Page 1

Harimau Masuk Perangkap Babi

WASPADA Demi Kebenaran Dan Keadilan

UN 2014 Mulai 14 Maret

DENPASAR (Waspada): Kepastian tentang kapan peMANGGENG RAYA (Waspada): Seekor harimau nyelenggaraan Ujian Nasional (UN) 2014 terjawab. Sumatra (Panthera Tigris Sumatrae) terjerat perangkap Menteri Pendidikan dan Kebudayaan, Mohammad Nuh, babi di perkebunan milik warga di lembah pegunungan mengatakan sudah menetapkan Peraturan Menteri PendiAlue Dawah, Desa Suka Damai, Kec. Lembah Sabil, Kab. Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) dikan dan Kebudayaan (Permendikbud) Nomor 97/2013 Aceh Barat Daya (Abdya), Sabtu (23/11) pukul 11:30. yang menjadi payung hukum tentang pelaksanaan UN Saksi mata M Yunus, 50, warga desa setempat ditemui SMP/MTs dan SMA/MA beberapa hari lalu. Waspada mengatakan, saat itu masyarakat sedang menMINGGU, Pahing, 24 November 2013/20 Muharram 1435 H z No: 24412 Tahun Ke-67 Terbit 20 Halaman cari durian, tiba-tiba “Permendikbudnya melihat dari kejauhan sudah terbit. UN akan seekor binatang terjerat dilaksanakan 14 April perangkap babi. “Mere2014 setelah pemilu,” ka sempat berpikir itu kata Mohammad Nuh, babi hutan, karena pesaat meninjau sejumlah rangkap yang dipasang sekolah pelaksana uji untuk babi hutan yang coba kurikulum 2013 kerap memakan tanadi Provinsi Bali, Sabtu man milik warga. Tetapi (23/11). begitu mendekat yang Dikatakan Nuh, UN terperangkap seekor tetap dilaksanakan seharimau cukup besar,” perti hasil akhir konvenkata Yunus. si UN di Jakarta akhir Berita terperangkapSeptember lalu. Kebernya harimau itu segera langsungan UN masih meluas, warga mulai d i p e r l u k a n k a re n a berdatangan menyakmengandung 4 fungsi sikan raja hutan yang yakni pemetaan, seleksi sering dipanggil dengan ke jenjang yang lebih sebutan nenek itu. tinggi, perbaikan mutu Pawang rusa dan dan standar kelulusan. babi, Muhammad Jalil, Mendikbud menga55, kemudian mendetakan, terkait penggankati harimau yang terpedaan soal UN, kemungrangkap untuk melepaskinan besar akan disekannya. “Namun saat rahkan ke daerah. Mekaharimau dilepas langnismenya bukan per sung mencakar bagian provinsi melainkan wajah pawang hingga regional. berdarah,” kata Yunus. “Nanti sesuai ketenSetelah itu harimau tuan yang ditetapkan langsung kabur, semenpenyelenggara UN yakni BSNP, percetakan dan tara warga yang melihat distribusi akan dilakuitu berlarian tunggang kan secara regional,” langgang. “Pawang Jalil kata Nuh. tidak berdaya, warga Selain lebih mudah, langsung melarikannya pertimbangan lainnya ke Puskesmas. Kami adalah terkait keamakhawatir harimau itu nan dan antisipasi jika akan turun kembali,” terjadi masalah seperti sebutnya. keterlambatan atau Setelah menjalani kekurangan soal seperti perawatan di Puskesmas UN 2013. Mang-geng, pawang Jalil Terkait standar keakhirnya dirujuk ke lulusan, Mendikbud RSUD Teuku Peukan. mengatakan, ada keLuka cakar harimau mungkinan masih pada cukup dalam mengenai angka 5,5 dengan derabagian kening dan pipi jat kesulitan soal ditingkiri sampai di bagian katkan.Pada tahun ini Waspada/Hang Tuah J Said punggung kiri. (cza) HUJAN DEBU DARI SINABUNG: Pengendara sepedamotor tampak menggunakan masker saat melintas di Jl Letjen Suprapto, Medan, dengan suasana penuh debu putih akibat kiriman Lanjut ke hal A2 kol 1 Foto di halaman A2 dari letusan gunung Sinabung, Minggu (24/11) sekitar pukul 00.10 WIB dinihari.

Medan Hujan Debu Sinabung Muntahkan Batu

KARO (Waspada): Letusan Gunung Sinabung semakin meresahkan warga Kabupaten Karo. Jika sebelumnya muntahannya sebatas menebarkan debu vulkanik, kini disertai hujan batu. Sementara semburan debu Sinabung telah menyelimuti kota Medan sejak Sabtu (23/11) pukul 22:30 hingga Minggu (24/11) dinihari. Laporan Waspada dari Karo, akibat letusan yang terjadi Sabtu (23/11) malam itu membuat warga di empat desa berhamburan. Mereka mengungsi menjauh dari desanya dibantu sejumlah mobil TNI dan Polri. Berdasarkan data PVMBG (Pusat Vulkanologi dan Mitigasi Bencana Geologi) yang ada di Kab. Karo, letusan pertama terjadi pukul 21:26, kemudian disusul letusan kedua pukul 21:36 dan letusan ketiga pukul 22:02. Letusan disertai bebatuan mengarah ke arah Timur Laut, yaitu Desa Huta Gugung, Sigaranggarang, Huta Rakyat, Huta Nalu di Kecamatan Naman Teran. Ke empat desa itu berjarak Lanjut ke hal A2 kol 7 Waspada/Rudi Arman

PETUGAS Sat Lantas Polresta Medan membersihkan kaca mobil patroli yang diselimuti debu vulkanik di Pos Lantas Lapangan Merdeka, Minggu (24/11) dinihari. Debu vulkanik ini sampai kota Medan karena terbawa angin akibat meletusnya gunung Sinabung pada Sabtu (23/11) malam.

Sekretariat LMP Sumut Di Bom Molotov

MEDAN (Waspada): Sekretariat Markas Besar Laskar Merah Putih (LMP) Sumut yang menyatu dengan sekretariat LMP Kota Medan di Jln. Brigjen Katamso, Medan di bom molotov oleh orang tidak dikenal, Sabtu (23/11) dinihari. Bom molotov terbuat dari botol air mineral yang di isi bensin itu menghanguskan pintu sekretariat dan membakar plang nama LMP Medan. Kasus tersebut sudah dilaporkan ke Polsek Medan Kota yang telah memeriksa

beberapa saksi, termasuk melakukan olah tempat kejadian perkara dengan mengambil beberapa barang bukti. Saksi mata yang seharinya mendiami sekretariat Markas Besar LMP Sumut, Boy Andika kepada Waspada mengatakan peristiwa terjadi sekira pukul 03:00. Dia mengatakan, malam itu bersama empat teman lainnya tidur di sekretariat berlantai tiga, yang juga dijadikan kantor bantuan hukum LMP. “Sebelum terjadi peristiwa itu,

Ikon Musik Filipina, Freddie Aquilar Masuk Islam MANILA, Filipina (Waspada): Ikon musik Filipina Freddie Aguilar (foto) telah memeluk Islam untuk menikahi seorang gadis 16 tahun, demikian menurut laporan website berita. Berita tersebut telah mengejutkan banyak orang di Manila. Tempo dan Balita melaporkan bahwa penyanyi berusia 60 tahun itu dan pacarnya yang remaja itu akan melaksanakan akad nikah menurut ajaran Islam yang akan diresmikan oleh Gubernur Maguindanao Esmael Mangudadatu. Menurut aturan Keluarga Muslim Filipina, setiap pria Muslim minimal 15 tahun dan setiap perempuan Muslim dari usia pubertas ke atas dan tidak menderita hambatan

Lanjut ke hal A2 kol 1

teman saya di lantai satu mendengar suara sepeda motor di depan kantor. Saat dilihat dari sela-sela pintu, tampak dua orang pria dengan sepeda motor matic warna hijau. Teman saya juga melihat dua orang lainnya dengan sepeda motor matic warna putih berhenti di seberang jalan. Tetapi saat itu tidak ada kecurigaan, karena tidak berapa lama mereka pergi,” katanya. Lanjut ke hal A2 kol 1

Irham Buana Tidak Tahu Istrinya Pernah Kirim Uang ke Akil JAKARTA (Waspada): Irham Buana Nasution belum mengetahui istrinya Akj pernah mentransfer uang sebesar Rp260 juta ke rekening mantan Ketua Mahkamah Konstitusi (MK) Akil Mochtar yang menjadi tersangka kasus suap. “Waduh kalau itu belum saya tanyakan ke istri,” kata Irham Buana usai menjalani pemeriksa di Komisi Pemberantasan Korupsi (KPK), Jumat (22/11). Mantan ketua KPUD Sumut itu diperiksa KPK sebagai saksi tersangka Akil Mochtar, namun tidak bersedia berkomentar atas dugaan transfer uang dari rekening istrinya kepada Akil Mochtar. Namun, calon senator Dewan Perwakilan Daerah pemilihan dari Sumut pada Pemilu 2014 itu mengakui, dirinya kenal dekat dan pernah beberapa kali nongkrong dengan Akil Mochtar. “Ya dekat karena beliau penguji disertasi saya,” kata Irham Buana. Sedangkan pemanggilan dan dimintainya keterangan Irham Buana oleh penyidik KPK belum diketauhi secara pasti. Namun informasi yang dihimpun Waspada menyebutkan, Irham Buana diperiksa terkait dugaan kasus suap yang pernah mencuat dalam Pilkada Simalungun. Lanjut ke hal A2 kol 7

Waspada/Rasudin Sihotang

KAPOLRES Tanjungbalai AKBP ML Hutagaol (kiri) didampingai Wakapolres Kompol RA Pandiangan (tengah) dan Kasat Narkoba AKP HM Jungjung Siregar (kanan) memberikan keterangan penangkapan puluhan ribu pil ekstasi, Sabtu (23/11).

Polres Tanjungbalai Sita 22.500 Pil Ekstasi TANJUNGBAL AI (Waspada): Satuan Narkoba Polres Tanjungbalai menggagalkan penyelundupan 22.500 butir pil ekstasi asal Malaysia yang dibawa seorang tenaga kerja wanita (TKW), Sabtu (23/11). Tersangka Naw, 34, warga Kel. Karangmekar, Kec. Kedungwaringin, Kab. Bekasi, Jawa Barat ditangkap bersama tiga lainnya RS, 32, nakhoda kapal, WM, 35, nelayan dan IB, 41, nelayan, warga Kel. Semulajadi, Kec. Datukbandar Timur, Kota Tanjung-

Duel Mahal City Vs Spurs USAI memperkuat Tim Nasional pada Prakualifikasi Piala Dunia 2014 dan laga persahabatan, para punggawa Liga Primer Inggris kembali merumput. Minggu (24/11) malam ini pukul 21:00 WIB akan menyajikan dua klub Inggris yang paling boros dalam membelanjakan uangnya pada musim panas lalu. Laga ini pun bertajuk duel mahal Manchester City vs Tottenham Hotspur. Perhelatan yang digelar di Etihad Stadium yang ditayangkan langsung beInSport 3 akan membuktikkan klub mana yang paling efektif dalam membelanjakan uang dalam pembelian pemain. Pembelian satu atau dua pemain dirasa tak cukup, maka kedua tim ini rela mengeluarkan ratusan juta euro untuk membeli minimal empat pemain top. The Citizen meneruskan tradisinya untuk membeli pemain-pemain mahal sejak diakuisisi grup Abu Dhabi United pada 2008 lalu. Lanjut ke hal 2 kol 1


5 Pertemuan Terakhir: 21/04/2013 EPL: Tottenham-Man City 3-1 11/11/2012 EPL: Man City-Tottenham 2-1 22/01/2012 EPL: Man City-Tottenham 3-2 28/08/2011 EPL: Tottenham-Man City 1-5 11/05/2011 EPL: Man City-Tottenham 1-0

Soldado Sumber Ap/design: marwan

balai. Kapolres Tanjungbalai AKBP ML Hutagaol di dampingi Waka Polres Kompol RA Pandiangan dan Kasat Narkoba AKP HM Jungjung Siregar mengatakan, tersangka ditangkap di Perairan Kuala Baganasahan Asahan. Saat itu boat kayu dinakhodai RS membawa Naw berlayar menuju Kota Tanjungbalai. “Kita sudah mengintai sejak pukul 02:00, tetapi baru jam sepuluh tertangkapnya,” ujar Kapolres.

Dia menjelaskan barang bukti itu dikemas dalam 31 plastik transparan. Rinciannya, 18 bungkus masingmasing berisi 1.000 butir, 8 bungkus berisi 500 butir dan 5 bungkus masing-masing berisi 100 butir. Pil ekstasi itu berwarna merah jambu dan kuning. Semuanya disembunyikan dalam tas sandang jenis ransel. Tersangka Naw di kantor polisi mengaku barang itu Lanjut ke hal A2 kol 1

Gudang Penyincangan Curanmor Digerebek MEDAN (Waspada): Satu gudang di Jln. Pasar VIII dekat Pajak Gambir Desa Tembung, Kec Percut Seituan yang diduga sebagai tempat mencincang kendaraan bermotor hasil curian digerebek petugas Reskrim Polsek Percut Seituan, Sabtu (23/11). Dari gudang merangkap bengkel itu petugas menyita 3 sepedamotor dan kepala mobil Pick-up L 300 sebagai barang bukti, sekaligus mengamankan empat pelakunya. Informasi di kepolisian, penggerebekan berawal dari informasi warga yang menyebutkan gudang itu selalu dijadikan sebagai tempat penyimpanan kendaraan bermotor hasil curian. Berbekal informasi tersebut beberapa petugas melakukan penyelidikan. Di lokasi, petugas melihat satu mobil Pick-up mengangkut bak mobil L 300 keluar dari gudang, yang dibawa HS dan anggotanya KR. Saat itu juga petugas menghentikan mobil tersebut, lalu mengamankan keduanya, diduga sebagai penadah/pembeli barang-barang curian. Lanjut ke hal A2 kol 7


Berita Utama

WASPADA Minggu 24 November 2013

Ikon Musik Filipina .....

Boediono Diperiksa KPK

Polres Tanjungbalai Sita .....

JAKARTA (Waspada): Wakil Presiden Boediono dalam jumpa pers, Sabtu (23/11) mengatakan diperiksa petugas Komisi Pemberantasan Korupsi (KPK) di kantor Wapres Jln. Medan Merdeka Utara, Jakarta Pusat. Boediono diperiksa terkait pemberian Fasilitas Pendanaan Jangka Pendek (FPJP) yang diberikan Bank Indonesia kepada Bank Century pada 2008. Saat itu Boediono menjabat Gubernur Bank Indonesia. “Saya membeberkan keterangan sebagai saksi pada hari ini di kantor Wapres. Saya

berdasarkan ketentuan aturan itu dapat mengikat pernikahan. Seorang wanita dianggap telah mencapai pubertas sebelum mencapai usia 15 tahun. Mangudadatu dikutip dalam laporan itu mengatakan bahwa dia telah kenal Aguilar sejak 2011 ketika musisi itu mengemukakan keinginannya untuk memeluk Islam. Website itu melaporkan bahwa pasangan itu akan tampil dengan mengenakan pakaian tradisional Islam selama upacara pernikahan serta resepsi perkawinan mereka. (an/m10) titipan suaminya Syam, 45, (nelayan di Malaysia). Rencananya pil itu akan dibawa dengan menumpang bus dari Simpangkawat menuju Jakarta. “Mau dibawa ke Jakarta bang,” kata Naw. Sedangkan nakhoda RS mengaku diberi imbalan 2000 RM membawa Naw ke Tanjungbalai. Dia mengatakan sehari-hari sebagai nelayan pukat rawe menangkap udang dan ikan. “Suami ibu ini nelayan pukat tarik di Malaysia, dia yang menelefon supaya menjemput di perbatasan Indonesia-Malaysia. Aku bersedia karena upahnya besar, biasanya membawa TKI cuma 200 ringgit per orang, ini dikasih 2000 ringgit,” kata RS. Ke empat tersangka masih diperiksa intensif untuk mengungkap jaringan berikut bandar besarnya. Atas perbuatannya mereka diancam UU RI No. 35/2009 tentang Narkotika dengan ancaman hukuman di atas lima tahun penjara. (a32)

Medan Hujan Debu .....

Sekretaris LMP Sumut .....

Namun berselang beberapa menit api membakar pintu depan kantor. Teman-teman Boy yang berada di lantai bawah, kemudian membangunkan Boy yang tidur di lantai atas. Mereka kemudian berusaha memadamkan api. Saat itu warga sekitar juga panik, karena sekretariat LMP berdampingan dengan rumah toko lain dan juga berdekatan dengan rumah penduduk. Karena api yang membakar pintu depan sekretariat sempat membesar, warga sekitar beramairamai membantu memadamkan api. “Api tidak sampai menjalar ke ruko lain, juga ke rumah warga karena cepat diketahui,” kata Boy. Ketua Markas Daerah LMP Sumut Darwin Hamonangan Lubis dikonfirmasi menyesalkan tindakan pembakaran itu. “Ini sangat tidak bisa ditolerir dan harus diusut siapa pelakunya,” kata dia, Sabtu sore, di dampingi sejumlah pengurus LMP Sumut dan Medan. Menurut Darwin Hamonangan, perbuatan yang dilakukan orang tidak dikenal itu tergolong pengecut dan dikategorikan sebagai teroris. “Saya katakan seperti itu karena telah membuat kepanikan. Disekitar sekretariat kita banyak rumah warga dan ruko-ruko. Jika api tidak segera padam, bisa saja menjalar membakar rumah warga dan ruko lainnya,” katanya. Laskar Merah Putih, kata Darwin Hamonangan, meminta aparat kepolisian segera bertindak mengusut kasus itu. Dia juga mengatakan sudah berkoordinasi dengan Intelkam Poldasu untuk mengusutnya. Mengenai dugaan pelaku pelemparan bom molotov tersebut, Darwin Hamonangan mengatakan belum mengetahuinya. “Kami tidak bisa menduga-duganya, selama ini LMP tidak punya masalah dengan organisasi lain, karena arah pergerakan organisasi ini juga jelas, membela tanah air dan memberi kemaslahatan bagi masyarakat. LMP bukan organisasi preman,” katanya. (m27)

UN 2014 Mulai .....

proporsi tingkat kesulitan soal adalah 10 persen mudah, 70 persen sedang, dan 20 persen sukar. Anggota Badan Standar Nasional Pendidikan, Teuku Ramli Zakaria yang dihubungi lewat telepon selularnya mengatakan akan segera menerbitkan SOP UN 2014. “Dalam waktu dekat akan ditetapkan SOP nya. Yang pasti, terkait penggandaan dan distribusi soal memang akan diserahkan ke daerah,” tegas Ramli yang dihubungi lewat telepon selularnya. (dianw)

Duel Mahal City .....

Sedangkan Spurs memanfaatkan hasil penjualan Gareth Bale ke Real Madrid untuk tujuh pemain baru. Jika digabung Manchester City dan Tottenham Hotspur total menggelontorkan 234 juta euro atau sekitar Rp 3,7 triliun. City memberikan sumbangsih 116 juta euro, sementara Spurs 2 juta euro lebih banyak. Uniknya, sampai pekan ke-11 Liga Primer, baik City maupun Spurs belum mampu menembus 4 besar. Pasukan Manuel Pellegrini terdampar di peringkat 8 dengan koleksi 19 poin, hasil enam kali menang dan empat kali kalah. Sementara armada Andre Villas-Boas tak lebih baik dari City, hanya unggul satu poin dan duduk satu tingkat di atasnya. Ini menjadi catatan, di Liga Primer uang belum berbanding lurus dengan peningkatan peforma. Laga ini akan lebih memperhatikan empat pemain yang menempati posisi striker dan gelandang. Dua dari Manchester City, Alvaro Negredo (striker) dan Fernandinho (gelandang). Dua lagi dari Tottenham, Roberto Soldado (striker) dan Paulinho (gelandang). Posisi gelandang akan mempertemukan duo pemain asal Brazil yang berlawanan, Fernandinho dan Paulinho. Fernandinho bersama Yaya Toure menjadi menjadi duet sentral di lini tengah City. Fernandinho yang ditransfer 40 juta euro dari Shaktar Donetsk mampu menjadi penyeimbang serangan dan bertahan City. Sementara Alvaro Negredo terus membuktikkan diri sebagai partner pas bagi topskor City, Sergio Aguero. Negredo yang direkrut dari Sevilla 25 juta euro sudah mengoleksi 4 gol dan 2 assist dari 11 laga yang dilakoninya. Kejadian sama berlaku pada Spurs. 7 pemain yang direkrut, hanya dua pemain yang tampil konsisten sepanjang awal musim ini. Merekalah Roberto Soldado dan Paulinho. Soldado punya kontribusi hampir 50 persen dari 9 gol Spurs. Sedangkan Paulinho mampu beradaptasi dengan baik sejak pindah dari Corinthians dan kini dia pun menjadi salah satu pemain inti Timnas Brazil. Dominasi City Menariknya, Spurs selalu takluk dari City pada tiga kunjungan terakhir Liga Primer di Etihad Stadium. Namun The Citizen selalu meraih kemenangan tipis. Pertemuan terakhir 21 April 2013 di markasnya Tottenham, Manchester Biru takluk 3-1. Pada 28 Agustus 2011, The Citizen mempermalukan tuan rumah Tottenham 5-1. Faktanya, Etihad Stadium masih angker bagi The Lilywhite. Sebagai tuan rumah, so pasti Manchester Biru menjaga asa. Kebiasaan Manuel Pellegrini menerapkan pola 4-4-2 dengan mengandalkan duet striker Alvaro Negredo dan Sergio Aguero. Suplai bola diharapkan datang dari lini tengah. Pellegrini melakukan gambling, lapis kedua di sektor tengah sama bagusnya. Jesus Navas dengan bandrol 20 juta euro harus bersaing dengan gelandang sayap lainnya yang tak kalah bagus seperti David Silva, Samir Nasri hingga James Milner. Sedangkan Martin Demichelis sedang memanfaatkan kondisi Vincent Kompany yang terus dibekap cedera. Sementara tim tamu berharap banyak kepada Roberto Soldado. Andre Villa-Boas berharap dapat memenagkan sektor tengah. Selain Paulinho, deretan pemain seperti Dembele, Townsend, Holtby dan Sigurdsson dapat merepotkan pertahanan City yang dikordinir Richards cs. Peforma tandang Spurs cukup imprensip beberapa Jawaban Problem Catur, pekan terakhir ini. Dari enam laga tandang terakhirnya Dari Halaman Sport. disemua kompetisi, Spurs meraih lima kemenangan dan sekali imbang. 1. Kf6+, Rh8. Prakiraan pemain Manchester City (4-4-2): Joe Hart; 2. Kxh5+, f6. Richards, Martin Demichelis, Lescott, Kolarov; Fernandinho, 3. Mxf6+, Rh7. Yaya Toure, James Milner, 4. Mg7+mat Samir Nasri; Alvaro Negredo dan Sergio Aguero. Tottenham (Jika 1. ...., Rg7. Hotspur (4-4-1-1): Lloris; Walker, Dawson, Chriches, Ver2. Kxh5++, Rg8 tonghen; Paulinho, Dembele, Townsend, Sigurdsson; Holtby; atau Rh7. Roberto Soldado. # Setia Budi Siregar 3. Mg7+mat).

menjawab beberapa pertanyaan dari petugas KPK, mulai dari proses awal pengambilan keputusan untuk memberi dana talangan ke Bank Century hingga proses setelahnya,” katanya. Boediono yang diperiksa petugas KPK lebih dari tujuh jam sejak pukul 10:00, mengatakan alasannya menjalani pemeriksaan di kantor Wapres adalah efektifitas. “Kalau saya datang ke suatu tempat, pasti akan banyak personel dari unit protokol dan keamanan bersiaga di sana. Pemeriksaan di kantor wapres juga sudah disetujui KPK,” sebut dia. (ant)


SEEKOR Harimau Sumatra (Panthera Tigris Sumatrae) terjerat dalam perangkap babi di areal perkebunan milik warga lembah pegunungan Alue Dawah, Desa Suka Damai, Kecamatan Lembah Sabil Kabupaten Aceh Barat Daya (Abdya), Sabtu (23/11) sekitar pukul 11:30.

