AP): Empat orang tewas setelah satu helikopter yang membawa 18 orang dari satu pengeboran minyak lepas pantai jatuh di Laut Utara di lepas pantai Skotlandia, demikian menurut kepolisian Sabtu (24/8). Helikopter Eurocopter Super Puma — yang dioperasikan oleh CHC, satu perusahaan yang melayani pengeboran minyak dan gas lepas pantai — tenggelam ke laut kira-kira 2 mil dari bandara Sumburgh di Shetland Jumat malam. Helikopter itu membawa 16 penumpang dan dua awak. CHC mengatakan pesawat itu mendekati bandara ketika kehilangan kontak dengan pengawas lalulintas udara. Badan pengawal pantai mengatakan, pihaknya telah mengirimkan sejumlah helikopter dan sampan penyelamat ke lokasi jatuhnya helikopter setelah badan tersebut menerima sinyal darurat. CHC tidak ingin berspekulasi mengenai apa penyebab jatuhnya helikopter tersebut, dengan mengatakan pihaknya akan bekerjasama penuh dengan satu lembaga penyelidik yang dipimpin polisi dan Cabang Penyelidik Kecelakaan Udara Inggris. Polisi di Skotlandia mengatakan tiga mayat telah ditemukan dan mereka masih mencari korban keempat. Keempatbelas yang selamat dibawa ke rumah sakit, namun cedera mereka tidak terlalu serius. Perusahaan minyak Total UK mengatakan salah seorang dari korban adalah pekerjanya, sementara yang lainnya adalah pekerja untuk beberapa kelompok kontraktor. (m10)

Kasad Resmikan Program ... program Gerakan Deliserdang Membangun (GDSM). Ratusan prajurit di bawah komando Ka.Zeni Dam I/BB Letkol Faturrahman dan Danramil Beringin GP Girsang serta perwira lainnya yang diultimatum menyelesaikan pekerjaan dalam sebulan, dipercepat menjadi seminggu. Kini desa itu menghijau ibarat perumahan militer. “Ini permintaan warga, hijau menggambarkan keteduhan,” ujar Aster Kodam I/BB Kolonel Bambang Supardi yang membawa mukadimah kedatangan Kasad di desa yang dihuni ratusan jiwa tersebut. Sementara Kasad Jenderal Moeldoko, melayangkan sebuah pantun terkait keikhlasan dan kecepatan prajuritnya merehab rumah masyarakat pesisir yang mayoritas dihuni etnis Melayu. “Ikan sepat ikan gabus, makin cepat mengerjakannya hasilnya makin bagus,” ujarnya saat menyampaikan sambutan di depan Gubsu Gatot Pudjo Nugroho, Pangdam I/BB Mayjen Burhanuddin Siagian, Bupati Deliserdang Amri Tambunan, para Pejabat Kodam I/BB, para Dandim dan pejabat TNI lainnya serta ribuan warga. Sambutan jenderal berbintang empat itu mengajak semua pihak tetap memelihara kebersa-

maan dalam membangun, dan mengucapkan terimakasih yang tulus dan penghargaan kepada Pangdam, Bupati Deliserdang atas kerjasamanya sehingga kegiatan bedah kampung berjalan lancar, aman dan tuntas. “Ke depan program ini akan lebih besar lagi jumlahnya, kita pilih lokasi di kawasan Tapanuli Utara. Intinya untuk pemerataan. Program ini sudah dilakukan di daerah Indramayu,” kata Moeldoko. Bupati Deliserdang Amri Tambunan, berterima kasih kepada Kasad, khususnya TNI-AD yang perdana hadir di Deliserdang dan membantu prorgam perbaikan dan pembangunan rumah tidak layak huni. “Sehingga warga Deliserdang lebih sejahtera, ini memberikan berkah luar biasa dan menjadikan bedah kampung menjadi kenangan abadi bagi masyarakat, sekaligus sebagai dorongan lebih kuat ke depan untuk melanjutkan proses pembangunan,” sebut bupati. Mewakili tokoh masyarakat Desa Regemuk Rahim Barus juga berterima kasih kepada TNIAD yang telah menolong kehidupan warga. “Ini seperti mimpi ibarat mendapatkan Laillatul Qadar,” kata Rahim. Acara dirangkaik pemberian 2.000 paket sembako, diberikan secara simbolis oleh Kasad, Gubsu dan Bupati Deliserdang serta diakhiri dengan meninjau seluruh komplek perumahan bedah kampung.(m16/a06)

WASPADA Minggu 25 Agustus 2013

IAIN Ar-Raniry Tingkatkan Mutu Pendidikan Lewat IDC BANDA ACEH (Waspada): Guna meningkatkan kegiatan ilmiah terkait dengan isu-isu Pendidikan dan Pembelajaran baik dalam konteks regional maupun nasional, Fakultas Ilmu Tarbiyah dan Keguruan (FITK) IAIN Ar-Raniry Banda Aceh membentuk Instructional Development Center (IDC). Dekan FITK Dr H Muhibbutthabry di sela-sela peresmian Sekretariat IDC, Sabtu (24/8) mengatakan, pembentukan lembaga ini diharapkan dapat menjadi Forum Kajian Pendidikan dan Pembelajaran bagi IAIN Ar-Raniry dan khususnya di Fakultas yang dipimpinnya. “Aktivitas berbentuk kajian-kajian ilmiah seperti ini sesungguhnya sangat diharapkan, karena akan berkontribusi positif bagi peningkatan kualitas pendidikan dan pembelajaran di kampus IAIN Ar-Raniry pada khususnya, maupun dunia pendidikan Aceh dan Indonesia pada umumnya,” ujar Muhibbutthabry. Dia menambahkan, forum itu sangat bermanfaat dalam mengembangkan keilmuan di kampus yang ada di kampus, “Ini merupakan salah satu bagian dari program kerja FITK Ar-Raniry”. Ketua Divisi Jurnal dan Penerbitan Buku IDC Anton Widyanto mengatakan, forum itu selain melakukan diskusi-diskusi, juga akan mengelola penerbitan baik jurnal maupun buku-buku karya dosen. “Selama ini FITK memiliki dua jurnal, yaitu Jurnal Didaktika dan Jurnal Kompetensi, ke depan diharapkan kepada penulis yang mengirimkan tulisannya pada jurnal tersebut dapat mempresentasikan karyanya sehingga bisa didiskusikan bersama dan menjadi pencerahan bagi peserta diskusi,” kata dia. Menurut Anton sangat diharapkan kontribusi para dosen untuk menulis pada jurnal tersebut. Pihaknya jugaberencana mendatangkan pakar pendidikan dalam skala nasional maupun internasional sebagai narasumber sehingga akan menambah kualitas jalannya diskusi yang diselenggarakan sehingga karya penulis lebih berkualitas untuk diterbitkan. (b07)

Sumut - Aceh Nelayan Tradisional Protes Operasional Pukat Grandong PERUPUK, Batubara (Waspada) : Puluhan nelayan tradisional sekitar Tanjungtiram mengadukan nasib kepada Dinas Kelautan dan Perikanan Batubara di Perupuk mohon perlindungan beroperasinya pukat grandong tarik dua, Kamis (22/8). Beroperasi kembali pukat grandong dinilai nelayan kecil sebagai pelecehan/melanggar kesepakatan bersama diprakarsai Diskanla dan HNSI Batubara, Senin (19/8) di kantor Camat Talawi dihadiri Kapolres Batubara AKBP JP Sinaga, Dan Pos AL Tanjungtiram, Polair, Camat NasirYuhanan, Abd. Latif Lufhti Panjatan. Para nelayan tradisional mengharapkan Kadiskanla Batubara Rinaldi dapat mengatasi kemelut antar nelayan di Kuala Tanjungtiram minimal memberikan peringatan keras kepada pengusaha pukat grandong yang

jelas dilarang sesuai Kepmen No.2/2011, bila tidak diindahkan supaya ditindak sesuai ancaman hukuman ditetapkan. Nelayan meminta Tim Terpadu penertiban pukat grandong sejenisnya di Batubara difungsikan karena dalam tim itu terdiri Diskanla, Dan Posal Tanjungtiram, Polair, Dishub, KPLP. Ironisnya, sebut nelayan kecil di Tanjungtiram di muka kuala digudang salah seorang pengusaha ikan ‘nongkrong’ kapal patroli Polair, kapal patroli AL bertambat ditangkahanbelakangkantornya. Tidak jelas mengapa dibiarkan pukat grandong leluasa melaut

padahal meresahkan nelayan kecil, ada mengatakan kapal patroli Polair dan Posal di sana rusak tidak dapat beroperasi ke laut. Ketua HNSI Batubara Eddy Alwi, Jumat (23/8) menegaskan pukatgrandongtarikduadilarang beroperasi di laut Batubara, bila kedapatanpukatgrandongmasih melaut supaya segera laporkan ke Diskanla agar ditindak. Itu merupakan keputusan dalam pertemuan delegasi nelayan tradisio-

nal dengan Diskanla Batubara, Kamis (22/8). “Diminta nelayan grandong tidak melaut lagi, kepada nelayan kecil supaya melapor ke Diskanla bila ada kegiatan pukat grandong yang masih ke laut, keputusan itu sudah disampaikan kepada semua instansi terkait, Dan Posal, Polair, Dishub, Camat Tanjungtiram/Talawi, Polres Batubara,” tutur Eddy Alwi. (a12)

A3 MIN Paya Bujok Gelar Aneka Lomba LANGSA (Waspada) : MIN Paya Bujok Langsa dalam memanfaatkan momentum HUT RI menggelar aneka untuk meningkatkan mutu pendidikan di madrasah tersebut. Kegiatan aneka lomba yang diadakan selama dua hari (Jumat dan Sabtu, 23-24/8) itu berlangsung meriah, karena seluruh siswa dari kelas 1-6 yang berjumlah 580 orang putra dan putri ikut ambil bagian sebegai peserta. Kepala MIN Paya Bujok Langsa Muzakkir mengatakan, tujuan diselenggarakan kegiatan tersebut yang utamanya untuk meningkat pendidikan. Adapun jenis-jenis lomba yang diadakan, kata dia, untuk siswa kelas 1 membawa kelereng dalam sendok, kelas 2 memasukkan air sirup ke dalam botol, kelas 3 memindahkan kelereng dalam bambu, kelas 4 berjalan dengan batok kelapa, kelas 5 memasukkan benang ke dalam jarum, dan kelas 6 tarik tambang. Kegiatan lomba dari kelas 1 sampai dengan kelas 5 dilakukan secara estafet, terakhr peserta menjemput wali kelasnya yang sudah siap menunggu anak didiknya di barisan paling depan untuk dibawa ke depan dewan juri. Digelarnya lomba dengan cara demikian rupa, kata Muzakkir, kaitannya dengan peningkatan mutu pendidikan diharapkan akan diperoleh melalui upaya menumbuhkembangkan kerja sama dan memupuk rasa persatuan kesatuan antar sesama peserta dan guru. (b20)

Alumni SMAN 9 Jalan Tilak Sekolah Tak Siapkan Tempat Ibadah Temu Kangen Akbar MEDAN (Waspada): Alumni SMA Negeri 9 (kini SMAN 10) Jalan Tilak Medan akan mengadakan acara Temu Kangen Akbar di Wong Solo Polonia Medan pada Minggu, 8 September mendatang. Kegiatan tersebut bertujuan untuk menjalin silaturrahim sesama alumni mulai dari alumni 1969 hingga 2010. Ketua panitiaTemu Kangen Akbar Oscar Jambak (alumni ’90) didampingi Siti Chadijah Siregar (alumni ’91), mantan ketua OSIS Ruslan dan Ketua Ikatan Alumni SMAN 9 Jalan Tilak (kini SMAN 10) Agus GM Panggabean, Selasa (20/8) menjelaskan, setelah beberapa tahun tak bertemu maka keinginan untuk melakukan silaturahmi sesama alumni sudah saatnya dilakukan, apalagi selain menjalin rasa kesatuan dan kekeluargaan juga menciptakan komunikasi tatap muka. “Dari acara Temu Kangen Akbar ini diharapkan semakin tercipta rasa kekeluargaan dan hubungan yang baik sesama alumni,” sebut Oscar Jambak. Dijelaskan Oscar Jambak, pihaknya mengharapkan dukungan dan kehadiran dari seluruh alumni SMAN 9 (kini SMAN 10) Jalan Tilak yang tersebar di seluruh provinsi di Indonesia agar datang dan menyempatkan diri karena ajang ini sekaligus merupakan nostalgia sesama alumni. Para mantan gu-

ru dan kepala sekolah juga akan diundang. Ruslan dari alumni 1986 sangatmendukungkegiatanTemu Kangen Akbar karena sudah 20 tahun lebih tak bertemu dengan sesama alumni. “Kegiatan ini merupakan kesempatan yang sangatdiharapkanuntukbertemu kembali dengan teman-teman di sekolah dulu,” ujar Ruslan. Panitia juga menyediakan bus untuk mengangkut para peserta Temu Kangen Akbar menuju lokasi acara di Wong Solo Polonia.Busakanmenunggupara peserta di depan Taman Makam Pahlawan Jalan Sisingamangaraja hingga pk 10:00 dan selanjutnya sopir akan membawa para peserta ke Wong Solo Polonia. Pihak panitia, tambah Oscar Jambak, juga memberikan nomor kontak yang bisa dihubungi demi suksesnya acara tersebut; Oscar Jambak (90) 085275528666, Siti Chadijah Siregar (91) 081365463713, Budi Hendra (96) 081370719300, Ruslan (86) 081265212933, Leo Silaban (84) 08126343134, Posman Butarbutar (84) 08126067970, Gregorius Lumbanbatu (84 ) 081362322432, Awaludin/Awel (88) 081362659670, Andi Aria Tirtayasa (87) 081260231966. Khusus untuk Jakarta/Pulau Jawa Ernest Riyanto Hutabarat (87) 081281839868 dan Edi Syamsuddin (87) 08128280275. (h04)

PEMATANGSIANTAR (Waspada): Walau jarak dari sekolah ke masjid lumayan jauh, namun para siswa SMP Negeri 4 dan beberapa siswa dari sekolah swasta lainnya di Jalan Kartini Pematangsiantar yang beragama Islam, terpaksa harus melaksanakan shalat zhuhur di Masjid Nurul Huda milik PT PLN (persero) di daerah itu. “Habis di sekolahan kami tidak ada mushallanya pak, kami terpaksa shalat Zuhur di sini,” sebut Siti Fadhila salah seorang siswa kepada Waspada, usai melaksanakan shalat Zuhur, Kamis (22/8). Pengakuan para siswa SMP itu, di sekolah mereka tidak ada disediakan mushalla sehingga untuk melaksanakan shalat, mere-ka terpaksa keluar meninggal sekolahnya dan berangkat ke Mas-jid Nurul Huda yang ada dalam komplek kantor PT PLN (persero) di Jln MH Sitorus. Selain dari sekolah negeri itu, di daerah tersebut terdapat juga beberapa sekolah swasta, seperti Taman Siswa, sekolah Panti, milik yayasan Korem 022/PT yang juga tidak menyediakan sarana untuk sholat. Padahal siswa muslim di sekolah itu cukup banyak yang akan melaksanakan kewajiban shalat, yakni shalat Zuhur, karena waktu sholat itu para siswa masih ada dalam jam belajar di sekolah. Muliadi salah seorang guru agama di sekolah tingkat SMP itu kepada Waspada mengatakan, pihaknya selaku guru agama sudah berulangkalimengusulkankepadakepalasekolahnyauntukdisediakan sarana air bersih dan satu ruang untuk keperluan pelaksanaan shalat, namun usulan itu tidak terealisasi. (c16)

Bupati Karo Sampaikan Nota Pengantar Ranperda 2012 KABANJAHE (Waspada) : Bapati Karo Kena Ukur karo Jambi Surbakti di hadapan sejumlah para instasi pimpinan daerah Karo pada rapat paripurna di kantor DPRD Karo JalanVeteran Kabanjahe menyampaikan nota pengantar (Ranperda) rancangan peraturan daerah pertaggunggiawaban pelaksanaan anggaran pendapatan dan belanja daerah tahun 2012. Dalam penyampaian yang dibacakan Bupati Karo, bahwa Ranperda pendapatan pemerintah Kab.Karo terdiri dari pendapatan asli daerah, pendapatan transfer dan pendapatan daerah yang sah, realisasi pendapatan Pemkab tahun 2012 sebesar Rp753.388.842.976 miliar dari jumlah anggaran sebesar Rp764.588.259.351 miliar atau mencapai 98,54 persen.Sedangka pendapatan asli daerah merupakan pendapatan yang diperoleh dari pajak daerah,retribusi dan lain pendapatan asli aderah yang sah, dengan realisasi sebesar Rp41.242.973.174miliardarijumlahanggaransebesarRp46.826.174.146 miliar atau mencapai 88,08 persen. Sedangkan pendapatan transfer merupakan pendapatan yang diperoleh dari pemerintah atasan terdiri transfer pemerintah pusat atau dana perimbangan, transfer pemerintah provinsi dan transfer pemerintah pusat lainnya. (c10)


A4 Banyolan Belikan Mobil Kepada Wanita Lelaki: “Sayang, tunggu kamu sudah berumur 30, aku nanti akan membelikanmu sebuah sedan.” Wanita: “Benar ya? Ah, kamu sungguh baik kepadaku.” Lelaki: “Sudah tentu donk, tetapi buah hatiku, di mataku kamu selamanya berumur 18 tahun!” Wanita: “???”

Otak Pintar Karena Makan Ikan Seorang Amerika bertanya kepada pemilik toko ikan milik orang Jepang: “Hampir semua orang mengatakan bahwa orang Jepang sangat pintar. Mengapa kok dikatakan demikian? Rahasianya di mana?” “Ah, sebenarnya tidak ada rahasia apa-apa, dan alasannya juga sangat sederhana, yaitu karena mereka tiap hari makan ikan.” “O, kalau begitu aku mulai besok tiap hari akan membeli ikan.” Sesudah lewat 10 hari, orang Amerika itu dengan marah kembali lagi. “Setelah mendengarkan perkataanmu, aku tiap hari juga makan ikan, tetapi sampai sekarang kok masih tak ada gejala aku berubah menjadi pintar?” Pemilik toko ikan itu berkata “Lihatlah sendiri, Anda sekarang sudah jauh lebih pintar daripada 10 hari yang lalu, hehehe...”

Kabar Baik Ketika Kaki Diamputasi

| Di sebuah rumah sakit, dokter berkata kepada seorang pasien: “Ada sebuah kabar baik dan sebuah kabar buruk, Anda mau mendengar yang mana lebih dulu?” “Kalau begitu Dokter katakan kabar yang buruk lebih dulu.” jawab sang pasien. Dokter berkata lebih lanjut: “Kedua kaki Anda harus digergaji.” Pasien hatinya sangat terpukul, lalu berkeluh-kesah dengan kecewa: “My God, kok begini jadinya? Tetapi keadaanku sekarang sudah begini, masakan masih bisa ada kabar baik apa lagi?” Dokter berkata: “Pasien orang Jepang di ranjang sebelah Anda mengatakan ia akan membeli sepatu Anda.”

Turis Australia di Bali Orang Indonesia: “Tahun ini orang yang datang dari negeri kalian ke Bali banyak sekali, aku pikir kalian datang kemari karena ingin menikmati pemandangan dan ingin mengetahui sejarah kami.” Orang Australia: “Bukan, kami hanya ingin menghemat sedikit uang.”

Hasil Operasi Plastik Seorang istri melakukan bedah plastik menjadi wanita cantik.Ia segera pulang. Saat masuk pintu, ia berkata kepada suaminya: “Lho, masak nggak kenal siapa diriku?” Suami nampak terbengong sejenak, lalu berkata dengan terkejut bercampur gembira: “Ayu masuk, sekarang kebetulan istriku tak ada di rumah.”

Cara Menjadi Politikus Ada orang menanya seorang perdana menter: “Apa syarat-syaratnya untuk menjadi seorang politikus.?”

0 4 3 2 9 B



A 4 1 5 3 9


Perbuatan Tak Terpuji Napi Saat melakukan inspeksi ke penjara, anggota DPR bertanya kepada seorang penjahat: “Kamu dulu pernah melakukan perbuatan yang tak terpuji apa saja?” “Aku telah menjambret seuntai kalung emas seorang nenek, dan aku juga pernah melecehkan seorang gadis di tengah jalan dengan kata-kata yang tak senonoh.” “Lalu apa pula yang kamu lakukan?” “Saat pemilihan anggota parlemen pada 2 tahun yang lalu, aku telah memasukkan surat suara untuk mendukung Bapak.”

Gunakan Uang Kelas Untuk Pribadi Amir adalah anak seorang pejabat negara yang bertugas dalam bidang keuangan dan bendahara di sekolahnya. Suatu hari, ia ketahuan menggunakan uang kelas itu untuk keperluan pribadi. Dipanggillah ia ke ruang guru. Guru: “Mengapa kau gunakan uang itu untuk kepentinganmu sendiri? Padahal itu kan uang milik temanmu! Apakah kau sedang terdesak?” Amir: “Tidak, Bu...” Guru: “Lalu mengapa? (Amir hanya terdiam.) Cepat katakan! Jika tidak, akan saya laporkan kepada ayahmu!!” Amir: “Laporin aja, Bu ..., toh ayah saya yang mengajarkan saya.”

07:00 07:30 09:00 09:30 10:00 10:30 11:30 12:00 16:00 16.30 17:00 18:00 19:30 21.00 22:00

Kopi dan Semut Ayah: “Bund ambilkan kopinya Ayah di meja ya?” Bunda: “Iya Yah.” Ayah: “Liatin ada semutnya gak? Ntar terminum ma semutnya lagi kayak kemarin.” Bunda: “Tenang Yah, semutnya udah ibu basmi koq...” Ayah: “Ooh ya, pake apa Bund?” Bunda: “Bunda semprotkan racun serangga ke kopinya Yah, di jamin gak di kerumunin semut lagi tuh...” Ayah: Kejengkang, stroke 6 bulan*

Istri menemani suaminya untuk pemeriksaan kesehatan. “Suami Nyonya menderita penyakit yang cukup berat, yang di pengaruhi stress. Jika ingin suami tetap hidup, lakukan nasihat saya,” kata dokter. “Pagi hari buatkan sarapan. Perlakukan suami dengan baik. Untuk makan siang, buatkan menu yang lengkap gizinya. Malam hari sajikan yang istimewa. Jaga perasaannya, jangan bebani dia dengan pekerjaan rumah tangga Dalam perjalanan pulang, si suami bertanya kepada istrinya, “Apa kata dokter tentang penyakitku?” “Kamu akan meninggal...”

4 0 7 3

2 6


2 9 1

5 3 2 1 4 1


5 4 3 7 A 6 3 4 2





Alamat sesuai KTP :


.................................................... ---------------------------------------------- potong di sini ---------------------------------------------

Ayo Main Layar Spesial Pose Pelesir Jendela Grebek Nusantara Mata Pancing Layar Kemilau Inspirasi Sore Lintas Petang Tuntas Sepatu Super Terbang Bersamamu Raden Kian Santang Musik Spesial

Nama: ..................................................

07.00 InBOX 09:00 Hot Shot 10:00 SCTV FTV Pagi 11.55 Mutiara Quraish Shihab 12:00 SL Liputan 6 Siang 12:30 Eat Bulaga Indonesia 14.30 Eat Bulaga Indonesia 16.30 SL Liputan 6 Petang 17.00 3 Semprul Mengejar Surga 20.30 Pesantren & Rock Roll 21.30 Emak Ijah Pengin Ke Mekkah 23:15 SCTV FTV

07:30 Gowes 08:00 Diary Bunda 08:30 Aku Bisa Sembuh 09:00 Properties In Harmony 09:30 Good Food Good Mood 10:00 Travellezza 10:30 Neo Planet Remaja 11:30 Topik Siang 12:00 KLIK! 13:00 Mantap 14:00 Total Football 14:30 Kampiun Sepak Bola Nasional 15:00 Indonesia Super League 17:35 Pesbukers 18:30 Indonesia Super League 21:00 Sinema Spesial 23:00 Ultimate Guinness World Of Record

Alamat: ................................................ No. KTP/SIM/Kartu Pelajar: ..............................

Penyakit Seorang Suami

5 0 6 7 2 8 2 3 4 5 6 0 B 1 4 6 Nama

22:00 CLASH OF THE TITANS 07:00 PHINEAS AND FERB 08:00 DORAEMON 08:30 LARVA 09:00 Dahsyat 11:00 INTENS 12:00 SEPUTAR INDONESIA SIANG 12:30 PENYEGARAN ROHANI 13:00 Sinema Siang 14.30 Pupus 16.00 SEPUTAR INDONESIA 17.00 Tangan Tangan Mungil 18.00 Anak Anak Manusia 19:30 Layar Drama Indonesia : TUKANG BUBUR NAIK HAJI THE SERIES 22.30 Box Office Movie 24.30 Seputar Indonesia Malam

Perdana Menteri menjawab: “Politikus harus bisa meramalkan hari besok, bulan depan, tahun yang akan datang” Orang itu menanya lebih lanjut: “Kalau sampai waktunya, hal yang diramalkan tersebut tidak juga terwujud, bagaimana? Apa yang harus kita perbuat?” Perdana Menteri berkata: “Saat itu sewajarnya kita perlu mencari dan membuat suatu alasan yang rasional”


A 1 5

Minggu 25 Agustus 2013


Gunakan angka 0 sampai 9 ditambah dua abjad -- A dan B -- untuk mengisi kotak-kotak kosong. Tidak boleh ada pengulangan angka dan huruf pada lajur mendatar dan menurun, serta di dalam kotak 4x3 bergaris tebal. Tingkat kesulitan: sedang (***). Tersedia hadiah Rp50.000,- untuk seorang pemenang. Antar kupon yang sudah terisi angka yang anda yakini benar ke kantor Waspada Jl. Brigjen Katamso 1 Medan paling lambat Jumat. Jawaban bisa juga dikirim ke faksimile (061) 4510025. Jawaban dan pemenangnya dimuat pada edisi Minggu ( 1/9). ------------------------------------------------------ potong di sini --------------------------------------------------------

0 6 3


gunting di sini TTS Berhadiah Jawab dan gunting TTS Berhadiah di atas kemudian kirimkan ke PT Harian Waspada Jalan Brigjen Katamso No.1 Medan/Jalan Letjend Suprapto No.1 Medan. Tulis nama dan alamat lengkap serta nomor pengenal. Jawaban paling lambat diterima Jumat 30 Agustus 2013, pukul 16:00. Bagi pengirim yang dapat menjawab semua pertanyaan dengan tepat dan benar akan diberi hadiah berupa uang tunai sebesar Rp50.000,-untuk satu orang pemenang. Semua jawaban yang benar akan diundi. Pengumuman pemenang akan diumumkan pada Minggu 1 September 2013 beserta jawaban yang benar di halaman yang sama. Hadiah dapat diambil di kantor Harian Waspada bagian Sekretaris Redaksi (jam kerja), setelah tiga hari pengumuman pemenang diterbitkan.



1. Tulang atas dan bawah dalam rongga mulut tempat gigi tumbuh 4. Bantal yang berbentuk bulat panjang 7. Abang (Padang) 8. Bagian kapal/perahu yang paling depan 12. Padang rumput yang terdapat digurun pasir 16. Ombak kecil 18. Lawan dingin 19. Tidak/kurang jelas 21. Mencampur, mengacau 23. Syarikat Islam 24. Digit pada bilangan binner 25. Kening,jidat 26. Ruangan besar di rumah sakit, bangsal 27. Bayi 29. Kasihan 31. Alat untuk mengangkat air dari dalam sumur 33. Suara tangis yang tertahan-tahan, sedusedan 36. Huruf ke-18 abjad Arab 37. Hujan (Inggris) 40. Kaca berbentuk persegi untuk ikan hias 45. Disatukan dengan tali/benang 46. Asia Afrika 47. Ibu (Arab) 48. Ayah, bapak 49. Bisul pada tengkuk 50. Jelas dan nyaring kedengaran 51. Aliran air

1. Nyawa, jiwa 2. Keadaan, peristiwa 3. Manfaat 4. Zat ringan yang sifatnya seperti udara 5. Hewan bersisik yang hidup di air 6. Ampunan yang diberikan oleh kepala negara 9. Ahli waris yang berhubungan darah langsung 10. Bagian dalam tubuh yang menyerupai benang atau tali 11. Benda cair 13. Habis kandungan airnya karena diperas 14. Talam, nampan 15. Takdir 17. Hadiah 20. Ukuran seperseribu 22. Kotoran sisa debu bercampur keringat yang melekat pada tubuh 27. Ikat pinggang lebar yang digunakan pada baju kimono atau baju yudo 28. Peperangan, medan perang (ark) 29. Keadaan hawa, cuaca 30. Manusia pertama 32. Bekas 34. (diulang) percuma 35. Cemburu 38. Pikiran 39. International Amateur Boxing Association 41. Barang yang ditenun dari benang 42. Duit 43. Binatang bertanduk 44. Universitas Islam Sumatra Utara

Pemenang Sudoku Berhadia Minggu Lalu

Pemenang TTS Berhadia Minggu Lalu Elly Yulisani Lubis Jln Tasikmadu No. 5 Sunggal

Syahrul Alinafiah, Jln Garu VI No 3 Medan


9 6 1 3 2 A B 0 7 5 4 8

0 8 B 3 A 7 5 6 2 1 4 A 3 5 1 8 4 2 B 9 7 0

2 4 B 8 0 1 6 7 5 6 1 9 4 A B 9 2 6 A 3 1 7 0 7 5 4 9 2 8 3

B 9 8 0 4

9 2 7 5 0 A 3 6 B 7 6 2 1 5 4

0 5 A 6 4 7 B 9 5 4 8 1 8 1 3 7 2 4 1 0 8 A 3 0 9 7 B B 3 A 6

6 1 A 3 9 5 2 8 0

3 0 6 2


B 5 4 8 9

8 A 3 B 7 6 9 1 5 2

07.00 Kartun 08:00 Pokemon Best Wishes 08:30 Scan2go 09:00 Dragon Ball Z Kai 09:30 Sinema Pagi Akhir Pekan 10.30 KiSS Pagi 11:30 Patroli 12:00 Sinema Pintu Taubat Siang 14:00 HOT KISS 15:00 Fokus 1 5 : 3 0 Sur g a D i Ba w a h Telapak Kaki Ibu 16:00 Sinema TV Sore 18:00 Drama Seri Indonesia: Setulus Kasih Ibu 19:00 Sinema Indonesia 20:00 The Voice Indonesia 22:00 Terus Terang Bersama Tina Talisa

07.00 Apa Kabar Indonesia Pagi 10:00 Tinju Legendaris 11:00 Sport Doc : The Magic Of FA CUP 11:30 Live News Kabar Siang 12:00 ImperialWorld A New World 12:30 Terabas (Terakses Tanpa Batas) 13:00 Damai Indonesiaku 15:00 Khazanah Islam 16:00 Bumi dan Manusia 17:00 Live News Kabar Petang 19:00 Indonesia Lawyers Club 21:00 Live News Apa Kabar Indonesia Malam 22:00 Live News Kabar Malam 23:00 Kabar Arena Akhir Pekan

07:05 Channel Japan 07:30 Agung Sedayu Group 08:05 Talk Indonesia 08:30 Agung Sedayu Group 09:05 Dunia Kita 09:30 Agung Sedayu Group 10:05 Let 10:30 Secret Of Health 11:05 Eagle Doc : Series 11:30 12 Pas 12:05 Metro Siang 13:05 Oprah Winfrey Show 14:05 Sudut Pandang 15:05 Ikonia 15:30 Kick Andy 17:05 Metro Hari Ini 18:30 Metro This Week 19:05 Mario Teguh The Golden Ways 20:30 Just Alvin 21:30 Shockwave 22:30 Newshow 23:30 Metro Sports

07:30 The Penguins Of Madagascar 08:30 Sketsa Tawa 09.30 Dapoer Cobek 10:00 Obsesi 11:00 Buletin Indonesia Siang 12:30 Masquerade 13:30 Film TV 15:30 Fokus Selebriti 16:00 Naruto Shippuden the Movie 18:00 Komeng AcakAdul 19:00 RRRrrrr!!! 21:30 Barclays Premier League 22.30 Box Office Movie


TRANS 7 07:00 Plester 07:30 Selebrita Pagi 08:30 Iseng Banget 09:30 Spotlite 10:00 Wollipop 10:30 RAN 12:00 Selebrita Siang 12:30 Galeri Sepak Bola In. .. 14:30 Mancing Mania 15:00 Seleb Expose 16:30 Redaksi Sore 17:00 Makan Besar 20:00 Hitam Putih 21:00 Pas Mantab 22:30 Mister Tukul 23:30 Dua Dunia

07:30 Mozaik Islam 08:00 Benu Buloe 08:30 Buah Hati 09:00 Ceriwis 09:30 Ala Chef 10:00 Sportvaganza 10:30 Ngulik 11:00 Insert 12:00 Bioskop Indonesia Premiere 14:00 Sketsa 15:00 DR OZ 17.15 Insert Investigasi 21:00 Bioskop TransTV 23:00 Bioskop TransTV **m31/G

Medan Metropolitan

WASPADA Minggu 25 Agustus 2013

Kadis Pertanian Sumut Diperiksa Kejaksaan Agung Waspada/Andi Aria Tirtayasa

PETUGAS Unit Laka Sat Lantas Polresta Medan Aiptu Supriyanto sedang melihat kondisi Praka Hartono yang masih kritis di Ruang ICU RS Delitua akibat ditabrak truk bermuatan pasir di Jalan Ardagusem, Desa Delitua Timur, Kec Delitua, Sabtu (24/8).