Polri Hentikan Sementara Kerjasama Australia JAKARTA (Waspada): Kepolisian Republik Indonesia (Polri) menghentikan sementara kerjasama dengan Australia menyusul memanasnya hubungan kedua negara setelah laporan tentang penyadapan yang dilakukan Australia terhadap Presiden Susilo Bambang Yudhoyono mengemuka. “Sementara dihentikan semua kerjasama itu karena ini perintah Presiden,” kata Kepala Divisi Humas Polri Irjen Pol Ronny F Sompie usai pun-

cak acara Kampung Bebas Narkoba di Jakarta, Sabtu (23/11). Ronny mengatakan, kerjasama Polri dengan Australia yang sementara dihentikan antara lain meliputi kegiatan pelatihan, pengadaan alat-alat untuk Detasemen Khusus 88 Antiteror serta pelacakan kejahatan cyber. Menurut dia, kepolisian juga akan memeriksa perangkat yang berasal dari Australia untuk memastikan tidak ada alat penyadap yang dipasang. “Nanti akan dievaluasi, dipe-

riksa semuanya apakah di dalamnya ada alat penyadap atau tidak. Kalau tidak ada akan kita gunakan terus,” sebutnya. Kepolisian saat ini telah membentuk tim khusus untuk memeriksa peralatan yang diperoleh dari Australia. “Kita sudah bergerak dan akan dilakukan maksimal sampai tuntas, perlatan itu kan computerized, membutuhkan ahli yang memahami. Kita datangkan dari ITB, kalau perlu dari Kemkominfo,” katanya lagi.

Ronny menambahkan, kerjasama dalam penanganan penyelundupan orang dengan Australia juga sementara dihentikan. “Kalau people smuggling (penyelundupan orang) yang sifatnya internasional itu kita lanjutkan. Karena Ini bukan hanya dengan Australia saja, tetapi termasuk transnational crime (kejahatan transnasional),” ujar Ronny mengaku belum mendapatkan informasi sampai kapan kerjasama dengan pemerintah Australia dihentikan.(ant)

Medan Berpeluang Angin Kencang Dan Hujan WN Bangladesh MEDAN (Waspada): Kawasan pesisir timut Sumatera Utara yaitu Medan, Deliserdang, Langkat dan sekitarnya hingga beberapa hari ke depan masih diguyur hujan lebat pada pagi hingga siang. Selain kondisi hujan lebat, angin kencang berke-kuatan 20 hingga 25 knot atau /50 Km/ jam juga bakal berpeluang lagi di kawasan Medan dan sekitarnya, pohon-pohon dipinggir jalan bakal tumbang lagi. Mega Sirait, SP, Kepala seksi data dan informasi pada Badan Meteorologi Klimatologi dan Geofisika (BMKG) Wilayah I stasiun Bandara Kualanamu membenarkan, Sabtu (23/11). Misalnya wilayah pesisir timur Sumut, seperti Medan dan sekitarnya hujan umumnya terjadi pada pagi dan sore hari, intensitas ringan hingga sedang. Sementara hujan pada sore hari intensitasnya sedang hingga lebat seperti kondisi

kota Medan dilanda hujan lebih kurang 1 jam Jumat dan Sabtu sore. Begitupun dia mengingatkan perlu diwaspadai pada saat hujan di sore hari, masih berpeluang angin kencang dan petir. Angin kencang yang kuat, khususnya di wilayah yang mendekati lereng timur pegunungan dan sekitarnya, seperti Padang Bulan, Sibiru-biru, Tuntungan, Pancurbatu dan sekitarnya. Sementara kondisi cuaca di pegunungan dan lereng perbukitan masih didominasi hujan walaupun intensitasnya bervariasi antara sedang hingga lebat, kata staf BMKG Wilayah I stasiun Bandara Kualanamu. Dia memprakirakan, memasuki pertengahan Nopember bahkan akhir Nopember 2013, kondisi cuaca di wilayah Sumut masih cenderung banyak hujan atau berfluktuasi (berubah-ubah) antara panas dan hujan, namun intensitas-

nya mulai berkurang dibandingkan sebelumnya (Oktober 2013). Curah hujan yang lebih tinggi terjadi di wilayah pantai barat Sumut (Nias, Tapteng dan Tapsel). Hal ini dipengaruhi semakin aktifnya gangguan-gangguan cuaca di lautan Hindia sebelah barat wilayah Sumut. Berdasarkan kondisi di atas, maka perlu diwaspadai potensi terjadinya angin kencang di daerah Medan, Deli Serdang, dan Serdang Bedagai. Sementara potensi longsor bakal terjadi di daerah Tapteng, Humbahas dan Tapsel. Peluang banjir dengan kategori rendah hingga sedang di daerah Asahan, Medan, Deli Serdang dan Tapsel. “Kawasan Medan masih berpeluang banjir termasuk banjir kiriman dari hulu sungai akibat intensitas curah hujan meningkat di kawasan Tanah Karo dan sekitarnya,” kata Mega Sirait. (m32)

Ditangkap Bawa Happy Five KUALANAMU, Deliserdang (Waspada): Pihak P2 Bea Cukai Kualanamu International Airport (KNIA) mengamankan seorang warga negara asing asal Bangladesh karena diduga menyimpan sebutir happy five di dompetnya. Informasi diterima Waspada, Sabtu (23/11), salah seorang petugas Bea Cukai sekira pukul 14:45 mengamankan seorang pria asal Bangladesh, penumpang salah satu maskapai bernomor lambung QZ 8055 dari Kualalumpur, Malaysia berinisial SMJI, nomor paspor c1445831, tempat tanggal lahir Comilla, 31 Oktober 1979. Petugas Bea Cukai menduga SMJI menyimpan sebutir pil narkotika jenis happy five yang disembunyikan di dalam dompet pelaku. Sumber Waspada m e n ye b u t k a n , sebelum diserahkan ke pihak Poldasu, tersangka diamankan di kantor Bea dan Cukai KNIA. (m16/m27)

sekira 3,3 kilometer dan 4 Km dari puncak Gunung Sinabung. Seorang warga disana, Terkelin Sembiring menyatakan kemungkinan letusan terjadi sekira pukul 21:30. Dari Huta Gugung, letusan tidak terlihat jelas karena kabut. “Tapi tak lama kemudian hujan batu. Ini besarnya sebesar kelereng, atau sama juga besarnya dengan buah kelengkeng,” kata Sembiring. Simon Sitepu, warga desa yang sama menyatakan hal serupa. Batu itu merupakan batu terbesar yang bersumber dari letusan Sinabung yang sampai ke desa mereka. “Batunya tidak panas, tapi karena ini batu, bukan lagi abu seperti biasa, warga jadi semakin ketakutan,” kata Sitepu. Sementara sebagian warga Desa Huta Rayat segera meninggalkan desa karena material batu dari letusan yang menimpa rumah-rumah mereka. Warga mengungsi karena khawatir kemungkinan batu yang lebih besar ikut terlontar bersamaan dengan letusan-letusan berikutnya. “Tentang ketinggian letusan belum bias diprediksi, termasuk awan panasnya karena tertutup kabut tebal,” kata Kepala PVMBG Ahmad Nabawi ditanya Waspada di Posko Pemantai Gunung Api Sinabung yang berjarak 8.5 Km dari kawah Sinabung. Dia juga mengatakan, dari lima sesmograf yang di pasang di lima titik untuk memantau aktifitas Sinabung juga belum bisa diketahui, karena ditutupi kabut dan debu. Namun gemuruh terdengar saat letusan, begitu juga terjadi beberapakali gempa. Hujan debu Sementara itu, Sabtu (23/11) malam Kota Medan diselimuti debu yang kemungkinan berasal dari semburan Gunung Sinabung. Tidak seperti biasanya, debu itu turun seperti hujan gerimis dan terasa menyakitkan mata. Bakhtiar warga Titikuning mengatakan, debu itu tidak biasa. “Debunya tebal menempel di jok kereta, serta terasa sakit di mata. Kemungkinan dari Sinabung,” kata dia. .(c10/m27/m39/m36)

Gudang Penyincangan .....

Petugas juga menggerebek gudang itu dan melakukan pemeriksaan. Di dalam gudang ditemukan kepala mobil Pickup L 300, 2 sepedamotor Jupiter BK 3900 ACM warna merah hitam maron, Supra 125 BK 4013 UQ warna biru hitam. Juga diamankan 2 orang dari dalam gudang, yakni AS alias Ki ,32, warga Jln. Pahlawan Gg Sakti Kel Pahlawan, Kec. Medan Perjuangan yang berprofesi sebagai penjaga gudang, EP pencari pembeli ,37, warga Jln. Batang Jambu, Kec. Batang Kuis, Kab. Deliserdang yang berperan sebagai pencari pembeli. Tersangka EP mengaku, yang mengantar mobil dan sepedamotor hasil curian adalah Ab,40, warga Jln. Keris, Kel. Pahlawan, Kec. Medan Perjuangan. “Ab yang selalu mengantar barang-barang curian itu ke gudang. Di dalam gudang itu temanteman Ab yang mencincang mobil dan sepedamotor. Tugasku hanya mencarikan pembeli, seperti bak Pick-up telah dibeli HS Rp4,8 juta,” ujar EP. Kapolsek Percut Seituan AKP Ronald Sipayung membenarkan telah mengamankan empat orang dari dalam gudang. “Kita telah mengamankan empat orang, satu di antaranya diduga sebagai penadah. Kasusnya masih kita kembangkan untuk menangkap Ab Cs yang berperan melakukan penyincangan mobil serta sepedamotor,” ujarnya. (h04)

Irham Buana.....

Dimana dugaan suap yang pernah disampaikan oleh Rafli Harun sebagai kuasa hukum JR Saragih (kini Bupati Simalungun) yang berpekara di MK dikatakannya, JR Saragih memberikan uang sekitar Rp1 miliar. Namun, oleh Ketua MK Mahfud MD (saat itu) meminta Rafli Harun membuktikannya. Yang oleh Rafli Harun tidak juga dapat membuktikannya sampai pergantian Ketua MK dijabat Akil Mochtar. Juru bicara KPK Johan Budi mengatakan, KPK tengah mendalami kemungkinan adanya perkara sengketa Pilkada lain yang terkait tersangka Akil Mochtar. (j02)

Mesir Usir Dubes Turki

Waspada/Andi Aria Tirtayasa

USTADZ Yusuf Mansur bersama seorang peserta saat tampil sebagai penceramah pada seminar Gampang Sukses di Hotel Tiara Medan, baru-baru ini.

KAIRO, Mesir (AP): Kementerian Luar Negeri Mesir mengatakan Dubes Turki untuk Kairo telah dianggap sebagai orang yang tak disenangi (persona non grata) dan diperintahkan agar meninggalkan Mesir karena Turki terus mencampuri masalah dalam negeri Mesir. Satu pernyataan yang dikeluarkan oleh jurubicara kementerian itu Sabtu (23/11) mengatakan pemerintah Mesir telah memutuskan untuk menurunkan tingkat perwakilan diplomatik ke tingkat Kuasa Usaha. Pernyataan itu mengatakan Mesir telah menarik dubesnya untuk

Turki ke Kairo. Pengusiran Dubes Huseyin Avni Botsali itu dilakukan setelah pernyataan yang dikeluarkan oleh PM Turki Recep Tayyip Erdogan bahwa Kairo dianggap sebagai ‘provokatif,’ kata kementerian luar negeri. Jurubicara Kementerian Badr Abdelatty mengatakan Kairo mengambil tiga keputusan Sabtu tentang hubungan diplomatik dengan Ankara. “Pertama mengusir dutabesar Turki dan menurunkan tingkat hubungan kami ke tingkat kuasa usaha, kedua untuk menyatakan dutabesar Turki persona non grata dan ketiga kami tidak

TG TIRAM ( Waspada): Kegiatan pengambilan bahan muatan dan bangkai kapal tenggelam (BMKT) di perairan Batubara dinilai liar karena t i d a k d i k e t a h u i Pe m k a b setempat. “Jika benar ini terjadi, kegiatan pembongkaran tersebut liar,” kata Kepala Dinas Kelautan dan Perikanan (DKP) Kab. Batubara Ir Rinaldi menjawab Waspada, Jumat (22/11) terkait laporan nelayan terjadinya pengambilan bahan muatan kapal tenggelam saat ini di perairan Batubara. Sampai saat ini, kegiatan itu tidak diberitahukan atau dilaporkan. “Ini sama sekali tidak dilaporkan,” sebutnya mengatakan, pihaknya akan menurunkan petugas mencari tahu benar tidaknya kegiatan tersebut. Terpisah, Himpunan Nelayan Seluruh Indonesia

(HNSI) Kec. Tanjungtiram mengecam keras kegiatan pengambilan BMKT di perairan daerah itu. Mereka meminta kegiatan itu di stop agar potensi perikanan dapat terjaga dan terpelihara secara baik, karena bangkai kapal bagian dari rumah ikan yang harus dipelihara demi kelangsungan populasi ikan. ‘’Kegiatan pengambilan BMKT harus segera dihentikan demi kelangsungan populasi ikan dan habitat laut,” kata Ketua HNSI Tanjungtiram Ganti. Beberapa waktu lalu BMKT itu juga akan dievakuasi oleh pemerintah, namun belum dilakukan karena masih ada syarat yang belum terpenuhi. ‘’Karena itu, sebelum habis dibongkar, dinas terkait agar menghentikannya dan menindak tegas pelakunya,” kata Ganti.(a13)

Hidup Matematis Akan Jauh Pengambilan BMKT Dari Peristiwa Keajaiban Di Batubara Liar M E D A N ( Wa s p a d a ) : Ustadz Yusuf Mansyur mengingatkan bila kita hidup terlalu matematis maka kita akan jadi jauh dari peristiwa keajaiban, setiap kaum muslim yang bekerja senantiasa harus menanam iman di hati, beriman kepada Allah, beriman kepada RasulNya, beriman kepada kitab-kitab sucinya dan beriman kepada hari akhir. “Bila kita senantiasa beriman maka Allah akan mendatangkan keajaiban. Orang yang sakit parah bisa sembuh seketika dan anak-anak yang bisa mengangkat kita dari kemiskinan. Namun, keadaan ini bisa semakin parah bila kita tidak ada memiliki rasa syukur dan lebih banyaik maksiatnya,” ujar Ustadz Yusuf Mansur di depan 2000 jamaah pada seminar Gampang Sukses live Ustadz Yusuf Mansur yang digelar di Hotel TiaraMedan, baru-baru ini.

Di hadapan peserta yang didominasi kaum wanita dan ibu rumahtangga itu, jelaskan Ustadz Yusuf Mansur, maksiat yang paling besar adalah bila kita tidak percaya kepada Allah. Tidak melaksanakan perintahNYA dan jauh dari perbuatan amal saleh. Keajaiban amal saleh datang dari banyaknya istigfar. Makin banyak kita beristigfar maka makin banyak keajaiban. Dari istigfar saja bisa menyembuhkan penyakit, menurunkan hujan dan sawah-ladang yang kering bisa berair seketika. Oleh sebab itu, tambha Ustadz Yusuf Mansur, bila keimanan dan amal saleh kita kurang, sebaliknya yang lebih banyak adalah dosa-dosanya maka hidup kita tidak ada keajaiban. “Keajaiban tidak ada karena kita tidak memiliki amal saleh. Teman-teman telah bergabung di Miracle

banyak-banyaklah berdoa, meningkatkan keimanan dan amal saleh,” ulang Yusuf Mansur. Sementara itu, Ketua Panitia The Miracle Seminar Syarif Hidayatullah didampingi sekretaris panitia Razali SAg menjelaskan, seminar tersebut mengkaji bahwa sukses itu gampang sekaligus sebagai persembahan dari Ustadz Yusuf Mansur untuk masyarakat Indonesia yang mendambakan sukses dunia akhirat. “Keberhasilan tidak datang begitu saja, semua memerlukan cara dan proses hingga sampai dianggap pantas untuk mendapatkannya. Allah SWT memberi ujian sesuai dengan kemampuan hambaNya, demikian pula memberi kesuksesan sebagaimana kepantasannya,” sebut Syarif. (h04)

akan mengirim dutabesar ke Turki,” kata Abdelatty. Dia mengatakan keputusan diambil setelah Erdogan membuat pernyataan di Rusia Kamis bahwa ‘yang provokatif dan mencampuri urusan dalam negeri Mesir.’ PM Turki itu mengutuk penindakan keras oleh pihak keamanan Mesir atas para pendukung presiden terguling Mohammed Moursi 14 Agustus lalu di Kairo. Hubungan kedua negara tegang sejak penggulingan Moursi dan penindakan brutal atas para pendukungnya di Rabaa Al-Adawiya, Kairo, dan Lapangan Nahda. Sekurang-kurangnya 627 orang tewas di Lapangan Rabaa Al-Adawiya saja 14 Agustus, demikian menurut para pejabat Mesir, ketika pasukan keamanan membubarkan aksi mogok duduk para pendukung Moursi. Dalam perkembangan lain, seorang anak laki-laki berusia 10 tahun tewas ketika para pendukung dan penent a n g Pre s i d e n t e r g u l i n g Mohammed Moursi bentrok di kota Suez, Jumat dan polisi menembakkan gas air mata untuk mengatasi kerusuhan di daerah-daerah lain Mesir, kata beberapa pejabat. Bentrokan meletus ketika kelompok-kelompok proMoursi memulai pekan demonstrasi anti-militer dengan slogan ‘Pembantaian Abad Ini’ — menunjuk pada insiden 14 Agustus ketika pasukan keamanan menumpas kubu garis keras di Lapangan Rabaa al-Adawiya, Kairo. Anak laki-laki itu tertembak kepalanya ketika bentrokan tersebut terjadi setelah sholat Jumat, kata pejabatpejabat keamanan.(m10)

WASPADA Minggu 24 November 2013

Sumut - Aceh

A3 Pembobol Pelabuhan T. Nibung Ditangkap


Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir

TANJUNGBALAI (Waspada): Satu dari dua pelaku diduga pembobol terminal Pelabuhan Teluknibung Kota Tanjungbalai ditangkap petugas Polsek Teluknibung, Kamis (22/11) dinihari. Tersangka SK, 32, diringkus di rumahnya di Jl Besar Teluknibung, Kel. Perjuangan, Kec. Teluknibung, Kota Tanjungbalai. Dari tangan lelaki berkumis ini, petugas menyita ratusan bungkus rokok berbagai merek bernilai sekitar Rp4,5 juta, satu buah linggis panjang. “Sehari setelah kejadian pelaku langsung kita tangkap, ini berkat kerjasama yang baik antara petugas dengan masyarakat,” kata Kapolres Tanjungbalai AKBP ML Hutagaol melalui Kasubbag Humas AKP Y Sinulingga didampingi Kapolsek Teluknibung Iptu AJ Simajuntak dan Kanit Ipda Subagya, Jumat (23/11). Kapolsek menerangkan saat ini pihaknya sedang memburu satu tersangka lainnya diduga membawa barang curian jenis leptop milik Kantor Imigrasi Tanjungbalai. Identitas dan ciri-ciri tersangka sudah ada di tangan petugas. Sementara, tersangka SK mengaku mencuri bersama temannya karena desakan ekonomi. SK yang tidak memiliki pekerjaan ini rencananya akan menggunakan hasil curian membeli beras untuk memenuhi kebutuhan istri dan dua anaknya. Sebelumnya, Pelabuhan Teluknibung dibobol maling dengan membawa kabur laptop milik petugas Imigrasi dan puluhan slop rokok. Akibat ulah mereka, keberangkatan ratusan penumpang tujuan Port Klang Malaysia, tertunda selama tiga jam karena alat mengecek paspor tidak ada. (a32)

Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu Lusia Damayanti (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: H. Halim Hasan. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Armin R. Nasution. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Promosi: Edward Thahir (Koordinator). Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Sinur Manik (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi).Hang Tuah Jasa Said (Potret). Wartawan Kota Medan: Umum: Zulkifli Harahap, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Hajrul Azhari Ritonga, Arianda Tanjung. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebingtinggi: Muhammad Idris, Abdul Khalik. Pematangsiantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanafiah, Hasanul Hidayat. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar, Dedek Juliadi. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Jasvira Sautisa. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan WASPADA dilengkapi dengan kartu pers. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada yang mengaku wartawan WASPADA tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �


TAMPAK plafon aula hotel Khalifah Idi Rayeuk yang ambruk dan menimpa sejumlah peserta pelatihan Kader PAUD di hotel tersebut, Minggu (24/11).

Peserta Pelatihan Kader PAUD Tertimpa Plafon IDI (Waspada): Akibat ambruknya plafon aula hotel Khalifah Idi Rayeuk mengakibatkan se jumlah peserta pelatihan Kader Pendidikan Anak Usia Dini (PAUD) dari Dinas Pendidikan Aceh Timur yang sedang mengikuti pelatihan tersebut harus dibawa ke Rumah Sakit Umum Daerah (RSUD) Idi untuk mendapatkan perawatan, Sabtu (23/11) sekira pukul 10:00 saat 45 kader PAUD yang sedang mendengarkan materi yang disampaikan oleh salah seorang perwakilan Unicef Umardi. Jalaluddin, Kabid PLB/LS Dinas Pendidikan Aceh Timur

di lokasi kejadian mengatakan, dalam kejadian tersebut

sedikitnya 8 orang peserta harus dibawa ke rumah sakit karena kepala mereka tertimpa plafon aula hotel yang ambruk. Namun demikian, Dinas Pendidikan Aceh Timur telah memberikan pelayanan medis bagi peserta yang terkena plafon dimaksud. “Alhamdulillah pada saat plafon ambruk posisi duduk peserta melingkar, bila posisi duduk peserta di tengah-tengah ruangan, besar kemungkinan semua peserta akan tertimpa runtuhan plafon tersebut,” papar Jalaluddin. Sementara pihak hotel su-

dah menjumpai panitia dan mengatakan, akan menanggung semua biaya perawatan bagi peserta yang dirawat di RSUD Idi. “Pihak hotel juga akan memfasilitasi tempat lain di hotel untuk melanjutkan kegiatan pelatihan itu yang berakhir Minggu (24/11),” jelas Jalaluddin. Jalaluddin mengatakan, para peserta yang dirawat di RSUD Idi sekira pukul 13:00B sudah kembali ke hotel untuk istirahat setelah mendapatkan perawatan medis beberapa jam, karena para korban tidak mengalami luka yang begitu serius. (cri)

Aceh Bussines Forum Kedua Digelar Di Jakarta BANDA ACEH (Waspada): Untuk kedua kalinya, Pemprov Aceh melalui Badan Investasi dan Promosi Aceh kembali menggelar Aceh Bussiness Forum (ABF). Kegiatan tersebut pernah digelar di Banda Aceh pada 20 Februari lalu. ABF kedua akan berlangsung di Jakarta, Senin (25/11) besok. Kepala Badan Investasi dan Promosi (BIP) Aceh Iskandar mengatakan, ada 24 kedutaan besar di Indonesia akan mengikuti kegiatan tersebut.“Trendnya bagus setelah kegiatan ABF yang pertama. Sampai saat ini, setidaknya terdapat 194 perusahaan asing yang ingin berinvestasi di Aceh. 32 di antaranya bahkan sedang mengurus perizinan. Karenanya kami berharap ABF kali ini dapat memancing ketertarikan pihak-pihak lain untuk berinvestasi di Aceh,” kata Iskandar di Banda Aceh Jumat (22/11). Menurut alumni University of London ini, Pemprov Aceh di bawah kepemimpinan Zaini Abdullah dan Muzakkir Manaf memiliki komitmen tinggi untuk memperbaiki taraf hidup masyarakat. Salah satu komitmen tersebut ditunjukkan dengan menggenjot iklim investasi di Aceh. Namun, sebagai bekas daerah konflik dengan kondisi psikologi masyarakat yang masih diwarnai phobia sosial yang berlebihan, keinginan mewujudkan Aceh sebagai tujuan investasi tidaklah mudah. Butuh koordinasi, sinergitas semua pihak dan pencitraan positif Aceh sebagai daerah yang mampu menjamin kenyamanan para investor. Hal itu pula yang menjadi alasan mengapa kegiatan promosi Aceh internasional harus dilakukan secara

berkelanjutan baik di Aceh, Jakarta maupun di luar negeri. “Ini tujuan mengapa kegiatan Aceh Bussiness Forum kembali digelar. Promosi Aceh sebagai daerah investasi harus dilakukanterus-menerus.Lihatsaja Malaysia dengan publikasinya yang luar biasa. Orang-orang jadi penasaran dengan brandnya sebagai Truly Asia,” kata mantan Deputy BRR NAD-Nias itu. Ketua Panitia Aceh Bussiness Forum Ir. Netty Muharni, MURP

mengatakan, pihaknya secara khusus melibatkan beberapa stakeholder dalam acara tersebut di antaranya kalangan duta besar. Hingga hari ini pihaknya sudah mengundang 24 kedutaan besar di Indonesia. Selain itu BIP Aceh juga mengundang kalangan pebisnis baik dari dalam negeri maupun luar negeri. Gubernur Aceh Zaini Abdullah diinformasikan akan menghadiridanmembukasecararesmi Aceh Bussiness Forum kedua di

Hotel Pan Pacific Jakarta. Selain Gubernur Aceh, juga akan hadir Kepala Badan Koordinasi Penanaman Modal (BKPM) Mahendra Siregar untuk membuka perspektif dunia internasional dalam melihat Aceh. “Pak gubernur nanti akan menjelaskan banyak hal mengenai isu-isu yang tak sedap berkaitan dengan investasi, misal berkaitan dengan Syariat Islam yang dituding menghambat investasi,” tandas Netty. (b05)

Hendaknya Semua Elemen Mendukung Ngogesa BINJAI (Waspada): Koordinator Mahasiswa Pancasila (Mapancas) Kota Binjai dan Kabupaten Langkat HeriFadly menghimbau semua pihak untuk mendukung Ngogesa Sitepu menjalankan roda pemerintahan setelah diberikan amanah oleh masyarakat Langkat dengan berhasilnya pasangan nomor 4 ini meraih sekitar 62,56 persen atau sebanyak 256.896 suara, pada pemilihan Bupati Langkat, 23 Oktober lalu. “KarenaPilkadatelahusaidan rakyatLangkattelahmenentukan pilihannya kepada Ngogesa Sitepu dengan kemenangan ini diharapkan semua elemen yang ada di bumi bertuah ini mendukung kinerja bupati pilihan rakyat dua periode tersebut,” ujar Heri Fadly, Kamis (21/11) di Binjai, yang pernah meraih pemuda pelopor Kabupaten Langkat pada 2009. Masyarakat kini menginginkan karya nyata bukan karya kata, dan hal ini telah dilakukan Ngogesa selama hampir lima tahun menjabat bupati, kini dirinya ter-

pilih kembali menjadi bupati periode kedua dengan Sulistianto sebagai Wakil Bupati Langkat. “Tidak ada kata lagi untuk menghujat, mencari keburukan, dan saling menjegal sesama calon bupati setelah pertarungan digelar,” papar Ketua Mapancas Kota Binjai Heri Fadly ini. Semua masyarakat telah mengetahui kalau ke-4 pasangan Cabup/CawabupLangkatinitelah melakukan kesepakatan pilkada damai, dan siap menerima kekalahan yang berarti kemenangan Ngogesa Sitepu diterima dengan lapang dada. “Kita semua masyarakat Langkat berharap Kabupaten

Langkat berpenduduk sekitar satu jiwa itu terus berpacu dalam pembangunansehingganantinya selamalimatahunkedepanmulai 2014 sampai 2019 Ngogesa bersama Sulistianto harus membuktikan kepada rakyatnya mereka mampu dan membuat gerakan perubahan yang berpihak kepada masyarakat,” kata pemuda pelopor Langkat ini. Menurutnya, sekarang semua telah berlalu, pertarungan, perjuangan, kerja kerja keras ke4 calon bupati pada pilkada lalu berakhir sudah dengan terpilihnya Ngogesa bersama Sulistianto sebagai Bupati/Wakil Bupati Langkat. (m14)

Tazkira Sumut Wisata Religi Ke Makam Wali Songo MEDAN (Waspada):Menyambut10 Muharram1435H,15 jamaah zikir Majelis Zikir Tazkira Sumut melakukan “Wisata Religi” (foto) berziarah ke Makam Walisongo di Jawa Barat, Jawa Tengah dan Jawa Timur 10-15 Novemmber. Pimpinan rombongan“Wisata Religi” yang jugaWakil Sekretaris Majelis Zikir Tazkira Sumut H Muhammad Dhuha Sholihin di Medan mengatakan, “Wisata Religi” Tazkira Sumut dari Medan dan Deliserdang ke Makam Walisongo bekerjasama dengan PT New Takagama Tours & Travel Medan, karena ingin menyaksikan langsung suasana 10 Muharram di makam-makam para wali yang menyebarkan agama Islam di Pulau Jawa. Muhammad Dhuha Sholihin menjelaskan, perjalanan “Wisata Religi” diawali berziarah ke Makam Sunan Gunung Jati di Cirebon (Jabar). Dilanjutkan ke Makam Sunan Kalijaga di Demak, Makam Sunan Kudus di Kudus dan Makam Sunan Muria juga di Kudus. Muhammad Dhuha Sholihin mengatakan, puncak 10 Muharram, Kamis malam (14/11) rombongan melaksanakan tausiyah dan zikir di satu masjid di Purworejo (Jateng) yang turut dihadiri sejumlah warga Purworejo. Tampil sebagai pentausiyah Hj Erniyati MS. BegitupuladiMasjidQubaEmasDepok,sambungnya,pihaknya melaksanakan zikir yang dipimpinnya, sedangkan tausiyah disampaikan Hj Erniyati MS yang dihadiri sejumlah jamaah dari Banyumas pada Jumat pagi (15/11). Muhammad Dhuha mengatakan, pihaknya akan melaksanakan kegiatan serupa sebagai gelombang II ke Makam Walisongo pada 20-27 Januari 2014 dalam memeriahkan Maulid Nabi Muhammad SAW 1435 H yang diakhiri berwisata ke “Pulau Dewata” Bali, mengunjungi Masjid Jami’ di Denpasar. Bagi jamaah zikirTazkira Sumut yang ingin mengikuti“Wisata Religi” gelombang II dapat mendaftarkan diri ke PT NewTakagama Tours & Travel Jalan Brigjen Katamso (depan Istana Maimun) Medan telepon 08126055165 dan Erniyati MS (pimpinan KBIH Al-Haramain) Medan telepon 085275540950.Sedangkan untuk wilayah Deliserdang, Serdangbedagai, Tebingtinggi dan P. Siantar dapat menghubungi Hj Zuraidah MS (PT New Takagama Tours & Travel Cabang Tebing Tinggi) telepon 08126214538. (cdiu)

Warnet Jalan Proklamasi Salahi Ketentuan STABAT (Waspada): Sejumlah masyarakat Stabat meminta aparat penegak hukum menertibkanWarnet ‘Bo’ di Jalan Proklamasi Stabat yang menyalahi ketentuan. Pasalnya sekat yang digunakan terlalu tinggi dan menggunakan penutup sehingga aktivitas orang didalamnya tidak diketahui, besar peluang untuk melakukan mesum. ‘’Kita berharap warnet tersebut ditertibkan sebagaimana warnet lainnya yang tidak seperti itu,’’ kata Azman, salah seorang warga Stabat, Jumat (22/11). Dia menambahkan, pengunjung warnet dominan pelajar yang berpasangan. Pantauan Waspada, pengunjung warnet setiap saat ramai, namun kegiatan orang di dalamnya tidak terlihat karena pengelola menyediakan penutup ruangan disertai sekat yang tinggi. Dampak gaya warnet seperti semi kamar, lokasi menjadi sasaran bolos anak sekolah saat jam belajar. Kasat Reskrim Polres Langkat AKP Rosyid Hartanto yang menerima beberapa pengaduan kasus pencabulan anak di bawah umur, salah satunya dilakukan di warnet tersebut, berniat untuk menertibkannya karena ruang menyalahi ketentuan. Namun hingga kini penertiban belum dilaksanakan. (a03)

Wali Kota Binjai Tepungtawari Jamaah Haji BINJAI (Waspada):Wali Kota Binjai HM Idaham menepungtawari jamaah haji kota Binjai di Pendopo Umar Baki, Jumat (22/11). Jamaah haji kota Binjai yang berangkat ke tanah suci dengan Kloter 11, berjumlah 246 orang tiba di tanah air 2 November 2013. Pemberian selamat kepada jamaah haji Binjai, Kakan Kemenag Al Ahyu, selaku Kepala Staf Penyelenggara Haji, Sekdako Elyuzar Siregar, Ketua TP. PKK Lisa Andriani M Idaham. HM Idaham mengemukakan jamaah haji merupakan tamu Allah. Perjalanan haji bukan perjalanan biasa. “Untuk pertama kali jamaah haji asal Binjai dapat melaksanakan wukuf satu lokasi, hal ini sangat baik dan membahagiakan,” ujarnya. Selain itu Wali Kota HM Idaham berharap para calon jamaah haji yang telah menyetor biaya perjalanan, agar bersabar. Disebabkan terjadi kebijakan pemerintah pusat, sesuai ketentuan pemerintah di Arab Saudi, untuk mengurangi jamaah sehingga terjadi pemotongan kuota haji kota Binjai. Bahkan ada yang harus menunggu 12 tahun untuk dapat berangkat ke tanah suci. Kakan Kemenag kota Binjai H. Al Ahyu, MA mengatakan, calon jamaah haji sudah terdata 3.257 orang mendaftar. Diperkirakan calon haji dapat berangkat hingga 2023. Dijelaskan, Binjai memperoleh 2 orang untuk TPHD, sebelumnya 1 orang. Ka Kankemenag Binjai mengucapkan terima kasih kepadaWali Kota Binjai yang memberikan mobil operasional dalam penyelenggaraan haji. (a04)

Adlin Nur Ketua KNPI Aceh Tamiang Periode 2013-2016 KUALASIMPANG (Waspada): Adlin Nur meraih suara terbanyak pada Musyawarah Daerah (Musda) III DPD II Komite Nasional Pemuda Indonesia (KNPI) Kabupaten Aceh Tamiang di SKB Karang Baru, Aceh Tamiang pada 19-20 November 2013 . Berdasarkan informasi yang dihimpun dari Panitia Pelaksana Musda organisasi tersebut, menjelang pelaksanaan Musda hanya muncul nama calon ketua yaitu Tarmizi dan M Toyib . Bahkan, Tarmizi ketika itu sudah berada di atas “angin” karena mendapat dukungan dari peserta Musda. Sedangkan Adlin Nur secara tiba-tiba muncul menjelang detikdetik proses pencalonan Ketua KNPI Aceh Tamiang Periode 20132016. Ketika proses pencalonan ketua, Tarmizi mendapat dukungan 15 suara, Adlin Nur yang tiba-tiba muncul dapat dukungan 15 suara dan M Thoyib mendapat dukungan 13 suara. Selanjutnya setelah proses pencalonan, dilakukan pemilihan ketua secara langsung melalui voting, ternyata Adlin Nur mendulang suara terbanyak mencapai 26 suara, Tarmizi memperoleh 20 suara dan M Thoyib hanya keciprat 2 suara. (b23)

Hasrul Azwar Resmikan Masjid Lahmuddin Delitua DELITUA (Waspada): Anggota Komisi VIII DPR-RI H Hasrul Azwar meresmikan Masjid Lahmuddin di Desa Suka Makmur. Kec. Delitua, Deliserdang, baru-baru ini. Peresmian Masjid Lahmuddin yang diwarnai penandatanganan prasasti pembangunan masjid oleh Hasrul Azwar dan Kakanwil Kemenagsu Abdul Rahim serta penandatanganan prasasti peletakan batu pertama pembangunan masjid dilakukan pewakif Salmah Lubis (istri alm H Lahmuddin Dalimunthe) bersama Penasihat Pembangunan Masjid Lahmuddin/anggota DPRD Deliserdang Sabar Ginting. Hasrul Azwar memberikan bantuan awal bagi pembangunan Masjid Lahmuddin sebesar Rp10 juta ditambah 20 kitab suci Alquran dan 20 kitab terjemahannya. Hasrul Azwar dalam sambutannya mengatakan, dalam Alquran Surah Attaubah ayat 18, Allah SWT berfirman yang maknanya:”Hanya saja orang-orang yang mau memakmurkan masjid, yakni orang-orang yang beriman kepada Allah dan Hari Akhirat, menegakkan shalat, mengeluarkan zakat dan tidak takut kepada siapa pun kecuali kepada Allah”. Kakanwil Kemenagsu Abdul Rahim mengulas Hadits Nabi Muhammad SAW yang maknanya:” Barangsiapa yang membangun masjid di dunia, maka Allah akan membangun baginya istana di Akhirat”. Karena itu, katanya, peresmian Masjid Lahmuddin ini diharapkan dapat memotivasi agar mengajak umat Islam mau meningkatkan kualitas keberagamaan dan keimanan serta ketakwaannya kepada Allah SWT. Kemenagsu akan membantu Rp20 juta bagi Masjid Lahmuddin pada anggaran tahun 2014.. Prof Rita F Dalimunthe menceritakan sejarah pewakafan Masjid Lahmuddin dari ayahandanya alm H Lahmuddin Dalimunthe yang meninggal dunia tahun 1978 di Mekkah dalam usia 47 tahun. Pada 1980, keluarga almarhum membeli tanah yang di atas tanah ini dibangun Masjid Lahmuddin yang ditangani H Bahrum Saleh yang selanjutnya secara sah menyerahkan wakaf kepada panitia pembangunan Masjid Lahmuddin diketuai Impun Siregar tahun 2008. Ketua panitia pembangunan masjid ini H Impun Siregar menjelaskan, masjid yang peletakan batu pertamanya dilaksanakan sekitar 3,5 tahun yang lalu, kini kondisinya 95 persen dan hanya tinggal penyelesaian akhir. (h04)

Waspada/Andi Aria Tirtayasa

H Hasrul Azwar bersama pewakif Hj Salmah Lubis disaksikan Kakanwil Kemenagsu Abdul Rahim (ketiga dari kiri) dan Ketua BKM Lahmuddin Impun Siregar ketika menggunting pita tanda peresmian Masjid Lahmuddin baru-baru ini.


A4 Banyolan Foto Kenangan


Suatu hari sebuah kelas berfoto bersama. Setelah foto jadi, Bu Guru membujuk anakanak untuk membeli, tiap orang satu foto. Bu Guru berkata kepada murid-muridnya. “Kalian seharusnya membeli foto ini, mumpung semua teman kalian lengkap terkumpul. Foto ini akan memberikan kenangan yang manis. Suatu hari nanti ketika kalian sudah besarbesar dan melihat foto ini, saya yakin kalian pasti akan senang.” Tak seorangpun berkata-kata. Bu Guru melanjutkan, “Coba bayangkan, nanti kalian melihat foto ini dan berkata ‘Oh ini si Tina, sekarang jadi dokter. Ini Totok, sekarang jadi pejabat, ini Tari sekarang jadi artis Seorang murid lelaki bandel di belakang menyela “Yang ini Bu Guru, sekarang sudah meninggal..”

co: iya soalnya kamu pintar banget mencuri hatiku.. co: bapak kamu nahkoda ya? ce: enggak kow…. co: tapi koq aku ingin sekali berlabuh di pelabuhan hatimu…

Buke Dan Tukang Ojek ( T ) adalah tukang ojek yang sedang nongkrong di pinggir jalan, tiba2 ada bule (B). dan terjadilah percakapan. B: Can you speak English? T: Hahh... Cimanggis? ya.. saya tau. B: What? T: Wah... saya bukan Ahmad, saya Bejo B: Are you crazy? T: Wah... mister tau aja kalo saya asli Bekasi. B: Ok let’s go.. T: Hah... masa sejauh itu cuman Cenggo?

Seorang anak kecil nangis dan menghampiri ibunya.. Ibu: “Lho, kenapa kamu nangis?” Anak: “Kepalaku digetok abang (kakak) Bu..” Ibu: “Memangnya kamu tuh buat salah apa? Sampai di getok abang mu gitu?” Anak: “Tak tahu bu. Aku hanya panggil namanya. Terus dia langsung marah katanya aku tidak sopan” Ibu: “Sudah.. Coba panggil abangmu dulu...” Anak: “Bang Sat!” (Nama abangnya Satyo)

Bintang Di Matamu

Kaki Kambing

Co: knapa malem ini gelap banget ya Ce: mendung kali bang Co: kyknya nggak dech Ce: trus napa bang Co: soalnya bulannya sedang menerangi & menemaniku disini co: kemarin aku liat ada 1000 bintang di langit ce: ah yang bener?? co: iya bener, tapi sekarang tinggal 998 bintang… ce: lho…kow bisa ilang dua? co: iya 2 bintang yang ilang itu ternyata ada di dalam mata kamu (sambil liat matanya dalam2) ce:(gubrakkkk)

Dalam sebuah pelajaran matematika, Ibu guru bertanya kepada murid. Ibu Guru : Kaki ayam ada berapa, Bonar ? Bonar : Dua bu Ibu Guru : Bagus, sekarang jojon, kaki kambing ada berapa ? Jojon : Delapan Ibu Guru Ibu Guru : Bagaimana bisa begitu ? Jojon : Coba hitung, 2 kaki depan, 2 kaki belakang, 2 kaki kiri dan 2 kaki kanan. Kan 2+2+2+2=8 Ibu Guru : Jojon, sungguh pintar kau seperti pejabat saja.


Seorang wanita kaya ditegur perempuan gelandanganminta uang untuk makan. Wanita itu ambil dompet, keluarkan uang empat ratus ribu. “Jika saya kasih uang ini, apakah kamu lebih pilih untuk beli perhiasan daripada makan?” “Tidak, Nyonya, saya ga pernah beli perhiasan seumur hidup saya,” jawab gelandangan itu. “Apakah kamu akan habiskan belanja?” wanita itu tanya lagi. “Tidak, Nyonya, saya gak mau buang waktu untuk belanja,” jawab si gelandangan. “Apakah kamu gunakan untuk ke salon?” wanita itu tanya sekali lagi. “Gila banget?” jawab gelandangan itu. “Saya ga pernah rapihkan rambut udah 10 puluh tahun.” Wanita itu berkata, “Oke. Saya ga jadi kasih kamu uang ini. Saya mau ajak kamu makan di restoran dengan suamiku.” Si gelandangan kaget banget. “Wah nanti suami Nyonya marah lah?! Lihat aja, saya kotor dan bau gini.” “Ga apa. Suamiku perlu lihat agar dia tahu apa jadinya seorang wanita jika ga dikasih uang belanja, perawatan ke salon, dan beli perhiasan.

Dokter kepada pasiennya, kakek 72 tahun.... Dokter : “Pak, rasa sakit di kaki kanan anda itu tampaknya akibat penyakit rematik.” Pasien : “Penyakit rematik itu apa, dok ?” Dokter : “Rematik itu salah satu penyakit yang menyerang sendi, Pak. Penyakit itu dapat disebabkan, misalnya, karena usia Bapak sudah tua...” Pasien : “Eh, dokter jangan coba2 bohongin saya ya !! Kaki sebelahnya, umurnya juga udah sama tuanya, tapi gak sakit apa2 tuh”

Suka Gombal Co : Mbak, orang tuanya pengrajin bantal ya..? Ce : Hah..!!!? bukan.. Emang kenapa..? Co : kok kalo deket sama mbak rasanya nyaman yach.. Co: “kamu itu seperti sendok…” Ce: “Kenapa?” Co:“Karena kamu ngaduk-ngaduk perasaan aku…” co: bapak kamu maling ya? ce: ih….kow jahat sie bapak ku dibilang maling. kow gitu?

Sepertinya Kayak Kenal

Tidak Sopan


Gunakan angka 0 sampai 9 ditambah dua abjad -- A dan B -- untuk mengisi kotak-kotak kosong. Tidak boleh ada pengulangan angka dan huruf pada lajur mendatar dan menurun, serta di dalam kotak 4x3 bergaris tebal. Tingkat kesulitan: sedang (***). Tersedia hadiah Rp50.000,- untuk seorang pemenang. Antar kupon berisi angka yang anda yakini benar ke kantor Waspada Jl. Brigjen Katamso 1 Medan, atau melalui faksimile ke (061) 4510025 paling lambat Jumat. Jawaban dan pemenangnya dimuat pada edisi Minggu ((1/12). ------------------------------------------------------ potong di sini --------------------------------------------------------

6 B 8 3 2 A



Seorang lelaki yang bertampang jelek terheran dipandangi seorang wanita cantik. Seperti menyelidik wanita tersebut berkata, “Kaya kenal ya?”. Si lelaki tersipu malu dan dengan sedikit sombong ia menjawab, “Ah neng.. mungkin neng salah lihat kali, saya tidak kenal neng?!”. “Nggak bang! Maksud saya, muka abang kayak KENALPOT!”, jawab si wanita itu.

S U DO K U P L US 3 0

WASPADA Minggu 24 November 2013

B 2 4 2 0 0 6 8 4 3 9 A 9 1 2 6 0 7 6 1 5 8 4 0 3 A 7 B 9


6 8 A 2 3 7 6

B 7

1 8 2 0 9

5 4 7 3 B 9 3 8 B 1 4







....................................................... .......................................................