Anggota Marinir Kritis Ditabrak Truk MEDAN (Waspada): Prajurit Kepala (Praka) Marinir Hartono ,29, warga Jln. Ardagusema, Desa Delitua Timur, kritis ditabrak truk pengangkut pasir di Jln. Ardagusema, Sabtu (24/8) sekira pukul 10:00. Anggota marinir tersebut selanjutnya dilarikan warga ke Rumah Sakit Sembiring Delitua sedangkan sopir truk BK 8042 LT melarikan diri bersama kernetnya. Informasi yang diperoleh di lokasi kejadian, pagi itu Praka Hartono mengendarai sepedamotor Vega BK 2732 GS datang dari arah Delitua menuju Sibiru-biru. Persis di Jln. SMA Negeri 1 Delitua simpang kuburan Jepang, dari arah berlawanan muncul truk Colt Diesel BK 8042 LT yang dikendarai Idris ,18, warga Mariendal. Sopir Colt Diesel tiba-tiba ‘nyelonong’ ke kanan jalan karena hendak mendahului bus yang di depannya sehingga menabrak sepeda motor yang dikendarai korban. Akibatnya, korban terpelanting dan menderita luka robek di bagian belakang kepala, lutut kiri dan rahangnya luka lecet. Sejumlahwargadankeluargakorbanyangmengetahuikecelakaan lalulintas tersebut segera mengevakuasi korban ke RS Sembiring, sementarasopirtrukdankernetnyamelarikandirikarena takut diamuk massa dan meninggalkan truknya begitu saja. Petugas Unit Laka Sat Lantas Polresta Medan Aiptu Supriyanto Nainggolan dan Brigadir Y Chandra yang tiba di lokasi kejadian segera melakukan olah TKP. Selanjutnya, petugas melihat kondisi korban di ruang IVU RS Sembiring dan mengamankan truk colt diesel bermuatan pasir dan sepedamotor milik korban ke Unit Laka Sat Lantas Polresta Medan. Kritis Di RS Kesdam Sementara itu, seorang pria tanpa identitas dalam kondisi kritis dilarikan ke Rumah Sakit Kesdam Jalan Putri Hijau Medan, Kamis (22/8) sekira pukul 23:00. Hingga Jumat (23/8) pukul 18:00, petugas Unit Laka Sat Lantas Polresta Medan kesulitan untuk mencari tahu keberadaan keluarga korban. Kanit Laka Sat Lantas Polresta Medan Iptu Gandi menjelaskan, pihaknya mendapat informasi ada lelaki tanpa identitas yang diduga korban tabrak lari dan dibawa ke RS Kesdam. Namun, identitas korban tidak diketahui sementara penarik beca bermotor yang mengantar korban ke rumah sakit tersebut meninggalkan rumah sakit tersebut tanpa memberi informasi di mana lokasi kecelakaan. “Usai mengantar korban ke rumah sakit, abang betor tersebut pergi begitu saja tanpa meninggalkan identitasnya dan tidak member tahu di mana lokasi lakalantas yang dialami korban,” ujar Iptu Gandi. Menurut Kanit Laka, ciri-ciri korban yang masih kritis di rumah sakit tersebut diperkirakan berusia 30 tahun, tinggi170 cm, rambut panjang ikal, kulit sawo matang. “Tadi saya lihat kepala korban sudah dibotak , kemungkinan akan menjalani operasi,” tutur Kanit Laka Iptu Gandi seraya mengimbau warga yang kehilangan sanak saudaranya segera menghubungi petugas Unit Laka Sat Lantas Polresta Medan atau mendatangi ruang ICU RS Kesdam Jalan Putri Hijau. (h04)

MEDAN (Waspada) : Terkait dengan adanya dugaan korupsi Bantuan Langsung Benih Unggul (BLBU) paket I oleh PT Hidayah Nur Wahana (HNW) Ditjen Tanaman Pangan Departemen Pertanian dengan kerugian diperkirakan senilai Rp209 miliar, Kepala Dinas Pertanian Provinsi Sumatera Utara M Roem diperiksa tim kejaksaan dari Kejaksaan Agung (Kejagung) di kantor Kejaksaan Tinggi Sumatera Utara (Kejatisu), Jumat (24/8). Dalam pemeriksaan tersebut M.Roem yang datang sekira pukul 10:15 dengan mengendarai mobil Honda CR-V warna hitam langsung masuk ke ruang penyidik. Setelah menjalani pemeriksaan sekira satu jam, pria berbadan subur yang tam-

pak mengenakan pakaian safari berwarna abu-abu itu langsung melangkah menuju pintu keluar Kejatisu. Saat ditanya wartawan, awalnya dia enggan berkomentar. Setelah didesak, M.Roem akhirnya memberikan penjelasan singkat soal kasus tersebut. “Kita ada kegiatan namanya BLBU. Bantuan Langsung Bibit Unggul tahun 2012. Itukan programnya pusat (Kementan). Tendernya juga di pusat,” kata M.Roem. Dia menjelaskan, kegiatan BLBU ini dilakukan di berbagai Provinsi di Indonesia, termasuk di Sumatera Utara. “Jadi yang menentukan calon petani dan calon lahan penerima (BLBUred) adalah Dinas Kabupaten yang sudah ditetapkan dari kementrian,” ujarnya. Pemenang rekanan, kata M.Roem, kemudian mendro-

Alfamart Alfamidi Bangun Rumah Layak Huni MEDAN (Waspada): Sebagai wujud kepedulian terhadap masyarakat kurang mampu, PT Sumber Alfaria Trijaya Tbk (SAT) pengelola Alfamart Alfamidi bersama dengan Habitat for Humanity Indonesia (HfH) meluncurkan Program Rumah Untuk Indonesia. Program ini bertujuan membangun rumah layak huni gratis bagi masyarakat kurang mampu di wilayah Tangerang, Surabaya, dan Medan. “Program ini akan melibatkan partisipasi masyarakat dalam penggalangan dana kepedulian melalui Alfamart dan Alfamidi mulai 18 Agustus-30 September 2013,” kata Corporate Affairs Director PT Sumber Alfaria Trijaya Tbk Solihin, Sabtu (24/8). Pelanggan Alfamart dan Alfamidi kata Solihin bisa mendonasikan uang kembalian atau melakukan donasi bebas melalui kasir di Toko Alfamart, sebagai bukti donasi bebas pelanggan akan mendapatkan struk. “Rumah salah satu kebutuhan hidup yang harus dipenuhi. Namun faktanya masih banyak masyarakat yang tidak memiliki rumah layak huni. Kami merasa

terpanggil untuk berkontribusi langsung dalam membantu pemerintah agar masyarakat dapat memiliki hidup yang lebih berkualitas, salah satunya dengan memiliki rumah layak huni.” papar Solihin. Direktur Nasional HfH Indonesia James Tumbuan mengatakan HfH Indonesia bekerja sama dan dipercaya sebagai mitra PT SAT akan melaksanakan pembangunan rumah, mulai dari penyiapan lokasi, pemilihan keluarga yang memperoleh bantuan dan proses konstruksi rumah hingga selesai. “Bagi Habitat for Humanity, rumah yang layak adalah awal segala kebaikan. Pendidikan, dan kesehatan yang berkualitas. Melalui program kerja sama dengan Alfamart dan Alfamidi, kami mengajak dan memberi kesempatan bagi seluruh masyarakat mampu untuk ikut membantu,” jelasnya. Komitmen ini kata James, wujud kontribusi signifikan dalam program jangka panjang I Build My Indonesia periode 2013-2018 untuk mewujudkan mimpi 60.000 keluarga untuk tinggaldirumahyanglayak.(m39)

ping benihnya kepada kelompok-kelompok tani (Koptan) yang ada di Kabupaten/Kota. Disinggung soal pemeriksaannya, M.Roem mengaku hal ini sifatnya hanya kordinasi. “Jadi Provinsi (Dinas Pertanian Sumut) sifatnya koordinasi. Jadi wajar Dinas Pertanian Provinsi diminta keterangannya,” kata M.Roem. Saat ditanya apa saja pertanyaan yang diajukan oleh tim Kejagung terhadap dirinya, ia enggan berkomentar banyak. Kepala Seksi Penerangan

Hukum (Kasi Penkum) Kejatisu, Chandra Purnama ketika dikonfirmasi soal pemeriksaan M.Roem mengaku tidak bisa memberikan komentarnya. “Itu (kasus BLBU-red) kan yang nangani Kejagung. Jadi konfirmasi langsung saja kesana,” kata Chandra. Menurut Chandra, dalam kasus ini pihak Kejatisu hanya sebagai fasilitator saja. “Pihak kita (Kejatisu-red) hanya memfasilitasi tempat saja,” terangnya. (m38)

Calhaj KBIH Al Adliyah Halal Bihalal MEDAN (Waspada) : Kelompok Bimbingan Ibadah Haji Al Adliyah Jln. Letda Sujono Medan Halal Bihalal bersama Calon jamaah haji (Calhaj) dan masyarakat di lingkungan Gg Adil, Sabtu (24/8). Hadir Pimpinan KBIH Al Adliyah H Ikhwansyah Nasution, Calon anggota DPDRI Sumut Drs H Syariful Mahya Bandar MAP, Ka.KUA Medan Tembung Sutan Syahrir, Kasi Urusan Haji Kementerian Agama Kota Medan Ahmad Qosbi, penceramah Ustad Dr. H. Muzakir, MA, tokoh masyarakat H Abdul Hadi Lubis. Kepada wartawan Ikhwansyah Nasution menyebutkan, Calhaj di KBIH ini yang akan berangkat ke tanah suci tahun ini sebanyak 68 orang, tergabung

dalam kloter 5 yang masuk asrama 14 September dan berangkat 15 September mendatang. “Sebenarnya Calhaj yang ikut bimbingan di sini ada 101 orang, tetapi yang melunasi 92 orang, karena adanya pemangkasan 20 persen oleh pemerintah Arab Saudi maka yang berangkat dari KBIH ini hanya 68 orang,” jelasnya. Sebelumnya Calon anggota DPD RI, Drs H Syariful Mahya Bandar MAP mengharapkan Calhaj yang akan berangkat tahun ini terutama yang ikut di KBIH Al Adliyah agar meluruskan niat untuk beribadah haji. Haji, kata dia, adalah serangkaian ibadah yang merupakan rukun Islam kelima. Sehingga keberadaan di sana benar-benar beribadah. (m37)

31 Calon Anggota KPU Labusel Lulus Seleksi Administrasi MEDAN (Waspada): Tim seleksi KPU Labusel (LabuhanbatuSelatan)menyeleksi31orang administrasi calon anggota KPU dan dinyatakan lulus sesuai SK nomor:02/TIMSELKPU/LS/2013 ditandatangani ketua tim seleksi Junita, S. Sos, M. Pd. Menurut anggota tim seleksi Sarwo Edi di Medan, Sabtu (24/ 8), seleksi selanjutnya, 27 Agustus seleksi tertulis, 28 Agustus seleksi kesehatan, 29 hingga 30 Agustus ter psikologi dan 3 September 2013 wawancara serta klarifikasi tanggapan masyarakat. Mereka yang lulus; Adesi Iskandar Nasution, Aidil Syahputra Siregar, SE, Alimukmin Simbolon, S. Pd, Bangun Shahril Ha-

rahap, Deni Syafrizal Daulay, Efendi Pasaribu, SE, M. AP, H. Syahruddin, HaflahYusri, Hamka Tambunan, S. Sos, Imran Husaini Siregar, SP, Imron Simanjuntak, Ir. M. Ali Nababan, Irwansyah, S.Sos, Khairul Mubarrik Hrp, SE, Mahmuddin, SE, Makmur Dedi Siregar, Mhd. Idris, SH, Muhammad Ashari, S. Pd, Muhammad Azhar Siregar, Nurhayati Panggabean, Pardamean Siregar, S. Pd, Rahmad Sarif Hutabarat, SH, Ridwan Hasibuan, S. Pd, SaipulnBahri Dalimunthe, Salim, S. Ag, Samsuten Ritonga, SH, Sarif Pardamean Harahap, SE, Sumarno, SP, Zulham Dani Rambe, SH dan Zupri HUsin Siregar. (m26)

A5 FPK Sumut Halal Bihalal Bersama Al-Barokah MEDAN (Waspada): FPK (Forum Pembauran Bangsa) Sumut halal bihalal dengan paguyuban masyarakat Al-Barokah di kediaman anggota FPK Asdani Jln. Pukesmas, Kec. Medan Sunggal, Minggu (18/8). Ketua FPK Sumut H Bahari Damanik dalam sambutannya menjelaskan proses kelahiran FPK termasuk para pengurus yang ada di dalamnya yang mencerminkan keberagaman. “Semua etnis di Sumut ada dalam FPK,” tuturnya. Kata dia, FKP sebagai organisasi yang dilahirkan pemerintah harus terus melakukan sosialisasi dengan masyarakat tentang keberadaannya, termasuk fungsi dan tugas yang dipikul. Tugas pokok FKP antaralain adalah bagaimana menguatkan rasa kebangsaan yang mampu menjadi modal pembangunan bangsa. Sementara itu, Sekretaris FPK Sumut Dr. H. Arifinsyah, MAg mengatakan, halal bihalal sekaligus silaturahim dengan masyarakat pada Idul Fitri 1434 H ini merupakan amanat Permendagri nomor 34 tahun 2006, sebagaimana tupoksi FPK yang diselenggarakan secara berkelanjutan dan bergilir di rumah anggota. Bagi FPK, silaturahim dengan berbagai etnis di Sumut yang juga dirangkaikan dengan peringkatan HUT ke 68 RI, merupakan modal besar bagi pembangunan bangsa. Disamping menciptakan semangat baru dalam membentuk rasa patriotisme atau kebangsaan terutama bagi generasi muda. Sebelumnya, Asdani sebagai tuan rumah menyatakan kebahagiaannya diselanggarakan halal bihalal serta silaturahim dengan paguyuban Al-Barokah. Dia berharap kegiatan yang sudah menjadi kalender tahunan FPK tersebut jangan sampai terputus dan terus dilakukan secara bergilir di rumah anggota. Hadir dalam pertemuan itu Wakil Ketua FPK Sumut Afifuddin Lubis, Bendahara Suwito dan anggota Julisman D, Syahwal Pasaribu, H. Zakaria Y Lafau, Gopala Krishna, Wan Nabari Ginting, Erwan Efendi, Guci, dan H Bustami Usman. (cwan)

Rayakan Kemerdekaan Dengan WiGO Meriah MEDAN (Waspada): Untuk memeriahkan HUT RI ke-68,WiGO selaku penyedia layanan internet berkecepatan tinggi yang mengusung teknologi 4G, menghadirkan WiGO Meriah. Program ini bertujuan membagikan TOP up Kuota jutaan rupiah kepada pengguna internet dalam rangka memeriahkan hari kemerdekaan dengan membagikan gratis Top Up Kuota hingga 1 Juta rupiah atau setara dengan 8 GB. “Pelanggan WiGO bisa lebih nyaman lagi dalam menikmati layanan internet. Program ini berlaku untuk setiap pelanggan yang melakukan aktivasi paket WiGO apapun pada 19-31 Agustus 2013,” kata Direktur Berca Duta Sarosa, Sabtu (24/8). WiGO Meriah tambah Duta merupakan wujud dari komitmen WiGo untuk meningkatkan kepuasan pelanggan dalam menikmati layanan internet dengan kecepatan dan teknologi tercanggih 4G serta sekaligus memeriahkan HUT RI. “Kami optimis dapat semakin memenuhi kebutuhan berinternet masyarakat di kota Medan, Batam, Pekanbaru, Palembang, Balikpapan, Pontianak, Denpasar dan Makassar.” Ujarnya. Dikatakannya,WiGO Start Up danWiGO Home Plus merupakan paket internet 4G dari WiGO yang bisa menjadi pilihan pelanggan personal. Kedua paket ini, dipasarkan dengan kecepatan hingga 1 mbps dan kuota mencapai hingga 25 GB per bulan , serta dengan bonus free Top Up kuota WiGO Meriah sebesar hingga 6GB yang diberikan saat pelanggan melakukan aktivasi. Sedangkan untuk memenuhi kebutuhan profesional, WiGO Premium dan WiGO Ultimate memungkinkan kecepatan internet hingga 30 Mbps dengan kapasitas kuota hingga 200 GB perbulan dan bonus free Top Up kuota WiGO Meriah sebesar hingga 8 GB. Area Manager Medan Edward Susanto mengatakan peluncuran WiGO Meriah didukung dengan rangkaian acara Open Booth yang akan dilaksanakan di perumahan dan pusat perbelanjaan terkemuka. “Kami sengaja memilih lokasi – lokasi tersebut supaya pelanggan dapat lebih mudah menjangkau dan menikmati layanan kami”, ucap. (m39)



Potret Pembaca

WASPADA Minggu 25 Agustus 2013

Dollar Meroket PELEMAHAN rupiah terhadap dolar Amerika Serikat (AS) terus terjadi hingga saat ini, dolar sampai menembus di angka Rp11.000. Dengan kondisi ini tentu akan berdampak kepada kenaikan sejumlah barang di antaranya emas, barang eletronik seperti ponsel (handphone), kulkas , TV serta sparepart kendaraan bermotor.

Foto Kiriman: Tengku Anisah tengkuanisah

FOTO BERSAMA Sejumlah siswi SMA An Nizam foto bersama sebelum berbuka puasa dalam rangkaian pesantren kilat Ramadhan 1434 H kemarin.

Waspada/Arianda Tanjung

Foto Kiriman: M. Azizi Mursali Sambas Simpang Empat - Asahan

TEMBUS 11 RIBU: Karyawati money changer menunjukkan uang dollar AS yang telah menembus Rp11.000 pada perdagangan valuta asing, Rabu (21/8).

Melihat kondisi seperti ini pemerintah akhirnya mengambil beberapa langkah yang dinilai strategis untuk menyelamatkan perekonomian Indonesia, antara lain berkaitan dengan Keterpurukan rupiah dan anjloknya IHSG. Terdapat empat kebijakan yang dikeluarkan pemerintah yang isinya terbagi lagi menjadi beberapa kebijakan antara lain.�Pemerintah dan BI secara seksama selalu mengikuti perkembangan ekonomi dan pemrintah sangat menyadari dampak yang ditimbulkannya. Situasi sampai saat ini aman, tapi kita harus meningkatkan kewaspadaan dengan terjadinya perkembangan yang ada,� ujar Menteri Koordinator Perekonomian Hatta Rajasa, Jumat (23/8). Adapun beberapa kebijakan di antaranya menaikkan pajak barang mewah (PPn BM) dari 75 % menjadi 125 %, produk yang dimaksud seperti kendaraan roda empat. Selanjutnya, memperbaiki neraca transaksi berjalan dan menjaga nilai tukar rupiah maka pemerintah akan mendorong ekspor dengan memberikan keringanan pajak pada industri padat karya yang mengekspor 30% produksinya, menurunkan impor minyak dan gas dengan menaikkan porsi penyerapan biodiesel dan mengurangi konsumsi solar dan pemerintah akan mengambil kebijakan untuk menstablisasi ekonomi dan reformasi struktur dalam jangak pendek. *Arianda Tanjung

BUKA PUASA Buka puasa bareng Consulate Taajussabab (Tanjungbalai, Asahan, Batubara) di Pesantren Darul Arafah Raya di Kisaran.

DANAU LAUT TAWAR Foto bersama di pantai menye-menye danau Taut Tawar Takengon, usai silaturrahmi dengan sanak famili saat lebaran Idul Fitri 1434 H.

Foto Kiriman: Herawati Jl. Peutua Raja Dsn. Aman Pulo Kiton Kota Juang Bireuen

Waspada/Arianda Tanjung

TUKAR UANG : Naiknya mata uang dollar AS membuat masyarakat berbondong-bondong melakukan penukaran uang di sejumlah money changer.

Foto Kiriman: Luna Malina Jl. Bromo Medan LOMBA TUJUH BELASAN Anak-anak bersemangat ketika mengikuti perlombaan lari dalam rangka HUT RI Ke 68 yang diselenggarakan angkatan muda di Jalan Bromo Gg Santun, Sabtu (17/8).

Waspada/Surya Efendi

EMAS IKUT NAIK: Warga memilih aneka cincin dan gelang emas di Medan. Harga emas naik hingga Rp80 ribu seiring naiknya dollar.

Waspada/Arianda Tanjung

EMAS: Seiring naiknya mata uang dollar AS mengakibatkan harga emas ikut meroket. Foto Kiriman: Ahmad Sofyan 085206641921 SAMBUT SISWA BARU Keluarga besar SMA Unggulan CT Foundation terlihat akrab dalam acara Pelepasan Siswa Akhir dan penyambutan siswa baru dilanjutkan dengan buka bersama dengan Bapak dan Ibu Chairul Tanjung, Kemendikbud, dan Ust. Maulana .

Waspada/Arianda Tanjung

ELEKTRONIK JUGA NAIK: Melemahnya nilai tukar rupiah terhadap dollar secara tidak langsung berdampak pada kenaikan harga barang-barang elektronik.

BERFOTO USAI IED Sesaat setelah melaksanakan ibadah shalat Idul Fitri. Momen kebersamaan yang tercipta setahun sekali. Setelahnya, akan kembali ke ranah masing-masing demi mengejar impian.

Foto Kiriman: Karunia Sylviany Sambas Simpang Empat Asahan Waspada/Surya Efendi

MONEY CHANGER: Salah satu tempat penukaran mata uang (money changer) di KNIA ramai pasca naiknya nilai tukar dolar AS terhadap rupiah. Kemarin, 1 dollar mencapai Rp11 ribu.

Waspada/Surya Efendi

HITUNG DOLLAR: Karyawati di salah satu money changer di Medan sedang menghitung dollar.

Kirim Hasil Karya atau

Beserta Biodata Singkat, Keterangan Foto & Foto Diri



25 Agustus 2013


Indonesia Target 10 Besar ISG PALEMBANG (Waspada): Indonesia sebagai tuan rumah Islamic Solidarity Games 2013 menargetkan masuk 10 Besar, meskipun pada perhelatan sebelumnya di Mekkah, Arab Saudi, hanya menempati urutan ke-18. “Semula hanya menargetkan tembus 15 Besar. Namun setelah menjumpaiparaatletdanpengurusKOIdanKONIsecaralangsung beberapa waktu lalu, saya mere-

visi menjadi 10 Besar,” kata Roy seusai rapat koordinasi persiapan penyelenggaraan ISG III di Palembang, Sabtu (24/8). Menpora yang bersama

Menkokesra Agung Laksono, Ketua KOI Rita Subowo, Gubernur Sumsel Alex Noerdin, dan Wali Kota Palembang Romi Herton, mengemukakanIndonesiameski bertindak sebagai penyelenggara tidak memasang target mulukmuluk mengingat ajang ISG ini bersifat internasional yang diikuti 32negaradanenamnegaramasih dinantikan konfirmasinya. Sejumlah atlet kelas dunia akan berlaga pada ajang olahraga

negara-negaraanggotaOrganisasi Kerja Sama Islam ini. “Indonesia harusrealistis,meskiatletyangakan diturunkanmerupakanatletyang akanbertandingpadaSEAGames Myanmar2013,tapisecarakualitas masih belum mampu bersaing secara internasional,” ujarnya. Sehingga, lanjutnya perhelatan ISG ini hanya sebatas ajang pemanasan menjelang pelaksanaan SEA Games.“Tapi, tidak ada yang tidak mungkin, asal mau berkerja keras,” tambahnya. Wakil Sekretaris Umum Pengurus Federasi Olahraga Karatedo Indonesia Provinsi Sumatera Selatan, Aliuddin, memastikan cabang olahraga karate Islamic SolidarityGamesIIIdiPalembang, 22 September-1 Oktober 2013 bakaldiramaikanatlet-atletberperingkat terbaik dunia, menyusul prestasi sejumlah negara peserta yang masuk dalam ranking tiga besar World Karate Federation.

“Karate bakal menyuguhkan tontonan menarik, karena yang ikut serta adalah juara-juara dunia karena negara-negara Islam kawasan Timur Tengah sudah menjadi kekuatan baru di samping negara Eropa,” katanya. Ia merincikan, para juara dunia rankingWorld Karate Federation(WKF)itu,diantaranyauntuk kelompok putra, peringkat satu nomorkumite-75kgRafaelAghayev (Azarbaijan), peringkat dua kumite-84kgYavuzKaramollaoglu (Turki), dan peringkat tiga kumite -84 kg Enes Erkan (Turki). Kemudian, untuk kelompok putri, peringkat dua kumite -50 kgSerapOzcelik(Turki),peringkat dua kumite-68 kg Hafsa Seyda Burucu (Turki). Sebanyak 1.759 orang atlet dan 624 ofisial akan ambil bagian padaISGedisike-3ituyangmempertandingkan 13 cabang olahraga. (m42/ant)

Banda Aceh Kirim 4 Petinju Kasau Cup 2013 Di Jakarta Waspada/Zafrullah

PARA juara Aceh International Surfing Championship 2013 pose bersama hadiah yang mereka terima, masing-masing Dede Suryana, Raditya Rondi, Sandi Selamet, dan Made Garut Widiarta (dua kanan sampai dua kiri).

Peselancar Jabar Buktikan Kelas Aceh International Surfing Championship SIMEULUE(Waspada):Peselancar Jawa Barat, Dede Suryana, membuktikan kelasnya dengan menjuarai ajang surfing bertajuk “AcehInternationalSurfingChampionship2013”yangberakhirJumat (23/8) petang, di Simeulue. Dalam perlombaan yang diikuti peserta dari enam negara tersebut, pada babak final Dede berhasil meraih 7,27 poin dari kemungkinan 10 di 5 menit tersisa untukmenambahpoinsebelumnya 6,0, sehingga berhasil menyalip juara selancar Indonesia dan Asia 2012 asal Bali, Raditya Rondi. “Saya benar-benar merasa bahagia bisa mendapat kemenanganini.Apalagidalamduatahun terakhir saya belum memenangkan kejuaraan mana pun,” tutur Dede ketika kembali ke pantai di depan ratusan penduduk setempat yang menyaksikan hari terakhir kompetisi. AdapunfinalisGarutWidiarta yang telah berselancar dengan sangat baik sampai akhir, tampak

ke luar dari ritme, sehingga gagal menyelesaikan manuver udara dan hanya mampu menempatkan dirinya di posisi keempat di bawah peselancar Jawa Barat lainnya, Sandi Selamet. Raditya Rondi yang tampil sebagai runner-up mengaku sangatkecewadenganpenampilannyadifinal.Begitupun,Rondimasih tetapmempertahankanposisinya di peringkat pertama dalam pengumpulan poin di ASC 2013. Setelah acara Aceh International Surfing Championship 2013 ini, peringkat I ASC 2013 masihditempatiRadityaRondi(Bali), diikutiMadeGarutWidiarta(Bali), Tipi Jabrik (Jabar), Dede Suryana (Jabar), dan Putra Hermawan di peringkat II hingga V. Kejuaraan Aceh International Surfing Championsip 2013 yang berlangsung di Simeulue ini diikuti 24 peselancar yang berasal dari enam negara, masingmasingIndonesia(Bali,JawaBarat, NTB,BandaAceh,danSimeulue),

serta dari Australia, Amerika Serikat, Australia, Thailand, dan Afrika Selatan. Event tersebut diselenggarakan Aceh Extreme Sport Championship (AESC) dan disponsori Kementerian Pariwisata dan Ekonomi Kreatif Kemenparenkraf, Pemerintah Aceh, dan Pemkab Simeulue. Dengan keberhasilannya menjadi juara di event ini, Dede Suryana yang meraih 13,2 poin berhak atas hadiah $1.500, sementara Raditya Rondi dengan 13,10 poin mendapat $900, Sandi Selamet (11,67 poin) $700 dan Made GarutWidiarta (8,23) poin. menerima $400. KetuaPanitia,Denny,mengatakankejuaraaninidigelardengan tujuan untuk mempromosikan potensiwisatabaharidiSimeulue, karenaselamainiwisatawanasing lebih banyak berkunjung ke Bali. “PadahaldiPulauSimeuluesurganya wisata bahari, jauh lebih indah dibandingkanlokasilainyangada di Indonesia,” katanya. (b04)

BANDA ACEH (Waspada): Pengurus Cabang Persatuan Tinju Amatir Indonesia (Pengcab Pertina) Banda Aceh mengirim empat petinju ke Kejuaraan Tinju Kasau Cup 2013 yang akan berlangsung di GOR Mabesau Cilangkap, Jakarta, 27-29 Agustus. Keempat petinju Banda Aceh dimaksud adalah Jufriadi (kelas terbang), Tuah Perkasa Alam (kelas ringan), Insanul Sabri (kelas welter ringan), dan Mario “Rio” Razura (kelas menengah). “Mereka adalah petinju-petinju muda milik Pertina Banda Aceh saat ini,” ungkap Kabid Binpres Pengcab Pertina Banda Aceh, A Rahman Boga, kepada Waspada di sela-sela latihan terakhir petinju Banda Aceh, Sabtu (24/8). Mantan petinju nasional era 1970-an ini menyebutkan, pihaknya tidak memberikan target yang muluk-muluk kepada keempat petinju tersebut. “Kita mengirimkan mereka sekadar untuk menambah pengalaman dan jam terbang saja, sekaligus sebagai ajang try out sebelum mengikuti Pra Pora yang akan digelar November mendatang,” kata pria akrab disapa Boga ini. Begitu pun, sebut Boga, melihat dari latihan yang dilakukan selama ini, tidak tertutup kemungkinan mereka bisa mempersembahkan prestasi terbaik di kejuaraan ini. Selama mengikuti kejuaraan ini, Pengcab Pertina Banda Aceh mempercayakan Ediwansyah sebagai pelatih dan Irwan Turbo sebagai manajer tim. “Kita harap mereka bisa memotivasi anakanak agar memberikan kebanggan bagi daerah,” ujarnya. (b04)

PBVSI Bireuen Seleksi Pemain Persiapan Jelang Pra Pora BIREUEN (Waspada): Pengurus Cabang Persatuan BolaVoli Seluruh Indonesia (Pengcab PBVSI) Bireuen menggelar seleksi pemain sebagai persiapan menghadapi Pra Pekan Olahraga Aceh (Pra Pora) di Pidie pada akhir Oktober mendatang. “Atlet putra dan putri yang mengikuti seleksi kali ini merupakan hasilpantauankitadalamsejumlahturnamenantarklubdiBireuen,” ujar Ketua Pengcab PBVSI Bireuen, Darwansyah, melalui Koordinator Wasit, Maimun Adam, kepada Waspada, Sabtu (24/8). Didampingi Koordinator Tim, Adnan Adam, Maimun menjelaskan para pemain yang mengikuti seleksi merupakan atlet muda. Dari kegiatan seleksi ini, nantinya akan dijaring masing-masing 12 pemain untuk tim putra dan putri. Maimun menjelaskan, kegiatan seleksi untuk tim putra dipusatkan di Lapangan Jl Bakti, Kota Juang. Sedangkan tim putri di Lapangan MAN 1 Bireuen. “Untuk seleksi tim putra dipandu Buyong Sutimin bersama Saputra, sedangkan putri ditangani Yunita SPd dan Zoel Purba. Insya Allah, akhir September nanti kedua tim akan terbentuk,” jelasnya. (cb02)

Waspada/Setia Budi Siregar

KETUA KONI Medan Denai, Widodo didampingi Manajer Tim Sepakbola Medan Denai Sapril Aritonang SPd, duet pelatih Hamdardi dan Sudarmaji serta pemain yang mengikuti seleksi diabadikan bersama di Lapangan Jermal XV Medan, Sabtu (24/8).

Medan Denai Seleksi Pemain Sepakbola Hadapi Porkot Medan V/2013 MEDAN (Waspada): Kecamatan Medan Denai menggelar seleksi pemain sepakbola untuk menghadapiPekanOlahragaKota (Porkot) Medan keV tahun 2013. Demikian disampaikan Ketua KONI Medan Denai,Widodo didampingiManajerTimSepakbola Medan Denai Sapril Aritonang SPd, di Lapangan Jermal XV Medan, Sabtu (24/8). Widodomenyebutkan,seleksi cabang sepakbola yang digelar 20- 27 Agustus, merupakan salah satu dari 23 cabang olahraga yang diikuti Kecamatan Medan Denai pada Porkot tahun ini. Sebagai cabangolahragapopuler,Widodo berharap sepakbola dapat memperoleh hasil lebih baik dari tahun sebelumnya. Terlaksananya seleksi sepak-

bola ini tidak terlepas dari dukungan Camat Medan Denai, Drs Edi Matondang dan seluruh masyarakat yang berdomisili di kecamatanitu.Selainsepakbola,lanjut Widodo, cabang olahraga lainnya jugasedangmelakukanpersiapan seperti catur, tenis meja, bulutangkis, dan cabang beladiri. Manajer Tim Sepakbola Medan Denai, Sapril Aritonang SPd, menjelaskansejumlah76pemain kelahiran tahun 1994 mengikuti seleksi. Mereka berasal dari sekolahsepakbolayangberadadiKota Medan seperti SSB Generasi Medan, SSB Sempizam, SSB Bintang Raya, SSB Gumarang, SSB Harapan Bangsa, SSB Global, SSB Medan City dan SSB Kenari Utama. Para pemain yang mengikuti seleksi seluruhnya berdomisili di

Problem Catur

Putih melangkah, mematikan lawannya lima langkah.

Jawaban di halaman A2.

Kecamatan Medan Denai. Dari 76 pemain itu akan dijaring 20 pemain yang akan dibawa ke Porkot. Seleksi dilaksanakan di dualapangan,JermalXVdanLapanganPasarII.“Pada27Agustusdiharapkansudahterjaring20pemain,” tambah Sapril Aritonang. (m18)

Waspada/Abdul Mukthi Hasan

PARA peserta seleksi tim PBVSI Bireuen foto bersama tim pemandu bakat setelah mengikuti tahapan seleksi di Lapangan MAN 1 Bireuen, Sabtu (24/8).

50 Peserta Touring Lintas Danau Toba MEDAN (Waspada): Dinas Kebudayaan dan Pariwisata (Disbudpar) Sumut berharap event Touring Sepeda Motor Lintas Danau Toba 2013 yang setiap tahun digelar, bisa ditingkatkan levelnya menjadi berskala nasional. “Dengan menjadi event nasional, maka pesan-pesan dalam upaya mempromosikan daerahdaerah tujuan wisata di Sumut bisa lebih berhasil,” ujar Sekretaris Disbudpar Sumut, Drs Avon Syafrullah Nasution, dalam kata sambutannya saat melepas peserta touring di Sirkuti Multi Fungsi IMI Sumut, Jl Pancing/Willem Iskandar Medan, Sabtu (24/8) pagi. Touring Sepeda Motor Lintas DanauToba itu berlangsung Sabtu dan Minggu (24-15/8) dengan

ruteharipertamaMedan-Tebingtinggi-P. Siantar-Prapat, dan melintasi Prapat-SimarjarunjungKabanjahe-Medan di hari kedua. Sebelumnya saat menyampaikan sambutan Kadisbudpar Sumut, Drs H Naruddin DalumuntheMSP,Avonmenyebutkan touring sepeda motor yang digelar merupakan upaya membangun dan memajukan dunia pariwisata di Sumut dan karenanya hal tersebut membutuhkan kesungguhan dan semangat dalam bentuk aksi kolektif. “Dengan tumbuh kembangnya sektor pariwisata, diharapkan akan mampu memberikan kontribusi terhadap Pendapatan Asli Daerah. Kegiatan touring sepeda motor lintas Danau Toba ini

membuktikan bahwa Pemprovsu, melalui Disbudpar senantiasa berupaya optimal bersama seluruh lapisan masyarakat membangun pariwisata di Sumut,” ungkap Kadisbudpar Sumut. Ketua Panpel, Constantin Pasaribu, mengatakan kegiatan diikuti 50 peserta dengan menempuh jarak 350 km melintasi lima kabupaten/kota di Sumut. Event initerbukabagiumum,khususnya pengendarasepedamotordigelar atas kerja sama klub CCI dengan Disbudpar Sumut. “Di Prapat, tempat para peserta bermalam adalah di Danau Toba Cottage. Para peserta akan diajakbermaindengangamegame yangtelahdipersiapkansertalucky draw,”ungkapConstantin.(m47)

Waspada/Armansyah Th

SEKRETARIS Disbudpar Sumut, Drs Avon Syafrullah Nasution, melepas peserta touring sepeda motor Lintas Danau Toba 2013 di Medan, Sabtu (24/8).