No. KTP/SIM : ................. ---------------------------------------------- potong di sini ---------------------------------------------

07:00 2 Sakti Mandracinta-1 07:10 Serial Pilihan 08:00 Pelesir 08:30 2 Sakti Mandracinta-2 08:35 Pose 09:00 2 Sakti Mandracinta Limbad 09:04 Grebek Nusantara 10:00 2 Sakti Mandracinta-3 10:05 Mata Pancing 10:30 Layar Kemilau 15:26 2 Sakti Mandracinta Limbad 15:30 Inspirasi Sore 16:00 Animasi Spesial 16:26 Tuntas 16:56 2 Sakti Mandracinta Limbad 17:00 Battle Of Jebret 20:00 Persembahan Cinta 22 01:00 Cerita Dinihari

Nama: .................................................. Alamat: ................................................

gunting di sini

TTS Berhadiah Jawab dan gunting TTS Berhadiah di atas kemudian kirimkan ke PT Harian Waspada Jalan Brigjen Katamso No.1 Medan/Jalan Letjend Suprapto No.1 Medan. Tulis nama dan alamat lengkap serta nomor pengenal. Jawaban paling lambat diterima Jumat 29 November 2013, pukul 16:00. Bagi pengirim yang dapat menjawab semua pertanyaan dengan tepat dan benar akan diberi hadiah berupa uang tunai sebesar Rp50.000,-untuk satu orang pemenang. Semua jawaban yang benar akan diundi. Pengumuman pemenang akan diumumkan pada Minggu 1 Desember 2013 beserta jawaban yang benar di halaman yang sama. Hadiah dapat diambil di kantor Harian Waspada bagian Sekretaris Redaksi (jam kerja), setelah

MENDATAR 2. Prakarsa 6. Rakit 7. Bulu di kepala 9. Duit 10. Petunjuk 12. Sepuluh (Inggris) 13. Getah yang diperoleh dari dua jenis pohon akasia 15. Berhenti bersuara 17. United State of America 18. Perabotan berbidang datar dan lebar, berkaki empat 19. Lindungan 21. Puncak (Inggris) 24. Setelah dua 25. Karya musik yang diberi nomor untuk menunjukkan tempat (urutan) gubahan dalam semua karya seorang komponis 26. Gembira 27. Sesuatu yang menyusahkan, kesengsaraan 29. Tawanan

31. Dapat didengar 32. Mobil (Inggris)

1. Kata penghubung untuk menandai perlawanan 2. Sumpah 3. Seni (Inggris) 4. Turut serta 5. Sebanyak yang dipegang (dikepal) dengan tangan 8. Campur 11. Pelancong 14. Yang dihasilkan lebah 15. Arah mata angin antara Timur dan Selatan 16. Menyatakan tidak setuju, menyangkal, dsb. 17. Binatang sejenis burung 20. Membawa sesuatu untuk disampaikan ke tujuan 22. Terhambat, tidak lancar 23. Pekuburan 28. Dasi (Inggris) 30. Benda cair

Pemenang Sudoku Berhadia Minggu Lalu


8 A 7 2 0 5 B 6 9 1 3 6 9 4 0 A 5 B 4 9 8 0 1 2 3 7 A 5 B 1 6 8 3 A 7 2 4

9 4 3 2 6 1 A

5 8 7



0 8 2 A 5 9 B 7 6 3 4 1

B 1 5 2 4 6 6 7 3 B 9 A

A 7 3 0 1 9 4 8 2 5

5 4 B 8 0 3 2

8 9 7 4 2 A 0 A 6 9 1 6 B

0 5 1 3 7 6 9 4 A 8

07:30 Perempuan Hebat 08:00 KPDT 08:30 Aku Bisa Sembuh 09:00 Properties In Harmony 09:30 Kaki 5 10:00 Travellezza 10:30 Mantap 11:30 Topik Siang 12:00 Total Football 12:30 Kampiun Sepak Bola Nasional 13:00 Crazy Sport 13:30 Gowes 14:00 Neo Planet Remaja 14:30 Animasi : Curious George 15:00 Animasi : Mr. Bean 15:30 Animasi : Angry Birds Toons 16:00 Topik Petang 16:30 Siapa Takut 17:30 Pesbukers 19:30 I-Sinema 21:00 Sinema Spesial 23:30 Fantastic World Cup

07:05 Channel Japan 07:30 Agung Sedayu Group 08:05 Talk Indonesia 08:30 Agung Sedayu Group 09:05 Kokoronotomo 09:30 Agung Sedayu Group 10:05 Let 10:30 Secret Of Health 11:05 Eagle Documentary Series 11:30 12 Pas 12:05 Metro Siang 13:05 Penantang Terakhir 14:05 Sudut Pandang 15:05 Ikonia 15:30 Kick Andy 17:05 Metro Hari Ini 18:05 Metro This Week 19:05 Mario Teguh The Golden Ways 20:30 Just Alvin 21:30 Ring Of Fire Adventure 22:30 Newshow 23:30 Metro Sports


Dra. Mimi Wahyuni, Lingk III Blok C, No 21 Kel. Nelayan Indah, Medan Labuhan

3 1 4 8 2 7 6 B 5 9 0

07:00 Ultraman Nexus 07:30 Dufan The Defender 08:00 Pokemon Best Wishes 08:30 Film Anak Indosiar 10:30 KISS Pagi 11:30 Patroli 12:00 Sinema Pintu Taubat 14:00 Hot KISS 15:00 Fokus Sore 15:30 Hikmah Kisah Nyata 16:00 Sinema TV Sore 18:00 Drama Seri Indonesia: Aku Bukan Anak Haram 19:00 Sinema Indonesia: Si Bunta Dari Lembah Hantu 20:00 Sinetron Unggulan: Damar Wulan 21:00 Take Me Out Indonesia 23:00 Sinema Unggulan

06:30 SL Inbox 08:45 Hot Shot 10:00 SCTV FTV Pagi 12:00 SL Liputan 6 Siang 12:30 SCTV FTV Siang 14:30 SL Super Boy Indonesia Final Show 16:30 SL Liputan 6 Petang 17:00 Bidadari-Bidadari Surga 18:00 Si Cemong 19:30 Cinta yang Sama 21.00 Emak Ijah Pengen Ke Mekah 21:30 Opening Barclays Premier League 22:30 FTV SCTV

1 7 0 B A 8 6 2 5 3 8 4 B 1 2 0 7 5 3 9

07.00 Apa Kabar Indonesia 08:00 Soccer One 08:30 Tinju Legendaris 10:30 Hot Sport 11:00 Menuju Brasil 11:30 Kabar Siang 12:00 TBA 12:30 Property In Harmony 13:00 Damai Indonesiaku 15:00 Khazanah Islam 16:00 Bukan Jalan-Jalan Biasa 17:00 Kabar Petang 19:30 Sentra Laga 22:00 Kabar Malam 22:30 Menyingkap Tabir

Pemenang TTS Berhadia Minggu Lalu


Irfan Wahyudi Ritonga, Jln Pijer Podi, Gg Tarigan No. 41 F


07:00 Spongebob Squarepants 07:30 New York Minute 09:30 Arjuna 10:00 Obsesi 11:00 Buletin Indonesia Siang 12:00 Fun Teenlicious 12:30 Takeshi Castle 13:30 Eksis 14:00 Masquerade 14:30 Fokus Selebriti 15:00 Sine TV 17:00 Spongebob Squarepants 17:30 Spongebob Squarepants 19:00 Komeng AcakAdul 20:00 Big Movies 22.30 Big Movies

07:30 Mozaik Islam 08:00 Street Food Chef 08:30 My Trip My Adventure 09:00 Survivor 09:30 Buah Hati 10:00 Ala Chef 10:30 Ngulik 11:00 Insert 12:00 Bioskop Indonesia Premiere 14:00 Sketsa 14:45 Insert Investigasi 15:30 DR OZ 16:30 Reportase Investigasi 17:00 Andai Aku Kamu 17:30 Info Temen 18:00 Love War 19:00 Mission X 20:00 Yuk Keep Smile 22:30 Bioskop TransTV 00:30 Bioskop TransTV

07:00 Fish N Chef 07:30 Selebrita Pagi 08:30 Like A Chef 09:00 Setiap Minggu Seru 10:30 Wolipop 11:30 Redaksi Siang Akhir Pekan 12:00 Selebrita Siang 12:30 Galeri Sepakbola Indonesia 13:30 One Stop Football 14:00 Highlights MotoGP 14:30 Mancing Mania 15:00 Seleb Expose 16:00 Redaksi Sore 17:00 CCTV 17:30 5 Juta 5 Menit 18:00 Gila Makan 19:00 THEATER 7 21:00 Mister Tukul 22:00 KOTAK: R ock Never Die 23:30 [Masih] Dunia Lain 00:30 THEATER 7


WASPADA Minggu 24 November 2013

Medan Metropolitan


Dua Karyawan PT GM Curi Voucher Senilai Rp300 Juta MEDAN (Waspada): Dua karyawan PT Granton Marketing (GM) yang mencuri voucher senilai Rp300 juta dari perusahaannya ditangkap Reskrim Unit Ekonomi Polresta Medan dalam penyergapan di Jln. Platina Medan, kemarin.

Waspada/Rudi Arman

KASAT Reskrim Polresta Medan Kompol Jean Calvijn Simanjuntak (dua kanan) didampingi Wakasat AKP Yudi Frianto (dua kiri) dan Kanit Ekonomi AKP Bambang Ardy (kanan) serta Panit Ekonomi menunjukkan voucher senilai Rp300 juta saat ekspos di Polresta Medan, Sabtu (23/11).

Pencuri Betor Babak-belur MEDAN (Waspada): Berdalih mencari uang untuk biaya pernikahan, pemuda MS ,27, warga Jln Yon Zipur, Kec Medan Helvetia, nekad mencuri beca bermotor di Jln. Benteng, PasarVII, Tembung, Kec Percut Seituan, Kamis (14/11). Akibatnya, MS dipukuli warga hinggababakbelurdanselanjutnyadiserahkankePolsekPercutSeituan. Informasi yang diperoleh di kepolisian, tersangka MS yang berjalan kaki melintas di depan gudang botot milik Hendrik ,33, di Jln Benteng, Pasar VII, Tembung dan melihat ada betor Astrea Grand BK 2519 DB terpakir. Karena situasi sepi, spontan timbul niat MS untuk mencuri betor tersebut sekaligus membawanya kabur. Namun, baru saja menghidupkan mesin betor tersebut, ternyata aksi pelaku diketahui oleh seorang pekerja gudang botot sekaligus berteriak maling. Warga sekitar yang mendengar teriakan tersebut, langsung melakukan pengejaran, dan pelaku berhasil ditangkap warga, tepat di jembatan Pasar IV, Tembung. Begitu tertangkap, pelaku pun dipukuli oleh puluhan warga hingga babak belur. Petugas Polsek Percut Seituan yang mendapat informasi adanya pelaku pencurian yang dihakimi massa, langsung datang ke lokasi. Petugas memboyong pelaku beserta barang bukti 1 unit betor ke markas Polsek Percut Seituan untuk proses secara hukum. (h04)

1.000 lembar dan lainnya diperkirakan mencapai Rp300 juta,” kata Calvijn. Dalam melakukan aksinya, kedua tersangka merusak pintu kantor, rantai pintu putus dan pintu lemari dirusak untuk mengambil barang-barang yang dicuri. Terbongkarnya kasus ini lanjutnya, pada 30 Oktober 2013 datang Jensen bekas karyawan PT GM memberitahukan kepada perusahaannya bahwa voucher milik PT GM ada padanya didapat dari tersangka NA. “Dari keterangan Jensen ini pihak PT GM melalui Putri Kurniasari membuat laporan polisi ke Polsek Medan Baru LP/ 2605/IX/2013/SU/Polresta

Medan/Sek. Medan Baru tanggal 12 November 2013 tentang pencurian,” kata Kompol Calvijn. Berdasarkan laporan ini lanjutnya, polisi melakukan pencarian terhadap tersangka dan menangkapnya saat berada di Jln. Platina Medan. Sementara itu, tersangka TKmengaku,melakukan pencurian karena sakit hati dengan atasannya di PT. Granton Marketing. ” Kami curi sekitar 2 bulan dan menjualnya di kota Medan. Kami jual harga satu map voucher Rp100 ribu sedangkan kalau dibeli dari Mickey Holiday Rp3 juta. Kami jual cepat agar laku,”kata TK. (m39)

Gelapkan Rp1,8 Miliar Material Huawei Ingan Habibie Pane Divonis 7 Bulan

Smartphone Oppo Android Gelar OPPO Goes To Campus MEDAN (Waspada): Sebagai vendor smartphone asal china yang produknya sedang laris di pasaran, OPPO terus memperkenalkan produksi terbaru di antaranya dengan menggelar OPPO Goes To Campus di Medan beberapa waktu lalu. ManagerTrainerOPPOIndonesiaFirmansyahmengatakan,OPPO Smartphone merupakan perusahaan yang baru mengembangkan sayap di dunia ponsel pintar di Indonesia. Sebelumnya perusahaan ini terlebih dulu dikenal melalui alat pemutar cakram (Blu-Ray). Dikatakan, sebelum Oppo android Smartphone diperkenalkan, terlebih dulu mahasiswa dibekali pengetahuan dari pakar teknologi pikiran sekaligus Consultant and Coach OPPO Medan, Mr. Candie Willy. Dalam kegiatan itu Candie mengatakan sebelum mahasiswa menyaksikan perkenalan Oppo Smartphone, mahasiswa haruslah pintar serta terbebas dari segala pikiran negatif. “Saat ini banyak orang tidak menyadari sebenarnya ada banyak masalah di pikiran dan emosi. Penderita stres berat, susah tidur, phobia, gugup, khawatir yang berlebihan, dan psikosomatis hanya bisa diatasi dengan teknologi pikiran seperti Neuro Linguistic Programming (NLP), Quantum Healing, Hypnotherapy, bukan dengan obat. Karena obat hanya menunda sakit bukan mencari masalah, sehingga pelatihan singkat ini perlu saya berikan kepada mereka agar tidak terlarut dalam stress,” kata Candie. (m39)

Kedua tersangka NA, 18, warga Jln. Madong Lubis Medan dan TK, 20, warga Jln. Brigjen Katamso Medan kemudian diboyong ke Polresta Medan dan dijebloskan dalam sel tahanan. Dari tersangka disita barang bukti buku penjualan, DDR CCTV, voucher Yai 674 lembar, voucher Takigawa/modem SPA

214 lembar, voucher Space 181 lembar, voucher Mickie Holiday 485 lembar, satu waterpark, Inul vista dan Happly, Ipod, buku tabungan BCA dan handphone seluruhnya bernilai Rp300 juta. Kasat Reskrim Polresta Medan Kompol Jean Calvijn Simanjuntak didampingiWakasat AKP Yudi Frianto dan Kanit Ekonomi AKP Bambang Ardy saat ekspos, Sabtu (23/11) mengatakan, peristiwa pencurian ini terjadi 15 Oktober 2013 sekira pukul 23:00 di kantor PT GM di Jln. Punak No. 15-A Sekip Medan. “Barang yang hilang di kantor tersebut voucher Yai 1.300 lembar, Takigawa 250 lembar, Space 276 lembar, Mikie Holiday


DEPUTI Manajer Komunikasi dan Umum PLN UIP I Rajiman (kanan) saat menyerahkan bantuan berupa 5 unit komputer kepada Ketua YLPK Erbansa Horman P Hutagaol didampingi pembina Merlyn Simanjuntak, Kamis (21/11).

PLN UIP I Bantu YLPK MEDAN (Waspada): General Manager PLN Unit Induk Pembangunan (UIP) I Didik Mardiyanto diwakili Deputi Manajer Komunikasi dan Umum Rajiman menyerahkan bantuan kepadaYayasan Lembaga Pelatihan Keterampilan Komputer (YLPK) Era Baru Anak Nusantara (Erbansa) Jalan Mangkara Medan, Kamis (21/11). Bantuan 5 unit komputer diterima KetuaYLPK Erbansa Horman P Hutagaol, SE didampingi Pimpinan Program YLPK Erbansa Franky Hutagaol dan Pembina YLPK Merlyn Simanjuntak. Rajiman menyampaikan pesan GM PLN UIP bahwa sumbangan yang diberikan untuk membantu dan mendorong lembaga pendidikan Erbansa meningkatkan keterampilan anak didik dalam upaya mencerdaskan anak bangsa. “Lembaga pendidikan Erbansa yang merupakan pelopor dunia pendidikan luar sekolah perlu didorong. Karena mereka mendidik calon-calon tenaga kerja yang memiliki pengetahuan IT dan manajemen,” ujarnya yang didampingi staf Humas PLN UIP I Sugeng Prayitno. Sementara itu, Ketua Yayasan Erbansa Horman P Hutagaol yang juga tokoh pemuda Sumut menyampaikan terimakasih atas bantuan manajemen PLN kepada Erbansa. Dia berharap ke depan kerjasama ini dapat ditingkatkan lagi. Horman menjelaskan, YLPK Erbansa membina dua program yaitu pelatihan tenaga kerja ke Jepang dan pelatihan teknik komputer dan dilaksanakan secara gratis. “Setiap gelombang diikuti 20 peserta dalam pelatihan komputer dan desain grafis. Kegiatan ini untuk melatih siswa kurang mampu di segi sosial ekonomi”, katanya. (m41)

MEDAN (Waspada) : Melakukan penggelapan 2.600 item material proyek milik PT Huawei Tech Investment (HTI) senilai Rp1,8 miliar, Mantan Project Engineer PT HTI Ingan Habibie Pane, 29, divonis tujuh bulan penjara di Pengadilan Negeri (PN) Medan, Rabu (20/11). Vonis terhadap terdakwa lebih ringan daripada tuntutan Jaksa Penuntut Umum SO Vera Tambun SH, MHum, yang menuntut satu tahun penjara, dalam sidang perkara itu sebelumnya. Ketua Majelis Hakim, Sun Basana Simatupang, SH, M. Hum yang memimpin sidang menyatakan, terdakwa Ingan Habibie Pane telah terbukti secara sah dan meyakinkan bersalah melakukan penggelapan dalam jabatannya selaku Project Engineer PT Huawei Tech Investment di Gudang terdakwa Jln. Krakatau Gang Ikhlas Medan. “Tindakan terdakwa Ingan Habibie Pane telah melanggar Pasal 374 junto 53 KUHP, tentang penggelapan dalam jabatan,” kata Hakim Sun Basana saat membacakan vonis terdakwa Ingan yang telah diberhentikan secara tidak hormat sebagai Project Engineer PT Huawei Tech Investment Cabang Medan. Majelis Hakim memberikan waktu kepada terdakwa selama tujuh hari untuk mengajukan pernyataan menerima atau menolak atas vonis tersebut. Majelis hakim juga meminta agar terdakwa mengembalikan lap-

top merek Lenovo yang menjadi barang barang bukti kepada korban PT HuaweiTech Investment. Kuasa Hukum PT Huawei Tech Investment Akmal Handi Ansari Nst SH dan Johannes Lumbangaol SH dari Kurniawan & Associates menilai vonis majelis hakim tersebut jauh lebih ringan dari tuntutan JPU

mengingat nilai kerugian materi yang diderita kliennya dari kasus penggelapan yang melibatkan terdakwa Ingan Habibie Pane sangat besar. “Dalam tuntutan JPU telah dijelaskan bahwa terdakwa terbukti secara sah dan meyakinkan mengambil barangbarang material proyek kemu-

dian disimpan di gudang milik terdakwa di Jln. Krakatau Gang Iklas Medan. Atas perbuatan yang dilakukan terdakwa tersebut, klien kami mengalami kerugian mencapai Rp1,8 Miliar,” ujar Akmal didampingi Christian Jahiras Hutauruk-Sitac & Legal Specialist PT HTI. (m38)

Waspada/Surya Efendi

RAZIA KENDARAAN: Polantas menyetop pengendara wanita saat melakukan razia kendaraan bermotor di Jl. Balaikota simpang Jl. Raden Saleh Medan, Jumat (22/11). Catur Prasetya Watch, sebuah lembaga pengawas kinerja polisi memberi aplaus karena polisi gencar melakukan razia dijalanan beberapa hari terakhir. Namun mereka menilai masih banyak oknum aparat penegak hukum tersebut yang belum profesional menjalankan tugasnya guna mengayomi, melayani dan membuat nyaman masyarakat.



WASPADA Minggu 24 November 2013

Waspada/Dio Utama Nasution

Erupsi Sinabung pada siang hari.

semburan debu vulkanik & lahar dingin sinabung Dalam beberapa minggu terakhir Gunung Sinabung di Kab. Karo, Sumatera Utara, bertubitubi menyemburkan debu vulkanik maupun lahar dingin. Ketinggian hingga 10 ribu meter, karena tertiup angin, debu Sinabung mencapai kawasan Deliserdang dan pinggiran Kota Medan yang berjarak 80 km. Erupsi terjadi pada malam, pagi, siang maupun sore hari. Enam ribu lebih warga disekitar kaki Gunung Sinabung hingga kini masih mengungsi. Entah sampai kapan. Rumah maupun ladang mereka ditinggal, sejumlah hasil kebun dan sawah rusak. (Dio Utama Nasution)

Waspada/Surya Efendi

Waspada/Dio Utama Nasution

Semburan lahar dingin Sinabung.

Erupsi Sinabung pada malam hari.

Waspada/Arianda Tanjung

Kota wisata Berastagi diselimuti debu vulkanik.


Waspada/Surya Efendi

Waspada/Surya Efendi

Menuju pengungsian.

Hasil kebun maupun pertanian rusak.

Kirim hasil karya beserta biodata singkat, keterangan foto & foto diri ke :

Askar Marlindo

Jeny Indrajaya SIBAYAK: Komunitas BPM bersiap-siap mendaki Gunung Sibayak di Kab. Karo, Sumut.

TRIP: Siswa SMP dan SMA Al Bukhari Muslim saat trip ke balai tanaman hortikultura Tongkoh Berastagi.

Hasri Dwi Manda ISTANA: Keceriaan mahasiswi Universitas Al-azhar Medan mengunjungi Istana Maimoon Medan



24 November 2013

Pacquiao Andalkan Kecepatan MACAU, China (Waspada): Manny Pacquiao mengungkapkan dirinya bakal mengandalkan kecepatan untuk merobohkan Brandon Rios dalam duel di kelas Welter di Macau, China, Minggu (24/11) ini. Petinju Filipina yang Desember lalu harus mencium kanvas setelah dikalahkan Juan Manuel Marquez pada ronde keenam, menyatakan pemenang di duel ini akan ditentukan oleh siapa yang mampu melancarkan pukulan masuk terlebih dahulu.

“Saya fokus pada kecepatan dan beberapa teknik berbeda yang bisa saya terapkan untuk meladenigayanya,”kataPacquiao sebagaimana dikutip BoxNation, Sabtu (23/11). “Dia seorang petarung yang sangat agresif, tapi saya lebih ce-

patdaridia.Kecepatandankekuatan akan menjadi kunci untuk memenangkanduelini.Kamimemilih Rios karena dia lawan terbaik bagi saya dan kami dapat memberikan aksi seru untuk para penonton,” ucapnya. Manny Pacquiao punya motivasi baru jelang meladeni Brandon Ríos. Bukan hanya mengusung spirit kemenangan untuk rakyatnya yang belum lama ini diderabadaiHaiyan,tapijugaaroma perhitungan akibat pelatihnya, Freddie Roach, diejek oleh tim Ríos. Sebelumnya, sempat terjadi perkelahian antara Roach dan tim Ríos yang awalnya disebabkan ejekan Alex Ariza, mantan

pelatih fisik Pacman yang kini bersama tim Ríos dengan mengungkit-ungkit penyakit Parkinson yang diderita Roach. Perkelahian itu pun sempat menyebabkan Roach terjengkang akibat tendangan Ariza. Pacquiao yang tahu kejadian itu, dikatakan Roach akan bikin perhitungan. Bukan dengan cara serupa, tapi di atas ring dengan berambisi mempermalukan Rios dengan kemenangan KO cepat. “Pacquiao bilang pada saya, “Apa orang-orang itu mengejek Anda? Saya jawab ya dan dia bilang lagi, “Hanya itu yang perlu saya ketahui”, dan dia pun pergi. Dia mengatakan bahwa dia akan mengurus orang-orang ini de-

Mantan PSMS Ungguli Kurnia MEDAN (Waspada): Mantan PSMS mengandaskan perlawananKurniaMedanCity4-3dalam laga lanjutan Piala Mantan PSMS di Stadion Kebun Bunga Medan, Sabtu (23/11). Kedua tim langsung tampil menyerang, sejumlah peluang emas pun tercipta. Saktiawan Sinaga membuka keunggulan Mantan PSMS di menit 15. Tak lama berselang, Kurnia langsung membalas lewat gol Didi Firmasyah menit 25. Babak kedua, Mantan PSMS kembalimeningkatkanserangan. Menit44,JuandaMayadimecetak gol dari sisi lapangan lewat tendangan kerasnya. Namun Kurnia kembali mampu menyamakan skor lewat gol Rahmad Hidayat menit 49. Salingberbalasgolpunterjadi, Zulkarnain memperbesar keunggulanMantanPSMSmenit52dan Rahmad Hidayat mencetak gol ketiga bagi Kurnia menit 54 untuk mengubahskor3-3.MantanPSMS memastikan kemenangan berkat gol Saktiawan menit 70. Asisten Pelatih Mantan PS-

Waspada/Arianda Tanjung

PEMAIN Mantan PSMS, Saktiawan Sinaga, melewati hadangan pemain Kurnia Medan City dalam laga lanjutan Piala Mantan PSMS di Stadion Kebun Bunga Medan, Sabtu (23/11). MS, Irwanto, menilai permainan yang ditampilkan kedua tim berimbang.“Jualbeliseranganterjadi pada pertandingan ini, hanya saja tim lawan lengah menjelang akhir babak kedua,” katanya.

Pelatih Kurnia Medan City, MAgung,mengakuikematangan permainan Mantan PSMS. “Barisan pertahanan kami kurang disiplin, inilah yang menyebabkan striker lawan leluasa mene-

bar ancaman,” ujar Agung. Minggu (24/11) ini, PS Kwarta berhadapan PSAD pukul 14:30 WIB dan All Star Binjai melawan Langkat Selection pukul 16:30 WIB. (m33/cat)

MEDAN (Waspada): Trio Pelatih Pro Duta FC, Slamet Riyadi, Ansyari Lubis, dan M Halim, tetap dipertahankan menangani klub berjuluk Kuda Pegasus dalam mengikuti kompetisi hasil unifikasi liga musim depan. “Masalah kontrak mereka bertiga tetap berjalan, karena setahu saya kontrak mereka masih panjang,” ujar Chief Executive Officer (CEO) Pro Duta FC, Wahyu Wahab, Sabtu (23/11). Dikatakan, ketiganya tetap dipertahankan pihak manajemen, karena sukses mereka menghantarkan Pro Duta ke kompetisi hasil unifikasiligamusimdepan.Selainitu,trio pelatihinijugasudahlama berada di Pro Duta. “Yang masih menganjal dari ketiga pelatih ini adalah masalah sertifikasi kepelatihan.Tapi kalau itu memang masih bisa dikejar sebelum liga bergulir atau kemungkinan lainnya mencari pelatih kepala yang baru,” beber Wahyu. Soalkontrakpemainmasihbanyakbelumditandatanganisampai sekarang,Wahyumengakubelummendapatlaporansoalitu.“Kalau sayapribadi,maunyamerekatetapdipertahankan.Tapiitu tergantung pemain, mau hengkang atau bertahan,” lanjutnya. (cat)

Jalan Beregu Gajah Mada Binjai BINJAI (Waspada): Ratusan siswa SD, SMP,dan SMA Perguruan Gajah Mada Binjai mengikuti lomba jalan beregu dalam rangka Hari Guru dan HUT PGRI, Sabtu (23/11). Koordinator Perguruan Gajah Mada Binjai, Aidil Alamsyah, mengatakan lomba jalan beregu diikuti 30 regu. Di pos yang ditentukan, peserta memperoleh pertanyaan seputar wawasan kebangsaan, sehingga kegiatan ini tidak sekadar dinilai dari variasi barisan, tetapi penilaian ditambah dengan kemampuan regu dalam menjawab berbagai pertanyaan. “Dalam kegiatan ini, kami ingin menambah wawasan dan menanamkan rasa kebangsaan, sekaligus meningkatkan solidaritas sosial para pelajar Perguruan Gajah Mada,” ujar Aidil. (a04)

10 Petinju Bireuen Siap Tanding BIREUEN (Waspada): 10 petinju Pertina Kabupaten Bireuen siap bertanding dalam ajang Prakualifikasi Pekan Olahraga Aceh (Pra Pora) 2013 di Takengon, Aceh Tengah, awal Desember nanti. “Untuk memantapkan persiapan, para petinju terus menjalani latihan intensif di GOR Glumpang Payong dan Lapangan Kie Ban Jonif-113/JS Bireuen,” ujar Pelatih Pertina Bireuen, Joniful Bahri didampingi Asisten Pelatih Dendi, Sabtu (23/11). Ke-10 petinju yang akan diturunkan dalam Pra Pora adalah M Haikalkelas46kg,SaladinAlgayubi(49kg),EdiWibawa(52kg),Wahyudi (56 kg), Fakrulrazi (60 kg), Irwansyah (64), Ilham S (69 kg), Nurmasyah (75 kg), Ari K (81 kg), dan Dendi Setiawan (91 kg). Dikatakan, para petinju yang sudah berlatih sejak Oktober lalu, diharapkan tampil maksimal, sehingga dapat lolos seleksi Pra Pora 2013, sekaligus tampil dalam ajang Pora 2014 . (b12)

Problem Catur

Putih melangkah, mematikan lawannya empat langkah.

Waspada/Sukri Falah Harahap

TIM PS Batangtoru diabadikan bersama Sekdakab, Kadispora, dan Ketua KONI, setelah menjuarai turnamen HUT Pemkab Tapsel, Jumat (22/11).

PS Batangtoru Kampiun Sepakbola HUT Tapsel Ke-63 BATANG ANGKOLA (Waspada): Persatuan Sepakbola Batangtoru (PSB) menjuari turnamen antar-kecamatan dalam rangka HUT Pemkab Tapanuli Selatan di Lapangan Muaratais II, Kecamatan Batang Angkola, Jumat (22/11). Tim binaan Camat Ahmad Raja Nasution ini di final menumbangkan PS Sayurmatinggi lewat drama adu tendangan penalti 54. Adu penalti dilakukan setelah kedua tim bermain tanpa gol di waktu normal 90 menit. Laga final berlangsung di bawah guyuran hujan lebat. La-pangan yang berjarak sekira 200 meter di seberang Jl Istana Sultan Baharuddin itu, menjadi becek dan berlumpur, sehingga kedua tim kesulitan mengembangkan permainan. Permainan keras diperagakan kedua kubu, sehingga wasit wanitabersertifikatnasional,Qori, berulangkalimeniuppluitpertanda pelanggaran dan mengeluarkan empat kartu kuning. Keduatimsalingjualbeliserangan,tetapiselalupatahdiwilayah pertahanan lawan. Faktor utamanya bukan karena kuatnya benteng pertahanan lawan, melainkanlajubolakeraptertahankarena lapangan becek dan berlumpur. Ratusan penonton berteriak

kesal, karena serangan demi serangan yang dibangun kedua tim yang nyaris membuahkan gol, selalu mentah di depan gawang. Laga pun berakhir tanpa gol. Dalam drama adu penalti, tendangan kempat pemain PS Batangtoru gagal berbuah gol. PSSayurmatinggisudahgagal di tendangan ketiga. PS Batangtoru pun ke luar sebagai juara setelah sepakan keenam PS Sayurmatinggi dimentahkan kiper Batangtoru. Bupati Tapsel, Syahrul M Pasaribu, diwakili Sekdakab Aswin Efendi Siregar, mengatakan turnamen ini digelar setiap tahun atau tepatnya pada peringatan HUT Pemkab Tapsel. Event ini untuk menjaring pemain andal yang bakal memperkuat tim Persatuan Sepakbola Indonesia Tapanuli Selatan (Persitas) yang telah lama vakum. Kadispora Tapsel, Ginda Uli Pasaribu,menegaskandari14tim kecamatanyangbertanding,tidak satu pun diperbolehkan membawa pemain luar kecamatan. “Selaku panitia pelaksana, sejak awal kita mewajibkan seluruh tim memainkan pemain asli putra daerah kecamatan masing-masing. Ada satu tim peserta yang cobamelanggarnya,kitalangsung diskualifikasi,” terangnya. (a27)


Harapan Bangsa 25 November PSSI Verifikasi 19 Stadion JAKARTA (Waspada): PSSI segera melakukan inspeksi terhadap stadion-stadion markas calon klub yang akan diverifikasi untukunifikasiligamusimdepan. Ada 19 stadion yang akan dicek langsung oleh PSSI. Stadion merupakan syarat dari infrastruktur yang menjadi bagian penting penilaian klub agar bisa diverifikasi dan mendapatkanlicensing. Selain itu, klub juga diwajibkan memenuhi beberapa aspek lainnya, antara lain administrasi dan personal, sporting, legal, dan financial. PSSI pun meminta klubklub mengajukan nama stadion yang dijadikan markas untuk dilihat kelayakannya. Proses

Pro Duta Pertahankan Trio Pelatih

Jawaban di halaman A2.

ngan cepat,” beber Roach. Brandon Rios sendiri optimis dapat mengalahkan Pacquiao. “Pencapaian Pacquiao sudah hebat. Tak ada yang bilang tidak, karena dia sudah memenangkan gelar di lima kelas. Tapi maaf Filipina, sudah waktunya dia pensiun, ini eranya saya,” ujar Ríos. “Saya ingin mengalahkan yang terbaik untuk jadi yang terbaik serta dikenal sebagai salah satu petinju terbaik dunia. Oleh karena itulah saya ingin kemenangandipartaiini,”tuntaspetinju kelahiran Lubbock 27 tahun silam itu. (m42/ok)

pengecekan bakal dilakukan oleh tim verifikasi. ‘’Kami akan mulai melihat stadion minggu ini. Yang pasti kami melihat dari segi lapangan dan sekretariatnya. Setelah itu, laporannya kami kumpulkan untuk dibawa ke rapat Komite Eksekutif,’’ ujar Ketua Departemen Licensing Club PSSI, Tigor Shalomboboy, Sabtu (23/11). Berdasar jadwal, Stadion Harapan Bangsa yang direkomendasikan oleh Pro Duta akan menjadi stadion pertama dilihat. Tigor menyebut kemungkinan pihaknya akan menghabiskan waktu 10 hari untuk melakukan pengecekan stadion-stadion tersebut. (m42/ini)

Jadwal Pengecekan Stadion Stadion Harapan Bangsa (Pro Duta/25 November) Stadion Haji Agus Salim (Semen Padang/26 November) Stadion Tuah Pahoe (Persepar/26 November) Stadion Wilis (Persela/26 November) Stadion Gelora Bumi Kartini (Persijap/27 November) Stadion Persiba Balikpapan (Persiba Balikpapan/27 November) Stadion Brawijaya (Persik/27 November) Stadion Gajayana (Persepar/ 28 November) Stadion Sultan Agung (Persiba Bantul/28 November) Stadion Gelora Mandiri (PSM/28 November) Stadion Singaperbangsa (Pro Duta/28 November) Stadion Andi Mattalatta (PSM/29 November) Stadion Gelora Bung Tomo (Persebaya/29 November) Stadion Gelora 10 Nopember (Persebaya/30 November) Stadion Krakatau Steel (Persita/30 November) Stadion A. Yani (Persepam/1 Desember) Stadion Bandung Lautan Api (Persib/1 Desember) Stadion Surajaya (Persela/2 Desember) Stadion Si Jalak Harupat (Persib dan PBR/2 Desember)

Brayen Kuasai Kelas 130 Cm Kejurnas Berkuda Piala Pangdam Jaya JAKARTA (Waspada): Brayen Brata Coolen tampil sebagai yang terbaik di kelas 130 cm open Kejurnas Equestrian memperebutkan Piala Pangdam Jaya 2013, di Kompleks Pacuan Kuda Pulomas, Jakarta Timur, Sabtu (23/11). Riderasal Aragon Horse Racing & Equestrian Club ini, tampil menawan dengan membuat dua kali clear round untuk memastikan gelar juara kelas bergengsi. Dalam pertandingan ini, sempat terjadi persaingan ketat dengan rider asal Pegasus Stable-DKI Jakarta, Joko Susilo yang juga tampil gemilang dan mencatat clear round.

Hal tersebut membuat pemenang harus ditentukan melaluijumpoff’ dengan posisi papan rintangan dinaikan 10 cm dari sebelumnya. Hasilnya, Brayen yang menunggang kuda bernama Chris de Rose, kembali membuat clear-round dan memastikan gelar juara, menyusul penampilan lawannya yang justru melakukan kesalahan pada lompatan terakhir. Sebelumnya, pada kelas 110 cm senior, gelar juara direbut Joko Susilo (Pegasus) dengan mengungguli beberapa rider lainnya, termasuk rekan satu timnya Raymen Kaunang. Padahal, kelas ini diikuti 12 peserta, terma-

sukridersenior Aragon dan Ferry Sudarmadi. Untuk lelas 110 cm junior, tampil juara Samuel Sampurno Prawiro (kuda Saltador/Pegasus Stable-DKI Jakarta) dan runnerup JohannWahyu Hasmoro Prawiro (Desert Snow/Pegasus Stable-DKI Jakarta). Pangdam Jaya, Mayjen TNI EHudawiLubis,dalamsambutan tertulisnya dibacakan Kesdam Jaya, Brigjen TNI Agung Risdhianto MDA, berharap penyelenggaraan kejuaraan berkuda kali ini tidak terbatas meningkatkan prestasi atlet, melainkan jugamembangkitkanminatolahraga berkuda di tengah-tengah

masyarakat. Kejuaraan ketangkasan berkuda tingkat nasional kali ini dalam rangka memperingati HUT Pangdam Jaya ke-64. Setidaknya 124 atlet dengan 111 kuda tampil di dua nomor, yakni tunggang serasi(dreases)danshowjumping yang berlangsung 22-24 November 2013. Ajang kali ini cukup kompetitif, karena diikuti delapan Pengprov Eqina Pordasi, yakni DKI Jakarta sebagai tuan rumah, Jawa Barat, Jawa Tengah, Banten, Riau, Yogyakarta, Kalimantan Selatan, Maluku Utara, serta beberapa klub equestrian nasional. (yuslan)

CSR BRI Agro Diusulkan Bantu Sepakbola Nasional RANTAUPRAPAT ( Waspada): Corporate Social Responsibility (CSR) atau tanggungjawab sosial perusahaan BRI Agro Rantauprapat, bakal diusulkan fokus untuk membantu pembinaan olahraga sepakbola daerah setempat. “Saatini,belumadaCSRBank Agro yang difokuskan ke sepakbola. Tetapi ada baiknya wacana ini dimasukkan ke pihak pengambil keputusan di Jakarta, agar menjadi skala prioritas,” ujar Kepala Cabang BRI Agro Rantauprapat, Kukuh Afra Adi, di selasela menyaksikan Turnamen U21 Tunas Muda di Rantauprapat, Sabtu (23/11). Kukuh yang juga pemerhati sepakbola itu, mengatakan jika CSRperbankandifokuskanuntuk sepakbola, tentu akan ada keuntunganyangdiperolehperbankan, tetapi besar kecilnya keuntungan dari CSR yang disalurkan, baru dapat dilihat setelah dilakukan evaluasi selama 12 bulan pascapenyaluran CSR. “CSR bisa disalurkan dengan adanya tunamen terjadwal setiap bulan, sehingga hasilnya terukur. Ada kesamaan antara perbankan

Waspada/Armansyah Abdi

TIM sepakbola Perisai Rantauprapat diabadikan bersama Kacab BRI Agro Rantauprapat, Kukuh Afra Adi (kaus putih) di Lapangan Poslab, Sabtu (23/11). dan sepakbola nasional, sehingga diperlukan perbaikan dan pembangunan SDM dan infrastruktur, sesuai promosi yang hendak dibangun. Karena itu, harus ada perhatian agar BRI Agro bisa bersaing dengan perbankan nasional,” katanya. Bicarasepakboladanperban-

kan,lanjutnya,pemainsepakbola yang memiliki kemampuan baik, berpotensi direkrut menjadi karyawan perbankan setelah pensiun dari dunia olahraga. Tetapi juga harus didukung kemampuan akademik agar dapat direkrut ke lingkungan perbankan, terutama di bidang kehumasan.

“Karena di bidang kehumasan perbangkan itu diperlukan orang yang cukup dikenal, seperti pemain bola. Misalnya Evans Dimas, ketika dia pensiun dari sepakbola, bisa saja nanti turut mempromosikan instansi perbankan,” beber pria kelahiran Jakarta tersebut. (a18)



WASPADA Minggu 24 November 2013

Trend Positif MU MANCHESTER (Waspada): Manchester United (MU) bertekad untuk terus melanjutkan catatan positif mereka dengan menarget empat kemenangan secara beruntun di Liga Primer Inggris ketika bertandang ke markas Cardiff City, Minggu (24/11) malam ini pukul 23:00 WIB (Live SCTV) Dalam laga ini, gelandang MU Marouane Fellaini, punya kesempatan besar membuktikan kemampuannya untuk tampil bersama Wayne Rooney cs. Hal ini dinyatakan oleh mantan gelandang MU Mickey Thomas dalam MUTV, Sabtu (24/11). Menurut mantan pemain The Red Devils 1978-1981, cedera Achilles yang memaksa Carrick absen selama enam minggu 10 hari ini menjadi kesempatan baik bagi Fellaini untuk membuktikan kehebatannya di lini tengah yang selama ini dipandang sebelah mata oleh banyak orang. Mantan pemain Everton ini diboyong ke Old Trafford Stadium dengan harga 27,5 juta pounds atau setara Rp 467,8 miliar. Pembelian pemain asal Belgia ini pun dinilai boros oleh banyak orang. Sejak kedatangannya musim panas lalu pemain berusia 26 tahun ini sempat mengalami cedera pergelangan tangan pada Oktober lalu dan baru dimainkan enam kali. “Secara pribadi, saya rasa hal ini (cedera Carrick) akan memberikan kesempatan kepada Fellaini untuk membela skuad utama dan menunjukkan permainan terbaik,” ujar Thomas. “Saat dia di Everton, dia secara efektif membuat United kehilangan juara liga pada 2012

lalu dengan penampilannya di Old Trafford, (imbang 4-4),” pujinya kepada eks pemain Everton. “Dia mampu menciptakan serangan yang kita butuhkan di lapangan,” tutupnya. Selain menjadi kesempatan emas bagi Fellaini, laga kontra Cardiff City juga memberikan kesempatan mengumpulkan poin bagi kubu David Moyes setelah kemenangan 1-0 kontra Arsenal di laga sebelumnya, yang menempatkan Red Devils di peringkat lima klasemen sementara. Rekor Buruk Cardiff memiliki rekor buruk saat bertemu MU sejak meraih kemenangan 3-0 pada November 1960. Sejak itu, kedua tim lantas bertemu sebanyak lima kali dengan partai terakhir dimenangi oleh United pada Maret 1975 dengan skor 4-0. Pelatih Malcolm Mackay tentu bertekad untuk bangkit setelah mengalami kekalahan 2-0 dari AstonVilla sebelum jeda internasional, sebagaimana kala itu mereka tumbang lewat golgol dari Leandro Bacuna dan Libor Kozak yang menghadirkan kekalahan kelima mereka di Liga Primer musim ini. Hasil tersebut membuat tim asal Wales itu bertengger di urutan ke-14, dengan koleksi 12 poin dari 11 pertandingan sejauhini.Malkayakanmenyam-

but kembalinya striker Andreas Cornelius ke skuatnya, setelah sebelumnya tidak disertakan lantaran mengalami cedera engkel kala bertemu Accrington Stanley di ajang Piala Liga, Agustus silam. Mantan striker West Brom Peter Odemwingie juga diragukan kondisinya

menyusul cedera ringan yang ia dapati kala berlatih bersama The Bluebirds. Sementara performa MU akhir-akhir ini bisa dibilang bagus mengingat mereka telah mengumpulkan 20 poin dari 11 pertandingan di mana kondisi seperti itu pernah membawa

Sony Melenggang Ke Final Hongkong Open Super Series


HONGKONG (Waspada): Perang saudara antara Sony Dwi Kuncoro (foto) kontra Tommy Sugiarto di babak semifinal Hongkong Open Super Series harus terhenti di tengah jalan. Tommy memutuskan mundur lantaran mengalami cedera. Sony dan Tommy berduel di babak semifinal demi memperebutkan satu tiket final di Hongkong Coliseum, Sabtu (23/ 11). Sayang, Tommy gagal melanjutkan pertarungan hingga usai lantaran cedera, sehingga terpaksa memberikan tiket final ke Sony. Dalam laga tersebut, kedua pemain sempat menunjukkan permainan menarik di game pertama. Sony langsung melejit dengan keunggulan 5-1, namun

Tommy sempat memperkecil ketertinggalan menjadi 10-13 di pertengahan game. Namun, dominasi Sony yang bermain lebih baik, kembali terjadi sebelum akhirnya menutup game pertama dengan keunggulan 21-14. Di game kedua, Tommy mulai merasakan ketidaknyamanan pada kakinya. Alhasil, putra dari legenda hidup bulutangkis Indonesia, Icuk Sugiarto ini harus menyerah dan memilih mundur pada pertengahan game kedua, lantaran mengalami cedera kaki. Tommy menyerah dalam kedudukan tertinggal 3-8. Dengan hasil ini, Sony pun berhak menggenggam tiket final untuk menghadapi pebulutangkis nomor satu dunia, Lee


STRIKER Manchester United Robin van Persie (kiri) dan Wayne Rooney.