Cal Crutclow berada di depan Alvaro Bautista saat sesi kualifikasi MotoGP Ceko, Sabtu (24/ 8) malam.

Pole Brno Milik Crutchlow BRNO, Rep Ceko (Waspada): Rider tim Tech 3Yamaha, Cal Crutchlow akan memulai MotoGP Republik Ceko dari posisi terdepan setelah mencatat waktu tercepat dalam kualifikasi yang digelar di sirkut Brno, Sabtu (24/8) malam. Crutchlow mengungguli dua pebalap Honda, masing-masing Alvaro Bautista dan Marc Marquez untuk menjadi yang tercepat. Hasil sesi kualifikasi tersebut sekaligus meneruskan laju positif Crutchlow yang juga mengemas waktu terbaik dalam sesi latihan bebas ketiga di awal hari ini. Pebalap Inggris ini membukukan waktu 1 menit 55,527 detik dan merupakan pole kedua bagi dia di arena MotoGP, setelah meraih pole di MotoGP Belanda Juni lalu. Crutchlow berhasil mengatasi torehan waktu dari Bautista (Honda Gresini) dengan 0,227 detik dan Marquez (Repsol Honda) dengan 0,336 detik. Dani Pedrosa, rekan setim Marquez, mengakhiri sesi kualifikasi ini di posisi empat atau satu posisi lebih baik dari Jorge Lorenzo (Yama-

ha). Bradley Smith yang membalap untuk Yamaha Tech 3 ada di posisi berikutnya, diikuti oleh Valentino Rossi yang merupakan rekan satu tim Lorenzo. Stefan Bradl dari Honda LCR berada di posisi delapan dengan diikuti dua pebalap Ducati, Andrea Dovizioso dan Nicky Hayden serta Andrea Iannone (Pramac Racing) dan Colin Edwards (Forward Racing) secara beruntun ada di posisi 11 dan 12. 10 Besar kualifikasi: 1.Cal Crutchlow (Inggris/Yamaha Tech 3) 1:55.527 2. Alvaro Bautista (Spanyol/Honda Gresini) 1:55.754 3. Marc Marquez (Spanyol/Repsol Honda) 1:55.863 4. Dani Pedrosa (Spanyo Repsol Honda) 1:55.868 5. Jorge Lorenzo (Spanyol/Yamaha Factory) 1:55.949 6. Bradley Smith (Inggris/Yamaha Tech 3) 1:56.014 7. Valentino Rossi (Italia/Yamaha Factory) 1:56.186 8. Stefan Bradl (Jerman/ LCR Honda) 1:56.477 9. Andrea Dovizioso (Italia/Ducati Team) 1:56.825 10. Nicky Hayden (AS/Ducati Team) 1:56.979 (ap/m47)

Hamilton Ungguli Duet Red Bull SPA FRANCHORCHAM, Rep Ceko (Waspada): Pebalap Inggris Lewis Hamilton (foto), meraih pole position keempat beruntun di musim ini, setelah tampil sebagai yang tercepat di kualifikasi GP Belgia dengan mengungguli duetRedBull,masing-masing Sebastian Vettel dan Mark Webber. Dalam sesi di Sirkuit Spa Franchorchamp, Sabtu (24/ 8) malam, Hamilton membesut Mercedesnya secara dramatis untuk mematahkan catatan waktu Vettel dan Webber di detik-detik akhir kualifikasiyangakhirnyaharus puas start dari posisi kedua dan ketiga. Dalam kualifikasi ini, Hamilton membukukan 2 menit 01,012 detik, atau unggul tipis dari raihan waktuVettel dengan catatan waktu 2 menit 01,200 detik, dan Webber dengan 2 menit 01,325 detik. DenganraihanpoleinimakaHamiltonmerajai sesi kualifikasi dalam empat seri terakhir. Sebelumnya, pebalap Inggris itu juga meraih pole di GP Inggris, Jerman dan terakhir Hongaria di mana dia tampil sebagai pemenang lomba. Rekan satu tim Hamilton di Mercedes, Nico Rosberg berada di tempat ke empat, diikuti pebalap tim Force India Paul di Resta yang melengkapi posisi 5 Besar. Sementara jagoan Ferrari Fernando Alonso hanya mampu mengisi posisi ke sembilan, tepat di belakang andalan tim Lotus Kimi Raikkonen.

10 Besar Kualifikasi GP Belgia 1. Lewis Hamilton (Inggris/Mercedes) 2:01.012 2. Sebastian Vettel (Jerman/Red Bull) 2:01.200 3. Mark Webber (Australia/Red Bull) 2:01.325 4. Nico Rosberg (Jerman/Mercedes) 2:02.251 5. Paul di Resta (Inggris/ Force India) 2:02.332 6. Jenson Button (Inggris/McLaren) 2:03.075 7. Romain Grosjean (Prancis/ Lotus) 2:03.081 8. Kimi Raikkonen (Finlandia/Lotus) 2:03.390 9. Fernando Alonso (Spanyol/Ferrari) : 03.482 10. Felipe Massa (Brazil/ Ferrari) 2:04.059


TIM SELEKSI CALON ANGGOTA KPU KABUPATEN BATUBARA Jl. Perintis Kemerdekaan No. 179 A, Lima Puluh Kota,Telp. (0622) 697852 HP:081263635111 Fax. (0622) 98851

PENGUNGUMAN HASIL PENELITIAN CALON ANGGOTA KPU KABUPATEN BATUBARA Nomor : 08/TS-KPU.BB/VIII/2013 Berdasarkan hasil penelitian administrasi Calong Anggota KPU Provinsi/ Kabupaten/Kota, dengan ini diumumkan nama – nama yang memenuhi persyaratan untuk seleksi tertulis, sebagai berikut: NO NOMOR URUT PENDAF TARAN 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27

01 02 03 04 05 06 07 08 09 10 11 12 13 14 16 17 18 19 20 21 22 23 24 25 27 36 37






Wiraswasta Wiraswasta Dosen Konsultan Wiraswasta Mengurus Rumah Tangga PNS Wiraswasta Wiraswasta Wiraswasta Wiraswasta Wiraswasta Wiraswasta Pedagang Karyawan Swasta Wiraswasta Ketua KPU Batubara Karyawan Honor Wiraswasta Karyawan swasta Karyawan Swasta Wiraswasta Wiraswasta Karyawan swasta Karyawan swasta Karyawan Honorer Wiraswasta

Lubuk Besar Dusun 2 LK I Kel.Indrapura Airputih Lima Laras Tg. Tiram Jl Rahmad Syah Tanjungtiram Dusun I Simpang Dolok Dusun II Pulau Sejuk Kec. Limapuluh JL.Panglima Muda Medang deras Tg. Gading S11-14A Lingk.III Labuhan Ruku Batubara Kayu Ara Dusun II Talawi Tanjung tiram Dusun X Dusun XI Seimuka Talawi Ds.IV Desa Sipare-pare, Kec. Airputih Ds.III Desa Aras Kec.Airputih Dsn Sei Suka Deras JL.Rengar Dsn VI Bogak Tg . tiram Lk.VI Pasar VI Blok 8 No 1B Lima Puluh Dsn II Desa Mangkei Lama Kec. Limapuluh Ds.II Desa Petatal Kec.Talawi Batubara Dsn 2 Blok 8 Kel Limapuluh Kota Labuhan Ruku Talawi Tj Seri Sei Suka Ds.I Simpang Dolok Kec. Limapuluh Psr I Blok 8 Kec. Limapuluh Tanah itam ulu no 181 Kec.Limapuluh JL.Merdeka No.30 Tanjung Tiram RT 003/001 Limapuluh Kota


Seleksi tertulis a: Hari/Tanggal b: Waktu c: Tempat

akan dilaksanakan pada: : 27 Agustus 2013 : 08.00 s/d selesai : MAN Limapuluh Jl. Perintis Kemerdekaan No.76 Lima Puluh

Peserta seleksi tertulis agar hadir 30(tiga puluh) menit sebelum seleksi dimulai, dengan membawa alat berupa pensil 2B, penghapus dan ballpoint, serta menunjukkan kartu identitas diri (KTP) yang asli kepada petugas saat pelaksanaan registrasi. Limapuluh, 24 Agustus 2013












40 % keterwakilan perempuan dan memenuhi penempatannya

1 2 3 4 5




33,33 % keterwakilan perempuan dan memenuhi penempatannya




36,36 % keterwakilan perempuan dan memenuhi penempatannya







40 % keterwakilan perempuan dan memenuhi penempatannya




66,66 % keterwakilan perempuan dan memenuhi penempatannya




40 % keterwakilan perempuan dan memenuhi penempatannya

1 2 3 4 5














40 % keterwakilan perempuan dan memenuhi penempatannya




33,33 % keterwakilan perempuan dan memenuhi penempatannya




36,36 % keterwakilan perempuan dan memenuhi penempatannya








45,45 % keterwakilan perempuan dan memenuhi penempatannya

1 2 3 4 5







33,33 % keterwakilan perempuan dan memenuhi penempatannya




37,50 % keterwakilan perempuan dan memenuhi penempatannya




40 % keterwakilan perempuan dan memenuhi penempatannya

Jumlah Bakal Calon untuk seluruh Daerah Pemilihan sebanyak = 289 (dua ratus delapan puluh sembilan) orang









36,36 % keterwakilan perempuan dan memenuhi penempatannya

1 2 3 4 5







40 % keterwakilan perempuan dan memenuhi penempatannya




33,33 % keterwakilan perempuan dan memenuhi penempatannya

1 2 3 4 5 6 7 8 9 10 11




40 % keterwakilan perempuan dan memenuhi penempatannya






1 2 3 4 5






33,33 % keterwakilan perempuan dan memenuhi penempatannya DAERAH PEMILIHAN : KOTA TEBING TINGGI 3 1 2 3 4 5 6 7 8 9 10 11












37,50 % keterwakilan perempuan dan memenuhi penempatannya



40 % keterwakilan perempuan dan memenuhi penempatannya











40 % keterwakilan perempuan dan memenuhi penempatannya DAERAH PEMILIHAN : KOTA TEBING TINGGI 2 1 2 3 4 5 6 7 8 9




37,50 % keterwakilan perempuan dan memenuhi penempatannya



36,36 % keterwakilan perempuan dan memenuhi penempatannya


1 2 3 4 5 6 7 8 9 10 11



40 % keterwakilan perempuan dan memenuhi penempatannya

1 2 3 4 5 6 7 8 9





40 % keterwakilan perempuan dan memenuhi penempatannya





36,36 % keterwakilan perempuan dan memenuhi penempatannya

DAERAH PEMILIHAN : KOTA TEBING TINGGI 3 1 2 3 4 5 6 7 8 9 10 11


33,33 % keterwakilan perempuan dan memenuhi penempatannya






40 % keterwakilan perempuan dan memenuhi penempatannya





DAERAH PEMILIHAN : KOTA TEBING TINGGI 3 1 2 3 4 5 6 7 8 9 10 11

DAERAH PEMILIHAN : KOTA TEBING TINGGI 3 1 2 3 4 5 6 7 8 9 10 11


33,33 % keterwakilan perempuan dan memenuhi penempatannya






50 % keterwakilan perempuan dan memenuhi penempatannya





DAERAH PEMILIHAN : KOTA TEBING TINGGI 3 1 2 3 4 5 6 7 8 9 10 11

DAERAH PEMILIHAN : KOTA TEBING TINGGI 3 1 2 3 4 5 6 7 8 9 10 11


33,33 % keterwakilan perempuan dan memenuhi penempatannya






40 % keterwakilan perempuan dan memenuhi penempatannya


DAERAH PEMILIHAN : KOTA TEBING TINGGI 3 1 2 3 4 5 6 7 8 9 10 11


36,36 % keterwakilan perempuan dan memenuhi penempatannya






DAERAH PEMILIHAN : KOTA TEBING TINGGI 3 1 2 3 4 5 6 7 8 9 10 11



44,44 % keterwakilan perempuan dan memenuhi penempatannya




DAERAH PEMILIHAN : KOTA TEBING TINGGI 3 1 2 3 4 5 6 7 8 9 10 11


40 % keterwakilan perempuan dan memenuhi penempatannya








DAERAH PEMILIHAN : KOTA TEBING TINGGI 3 1 2 3 4 5 6 7 8 9 10 11




30 % keterwakilan perempuan dan memenuhi penempatannya

Ditetapkan di Tebing Tinggi Pada tanggal 22 Agustus 2013




WASPADA Minggu 25 Agustus 2013

6 Inspirasi Gaya Hijab Stylish GAYA berjilbab kini makin beragam. Mulai dari hijab klasik yang menjuntai ke depan hingga modifikasi pada turban. Untuk tampil istimewa, Anda bisa menyimak enam inspirasi gaya hijab stylish berikut ini.

BERMAIN DRAPERY Gaya hijab yang dibiarkan menjuntai ke depan bisa tampil lebih stylish dengan permainan drapery. Gunakan kerudung berbahan sifon agar efek drapery yang memberi kesan feminin dan romantis lebih terlihat.

SENTUHAN MOTIF Kerudung bermotif adalah salah satu trik untuk tampil seru dan berbeda tanpa harus banyak ‘berusaha’. Pilih kerudung dengan warna-warna cerah. Gunakan teknik drapery di bagian depan kerudung untuk mempertahankan gaya feminin Anda. Pilih ciput yang warnanya senada dengan salah satu warna di motif kerudung.


Bagi Anda yang lebih menyukai gaya hijab simple, agar tidak membosankan bisa divariasikan dengan teknik pilin di bagian samping. Gunakan ciput dan kerudung berwarna senada, tapi dalam tone yang berbeda misalnya ungu muda untuk kerudung dan ungu tua untuk ciput.

DETAIL BELAKANG Hijab dengan fokus detail di bagian belakang dan samping menciptakan gaya formal yang cocok dikenakan untuk silaturahmi saat Lebaran di acara resmi seperti open house tokoh masyarakat, aula atau gedung. Lipat kerudung jadi segitiga, sampirkan menyilang ke sisi kiri dan kanan agar terbentuk detail menyerupai sanggul di bagian belakang.

B1 AKSEN LAYER Cukup dengan selembar pashmina lebar, Anda bisa menciptakan gaya hijab yang stylish. Aplikasikan teknik layer atau tumpuk dan fokuskan di bagian leher. Lalu kenakan aksesori kepala untuk mempercantik penampilan.

MODIFIKASI TURBAN Tampil edgy di hari istimewa dengan gaya hijab modifikasi turban. Anda harus menyiapkan dua bahan yang terdiri dari kerudung sifon dan pashmina panjang. Jangan lupa ciput dan bandana untuk menambah aksen agar lebih menarik. Detail menjuntai di bagian samping membuat tampilan turban lebih modern dan tidak biasa. m31/Wlp

Produk Luar Harga Lokal Bagi wanita dewasa yang gemar berbelanja produk-produk luar negeri seperti pakaian , sepatu, dan sandal dengan harga terjangkau, kamu bisa mencoba untuk berkunjung ke New Veru

Lebih Gaya Dengan Lejing Impor Bermotif BERGAYA dengan lejing impor bermotif menjadi pilihan bagi penikmat fashion yang suka mengkoleksi celana panjang ketat. Motif dengan beragam pilihan corak loreng maupun bludru macan serta tribell, membuat tampilan penggunanya menjadi berbeda. Pilihan busana dengan warna terang dengan bahan siffon semakin menambah gaya pemakainya. Koleksi tas yang polos dengan gaya jinjing atau dompet berukuran sedang menambah menarik penggunanya. Celana yang lazim dikenakan cewek langsing ini, menjadi sebagian koleksi Qie-Qie Boutique di Jln Amaliun No 44 Medan. Pengelolanya Riscki Elita Rosihana SPd menyebutkan, koleksi lejing impor di boutiquenya ini laris manis dibeli konsumen. “Masih trend, meski sudah beberapa bulan merajai pasar tren mode. Warna dan motif serta bahannya yang nyaman dipakai, menjadi alasan mengapa kaum cewek suka dengan lejing ini,” ujarnya yang mengaku usahanya ini bisa diorder juga secara on line. * Naskah dan foto : Anum Saskia

Butik yang beralamat di Grand Palladium Mall GS 18, Medan. Pakaian yang tersedia di butik ini beraganm mulai dari blues, dress, dan sifon dengan kisaran harga mulai dari Rp100 ribu hingga 200 ribu. “Barang yang tersedia di sini semuanya diimpor dari Bangkok,” kata salah seorang pegawai Lima kepada Waspada, Kamis (22/8). Sementara untuk produk tas dan sandal juga terbilang cukup murah, terbukti harga dipatok mulai dari Rp200 ribu untuk sepatu dan Rp 150 ribu untuk sandal. “Meskipun harga yang diberikan cukup murah tapi kualitas yang dimiliki dipastikan bagus,” tambah Lima. *Teks dan Foto : Arianda Tanjung


B2 Siti Robiatun

Perempuan Berfisik Lemah Tetapi Kuat Dalam Berkarya FISIKNYA memang sangat lemah, karena kakinya yang mengecil akibat penyakit folio yang menyerangnya saat masih kecil. Tetapi orang tuanya, memberikan keyakinan dan semangat pada dirinya, agar tegar dan mandiri. “Saya ingat kata-kata ibu dan bapak saya, bahwa dua kaki berfungsi menyangga tubuh dan membuat tampilan fisik kita sempurna beraktifitas. Selain itu mempermudah kita bekerja untuk memenuhi kebutuhan hidup. Tapi dengan satu kaki, kita harus bisa menyangga tubuh dan lebih penting bisa menopang hidup yang harus dilengkapi dengan keperluan materi dengan bekerja. Sempurna atau tidak anggota tubuh, kita harus bekerja untuk mendapatkan uang yang halal guna memenuhi keperluan hidup,” kata Siti Robiatun yang berfisik lemah tetapi punya kemauan kuat untuk berkarya. Ditemui Kamis lalu di kediamannya Jln Amal Luhur Gg Arjuna Medan, Siti Robiatun sedang merapikan beberapa jahitan yang belum dia selesaikan menjelang Lebaran lalu. Musibah menimpa keluarganya saat bulan puasa, ayahnya meninggal dunia, sehingga banyak pesanan yang tidak sempat dia siapkan dan berjanji pada pelanggan akan menyelesaikannya di bulan Syawal. Begini keseharian saya di rumah, kata Siti Robiatun sembari terus menjahit dan mencocokkan pasangan kancing yang sedang dia jelujur dengan benang. Setumpuk jahitan yang belum selesai tersusun rapi di sebelah keranjang mesin jahit 3 unit di ruang khusus menjahit yang dia siapkan. “Biar hanya tukang jahit, tapi saya punya ruang kerja sendiri. Anak saya suka mengganggu, maklum sedang lasak-lasaknya, takut pula dia kena jarum saat saya bekerja,” tuturnya. Apa yang membuatnya terobsesi menjadi penjahit ? Dia mengakui jika memiliki fisik yang tidak sempurna ini mengharuskan dia berpikir pekerjaan apa yang cocok untuk dirinya. Ibunya yang kini hanya pedagang pecal keliling, dulu adalah penjahit otodidak di keluarga

WASPADA Minggu 25 Agustus 2013

mereka. Sering melihat ibunya menjahit meski hanya dengan jahit tangan, tetapi mampu menyelesaikan beragam baju pilihan untuk anak-anaknya, terutama seragam sekolah dan baju hari raya, membuatnya tertarik menjadi seorang penjahit juga. “Kalau ibu saya pandai menjahit dengan cara otodidak. Tapi saya sekolah di SMK jurusan Tatabusana di Langsa. Saat di SMP, sudah ikut kursus menjahit. Alhamdulillah, akhirnya saya bisa menjahit dan mulai merintis usaha setelah kembali ke Medan,” ujar ibu dari Muhmmad Wira Anargiya Rafii yang memulai usaha jahitannya dengan meminjam mesin jahit milik kakaknya. Membuka usaha sejak tahun 2000 silam dengan tarif jahitan antara 150 sampai 250 ribu rupiah perstelnya, membuat dia mampu memenuhi kebutuhan hidup. “Saya bisa membantu suami memenuhi keperluan rumah tangga. Order jahitan lumayan banyak dan rezeki terbilang lumayan dari hasil menjahit,”kata isteri Hendry ini. Saat ini, sambung Siti Robiatun, meski order jahitan masih ada setiap harinya. Namun, dia memprediksi kedepan ini para penjahit busana akan mengalami penurunan omset, hal ini akibat banyaknya busana siap pakai yang impor dari berbagai negara dengan harga relatif murah. “Kalau ada yang datang, pastilah mereka sekadar memperbaiki baju yang kebesaran atau kekecilan. Tapi untuk tempahan, mungkin semakin sedikit jumlahnya. Meningkatkan kuwalitas dan model jahitan, mungkin masih bisa menjadi solusi agar para penjahit seperti saya ini tidak ditinggalkan,”kata perempuan yang aktif di organisasi Persatuan Penyandang Cacat Indonesia dan Himpunan Wanita Disabilitas Indonesia. Untuk memudahkan aktifitasnya, terutama saat aktif dalam berorganisasi, suaminya Hendry menyiapkan kenderaan roda tiga untuknya. Sepeda motor yang dimodifikasi secara khusus, sehingga mempermudah dia untuk bepergian. “Saya berpikir enggak benar juga kalau setiap ada kegiatan harus diantar suami. Diakan sibuk kerja, makanya dengan sepeda motor roda tiga ini, saya bisa bepergian tanpa merepotkan,” tuturnya. Pernah jadi atlit Kesungguhan Siti Robiatun untuk berkarya dalam menjalani aktifitas hidup meski tak sempurna 100 persen, dia tunjukkan dengan kemampuannya bidang olah raga. Dia pernah tercatat sebagai atlit lempar

cakram dan lempar lembing serta tenis meja. Namun dengan berat hati dia meninggalkan dunia olah raga ini karena merasa panitia di organisasi olah raga untuk orang cacat tidak affair memperlakukan para atlit. “Ya, sudahlah. Saya tak ingin mengenang kejayaan yang pernah berlomba sampai ke Solo. Karir sebagai atlit itu hanya kenangan,” ucapnya. Naskah dan foto : Anum Saskia

Rubrik Konsultasi Perkawinan & Hukum Kewarisan

Sri Hartini MSi

Tingkatkan Pemahaman Sejarah Pada Anak Lewat Pameran SALAH satu cara yang bisa dilakukan untuk lebih meningkatkan pemahaman sejarah pada anak dapat dilakukan dengan mengjak mereka mengunjungi museum. Selain itu, pihak sekolah juga mempunyai andil yang kuat dalam rangka memberikan pendidikan pada anaknya pentingnya mengunjungi museum. Demikian antara lain disampaikan Kepala Museum Negeri Medan, Sri Hartini MSi, Selasa lalu saat berlangsungnya pameran dan lomba menyemarakkan HUT Kemerdekaan RI ke 68. Acara pembukaan kegiatan pameran dihadiri Kadis Pariwisata dan Kerajinan Kreatif Nurudin Dalimunthe, Ketua DHD 45 Sumut H. Bachta Nizar Lubis,SH, perwakilan konsul di Medan serta undangan lainnya. Museum Negeri Medan rutin menyelenggarakan pameran serangkaian peringatan HUT Kemerdekaan RI. Kegiatan sekaligus peluncuran komunitas pecinta dan reka ulang sejarah Sumut “Tahun ini penyelenggaraan pameran bekerjasama dengan DHD 45 dengan tujuan memfasilitasi ruang waktu dan tempat bagi berlangsungnya kegiatan kesejarahan dalam rangka peningkatan kesadaran sejarah masyarakat guna membangun karakter bangsa serta memperkuat jati diri bangsa,” kata Sri yang menyebutkan pameran disertai kegiatan lomba baca puisi perjuangan tingkat SMP, lansia, melukis wajah pahlawan dan mewarnai.

akan menjadi bangsa yang “buta” yakni bangsa yang tidak mengerti asal usul dan tujuannya serta menjadi bangsa yang tidak mandiri karena akan selalu dikendalikan oleh bangsa lain.Dalam konteks ini pidato presiden Soekarno jangan sekalikali melupakan sejarah menjadi penting dan bermakna sepanjang zaman,” ujarnya. Dia memberikan apresiasi atas penyelenggaraa pameran tersebut. Karena melalui pameran itu dapat menjadi inspirasi dan semangat dalam berkarya dan membangun bangsa. Ketua DHD 45 Bachta Nizar merasa bangga Museum Negeri rutin menyelenggarakan pameran sejarah . Dia berharap dengan pameran itu masyarakat mengingat kembali kesadaran sejarah bahwa persatuan dan kesatuan Negara RI harus dipertahankan dan dilestarikan sehingga ungkapan belajarlah dari sejarah tidak merupakan slogan semata. Anum Saskia

Istri Sering Bilang Cerai Tanya: Apa hukumnya seorang istri setiap saat berkata kita cerai, dan juga seringkali mengatakan lebih baik kita cerai, apakah setelah istri bilang cerai beberapa hari kemudian melakukan hubungan suami istri apakah itu disebut berzina? Statusnya apa bisa disebut cerai sesuai hukum Islam? Dari 081269742xxx Jawab: Memang wanita seringkali terbawa oleh emosi atau

perasaan sehingga mudah sekali menyebut kata-kata cerai. Untunglah hak Talaq diberikan Allah SWT kepada laki-laki, sehingga meski seorang wanita berulangkali menyatakan cerai, namun cerai tidak terjadi. Jadi jika Anda melakukan hubungan intim suami-istri, hal itu bukanlah berzina. Menurut Kompilasi Hukum Islam (KHI) yang berlaku di lingkungan peradilan agama Pasal 115 bahwa Perceraian hanya dapat dilakukan di depan sidang Pengadilan Agama setelah Pengadilan Agama tersebut berusaha dan tidak berhasil mendamaikan kedua belah pihak. Salam.

Suami Curigai Istri Tanya: Buk saya mau tanya, saya sudah berkeluarga dan saya bekerja malam terus. Masalahnya saya merasa curiga dengan istri saya, begini buk setiap kali saya lihat HP istri saya, ada penghitungan pesan masuk tapi SMS sudah dihapus, bagaimana solusinya. Terima kasih. Wassalam. Dari 085296411xxx

nah jika dia memang bohong maka nasehatilah, jika Anda tidak mampu menasehatinya pergunakanlah jasa pihak ketiga untuk menasehatinya, jangan buru-buru ambil langkah perceraian. Berdasar pengalaman saya sebagai mediator, memang banyak pasangan suami istri yang kurang memahami kewajibannya baik sebagai suami ataupun sebagai seorang istri dari sisi ajaran agama ataupun hukum perkawinan. Oleh karena itu perlu nasehat perkawinan, terlebih saat ini permasalahan rumah tangga semakin kompleks, dan banyak pasutri (pasangan suami istri) yang terlibat perselingkuhan sehingga semakin banyak rumah tangga berantakan dan akhirnya bercerai. JadisegeraselesaikanmasalahrumahtanggaAndasebelummasalah semakin akut. Salam.

Suami Sedang Galau

Waspada / Ist

Anak Aktif, Anak Cerdas

Waspada/ Ilustrasi

Z Pengasuh: Hj. Beby Nazlia Hasibuan, SH, MH. (Mediator) foto beby Z Penanggungjawab: Dra. Hj. Erma Sujianti Tarigan, SH, MH. (Mediator) Z Pertanyaan tentang waris sms ke 081370031597 Z Pertanyaan tentang Perkawinan ke Email Litbang Waspada 08126030294.

Jawab: JikaSaudaramerasacurigapadaistrilangsungsajapertanyakan tentang isi SMS yang ada di HP-nya, sebagai suami Saudara berhak sepenuhnya atas diri istri. Jika istri Anda menutupnutupi sesuatu maka Anda akan mengetahui kebohongannya,

Sarana Belajar Gubernur Sumatera Utara Gatot Pudjonugroho menegaskan sejarah akan selalu memberikan pelajaran berharga bagi mereka yang mau belajar dan memahaminya. Pengalaman sejarah dapat menjadi pedoman untuk menapaki masa yang akan datang. “Melalui sejarah kita dapat menemukan jati diri bangsa untuk kemudian memahaminya agar dapat mengaktualisasikan diri untuk membangun bangsa ini,” kata Gubsu diwakili Kadis Pariwisata Nurdin Dalimunthe. Disebutkannya,bangsa yang melupakan sejarah

Banyak gerak, ternyata membuat anak cerdas. Semakin sering anak dilatih bergerak, fungsi otaknya akan terus berkembang. “Kecerdasan gerak itu disebut kecerdasan kinestetik. Orang tua boleh bersyukur kalau anaknya rajin bergerak,” kata Anne Gracia, konsultan Neuroscience terapan dari Smart Brain Energy di acara penutupan Corporate Day Care Unilever 2013 di Graha Unilever Jakarta, Jumat (23/8). Sebagai narasumber lain adalah Kepala Badan Kependudukan dan Keluarga Berencana Nasional (BKKBN), Prof Fasli Jalal serta ibu muda dan juga pemain film, Dian Sastrowardoyo.

Masalah perkawinan semakin rumit sehingga angka perceraian meningkat namun hal itu merupakan perbuatan halal yang sangat dibenci Allah Swt. Rubrik ini berupaya membantu mencari solusi agar perceraian dapat dihindari. Demikian pula masalah Waris, sangat penting dipahami penyelesaiannya secara Faraidh untuk menghindari sengketa melalui pengadilan yang seringkali berkepanjangan.(Red)

Kecerdasan kinestetik yang ditimbulkan akibat gerak lincah anak-anak disebut juga neurokinestetik. Hal itu merupakan faktor penting yang dapat merangsang selsel otak anak untuk berkembang lebih baik. “Jadi kalau ada anak yang diam saja, jangan kita bangga dan memujinya sebagai anak yang baik. Atau kalau anak kita bergerak ke sana ke mari malah dibilang nakal, jangan ya. Anak cerdas memang senang bergerak. Dan itu perlu terus dirangsang,” kata Anne Ada 8 kecerdasan majemuk yang dapat berkembang melalui stimulasi neurokinestetik yaitu cerdas bahasa, cerdas matematika, cerdas spasial, cerdas fisik, cerdas musik, cerdas interpersonal, cerdas intrapersonal dan cerdas alam. Yang terpenting, sebut Anna, kecerdasan kinestetik mampu membuat saraf matang dalam mengubah gerak refleks menjadi gerak terkendali dan terkoordinasi. Antara proses berpikir dan tubuh terjadi sinergi yang stimultan, dimana pada akhirnya membuat gerak itu bertujuan bahkan indah. Aktris layar lebar, Dian Sastro mengaku senang jika anaknya rajin bergerak. Dian bahkan merangsang gerak anaknya dengan respon positif lewat nyanyian dan permainan mendidik. “Saya paling senang kalau memandikan anak. Di situ saya dapat menyentuhnya dengan penuh perhatian. Dia pun bergerak aktif sebagai tanda merespon kehangatan lewat sentuhan saya,” kata Dian. Dian mengaku tidak banyak menggunakan jasa

Tanya: Aswb.Yth ibu pengasuh, ucapan istri membuat suami resah. Masalahnya bini saya penegawai negeri, saya juga PNS, kalau sudah marah/bertengkar selalu berucap; “Tunggu kalau aku sudah pensiun kita mencari jalan hidup masing-masing.” Katakata ini bagi saya tak enak di hati dan kubertahan (biologisku), sudah bertepuk sebelah tangan, rasa mau jajan biologis takut dosa, mau poligami takut nambah masalah, apakah saya harus tanpa menunggu pensiun membuat keputusan pisah lebih cepat, sedangkan masa pensiun 9 (Sembilan) tahun lagi. Mohon solusi biar ndak galau hati. Terima kasih bu. Dari 081375778xxx Jawab: Waalaikumsalam Wrwb. Perbaikilah rumah tangga Anda,

nasehati istri yang berlaku demikian sebab sebenarnya suami mempunyai kewajiban mendidik istri. Sebagaimana Pasal 80 ayat (3) Kompilasi Hukum Islam (KHI) bahwa suami wajib member pendidikan agama kepada istrinya dan memberi kesempatan belajar pengetahuan yang berguna dan bermanfaat bagi agama, nusa dan bangsa. Namun jika Anda tidak sanggup menasehatinya maka pergunakanlah jasa pihak ketiga untuk memberi nasehat. Seorang istri yang tidak mau melayani suaminya di tempat tidur, jelas salah, dan membuka peluang bagi suami untuk mencari wanita idaman lain. Tidak perlu Anda menunggu masa pensiun, dari saat ini juga perbaiki rumah tangga yang sedang menghadapi masalah, agar Anda dan istri tidak terjerumus melakukan dosa atau maksiat. Jika sudah tidak dapat diperbaiki maka barulah ambil ancangancang, yang penting tidak terjerumus ke perzinahanan. Salam


Apakah Cucu Dari Anak Perempuan Dapat Warisan? Tanya: Asw.Wr.Wb Ibu MediatorYth, Saya mau nanya, Kakek saya mempunyai anak 3 orang. 2 laki-laki dan 1 perempuan. Sebelum kakekmeninggalanakperempuanmeninggalterlebihdahuludan meninggalkan2oranganakperempuan.Pertanyaansaya,jikakakek meninggal dunia apakah cucu perempuan dari anak perempuan yang lebih dahulu meninggal dapat warisan ? Terima kasih. Dari 081263578xxx

Jawab : Waalaikum salam Wr Wb. Berdasarkan ketentuan dari Pasal 185 Kompilasi Hukum Islam yang menjelaskan bahwa apabila ahli waris meninggal lebih dahulu daripada Pewaris, maka kedudukannya dapat digantikan oleh anaknya. Sehingga cucu dari anak perempuan kakek anda tersebut dapat menggantikan posisi Ibunya dalam menerima warisan. Salam.

pengasuh dalam mengurus anaknya. Ketika bekerja pun, menitipkan buah hatinya kepada pengasuh dengan satu pesan, biarkan anak saya aktif. “Sebab saya sadar, anak aktif bergerak menandakan dia sehat dan cerdas,” kata Dian. Memahami hal itu, Corporate Day Care Unilever 2013 sebagai wahana penitipan anak-anak pegawai Unilever mengedepankan fungsi pengasuhan yang berfokus pada kecerdasan kinestetik. Anak dan bayi dititipkan selagi ibu atau bapaknya bekerja, sambil dilatih kecerdasan kinestetiknya. Johny Sulistio, Senior Medical Advisor PT Unilever Indonesia yang juga ketua pelaksana program Day Care Unilever menjelaskan, penting bagi sebuah day care untuk menjadikan suasana layaknya di rumah. Bahkan, orang tua dapat belajar bersama anak-

anaknya di Day Care Unilever. “Day care atau penitipan anak ini merupakan kebutuhan tahunan para pekerja, termasuk pekerja di Unilever yang ditinggal pembantu atau pengasuh anak pasca mudik lebaran,” kata Johny. Pemerintah sendiri, kata Kepala BKKBN Fasli Jalal, telah mencanangkan gerakan 1000 Corporate Day Care. Semua dimaksudkan sebagai upaya memberikan layanan bekerja bagi karyawan sekaligus menyosialisasikan pentingnya pendidikan anak sejak usia dini. “Dengan kampanye ini diharapkan semakin banyak lagi perusahaan-perusahaan di Indonesia yang meniru inisiatif Unilever dalam menyediakan Corporate Daycare yang sarat akan informasi dan edukasi yang tepat bagi orang tua dan anak,” tandas Fasli. (dianw).