Chong Wei yang sebelumnya sudah memastikan tempat usai menaklukkan Boonsak Ponsana. Sementara pebulutangkis nomor satu dunia Lee Chong Wei belum menemui kendala berarti pada kejuaraan Hong Kong Open Super Series 2013. Chong Wei baru saja memastikan tempat di babak final usai menyudahi perlawanan pebulutangkis Thailand, Boonsak Ponsana. Chong Wei nampaknya masih terlalu tangguh buat Bonsak. Pasalnya, dalam duel kedua pemain di HongKong Coliseum, kemarin, pebulutangkis Malaysia ini tidak menemui kendala berarti. Chong Wei yang unggul segala-galanya membungkus kemenangan lewat straight game, 21-12 dan

21-7 dalam tempo 34 menit. Pembenahan Indonesia gagal menempatkan wakil ganda putri ke babak semifinal Hongkong Open Super Series 2013 setelah dua pasangan ditaklukkan para unggulan. Sektor pertahanan pun menjadi fokus pembenahan ganda putri. Dalam laga perempatfinal yang berlangsung di Stadion Hongkong Coliseum, Jumat (22/11), pasangan muda Anggia Shitta Awand/Della Destiara Haris dihadang unggulan kedua, Kamilla Rytter Juhl/ Cristinna Pedersen (Denmark), 14-21, 13-21. Sebelumnya ada Vita Marissa/Variella Aprilsasi juga terhenti di tangan unggulan ketiga dari Jepang, Misaki Matsutomo/Ayaka Takahashi, 1821, 10-21. Pelatih ganda putri, Bambang Supriyanto, menilai pertahanan anak asuhnya masih cukup lemah. “Anggia/Della harus memperbaiki pertahanan mereka yang kurang rapat. Pasangan top dunia rata-rata punya pertahanan yang kuat dan serangan yang bagus,” kata Bambang Supriyanto pada situs PBSI. “Pertahanan kami memang mesti diperbaiki lagi, harus banyak latihan lagi,” Anggia menambahkan. Tak bisa dipungkiri, Juhl/Pedersen memang menang pengalaman. Pasangan ranking dua dunia ini juga lebih dijagokan ketimbang Anggia/ Della yang kini bertengger di posisi 102 dunia. “Karena merasa tidak yakin dengan defense kami, jadi kami sering ragu-ragu saat mengangkat bola. Lawan yang lebih berpengalaman, mereka selalu tahu apa yang harus dilakukan di lapangan,” pungkas Della. (m18/pbsi/okz)

The Red Devils mengklaim gelar Liga Primer meski kala itu perolehan poinnya lebih rendah pada tahapan yang sama di tiga kesempatan. Tim tamu kali ini memiliki permasalahan di sektor tengah dengan Michael Carrick yang takkan bermain karena meng-

alami cedera tendon achilles dan Phil Jones yang absen lantaran terkendala masalah di kunci paha. Moyes sendiri berharap untuk bisa menurunkan Nemanja Vidic setelah sebelumnya ditarik keluar saat meladeni Arsenal lantaran mengalami benturan,


phile, Caulker, Turner; Taylor; Medel, Whittingham, Cowie, Gunnarsson; Bellamy dan Odemwingie. Manchester Un i t e d ( 4 - 4 - 2 ) ; De G e a ; Smalling, Evans, Vidic, Evra; Jones, Carrick, Valencia, Kagawa; Wayne Rooney dan Robin van Persie. (m18/euro/ okz)

MEMPHIS, AS (Waspada): San Antonio Spurs terus melanjutkan tren positif mereka di pentas NBA musim ini. Tony Parker dkk baru memetik kemenangan ke sembilannya secara beruntun usai menaklukkan tuan rumah Memphis Grizzlies. Bertandang ke FedEx Forum, Jumat malam waktu setempat atau Sabtu (23/11) WIB Spurs tampil gemilang. Dimotori Tony Parker dan Tiago Splitter, Spurs mendominasi di paruh pertama dengan keunggulan 51-37. Keberhasilan Spurs unggul jauh ini tak lepas dari cederanya center Grizzlies Marc Gasol di kuarter kedua dan tidak bisa melanjutkan pertandingan. Kendati tanpa Gasol, Grizzlies ternyata masih mampu memberikan perlawanan. Penggantinya, Kosta Koufos mampu menunjukkan performa ciamik. Sebuah lay up yang dilakukannya setelah menerima operan Tony Allen membuat kedudukan sama kuat 59-59 di pertengahan kuarter ketiga. Bahkan Grizzlies berbalik unggul 79-78 saat laga menyisakan 6:37 detik di kuarter terakhir. Sayang, momentum tersebut tidak mampu dipertahankan kubu tuan rumah. Parker yang bermain buruk di kuarter ketiga, mampu kembali ke bentuk permainan terbaiknya. Dia memimpin timnya 23 poin,

berbanding 8 milik Grizzlies untuk membawa Spurs menang 102-86. Parker tampil sebagai pendulang poin terbanyak di kubu Spurs dengan koleksi 20 poin. Sementara top performer diraih Manu Ginobili yang tampil 15 poin, lima rebound dan tujuh assist. “Kami tetap menjaga ketenangan kami dan tidak panik. Kami hanya mencoba terus menampilkan permainan kami menghentikan mereka mencetak poin,” kata Parker tentang kunci sukses timnya membalikkan ketertinggalan pada menit-menit akhir pertandingan. “Dia (Parker) membuat keputusan hebat, merebut bola dan melibatkan semua orang. Dia menguasai lapangan dan melakukan pekerjaan yang benar-benar baik,” pelatih Spurs memuji kinerja Parker di laga ini sebagaimana dikutip Yahoosports, Sabtu (23/11). Bagi Spurs, ini merupakan kemenangan keenamnya secara beruntun atas Grizzlies termasuk di laga pra musim. Sebelumnya, Spurs menyapu bersih kemenangan atas Grizzlies pada final wilayah barat, musim lalu dan kemenangan di laga pra musim. Dengan kemenangan ini, Spurs pun mencatatkan rekor terbaiknya di awal musim ini, dengan memetik 11 kemenangan dan hanya sekali menelan kekalahan. (m18/okz)

Spurs Cetak 9 Kemenangan Beruntun


PEBASKET San Antonio Spurs Tony Parker (9) dari Perancis menguasai bola dan coba dihalangi pebasket Memphis Grizzlies’ Mike (11) dalam lanjutan Kompetisi NBA di Memphis, Tenn, Sabtu (23/11). Parker memperoleh 20 poin untuk kemenangan Spurs 102-86 atas Grizzlies.

Cedera Messi Lebih Parah BARCELONA (Waspada): Bintang Barcelona, Lionel Messi, harus menepi selama enam hingga delapan pekan karena cedera hamstring. Menurut kabar, cedera La Pulga lebih parah dari yang diperkirakan. Mundo Deportivo melaporkan, pemain asal Argentina itu kemungkinan harus absen lebih lama dari yang diperkira-

kan sebelumnya. Otot hamstring Messi dikabarkan robek sepanjang 6 cm. Awalnya,Messidiprediksibisa kembalimerumputdipekanawal bulan Januari. Namun, dengan kondisi yang diungkap koran Spanyol tersebut, tampaknya pemainberusia26tahunituharus absen sedikit lebih lama. Beberapa hari lalu, Messi

Rossi Ikut Rally Monza

MOBIL yang akan digunakan Valentino Rossi.

sementara Rafael (engkel) dan Robin van Persie (jari kaki dan kunci paha) diharapkan juga bisa terlibat, namun pertandingan ini tampaknya datang terlalu dini bagi DannyWelbeck (lutut). Prakiraan pemain Cardiff City (4-4-2): Marshall; Theo-

MONZA (Waspada): Meski kompetisi MotoGP telah berakhir, Valentino Rossi nampaknya belum bisa santai menikmati liburan. Sepanjang pekan ini, rider Yamaha Factory ini akan ambil bagian pada balapan Rally di Monza. Rossi akan mengikuti ajang Monza RallyShow 2013, akhir pekan ini. Rossi akan menggunakan mobil Ford Fiesta RSWRC dan akan berusaha mengulangi suksesnyanya pada 2012 di mana dia tampil sebagai juara ketiga. “Ini sesuatu yang kami tunggu sepanjang tahun. Musim MotoGP sudah berakhir dan ini (rally) merupakan kegiatan yang selalu kami lakukan,” tutur Rossi sebagaimana dikutip Speed,

Sabtu (23/11). “Ini adalah kompetisi, ada adrenalin, tapi pada saat bersamaan ini menyenangkan, karena ini seperti permainan dan tidak ada tekanan. Tahun lalu berjalan bagus, dan tahun ini medannya semakin kuat. Jadi, kami mengincar hasil bagus, tapi intinya adalah untuk kesenangan,” tandasnya. Dalam balapan kali ini, Rossi akan bersaing dengan para pembalap rally tangguh, seperti Dani Sordo dan Dindo Capello yang menggunakan mobil Citroen DS3 WRC. Pembalap hebat lainnya seperti Alessandro Perico danTony Cairoli juga akan ikut ambil bagian dalam ajang ini. (m18/okz)

hadir dalam penyerahan penghargaan Sepatu Emas. Saat itu, ia mengatakan tak lagi merasakan rasa sakit. Saat ini, ayah satu anak itu tengah menjalani perawatan dengan bantuan fisioterapis Argentina, Luis Garcia, tiga kali sehari. Messi diprediksi bisa bermain saat Barcelona menghadapi Elche 5 Januari mendatang. Tapi, keinginannya sesegera mungkin merumput tampaknya harus tertunda. Pelatih Barcelona Gerrardo Martino memanggil pemain muda dari Barcelona B. Namun, bukan hanya Messi yang absen karena cedera. Masih ada beberapa nama yang dipastikan menghilang dari skuad utama. Lima pemain lain yang absen karena cedera adalah Jordi Alba, VictorValdes, Isaac Cuenca, Xavi

dan Cristian Tello. Untuk mengantisipasinya, Martino memutuskan memanggil dua pemain muda dari Barcelona B, Adama Traore (17 tahun) dan Jean Marie Dongou (18 tahun). “Meski prematur, kami memutuskan memanggil dan memasukkan mereka ke dalam tim utama demi memberikan menit bermain di laga kompetitif. Kami kehilangan beberapa pemain pilar, tapi pemain pengganti yang ada juga bagus,” kata Martino, dilansir dari Football Espana, Sabtu (23/11). “Adama dan Dongou adalah pemain yang tampil bersama Barcelona B. Adama mungkin salah satu pemain muda yang paling menjanjikan sementara Dongou cukup baik sebagai pemain sayap . (m18/ini)


WASPADA Minggu 24 November 2013


Tampil Edgy Dengan 5 Tas Ransel

FOREVER 21 Tas ransel kulit dari Forever 21 ini cocok digunakan saat pergi bersama teman atau pasangan. Ukuran tas yang tidak begitu besar cocok bagi Anda yang hanya ingin berpergian ke mal atau kampus. Tas warna hitam itu bisa dibeli melalui tokonya yang ada di Indonesia. Harganya sekitar Rp 400 ribuan.

KINI wanita senang berekspresi sesuai kepribadian mereka. Tidak selalu tampil feminin dengan tas tangan yang membuat penampilan terlihat lebih manis, beberapa wanita masih senang memakai tas ransel. Tas punggung dengan material kulit cocok bagi Anda yang suka tampil edgy. Ini dia lima pilihannya.

JUICY COUTURE Tas ransel hitam ini dibuat dari material nylon dan kulit untuk pinggirannya. Tas ini memiliki hiasan rantai pada bagian depan. Terdapat dua saku di kanan dan kiri tas untuk menyimpang pernak-pernik yang biasa Anda bawa ketika berpergian. Tas tersedia dalam tiga warna, hitam, merah muda, dan biru. Tas bisa dibeli melalui situs belanja online Zappos dengan harga Rp 2 jutaan.

GUESS MARC BY MARC JACOBS Ada pula tas ransel kulit dari Marc Jacobs. Tas berwarna nude ini bisa memuat berbagai perlengkapan gadget serta makeup Anda. Tas bisa dibeli melalui situs net a porter dengan harga sekitar US$ 612 atau Rp 7 jutaan.

Tas ransel kulit dari Guess ini cocok digunakan ketika berpergian bersama teman-teman tapi tidak untuk membawa banyak barang. Tas memiliki desain yang simpel dan membuat penampilan Anda kelihatan lebih edgy. Tas tersedia dalam tiga warna, hitam, merah, dan cokelat. Ransel Guess bisa dibeli melalui tokonya di Indonesia. Tas dijual dengan harga Rp 1 jutaan.

TOPSHOP Ransel kulit hitam dari Topshop ini juga bisa menjadi pilihan Anda yang suka tampil edgy. Tas tersebut memiliki desain simpel dan bertekstur. Tas bisa dibeli melalui situs resminya atau datang langsung ke tokonya. Harga tas sekitar Rp 1,3 jutaan. NZ/Wlp

Lebih Gaya Dengan Busana New Shine SADAR atau tidak, saat ini baik remaja maupun orang dewasa berlomba-lomba untuk berbusana sebaik mungkin agar terlihat lebih ‘gaya’ di depan relasi atau teman mereka.

Natural Dengan Kebaya BANYAK faktor yang harus diperhatikan dalam menentukan warna kebaya. Salah satunya adalah waktu. Terutama untuk kebaya pengantin, masalah waktu ini sangat berpengaruh. Bila pesta yang diadakan pagi atau siang, sebaiknya anda menggunakan warna-warna soft seperti off white atau broken white, kuning gading, beige, warnawarna pastel, atau dusty. Tema acara juga menentukan pemilihan warna. Untuk akad nikah atau pemberkatan, umumnya orang Indonesia memilih warna putih karena melambangkan kesucian. Meski demikian, dengan putih sebagai patokan, sebenarnya Anda masih bisa memilih silver, baby pink, bahkan abu-abu yang sangat muda. Faktor penting lain yang memengaruhi pemilihan warna adalah warna kulit. Anda yang memiliki kulit lebih terang tentu saja lebih beruntung karena memiliki pilihan yang lebih beragam. Dibandingkan mereka yang berkulit gelap atau kecokelatan, yang mana merupakan warna kulit kebanyakan wanita Indonesia. Meskipun, menurut Marga Alam, salah satu perancang kebaya, ‘’Untuk mereka yang berkulit sangat gelap, sebenarnya belum tentu tidak pantas memakai warna menyolok, terkadang kulit gelap justru terlihat cantik bila memakai warna yang lebih bright.’’ Namun kebanyakan wanita berkulit cokelat, memang cenderung memilih warna aman, seperti warna kulit, warnawarna pastel, merah muda, peach. Warna-warna dusty seperti dusty pink juga kerap menjadi pilihan, seperti dikatakan Riny Suwardy yang juga perancang kebaya, ‘’Warna dusty bisa menjadi pilihan untuk mereka yang berkulit gelap, karena cenderung memberi kesan bersih.Atau warna abu-abu dengan campuran payet akan terlihat lebih terang di kulit yang gelap.’’ Hingga saat ini, kebaya dengan warna keemasan masih menjadi favorit, baik itu murni keemasan atau dipadukan dengan warna-warna lain. Mengapa? Selain pantas dikenakan oleh setiap orang dengan warna kulit apa pun, warna emas juga melambangkan sesuatu yang anggun, elegan, aristokrat dan mahal. Kesan yang hendak dihadirkan oleh kebanyakan pengantin wanita. Oleh sebab itu, tak heran bila kebaya dengan nuansa keemasan sering menjadi pilihan. Bentuk Tubuh Banyak sekali hal yang harus diperhatikan dalam pembuatan kebaya bila menyangkut bentuk badan. Pemilihan bahan mulai dari jenis dan motif, warna, model kebaya, cutting termasuk bustier. Untuk yang bertubuh langsing biasanya tidak ada masalah, Anda memiliki kebebasan memilih bahan,

model, bahkan warna, kecuali Anda tidak percaya diri menggunakan warna-warna tertentu. Masalah timbul pada Anda yang memiliki tubuh besar. Mulai dari pemilihan bahan pun harus lebih hati-hati, seperti disebutkan di atas, hindari organdi. Selain itu juga hindari bahan polos yang tembus pandang, hanya akan menampakkan kelebihan lemak di tubuh Anda. Pilihlah bahan bermotif, karena dengan begitu, perancang akan mudah menutupi lemak dengan motif tersebut. Bustier memegang peranan penting dalam pembuatan kebaya, terutama pada bagiandada,pinggang,danpanggulpertama. Setiap perancang akan memusatkan perhatiannya pada bustier terlebih dulu untuk mendapatkan siluet yang sempurna, setelah itu kebaya akan mengikuti bustier. Pada saat pembuatan bustier, koreksi terhadap bentuk badan akan dilakukan. Mereka yang memiliki payudara kecil akan diangkat dan diisi agar terlihat lebih besar. Untuk yang siluet badannya cenderung lurus, bagian dada dibuat lebih besar, bagian pinggang dibuat yang benar-benar pas, sehingga akan terlihat langsing. Tak hanya itu, besar payudara yang tidak sama persis pada setiap wanita pun dikoreksi, bagian mana yang lebih kecil akan diisi sehingga terlihat sama besar. Akan tetapi, pemakaian bustier umumnya hanya untuk kebaya formal di mana waktu pemakaiannya hanya beberapa jam. Untuk para ibu yang mengenakan kebaya hampir sehari penuh, biasanya tidak bersedia mengenakan bustier karena akan merasa tidak nyaman. Oleh karena itu sering diganti dengan longtorso yang jauh lebih elastis. Tips Tidak semua wanita mempunyai bentuk tubuh proporsional. Bila Anda datang kepada perancang kebaya yang sudah cukup berpengalaman, mereka akan mempelajari di mana kekurangan Anda dan menutupinya dengan berbagai cara sehingga akan terlihat sempurna. Namun, ada baiknya Anda membekali diri dengan sedikit ilmu sebelum memutuskan untuk menjahitkan kebaya. Salah satunya adalah bila Anda merasa memiliki kelebihan lemak di berbagai tempat, pilihlah warna dan model kebaya yang aman. Jangan sudah gemuk, lalu memilih bahan tile yang polos untuk bagian tangan. Hasilnya lengan Anda yang besar pun akan lebih terlihat. Lace dengan motif konvensional merupakan pilihan bahan paling tepat, karena dapat menyamarkan lemak. Bila merasa risi karena bahan lace biasanya bolong-bolong, gunakan furing dari bahan sifon tipis dengan warna yang senada. (H)

Beranjak dari keinginan serta kemajuan masyarakat yang cukup pesat itu, took busana New Shine hadir dengan menawarkan berbagai busana yang berbeda dengan butik lainnya. Mulai dari busana sepetti Blues, Dress, Long Dress, dan Pants turut menghiasi butik yang beralamat di Grand Paladium, Medan ini. Sejak dibuka beberapa tahun lalu, pelanggan toko busana tersebut terbilang meningkat, terbukti setiap harinya banyak masyarakat yang berkunjung, apalagi jika akhir pekan. Pengunjung dapat memilih berbagai busana yang diimpor dari luar negri seperti Hongkong dan Korea Selatan dengan variasi warna yang menarik. Jangan khawatir harga yang ditawarkan dijamin nggak menguras kantong kok. “Kami di sini menawarkan busana dengan harga terjangkau dengan kisaran Rp 200 ribu hingga Rp 500 ribu,” ujar pemilik toko Cindy kepada Waspada, Jumat (22/11). Tak hanya busana, New Shine juga menawarkan sejumlah asesoris berupa kalung, gelang, anting, sepatu, dan tas dengan beragam warna dengan harga Rp 100-300 ribu. *m31



WASPADA Minggu 24 November 2013

Wanita Berpengaruh Yang Sukses Mengurus Rumah Tangga D

ULU, kodrat seorang wanita memang hanya untuk mengurus suami dan anak-anak di rumah. Tetapi zaman sudah berubah. Emansipasi wanita sudah merajalela. Sekarang banyak wanita mandiri, apa-apa dilakukannya sendiri. Sedangkan peran lelaki untuk memberi dorongan dan motivasi bagi mereka. Tidak lepas dari kodrat wanita, menjadi seorang ibu memang menjadi impian setiap wanita. Menjadi seorang ibu adalah anugerah luar biasa. Wanita jaman sekarang tidak harus tinggal di rumah untuk mengurus suami dan anak mereka. Mengurus suami dan anak bukan menjadi alasan suksesnya seorang wanita. Malah banyak wanita yang berpengaruh pada negaranya juga sukses mengurus rumah tangga dan menjaga penampilan mereka. Bisa Anda bayangkan seberapa super duper sibuknya mereka ? Siapa saja sih wanita tangguh itu ?

Michelle Obama 2009-2013. Menikah dengan Bill Clinton, wanita kelahiran 1947 itu dikaruniai seorang putri tunggal bernama Chelsea Clinton. Tugas negara yang diemban beliau tak menyurutkan hasratnya untuk tetap tampil cantik dan sukses membesarkan anak. MICHELLE OBAMA Wanita berumur 49 tahun ini adalah istri presiden kulit hitam pertama Amerika Serikat. Michelle LaVaughn Robinson atau dikenal dengan nama Michelle Obama tersebut pernah menjadi ibu negara paling modis versi salah satu media. Menjadi ibu negara apalagi ibu negara dari negara sekaliber Amerika Serikat pasti tak mudah. Sosok ibu negara adalah sosok panutan, entah itu dari segi sikap maupun penampilan. Kepadatan jadwal acara kenegaraan sang suami tak membuat wanita ini lantas acuh kepada anak mereka. Meskipun jadwal padat, dapat terlihat bahwa Michelle sukses mengurus rumah tangga mereka. Pun terlihat dari foto-foto yang kerap tertangkap oleh media. Michelle dan suaminya, Barrack Obama sering berfoto bersama 2 putri mereka. Keluarga yang harmonis ya Ladies.

Hillary Clinton HILLARY CLINTON Nama yang satu ini sudah benar-benar mendunia. Istri dari Presiden Amerika Serikat tersebut menjadi ibu negara selama jangka waktu yang lumayan lama. Dia menjadi ibu negara selama 8 tahun dari tahun 1993-2001. Sudah bisa Anda bayangkan betapa sibuknya beliau. Tak hanya itu, wanita ini ternyata masih menjabat sebagai menteri luar negeri Amerika Serikat sejak tahun

Park Geun-hye

PARK GEUN-HYE Lihat jug wanita yang satu ini, juga tak diragukan lagi ketangguhannya. Dia menjadi presiden wanita pertama di Korea Selatan di usianya yang ke 60 tahun. Bahkan wanita ini juga berjanji akan mempersatukan rakyat Korea. Seperti yang kita tahu Korea terpecah menjadi dua, yakni Korea Selatan dan Korea Utara. Di usianya yang ke 60, beliau masih terlihat lebih muda dari usianya. Namun sayang sekali, wanita ini tidak mempunyai suami dan anak. Walaupun begitu, wanita ini inspiratif ya ? Mengajarkan kita tak ada kata terlambat untuk sesuatu. Di mana semua orang saat usia senja sudah seharusnya dirawat oleh anak mereka, wanita ini malah masih baru dilantik menjadi seorang presiden wanita pertama Korea Selatan. YINGLUCK SHINAWATRA Wanita yang satu ini tak kalah hebat. Adalah Yingluck Shinawatra, wanita pertama yang menjadi perdana menteri Thailand. Sepak terjang wanita cantik ini dalam dunia politik tak lagi diragukan. Menjadi seorang perdana menteri, apalagi bagi seorang wanita tak ayal adalah pekerjaan yang menyita waktu. Dengan banyaknya acara negara yang harus diikutinya, penampilan Yingluck pun diperhitungkan. Ternyata Ladies, wanita yang dikaruniai seorang putra ini dipercaya menjadi wanita berpengaruh paling cantik dan fotogenik.

Ani Yudhoyono

ANI YUDHOYONO Siapa yang tidak tahu ibu yang satu ini ? Ibu negara kita tercinta, Indonesia. Menjadi seorang istri presiden sangat amat tidak mudah Ladies. Jadwal suami yang terlampau padat membuat sang istri harus siap sedia menemani. Tampil di setiap acara negara juga harus membuat beliau selalu menjaga penampilan. Kegiatan yang super padat tak menghalangi beliau untuk tampil tetap cantik. Istri orang nomor satu di Indonesia ini pun sukses membesarkan dua putra mereka, Agus Harimurti Yudhoyono dan Edhie Baskoro Yudhoyono. Banyak sekali ya wanita berpengaruh ? Menjadi wanita memang tak harus tinggal di rumah dan diam begitu saja. Anda juga bisa sukses mengurus rumah tangga dan menjaga penampilan Anda di tengah kesibukan Anda yang menumpuk. Menjadi pahlawan tidak terbatas pada perjuangan otot untuk merebut kemenangan fisik semata. Kamu juga bisa jadi pahlawan bagi anak dan keluarga ketika secara konsisten berupaya menyediakan makanan yang memenuhi kebutuhan gizi keluarga dan sehat. Jika kamu adalah anggota sebuah komunitas, keberadaan kamu yang selalu “mempromosikan” dan menjalankan pola makan sehat adalah seorang pahlawan yang nyata. Nah, sekarang buka cakrawala mu dan jadilah wanita inspiratif, membangun keluarga dan lingkungan, meski sekecil apa pun itu. Yingluck Shinawatra

Berbagai sumber

Konsultasi Hukum Perkawinan Hari ini masalah perkawinan semakin rumit sehingga angka perceraian mengalami peningkatan setiap tahun. Namun perceraian merupakan perbuatan halal yang sangat dibenci Allah SWT. Rubrik ini berupaya membantu mencari solusi agar perceraian dapat dihindari, sebab perceraian tidaklah selalu solusi terbaik bahkan bisa jadi menimbulkan masalah baru. (Red)

Tupperware “Opportunity Hour”

Mengubah Hidup Wanita Menjadi Lebih Baik SIAPA tidak kenal Tupperware, perusahaan multinasional yang memproduksi produk plastik berkualitas untuk keperluan rumah tangga. Dalam beberapa tahun ini para ibu memilih produk ini karena lebih tahan lama dan bentuknya yang modis. Tupperware terus berkembang dan ada di lebih 100 negara. Di banyak negara, di antara perusahaan direct selling lain, Tupperware berhasil menempati ranking teratas. Dan saat ini mereka merambah ke user langsung dengan mengadakan berbagai kegiatan edukasi, salah satunya bersama Tim Penggerak PKK Pemerintah Kota Medan. Acara berlangsung di Gedung PKK Kota Medan, 15 November 2013 bertema Tupperware Opportunity Hour, Mengubah Hidup Wanita dan Keluarga Menjadi Lebih Baik, yang dihadiri tiga distributor Medan. Tujuannya tentu untuk mengedukasi kaum wanita agar berani serta percaya diri dalam mewujudkan impiannya. Enasari Sirait, salah satu distributor Medan kepada Waspada, Sabtu (23/11) mengatakan, kepedulian dan komitment Tupperware terhadap wanita Indonesia tidak akan berhenti dan tak tergoyahkan, seiring dengan semangat kemajuan yang mengalir di tubuh wanita Indonesia saat ini. Hal itu, kata dia, sejalan denga visi Tupperware, mendorong perubahan positif pada kehidupan kaum wanita. “Ada kekuatan luar biasa yang mampu mengubah hidup dan keluarga menjadi lebih baik dengan melakukan 3E, enlighten (pencerahan) educate (mendidik) dan empowerment (pemberdayaan). Ini lah yang dilakukan Tupperware, sehingga impian itu tercapai dan kaum wanita lebih percaya diri dalam meraih tujuannnya,” kata dia di damping distributor Medan lainnya, Emi Chandrawaty


Pengasuh : Dra. Hj. Erma Sujianti Tarigan, SH., MH. (Mediator Bersertifikat).

Z Pertanyaan alamatkan ke Email Litbang Waspada atau sms ke 08126030294.

Hendak Menjual Harta Warisan Untuk Menghajikan Orang Tua Tanya: Aswrwb. Saya pernah menceritakan masalah rumah tangga saya kepada ibu, Alhamdulillah sekarang rumah tangga saya baik-baik saja. Sekarang masalah saya begini buk, kedua orang tua saya sudah meninggal, ada meninggalkan sedikit harta berupa tanah dan rumah. Oleh abang kandung saya mau dijual semua untuk menghajikan kedua orang tua saya, sementara kami anaknya ada tujuh orang yang tiga orang lagi termasuk miskin tapi punya rumah (sederhana). Saya sendiri belum punya rumah, masih menyewa. Pertanyaan saya; apa hukumnya haji melalui orang lain, apakah sampai pahalanya kepada kedua orang tua saya, apa sah hajinya? Dari 085370346xxx


Tiga distributor Tupperware Medan bersama perwakilan pengurus penggerak PKK Kota Medan usai memberikan pendidikan (edukasi) kepada kaum ibu di Gedung PKK Kota Medan, belum lama ini dan Brenda Martha Christina. Tentang acara itu, kata dia, dihadiri perwakilan tim penggerak PKK Kota Medan, wakil ketua dan pengurus tim penggerak PKK Kota Medan, Ketua Tim Penggerak PKK Kecamatan Se-kota Medan dan Ketua Tim Penggerak PKK Kelurahan Se-kota Medan. “Kami berharap kegiatan ini dapat menyentuh kaum wanita dan membuka wawasan para ibu rumah tangga,” sebutnya mnegatakan kegiatan serupa akan dilakukan berkelanjutan.(m27)

Jawab: Waalaikumsalamwrwb. Jika orangtua sudah meninggal dunia maka yang harus disegerakan adalah membagikan harta warisannya sesuai Faraidh (setelah melunasi utang dan biayabiaya lainnya). Tentang adanya rencana salah seorang anak yang hendak menjual semuanya untuk menghajikan kedua orang tua Sdr/Sdri, semestinya melakukan musyawarah dengan semua ahli waris, siapa yang ingin membantu silakan, yang hendak membeli rumah silakan, jangan memaksakan kemauan pada yang lainnya. Tentang sah, tidaknya menghajikan orang lain, atau sampai-tidaknya pahalanya pada yang bersangkutan, tanyakan pada ahli agama, sebab hal itu bukan kompetensi saya. Salam.

Hendak Menceraikan Istri Tanya: Aswrwb. Buk Hj saya laki-laki, usia 27 tahun, saya menikahji janda anak satu, dia bekas anak malam. Kami sudah punya anak satu juga sekarang, orang tua saya tidak setuju, hidup kami pun susah, apa bisa saya menceraikan dia. Wassalam. Dari 085372223xxx Jawab: Waalaikumsalamwrwb. Perceraian merupakan perbuatan

halal yang sangat dibenci Allah SWT. Saudara telah menikahinya dan sudah mempunyai satu anak pula, maka yang harus Sdra lakukan adalah mintalah restu dari orang tua Sdra, dengan melakukan hal-hal yang terbaik dan disukainya, serta tetap berdoa agar Allah SWT melembutkan hati orang tua Sdra. Hidup susah dapat diubah dengan bekerja lebih rajin, ulet plus doa. Salam.

Suami Kembali Ke Agamanya Tanya: Aswrwb. Buk Hj saya seorang muslimah menikah dengan pria mualaf. Kami menikah sudah delapan tahun, mempunyai dua orang anak umur 7 tahun dan 2 tahun hasil pernikahan kami. Sekarang suami saya meninggalkan saya sudah empat bulan karena suami saya kembali ke agamanya yang dulu dan saya tidak mau mengikutinya. Pertanyaan saya; jika suami saya menceraikan saya apakah suami saya berhak mengasuh anak saya yang selama 4 bulan belakangan ini tidak dinafkahi, dengan agamanya yang sekarang dan apa haram hukumnya jika saya menuntut agar suami saya menafkahi anak anak saya. Wassalam. Dari 082161219xxx Jawab: Waalaikumsalamwrwb. Oleh karena dia kembali ke

agamanya semula maka sudah menjadi alasan yang kuat untuk bercerai, sebagaimana diatur di dalam Kompilasi Hukum Islam/ KHI Pasal 116 huruf (h). Jika Sdri mengajukan Gugat Cerai di Pengadilan Agama, maka Sdri dapat menuntut Hak Asuh/ Pemeliharaan/Hadhonah terhadap anak sebab usianya masih di bawah 12 tahun, belum Mummayyiz (belum dapat membedakan baik dan buruk), dan menurut hukumnya anak di bawah usia 12 tahun berada pada pengasuhan ibu kandungnya. Saudari dapat juga menuntut nafkah anak hingga si anak berusia dewasa, 21 tahun. Jika pekerjaan mantan suami bukan di sector/bidang yang haram seperti beternak babi, maka hasilnya juga halal. Namun jika Sdri merasa ragu soal halal-haram maka lebih baik Sdri bertanya pada ahli agama. Salam.

Apakah Cerai Hanya Dapat Dilakukan Suami?

Waspada/Neneng KZ REKTOR IAIN MANTU: Rektor IAIN Prof. Dr.H.Nur A Fadhil Lubis dan Dra. Mekar Sari Dewi menggelar resepsi pernikahan anak keduanya Naufal Dzaki Lubis,S.Sosdengan Poppy Lia Yulinda,S.Psi bertempat di Jl. Meteorologi Raya Komp Al Barokah yang dihadiri segenap Civitas Akademi di Sumatera Utara dan tokoh masyarakat.

Tanya: Aswrwb. Saya sering mendengar bahwa perceraian hanya dapat dilakukan oleh suami, tapi sering pula perempuan mengajukan Gugat Cerai, apa maksudnya buk. Terima kasih. N – Medan Jawab: Waalaikumsalamwrwb. Berdasar Kompilasi Hukum Islam (KHI)tepatnyaPasal114menyebutkanbahwaputusnyaperkawinan yang disebabkan karena perceraian dapat terjadi karena talak

atau berdasarkan gugatan perceraian. Hal yang sering kita dengar dan yang sebenarnya adalah bahwa hak talak ada pada tangan suami. Maksudnya, hanya suami yang dapat menjatuhkan talak terhadap istrinya, kenapa pada suami hak talak, jawabnya jika hak talak pada istri maka talak bisa jatuh tiap hari disebabkan sifat wanita emosional. Sedangkan istri dapat pula menceraikan suaminya dengan mengajukan Gugat Cerai di Pengadilan Agama, pengabulan permintaan istri untuk dijatuhkan talaq oleh suaminya selaku Tergugat oleh Hakim. Salam.


WASPADA Minggu 24 November 2013


Sjah Bandar Cerpen: Pilo Poly SIAPA yang tak kenal Bram. Di mata orang kampung dia adalah jarum dalam jerami. Selalu membuat onar di kampungkampung sebelah. Ia selalu membawa angin tak sedap ke kampungnya sendiri. Orangorang kampung sangat sering mendengar keluhan kampung sebelah lantaran Bram sering menelanjangi rumah-rumah mewah di kampung mereka. “Bram mencuri, Bram mencuri!” begitu kata masyarakat kampung sebelah. Tapi aneh, mereka selalu tidak menemukan bukti. Tapi orang-orang kampungnya tidak pernah mengerti apa tujuan Bram sebenarnya. Ia terlalu miskin untuk bisa menanak nasi, tapi ia terlalu kaya untuk selalu berbagi hasil curiannya kepada yang lebih miskin dari pada ia sendiri. Dan memang, uang, perhiasan, atau apapun yang ia curi, semua ia bagikan pada orang-orang miskin di mana pun. Ia juga hanya mencuri punya orangorang yang kaya dengan uang masyarakat. Seperti suatu waktu, entah bagaimana, Bram bisa meringsek masuk ke salah satu rumah di utara kampungnya. Ia pernah dengar dari obrolan-obrolan di warung kopi kalau ada orang baru yang tinggal di kampungnya dan ketahuan korupsi, tapi setiap diintrogasi oleh pihak keamanan, selalu ia berkilah, dan terlalu banyak orang yang mendukungnya bahwa orang itu tak mungkin melakukan hal yang memalukan itu. “Orang itu, kaya betul. Dalam sebuah berita, disebutkan bahwa ada di kampung utara satu rumahnya. Warna cokelat. Mobil sepuluh di dalamnya. Motor delapan. Dijaga tiga satpam bergantian!” Dengar Bram. *** Pada saat perang meletus. Presiden negara meminta masyarakat untuk bahu-membahu, baris-membaris di garda

terdepan untuk mengusir penjajah. Bram ketika itu sangat ingin berada di garda paling depan. Ia ingin sekali menyelesaikan setiap dosa dengan berperang fisabilillah di jalan Tuhan. Tapi ketika ia ingin melakukan semua itu, masyarakat kampung dengan tegas menolak kehadirannya. “Nanti yang ada kau akan membawa sial dalam kubu kami!” ucap salah satu kepala rombongan yang akan dikirim ke perbatasan. Bram murung, padahal telah ia mengakui semua kesalahannya dan berjanji tidak akan mengulang apa yang telah ia lakukan tempo dulu. Ia menangis, ia betul-betul cinta akan bangsa ini. Akan apa saja yang ada di tanah ini. Tapi masyarakat tidak mengerti bahwa ia mencintai bangsa ini dengan caranya sendiri. Dalam kekalutan yang dalam, Bram sangsi dengan niatnya. Ia memutuskan akan pergi meninggalkan kampung. Ia teringat pada Kencana. Sebelum Kencana dijemput Tuhan, ia sempat menitipkan sebuah alamat yang suatu saat akan bisa membantunya. Kencana adalah salah satu gurunya, ia juga pernah jadi tahanan politik. Politik yang kejam, jurang penindasan. Tanpa peradilan. Tanpa penelusuran. “Kau akan sampai di sana jika kau berangkat sebelum subuh dari tempatmu lahir, dua hari perjalanan, di sana kau akan banyak mendengar suara alam. Dan ketika itu matahari telah tergelincir menuju timur. Safak merah membelah langit. Awan

Karya: Siti Fatimah Sitepu

Membelai November Semerbak aroma bunga Berastagi membaur Campurmu dengan derai debur Sembahe Semakin engkau meneguk kopi jahe Menuai kepingan memori Sinabung hentakkan bilah Kabanjahe Hingga November akhir Jiwamu tak jua mendamai

Seputik Nasehat Seputik nasehat dikau lembahkan Danau kemesraan hilangkan keringnya kelam Muara kasih membelai mesra Demi sebuah masa depan Sejati angin menukil malam Engkau hias ia dengan keteduhan Karya: Ihsan Ahmed

Kita Satu Kita Sama Indonesia berbeda warna ras suku agama Sekolah ajarkan kita Bhineka Tunggal Ika (Tak ada beda hanya pandangan) Tuhan menciptakan dalam rahim bidadari Menangis dan tawa bumbunya (Tak ada beda hanya pandangan) Kenalkan persamaan pada pemimpin Kita satu kita sama

Karya: Reni Mulfiani

Ombak Gerhana (September 11, 2013)

buih geram membias ombak jernih air membakar mentari lalu lalang nelayan kian terpanjat terpaan angin laksana ikan-ikan kecil berkeliaran bermain ombak gerhana desiran pasir pantai menghujani air biru puncak ombak sejuta harapan titipkan melayang berbaur buihnya indah biasan surga bening mutiara tiada tara

Meraih Mimpi (Sepetember 14, 2013)

melihat burung timbul hasrat ini impianmencakarlangitpunmelayangdiangkasa suatu hari mereka akan menjabat tanganku kemenangan hanya ada padaku, laksana langit pun tunduk padaku, merasa semuanya mati, hanya suara yang tidak pernah mati suaraku pekikkan tepat di puncak angkasa menggelegar sayu membahana aku berlari di tengah keramaian orang bersorak menampar telingaku inikah mimpi itu? terus memenangkanku

Setelah Bram menempuh perjalanan dua hari melewati gunung, ia mulai mendengar pekikan burung yang kelaparan, jangkrik yang tak diam sepanjang jalan, pohon yang bergoyang karena tak henti diterpa angin, dan tanah yang licin diguyur hujan. Semua itu telah menjadi sahabat paling sejati untuknya. Lelah menyerang, asap dari pembakaran kayu terlihat diterbangkan angin, ada permainan Tuhanuntukmenentramkanhatinya. Ia teringat pesan Kencana. “Perjalanan tak jauh lagi.” Bram bersungut dalam hati. Ia menduga-duga. “Tapi di mana guru itu?” satu pertanyaan yang membuatnya tergelitik. Suara alam makin hilang. Safak di balik awan sudah redup. Lelahnya akan melahirkan malam. Sebentar lagi akan gulita. Penerangan yang ada baginya adalah berhenti atau berteduh di mana hatinya berkata. Barangkali ia akan melanjutkan perjalanan.Tapi ..., sebuah tepukan mengejutkan dirinya.

Karya: Anny Noor

Mengejar Mimpi Kala senja menggilir waktu Dan malam kian melaju Kubasuh jiwa nan dahaga Untuk menghilangkan penat sekujur raga

“Bram!” kata orang itu. Ubannya sebahu, janggut putih sejengkal membuat Bram kaget. Tapi Bram melihat keteduhan di mata lelaki yang bungkuk itu.Lelakiitumenggunakantongkat. “Ada kabar angin, katanya ada tamu jauh. Seorang dari Asahan. Dua hari perjalanan. Namanya berawalan Bram. Sudah pernah kulihat dalam mimpiku. Ketika seseorang hendak lepas dari dunia. Ciricirinya seperti engkau.” Kata orang tua itu sambil memperhatikan Bram dari ujung rambut sampai ujung kaki. “Iya.” hanya itu yang bisa dijawab Bram. Lalu tak ada pembicaraan lagi. Mereka saling diam. Sediam angin yang membawa pesan. Sediam malam melahirkan pagi. Barangkali sediam daun yang gugur lalu menyetubuhi tanah. Tapi yang sama sekali tak diam adalah hati Bram, hatinya bergemuruh kencang. Nyalinya berangsur ciut. Bibirnya sepucat mendung. Sejurus kemudian, ia mengikuti langkah orang tua itu. Langkah yang tegar, walau umur sudah bergetar di badan. Bram melihat semua itu. Lalu ia teringat lagi akan gurunya yang telah tiada. Kencana. ***

Bau minyak tanah. Cahaya lampu teplok, dan langkahlangkah kecil yang dulu ia dengar tak lagi membuat hatinya berdebar. Bram telah terbiasa dengan hal-hal dan suara-suara itu. Kegelapan yang menjadi tuan rumahnya sekarang adalah terang benderang yang tak terkira. Setelah pertemuan misteri dengan sang gurunya, ia juga semakin misteri. Banyak hal yang telah ia pelajari saat ini. Ia telah siap terjun pada perang sebenarnya. Ia akan turun gunung. Ia akan berperang dengan orang-orang kampung yang mencintai bangsanya. Sama seperti ia mencintai bangsanya dengan caranya sendiri. Ia telah melumatkan hatinya dengan fisabilillah. Ia telah ikhlas. “Bilang ke orang kampung, nama engkau sekarang adalah Sjah Bandar. Kau yang akan menuntun orang-orang kampungmu menuju kemenangan. Karena pada engkau telah kuturunkan segala ilmu. Hitam dan putih. Dan ingatlah! Segala ilmu yang kutenun dalam dirimu adalah kepunyaan Tuhan. Kesemua kepunyaan Tuhan itu harus kau jaga baik-baik. Kau terikat baiat. Kau terikat dengan banyak hal yang akan mem-

buatmu menderita jika tidak kau perngunakan untuk hal yang baik dan atas nama khalayak. Jangan kau menjadi sia-sia.” Sambil membungkus bajunya, Bram mencium tangan gurunya itu dengan hikmat. Ia ingin menangis, tapi kata gurunya, lelaki tak boleh melahirkan air mata. Bahkan di punggung orang mati sekali pun. Akhirnya ia terdiam. Gurunya menghilang. Berubah kupu-kupu, begitu ungu dalam mata Bram. *** Bram sampai di kampungnya, tapi tak ia dapatkan lagi peta lahirnya seperti sediakala. Rumah-rumah yang tegak dan gagah di tanah kampungnya dulu telah lebur bersama bersama aroma mesiu. Dilahap api berbulan-bulan. Lantas ia bertanya dalam hatinya. Kepada siapa ia hendak mengadu namanya telah diganti? Atau, siapa yang akan tahu bahwa ia yang akan membawa kemenangan pada perjuangan ini? Sambil berjalan, ilmu yang diajarkan gurunya ia hapal dalam hati. Mengerikan!Mengerikan!Setiapialewatikampungdemikampung. Sepanjang itu Bram menemukan desa-desa yang murung. Bram terus berjalan. Mele-


Dan ketika mentari menjelang Mulai meniti hari mengejar mimpi Untuk sebuah ketidakpastian Akankah terus begini. Waktu terasa cepat berlalu Menyisakan hari yang kian tak berarti Sementara usia beranjak senja

Karya: Zakiyah R Sihombing

Tua Haruskah kami mengetam diri Lalu membusuk dengan senyap Lihatlah gedung renta yang tak seberapa Ada luapan rasa yang berbeda Ketika hak yang serupa Dijadikan terlalu berbeda Bahkan hampir tak menyerupa Semampunyahanyamematutdoa,saja…

Muharam Aku lelah berlimpah resah Aku lelah dihimpit gelisah Tentang amukan jiwa yang bernoda Diri yang terlebih-lebih durjana Aku berdiam, muharam datang Lewati hari dengan mengingat-MU Bahwa tak ada yang sempurna Sesungguhnya seluruhnya fana Karya: Eymadyah

Kekasih Pengamen Kecil Dawai gitar mencercau tak karuan Bait lagu cinta terlantun Hmm, harusnya ia berceloteh Tentang abjad dan warna Tentang sekolah dan gurunya Benarkah takdir pilihkan sekolah perempatan jalan Danlampumerah,guruyangiabanggakan Tuk ajari waktu terbaik Lantunkan lagu-lagu cinta Pada kekasih yang beri mimpi-mimpi palsu Jika hari ini recehnya bisa beli secorong es krim

Kisah malam ini sungguh bermakna Banyak kenangan terjuntai manis padanya Aku berharap ada keajaiban cinta Hadir bersama sejuta cita Yang siap mengukir dengan senyuman bahagia

Bukan sakadar alasan mengantre embun di pucuk-pucuk pohon kering juga menunggu badai mengambrukkan ketegaran cuma ingin saja bersua-sua ria bilamana ada kata adalah pesan di daun layu

Karya: Yulia Tasnim

Takdir Karya: Dian Novita Sari

Karya: Sulaiman Rambe

Senyum Angkat Kaki

Di Persimpangan Jalan

Bahkan malam enggan singgah menyapamu Terlalu banyak bintang yang setianya kau abai PunRembulandenganbinarsemakintemaram Kunang-kunang jemu bercumbu di taman Cahayanya terus kau perah menerangi kisah Kau makin tak terkendali Sedang senyum mulai angkat kaki

Langkahku terhenti Pada satu titik persimpangan jalan Aku melihat seorang bocah dekil Sembari menggenggam mangkuk kecil

Kembara Sepi Dalam kembara sepi Kutemu damai disuguhkan malam Bersebab rindu yang hilang diujung ucap Pun nyali kian kalap kala waktu menyatu tatap Hati berderap ingin merayu Tapi malu terlalu angkuh Karya: Abd. Rahman M

Hampa Luka yang menganga di ujung waktu telah terlepas di nadi bimbang awan hitam menghantui langkahku hampa tanpamu

Purnama Rindu Meretas sudah masa itu yang selalu kau ungkit masa ini biarlah berjalan sedemikian waktu adakah masa lalu terbawa di sini adakah masa ini terbawa di waktu nanti purnama merindu aku yang dulu dan aku telah putuskan inilah masaku

Pakaiannya lusuh Kulitnya legam disengat panasnya pijar mentari Rambut kumal dan bau Hingga aku pun pergi menjauh Di persimpangan jalan lain Aku melihat wanita hamil tanpa suami Menjerit sambil menggenggam perut Namun karena tak kuasa menahan Ia pun terjatuh ke tengah jalan Di lindas mobil yang berlewatan “Tragisnya kehidupan”, ucapku sembari melanjutkan perjalanan Karya: Mirsan Simamora

Panggung Sandiwara Rumah-rumah telah terkunci rapat menutup diri dari harapan harapan seperti oasis di padang pasir yang dilantunkan para aktor panggung sandiwara untuk menjual janji-janji jalanan kian lengang dari pamplet-pamplet kejujuran kekuasaan telah dipertuan menghantui orang-orang pinggiran diri telah jadi boneka dari nafsu yang menjadi dalang.