WASPADA Minggu 25 Agustus 2013


Pengemis Kecil Cerpen: Rahmat Al Muhrid MULANYA hanyalah seorang pengemis kecil yang kudorong dengan kasar sehingga jatuh terduduk ke gundukan batu-batu. Muncul dari sekelompok pengemis yang menunggu para pendaki di tepi jalan setapak menuju Gua Hira, gadis kecil itu mencegatku di deretan paling depan dan langsung menggelayuti sajadahku dengan cengkraman yang begitu kuat. “Ana miskin…ana miskin…,” rengeknya dengan tatapan mata iba sambil menadahkan tangan kanannya ke dadaku. Ketika itu aku benar-benar kehabisan uang kecil, karena terlalu banyaknya pengemis di sepanjang jalan setapak itu – konon mereka datang dari daerah-daerah miskindi AsiaTengah. Kalaupun masih ada uang receh didompetku,palingkecil10Dinar dan ini pecahan yang tidak lazim dibagikan kepada pengemis. Tetapi, ternyata tidak gampang untukmenolakpengemis-pengemisyangrata-ratamasihdibawah umuritu.Merekaakanmenggelayuti tangan, ujung baju, sarung, sajadah, atau apa saja, untuk memaksa pendaki memberi mereka uang receh. Begitulah dengan gadis kecil yang menggelayuti ujung sajadahku, sehingga aku sulit untuk meneruskan perjalanan. Berkalikali aku mencoba menolaknya dengan halus, dengan bahasa Inggris campur Arab, “No money… no more… no more…. La… la… Ana laisa fulus… laisa fulus…Halas…halas!” kataku sambil menggerakkan tangan dengan isyarat menolak, dengan harapan ia mengerti maksudku dan segera melepaskan ujung sajadahku. Tapi, gadis kecil itu masih menggelayut begitu kuat di ujung sajadahku, sampai terjadi tarikmenarik sajadah antara aku dengan si kecil yang punya “daya

juang” tinggi itu. Maka, dengan agak marah, kutarik sekeraskerasnya sajadahku, lepas dari cengkramannya. Dan, ketika gadis kecil itu tetap memburuku untuk meraih ujung baju kokoku, kuhempaskan dia dengan kasar, sehinggaterhuyung-huyungjatuh terduduk ke atas gundukan batubatu. “Ana miskin… ana miskin…,” rengeknya dengan tatapan mata cokelat yang makin mengiba ke arahku. Dan, tatapan itulah yang terus memburuku, terus menusuknusuk ulu hatiku, sampai aku kembali ke hotel. Saat makan malam, tiap menjelang shalat, dan terutama menjelang tidur, mata cokelat perempuan kecil itu seperti hadir kembali dengan seluruh dirinya. Wajahnya yang oval dengan hidung mancung, alisnya yang tebal dengan mata cokelat bulat lebar –wajah khas Afghanistan– dengan rambut panjang hitam kemerahan dikepangdua,seakanhadirseluruhnya dengan begitu nyata. Dan, suaranyasepertiterngiang-ngiang kembali di telingaku, “Ana miskin… ana miskin….” *** Perempuan kecil itu sebenarnya sangat cantik. Setidaknya, di atas rata-rata anak perempuan Indonesia.Usianyamungkinbaru sekitar 10 tahun. Posturnya yang

Karya: Latifah Harahap

tinggi-padat dengan kulit kuning bersih sebenarnya kurang pas dengan pekerjaannya sebagai pengemis. Apalagi di bukit terpencil yang terik di siang hari dan menggigilkan di malam hari. Hanya rok hijau lusuhnya yang kumal dan robek-robek, dan rambutnya yang tidak terurus, yang memberi kesan dia sebagai gembel. Sejujurnya, ketika itu kami juga sedang merindukan anak perempuan, untuk melengkapi dua anak laki-laki kami. Dan, doa inilah yang berulang-ulang kuucapkan di multazam –tempat berdoa yang paling mustajab– sehabis wukuf. “Kamu merindukan anak perempuan….Kamu terus berdoa memohon anak perempuan. Tetapi, kenapa kau tolakkehadirananakperempuan, bahkan kau sakiti hatinya?” Sebuah suara tiba-tiba menyambar batinku. Ya, perempuan kecil itu me-

Karya: F Pratama

Gemercik Tangisan Alam Wanita Tua Bening awan meradang langit Desuh cahaya menyepuh surya Serat-serat angin mendesir Kepala dan dahiku Gemercik ini memecah senyap Sudahkan aku bersyukur? Indah akan di dapat Meski kemilau tak dihunus mata

Tuntunlah Aku Gelap kelam hampa dan resah Sudah berurat dalam kepingan lekositku Menjelma dalam amarah Dan keangkuhanku Tuntunlah aku Menjadi seorang yang mulia Menapaki tumpangan bumi Aku Yang tak layak ini Hendak berseru Karya: Julaiha S

Angin Kira-kira Semenit Dan aku berjalan menjelajahi jejak langkah kaki menuliskan sebuah surat dari angin-angi yang kira-kira semenit bertuip sekencang badai yang teratur Dan aku berjalan bergandengan dengan para semut menjejali suara-suara laut yang kira-kira semenit tercicipi.

Ketika Harus Kembali Ketika harus kembali ada saja hal yang perlu difikirkan kejujuran dan hal-hal puitis lainnya apa yang harus kuperbuat ketika hal baru itu datang di dalam kehidupan yang semakin zaman tak mendewasakanku Ketika harus berakhir maka yang terjadi, malam kebanjiran air lewat tangis-tangis akibat pecahnya hati dengan keadaan yang dulu tak disangka Aku tak mengerti dengan ini dengannya dengan mereka yang bercerita tentang jalanan lengang yang dilaluinya kemudian aku mulai memahami hari dengan diam

Karya: Abd. Rahman M

Agustus Yang Basah Sebening embun menyentuh tubuhmu setenang hamparan samudera agustus yang basah menyaru membasah kotamu kampungku meredup seiring lilin padam agustus beraroma basah perlahan pergi lewat mimpi-mimpi palsu

Jalan Pulang Saat lampu telah padam langkai gontai meletih di penghujung waktu kuingin pulang merindukan wajah rumah di ujung senyum ibu selalu senang aku pulang

Merajai Waktu Seiring meredupnya lilin dihempas angin perlahan pasti aku pulang kepangkuanmu buka hatimu melepas penatku di hari nanti iringi kisah kita bertemankan pedih merajai waktu

(seperti biasa) ia tampakkan wajah sepuluh hari yang akan menyudah ramadhan, wanita tua menjaja kartu ucapan lebaran

mangcukupmewakilisosokanak perempuan yang kurindukan, cantik, sehat, dan cerdas. Namun, tentu bukan pengemis. Jelas aku takkanikhlasanakkujadipemintaminta.Anakkuharusmandiridan banyak memberi. Bukan banyak meminta. Tapi, mengapa wajah perempuan kecil itu terus memburuku dan tatapan mata ibanya terus menusuk-nusukkan belati ke ulu hatiku? *** Keesokan harinya aku benarbenar kembali mendaki Jabal Noor (Bukit Cahaya) untuk menemukan gadis kecil bermata belati itu. Kuingat betul wajah kekanakannya, mata bulat cokelatnya, alis tebalnya, hidung mancungnya, bibir merekahnya, dan rambutnya yang hitam kemerahan dan dikepang dua. Juga kuingat baju hijau lusuhnya yang robek lengan dan ujung kanannya, kaki telanjangnya yang ramping, dari kelompok pengemis

mana ia muncul dan di mana ia kuhempaskan. Tetapi anehnya, sesampai di lerengyangkuyakinisebagaitempat perempuan kecil bermata belati itu kuhempaskan, tak ada satu pun pengemis yang mencegatku. Beberapa pengemis kecil, kebanyakan perempuan, tetap asyik bermain di dekat bebatuan atau duduk-duduk santai di atas gundukan batu. Kusapukan pandanganku berkali-kali ke seluruh penjuru lereng itu, tapi tidak kutemukan juga perempuan kecil bermata belati itu. Akhirnya, anak-anak gembel itulah yang kupanggil untuk mendekat sambil berharap perempuan kecil yang kucari itu segera muncul dari balik bebatuan atau dari dalam gubuk kayu beratap kainkain lusuh tidak jauh dari jalan setapak itu. Beberapa kelompok pengemis kecil sudah mendekat dan segera pergi lagi setelah semua

mendapatuangrecehdariku,tapi tidakkutemukanjugaperempuan kecil bermata belati yang kucari itu. “Ah, mungkin anak itu sudah pindah ke lereng yang agak ke atas,” pikirku. Aku sudah hendak melangkahkan kaki untuk mendaki lagi, namun ujung sajadahku tiba-tiba terasa berat. Aku menengok ke belakang, dan kulihat seorang perempuan kecil menggelayut di ujung sajadah tipis yang kuikatkan di pinggangku. “Ini dia!” teriakku dalam hati. Aku yakin, dialah perempuan kecil bermata belati yang kucari itu. Kurogoh saku baju kokoku, dan kuberi dia beberapa Dinar. “Syukron… syukron!” katanya sambil menghitung-hitung uang itu dan meloncat-loncat kecil menjauhiku. Melihat kegembiraan itu, dadaku terasa plong, seperti baru sajamelunasihutangpadakawan sekantor yang begitu mengganjal perasaan karena ia sering mena-


di trotoar beratap trembesi ia gelar kain selembar di atasnya rapi ia jajar yang ia simpan di kardus mi (seperti biasa) gelagat pejalan kaki entah kapan hendak berhenti sengaja ia pajang lebar senyuman semoga, berpindah selembar barang dagangan

Sembuhkan Hati Biakan aku pergi Bersama luka hati Yang sinarnya kini t’lah mati Relakan kisah ini Cukup berakhir sampai di sini Semoga ini memberi arti Sebab aku pergi untuk sembuhkan hati

KetikaAku Mulai Menjauh Ketika aku mulai menjauh Adasederetraguyangmenahanlangkahku Dan wajahku kembali dipertemukan Pada sisi yang sudah lama ingin kusudahi Aku ingin pergi Melepas kisah ini Membiarkan diriku sendiri Tapi kembali aku terjatuh dalam perih Karya: Tommy Sianturi

Sarapan Aku tak pernah muak, sayang Melahap sarapan kerinduan Yang kau hidangkan Ketika mentari mencubitku Karya: Harry Akbar

Perpisahan Disaat dunia telah memisahkan kita Aku tak mampu menahan rindu Air mata ini seakan mengerti kepedihan hati ini Kini kau sudah berada jauh di pelupuk mata Bahkan suaramupun sudah tak lagi mungkin terdengar Aku hanya mampu berdoa kepadaTuhan Semoga dapat mempertemukan kita di keabadian.

Telah redup sekian lama Jalan tertutup tuk berbagi cerita Lama terkelungkup Di atas pebaringan kusut Sekian janji telah terbagi Hingga sibuk menggali satu persatu Separuh hari telah melayang Membumbung tinggi lenyap oleh siang Hingga mulut acap berdusta Karena waktu tersiksa Tinggal setengah rokok lagi

Siapa kau Menjaring bayang Di punggung kesunyian Menari bahang Lupakan tubuh tak berbadan Anjing berkuduk remang Kau biarkan Liurnya menjadi tambang Selasakan erang Di parumu Petitih lekuk tubuh Pairaan kuda nafsu Menginjak-injak harkatmu Busukkan namamu

Karya: Syamsul Olenka G

Parade Taman Hati (1) Karya: Winda Prihartini

Cermin Kusut Cermin-cermin memecahkan diri Bayang gelap hilang ragam Kepala-kepala berbenturan Masing-masing melumpuhkan badan di tanah Segalanya mati Daun-daun memisahkan tubuhnya Di lorong semut-semut memadat Semakin kusut Terbelah Bebayangan dibawa burung terbang tega Dan menanggalkan bangkai yang sedang bercinta di kuncup malam wewangian kita ikut memudar pun lara

Luka Berjuta Pertanyaan di waktu menggelantungkan jiwa Seperti apa rasanya siksa yang membuat suara menggema Angan memijaki kesadaran Dalam darah mengalir kepedihan Luka-luka tumbuh jadi berjuta Bola mata berguling menahan siksa “alahai aku rasa langit hilang” Dalam kegigilan panjang di surau tinggal rangka tak elok rasa Melantunkan lafaz suci hanya igau-igau kecil lalu menjelma debu mengikuti udara Sampai bulan jatuh, tubuh masih berada pada sembilu Tanpa pinang dan rayu seperti musim lalu Karya: Eva Rosanti Halawa

Intimidasi Kusebut kau si jahat menghantuiku dengan intimidasi berharap kepercayaan diriku berhamburan sehingga kau bebas mengolok-olokku damaiku adalah kerisauan bagimu dengan usaha kau coba jatuhkanku ke sumur yang tak berdasar akh, yakinku usahamu akan sia-sia

Karya: Wyaz Ibnu Sinentang

Kunang-kunang Dalam Gelas : Gadis malam Sajian warna kata-kata kau pilih merebak Lampu kerlap-kerlip pada ruang tiga kali empat Suasana malam minggu masyuk menggugur Aroma parfum bersetubuh dalam hangar-bingar Hentakan dangdut menyulut emosi Malam boleh saja bertahta bangga Rembulan gemintang bersanding setia Tapi detak jantungmu memburu etika tak bermoral Hiasan dunia memang selalu menggairahkan Sebatas fana meraba-raba kebenaran Anggur merah kau sulang dalam gelas saling berebut angan-angan tak bermakna Nilai kehidupan pun porak poranda Celoteh busuk sudah tak terukur waktu Malammu roboh bersimbah memeluk luka Karya: Anhar

Nyanyian Sunyi Seberapa lama lagi aku harus menunggu Ditempatyangmengundangkenangandirimu Senyum di wajahmu masih tertinggal di sini Menyisakan kenangan yang sering menghampiri Kini aku merindu, dalam penjara sunyi Aku sendiri.

Hanya Mimpi Aku mengerti tentang wajahmu Meninggalkan sejuta ke indahan di bawah awan biru Senyum melengkung sempurna Di wajah cantik yang kau punya Tapi ini hanya mimpi siang Yang harus ku hapus di perasaan riang Karena aku tak mungkin memilikimu Dengan wajah dan parasku.

Terimakasih atas atensi para penulis yang telah mengirimkan karya cerpen dan puisi ke Redaksi Harian Waspada. Pengiriman karya puisi dan cerpen melalui email:

Karya: M Asqalani Erneste

Siapa Kau?

Kutuliskan bait kalam Bukan untuk mereka bergumam Hanya untuk seseorang Sesuatu rasa hanya terpendam Hingga Dia meraba apa masih terbungkam Sepanjang wajahnya masih terlihat buram Tak pernah habis aku meluap asa Aku masih bersembunyi dalam bayang senja

Pengadzan tua menabur panggilan pepohon menegak dedaun meriap bebunga menguak setelah hingar bingar perihal bulan mengkal

Karya: Mega Yudia Tobing

Karya: Irsa Mustafa

hempaskan itu. Mereka melangkah serentak ke arahku, seperti mumi-mumi hidup, dengan pakaian compang-camping, sambil menadahkan tangan dan koor, “Ana miskin… ana miskin….” Dengan begitu cepat pengemis-pengemis kecil itu mengepungku, sehingga aku tak dapat menghindardarimereka.Dengan agresif tangan-tangan kecil mereka pun menadah di sekelilingku, bertempelan di dadaku, di lengan kanan-kiriku,dipunggungku.Dan, dengan tatapan-tatapan iba yang menghunjamkan puluhan pisau belati ke ulu hatiku, mereka memaksaku untuk menguras seluruhisisakubajuku,sakucelanaku, dan dompetku. Dengan tangan gemetar dan perasaan tak menentu, kubagikan semua sisa recehan satu Dinar, lima Dinar, dan bahkan sepuluh Dinarku. Satu demi satu mereka pun pergi meninggalkanku, kembali ke balik bongkahan-bongkahan batu, ke dalam gukuk-gubuk beratap kain lusuh dan ke celahcelah pebukitan tandus Jabal Noor. Dengan tubuh lemas dan perasaan tak menentu, akhirnya aku turun, dan langsung menuju Masjidil Haram. Usai shalat Ashar aku meninggalkan masjid untuk kembali ke hotel. Tapi, di pintu keluar aku masih dicegat seorang perempuan kecil bermata belati itu. Dan, ini yang paling persis di antara gadis-gadis kecil bermata belati yang kutemukan di Jabal Noor tadi. Rambutnya masih dikepang dua, dan roknya juga masih hijau lusuh dengan robekan kecil pada lengan kiri dan ujung bawah kanannya. Maka, tanpa pikir panjang kurogoh dompetku dan kucari sisa uang receh yang ada. Tapi, tak ada lagi uang receh di sana. Yang kutemukan tinggal selembar 50 Dinar. Dan, tidak tahu apa yang terjadi dengan diriku, uang itu kuberikan begitu saja padanya. Sampai di kamar hotel aku baru sadar, yang kuberikan pada perempuan kecil bermata belati itu ternyata satu-satunya sisa uang sakuku. ***

Janji Asap Rokok

Bait Kalam

Pengadzan Tua

Pengadzan tua menabur panggilan gaung menyahut gema gema menyahut gaung usai sudah bulan setelah hingar bingar seruan-seruan akbar

gihnya. Maka, dengan perasaan lega akupun meneruskan perjalanan ke puncak, sebab masih terlalu siang untuk kembali ke hotel. Setidaknya, aku bisa shalat Ashar di puncak Jabal Noor atau di Gua Hira –tempat Nabi Muhammad SAW dulu menerima wahyu pertama. Tetapi, baru sekitar 50 meter melangkah, aku melihat gadis kecil yang sangat mirip dengan perempuan kecil bermata belati yang kucari. Penampilannya masih seperti kemarin. Rambutnya masih dikepang dua, dan ketika kudekati, tatapan ibanya yang mengandung belati masih tajam menusuk ulu hatiku.“Ah, janganjangan ini yang benar,” pikirku. Dan yang bersamanya, aku ingat, adalah pengemis-pengemis kecil yang kemarin juga. Hanya warna bajunya, lagi-lagi, yang berbeda. Kemarin hijau lusuh, kini kuning kecoklatan. Maka, kurogoh lagi saku bajuku lalu kuberi dia lima Dinar. Dengan wajah terbengong gadis kecil itu menerimanya. Namun, ketika aku hendak melangkahlagi,tiba-tibaadayang terasamenggelayutitangankiriku, dan ternyata seorang perempuan kecil yang wajahnya sangat mirip dengan gadis kecil bermata belati yang baru saja berlalu. Rambutnya pun hitam kemerahan dan dikepang dua. Bajunya juga hijau lusuh seperti baju gadis kecil yang kucari itu. “Ana miskin… Ana miskin…,” rengeknya sambil menadahkan tangan kanannya, persis seperti rengek perempuan kecilyangkemarinkuhempaskan ke atas gundukan batu. Ini yang benar, pikirku. Inilah perempuan kecil yang kucari. Maka, segera kurogoh lagi saku celana jinku, dan kuberikan beberapa Dinar kepadanya. Tetapi, bersamaan dengan itu, seperti serentak muncul pengemis-pengemiskecildaribalikbongkahan batu, dari celah bukit, dari dalam gubuk-gubuk beratap kain lusuh, lima, sepuluh, lima belas, tiga puluh …. dan banyak di antara mereka yang wajahnya sangat mirip dengan perempuan kecil bermata belati yang kemarin ku-

Kini, Nona cantik telah pergi Tak ada puisi, tak ada syair Dan tak ada lagi sajak roman Tak apalah Jika sekumpulan opini Menganggap ini aneh Tapi aku merasa lebih baik Tanpa perasaan membebaniku, Nona Benar kata orang-orang Keinginan adalah sumber penderitaan Kini tanpamu aku merasa lebih baik Aku tak lagi dirundung kegalauan Aku nyamn, aku aman

Parade Taman Hati (2) Aku menyematkan senyum kecil Untuk membingkai perasaanku Yang tenang aman dan nyaman ini Kupejamkan mata beberapa saat Menyelami alam hati yang penuh Dihiasi bunga-bunga yang bersemi Merekah dengan eloknya Hamparan Horison nampak begitu kokoh Menopang langit-langit jiwa Bertabur ribuan bintang Bercahaya dengan sinar pijar Tak terlalu terang menambah keharmonisan Parade taman cahaya dalam hati Damai tanpa Nona manis Aku menemukan dunia indah lainnya Selain dirimu Terpikir olehku Ini cukup untuk melupakan sejenak Riwayat Nona manis yang menyebalkan Karya: Putri Desifa Parahima

Buat Malam di Larut Buat malam di larut Dinginnya sepi Untuk kepompong asa menggelantung Nyerinya sorot mata di sudut pelupuk Atau hampanya kosong melompong Sampai kapan? Aku menanggung perih Dari luka tanpa goresan Buat apa? Aku telan fitnah ini bulat-bulat? Sebab apa, aku tercantum Dalam lirik di dinding teater itu Buat malam di larut Mereka cuman anggap aku salah Lantas tak perduli pada absurdnya fitnah Mereka anggap aku belenggu Lantas menjauh, dan tak tahu Sampai kapan, larut malam

Karya: Pilo Poly

Membawa Ingatan Kadang kita tak butuh hujan Untuk membelai tanah kemarau Kita juga tak butuh angin supaya Mengerti seperti apa itu gigil Kita hanya butuh melangkah Mencari arah sebenarnya kelahiran Lalu setelah kita mendapati itu Nyawa kita telah berpulang Dan tak ada yang kita ikut sertakan Karya: Revy Ansyah

Kemarau Diam (1) Kemarau diam di jiwaku Serangkai Bayang-bayang rindu tumbang Bersiadzan Pengan pilu Pahamilah bagaimana mataku rabun Jumpalitan, begitu cemburu Aku susuri ketiakmu Tapi rupanya jalanan makin malam Meski aku telah tinggalkan dirimu Sepanjang keriuhan kelu Mayatku terpencil Ingus para pejalan bergayutan Di jenggotku

Kemarau Diam (2) Seluruh kesumat dan derita memacu Pengetahuanku Arwahku memanggil namamu Sementara panorama lebur Selangkah demi selangkah Memudar, menjejali batu Di dasar pijaran kabut Aku adalah jenazah Bagi setiap hasrat dan kesintalanmu Kegembiraanku Mengintip tato kupu-kupu di pusarmu Malam makin dingin, mendzikirkan diam Penampakan-penampakanku gaib Samun, mencair Hitam bersama salju Karya: Fajar Azwar

Melodi Dalam Hati Dentuman melodi yang meledak Dalam jiwa… Berpencar meredam hantu di hati Yang melekat di dasar hati Dentuman melodi yang meledak Berpencar mencari-cari Dimana letak hantu di cakrawala raga Yang menempel di dinding hati Dentuman melodi dalam hati Berceramah di dalam hati Menghantui dalam hati Berteriak seraya mengancam Mengancam hantu di dasar raga Untuk pergi tak kan kembali Dentuman melodi dalam hati Membawa harmoni menuju mentari



WASPADA Minggu 25 Agustus 2013

Aneka Lomba Di TK Harapan I Medan DALAM memperingati Hari Ulang Tahun Kemerdekaan RI ke 68 TK Harapan I Jl. Imam Bonjol Medan mengadakan berbagai lomba di lingkungan taman kanak-kanak tersebut pada Rabu (21/8). Lomba yang diadakan yaitu lomba lari memindahkan bendera untuk kelompok A. Dan lomba mewarnai untuk kelompok B. Dalam acara tersebut dimulai dengan perlombaan mewarnai dengan demonstrasi mewarnai oleh Pak Surya guru menggambar dari SD Harapan 2 Medan, dan diikuti anak didik TK Harapan I dari kelompok B. Penyerahan hadiah diberikan kepala sekolah TK Harapan I ibu Mimi denga menyatakan bagi pemenang akan dapat meningkatkan cara belajar menggambarnya dan bagi yang belum menang atau kalah jangan berkecil hati. Karena hari esok akan ada lagi kegiatan yang sama sehingga dapat bersaing dengan para juarajuara sebelumnya. (H)

Pemenang lomba mewarnai diabadikan bersama para guru TK Harapan I dan juri.

CERIT A ADIK Adik-adik, berikut Redaksi memuat cerita-cerita berkaitan tentang malaikat. Malaikat adalah makhluk Allah yang taat dan setia kepada Nya. Semoga bisa menambah wawasan dan menambah keimanan kita pada kekuasaan Allah SWT.

Kepala Sekolah TK Harapan I, Mimi memberikan kata sambutan kepada anak-anak pemenang lomba mewarnai dari Kelompok B.

Malaikat Memuji Kebaikan Nabi Ayyub AS

Kupon Seri

BERKATALAH salah seorang malaikat kepada kawan-kawannya yang berkumpul berbincang-bincang tentang tingkah laku makhluk Allah jenis manusia, di atas bumi : “Aku tidak melihat seorang manusia yang hidup di atas bumi Allah yang lebih baik dari hamba Allah Ayub.” Ia adalah seorang mukmin sejati, ahli ibadah yang tekun. Dari rezeki yang luas dan harta kekayaan yang diberikan Allah kepadanya, ia menyisihkan sebagian untuk menolong orangorang yang perlu pada fakir miskin. Hari-harinya terisi dengan penuh membuat ibadah, sujud kepada Allah dan bersyukur atas segala nikmat dan karunia yang diberikan kepadanya.” Para malaikat yang mendengarkan kata-kata pujian dan sanjungan untuk diri Nabi Ayub mengakui kebenaran itu bahkan masing-masing menambah lagi dengan menyebut beberapa sifat dan tabiat yang lain yang ada pada diri Nabi Ayub. Bersambung Darul Nu’man/ m31 Darul Nu’man/ m31

H Tempel DiAmplop


Sayembara Mewarnai Berhadiah Hadiah I : Rp75.000 + sertifikat Hadiah II : Rp50.000 + sertifikat Hadiah III : Rp25.000 + sertifikat

Syarat-syarat peserta 1. Peserta bebas menggunakan alat pewarna apa saja. 2. Peserta terbatas hingga kelas VI SD, menyantumkan nama, alamat yang jelas 3. Sudah sampai di meja redaksi selamat-lambatnya tanggal 30 Septi 2013

Untuk harapan I s/d III akan mendapatkan bingkisan dan sertifikat.

N a m a : .............................................................................. Sekolah : .............................................................................. Alamat : ..............................................................................

Lihat dulu seorang wisudawan ini dik dengan benar. Bila adik sudah tahu mana yang ganjil, tulislah di kotak yang telah disediakan.


Carilah pasangan kata-kata dalam bulatan ini. Caranya, lihat contoh yang sudah ada, selamat mencari ya.



Konsultasi Teknologi Informasi Diasuh oleh Codealgo

Dari : 0831991xxxxx Hai codealgo di Medan, aku mau nanya, flashdiskku kena virus terus aku format kenapa setelah aku format koq ada folder recycle terus folder tersebut gak bisa dihapus, jadi bagaimana cara menghapusnya, terima

Minggu 25 Agustus 2013

Bantuin Aku, Dong?! BUAT yang punya problem, khusus remaja atau pelajar tapi susah buat dipecahkan, seperti masalah sekolah, pacar, ortu yang suka ngomel atau teman yang nyebelin, jangan bingung dulu. Tim Remaja Waspada dan Mbak Fifi yang nama lengkapnya Fidia Rizki, S.Psi, psikolog lulusan Universitas Medan Area akan mencoba membantu kamu mencari jalan solusinya. Silahkan kirim pertanyaan melalui SMS ke

Dari : 0878611xxxxx Hai codealgo, bagaimana caranya mengembalikan explorer windows xp yang menghilang? Kemarin laptopku kena virus, sudah dibersihkan dengan MSE tapi tetap tidak bisa tampil kembali eksplorernya, mohon dibantu, terima kasih. Jawab : Hai juga, membersihkan virus berbeda dengan memperbaiki kerusakan yang telah ditimbulkannya, mungkin saja kamu sudah membersihkan virus dari laptop kamu, akan tetapi kerusakan ataupun perubahan yang dibuat virus tersebut mungkin tidak bisa direcover oleh antivirus kamu karena keterbatasan fitur. Dalam kasus kamu, antivirus MSE tidak mampu merecover fungsi OS kamu seperti sedia kala, akan tetapi apabila virus memang telah bersih, kamu bisa mencoba dua pilihan untuk merecover explorer kamu, cara yang pertama adalah Klik menu Start > Run, Ketik : “gpedit.msc” tanpa tanda kutip untuk membuka Group Policy Windows. Setelah itu masuk ke :UseConfiguration >Administra-tive Templates >Windows Component > Windows Explorer. Di Panel sebelah kanan, carilah “Remove the Folder Option menu item from the Tools Menu” kemu-dian double klik dan set value ke “Not Configured”. Apabila cara ini tidak berhasil, cara kedua adalah dengan menggunakan registry yaitu buka Registry Editor dengan mengetikan “Regedit” pada menu Run, Kemudian carilah key berikut HKEY_ CURRENT_USER\ Software\ Microsoft\Windows\ CurrentVersion\ Policies\Explorer dan pada panel sebelah kanan cari : NoFolderOptions dan set value menjadi 0. jika kamu tidak menemukan NoFolderOptions, tinggal buat sendiri dan masukkan valuenya dengan 0. Apabila kedua cara tersebut tidak bisa juga digunakan, maka sebaiknya repair OS kamu karena mungkin virus yang menyerang laptop kamu telah merusak sistem operasi kamu. semoga dapat membantu, selamat mencoba dan terima kasih.


No 082364766027,

Jawaban akan dibalas melalui Harian Waspada, jadi dimohon sabar menunggu.

Tanya: Kikie – Hp 6285571342xxx Assalamualaikum, Dear mbak Fifi… salam kenal. Aku baru pindah dan dilingkungan yang baru ini aku merasa harus bisa bersikap nyaman supaya orang juga merasa enak dekat denganku. Tapi lama-lama aku merasa capek dan terpaksa.. harus terus bersikap ramah dan tersenyum. Gimana tuu mbak Fifi? Makasih atas jawabannya

kasih codealgo. Jawab : Hai, folder recycle sebenarnya merupakan bagian dari sistem operasi windows, pada saat kamu menghapus suatu file ke recycle bin, sebenarnya file tersebut tidak langsung terhapus, akan tetapi tersimpan ke dalam folder recycle sebelum kamu mengosongkan recycle bin (empty recycle bin). Setiap kali kamu memformat suatu partisi (partisi harddisk atau flashdisk), secara otomatis windows akan membuat folder recycle. Pada partisi dengan format NTFS, folder yang akan dibuat adalah folder dengan nama “Recycler”, sedangkan pada format FAT, folder yang akan terbuat adalah folder dengan nama “Recycled”. Folder ini secara default tidak tampak (hidden) dan baru akan tampak apabila kamu sudah pernah mengkonfigurasi settingan view folder dan file kamu. Karena merupakan bagian dari sistem operasi windows, kamu tidak akan bisa menghapus folder tersebut . Akan tetapi, saat ini terdapat virus yang menduplikasi nama folder tersebut, kamu dapat mengetahui perbedaannya dengan mengecek ekstensi folder tersebut, biasanya terdapat ekstensi .exe pada akhiran nama folder, sehingga menjadi recycler.exe atau recycled.exe, virus ini dapat kamu hapus dengan menggunakan antivirus. Jadi, pastikan terlebih dahulu apakah folder yang terdapat merupakan virus atau memang merupakan folder bawaan windows. Semoga dapat membantu, terima kasih.

PEMBERITAHUAN : NB : Kirimkan pertanyaan kamu ke codealgo melalui nomor 081370311355 atau ke email Setiap pertanyaan yang masuk akan kami jawab menggunakan metode FIFO (First In First Out). Codealgo hanya akan menjawab pertanyaan konsultasi melalui rubrik konsultasi Waspada. Kunjungi website kami untuk mengetahui produk dan jasa yang kami tawarkan di yang akan segera dilaunching dalam waktu dekat.

Dari : 081265xxxxxSaya nanya, kenapa power CPU gak mau mati secara otomatis lagi. terima kasih.

Dari : 081265xxxxx Asslm. saya mau tanya, kenapa tinta printer PIXMA saya gak mau naik??

Jawab : Sebelumnya pertanyaannya seperti ini sudah pernah dijawab. Hal ini kemungkinan terjadi karena ada masalah di BIOS motherboard Anda. Coba Anda reset BIOS Motherboard Anda dengan cara mencabut baterai (seperti baterai jam tangan) selama beberapa saat, kemudian memasangnya kembali. Semoga berhasil.

Jawab : Wslm. Apakah lampu printer Bapak/Ibu terus menerus berkedip? Kalau kejadiannya seperti itu, masalahnya biasanya disebut sebagai blinking. Blinking biasanya terjadi karena halhal seperti tinta tidak cocok dengan printer (jadi coba berhati - hati jika membeli tinta refill), tempat pembuangan sisa tinta sudah penuh (coba kosongkan tempat pembuangan sisa tinta), bagian dalam printer kotor (coba buka covernya dan bersihkan, namun hatihati sekali jangan sampai merusak komponen di dalamnya), dan banyak hal lagi yang dapat menyebabkan printer blinking. Untuk mengatasinya coba lepas kabel POWER dan USB, kemudian buka pintu printer dan TEKAN+TAHAN tombol POWER, pasang lagi kabel POWER, kemudian tutup pintu printer dan lepas tombol POWER, kemudian nyalakan printer seperti biasa. Apabila printer masih blinking, coba lepas kabel POWER dan USB, kemudian TEKAN+TAHAN tombol POWER, pasang lagi kabel POWER, kemudian lepas tombol POWER, kemudian coba nyalakan printer seperti biasa. Apabila setelah melakukan langkah-langkah di atas namun belum berhasil, coba Bapak/Ibu gunakan program resetter untuk printer PIXMA. Untuk mendapatkannya coba search di Setelah didownload, coba Bapak/ Ibu baca instruksi penggunaan program resetter tersebut, biasanya instruksinya tersedia di tempat program resetter tadi dapat didownload. Mungkin sampai disini dulu penjelasan Kami, selamat mencoba dan semoga berhasil.

Dari : 0852703xxxxxHalo.. Saya mo nanya. terkadang muncul pesan error ketika membuka/menjalankan program. isinya : application error : the instruction at “0x73dd11c7” referenced memory at “0x00000004”.the memory could not be “read”. click on OK to terminate the program. maksudnya apa ya? n bagaimana cara mengatasinya?Thanks... Jawab : Halo juga. Apakah Anda sudah mencoba menginstal ulang aplikasi yang error tersebut? Kalau belum coba Anda instal ulang kembali aplikasi tersebut. Apabila masih terjadi hal yang sama, kemungkinan adanya kesalahan di registry sistem operasi Anda. Untuk mengatasinya coba Anda perbaiki registry dengan menggunakan aplikasi-aplikasi untuk memperbaiki registry. Ada banyak sekali pilihan program seperti ini baik yang gratis maupun yang berbayar. Untuk yang gratis Anda dapat menggunakan Free Registry Fix, ataupun juga WinXP_EXE_Fix. Untuk memperolehnya Anda dapat mencarinya di Internet dan mendownloadnya. Atau Anda juga dapat mencoba untuk merepair sistem operasi Anda. Selamat mencoba.

Jawab: Waalaikumsalam, Dear Kikie… Senang bisa punya teman di lingkungan yang berbedabeda. Kita jadi mengenal banyak watak dan karakter orang. Supaya tetap merasa enjoy dalam berteman.. resepnya kamu harus tetap nyaman dengan dirimu sendiri. Karena keramahan memang dibutuhkan dalam berteman… disaat kamu lagi engga pengen beramah-ramah dengan orang lain, batasi kontak dengan orang lain, karena kamu juga perlu menikmati waktu dengan dirimu sendiri.. atau bisa juga curhat dengan temanmu apa yang sedang kamu rasakan. Karena dengan berbagi curhat kamu bisa menjalin kedekatan dan kesenangan dengan orang lain. Tapi pilih teman yang kamu rasa cocok dan bisa diajak share… Disaat kamu merasa capek dan terpaksa… jangan-jangan karena kamu merasa pertemananmu terlalu dipaksakan. So Kikie.. relax dan enjoy, nikmati saja kapan kamu merasa pengen rame-reme atau justru lg pengen sendiri… salam Tanya: Rahmawati – Hp 6281353681xxx Assalamualaikum, .Mbak saya Rahmawati. .kenapa ya orang tua saya cerewet banget.makasi mbak. Jawab: waalaikumsalam, Dear Rahma.. Ada-ada aja adik ini.. Mbak jadi ingat waktu muda seusiamu dulu. Suka merasa ortu koq cerewet banget.. engga ngerti anak muda. Nah setelah menjadi orang tua.. mbak baru paham ternyata.. “nyanyian merdu” itu adalah teguran kasih sayang. Orang tua ngomel dan cerewet jangan diartikan negative dulu.. itu merupakan komunikasi antara ortu dan kamu, Cuma penyampaiannya yang sedikit berbeda. Ketika kamu merasa sering disalahkan , mengapa tidak menyampaikan dan mengungkapkan apa yang kamu rasakan. Tapi harus pakai trik.. jangan pake ngambek dan marah dan menyalahkan tindakan beliau. Ungkapkan keinginanmu ingin diberi kesempatan dan kepercayaan seandainya ada tingkahmu yang kurang berkenan di hati nya. Belajar untuk terbuka sangat penting loh.. toh papa mama juga manusia biasa, mereka bukan malaikat yang selalu paham dan tahu keinginan anaknya. Dengan demikian orangtuamu juga belajar memahami keinginanmu sebagai anak. Setiap orang tua pasti punya alasan kenapa dia marah, atau cerewet.. siapa tahu mungkin kamu sebagai anak lalai melakukan kewajibanmu.. nah anggap saja omelan dan cerewetnya sebagai teguran dan nasehat. Nah semoga setelah ini hubungan kalian makin dekat yaa, salam buar papa mamamu. Tanya: Ulie – Hp 62852768731xxx Assalamualaikum, salam kenal. Mbak saya Ulie.. saya pengen curhat… Saya remaja putri. Saya pengen banget kaya cewek yang langsing dan putih. Karena saya agak gemuk dan tidak putih. Saya suka sedih kalau ingat itu. Gimana supaya saya bisa happy dengan diriku sendiri. Makasih atas jawabannya. Tanya: Ratih- Hp 6281377562xxx Dear mbak Fifi yang maniszz… salam kenal. Mbak saya mau curhat. Sedih banget rasanya sering jadi bahan becandaan teman, gara-gara bodyku yang gak ramping. Saya berusaha gak sedih dan ikut tertawa.. tapi dalam hati menangis. Karena menurut saya candaannya udahkelewatan. Pliss bantuin donk, makasih yaa Jawab: Waalaikumsalam, Dear Ulie n Ratih yang cantik Mbak paham banget apa yang kalian rasakan. Siapa yang engga pengen punya tubuh langsing, mulus, putih dan sebagainya… tapi.. jangan kecil hati dengan ukuran tubuh dan fisik yang kalian miliki. Setiap orang pasti diberikan kelebihan

Konsultasi Remaja

sekali-gus kekurangan. Kalau punya body agak over.. tinggal mengatur pola makan, supaya bisa lebih ramping dan tetap harus sehat. Jadi kamu dapat konsultasi ke dokter atau rajin berolah raga. Apalagi kalian masih dalam pertumbuhan, masih bisa berubah asal teratur dan disiplin mengatur pola hidup, terutama maka-nan dan olah raga. Kalau kulitnya kurang putih.. jangan sedih donk.. orang uang kulitnya agak gelap justru dianugerahi anti body yang lebih kuat dibanding yang putih. Asal bersih dan terawatt, hitam itu jadi lebih eksotis, buktinya bule suka tuu berjemur di terik matahari. Jadi kenapa tidak mensyukuri dengan apa yang kita punya. Ulie n Ratih.. biasanya Cuma saat kenalan saja orang melihat ke kondisi fisik seseorang, tapi selanjutnya lebih banyak ditentukan oleh karakter dan kepribadian, apakah dia orang yang ramah, hangat dan menyenangkan. Tentang becandaan teman yang kadang menurut kalian agak keterlaluan, hak kalian buat menentukan respon yang akan diambil, mau dicuekin, atau ikut becanda dan tertawa.. tapi kalau kamu rasa terlalu banget.. kamu dapat ngomong.. ‘maaf nih, menurutku candaan kalian udah enggak nyaman lagi buatku dengerinnya.” Jadi jangan sediiiih donk… syukuri apa yang sudah diberikan Allah pada kita.. seperti kesehatan dan lain hal yang lebih indah buat dinikmati. salam Tanya: Iqbal – Hp 6285267565xxx Pagi mbak, salam kenal.. nama saya Iqbal pelajar SMU. Mbak saya punya teman.. dia tuu gampang kali jatuh cinta.. trus gampang putus. Apa ada hubungannya karena dia kurang kasih sayang dari papanya? Menurut mbak benar engga analisa saya? Makasih atas jawabannya.. Jawab: Pagi Iqbal… Wah, analisamu bagus.. bisa jadi psikolog tuu. Memang biasanya anak yang kurang mendapat perhatian dari orang tuanya suka mencari perhatian dan pelarian dari orang lain, engga harus perhatian dari papa/orang tua atau teman..jadi dia mencari perhatian dari teman lawan jenis. Nah sebagai temannya… kamu bisa tunjukin kepedulian, dengan care padanya .. missal ngajak ngobrol, jalan bareng dengannya. Karena orang yang merasa lonely biasanya butuh teman yang dia sayangi untuk berbagi.. nah.. sebagai teman yang baik.. kamu bisa jadi bagian orang yang dia sayangi. Salam… Tanya: Aurel – Hp 6281385984xxx Hallo mbak… salam kenal namaku Aurel… mbak saya baru kenal nee sama cowok, baru sebulan tapi dia udah maksa pengen aku jadi pacarnya.Padahal dia tahu aku uda punya pacar. Gimana nee… nolaknya? Makasih atas jawabannya mbak Tanya: Mora – Hp 6288272614xxx Assalamualaikum.. salam kenal mbak fi yang cantik.. mbak, mau curhat ni. Saya lagi bête ni. Saya punya teman, dia itu maksa banget pengen jadi pacar saya, sementara saya gak suka.. kalo jadi teman gak papa, tapi jadi cowo… yaa ntar dulu. Menurut mbak apa yang harus saya lakukan, supaya dia mau ngerti. Makasih ya mbak, salam Jawab: Waalaikumsalam, Dear Aurel n Mora Mbak senang baca curhatmu.. Kamu cewe yang punya prinsip.. tidak mau menerima orang karena gak enak hati menolak. Cowok yang suka maksa, nunjukin bahwa dia orang yang cenderung egois dan selalu mengikuti kemauannya sendiri. Orang yang egois biasanya engga peduli dengan orang lain, buktinya dia maksakan perasaannya tanpa peduli pada perasaan yang kamu punya. Kalau menghadapi cowok seperti ini susah berbasa-basi, jadi engga perlu ditolak secara halus, karena bakalan engga ngerti. Apalagi dia tahu bahwa kamu sudah punya cowok dan engga suka sama dia, tapi dia tetap ngotot. Nah sebelum dia semakin jauh dan masuk ke dalam kehidupanmu, kamu harus batasi hubunganmu dengannya. Bila perlu libatkan keluarga atau teman buat membantumu. Jadi kamu engga perlu merespon, kecuali dia mulai menyadari dan menghargai keinginanmu. Hidup ini indah… jadi enjoy dan nikmati aja.. jangan buang waktu untuk masalah seperti ini.. gak usah mikirin cowok ngotot itu.salam

Konsultasi Sumber Daya Manusia Diasuh oleh Drs. Thoga M. Sitorus, M.Si Pengamat Ketenagakerjaan/Konsultan Ketenagakerjaan Alumni Fisip Universitas Gajah Mada

Ketentuan Status Pekerja Harian Selamat pagi, Pak Thoga. Nama saya Sulastri, bekerja di sebuah perusahaan swasta di Kabupaten Langkat, mau menanyakan kepada Bapak tentang perbedaan pekerjaan harian dan pekerjaan bulanan. Apakah saya sebagai pekerja harian ada batas waktu bekerjanya dan bagaimana kalau perusahaan mempekerjakan pekerja harian melewati batas waktu yang ditentukan. Mohon penjelasan Bapak agar kami mengerti status kami sebagai pekerja harian. Demikian pertanyaan saya mewakili teman-teman dan saya ucapkan terima kasih. Jawab : Selamat pagi, Sdri Sulastri. Mengenai pertanyaan Sdri tentang pekerjaan harian lepas, maka acuan kita adalah keputusan Menteri Tenaga Kerja dan Transmigrasi Nomor Kep-100/MEN/ VI/2004 tentang Ketentuan Pelaksanaan Perjanjian Kerja Waktu Tertentu. Dalam Kep-

men 100/2004 ini disebutkan bahwa untuk dapat dikategorikan sebagai pekerja/buruh harian lepas harus mengikuti beberapa ketentuan, di antaranya lama bekerja dalam 1(satu) bulan tidak boleh melebihi dari 21 (dua puluh satu) hari kerja. Di samping itu pengusaha/perusahaan yang mempekerjakan perkerja/ buruh harian lepas wajib membuat perjanjian kerja harian lepas secara tertulis. Bentuk perjanjiannya dapat dibuat berupa daftar pekerja/buruh yang melakukan pekerjaan tersebut, dan sekurang-kurangnya memuat: a. nama/alamat perusahaan atau pemberi kerja; b. nama/alamat pekerja/ buruh; c. jenis pekerjaan yang dilakukan; d. besarnya upah dan/atau imbalan lainnya. Daftar pekerja/buruh tersebut disampaikan kepada instansi yang bertanggung jawab di bidang ketenagakerjaan setempat selambat-lambatnya 7 (tujuh) hari kerja sejak mempekerjakan pekerja/buruh harian lepas. Pelanggaran dari ketentuan di atas dapat mengakibatkan berubahnya

status pekerja/buruh dari pekerja/buruh harian lepas (pekerja kontrak) menjadi pekerja/buruh tetap. Untuk pekerja/buruh bulanan dapat kita bagi menjadi dua, yaitu pekerja/ buruh bulanan yang berdasarkan perjanjian kerja kontrak dan pekerja/buruh bulanan yang berdasarkan perjanjian kerja tetap. Ketentuan yang mengatur pekerja/buruh bulanan yang kontrak mengacu pada Kepmen 100/2004 (BAB V) sedangkan untuk pekerja/buruh bulanan tetap mengacu pada ketentuan umum yang diatur dalam Undang-Undang No.13 Tahun 2003 tentang Ketenagakerjaan Pasal 59.

Sanksi Bagi Pelanggaran Normatif Selamat pagi, Pak Thoga. Nama saya Purnomo, pekerja di sebuah perusahaan swasta di Kabupaten Asahan, ingin menanyakan kepada Bapak tentang hakhak normatif yang tidak dilaksanakan perusahaan, antara lain : pembayaran upah lebih rendah dari UMP/UMK, perusahaan tidak melaksanakan

program Jamsostek, pelaksanaan outsourcing tidak sesuai ketentuan. Pertanyaan saya apakah tindakan yang diambil terhadap perusahaan tersebut dan apa sanksinya. Mohon penjelasan dari Bapak tentang masalah tersebut dan saya ucapkan terima kasih. Jawab : Selamat pagi, Sdr Purnomo. Mengenai masalah yang Sdr tanyakan tentang pelanggaran hak-hak normatif pekerja/buruh, diatur dalam ketentuan perundang- undangan ketenagakerjaan yang diperjelas dalam Kesepakatan Kerja (KK), Peraturan Perusahaan (PP), Perjanjian Kerja Bersama (PKB), yang dibuat oleh perusahaan dan wajib dilaksanakan oleh perusahaan yang bila tidak dilaksanakan ada sanksinya. Perusahaan membayar upah lebih rendah dari upah minimum maka sanksinya adalah pidana penjara paling singkat 1 (satu) tahun dan paling lama 4 (empat) tahun dan/atau denda paling sedikit Rp 100.000.000 dan paling banyak Rp 400.000.000. Tindak pidana

dimaksud adalah tindak pidana kejahatan (Pasal 185 Undang- Undang Nomor 13 Tahun 2003) sedangkan pelanggaran terhadap pelaksanaan program Jamsostek diancam dengan hukuman kurungan 6 (enam) bulan atau denda setinggi- tingginya Rp 50.000.000 dan tindak pidananya adalah pelanggaran (Pasal 29 Undang-Undang Nomor 3 Tahun 1992). Pelanggaran terhadap pelaksanaan outsourcing yang banyak dilaksanakan di Kabupaten Asahan yang tidak sesuai ketentuan, seperti perusahaan pemborong pekerjaan tidak berbadan hukum dan tidak memiliki izin dari instansi yang ber-

tanggung jawab di bidang Ketenagakerjaan, maka demi hukum status hubungan kerja pekerja/buruh dengan perusahaan penerima pemborongan beralih menjadi hubungan kerja pekerja/buruh dengan perusahaan pemberi pekerjaan. Bilamana hubungan kerja didasarkan atas Perjanjian Kerja Waktu Tertentu (PKWT/kontrak kerja) dan pekerja/buruh melaksanakan pekerjaan yang menurut jenis dan sifat kegiatan pekerjaannya bersifat tetap/

terus-menerus dan/atau melaksanakan kegiatan pokok atau kegiatan yang berhubungan langsung dengan kegiatan produksi maka hubungan kerja menjadi Perjanjian Kerja Waktu Tidak Tertentu (PKWTT/pekerja tetap) Pasal 59 Undang- Undang Nomor 13 tahun 2003 Jo. Kepmenakertrans Nomor KEP 220 Tahun 2004 tentang Syarat- Syarat Penyerahan Sebagian Pelaksanaan Pekerjaan Kepada Perusahaan Lain. Dalam hal perusahaan

Bagi para pembaca yang ingin menanyakan seputar tentang ketenagakerjaan dapat mengirimkan pertanyaan melalui, atau SMS Ke HP:0811632554

sebagai penyedia jasa pekerja/buruh, tidak mendaftarkan perjanjian penyediaan jasa pekerja/buruh, maka instansi yang bertanggung jawab di bidang ketenagakerjaan dapat mencabut izin operasionalnya dan hak- hak pekerja/buruh tetap menjadi tanggung jawab perusahaan penyediaan jasa pekerja/buruh yang bersangkutan (Kepmenakertrans Nomor 101 Tahun 2004 tentang Tata Cara Perijinan Perusahaan Penyedia Jasa Pekerja/ Buruh).

Kupon Konsultasi


WASPADA Minggu 25 Agustus 2013


Seochi Internasional Manjakan Pengunjung

Pesan Dan Makan Nasi Goreng Sepuasnya yang memesan satu porsi, boleh menambah satu porsi lagi atau lebih. Bukan hanya itu, jika Anda komlpain karena makanan kurang enak, Anda mendapatkan potongan harga 10 persen. “Ini cara kami memberikan pelayanan kepada pengunjung restoran,” kata Mariono selaku FBM di hotel ini, Rabu lalu. Dia menyebutkan, menu yang disiapkan bagi pengunjung di Asoka Restoran setiap harinya selalu berbeda. Hari Senin ada nasi goreng spesial asoka, Selasa , nasi goreng yangzhou, Rabu, nasi goreng seafood, Kamis nasi goreng surabaya, Jumat, nasi goreng ikan asin, Sabtu, nasi goreng thailand dan Minggu nasi goreng hongkong. Selain nasi goreng di Kim Chu Restoran juga tersedia menu mi ayam promo dengan harga hanya Rp 10.000 belum termasuk minuman. “Kami sengaja menyiapkan makanan dengan harga terjangkau ini agar konsumen bisa merasakan aneka hidangan yang kami siapkan. Rasa tetap berkelas, harga kaki lima,”kata Mariono.

ANDA penikmat nasi goreng ? Ingin makan sepuasnya sambil melihat chef yang mengolah makanan ini sebelum disajikan. Mampirlah ke Restoran Asoka Hotel Soechi Internasional di Jln Cirebon Medan. Setiap hari sejak pukul 12 siang sampai pukul 15 WIB, sajian nasi goreng dengan beragam variasi rasa bisa Anda pesan. Mengandalkan harga Rp 15.000 belum termasuk minuman, nasi goreng di restoran ini bisa membuat penikmatnya sangat kenyang. Coba saja sensasi rasa nasi goreng yangzhou. Nasi yang diolah dengan racikan bumbu di antaranya bawang putih dan sedikit margarin, membuat nasi goreng ini sangat berbeda. Perpaduan sayuran seperti wortel, arcis, jagung muda dan potongan acar timun serta potongan cabai rawit yang dipadu dengan kecap asin membuat nasi goreng terasa lebih enak. Taburan bawang goreng dan sedikit kerupuk menambah lengkapnya menu ini. Anda juga merasakan pelayanan yang lebih dengan bersantap nasi goreng di restoran ini. Pasalnya, setiap pengunjung

Naskah dan foto : Anum Saskia

“Pengunjung boleh memesan kembali nasi goreng jika satu porsi belum cukup. Chef akan langsung memenuhi permintaan dengan memasak pesanan pengunjung. Boleh satu, dua atau tiga kali tambah ”

Olahan Kerang Gugah Selera KERANG, binatang bertubuh lunak memiliki cangkang yang bisa dibuka dan ditutup. Beragam jenis yang ada di Indonesia dan bisa dikonsumsi adalah kerang hijau, kerang kima, remis, dan sebagainya. Konon kerang yang bernama Mya Arenaria merupakan kerang termahal di dunia. Kerang dapat diolah demikian rupa, sehingga diyakini mampu menggugah selera. Sepertinya tak ada yang tidak suka makanan satu ini, karena rasanya enak dan tidak terlalu sulit untuk mendapatkannya. Harganya yang terjangkau dan pengolahannya yang tidak begitu sulit, makanan ini tetap jadi pavorit. Diolah dengan cara ditumis, ditaucho atau dijadikan bahan campuran makanan lainnya, maupun hanya direbus saja, atau direndang dan digulai. Makanan yang satu ini tak pernah bosan dihadirkan di meja makan. Untuk jenis tumisan, cukup mengandalkan kerang yang sudah dibersihakan, menyediakan bumbu seperti bawang bombay, tonat, cabai

hijau saus dan minyak untuk menggoreng. Jika ingin membuat tauco kerang, tentu cabai hijau dan tomat segar serta irisan bawang merah dan bawang putih dipadukan dengan tauco saat memasaknya. Cukup dengan memanaskan minyak goreng, tumis bawang bombay dan bawang putih hingga harum. Tambahkan hijau dan cabe rawit, masukkan kerang, aduk hingga rata. Masukkan tomat, saus tiram, air jeruk lemon, garam dan meruca bubuk. Tuangkan air, masak hingga mendidih dan kuah menyusut. Hidangan yang cukup menggugah selera saat menyantapnya. Bila Anda tak sempat mengolah makanan ini, bisa membeli yang siap saji. Restoran Toha-Rahmat di Jln Gatot Subroto Medan yang menyediakan aneka makanan olahan dari kerang. Sate maupun aneka tumisan kerang dan kerang yang dipadu dengan beragam makanan olahan. Setiap hari restoran ini juga menerima orderan sate yang biasanya dijadikan oleh-oleh.

Anum Saskia


Empek-empek Kapal Selam Bahan 500 ikan tenggiri Haluskan 6 butir bawan merah 5 siung bawang putih 1 sdt merica 200 gram tepung kanji 2 sdt garam 8 butir telur bebek

Cuko 5 siung bawang putih 10 buah cabai rawit 1 sdt garam 150 gram gula merah 2 sdt air asam jawa 3 sdm cuka 300 ml air matang

Cara membuat Bersihkan ikan, buang seluruh tulang ikan dan kulitnya, haluskan. Campur ikan dengan bumbu halus, tepung kanji, dan garam. Aduk adonan sampai rata. Ambil adonan, bentuk menjadi bulatan, lalu buat seperti mangkuk lonjong, isi dengan telur. Katupkan bagian tepi adonan sampai telur terbungkus rapi. Rebus adonan empek-empek dalam air mendidih sampai terapung, angkat. Goreng empek-empek sampai kekuningan. Angkat, potong-potong.

Cuko: Haluskan bawan putih, cabai rawit, dan garam. Campurkan dengan gula merah, air asam jawa, cuka dan air matang. Saring cuko. Sajikan empek-empek bersama cuko dan pelengkap. Pelengkap Irisan mentimun Mi kuning secukupnya

Tips : Bawang Goreng Berwarna Bagus Bawang goreng akan tidak hangus dan warnanya bagus kalau selama menggoreng Anda tambahkan 1 atau 2 sendok makan susu cair. Ingatlah susu cair harus tawar. Kalau dibuat dari susu bubuk yang dicairkan pun, harus dipilih yang tidak mengandung gula.

Srigustina: Dari Berbagai Sumber By: Sri Gustina

WASPADA Minggu 25 Agustus 2013

Konsultasi Seputar Diabetes Bersama:

DR. Dr. Dharma Lindarto, SpPD, KEMD (Dokter Internis – Konsultan Endokrin, Metabolik, Diabetes)

Diabetes Dan Gagal Ginjal ? Dokter Dharma YTH, Bapak saya sudah berumur 66 tahun, menderita diabetes sudah 15 tahun. Selama ini bapak saya tidak teratur minum obat gula. Dalam 1 bulan terakhir, air seni bapak saya sedikit sekali sekitar satu gelas aqua setiap harinya. Kemudian seminggu yang lalu saya bawa ke rumah sakit karena mual, muntah, lemas dan sedikit pucat. Kami sangat terkejut ketika hasil laboratorium dan keterangan dokter yang merawat ternyata fungsi ginjal bapak sangat buruk dan harus menjalani ncuci darah. Apakahbapaksayasudahmenderitagagalginjal?.Apapenyebab gagal ginjal yang diderita bapak saya?.Apakah harus cuci darah seumur hidup?. Terima kasih. (Bu Erni-Medan,HP.0812650xxxx) Bu Erni yang baik, Semua komplikasi pada diabetes ditakuti. Komplikasi akut bisa mendadak karena mengancam hidup diabetisi. Komplikasi kronis membuat orang hidup lama tetapi tidak merasa sehat, sangat terganggu karena gejalanya dan tersiksa karena biaya pengobatan semakin mahal. Komplikasi kronis disebabkan kelainan pembuluh darah halus (mikroangiopati) dapat terwujud pada organ mata (disebut retinopati) dan ginjal (disebut nefropati) yang kadangkala sering berujung pada gagal ginjal yang membutuhkan cuci darah seumur hidup. Nefropati diabetik, disebut juga penyakit ginjal diabetik menduduki angka teratas sebagai penyebab penyakit ginjal kronik. Kejadian penyakit ginjal diabetik sekitar 85% (tahun 2000) di Indonesia. Tujuan pengelolaan penyakit ginjal diabetik mencegah atau menunda progresifitas penyakit ginjal dan memperbaiki kualitas hidup pasien sebelum masuk ke dalam tahap gagal ginjal. Cara menghambatprogresifitaskerusakanginjaldengancaraoptimalisasi kadar gula darah, menurunkan tekanan darah (120/80 mmHg), melakukan test tahunan terhadap adanya mikroalbuminuria. Keluhangagalginjalyangdialamipasiendarirasamual-muntah, tidak ada nafsu makan, muka pucat, buang air kecil sedikit sampai tidak ada kencing sama sekali. Petanda adanya penyakit ginjal diabetik adalah dijumpai albumin di dalam urine. Awalnya hanya albumin yang halus (mikro-albuminuria) dan berlanjut sejalan dengan memberatnya komplikasi, akan dijumpai makro-albuminuria di dalam urine. Untuk melihat tingkat keparahan gangguan ginjal, selain memeriksa albumin, dokter akan memeriksa petanda kelainan ginjal lain, diantaranya kadar ureum dan kreatinin darah. Bapak Ibu Erni telah mengalami gagal ginjal kronik, sehingga memerlukan cuci darah berkelanjutan. Cuci darah bukan untuk mengobati penyakit ginjal yang dialami saat ini. Dengan cuci darah sangat membantu peningkatan kualitas hidup. Dengan kontrol gula darah optimal, menjaga tekanan darah dan diet, mudahmudahan dapat mencegah kompliakasi kronik laiinya. Untuk pilihan obat gula yang diberikan harus dikonsultasikan dengan dokter, tapi sebaiknya berkonsultasi ke dokter Spesialis Penyakit Dalam, khusunya divisi Nefrologi-Hipertensi dan Endokrin Metabolik-Diabetes. Mungkin jawaban ini dapat bermanfaat. Terima kasih. „ Rubrik Konsultasi Seputar Diabetes: Kerja sama PERSADA CABANG MEDAN dan Harian WASPADA Medan, untuk menjawab segala pertanyaan seputar Diabetes dan Komplikasi „ Pertanyaan dapat dikirim tertulis ke Harian Wasapada, sms ke HP. 08126505336 / 081263852525, dan email : atau dan , Sekretariat PERSADIA MEDAN (KLINIK DIABETES DHARMA) Jl. Beringin Raya No. 1 A-B Telp. 06177688850.

Kesehatan Suhu Tubuh Berperan Penting Parameter Kesehatan (Bagian I)

Suhu pasien biasanya diukur dengan termometer air raksa. Suhu subnormal dibawah 36,5p C. Sedangkan demam didefenisikan jika suhu tubuh diatas 37,3p C. Hiperpireksia suatu keadaan kenaikan suhu tubuh sampai setinggi 41,2p C atau lebih, sedangkan hipotermia keadaan suhu tubuh di bawah 36p C. pengukuran suhu tubuh dapat dilakukan melalui anal, oral/mulut dan ketiak. Belakangan ini, semakin banyak orang yang status suhu tubuhnyahipotermiayangmerupakan keadaan berbahaya bagi tubuh. Namun, kebanyakan dari Anda tidak menyadari hal itu. Sehingga membiarkan kondisi hipotermia tersebut. Kondisi hipotermia jika dibiarkan mempermudah seseorang terserang penyakit. Risiko penyakit yang ditimbulkan seperti kulit kasar, sembelit, penyakit periodontal pada gigi, tukak pencernaan, mempermudah diabetes, osteoporosis, kolitis ulseratif, kanker, pneumonia, penyakit demensia serta beragam penyakit alergi.

kungan. Sedangkan tubuh telah diberikan sistem untuk menanggulangi ketiga stres tersebut melalui keseimbangan saraf otonom dan keseimbangan hormon. Keseimbangan Saraf Otonom. Tubuh menjaga keseimbangan ini melalui dua saraf otonom (bekerja secara otomatis), yaitu saraf simpatik dan saraf parasimpatik mengendalikan tubuh secara berpasangan dan bergantian. Sebagai contoh, saat sedang bekerja, berolahraga dan aktif bergerak, tubuh berada dalam kendali saraf simpatik. Sebaliknya saat tidur atau bersantai, tubuh berada dalam saraf para simpatik. Keseimbangan saraf otonom mengendalikan sistemkekebalanyangmelindungi tubuh dari stres yang menyusup masuk dari luar tubuh seperti kuman, virus dan lain-lain. Keseimbangan Hormon. Kalenjar adrenal mengendalikan keseimbangan hormon.Terletak di atas ginjal (“ad+renal, renal berarti ginjal”). Kalenjal adrenal berperan memulihkan sel saat sel menerima kerusakan, dengan cara mengeluarkan hormon bernama kortisol. Dengan bekerjanya kedua fungsi tersebut, yaitusistemkekebalandansistem hormon, tubuh kita melindungi dirinya dari segala jenis stres diatas. Jika kedua sistem ini terganggu, aliran darah memburuk sehingga terjadi gangguan aliran darah, pemulihan sel menjadi lambat dan energi sel menjadi menurun, sehingga terjadilah hipotermia.

Mengapa Hipotermia Bisa Terjadi? Biangnya adalah stres. Masyarakat modern adalah masyarakat stres. Tanpa disadari kita selalu memilih udara dingin ber AC,sepertikendaraan,bisumum, kamar tunggu, ruangan tidur dan tempat tinggal. Ada bermacammacam stres, seperti stres jasmani, stres psikis dan stres ling-

Mengapa Hipotermia Menyebabkan Penyakit? Jika suhu tubuh normal, makasistemkekebalandansitem hormonal normal pula. Kondisi suhu tubuh yang tinggi merupakan keadaan sistem kekebalan yang sedang bekerja untuk mengembalikankelainanyangterjadi di dalam tubuh yang normal. Sebaliknya, suhu tubuh rendah


ahukah Anda berapa derajat Celsius suhu normal tubuh ? Tahukah Anda suhu tubuh memegang peranan penting untuk parameter kesehatan ? Ketika terkena flu, kebanyakan orang menilai apakah harus ke dokter atau tidak tergantung dari suhu tubuhnya. Menurut pandangan awam, jika panas tubuh menjadi sekitar 37p C, berarti sedikit demam, cukup disembuhkan dengan obat penurun demam, jika suhu tubuhnya diatas 38p C, lebih baik ke dokter dan seterusnya.

Dengan melihat angka suhu tubuh Anda tidak bisa menilai dengan benar apakah muncul serangan demam ataukah sekadar sedikit demam. Oleh karena, bagi orang suhu normalnya 36,5p C, maka untuk suhu 37p C bukan demam, sedangkan merekadengansuhutubuh35,5p C, maka suhu 37p C dapat berarti ‘bahaya’ munculnya demam tinggi. Saya teringat saat kecil ketika ibu tercinta bercerita tentang kakek (bapaknyaibu)mengalami demam, beliau mengurung diri di kamar dengan menyelimuti seluruhbadandankepaladengan tikar dan memasang lampu 100 watt di atas kepala beliau. Apa yang dia lakukan dahulu, baru sayatahumanfaatnya,ketikasaya membaca buku dr Masashi Saito tentang Mukjizat Suhu Tubuh. Masashi Saito sendiri seorang dokter anti-aging di Jepang, Amerika Serikat dan Eropa. (Tapi saya tidak menganjurkan prilaku kakek untuk dipraktikkan, mungkin ini prilaku pribadi kakek untuk menghindari penyakit) Suhu Tubuh: Sehat vs Tidak Sehat (Hipotermia) Suhu tubuh orang sehat 36,8p C ± 0,34p C. Artinya, suhu tubuh orang sehat berkisar 36,5-37,1p C. Suhu tubuh 37p C tanpa disertai rasa lesu, nyeri dan rasa tak enak lainnya, bukanlah demam ringan, melainkan suhu tubuh sehat.

(hipotermia) merupakan kondisi menurunya sistem kekebalan sekaligus gangguan pengeluaran hormon. (Saya teringat saat mengambil pendidikan spesialis penyakit dalam, sering saya saksikan pasien kanker mendapat awal obat kemoterapi sering mengalami demam tinggi, ini mungkin usaha tubuh pasien memperbaiki keseimbangan. Juga sering kita dapatkan anak balita yang masa pertumbuhan fisik sering juga mengalami demam tanpa sebab yang diketahui.) Suhu tubuh sangat mempengaruhi daya tahan tubuh. Jika suhu tubuh turun 1p C, daya tahan tubuh berkurang 30%. Jika daya tahan tubuh menurun, ia tidak bisa melindungi tubuh dari kumandanvirus,malfungsikekebalan menyebabkan sistem kekebalan malah merusak kekebalan itu sendiri dan memicu munculnya penyakit. Tahukah Anda apa yang terjadi sebaliknya, jika suhu tubuh naik 1p C? Seberapa banyak daya tahantubuhmeningkat?Ternyata sangat luar biasa. Daya tahan tubuh naik 500-600%, atau dengankatalain,hanyadengansuhu tubuhmeningkat1pC,dayatahan tubuh meninglkat 5-6 kali lipat. Sehingga dengan meningkatkan suhu tubuh, Anda dapat menjadi lebih kuat terhadap stres dan tubuh menjadi terpelihara sehingga tidak mudah terkena penyakit.Pertanyaanselanjutnya, bagaimana cara terbaik untuk mempertahankan suhu tubuh yang tinggi ? Mungkin jawabannya di minggu depan pada artikel saya berikutnya. Semoga bermanfaat!. (Disadur dari berbagai sumber) *M. Aron Pase (Dokter Spesialis di Departemen Ilmu Penyakit Dalam FKUSU/RSHAM; alamat email: atau dan HP. 0812 650 5336)

25% Orang Pernah Alami Biduran Alergidibagimenjadiduatipe. Tipe pertama alergi berdasarkan penyebabnya. Tipe kedua alergi berdasarkan gejala yang muncul di tubuh. Alergi yang dibedakan atas dasar penyebabnya juga terbagi atau dua macam, yaitu penyebab yang berasal dari luar tubuh (ekstrinsik)danpenyebabyangberasal dari dalam tubuh (intrinsik). Penyebab yang berasal dari luar tubuh terdiri seperti alergi debu rumah, kapuk dan serbuk saribunga,biasanyaberupaasma dan batuk. Alergi makanan, seperti udang, kepiting, susu dan telur, biasanya berupa alergi kulit. Alergi tembaga, kulit, rantai jam tangan dan sebagainya Alergi obat-obat antibiotik, seperti Tetrasiklin Sementara itu, penyebab yang berasal dari dalam tubuh (intrinsik) umumnya merupakan faktor keturunan (genetis). Tipe kedua berdasarkan gejala yakni tipe cepat reaksi timbul 15-20 menit setelah alergen masuk ke dalam tubuh penderita. Tipe lambat reaksi baru timbul 2-3 hari setelah tubuh kontak dengan alergen. Jika terjadi pada kulit yang timbul adalah gejala eksim. Jika terjadi pada hidung yang timbul adalah rhinitis, sinusitis dan polip hidung. Pada bayi dapat menyebabkan peradangan usus. Kedua tipe alergi ini paling banyak ditemui di Indonesia. Dibandingkan dengan alergi tipe lambat, alergi tipe cepat kasusnya lebihbanyakterjadi.DiIndonesia, kemunculan IgE lebih sering dibandingkan dengan di negara maju (Eropa). Hal ini disebabkan

Indonesia terletak di wilayah tropis. IgE juga dapat diproduksi cacing, virus dan limfosit. Alergi tipe cepat biasanya disebabkanalergenhirup,alergen makanan dan alergen obat-obatan. Alergi lambat biasanya, selain alergen makanan, juga disebabkan alergen yang menempel di kulit. Alergen tipe lambat membutuhkan waktu agak lama dan menimbulkan reaksi lokal, seperti gejala eksim dan bintik-bintik berair di lokasi-lokasi tertentu di tubuh. Misalnya alergi pada hidung (rhinitis), alergi pada saluran pernapasan (asma bronkial), alergipadakulit(biduran,kaligata, eksim) dan alergi pada saluran pencernaan Tentang Biduran (Kaligata) Biduran merupakan penyakit kulit sering di jumpai dan biasa terjadi. Biduran atau kaligata atau urtikaria dalam istilah kedokterannya merupakan kelainan kulit ditandai dengan bentolbentol kemerahan, sangat gatal, sering disertai rasa tertusuk dan panas. Biduran bisa datang tanpa permisidantakkenalwaktu,dapat terjadi di bagian tubuh mana saja dengan bentuk dan ukuran beraneka ragam. Karena gatalnya terkadang seseorang mengalami biduran sering menggaruk sehingga bentol-bentol tersebut makin meluas. Biduran bisa berlangsung beberapamenitsampaibeberapa hari. Umumnya tidak berbahaya dan tidak meninggalkan bekas, namun biduran bisa menjadi penyakit serius bila bersamaan dengan angioedema (urtikaria

yang mengenai lapisan bawah kulit dan mukosa), karena jika terkena saluran nafas bisa menyebabkan sulit bernafas sehingga menyebabkan kematian. Sekitar 40% penderita urtikaria kronis menderita angioedema. Sekitar 10-25% orang pernah mengalami biduran, paling tidak sekali dalam hidupnya. Biduran akutlebihseringterjadipadaanak muda, umumnya laki-laki lebih sering dari perempuan. Sedangkan biduran kronik lebih sering pada wanita usia pertengahan (60%). Orang-orang dengan riwayat atopi lebih mudah terkena biduran. Biduran terjadi ketika seseorang terkena sesuatu yang bisa memicu, kemudian beberapa sel di dalam tubuhnya melepas histamin dan zat lain. Hal ini menyebabkan bocornya cairan dari pembuluh darah kecil di bawah kulit. Cairan ini membentuk bentolan ketika berkumpul di bawah kulit yang lazim disebut biduran. Dasar penyebabnya atopi, suatukeadaanataukelainanalergi yang sifatnya diturunkan dari dalam satu keluarga dengan manifestasi penyakit seperti biduran, radang kulit berulang, timbulnya pada tempat tertentu dengan tanda khas sesuai umur (dermatitis atopi), asma, sering pilek , bersin sampai hidung tersumbat dan biasanya terdapat pula tanda lain berupa lingkaran gelap di mata, kulit kering dan wajah agak pucat. Hampir 80% tidak diketahui penyebabnya. Ketidakpastian penyebab timbulnya urtikaria disebabkan faktor yang berpengaruhsangatbanyakdansulitdipas-

tikan. Diduga penyebab biduran antaralainobat-obatan:antibiotik (penicillin,sulfa,tetrasiklin),penghilang rasa sakit, aspirin, obat hormonal,pilkontrasepsi).Makanan, seperti udang, ikan, putih telur, kerang, kacang, coklat, susu, tomat,arbei,keju,bawang,semangka, tartrazine (pada minuman atau permen berwarna jingga atau kuning), natrium benzoate yang di gunakan secara luas sebagai bahan pengawet dan penyedap rasa. Bahan yang sering kontak dengan tubuh (sabun cair, hand and body lotion). Gigitan atau sengatan serangga (nyamuk, lebah dan lainnya). Inhalan seperti serbuk sari bunga, spora jamur, debu, bulu binatang dan aerosol.Kontakdengankutubinatang, serbuk tekstil, air liur binatang, tumbuhan, buah-buahan. Faktor fisik seperti udara dingin, panas, cahaya matahari, getaran, gesekan atau tekanan (goresan, pakaian ketat, semprotanair,ikatpinggang).Infeksivirus, bakteri, jamur dan parasit. Lingkungan yang kotor (debu rumah) Psikis: stres emosional atau gelisah. Penyakit sistemik (limfoma, hipertiroid, lupus eritematosus dan keganasan). Gangguan hormonal (kehamilan, menstruasi). Berdasarkan lamanya, biduran dibedakan menjadi urtikaria akut dan kronik. Urtikaria akut, bila kelainan kulit terjadi selama 6 minggu atau berlangsung selama 4 minggu namun timbul setiap hari. Sekitar 20%-30% pasien denganurtikariaakutberkembang menjadi kronis. Sedangkan ur-

Tabir Surya Dan Sinar Matahari Kita sangat membutuhkan sinar matahari sebagai salah satu sumber kehidupan. Di sisi lain, matahari dengan sinar ultraviolet-nya bisa memicu gangguan kesehatan, terutama bagi kulit. Menipisnya lapisan ozon sudah menimbulkan pemanasan global yang juga semakin beresiko meningkatkan sisi buruk penyinaran ultraviolet.Yang paling jelas iklim yang kita rasakan sekarang, aktifitas di siang hari sering menjadi terganggu. Kapan Harus Menghindari Sinar Matahari? Salah satu fungsi sinar matahari yang tak kalah penting bagi tubuh manusia membantu sintesa vitamin D dari bentuk provitamin menjadi bentuk yang dapat digunakan tubuh. Karena itu rata-rata bayi dianjurkan berjemur di pagi hari, biasanya sebelum pukul 9.00-10.00 pagi secara bervariasi karena kandungan sinar ultraviolet pada waktu tersebut sangat diperlukan. Sementara sinar ultraviolet siang hari dari pukul 9.00-10.00 ke pukul 16.00 sore berbahaya bagi kesehatan. Sinar ultraviolet (UV) ini terbagi tiga jenis berdasar panjang gelombangnya, yaitu UVA (320-400 nm), UVB (290-320 nm) dan UVC (100-290 nm). Dengan panjang gelombang tersebut, UVC langsung terserap lapisan ozon sehingga tak berpengaruh pada kulit. Sementara UVB dengan gelombang lebih panjang berpengaruh pada lapisan terluar kulit dikenal dengan sebutan epidermis. Efek yang tak diharapkan terpicunya produksi pigmen melanin sebagai

pewarna kulit sehingga kulit gampang menghitam atau berwarna coklat. Pada beberapa ras, kulit seperti ini justru jadi dambaan dalam masalah estetis, kadang tanpa memperhatikan efek buruknya bagi kesehatan, ketika melanin tak lagi bisa menahan sinar UVB yang diserap kulit, kulit bisa mengalami gangguan terbakar dikenal dengan sunburn. Proses ini semakin meningkat pada orang dengan kadar pigmen melanin rendah misalnya kebanyakan bangsa Asia, sementara yang berkadar pigmen tinggi tetap lebih terlindung. Setelah itu ada UVA dengan panjang gelombang tertinggi yang bahkan bisa menembus lapisan-lapisan seperti jendela atau kaca biasa dengan ketebalan tertentu, hingga ke lapisan kulit lebih dalam atau kulit jangat. Bagian kulit yang mengandung semua unsur penunjang kulit seperti kolagen, kelenjar lemak, keringat, akar rambut, pembuluh darah hingga ujung syaraf pengatur rasa. Karena itu pula pajanan UVA ini merupakan paling dikhawatirkan dan berpotensi menimbulkan kerusakan lebih berat. Dari efeknya pada proses penuaan kulit, wrinkles atau kerutan, flek-flek hitam hingga kerusakan sel lebih parah termasuk kerusakan mukosa misalnya pada mata ataupun keganasan kulit tetap paling tinggi resikonya pada pemilik kadar melanin rendah. Atas bahaya seperti ini, terutama saat sekarang dimana lapisan ozon sebagai penyerap panas utamanya semakin menipis, efek dari ultraviolet memerlukan tabir surya bagi objek yang disinarinya.

tikaria kronik terjadi lebih dari 6 minggu lamanya. Berdasarkan morfologinya, maka urtikaria dibedakan menjadi urtikaria papular, gutata (sebesar ukuran tetesan air) dan girata (ukuran besar-besar). Berdasarkan dalam dan luasnya urtikaria, maka urtikaria dibedakan menjadi urtikaria lokal,generalisatadanangioedema. Dan berdasarkan penyebabnya maka urtikaria dibedakan menjadi urtikaria imunologik, nonimunologik dan idiopatik. Beberapa pemeriksaan penunjang diperlukan untuk membuktikan penyebab urtikaria: pemeriksaandarah,airsenidantinja rutin untuk menilai ada tidaknya infeksi yang tersembunyi atau kelainan pada organ dalam. Pemeriksaan imunologis seperti pemeriksaan kadar IgE, eosinofil dan komplemen. Test kulit, walaupunterbataskegunaannyadapat dipergunakan untuk membantu diagnosis. Uji gores dan uji tusuk dapat dipergunakan untuk mencari alergen. Teseliminasimakanandengan cara menghentikan semua makanan yang dicurigai untuk beberapa waktu, lalu mencobanya kembali satu per satu. Penanganan biduran paling idealmenghindaripenyebabatau faktor pencetus agar tidak terjadi atau meminimalisir terjadinya biduran.Caramenemukanfaktor pencetus adalah dengan mencatat obat, makanan atau bahan yang ketika dikonsumsi atau digunakan menyebabkan timbulnya biduran. Usahakanjangandigaruk.Jika digaruk, maka bahan aktif his-

tamin makin banyak keluar dan yang terjadi justru bagian yang digaruk semakin gatal. *dr Lily


Dibalik Pedasnya, Cabe Bermanfaat Untuk Kesehatan Berbagai kegiatan penelitian menyimpulkan dibalik rasa pedasnya,cabememilikibanyakmanfaatterutamabagikesehatan. Di antara manfaatnya cabe dapat mengurangi resiko kanker, menurunkan kadar kolesterol dalam darah, bahkan dapat menyembuhkan luka. Dokter Khursheed Jeejeebhoy, ahli penyakit dalam dari University of Toronto menganjurkan konsumsi makanan pedas secara teratur meningkatkan kualitas kesehatan tubuh. Mengkonsumsi makanan pedas secara tidak berlebihan sangat baik bagi kesehatan dan mengurangi risiko kanker. Hasil penelitian laboratorium di Inggris menemukan, kandungan capsaicin pada cabe yang menimbulkan rasa pedas dapat membunuh sel kanker tanpa merusak sel normal. Jadi tidak heran mengapa beberapa kasus kanker di Meksiko dan India yang masyarakatnya banyak mengonsumsi makanan pedas lebih sedikit dibandingkan negara Barat yang masyarakatnya cenderung tidak suka makanan pedas. Dua penelitian yang dilakukan tim dari Australia juga mengungkap menambahkan cabe dalam setiap masakan bisa menurunkan kadar kolesterol dalam darah. Hasil penelitian itu juga menjelaskan, makanan pedas bisa menstabilkan kadar insulin dalam darah. Dalam takaran tidak berlebihan, makanan pedas bermanfaat untuk kesehatan lambung. Demikian hasil studi tim peneliti dari Hungaria. Capsaicin bisa mengurangi asam lambung dan berfungsi sebagai antiinflamasi. Penyembuh Luka dan Pereda Demam Tinggi Bagi masyarakat pedesaan tanaman cabe banyak digunakan sebagai penyembuh. Di antaranya dapat menyembuhkan luka dan daunnya dapat digunakan sebagai pereda demam tinggi. Untuk penyembuh luka, cabe merah dikeringkan dan ditumbuk sampai halus bila ditaburkan pada luka dapat mempercepat proses penyembuhan luka. Ini disebabkan adanya zat capsaicin pada cabe merah yang menghilangkan rasa sakit. Sementara daun pohon cabe digunakan masyarakat pedasaan untuk menurunkan demam. Caranya ambil segenggam daun cabe rawit, lalu tumbuk sampai halus. Tambahkan 1 sendok minyak selada, campurkan kedua bahan ini sampai rata. Setelah itu tempelkan ramuan pada ubun-ubun atau dibalurkan pada seluruh badan. Selimuti badan penderita dengan selimut tebal. Tak berapa lama, badan mengeluarkan keringat, sehingga panas badan menurun dengan cepat. Manfaat lain dari cabe dapat meredakan pilek dan hidung tersumbat karena capsaicin dapat mengencerkan lendir. Sehingga, lendir tersumbat dalam rongga hidung menjadi encer dan keluar. Akibatnya, hidung tidak tersumbat lagi. Ini berlaku pada sinusitis dan juga batuk berdahak. Cabe dapat memperkecil risiko terserang stroke, penyumbatan pembuluh darah, impotensi dan jantung koroner. Karena, dengan mengkonsumsi capsaicin secara rutin darah tetap encer dan kerak lemak pada pembuluh darah tidak akanterbentuk.Sehingga,darahmengalirlancar.Jadicabeberkhasiat mengurangi terjadinya penggumpalan darah (trombosis). Sebagai antibiotik alami cabe dapat meringankan keluhan sakit kepala dan nyeri sendi. Karena, rasa pedas dan panas yang ditimbulkan capsaicin menghadang pengiriman sinyal rasa sakit dari pusat sistem saraf ke otak. Sehingga, rasa sakit tersebut akan berkurang, bahkan hilang. Cabe dapat meningkatkan nafsu makan pengkonsumsinya. Karena, capsaicin dapat merangsang produksi hormon endorphin, hormon yang mampu membangkitkan rasa nikmat dan kebahagiaan. Sehingga, nafsu makan menjadi bertambah. Kandunganantioksidannyadapatdigunakanuntukmengatasi ketidaksuburan (infertilitas), afrodisiak dan memperlambat proses penuaan. Ekstrak cabe rawit mempunyai daya hambat terhadap pertumbuhan jamur Candida Albicans, yaitu jamur pada permukaan kulit. Untuk gangguan rematik dan frostbite (jari nyeri karena kedinginan). Daunnya bisa digiling untuk dibalurkan di daerah yang sakit guna mengatasi sakit perut dan bisul. Mengobati perut kembung. Membantu pembakaran kalori hingga 25%. Memberikan kalsium dan fosfor bagi tubuh. Cabe menghasilkan vitamin C (lebih banyak daripada jeruk) dan provitamin A (lebih banyak daripada wortel) yang sangat diperlukan bagi tubuh. Walau banyak manfaat yang bisa diambil dari mengkonsumsi cabe, namun dianjurkan untuk tidak mengkonsumsi cabe secara berlebihan. Jadi tidak salah bila mulai menyisipkan makanan pedas dalam menu harian Anda secara berkala.*Fahmi Isya

Albern Sultan “L-Men of theYear 2013” Kampanyekan Gaya Hidup Sehat Beberapa waktu lalu pemenang L-Men of the Year 2013 AlbernSultandariSumateraUtara berkunjung ke Redaksi Harian Waspada. Kedatangan Albern Sultan yang didampingi Steven Wang dan Masudi dari Marketing Promotion Nutrifood Medan untuk mengkampanyekan gaya hidup sehat kepada para kawula muda khususnya remaja agar lebih memilih gaya hidup yang lebih sehat. Kunjungan Albern ke kantor Redaksi Harian Waspada diterima olehWakil Pemimpin Redaksi Sofyan Harahap, Humas AidiYursal, Redaktur Agenda Junaidi dan Redaktur Kesehatan Ayu Kesumaningtyas. Nutrifood Marketing Promotion Medan StevenWang mengatakan terpilihnya Albern Sultan sebagai pemenang L-Men of theYear2013,karenatelahmemenuhi beberapa kriteria yakni potensi untuk menjadi figur publik yang menginspirasi dan berkomitmen kuat menjalankan gaya hidup sehat, selain memiliki tubuh atletis dan berpenampilan menarik. Sementara itu Albern Sultan menjelaskan tentang pentingnya

Jenis-Jenis Tabir Surya Selain cara atau sarana pelindung alami seperti topi, payung dan sebagainya, kulit memerlukan perlindungan lebih dari pajanan sinar ultraviolet berbahaya tadi.Terlebih untuk orang dengan aktifitas lebih di bawah sinar matahari siang, ada bentuk kosmetik yang sejak dulu dikenal dengan sebutan tabir surya. Fungsi utamanya untuk melindungi kulit dari pajanan sinar ultraviolet melalui bahanbahan kimiawi yang terkandung di dalamnya. Dalam berbagai wujud variatif berupa krim, lotion hingga oles bibir (lipbalm) juga diperlukan dalam kondisi cuaca terlalu dingin namun dalam konten berbeda, tabir surya ini memiliki apa yang disebut dengan SPF atau Sun Protecting Factor yang berbeda-beda besarnya berdasarkan racikannya yang juga sangat variatif. Malah, dalamkepentingankosmetis,bahaninibiasanyadicampurkandengan berbagai macam bahan lain dan masih akan berbeda lagi untuk masing-masing bagian tubuh misalnya untuk wajah, tubuh dan sebagainya. Tabir surya buat wajah selain punya konten lebih mild, juga dilengkapi vitamin atau pelembab. Ada yang aman dan ada yang bersifat iritatif dan menentukan pemilihannya bagi jenis-jenis kulit yang berbeda. Pemilihan Tabir Surya Semakin tinggi SPF-nya, semakin tinggi daya perlindungannya, namun bukan berarti kita harus memilih paling tinggi karena semuanya harus disesuaikan dengan aktifitas, misalnya berapa lama kita terpajan sinar matahari ketika bekerja, berolahraga atau sekedar menikmati rekreasi. Cara perhitungannya, nilai SPF 15, 30 atau lebih melindungi kulit secara variatif berupa kelipatan waktu secepat

susu nutrisi untuk menyertai program fitnes. Susu nutrisi ini penting untuk mengoptimalkan pembentukan otot yakni protein. Susu nutrisi protein tinggi ini sangat bagus untuk memenuhi kebutuhan protein tubuh. Susu nutrisi protein tinggi sendiri mempunyai banyak macampilihan,bertujuanuntukmengoptimalkan pemenuhan nutrisi disesuaikan kebutuhan fitnes. Berikut ini jenis susu nutrisi protein tinggi untuk awal program fitnes. Sekilas ulasan untuk memberikan gambaran bagi pemulayangbarusajamenjalankan program fitnes. DijelaskanAlbern,dalammemulai latihan sebaiknya mempunyai berat tubuh ideal, artinya tidak kurus dan tidak gemuk. Karena, jika keaadaan tubuh gemuk atau kurus akan terfokus pada penyesuaianberattubuhsebelum membentuk otot. Ada tiga jenis susu nutrisi protein tinggi yang cocok untuk menambah nutrisi di awal program latihan yakni susu nutrisi protein tinggi basic formula dengan kandungan protein 12g/serving, dan memiliki rasa caramel macchiato. Kemudiansusunutrisiprotein

Waspada/Arianda Tanjung

Desk Agenda Junaidi berfoto bersama Albern Sultan di bumi warta Harian Waspada.

tinggi daily formula, dengan kandungan protein 12g/serving dan memiliki rasa dark chocolate. Selanjutnya suplemen basic formula dan daily formula dengan protein whey ini sangat cocok dipilih untuk menunjang program pembentukan tubuh atletis, karena memiliki keunggulan rendah lemak, tinggi protein whey (mendukung pembentukan tubuh atletis), serta diperkaya L-Carnitine (untuk mengoptimalkan pembakaran lemak menjadi energi). (m30)

apa kulit seseorang terbakar atau mengalami sunburn di bawah sinar matahari. Bila seseorang cenderung mengalami sunburn dalam waktu 10 menit dalam pajanan UV, maka sun screen atau sun block dengan nilai SPF 15 akan melindunginya selama 150 menit, kirakira seperti itu. Untuk sekarang, rata-rata yang paling dianjurkan SPF 30 ke atas kecuali aktifitas di bawah sinar matahari benar-benar minim. Berdasarkan kandungan bahan kimiawinya tadi, tabir surya juga dibedakan menjadi sun block dan sun screen. Beda yang sering takdiketahuibanyakorangsebenarnyaadapadasifatperlindungannya, dimana sun block memantulkan sinar UV secara fisik misalnya lewat bahan seperti zinc oxide atau titanium dioxide, sementara sun screen melindungi lewat sistem penyerapan sinar UV agar tak melukai kulit, misalnya lewat bahan-bahan seperti benzophenone cenderung lebih mudah menimbulkan iritasi. Pemilihannya berdasarkan kebutuhan seperti aktifitas dan jenis kulit, dimana sun screen lebih ditujukan untuk mencoklatkan kulit dan harus diulangulang pemakaiannya sementara sun block rata-rata lebih tebal bisa bertahan lebih lama. Dalam memilih jenis, kondisi kulitlah yang paling menentukan pemilihannya. Misalnya kulit berminyak sebaiknya memilih gel atau lotion, sementara berkulit kering atau beraktifitas lama dalam suhu ruangan dingin, sebaiknya bentuk krim. Untuk aktifitas luar seperti olahraga atau berenang ada pertimbangan lebih lanjut lagi untuk pemilihannya. Jangan lupa gunakan tabir surya paling tidak setengah jam sebelum memulai aktifitas di bawah sinar matahari karena penyerapannya ke dalam lapisan kulit juga memerlukan waktu. (dr. Daniel Irawan)



Pukat Udang Berukuran Kecil Bagian Dari Masa Lalu?


Pukat udang Udang


Fernandina Teluk Mexico


Jaring Jaring ditarik di bawah permukaan laut.


erruku ukk raan an Pukat udang ber berukuran ter da an panjang kira-kira 22 met meter dan beroperasi dengan tiga atau empat awak.

Menarik jaring

ukat udang seperti gambar di sebelah kiri masih merupakan pemandangan umum di sepanjang pantai Amerika, namun jumlahnya kini jauh lebih sedikit dibanding masa sebelumnya. Kapal nelayan kecil ini mulanya berasal dari Norwegia dan diimpor ke Amerika pada awal 1900-an untuk memenuhi tingginya permintaan pasar pada udang, diawali di Fernandina, Florida, kemudian menyebar di sepanjang pantai Atlantik sampai ke Teluk Mexico dan akhirnya ke barat daya Pasifik. Pada 1930-an lebih dari 90 persen konsumsi udang Amerika pers en k kon nssums ums msi m si ud u merupakan hasil m eerr tangkapan tta an ng g kapal-kapal jenis k apa ap a p pa Samudera Atlantik ini. in iini nii. n Kini kapal K Fl o r i d a seperti sep sepe p itu digunakan di d di digu g gu seluruh penjuru se elu dunia. duni Amerika Utara, Namun di Amer N persaingan dengan udang per rsaingan harga d impor, mahalnya bahan bakar dan perlengkapan, dan merosotnya infrastruktur mengakibatkan menurunnya jumlah nelayan udang komersial. Hanya sebagian kecil saja yang masih beroperasi saat ini. Ironisnya, yang masih bertahan sebagai nelayan udang hidupnya cukup makmur. Mungkin karena berkurangnya pukat udang.

WASPADA Minggu 25 Agustus 2013

Pelajar SMAN 14 Medan Peserta Karnaval Busana Daerah SISWA SMAN 14 Medan yang ikut serta saat karnaval busana daerah, pada perayaan HUT Kemerdekaan RI ke 68 Sabtu lalu, mengaku kegiatan itu bermanfaat buat mereka. Meski hanya berbusana daerah dan ikut pawai yang dilepaslangsungolehGubernur Sumatera Utara, Gatot Pujo Nugroho, tetapi kegiatan itu tetap memberikan kesan khusus pada siswa. Hal itu dsampaikan Putri Ayu Rizky dan Dedi Herman Simamorayangmenjadipeserta karnaval. Mereka menyubutkan, dengan kegiatan itu memWaspada/Anum Saskia buat mereka lebih paham tenSiswa SMAN 14 saat mengikuti kegiatan karnaval budaya dilepas Gubernur Sumatera Utara, tang makna budaya bangsa Indonesia yang cukup beragam. Gatot Pujo Nugroho pada 17 Agustus lalu, putri Ayu Rizky dan Dedi Herman Simamora mengenakan busana ada Jawa. Bahkandengankegiatanini mempermudah mereka untuk mengetahui seberapa besar aset budaya yang dimiliki oleh bangsa Kemerdekaan RI berlangsung setiap tahun. Hal ini menjadi kita, terutama busana adat daerah yang menggambarkan kebanggaan sekolah yang terpilih jadi peserta. Selain itu, Simajuntak mengatakan bahwa prestasi siswa di keberagaman suku di tanah air. “ Kami merasa bangga bisa disertakan dalam kegiatan ini, apalagi sekolah ini mengalami peningkatan dari program akademik dan peserta dari berbagai sekolah yang terpilih semakin menguatkan non akademik. Khusus untuk akademik, tahun ini siswa yang lolos kami bahwa pemerintah masih memberikan ruang pada pelajar jalur SNMPTN meningkat 20 persen. Selain itu dalam berbagai kegiatanlomba,pesertadarisekolahinibanyakmeraihkemenangan. untuk selalu mencintai khazanah adat budaya bangsa. Meskipun karnaval seperti ini digelar hanya setahun sekali,”kata Antaranya, juara 2, senam Pramuka Gubsu, juara 1 O2SN lari dua siswa yang aktif dalam berbagai kegiatan ekskul Paskibra di tingkat Sumut, juara 3 POR Kota Medan. “Semuaprestasisiswadidukungolehkinerjagurudandukungan sekolahnya. penuh dari kepala sekolah. Kedepan, sekolah kami yang dikenal Prestasi Meningkat dengan Paskibranya, akan terus membuat berbagai program Sebelumnya Kepala Sekolah Drs Guboan MPd bersamaWakil ekskul yang lebih mampu membangun kemampuan diri siswa Drs H Simajuntak MSi dan Lasma Rohani Siregar SPd menyebutkan, dalam bidang akademik dan non akademik,” paparnya. * Anum Saskia kesertaan siswa mereka dalam kegiatan karnaval budaya HUT

Bill Pitzer - • Copyright © 2013 The New York Times Syndicate

4 Siswa SMP Al-Azhar Ikuti Pelatihan OSIS EMPAT siswa SMP AlAzhar Medan didam-pingi seorang guru pembina mengikuti pelatihan OSIS Latihan Dasar Kepemimpinan (LDK) dan Motivasi Spritual atau pendidikan karakter yang diselenggarakan Dinas Pendidikan Provinsi Sumatera Utara di Hotel Innal Darma Deli Medan. Empat siswa yang mengikuti kegiatan tersebut adalah Raldo S Meilala, Bobby Ghafur, Shafany

Marwah, Adinda Dhita Putri, dan seorang guru pembina Ikhsanul Hidayat. Ikhsanul Hidayat mengatakan kegiatan yang digelar sejak tanggal 22 hingga 24 Agustus 2013 bertujuan agar siswa mampu menyusun struktur dan kegiatan keorganisasian, menerapkan sistem pendidikan karakter melalui menampilkan baik dari segi bertindak, bertingkah laku maupun dari segi berpakaian para pengurus OSIS.

Menurutnya ini juga bertujuan untuk memperkenalkan pengetahuan dan kemampuan tentang manajemen organisasi, dasar-dasar kepemimpinan serta pengendalian emosi dan spiritual ke sekolah. Menanamkan nilai-nilai demokrasi bagi siswa dan mengembangkan bakat serta kemampuan siswa di bidang politik, organisasi, dan kepemimpinan Mengembangkan strategi


Empat siswa SMP Al-Azhar dan bersama seorang guru pembina berfose bersama usai pelaksanaan kegiatan pelatihan OSIS Latihan Dasar Kepemimpinan dan Motivasi Sipritual atau pendidikan karakter di Hotel Innal Darma Deli Medan.


24 Agt – 23 Sep

SAA TNY SAATNY TNYAA memperhatikan tubuh kita yang dipaksa “kerja” setiap hari. Sayang, kan kalau ketinggalan momen seru di sekolah garagara sakit dan kecapekan. LO VE : Si dia lagi seperti prince charming. TH : Banyak istirahat. LUCKY Senangnya! HEAL HEALTH DA DAYY : Senin.


24 Sep – 22 Okt

SEP ER TINY SEPER ERTINY TINYAA kali akan jadi bulan yang menyenangkan untuk mulai belajar mengatur uang jajan sendiri, mumpung dompet lagi tebal. Hi hi hi .LO VE : Boleh manja TH : Jaga kesehatan bikin dan mesra, lho! HEAL HEALTH kita jadi terlihat lebih tanggung jawab. LUCKY DA DAYY : Kamis.


23 Okt – 22 Nov

penerapan pendi-dikan karakter yang terintegritas dalam kegiatan OSIS, LDK dan Motivasi Spititual, bagi Pembina kesiswaan SMP di Provinsi Sumatera Utara. Kegiatan dilaksanakan dalam bentuk pelatihan bagi biswa dan guru untuk menyusun model pelatihan di sekolah yang selanjutnya diimple-mentasikan di daerah atau sekolahnya masing-masing. Ikhsanul Hidayat mengatakan kegiatan ini sangat positif dan memberikan banyak manfaat sehingga nantinya dapat diterapkan dalam kegiatan keorganisasian siswa di sekolah. Dia berharap keempat siswa SMP Al-Azhar yang mengikuti kegiatan ini dapat menyerap ilmu yang dipelajari saat mengikuti pelatihan ini, khususnya menyangkut pengetahuan dan kemampuan tentang manajemen organisasi sehingga hal ini dapat menjadi modal dasar bagi siswa dalam menjalani kegiatan keorganisasian di sekolah seperti OSIS. Dengan demikian diharapkan dengan adanya pelatihan ini para pengurus OSIS khususnya siswa SMP Al-Azhar mampu menjadi contoh bagi siswa lainnya di sekolah dalam menerapkan motivasi sipritual atau pendidikan karakter nantinya. * Erzilmarkos


22 Des – 20 Jan


Wagubsu Ir H Tengku Erry Nuradi, M.Si.,menyempatkan diri berfoto bersama dengan siswa YPSA usai pelaksanaan upacara bendera yang berlangsung di sekolah ini Senin pekan lalu.

Menjadi Pemimpin Harus Dimulai Dari Diri Sendiri UNTUK meningkatkan prestasi sekaligus memotivasi belajar siswanya YPSA selalu memberikan arahan, bimbingan dan motivasi agar siswa terpacu untuk belajar lebih giat lagi. Salah satu cara untuk memotivasi siswanya belum lama mereka mengundang Wagubsu untuk memberikan motivasi dan semangat belajar kepada seluruh siswa YPSA pada kegiatan Upacara bendera yang berlangsung Seninpekanlaludilapanganhijau sekolah itu. Menjadi pemimpin dan mempunyai cita-cita yang tinggi harus dimulai dari dalam diri sendiri, mulailah cita-cita dari diri sendirikemudiandarilingkungan yang terkecil, memperbaiki diri terlebih dahulu dan menjadi contoh di lingkungan sendiri.


Karenauntukmenjadipemimpin yang besar harus dimulai dari yangkecil. Demikiandisampaikan Wakil Gubernur Sumatera Utara Ir H Tengku Erry Nuradi, M.Si., saat menjadi pembina upacara bendera, Senin(19/8)dilapangan hijau YPSA. Untuk mencapai cita-cita yang tinggi harus mempunyai landasanyangkokoh,makauntuk mencapai cita-cita yang tinggi tersebut mulai dari yang terendah sesuaidenganjenjangpendidikan seperti TK, SD, SMP dan SMA sebab ini landasan untuk mencapai cita-cita tersebut, karena itu jika ingin mencapai cita-cita yang diinginkan belajar lah dengan rajin dan tuntutlah ilmu setinggi-tingginya. “ Tidak ada istilah terlambat dalam menuntut ilmu apa lagi dalam usia keemasan seperti usia kalian saat ini. Saya yakin semua siswa-siswiYPSA ini merupakan calon pemimpin baik dalam keluarga maupun dalam pemerintahan atau instansi lainnya,

20 Feb – 20 Mar


paling tidak kalian adalah calon pemimpin dalam rumah tangga kalian nantinya, “ujar Wagubsu memberi motivasi kepada siswa. Wagubsu mengatakanYPSA merupakan salah satu sekolah terbaik di Kota Medan bahkan di Sumatera Utara untuk itu diharapkan siswa-siswiYPSA bisa menjadi contoh dan teladan bagi siswa di sekolah lainnya. Berikanlah contoh yang terbaik dan jangan sampai terlibat ke dalam kenakalan remaja atau segala bentuk perbuatan yang akan merusak moral dan mental generasi muda seperti narkoba. Menurut Wagubsu saat ini Sumatera Utara memiliki 17.000 lebih Narapidana (Napi) dan ini merupakan yang paling banyak di Indonesia. Dari 17.000 Napi tersebut 61 persen di antaranya merupakan tahanan kasus Narkoba. Untuk itu kita harus berusaha dengan segala cara untuk mengurangi jumlah tahanan tersebut termasuk tahanan kasus narkoba dengan cara mengajak 20 Apr – 20 Mei

ADA baiknya kalau sekarang kita mulai bikin back up plan untuk beberapa rencana jangka panjang kita. Supaya selalu semangat tiap saat. LO VE : TH Tetap jaga komunikasi dengannya, ya. HEAL HEALTH : Fokus sama beberapa kegiatan dulu, biar UCKY DA enggak kewalahan. LLUCKY DAYY : Sabtu.

MUSIM pancaroba seperti ini wajar kalau tubuh kita jadi gampang drop. Sedia paying konsumsi sayur – buah dan selalu jaga kebersihan. LOVE : Dia selalu siap sedia saat TH : kita sakit. Sweet. HEAL HEALTH Enggak boleh malas makan makanan sehat, ya. LUCKY DA DAYY : Jumat.

BANY AK banget adik kelas ANYAK lucu yang sebenarnya butuh bantuan dan panduan kita. Sekali-kali jadi kakak kelas yang ramah, boleh juga, nih. LO VE : Nembak adik kelas , why not? HEALTH : UCKY DA Perbanyak air putih biar tetap sehat. LLUCKY DAYY : Kamis.

SEMAKIN banyak kenalan, semakin besar juga kesempatan yang bisa kita dapatkan. LO VE : Enggak Cuma satu, nih, yang merhatiin TH : Udah kita. Ciee.. HEAL HEALTH saatnya mulai belajar jaga pola makan. LUCKY DA DAYY : Rabu.





23 Nov – 21 Des

BOLEH banget kalau mau belajar untuk mulai diet, selama tujuan utamanya adalah kesehatan. Banyak banget cara diet sehat yang bisa kita cari di internet. Yuk! LO VE : Mengambil risiko terlalu besar enggak selalu menjanjikan hasil maksimal, TH : Tertarik ikutan yoga atau latihan lho. HEAL HEALTH meditasi? Coba deh. LUCKY DA DAYY : Rabu.

21 Jan – 19 Feb

KOMPETITIF sama teman? Asal dengan cara yang baik, kenapa enggak. Berjuang demi jadi yang terbaik itu bagus, lho. LO VE : Coba pikirkan ide nge-date yang TH : Terlihat kreatif. HEAL HEALTH lebih cantik dengan wajah yang segar. Ihiy! LUCKY DA DAYY : Selasa.

21 Mar – 19 Apr

WAJIB luangin waktu untuk janjian main sama mama papa. Akhir minggu ini sepertinya pas buat dihabiskan sama mereka. LO VE : Romantisnya dinner TH : di halaman belakang rumah kita. HEAL HEALTH Enggak sia-sia merawat kulit. Jadi lembut dan berkilau! LUCKY DA DAYY : Senin.

21 Mei – 21 Jun

ASYIKNY ASYIKNYAA bisa bertemu banyak orang dan dapat pengalaman seru gara-gara satu petualangan baru. Yuk bertualang lagi! LO VE : Teman baru kok banyak yang cute, ya? He he TH : Sehat semangat! LLUCKY UCKY DA he. HEAL HEALTH DAYY : Minggu.

teman-temannya untuk tidak terlibat dengan barang haram tersebut. Upacara bendera yang berlangsung di tengah hujan gerimis tersebut diikuti seluruh siswa YPSA mulai dari SD, SMP, dan SMA dan turut dihadiri Kadis pendidikan Sumut M Zein, Kadis Infokom Drs Jumsadi Damanik, SH, M.Hum, PembinaYPSA Drs. H. Sofyan Raz, Ak.M.M., Ketua Umum YPSA Hj. Rahmawaty Sofyan Raz, Sekretaris Umum YPSA Hj. Rizki Fadilah Raz, M.Psi.Psikolog., Ketua Harian YPSA Addaratul Hasanah, S.Sos., S.Pd., Kepala PG/TK, SD, SMP, SMA YPSA dan orang tua siswa. Usai upacara Pembina Drs. H. Sofyan Raz, Ak.M.M., menyematkan PIN kehormatan YPSA sekaligus menyerahkan buku biografi Sofyan Raz membangun generasi emas kepadaWagubsu Ir H Tengku Erry Nuradi, M.Si dan pemberian cendramata oleh Ketua Umum YPSA Hj. Rahmawaty Sofyan Raz. * Erzilmarkos


22 Jun – 23 Jul

MENCOBA untuk menghargai orang sekitar, bisa bikin kita jadi belajar menghargai diri kita sendiri. LO VE : Tenaaang, dia TH : sayang kita, kok. HEAL HEALTH Buah-buahan bagus buat dijadiin sahabat baru. LUCKY DA DAYY : Jumat.


24 Jul – 23 Agt

ENGGAK perlu takut untuk bikin satu keputusan yang berpengaruh besar sama keseharian kita. Pasti bakal bikin hari-hari kita jadi enggak monoton. LO VE : TH : Coba Ada yang ngerasa dicuekin tuh. HEAL HEALTH UCKY DA stretching setiap mau tidur yuk. LLUCKY DAYY : Minggu. **m31/ KW

WASPADA Minggu 25 Agustus 2013

B9 Remaja Paskibra SMKN 9 Semakin Eksis BERLATIH selama sebulan sembari melaksanakan ibadah puasa, semakin memperkuat rasa percaya diri siswa SMKN 9 Medan, untuk tampil lebih baik saat detik-detik HUT Kemerdekaan RI ke 68 Sabtu lalu.

Agar Tetap Konsentrasi Saat Belajar BANYAK di antara kita yang merasa rajin belajar, tapi tidak memperoleh nilai bagus di sekolah. Alasan umum mengapa hal tersebut bisa terjadi adalah tidak bisa berkonsentrasi saat belajar, sehingga daya penerimaan atau pemahaman suatu mata pelajaran menurun. Contohnya tidak bisa konsentrasi saat belajar adalah ketika memahami suatu materi dengan membaca secara seksama dan berulang-ulang atau mencoba menghafal, tetapi sering kali merasa tidak memahami maksud dari materi tersebut. Beberapa hal yang dapat menyebabkan tidak bisa atau penurunan konsentrasi saat belajar, seperti cara belajar yang salah mengantuk, malas, sedang ada masalah, letih, banyak kegiatan, kurangnya nutrisi pada otak dan lain sebagainya. Jika mengalami kesulitan dalam berkonsentrasi belajar dan dibiarkan secara terus-menerus, bukan hanya dapat mengakibatkan penurunan prestasi akademik, tetapi juga akan berdampak pada masalah kejiwaan seperti, depresi, mudah panik, minder atau kurangnya rasa percaya diri dan lain-lain. Berikut Merupakan Cara Agar Tetap Berkonsentrasi Saat Belajar Istirahat yang cukup dapat membantu otak kita untuk relaksasi dari ketegangan yang terjadi sehari-hari. Sehingga saat kita belajar, otak dapat merespon suatu pemahaman materi dengan lebih cepat. � Lakukan cara belajar yang benar. Kebanyakan dari kita belajar dengan sangat giat, ketika menjelang ujian yang sering disebut Sistem Kebut Semalam (SKS). Sedangkan pada harihari biasanya jarang melakukan kegiatan belajar. Sehingga tekanan pada otak akan berlipat ganda ketika melakukan SKS, dan hal ini akan menurunkan kosentrasi saat belajar. Sebaiknya membuat jadwal belajar secara rutin, dengan jangka waktu 1-3 jam setiap harinya. � Musuh terberat kita saat belajar adalah rasa malas. Rasa malas dapat datang kapan saja sebagai penghalang kita untuk mendapatkan nilai bagus atau prestasi yang lain. Selain itu, juga dapat menurunkan daya konsentrasi belajar, maka sebaiknya jika rasa malas mulai datang segera pacu semangat belajar kita. � Lakukan latihan fisik untuk memulihkan kebugaran tubuh. Sebab dengan tubuh yang segar dan sehat dapat membantu kita dalam berkonsentrasi belajar. Menurut penelitian, berjalan kaki juga dapat meningkatkan daya konsentrasi kita. � Makan makanan yang bergizi dan bernutrisi yang baik untuk otak. Biasanya makanan yang mengandung lechitin, asam lemak esensial, protein, DHA, vitamin B12, vitamin B6, asam float dan lain sebagainy. Kandungan tersebut dapat diperoleh dari kuning telur, ikan salmon, teh hijau, blueberry, gandum, biji labu dan sebagainya.( ER) �

Keseriusan anggota Paskibra saat upacara bendera terlihat dari formasi barisan dan kedisiplinan mereka mengikuti upacara. Demikian antara lain disampaikan Kepala SMKN 9, Sakti Siregar MPd,disela kegiatan siswa yang menyemarakkan HUT Kemerdekaan RI dengan beragam kegiatan. Usai upacara pengibaran bendera merah putih, sambung Sakti Siregar didampingi Drs Kaswardi selaku wakil bidang kesiswaan, para siswa mengikuti berbagai kegiatan lomba tradisional. Ada lari dalam goni, lari dengan terompah, lari membawa guli dalam sendok dan permainan lainnya. Menurut Sakti, dengan digelarnya berbagai perlombaan tradisional ini, diharapkan menumbuhkan rasa cita siswa terhadap beragam budaya Indonesia, termasuk aneka permainan yang perlu dilestarikan.

“Permainan tradisional semakin langka, dengan melestarikannya diharapkan semakin memupuk kecintaan siswa pada beragam budaya bangsa. Apalagi saat ini kemajuan teknologi yang mudah diakses semakin mempermudah siswa untuk bermain game sesuai keinginan mereka. Padahal permainan tradisional itu mempunyai makna yang cukup baik untuk anak saling berinteraksi dengan temannya, saling berkomunikasi dan kordinasi yang baik dalam membentuk kekutan tim yang solid, seperti dalam permainan berjalan dengan terompah yang mengikat kaki antar pemainnya. Kesabaran peserta juga diuji dalam permainan memasukkan paku dalam botol. Cara yang tepat untuk memastikan apakan siswa punya kesabaran atau tidak saat memasukkan paku dalam botol yang terbilang sulit,” ujarnya.

PARA siswa SMKN 9 saat upacara bendera HUT Proklamasi Kemerdekaan RI ke 68. Hal yang sama disampaikan Kaswardi bahwa siswa di sekolah itu, sangat berminat dengan beragam

atraksi lomba tradisional, meskipun saat ini permainan modern sudah merajai pasar, namun permainan

tradisional yang sarat dengan makna harus tetap diprioritaskan. Walau sifatnya hanya tahunan, tetapi upaya

Waspada/ Anum Saskia

untuk melestarikannya sudah ada. Anum Saskia


Dimeriahkan Berbagai Perlombaan PERINGATAN HUT Ke68 RI di Madrasah Aliyah Negeri (MAN) 1 Jl. Willem Iskandar Medan Estate, Sabtu (17/8) dimeriahkan dengan berbagai perlombaan oleh para siswa/i. Humas MAN 1 Medan Drs. Hamdah Syarif mengatakan, adapun perlombaan tersebut meliputi menghias, kebersihan, keindahan kelas, kemudian membuat nasi tumpeng, kue dan minuman, lari bawa guli dalam sendok, lari goni, lari estafet. Dalam kesempatan itu dilaku-kan pelantikan pengurus eskul (ekstra kurikuler) antara lain pramuka, Jerman Club, Dumband, Engslih Club, Paskibra, Aerobic Club, Palang Merah, OSIS, Dokter Remaja, Tarung Drajat, Teathter, KKD dan pengurus sepakbola MAN 1. Serta pemberian piagam penghargaan kepada guruguru yang berdedikasi tinggi. Kepala MAN 1 Medan Dr.H.Burhanuddin,MPd membacakan amanat Gubernur Sumut mengatakan, pencapaian cita-cita mulia tersebut terus

menerus diperjuangkan meskipun bangsa kita dihadapkan pada berbagai ancaman dan tantangan. Demikian juga halnya terhadap rasa nasionalisme dan kebangsaan dan mulai bergesernya nilai budaya yang dijunjung tinggi bangsa Indonesia. Peringatan hari kemerdekaan perlu kita jadikan sebagai energi baru untuk memompa semangat kebangsaan dan nasionalisme. Mari kita tumbuhkan kembali rasa cinta tanah air dan bangsa yang perlahan mulai pupus tergerus globalisasi, paparan teknologi dan budaya modern. Rasa nasionalisme dan kebangsaan penting dan harus diprioritaskan karena sangat berpengaruh terhadap kehidupan berbangsa dan bernegara. Berbagai persoalan yang kita hadapi saat ini, seperti kenakalan remaja, maraknya penggunaan Narkotika dan terorisme sebenarnya tidak jauh dari akibat tergerusnya sikap kebangsaan dan nasionalisme. Penampilan dan pola

piker banyak anak-anak muda saat ini dipengaruhi oleh paparan budaya asing. Memang tidak semua yang datang dari budaya luar bersifat negatif dan berdampak buruk pada identitas nasional kita. Namun harus diakui bahwa kecenderungan konsumtif terhadap apa yang dating dari luar dan secara tidak disadari ikut mengaburkan rasa nasionalisme dan kebangsaan masyarakat generasi muda. Kearifan lokal, budaya ketimuran yang mengandung nilai-nilai luhur kemudian menjadi kurang mendapat perhatian dan cenderung ditinggalkan. Inilah yang menjadi pangkal terkikisnya identitas nasional kita. Secara budaya, identitas asli kita sebagai bangsa yang besar kian memudar, kebersamaan dengan itu rasa kebangsaan pun terkikis. Maka persoalan rasa kebangsaan dan nasionalisme kita sebenarnya adalah masalah yang tidak sederhana namun sedemikian kompleks. “Kita kagum dengan pelaku sejarah, pejuang kemerdekaan yang memiliki


SISWA/I MAN 1 Medan yang tergabung dalam Paskibra pada peringatan HUT Ke-68 Proklamasi RI di halaman sekolah tersebut Jl.Willem Iskandar Medan Estate, Sabtu (17/8). rasa nasionelisme yang kuat karena ditempa pengalaman fisik dan psikologis. Namun itu berbeda dengan generasi baru saat ini yang secara

psikologis dan fisik tidak pernah mengalami langsung perang kemerdekaan. Oleh karena itu, pembentukan karakter dan nilai wasasan

kebangsaan serta nasionalisme perlu terus menerus kita tumbuh kembangkan di jiwa generasi penerus,” tegasnya. H.Suyono

Pembina YPSA Hadiri Upacara Peringatan HUT Ke-68 RI Di Istana Negara


20 Mahasiswa Fakultas Ekonomi program Studi Manajemen Universitas Dharmawangsa berfose bersama usai pelaksanaan yudisium yang dilaksanakan di aula kampus itu belum lama ini.

Sarjana Harus Mampu Kembangkan Ilmu Yang Dimilikinya SEORANG sarjana harus bisa mengembangkan kemampuannya, karena hanya mereka yang terampil yang bisa berkreativitas yang mampu bersaing dalam dunia kerja yang akan terpakai di era globalisasi seperti sekarang ini. DemikiandisampaikanKetua Penguji Sahnan Rangkuti, SE, MAP melalui sekretaris yayasan Dra H Farida Hanum Nasution usai pelaksanaan sidang meja hijau (yudisium) 20 mahasiswa Fak. Ekonomi program Studi Manajemen Universitas Dharmawangsa yang juga dihadiri Cut Zahri, SE,M. Si, dan anggotanya Syamsul Rizal, SE, Dra Hj. Rohani Gultom, M. Si, H. Edi Sofuan, SE,

M. Si, Dr H Yuris Danilwan, SE, M. Si, Drs Zulkarnain Adi, M. Si. Menurut Sahnan, seorang sarjana tidak hanya berpuas denganilmuyangdidapatselama masa kuliah, akan tetapi mereka harus mampu mengembangkan ilmu pengetahuan tersebut hal ini sangat diperlukan dalam menghadapi problema dan dilema kehidupan masyarakat pada era globalisasi yang tidak hanya menuntut keahlian saja, tetapi juga keberanian, ketrampilan, kearifan dan integritas kepribadian. Apalagi di era globalisasi ini telah terjadi pergeseran nilai-nilai sosial dalam masyarakat, karena itu pendidikan mengenai etika

hendaklah menjadi perhatian khusus bagi kita, sebab ilmu pengetahuan dan keterampilan yang dimiliki tanpa dilandasi etika akan menjadi bumerang bagi almamaternya. Pada kesempatan itu Sahnan juga mengucapkan selamat kepada para peserta yang berhasil menyelesaikan studinya khusus pada yudisium ini di mana semua siswa yang mengikuti yudisium kali berhasil mendapatkan nilai sangat baik. Sahnan berharap semoga ilmu yang diperoleh dapat diterapkan di dunia kerja dan bermanfaat bagi masyarakat. Selain itu yang terpenting adalah dimanapun nantinya kalian

ditempatkan atau bekerja jangan lupa tetaplah menjaga nama baik almameter dan tetap menjaga sikap mental terpuji. 20 Mahasiswa yang di yudisiumadalahSudirmanYunus, Sartika Aniza, April Leni Rangkuti, Ayu Saharany, Budi Wati, Nina Junaini, Candra Gunawan, Sity Kumala Dewi, Beby Silvia Tambunan, Edri Usman, Beby CanCena,IbnuRachmanmZefry Arie Sandy,Arif Fadillah Nasution, Uci Apreasnely, Agustina Simatupang, Elvy Rahmayana Lubis, Didi Hariansyah, Masitah, Lindawati Br. Karo. Keseluruhan peserta lulus dengan nilai dengan pujian. Erzilmarkos

EKSISTENSI YP. Shafiyyatul Amaliyyah (YPSA) sebagai salah satu sekolah Islam berstandar internasional mulai diakui di Indonesia. Kerja keras dan usaha yang dilakukan segenap pembina dan pengurus yayasan selama ini mulai membuahkan hasil. Hal ini terbukti dengan diundangnya Pembina YPSA H Arisyi Fariza Raz, M.Sc., dan Bendahara Umum YPSA H. Hizrian Fathullah Raz, B.Com., S.E, M.Sc., untuk menghadiri Upacara Peringatan HUT Kemerdekaan ke-68 Republik Indonesia di Istana Negara Jakarta pada 17 Agustus yang lalu. “Ini merupakan sebuah pengalaman berharga bagi saya dan dapat dijadikan momen untuk meningkatkan rasa cinta kepada tanah air ini. Di sini saya dapat menyaksikan paduan suara anak-anak menyanyikan lagu-lagu wajib dan medley lagu daerah serta fly pass empat pesawat tempur milik TNI Angkatan Udara masingmasing dua Sukhoi dan dua F-16”, ujar H. Arisyi Fariza Raz, M.Sc. Arisy Fariza menjelaskan dengan diundangnya Pembina YPSA untuk mengikuti kegiatan upacara bendera memperingati HUT kemerdekaan RI ke 68 di istana negara ini merupakan suatu kebanggaan bagi YPSA. “Ini sangat membanggakan dan ini berarti eksistensi YPSA

sebagai sekolah Islam internasional yang berasal Medan sudah diakui di Indonesia dan kita berharap beberapa tahun ke depan YPSA lebih mampu menunjukkan serta mengembangkan eksistensinya di dunia internasional,” ucapnya. Sementara H. Hizrian yang juga ikuti bersama H Arisy Fariza mengatakan, bahwa upacara Peringatan

HUT Kemerdekaan ke-68 RI di Istana Negara berlangsung khidmat. Upacara dipimpin langsung oleh Presiden Susilo Bambang Yudhoyono didampingi Ibu Negara Ani Yudhoyono beserta Wakil Presiden Boediono beserta Ibu Herawati Boediono. Hadir juga para menteri, duta besar negara sahabat, tokoh agama dan tokoh nasional. Peringatan detik-detik

proklamasi berlangsung sekitar pukul 10:00 ditandai pembacaan teks proklamasi oleh Ketua DPD RI Irman Gusman dan pengibaran duplikat bendera pusaka oleh 66 anggota Paskibraka. Bertindak selaku komandan upacara Kolonel Penerbang Ronald L Siregar, lulusan Akademi Angkatan Udara tahun 1992 yang kini menjabat Dosen AAU. Erzilmarkos


PEMBINA Muda YPSA H Arisyi Fariza Raz, M.Sc., dan Bendahara Umum YPSA H. Hizrian Fathullah Raz, B.Com., S.E, M.Sc., usai menghadiri upacara peringatah HUT ke-68 RI di Istana Negara.



WASPADA Minggu 25 Agustus 2013

Mengukur Batas Imajinasi Pengarang Oleh: Yulhasni


EBUAH ungkapan menarik datang dari pengarang ternama Teri Liye saat menjelaskan tentang novelnya berjudul ‘’Hafalan Shalat Delisa.’’ Dikatakan bahwa ketika karya ini diciptakan, si pengarang sama sekali tidak pernah mengetahui atau datang ke setting dari novelnya tersebut. “HafalanShalatDelisa”adalah novel yang bercerita tentang tsunami di bumi Serambi Mekkah, Aceh. Teri Liye sama sekali tidak hadir ke Aceh dan tidak menyaksikan langsung kedahsyatan air yang meluluhlantakkan Aceh. Namun novel ini laris manis dan sudah diangkat ke layar lebar. Teri Liye berimajinasi tentang sebuah peristiwa melalui pembacaan yang intensif atas sebuah lokasiatauperistiwa.Salahseorang pengarang dari Forum Lingkar Pena (FLP) bernama Muthamainnah pernah membuat cerpen tentang perjuangan orang-orang Palestina menghadapi agresor Israel. Si pengarang sama sekali tidak pernah ke Palestina dan ia mengarang hanya berdasarkan pembacaan yang intensif juga. Bagaimanakah kita mengukur imajinasi pengarang atas sebuah peristiwa? Dunia pengarang memang selalu identik dengan imajinasi. Daya hayal merupakan modal besar bagi seorang pengarang untuk menghadirkan realitas ke atas teks wacana bernama novel. Pengarang futuristik sering membuat cerita tentang sebuah dunia yang belum hadir. Penulis skenario film futuristik bahkan mampu menghadirkan sebuah

teks meski realitasnya tidak pernah hadir dalam dunia nyata. Novel adalah karya fiksi. Karena bentuknya fiksi maka pengarang dibebaskan berimajinasi tentang apa, siapa, di mana, kenapa dan bagaimana. Meski dibeberi kebebasan mutlak, namum imajinasi tetaplah terikat oleh realitas yang sebenarnya. Pada kasus karya futuristik imajinasi bisa bebas tanpa ikatan karena tidak seorang pun pernah menghadapi realitas itu sebelumnya. Sederhananya, ketika pengarang menciptakan karya fiksi dengan setting tahun 3.000-an, tidak akan ada seorang pun bisa membantahrealitastekstersebut. Alasan sederhana karena belum satu pun orang yang membaca karya itu hidup di tahun 3.000an untuk kembali ke tahun penciptaan karya. Imajinasi yang bebas pada diri pengarang di luar karya futuristik akan mudah dikritisi meski novel adalah karya fiksi. KetikaTeriLiyemenciptakannovel di atas, tentu saja dia tidak akan ke luar dari fakta-fakta yang sesungguhnya. Imajinasinya tentang tokoh, alur, maupun setting tetap dibatasi oleh beberapa fakta yang sesungguhnya tentang peristiwa tsunami tersebut. Oleh

karena itulah, seorang pengarang tidak bisa berimajinasi dengan sebebasnya meski dalam bentuk fiski sekali pun. Andrea Hirata menciptakan “Laskar Pelangi” dengan setting bumi Belitong. Ada pertanyaaan besar muncul apakah novel tersebut fiksi atau narasi sejarah yang dialami seorang pengarang? Itulah perbedaan yang mendasar antara fiksi dengan laporan jurnalistik. “Laskar Pelangi” tetaplah karya fiksi meski setting novel adalah realitas yang dipindahkan pengarang ke dalam teks novel. Kekuatan“LaskarPelangi”karena

AndreaHiratakarenadiamampu merekam realitas untuk kemudian dipindahkan ke dalam fiksi yang dinikmati pembaca sebagai sebuah narasi sejarah pendidikan di bumi Belitong. Sebuah novel menjadi kuat ketika pengarang mampu membawa imajinasi pembaca ke dalam teks yang dibacanya. Barangkali sedikit kita mengenal nama Belitong sebelum novel best seller tersebutmunculdalamkhazanah sastra Indonesia. Pertanyaan kemudian apakah imajinasi Andrea Hirata terikatolehrealitassesungguhnya dari bumi Belitong? Tentu saja

si pengarang sangat terikat karena dia tidak bisa keluar dari batasan-batasan itu. Jika Belitong terkenal dengan hasil timahnya, maka pengarang tidak bisa berimajinasi dengan menukarnya dengan pabrik emas atau yang lain. Jika itu terjadi maka si pengarang dinilai telah mengabaikan fakta sesungguhnya. Itulah sebabnya dalam kajian Wacana Kritis, sebuah karya yang lahir dari realitas sesungguhnya akan mudah didekati daripada imajinasi manipulatif pengarang tentang sebuah realitas. Norman Fairclough, salah seorang teoritisi Critical Discourse Analysis (CDA)

mengemukakan bahwa hubungan antara teks dan struktur sosial dimediasikan oleh konteks sosial wacana. Kita mengetahui bahwa struktur sosial dalam beberapa teks sastra Indonesia masih menekankan imajinasi manipulatif. Beberapa karya pengarang Indonesiamencobamenguraibenang merah antara realitas sosial ke dalam teks sastra. Kita menyebut beberapa diantaranya novel “Ladang Perminus” karya Ramadhan KH yang mengurai kasus korupsi di Pertamina di era Orde Baru, kumpulan cerpen “Leontin Dewangga” karya Martin Aleida yang mengangkat realitas kekerasanterhadapgolongankiri. Atau novel karya pengarang Sumatera Utara seperti “Pincalang” karya Idris Pasaribu tentangnelayanpesisirBaratyang dikalahkan kapitalisme pukat harimau, dan realitas sejarah orang kuli kontrak di Sumatera yang diuraikan Emil W Aulia dalamnovelnya“Berjuta-jutadari Deli.’’ Batasan imajinasi pengarang dapat diukur ketika realitas sesungguhnya mampu dipindahkan ke dalam teks sastra dengan tetap berpedoman kepada faktafaktayangtidakbisadimanipulatif. Pengertian ini akan memudahkan kita untuk mendefenisikan sebuahkonsepbahwakebabasan imajinasi dibatasi oleh realitas sesungguhnya dari fakta dan struktur sosial. *Penulis Dosen FKIP UMSU dan Bergiat di Komunitas Diskusi Sastra FOKUS UMSU

Mengapresiasi Cerpen Waspada Juli 2013 Oleh: Mihar Harahap CERPEN“Zahra Haima Fata” karya Taura Al-Qalami,“KidungKidung Alam” karya DiraWulandari,“LantunanDzikirdiTerminal Tua” karya Maufiqurrahman Surahman dan “Ramadhan Terakhir” karya Latifah Harahap, telah mengisi ruang Cemerlang harian Waspada, Juli 2013. Keempat cerpen pemula ini memiliki kekuatan dan kelemahan sendiri-sendiri. Begitupun, sebagaimana biasa, saya mengapresiasinya. Dimulai dari cerpen “Ramadhan Terakhir” karya Latifah Harahap. Kebetulan saya lebih mengenal namanya sebagai pemuisi. Kalau cerpen ini bisa jadi panutan,makamenurutsayalebih lumayan puisinya, walaupun masih perlu pendalaman. Karena itu, saran saya kepada para pemula, termasuk si Latifah, lebih baik fokus dan eksis dulu pada salah satu karya sastra. Setelah mapan dan diperhitungkan, baru ke yang lain. Cerpen ini menceritakan Bambang (anak) yang tega tak mengabulkanpermintaanibunya yang ingin bermukena baru pada Ramadhan ini. Sementara permintaan Narti (istri) membeli

baju baru, segera dipenuhi. Jadi, ia pilih kasih, tak tahu balas budi. Begitupun, ibu tetap mendoakan kebahagiaan anaknya. Tiba-tiba, ibumeninggalbersamakeinginannya. Barulah Bambang dan Narti sadar, lalu merasa menyesal. Saya kira cerpen ini biasabiasa saja. Malah kelemahannya lebih dominan. Pertama, pemakaianbahasadantandabacayang tidak efektif/tidak tepat. Contoh, paragraf pertama cerpen ini dan banyak lagi. Kedua, ceritaya berulang-ulang,ibumemintadan anak tak memberi tanpa alasan/ perubahan signifikan. Ketiga, karakteistik pelaku terasa kaku, belum terbangun. Keempat, tak ada tanda-tanda akan kematian sang ibu. Cerpen kedua “Kidung-KidungAlam”karyaDiraWulandari. Saya baru mengenal namanya. Kedengaran judulnya manis, melankolis, tetapi terasa gagahgagahan atau supaya keren saja. Semestinya judul harus berkaitan atau mencerminkan isi cerita, meskipun judul bersifat umum/ abstrak, sedangkan isi cerita bersifat khusus/konkrit. Boleh bermakna konotatif, tetapi tidak sekadar dikait-kaitkan supaya

terkait. Terus terang, saya mengakui kekuatan cerpen ini terletak pada detil cerita. Malah mungkin atau sering kedapatan para pecerpen mengabaikan hal ini –entah apa alasannya –tetapi bagi Dira justru menarikperhatiannya.Sadaratau tidak,manfaatnya,setidaknyadua hal. Pertama, bahwa pecerpen benar-benarmenguasaiapayang dibicarakannya. Kedua, dapat mengarahkan pembaca kepada satu suasana yang diharapkan. Sayangnya, cerpen ini tidak memiliki fokus. Akibatnya, tema dan amanat yang disampaikan itumenjadikurangterarah.Dalam cerpen ini, tak jelas, apakah penekanannya kepada tradisi berkumpul di rumah kakek-nenek pada tiap puasa pertama Ramadhan. Atau mengenang kedua orangtua Saras yang meninggal dunia akibat kecelakaan pesawat saat pergi haji. Ataupun mengingat keteguhan kakeknenek mengasuh cucunya. Sebenarnya pecerpen — sebagaimana penovel –dalam lingkup terbatas dapat saja mengembangkanceritakemanasaja asal tidak menyimpang dari fokus cerita dan tidak molor atau kendor dari jalan ceritanya. Akan tetapi fokus cerita sebagai pusat perhatian untuk menajamkan tema dan amanat, mutlak harus

ada. Karena itu, kalau fokus cerita dapatdiungkapsecaradetil,maka cerpen akan menjadi lebih baik lagi. Cerpen ketiga “Lantunan Dzikir di Terminal Tua” karya Maufiqurrahman Surahman. Saya terkesan dengan cerpennya terdahulu,kalautaksalahberjudul “Final Call” (dimuat Waspada, Juni 2013 dan telah diapresiasi Juli 2013 ). Kesan saya, lebih menominasikan cerpen itu ketimbang cerpen ini. Bukan soal tema, amanat dan seting cerita, melainkan karena teknik pengungkapannya yang lebih mengena. Cerpen ini menceritakan ‘aku’,anakpesantrenyangmerasa tertarik melihat Pak Imin (bekas supir angkot) bertindak aneh. Dengan badan dan pakaian tak terurus,iaasyik mengutipirimbun daun yang jatuh dari pohonnya, lantasmemasukkannyakedalam kantong plastik. Hal ini dilakukan bertahundimushollaterminal,sejak ia ditinggal anak dan istri sebagai akibat tak peduli keluarga karena di ambung laku maksiatnya. Begitulah lelaki bila sudah berduit, tak terkecuali supir angkot. Terminal angkot malah menjadi sarang bermain perempuan, perjudian, dan mabukmabukan. Apalah arti musholla berdiri di situ? Rupanya, anak dan istri tak tega melihat derita Pak

Imin, lalu ingin menjemputnya. Sayang, ia keburu meninggal dunia. Demikian cerita seorang nenek beberapa hari kemudian yang datang pada’ku’ secara gaib di terminal itu. Kekuatan cerpen ini terletak pada detil cerita, sebagaimana cerpennya terdahulu. Terkadang pecerpen hanya bisa menyusun cerita tetapi sayang tak mampu menguasai detil ceritanya. Akibatnya cerpen terasa kaku, dangkal dan tak mencair. Di antara plot ada saja lubanglubang menganga hingga sangat mengganggu pengembaraan pembaca. Dalam cerpen ini, lubang-lubangitutertutupi,meski tidak seluruhnya. Kelemahannya terletak pada dua hal. Pertama, ‘aku’ sebagai anak pesantren tidak istiqomah menunjukkan tobat yang benar pada Pak Imin. Padahal peluang bahkantantangansudahdidepan mata untuk segera dijawab. Kedua,perubahansuasanaislami di terminal terlalu dipaksakan hanya karena meninggalnya Pak Imin secara tiba-tiba. Betapa sulit menerima hal ini secara logika, lalu kematian tanpa tanda-tanda. Cerpen keempat “Zahra Haima Fata” karya Taura Al-Qalami, pecerpen yang baru saya kenal namanya. Cerpen ini menceritakan perjuangan pasangan

suami-istri dalam menanti kelahiran anak pertama. Dimulai dari Rifala menahan sakit bak tanda akan melahirkan. Lalu, pergi ke rumah bersalin naik bis umum berjarak tiga jam dari rumah. Kemudian melahirkan dengan selamat walau harus melalui operasi caesar. Tak cuma itu, menurut keterangan dokter, bayi harus mendapat pelayanan khusus karena terminum cairan. Cerpen berakhir, setelah lima tahun kemudian, tatkala pecerpen ingin mengambil hikmah dari perjuangan Ramanta-Rifala bahwa kasihsayang,cintadandoaadalah obat dari segala penyakit dan diagnosa.Terbukti kalau Zahra Haiman Fata, gadis mungil yang sangat jelita dengan tingkat kecerdasan di atas seusianya. Menurut saya, cerpen ini dianggap baik. Begitupun, tentu adapulakurangnya.Memangpecerpen bukan dokter, tetapi dia harus tahu apa, bagaimana, dan akibatnya, kalau pelaku ceritanya mengalami operasi caesar, terminum cairan, dan lainnya. Caranya, membaca buku kedokteran atau dialog dengan dokter. Lalu,menutuptiapbagiancerpen tidak tepat, kecuali bagian akhir saja.Jadisebaiknya,janganditutup. * Penulis adalah Kritikus Sastra Indonesia di Sumut

Catatan Budaya

Kemerdekaan Oleh: S Satya Dharma BUNG, harus diakui, saat ini semangat kebangsaan pada sebagian besar masyarakat Indonesia mengalami degradasi yang cukup mengkhawatirkan. Situasi ini diperparah dengan ketidakberdayaan para pemimpin bangsa dalam menyikapi pelecehan kultural, sosial, politik, dan ekonomi oleh negara lain sebagaimana yang dicontohkan dalam kasus klaim Malaysia terhadap sejumlah pulau dan warisan budaya Indonesia, beberapa waktu lalu. Degradasi semangat kebangsaan dan ketidakberdayaan para pemimpin itu adalah dua hal yang harus menjadi renungan utama bangsa Indonesia dalam memperingati Hari Ulang Tahun Kemerdekaan RI ke-68 di tahun 2013 ini. Maka, apapun tantangannya, bangsa Indonesia tetap berkewajiban untuk mempertahankan kedaulatannya, mengembalikan jatidiri dan martabatnya, serta meneguhkan marwah dan kehormatannya sebagai bangsa yang besar, khususnya di kawasan AsiaTenggara. Oleh karena itu, peringatan HUT Kemerdekaan RI kali ini haruslah menjadi momentum untuk mengembalikan semangat kebangsaan tersebut. Sebab, diakui atau tidak, bangsa Indonesia saat ini sedang terkotak-kotak pada kepentingan-kepentingan lokal, kelompok, daerah,suku,etnis,danbahkanagama.Tragisnya,ditengahkondisi sepertiitu,tidakbanyakpemimpinbangsa,baikditingkatnasional maupun lokal, yang mampu mendorong tumbuhnya kembali semangat kebangsaan, kesatuan, dan persatuan sebagaimana yang diamanatkan oleh Pancasila dan UUD 1945. Itulah sebabnya ketika Majelis Permusyawaratan Rakyat Republik Indonesia (MPR RI), sesuai amanat Undang Undang Nomor 27 Tahun 2009 dengan gencar melakukan gerakan pemasyarakatan (sosialisasi) mengenai Pancasila, UUD 1945, NKRI,danBhinnekaTunggalIkasebagai“empatpilar”kehidupan bernegara, kita menyambut gerakan sosialisasi itu dengan penuh antusias dan gembira. Karena itu, sederas apapun pengaruh global yang merasuki

Kecenderungan yang terjadi dalam kehidupan bangsa Indonesia pada beberapa tahun terakhir ini justru bertolak belakang dengan nilai-nilai filosofis keempat pilar kehidupan berbangsa

kehidupankebangsaankita,Pancasilaharustetapdipertahankan sebagai pilar pertama kehidupan bangsa Indonesia dan harus menjadilandasanideologis,falsafah,etikamoral,sertapemersatu bangsa.SedangkanUUD1945sebagaipilarkeduaharusmenjadi hukum dasar, sumber hukum serta rujukan utama dalam kehidupan bermasyarakat, berbangsa dan bernegara. Adapun NKRI sebagai pilar ketiga adalah wujud konsensus nasional yang harus dijaga dan dipertahankan oleh semua warga bangsa karena tujuan negara Republik Indonesa hanya akan tercapai melalui perjuangan bangsa Indonesia yang bersatu, bukan bangsa yang terpecah belah. Dan Bhinneka Tunggal Ika, sebagai pilar keempat, harus menjadi solusi atas realitas kemajemukan bangsa Indonesia yang terdiri atas berbagai suku, ras, etnis, agama, adat istiadat, dan budaya. Jujur saja, kecenderungan yang terjadi dalam kehidupan bangsa Indonesia pada beberapa tahun terakhir ini justru bertolak belakang dengan nilai-nilai filosofis keempat pilar kehidupan berbangsa tersebut. Bukan saja karena kuatnya pengaruhdinamikaglobal,tapijugakarenaterjadinyapergeseran makna atas prinsip-prinsip dasar kehidupan bernegara. Olehkarenaitu,rakyatdanparapemimpinbangsaIndonesia di semua tingkatannya harus diingatkan kembali pada citacita dan semangat pembentukan negara Republik Indonesia yang puluhan tahun lalu diperjuangkan oleh para pendiri republik ini. ApalagiikrarkebangkitannasionalIndonesiayangbermuara pada proklamasi kemerdekaan 17 Agustus 1945, pada dasarnya bukanlah sekadar menghimpun potensi bangsa untuk sematamata melakukan perlawanan terhadap penjajahan bangsa asing, tapi merupakan komitmen dan wujud tanggungjawab para founding fathers republic untuk terlibat secara aktif dalam proses kemerdekaan serta pembangunan bangsa dan negara dalam semua aspeknya. Tapi, akankah kesadaran kebangsaan itu muncul setelah peringatan HUT Kemerdekaan yang ke-68 ini? Walahu’alam bissawab! *Penulis adalah kolumnis

Tari Ratoh Duek Memukau Alnwicj Musik Festival TARI Ratoh Duek dari Aceh yang dibawakan pelajar Indonesia yang tengah menuntut ilmu di Newcastle-upon-Tyne, Inggris tampil memukau dalam acara Alnwick Internasional Music Festival 2013 di Kota Alnwick, Inggris. “KeikutsertaanparapelajarIndonesiadalamAlniwckInternasional Music Festival, pagelaran musik dan tari yang berlangsung selama delapan hari di kota Alnwick untuk kedua kalinya,” ujar Koordinator dan pelatih tim Indonesia, Dewi Kurniati Setiorini, di London, Sabtu (24/8). Tahun ini, Alnwick Festival diikuti berbagai grup musik dan tari dari penjuru dunia, seperti dari Indonesia, India, Estonia, Taiwan, Ceko, dan negara lainnya berhasil menarik minat wisatawan, baik lokal maupun wisatawan mancanegara. Dewi Kurniati Setiorini, mengatakan selain menampilkan tari Ratoh Duek, pelajar Indonesia dan keluarga juga menampilkan musik Angklung. (ant)

Resensi Buku Novel Ciuman Terakhir Ayah

Kisah Inspiratif Anak Aflatoun Di Kota Santri “Aku akan menjadi seperti Aflatoun Bersinar terang menyinari dunia Seperti sebuah nyala api Aflatoun. Menjelajah, berpikir, menyelidiki, dan siap bertindak. — Nina

Judul Penulis Penerbit Cetakan 1 Cetakan 2 ISBN Tebal

: Ciuman Terakhir Ayah : Maufiqurrahman Surahman : Smart Writing Jogjakarta : Desember 2012 : Februari 2013 : 978-602-7858-06-0 : 170 halaman

GADIS kecil korban Tsunami Aceh 2004 yang lalu itu telah membuktikan kegigihan dan kebesaran jiwanya dengan tubuh tak sempurna, Nina mengajarkan kepada dunia makna menghadapi hidup yang tak selalu sejalan dengan kehendak langit. Nina tokoh utama penuh ispiratif dalam novel Ciuman Terakhir Ayah, karya Maufiqurrahman Surahman yang sangat menggugah emosi, cerita yang realistis, dengan bahasa yang mengalir, gambaran latar yang begitu hidup dan karakterisasai tokoh yang sangat kuat, menyentuh begitu dalam. Novel yang sudah cetakan kedua dalam waktu dua bulan ini dengan tebal 170 halaman berkisah tentang gadis kecil yang terpisah dari keluarganya akibat tragedi Tsunami Aceh. Nina anak kecil kelas lima SD adalah anak kedua dari tiga bersaudara. Si Sulung bernama Radit dan si bungsu, Sarah. Sedang Ayah kelahiran Jawa dan ibu asli Aceh. Keanehan berawal dari Ciuman sang ayah yang mendarat di kening Nina dan Sarah sebelum jarum jam 07.58 pagi. Tak lama kemudian, bumi Aceh luluh lantah dan gelap gulita, gelombang tsunami memisahkan mereka. Alhasil, si Sulung, Nina dan Ibu selamat. Ayah dan Sarah hingga kini hanya bisa diyakini mereka sudah di surga.

Perjalanan Nina bertemu ibunda sangat mengharukan, penulis dengan kata tuturnya yang khas berhasil memotret situasi tersebut dengan diksi yang pas dan realistis. Adegan terjadinya obrolan Nina dengan seekor biawak, sesosok lelaki mirip ayah, sampai bermimpi bertemu sang Ayah dengan sebungkus bonbon dari tercintanya (lihat halaman 30) sungguh membuat mata berkaca-kaca dan membasah. Kemudian, peulis menggiring pembaca pada pertemuan Ibunda dan si sulung dengan Nina yang berujung di salah satu rumah sakit di Kota Medan. Gadis kecil itu didapatkan ibunda dalam keadaan cacat. Tangan kanan Nina harus diamputasi akibat vonis dokter yang tak bisa ditunda, sebab luka yang sangat parah. Ibunda Nina harus menerima keadaan itu dengan sabar setelah sadar dari pingsannya yang tak berkesudahan. Tokoh Dewi, seorang muallaf hadir sebagai penolong dalam kesulitan ini. Relawan Muslim Hand dari Inggris itu banyak mengambil peran hingga ikut menentukan masa depan pendidikan Nina. Kesabaran Nina diuji sejak ia masuk pesantren, Nina tampil sebagai sosok santri yang gigih, kreatif dan ramah. Di Kota Santri inilah Nina berkenalan dengan Aflatoun—salah satu Organisasi Internasional yang bergerak di bidang pendidikan karakter dan financial. AflatounbanyakmengispirasiNinadalamsegalaaspekkehidupan. Ustadz Perdamean sebagai guru Aflatoun selalu mengajarkan arti hidup.“Jangan Menyerah” nasehat guru Aflatoun itu. (Lihat halaman

84). Episode di Pesantren diurai oleh penulis dengan apa adanya. Menciptakan komposisi rasa haru, tawa, dan kadang merana. Keadaan yang sangat mengharukan terjadi di kelas Aflatoun, saat salah satu guru bahasa Arab membuka pelajaran.. “Anak-anak, coba sekarang angkat kedua tangan kalian,” pinta ustadzah sambil mengangkat kedua tangannya.Teman-teman akhwat langsung mengangkat kedua tangan mereka ke atas kepala mereka masing-masing. Sementara aku tak bisa melakukan itu, aku tertunduk dengan sebelah tangan kiri terangkat ke atas kepala. Keadaan semakin senyap saat ustadzah itu menyuruhku mengangkat tangan kananku. Semua pasang mata membulay melotot ke arahku. Aku tak bergeming dengan setangan kiriku.” (halaman 71) Hebat! Novel ini sangat layak baca secara lengkap oleh khalayak, lebih-lebih para peserta didik. Lembar demi lembar mengandung inspirasi dan motivasi yang kental dengan pesan moral untuk selalu bersabar, bangkit dari keterpurukan, tak kenal menyerah, menebar manfaat bagi yang lain, berlomba-lomba dalam kebaikan dst, bisa kita dapatkan dalam novel inspiratif ini. Penulis menutup novel ini dengan happy ending, Nina menjuarai lomba menghafal Alquran yang diadakan Aflatoun di Pesantren. Suatu cita-cita yang dimimpikannya. Prestasi ini Nina persembahkan untuk Sarah dan Ayahnya di Surga. Maka, siapa pun yang membutuhkan ispirasi dan motivasi, buku ini layak dijadikan bacaan harian anda. Selamat membaca!*Dedi Riono


WASPADA Minggu 25 Agustus 2013


Sensasi Merayakan 17-an Di Gunung-Gunung Populer

Foto dok. Robi

SUASANA 17-an di Gunung Batur, Bali. CARA merayakan hari kemerdekaan Indonesia belakangan ini semakin variatif. Bosan begitu-begitu saja, ribuan orang membuat acara spesial untuk melepas jenuh itu di tempattempat tak umum dengan kegiatan yang sedikit ekstrim dan memompa adrenalin. Perayaan 17-an tahun ini misalnya, ribuan orang rela bersusah payah mendaki gunung untuk menggelar upacara Detik-Detik Proklamasi di lereng bahkan puncaknya. Kebanyakan gunung yang dipilih adalah gunung-gunung aktif yang populer. Sebut saja

Gunung Semeru di Jawa Timur, Merapi di Jawa Tengah, Batur di Bali, dan Gunung Ciremai di Jawa Barat. Di Gunung Semeru, misalnya, tercatat ada 3.050 orang yang melaksanakan upacara bendera di sepanjang jalur pendakian Semeru. Gunung yang berada di perbatasan Kabupaten LumajangMalang, Jawa Timur ini memang menjadi salah satu gunung paling diincar para pendaki untuk tempat menggelar upacara 17-an dan momentum nasional lainnya. Kepala Balai Besar Taman

Nasional Bromo Tengger Semeru (TNBTS), Ayu Dewi Utari, merinci lebih detil dari 3.050 pendaki, sebanyak 2.513 orang yang terdiri dari 2.509 pendaki domestik dan empat pendaki asing asal Belgia melakukan pendakian sejak Jumat (16/8) dan sisanya mendaki pada Sabtu (17/8). Para pendaki tersebut melakukan upacara peringatan Hari Ulang Tahun (HUT) ke-68 Kemerdekaan Republik Indonesia di Pos Kalimati. Seperti tahun-tahun sebelumnya, pihak TNBTS melarang pendaki melaksanakan upacara bendera di puncak Semeru

GUNUNG Batur di Kabupaten Bangli, Bali menjadi lokasi upacara 17-an bagi pendaki Bali tahun ini.

PESONA Gunung Batur, bali dari Kintamani.

yang bernama Mahameru. Mengingat kondisinya berbahaya, seiring dengan status gunung tertinggi di Pulau Jawa ini masih Waspada (Level II). Dengan status tersebut, Pusat Vulkanologi dan Mitigasi Bencana Geologi (PVMBG) merekomendasikan pendakian hingga Kalimati. Masyarakat maupun pendaki tidak boleh melakukan aktivitas pada radius 4 kilometer dari Mahameru. Guna mencegah pendaki yang nekat ke puncak gunung berketinggian 3.676 Meter di atas permukaan laut (Mdpl) ini, pihak TNBTS mengerahkan 30 petugasnya untuk bersiaga di sepanjang jalur pendakian gunung mulai dari Pos Ranu Pani, Ranu Kumbolo hingga Kalimati. Pihak TNBTS juga dibantu oleh aparat kepolisian sektor setempat, anggota TNI, para pencinta alam, dan tim SAR kabupaten untuk pengamanan perayaan tersebut. Yang menarik dari pelaksanaan upacara 17-an di Semeru tahun ini, banyak orang tua yang mengajak anaknya turut serta. Di satu sisi tindakan itu memang baik untuk memupuk rasa nasionalisme sejak dini. Tapi di sisi lain amat membahayakan nyawa sang anak dan tak patut dilakukan. Ayu Dewi Utami mengakui masih ada pendaki bandel yang mengajak anak usia di bawah 10 tahun untuk mengikuti upacara HUT RI di Gunung Semeru tahun ini. “Ada orang tua yang membawa anak-anak usia lima tahun, enam tahun, delapan tahun, untuk naik ke Semeru. Bahkan, ada juga yang nekat mengajak balitanya yang masih berumur enam bulan,” sesalnya. Ayu sudah menegur dan melarangnya, tapi, banyak pendaki yang sembunyisembunyi nekat naik ke Semeru dengan mengajak putranya yang masih kecil. Dia juga menghimbau para pendaki agar waspada dengan suhu dingin di Semeru. Menurutnya, bulan ini merupakan puncak dingin di Semeru yang suhunya mencapai minus 5 derajat Celcius sampai minus 10 derajat Celcius. Para pendaki juga harus waspada dengan peristiwa kebakaran hutan, mengingat saat ini sedang musim kemaru. Pendaki dilarang keras menyalakan api unggun.

Sementara di Gunung Merapi, ratusan pendaki melakukan pendakian ke puncaknya lewat Dukuh Plalangan, Desa Lencoh, Selo, Kabupaten Boyolali, sejak Jumat (16/8/2013) untuk maksud serupa. Para pendaki datang dari berbagai daerah di antaranya, Jakarta, Yogyakarta, Surabaya, Semarang, Kota Solo, dan lokal Boyolali. Para pendaki mulai berdatangan di base camp Dukuh Plalangan, Lencoh, sejak Jumat pagi dan memulai pendakian Jumat sore hingga Sabtu (17/8). Tercatat ada 200 orang yang melakukan pendaftaran identitas di base camp Plalangan sejak Jumat. Di Bali, puluhan relawan Bali yang tergabung dalam Komunitas Anak Alam juga menggelar upacara peringatan HUT Kemerdekaan RI ke-68 di atas Gunung Batur, Kintamani, Bangli. Koordinator Komunitas Anak Alam, Pande Putu Setiawan mengatakan perayaan kemerdekaan juga harus dimaknai dengan memberikan alam untuk bebas berkembang dan mendukung kehidupan. “Kemerdekaan buat alam adalah membiarkan keindahannya tanpa diusik,” ujarnya. Pande Putu Setiawan berharap pemerintah Kabupaten Bangli mengembangkan kawasan Kaldera Batur dengan tetap mengedepankan konsep-konsep pembangunan berkelanjutan. Apalagi saat ini kawasan kaldera Batur telah ditetapkan sebagai jaringan geopark dunia. “Pengembangan kaldera Batur sebagai kawasan taman bumi juga harus memberi kontribusi bagi peningkatan ekonomi masyarakat yang hidup di kawasan Kaldera Batur,” imbaunya. Melebihi Kuota Pendakian ke Puncak Gunung Ciremai untuk merayakan 17-an berlangsung sejak Kamis (15/8/2013) hingga Sabtu (17/ 8/2013). Jumlahnya melampaui kuota kebijakan Balai Taman Nasional Gunung Ciremai (BTNGC) yang hanya 750 orang. Namun pada momen khusus ini membludak sampai di atas 2.500 orang. Para pendaki bukan saja datang dari Jakarta, Cirebon, Kuningan, Bandung dan kota-kota lain di Jawa pun juga dari Lampung. Ada tiga jalur pendakian yang digunakan para pendaki.

Foto dok. Iwoe.

GUNUNG Merapi dilihat dari Lereng Gunung Merbabu. Jalur terpadat lewat Pos Jalur Pendakian Linggarjati, Desa Linggarjati, Kecamatan Cilimus, Kabupaten Kuningan yang mencapai 1.500 orang. Kemudian dari Pos Jalur Palutungan, Desa Cisantana, Kecamatan Cigugur, kabupaten Cigugur sekitar 700 orang. Dan terakhir lewat Pos jalur Apuy, Desa Argapura, Kecamatan Argalingga, Kabupaten Majalengka sebanyak 500 orang. Para pendaki mendaki sejak Sabtu dini hari lalu berkemah dalam perjalanan di tiga jalur pendakian tersebut. Jelang subuh, mereka bergerak

menuju puncak. Gunung berketinggian 3.078 Mdpl ini merupakan atap tertinggi Jawa Barat. Di puncaknya sejumlah pendaki membuat kelompok-kelompok kecil dan atau bergabung dalam kelompok besar untuk melakukan upacara 17-an. Selain di gunung, ada 68 penyelam yang melakukan penyelaman (diving) ke dasar laut lalu melangsungkan upacara kemerdekaan dan mengibarkan bendera berukuran 1 X 3 meter di kedalaman sampai dengan 15 meter di perairan Pulau Selayar, Sulawesi Selatan.

Sedangkan di Aceh, prajurit TNI lakukan aksi terjun payung di dua lokasi yakni di Blang Padang, Banda Aceh dan di Lapangan Lhoksukon, Aceh Utara. Di Blang Padang ada 15 orang penerjun, tiga di antaranya berasal dari Aceh, sementara di Aceh Utara aksi terjun payung statis dilakukan oleh 120 penerjun dan terjun payung Free Fall oleh 15 penerjun, di antaranya penerjun asal Aceh sambil membentangkan bendera Merah Putih raksasa dan spanduk besar bertuliskan “Damai itu Indah”. (Naskah: Adji K. Foto: Adji K & dok. Robi/Iwoe)

GUNUNG Semeru, lokasi upacara 17-an paling diincar pendaki.

Festival Kalimalang, Menyulap Kali Jadi Arena 17-an

PESERTA panjat pinang 17-an khas Kalimalang, Jakarta Timur.

SUDAH tiga kali Dion, 13, berusaha menggapai ujung pohon pinang yang diletakkan miring ke arah sungai. Dia kembali jatuh, tercebur ke aliran sungai dan basah kuyup. Setiap dia terjatuh, warga yang menonton di sisi kali pun bersorak, bertepuk tangan, dan tertawa geli. Itulah sepenggal kemeriahan perayaan HUT Kemerdekaan RI di sepanjang Kalimalang, Jakarta Timur. Setiap tahun, di lokasi ini digelar hajatan berlabel Festival Kalimalang. Festival tersebut berisi berbagai perlombaan khas kemerdekaan seperti panjat pinang dan gebuk bantal. Bedanya, kedua acara itu dilakukan di atas sungai Kalimalang yang berairan tenang. Tak jauh dari tempat Dion “berjuang”, juga ada sekelompok anak muda yang berusaha memanjat batang pinang yang licin lantaran dilumuri “gemuk” atau oli. Mereka berjuang keras untuk mencapai dan melucuti aneka hadiah yang sengaja ditempatkan di ujung pohon pinang itu. Untuk berhasil mencapainya, mereka bekerja sama. Bahkan ada yang rela menjadikan pundaknya sebagai anak tangga, tempat pijakan kaki temannya agar dapat mencapai ujung pinang. Cara itu pun tak mudah. Kerap mereka terpeleset dan kembali terjatuh ke aliran air Kalimalang. Saat itulah gelak tawa dan tepuk tangan warga yang menonton kembali membahana. Kalau ada yang berhasil sampai ujung pinang, hadiahnya dibagi rata, tentu peserta yang sukses mencapainya memperoleh hadiah paling banyak dan istimewa. Hadiahnya bermacam seperti kaos, baju, diterjen, bola, sepatu, raket bulutangkis, dan sepeda. Acara ini tiap tahun digelar dan menjadi tontonan gratis yang menghibur, bukan hanya warga setempat tapi juga turis. (Naskah & foto: Adji K)

MERIAHKAN 17-an di atas sungai sepanjang Kalimalang, Jakarta Timur.

Foto dok. Iwoe.



WASPADA Minggu 25 Agustus 2013

Aishwarya Rai Singkirkan Katrina Kaif PASCA menikah dan melahirkan, aktris cantik Bollywood Aishwarya Rai (foto) memang jarang tampil di layar lebar. Kendati demikian, dia masih menjadi ratu di dunia iklan negara setempat. Bahkan, Aishwarya Rai dikabarkan telah menyingkirkan aktris Bollywood lainnya Katrina Kaif untuk membintangi sebuah iklan. Sebagaimana dilansir media lokal, baru-baru ini, awalnya pihak perusahaan telah menghubungi Katrina untuk membintangi iklan

sebuah produk. Tiba-tiba pihak perusahaan membatalkan kontrak dengan Katrina dan memilih Aishwarya Rai sebagai bintang iklan mereka. Hal tersebut membuat Katrina marah besar. Dia menilai perusahaan itu tidak profesional. Sebab, pihak perusahaan membatalkan kontrak dengan Katrina hanya beberapa saat menjelang penandatanganan kontrak dengan Aishwarya Rai. Sejumlah sumber dari lingkungan perusahaan menyatakan, memang ada

sedikit masalah mengenai iklan tersebut. “Nama Aishwarya Rai terlanjur diumumkan sebagai bintang iklan produk tersebut dan mendapatkan respon sangat bagus dari masyarakat. Sayangnya, pihak perusahaan lebih dahulu menghubungi Katrina Kaif dan mereka sudah merancang konsep iklan tersebut. Tetapi komunikasi antara Katrina dan pihak perusahaan tiba-tiba buntu. Karenanya, pihak perusahaan membatalkan kontrak dengan Katrina.

Sementara, Katrina tidak tahu mengapa dirinya diganti oleh Aishwarya Rai,” ujar sumber tersebut. Keuntungan Kehadiran Aishwarya Rai memang sudah dinantinanti oleh banyak orang. Hal ini menjadi salah satu alasan pihak perusahaan memilih Aishwarya Rai untuk membintangi iklan tersebut. Sementara itu, absennya Aishwarya Rai dari dunia akting memberi keuntungan tersendiri bagi Priyanka Chopra. Semula Aishwarya Rai dijadwalkan tampil di salah satu scene film Sanjay

Leela Bhansali. Belakangan, dia membatalkan keikutsertaannya. Hal ini membuat Sanjay Leela harus mencari penggantinya. Dia menunjuk Priyanka Chopra mengganti peran Aishwarya Rai. Pada akhirnya, Priyanka dilirik banyak orang untuk menjalin kerjasama. Priyanka menyatakan tertarik dengan ide Sanjay. Tetapi dia masih mengatur jadwal. Sebab, dia masih menjalani syuting film Gunday dan Mary Kom. (k/m25)

Paula Abdul Suka Gado-gado PENYANYI Paula Abdul ternyata sudah mencoba makanan khas Jakarta, gado-gado. “Saya sudah coba gado-gado dan rendang,” kata Paula (foto) saat jum-pa media “X Factor Around The World” di Kemayoran, Jakarta, Jumat (23/8). Juri X Factor itu mengaku dirinya memang menyukai makanan pedas. Paula Abdul datang ke Jakarta

sejak beberapa hari yang lalu. Dia ingin mengunjungi Bali. “Saya harus ke Bali sebelum pulang,” katanya. Paula Abdul datang ke Indonesia dalam rangka “X Factor Around The World”, memperingati hari ulang tahun ke-24 RCTI. Dia tidak datang sendiri. Juri X Factor lainnya, Daniel Bedingfield (Selandia Baru) dan Louis Walsh (Inggris Raya) juga hadir untuk acara itu. Dalam acara yang digelar di JIExpo Kemayoran pada 24 Agustus, Fatin Shidqia dan Novita Dewi

dari X Factor Indonesia tampil bersama Samantha Jade (X Factor Australia musim 4), Melanie Amaro (X Factor AS), The Collective (X Factor Australia), Jahmene Douglas (X Factor Inggris Raya). Untung Pranoto, Manager Operasional Produksi RCTI mengatakan, tidak hanya para jebolan X Factor, juri pun juga akan tampil. Daniel Bedingfield berkata akan menyanyikan dua lagu, salah satunya adalah lagu yang membesarkan namanya, “If You’re Not The One”.(ant)

Ben Affleck Jadi Batman AKTOR Ben Affleck, 41, ditunjuk menjadi Batman dalam sekuel film Superman

Ben Affleck

yang akan tayang tahun 2015. “Kami butuh aktor luar biasa untuk menjadi salah satu pahlawan populer DC Comic, dan Ben Affleck benarbenar pas untuk itu,” kata Presiden Warner Bross Greg Silverman dalam pernyataan pers uamh dikutip BBC, Jumat (23/8). Un t u k p e r t a m a kalinya, film ini mempertemukan dua superhero yakni Batman dan Superman. Affleck akan beradu akting dengan Henry Cavill, aktor Inggris yang berpe-


ran sebagai Superman di film “Man of Steel”. Penampilan Affleck dalam sekuel Superman itu pernah diungkapkan Sutradara Zack Snyder dalam acara komik di San Diego, bulan lalu. Snyder, yang menyutradarai “Man of Steel” mengatakan, Affleck akan menjadi “pengimbang menarik” bagi Cavill, 31, yang berperan sebagai Clark Kent. “Dia (Affleck) punya kemampuan untuk membuat gambaran seorang pria yang lebih tua dan lebih bijak dari Clark Kent dan memberi sentuhan penumpas kejahatan berpengalaman, tapi tetap punya pesona sebagai miliuner Bruce Wayne,” kata Snyder dalam satu pernyataan. “Saya tidak sabar bekerja dengan dia,” tambahnya. Sekuel “Superman” akan mulai digarap tahun depan untuk ditayangkan pada tahun 2015. Sekuel yang belum diberi judul itu juga menampilkan Amy Adams (Lois Lane), Laurence Fishburne (Perry White), dan Diane Lane (Martha Kent).(ant)


MUI: Sebaiknya Ustadz Solmed Tidak Pasang Tarif PROFESI ustadz sedang menjadi sorotan menyusul kasus perselisihan antara Ustadz Soleh Mahmud alias Solmed dengan sebuah majelis taklim di Hongkong. Solmed diduga meminta bayaran terlalu besar, sementara majelis taklim dituding mengutip uang kepada jamaah untuk menghadiri ceramahnya. Sikap ustadz Solmed yang diduga memasang tarif terhadap majelis taklim di Hongkong, mendapat sorotan dari berbagai kalangan. Majelis Ulama Indonesia (MUI) menyarankan Solmed agar tidak pasang tarif dalam berdakwah. “Bukan tidak boleh, tapi sebaiknya tidak pasang tarif,” kata Ketua Infokom MUI Sinansari Ecip di Jakarta, Jumat (23/8). Mengenai fatwa yang akan dikeluarkan terkait pasang tarif ustadz bernama asli Solehuddin Mahmoed itu, MUI belum berpikir tentang hal itu. “Belum terpikirkan itu,” ujarnya. Polemik mengenai pasang tarif tersebut belakangan ini menyulut kontroversi hingga ke ormas FPI, namun Sinansari berharap hal itu tidak menimbulkan konflik berkepanfeet

jangan. “Kita nggak mau seperti itu. Kalau memang ada pihak yang minta menengahi, pasti kita tengahi. Jangan sampai terjadi konflik sesama umat muslim,” tegasnya. Di tempat terpisah, Sekretaris DPD Front Pembela Islam (FPI) DKI Jakarta Ustadz H. Novel Bamu’min angkat bicara soal isu pasang tarif yang dilakukan Ustadz Solmed saat diminta dakwah di Hongkong. Ustadz Novel secara tegas menyarankan agar Solmed bertobat atas tindakan yang sudah dilakukannya. “Solmed itu seperti kacang lupa sama kulit. Sebaiknya dia insyaf, lebih bagus lagi bertobat,” kata Novel, Kamis (22/8). Menurut Novel, tindakan Solmed sudah menciderai makna dakwah yang seharusnya dilakukan ikhlas tanpa meminta imbalan. “Dakwah itu suatu perjuangan. Malah sudah biasa kadang dakwah kita ditinggalin (jamaah) dan nggak dibayar. Kok sekarang malah minta bayaran,” urainya. Novel menegaskan, tindakan Ustadz Solmed yang diduga memasang tarif dakwah sangat memalukan. “Sangat

Ustadz Solmed


memalukan kalau ada ustadz pasang tarif untuk ceramah dan berdakwah,” tegasnya. Duduk bersama Sementara itu, Ustadz Yusuf Mansyur berpendapat, permasalahan kedua belah pihak tidak akan selesai jika terus melempar komentar di media. Keduanya harus duduk bersama, mencari jalan tengah. “Kalau mau selesai, duduk bareng jangan bicara sendiri-sendiri,” ujarnya. Yusuf juga meminta masyarakat tidak berburuk sangka kepada kedua pihak. Dia mengimbau agar tidak berkomentar negatif, sementara akar masalah sebenarnya tidak

diketahui. Sebagaimana diketahui, perselisihan antara Ustadz Solmed dengan majelis taklim di Hongkong sempat diberitakan media lokal setempat dengan judul ‘Tarif Ustad Dipasang, EO Hongkong Meradang’ pada 23 Juni 2013. Saat itu, Solmed dijadwalkan berdakwah di Lapangan Victoria di hadapan warga Indonesia yang bekerja di sana. Namun rencana itu batal. Diberitakan di media lokal tersebut, sekelompok jamaah yang menamakan diri ‘Thariqul Jannah’ mengaku kecewa saat Solmed mendadak menaikkan honor secara sepihak. Lifah Khalifah, Ketua Thariqul Jannah mengatakan, kesepakatan semula telah disetujui dengan Solmed. Lewat telepon dan SMS, sang ustadz muda menyetujui honor sebesar Rp6 juta. Selain honor tampil, Solmed juga setuju menerima tiket Jakarta-Hongkong PP untuk kelas ekonomi, penginapan dan konsumsi, serta tambahan dana transportasi lokal. Namun melalui manajernya, Ustadz Solmed minta

tambahan honor. Dari Rp 6 juta, Solmed meminta tambahan honor hingga Rp10 juta, serta tiket pesawat JakartaHongkong PP untuk dua orang dan satu kamar di hotel berbintang. Mengenai pengutipan uang dari jamaah, menurut Lifah, uang tersebut digunakan untuk membayar sewa tempat dan operasional acara. Sebab, tidak ada perusahaan di Hongkong yang bersedia menjadi sponsor untuk acara dakwah. Sisa uang akan disumbangkan untuk pembangunan masjid di Indonesia. Di Jakarta, Solmed membantah semua tuduhan itu. Dia bahkan tak terima disebut ustadz matre. Soal pembatalan, Solmed beralasan bahwa dia tak sepakat dengan langkah EO yang menarik uang dari jamaah. “Saya enggak mau, justru saya yang protes,” jelas Solmed. Di depan EO, Solmed sempat mengancam, jika tetap minta bayaran dari jamaah, dia tidak bersedia datang dan berdakwah di Hongkong. “Saya dakwah ikhlas, tapi di lokasi, jamaah disuruh bayar,” ujarnya.(inc/k)

Waspada, minggu 25 agustus 2013  
Read more
Read more
Similar to
Popular now
Just for you