Terimakasih atas atensi para penulis yang telah mengirimkan karya cerpen dan puisi ke Redaksi Harian Waspada. Pengiriman karya puisi dan cerpen melalui email:

Karya: Farida Sundari

Pesan Di Daun Layu

Perpisahanku kepada orang tua Membuat batin semakin tersiksa Semua karena perubahan hidup yang memaksa Perantauan tuk mencari sesuap nasi Kebahagian terhenti sejenak Aku pun mengembara di tempat orang Bekerja keras mengumpulkan uang Tapi tak kusangka fitnahan datang kepadaku Kini aku menjadi gelandangan yang tak beruntung

Terluka Aku tak pernah sesakit ini Ketika kau tikam aku dengan kata-katamu Seakan tak ada Tuhan dalam hidupmu Angkuh dan sombong Luka hatiku paling dalam Kau hanya diam Aku meradang dalam hati Bersembunyi dalam senyum palsu Jerit dan tangis batinku Tak berkesudahan

Karya: Suherlinda

Beberapa bulan setelah itu, tersiar kabar yang menakutkan bagi para penjajah-penjajah. Nama Sjah Bandar, pemimpin dari kampung selatan, telah membuat mereka harus waspada siang malam. Bahkan, di siang bolong saja mereka harus berhati-hati. Karena, para pejuang kemerdekaan tidak akan kompromi. Mereka akan menebas dan menembak di mana saja asal mereka lihat dan temukan penjajah-penjajah itu. “Orang itu, yang bernama Sjah Bandar, bagaimana pun caranya harus dilumpuhkan.” Kata seorang pimpinan perang pada sebuah forum rapat terbatas yang membahas tentang kekacauan yang dibuat Bram. “Tak mudah, Tuan. Dia, lelaki itu, penuh kharisma. Beberapa pejuang kita di utara telah dibuat kucar-kacir. Markasnya telah ditelanjangi. Bahkan, serdadu-serdadu kita yang ada di kampung asalnya telah dibumihanguskan!” beberapa petinggi lain yang ikut dalam rapat saling pandang. Suasana dalam gedung itu mendadak ketakutan. Apalagi saat mendengar bahwa, jangankan penjajah, orang pribumi yang bekerjasama dengan penjajah saja akan mereka minta pertanggungjawabannya. Suatu kali, Amir menanyakan dari mana Bram mendapatkan ilmu-ilmu itu. Ia hanya tersenyum. Lalu mengenang dua nama yang merdu dipikirannya. Tuhan dan Guru. “Kau akan sampai di sana jika kau berangkat sebelum subuh dari tempatmu lahir, dua hari perjalanan, di sana kau akan banyak mendengar suara alam. Dan ketika itu matahari telah tergelincir menuju timur. Safak merah membelah langit. Awan berubah hitam. Asap berterbangan memenuhi hidungmu. Kau akan merasakan kehadiran guruku.” Ia mengulangi pesan Kencana sepuluh tahun yang lalu pada Amir. Benar kata gurunya itu. Bahwa memang dirinya yang akan membuat sebuah perubahan dan kemenangan. Semua terjadi begitu cepat. Penjajah-penjajah itu angkat kaki dari negeri mereka. Mereka takluk oleh ribuan pemuda-pemuda yang ingin negerinya merdeka. *

Sejuta Cita


Aku tak ingin sia-sia Ingin aku bahagia Menata hati mengelus dada Hendak bersabar hingga tutup usia

Kisah Untuk Kasih Menyapu wajah di antara guratan cerita Damaikan duka Dendangan pohon cemara dan nyanyian nuri Bawa pulang kisah di bangku taman Losari Dan ukiran pasir jejak kaki Selangkah menuju mimpi Takkan sendiri meniti terjal batu hidup Ranggul jemari, dan bunga mekar menyambut

berubah hitam. Kau bisa mencium bau asap di mana-mana. Kau juga akan merasakan kehadiran guruku.” Begitu pesan Kencana yang masih di hapalnya. ***

wati sungai. Bangkai rumah yang tanpa ampun dilalap si jago merah. Masjid-masjid yang kosong. Tanah sawah yang membawa bau mayat yang menyengat. Kebun kopi yang sepi. Ladang yang tak lagi ditanami. Semuanya hampa. Dengan ketidak berdayaannya, Bram akhirnya duduk di sebuah batu. “Bram!” sebuah suara melayang dibawa angin. Sayupsayup ia melihat lambaian tangan orang itu bagaikan orang putus asa. Lalu Bram mendapati sebuah wajah yang pernah menolaknya saat ia meminta ikut berperang dalam sebuah kubu. “Kau? Masih hidup?” katanya terbata. Lelaki itu terlihat seperti keran yang telah lama ditinggalkan air. Seperti sungai yang telah mengering. Seperti mendung yang tak lagi mau melahirkan hujan. Dan lelaki itu pun tidak percaya dengan yang baru saja dilihatnya! “Iya, masih. Kemana orang kampung lain?” itulah hal pertama yang ia tanyakan pada Amir. Dari raut wajahnya, Bram bisa membaca, ada kekalahan yangbegitubesardikampungnya. “Kampung telah dibumihanguskan.” “Penjajah-penjajah itu datang dengan meriam-meriam.” “Dengan banyak mesiumesiu.” “Dan kita bisa, apa?” Jawab Amir gelisah! Hari-hari berikutnya, Bram mulai bergerilya dengan Amir. Beberpa pejuang yang tersisa ia turunkan ilmu yang ada dalam dirinya, diturunkan juga pada Amir. Sedikit demi sedikit. Segala yang sombong dalam diri Amir, pelan-pelan memudar dan hilang. Pejuang yang masih ada tak lagi gentar seperti saat-saat sebelum Bram datang. Mereka terus bergerilya dari kampung ke kampung. Menyusup ke tempat-tempat paling banyak diduduki penjajah. Meneror, melempar bom, mencuri senjata, menggunduli pejabatpejabat negara yang pro terhadap penjajah. Pengikut Bram semakin banyak. Datang dari berbagai pelosok. Ingin bergabung dengan perjuangannya. Namanya tak lagidikenalsebagaiBram.Melainkan Sjah Bandar. Orang-orang banyak mengelukan dirinya. ***

mereka bilang hidup ini takdir walau kemiskinan kini menggerogoti tetap saja dikatakan takdir Takdirkah jika itu kesengsaraan, takdirkah jika itu kesedihan, takdirkah jika itu kepedihan, atau takdirkah jika itu kebahagiaan Entahlah, hanya Tuhan yang Maha Mengetahui walau itu misteri kita sebagai manusia hanya bisa menjalaninya

Omong Kosong Percuma jika ocehanmu kau anggap sebagai simbol menarik simpati mereka Mereka tak lagi bodoh seperti yang kau kira mereka takkan mau memilih pemimpin yang punya tipe seperti itu mereka bosan bahkan jenuh dengan janji busuk yang kalian umbar Omong kosong jika janji itu kalian tepati mereka sudah bisa baca isi otak kalian yang kotor itu Karya: Nurhasibah Nasution

Rasa Yang Kau Bawa Suara denting gitar mengenangkan kebersamaan Kita melagu cinta dalam konteks yang tak serupa asmara Aih, kesyahduan nada membawa kita pada hati yang kian dalam Hingga waktu menuntut kita tuk menyimpan rasa Saling menyimak bahasa mata Sampai kau berpulang, dan aku satu

Aku Tetaplah Malam Malam itu, kita saling diam dalam tanya Rembulan malu-malu, kunang-kunang mengisyaratkan keindahan di hati Hingga malam mendalam, kita tetap diam Sunyi pecah oleh kata selamat jalan Aku tetaplah malam, Sahabat bersama jeritan rindu dan cerita cinta membiru

Omongan Lumpuh Menyinari dunia dengan kasih sayang Memangku nasib Memadukan warna Buat ini dan itu Aku, dia , dan siapa saja Menjadi pemenang Sembari bersikap meski dengan omongan lumpuh Karya: Nia Lestari

Gulali Rasa Pinang aku dengan bismillah Agar bukan sesal mengarah Hingga kita berucap sama Alhamdulillah Bahagia sederhana seamsal syair cinta. Insyaallah pertemuan telah menjadi garis takdir Pilihan akad pun nikmat pacaran setelah menikah Dan akan kita semai benih gulali rasa.

Di Balut Lekuk Kata Mengintai jingga yang mulai pasrah mungkin jua pudar hingga mengikutinya ke labirin berkabut. Pun menyeringai hilang di balut lekuk-lekuk kata Telah jauh kaki melangkah, menindih rerumput yang menyapa Nan meninggalkan pemelihara aksara dalam tanya. Karya: Aswita M Simarmata

Negeri Hukum Negeri hukum memakai nilai-nilai hukum hukum ditindak sesuai aturan hukum yang berlaku adalah hukum ditindak tegas yang salah dihukum negeri hukum hanya ada di angan-angan hukum tetaplah hukum yang ada hakim hakim adalah manusia yang pasti suka uang jadilah hukum hakim uang

Mencari Keadilan Lambat laun keadilan akan menemuimu seperti halnya yang terus kau ingat akan kau lupakan mencari keadilan tidak usah cari-cari keadilan tidak adil buatmu buatku juga tidak adil yang terus mencintaimu

Mahkamah Mahkamah yang telah kita cipta terkubur di puncak kebencian satu karya dari goresan pena terkubur bersamaan dengan mahkamah rindu



WASPADA Minggu 24 November 2013

Si Semut Dan Kepompong


SEEKOR kepompong sedang menangis dan bersedih akan apa yang telah terjadi di sebuah pohon yang sudah tumbang. “Hu..huu...betapa sedihnya kita, diterjang badai tapi tak ada tempat satupun yang aman untuk berlindung..huhu..” sedih sang Kepompong meratapi keadaan. Dari balik tanah, muncullah seekor semut yang dengan sombongnya berkata “Hai kepompong, lihatlah aku, aku terlindungi dari badai kemarin, tidak seperti kau yang ada diatas tanah, lihat tubuhmu, kau hanya menempel di pohon yang tumbang dan tidak bisa berlindung dari badai” kata sang Semut dengan sombongnya. Si Semut semakin sombong dan terus berkata demikian kepada semua hewan yang ada di hutan tersebut, sampai pada suatu hari si Semut berjalan diatas lumpur hidup. Si Semut tidak tahu kalau ia berjalan diatas lumpur hidup yang bisa menelan dan menariknya kedalam lumpur tersebut. “Tolong...tolong....aku terjebak di lumpur hidup..tolong”, teriak si semut. Lalu terdengar suara dari atas, “Kayaknya kamu

lagi sedang kesulitan ya, semut?” si Semut menengok ke atas mencari sumber suara tadi, ternyata suara tadi berasal dari seekor kupu-kupu yang sedang terbang diatas lumpur hidup tadi. “Siapa kau?” tanya si Semut galau. “Aku adalah kepompong yang waktu itu kau hina” jawab si Kupu-kupu. Semut merasa malu sekali dan meminta bantuan si Kupu-kupu untuk menolong dia dari lumpur yang menghisapnya. “Tolong aku kupu-kupu, aku minta maaf waktu itu aku sangat sombong sekali bisa bertahan dari badai cuma hanya karena aku berlindung dibawah tanah”. Si kupu-kupu akhirnya menolong si Semut dan semutpun selamat serta berjanji ia tidak akan menghina semua makhluk ciptaan Tuhan yang ada di hutan tersebut. Nah, hikmah yang bisa kita tarik dari dongeng diatas adalah, kita harus menyayangi dan menghormati semua makhluk ciptaan Tuhan. Intinya semua ciptaan Tuhan harus kita kasihi dan tidak boleh kita menghina makhluk yang lain. Oke sampai disini dulu dongeng anak indonesia, sampai berjumpa di dongeng anak indonesia berikutnya. (H)

Pemenang Sayembara Mewarnai Berhadiah Seri : H

Juara I Restu Ilham HD SDIT Hikmatul Fadillah Jl. Sidomulyo Gg. Sukses Pasar 9 Tembung Juara II Zulkarnain SDN No.69 Jl. Darussalam Jl. Sei Kapuas - Medan Juara III Travy Apuila JS SD Harapan I Jl. Sisingamangaraja - Medan Juara Harapan I

Mhd. Iman Fadilah Hsb SD Islam Azizi Jl. Letda Sudjono - Medan Juara Harapan II Mutia Chairani D Nst SDNJl.KaryaJaya-JlKaryaDarma Gg. Pipa - Medan Juara Harapan III Marini Siahaan SDN Pulau Rakyat Tua Jl. Besar Sei Piring Penilaian dewan juri kepada pewarnaan, kerapian dan kesiapan gambar. Keputusan juri tidak dapat

dianggu gugat ditetapkan di Medan tanggal 22 Nopember 2013 dan pada pemenang diharap-kan kehadirannya tanggal 27 September 2013 di kantor harianWaspada Jl. Brigjen Katamso No.1Medan,jam13.00Wibuntuk menerimahadiahnya.Pemenang luar kota hadiahnya akan dikirim. Kecuali Kota Binjai, Belawan, Pancur Batu, Tj. Morawa hadiahnyadiambillangsungselamatbagi adik-adik pemenang.Yang belum berhasil sebagai pemenang, hayo ikutan terus sayembara mewarnai berhadiah ini. (Redaksi)

J .A. M CERIT A ADIK Adik-adik, berikut Redaksi memuat cerita-cerita tentang Nabi Muhammad SAW, yang dikenal memiliki sifat penyayang kepada sesama. Semoga bisa menjadi tauladan dan menambah wawasan serta pembelajaran bagi kita semua.

Kehebatan Tangan Rasulullah

Kupon Seri

KETIKA peristiwa penaklukan kota Mekkah oleh pasukan kaum Muslimin di bawah pimpinan Rasulullah SAW, terdapat seorang seseorang yang berniat ingin membunuh Rasulullah SAW. Orang itu bernama Fadhalah bin Umair Al-Laitsi. Dia berniat membunuh Rasulullah SAW sewaktu baginda melakukan tawaf di Ka’bah. Untuk melancarkan niatnya, Fadhalah mencoba mendekat Rasulullah SAW yang saat itu sedang melakukan tawaf. Ketika sudah menghampiri, tiba-tiba Rasulullah SAW menegurnya, “Adakah kamu yang bernama Fadhalah?” “Ya saya Fadhalah, wahai Rasulullah,”jawab Fadhalah. “Apa yang sedang engkau fikirkan?”tanya Rasulullah selanjutnya. “AKu tidak memikirkan apa-apa. Aku sedang mengingat Allah saja.”jawab Fadhalah. Mendengar jawaban Fadhalah tersebut, Rasulullah SAW tersenyum dan berkata,”Mohonlah keampunan kepada Allah SWT.” Kemudian Rasulullah SAW meletakkan tangannya di atas dada Fadhalah sehingga hati Fadhalah tenang. Ketika Rasulullah SAW melepaskan tangannya dari Fadhalah, tidak ada seorang pun yang lebih dicintainya daripada Rasulullah SAW. Setelah peristiwa itu menimpa Fadhalah, dia tidak jadi membunuh Rasulullah SAW dan segera pulang ke rumah. **m31/SynergyMedia

I Tempel DiAmplop

Sayembara Mewarnai Berhadiah Hadiah I : Rp75.000 + sertifikat Hadiah II : Rp50.000 + sertifikat Hadiah III : Rp25.000 + sertifikat

Syarat-syarat peserta 1. Peserta bebas menggunakan alat pewarna apa saja. 2. Peserta terbatas hingga kelas VI SD, menyantumkan nama, alamat yang jelas 3. Sudah sampai di meja redaksi selamat-lambatnya tanggal 30 Nopember 2013

Untuk harapan I s/d III akan mendapatkan bingkisan dan sertifikat.

N a m a : .............................................................................. Sekolah : .............................................................................. Alamat : ..............................................................................

Buatlah dik, di angka berapa jarum panjang dan pendeknya. Jam A pukul 11.00, B pukul 09.30, C pukul 12.00, D pukul 13.00, E pukul 06.00, F pukul 08.00


Isilah kotak-kotak ini dik, lihat panahnya pada arah yang dituju dan adik telah dibantu dengan satu huruf.


WASPADA Minggu 24 November 2013


Resep Pepes Ikan Kembung

Beberapa diantaranya adalah: Bahan-bahan utama pepes ikan kembung pedas gurih: -4 ekor ikan kembung yang sudah dicuci dan dibersihkan insang dan perutnya -2 tangkai daun bawang yang di iris tipis-tipis Seikat daun kemangi -5 lembar daun salam -2 tangkai daun sereh di ikat simpul -1 helai daun pisang batu untuk membungkus -10 buah cabai rawit merah -Potongan lidi untuk menyemat daun pisang Bumbu yang dihaluskan: 5 butir kemiri 1 cm lengkuas 2 siung bawang putih 8 siung bawang merah 1 bungkus penyedap rasa 1 ruas jari kunyit

RESEP pepes ikan kembung merupakan salah satu resep favorit tanah air yang sudah dikenal sejak lama oleh masyarakat Indonesia karena memiliki cita rasa yang gurih serta tata cara memasaknya yang unik dan dianggap tak biasa.

Cara pembuatan: - Bumbu yang sudah dihaluskan dicampur dengan bahan-bahan utama yang tertera diatas. - Aduk-aduk bumbu dan lumuri ikan secara merata pada bagian luar serta bagian dalamnya. - Bungkus sebanyak 2 sampai 3 lapis daun pisang untuk memastikan bumbu tidak bocor keluar kemudian jepit dengan menggunakan potongan-potongan lidi yang sudah disiapkan. - Panaskan oven atau microwave dan atur suhu hingga kurang lebih 200 derajat celcius. - Masukan ikan yang sudah dibungkus tersebut kedalamnya dan biarkan selama kurang lebih 10 menit atau hingga daun pembungkus berwarna kecoklatan. - Angkat dan sajikan diatas piring.

Selain pepes tahu, pepes ikan mas dan ikan bandeng, pepes ikan kembung merupakan salah satu masakan yang paling banyak digemari. Hal tersebut dikarenakan tekstur ikan kembung yang legit dan memiliki rasa yang gurih. Cara pengolahan pepes ikan memang cukup unik

karena ikan dibungkus dalam balutan daun pisang batu dan kemudian dimasukkan kedalam panggangan atau oven. Akan tetapi pada saat ini metode pembuatan pepes dapat dilakukan dengan cepat dan mudah berkat bantuan microwave. Pepes ikan kembung merupakan masakan yang sehat dan cocok dikonsumsi karena ikan kembung rendah akan

kolesterol, kaya asam folat, protein serta omega 3 yang baik untuk perkembangan otak. Bagi yang gemar dengan masakan yang satu ini berikut panduan serta resep pepes ikan kembung yang bisa dibuat sendiri dirumah. Namun sebelum membuatnya, ada beberapa bahan-bahan serta bumbu yang harus dipersiapkan terlebih dahulu.

Tips mencuci ikan kembung agar tidak bau lumpur: - Bersihkan dan keluarkan bagian perut serta kedua insangnya dengan menggunakan air bersih. - Masukkan ikan kembung kedalam wadah seperti baskom dan berikan perasan air jeruk nipis secara merata kemudian diamkan selama 5 hingga 10 menit. *Sri Gustina: Dari berbagai sumber

Aroma Nasi Uduk Menggugah Selera MAKANAN olahan nasi uduk ini memang sudah sangat akrab di lidah masyarakat. Nasi uduk ini memang mempunyai rasa yang cukup unik, rasa gurih dari nasi yang dalam pengolahannya dicampur dengan santan membuat resep nasi uduk ini dari aromanya saja sudah menggugah selera. Belum lagi dengan berbagai makanan pelengkap yang disajikan untuk disantap bersamaan dengan resep nasi uduk lezat ini. Dalam proses pembuatannya pun ada yang masih menggunakan cara tradisional dengan menggunakan panci besar untuk menanak nasinya dan ada juga yang menggunakan rice cooker dengan alasan agar lebih praktis. Kebanyakan penjual resep nasi uduk ini menjual dagangannya pada pagi hari karena makanan ini idientik sebagai makanan untuk sarapan. Sekarang anda tak perlu lagi susah-susah mencari penjual resep nasi uduk ini karena anda bisa mempraktekkan resep di bawah ini. berikut resep nasi uduk sederhana.

Bahan dan Bumbu : 1 kg beras, cuci 1250 ml santan dari 1 butir kelapa 4 batang serai, memarkan 5 lembar daun salam 3 lembar daun pandan 1 sdm garam Pelengkap: Telor Kacang tanah Tomat Bawang goreng Kerupuk Cara Membuat: Masak beras bersama santan, serai, daun salam, daun pandan dan garam hingga mengering. Kemudian kukus nasi hingga matang. Angkat dan hidangkan dengan pelengkap sajian sesuai selera. Aroma nasi uduk ini sangat menggugah selera apalagi ditambah dengan berbagai makanan pelengkap lainnya. *Sri Gustina: Dari berbagai sumber

DAPUR KITA Bahan : 250 gr tepung terigu 250 gr gula pasir 2 sdt emulsifier 3 btr telur 200 ml sprite Cara membuat : 1. Campur semua bahan, mixer hingga putih, mengembang dan kental. 2. Panaskan kukusan. Isi air dan jangan terlalu penuh. 3. Siapkan cetakan roti kukus dan beri kertas cup. 4. Ambil sedikit adonan, taruh dalam mangkuk terpisah, beri pasta cokelat. 5. Tuang adonan sisanya ke dalam cup sampai penuh Ambil 1 sdt adonan cokelat. letakkan diatas permukaan adonan dalam wadah cup tersebut 6. Kukus selama kurang lebih 15-20 menit, baru dibuka tutupnya (jangan buka tutup sebelum waktunya) 7. Angkat...dinginkan. Siap disajikan

Bolu Kukus

Tips : Bahan : 4 buah telur 1/4 cangkir susu Garam dan merica 1 sendok teh butter

Cara dan Tips Membuat Scrambled Eggs

Cara Memasak : Kocok telur, susu, garam dan merica seperti biasa. Kocok hingga semua tercampur rata. Panaskan butter di wajan anti lengket dengan api sedang. Kemudian tuang adonan telur dan tunggu hingga set. Jika adonan telur mulai mengeras, kemudian bolak-balik menggunakan garpu. Pastikan telur matang merata. Aduk-aduk hingga telur matang seluruhnya. Kemudian, angkat dan sisihkan. Tips : Lebih baik menggunakan wajan berbahan teflon karena menghindari telur menempel dan gosong Jangan terlalu matang dan lama saat memasak karena yang diinginkan adalah warna kuning yang cerah. By: Sri Gustina

Langsung angkat telur yang sudah cukup matang, membiarkannya di atas wajan akan terus membuat proses pemasakan berlanjut. Berapa lama Anda mengocok telur juga mempengaruhi seberapa padat telur orak arik Anda. Lebih baik memang langsung menyantap scrambled egg setelah diangkat dari wajan. Namun, untuk jangka tidak terlalu lama juga bisa. Jika ingin menghangatkan scrambled egg, lebih baik hangatkan dengan dengan cara meletakkannya di atas air panas, sama seperti cara melelehkan cokelat. Srigustina: Dari Berbagai Sumber



Konsultasi Teknologi Informasi Diasuh oleh Codealgo

No 082364766027, Jawaban akan dibalas melalui Harian Waspada, jadi dimohon sabar menunggu.

Jawab : Hai, program format factory adalah program yang digunakan untuk mengubah jenis-jenis file yang kita miliki ke bentuk lain. Program format factory dibuat oleh independen developer bernama Chen Jun Hao. Untuk mendownload aplikasi ini, kami sarankan kamu mendownloadnya langsung dari situs developer yang mengembangkan aplikasi ini. Situs developer resmi pembuat program ini bisa dilihat di http:// Semoga dapat membantu, terima kasih.

Jawab : Waalaikumsalam Dana, flash, atau adobe flash, merupakan perangkat lunak yang memang telah dikenal sangat boros konsumsi energi CPU dan memori. Tidak mengherankan apabila kejadian tersebut terjadi pada kamu. Lambat tidaknya game online berbasis flash saat dibuka dikomputer sangat tergantung sekali dengan spesifikasi laptop yang kamu miliki dan bagaimana cara developer games tersebut mengoptimisasi games mereka sehingga bisa mengurangi konsumsi energi CPU dan memori komputer kamu. sebagai perbandingan untuk kamu, Tanpa games saja, konsumsi energi CPU saat membuka flash player sudah cukup besar, antara 10-25% dari kemampuan CPU, apalagi kalau menggunakan games. Hal inilah yang menyebabkan komputer kamu menjadi sangat lambat, selain kamu sudah menggunakan browser yang juga membutuhkan alokasi memori, kamu menambahnya lagi dengan membuka games flash, sehingga alokasi energi CPU dan memori habis untuk kedua aplikasi tersebut dan menyebabkan alokasi memori dan CPU untuk sistem operasi berkurang

Bantuin Aku, Dong?! BUAT yang punya problem, khusus remaja atau pelajar tapi susah buat dipecahkan, seperti masalah sekolah, pacar, ortu yang suka ngomel atau teman yang nyebelin, jangan bingung dulu. Tim Remaja Waspada dan Mbak Fifi yang nama lengkapnya Fidia Rizki, S.Psi, psikolog lulusan Universitas Medan Area akan mencoba membantu kamu mencari jalan solusinya. Silahkan kirim pertanyaan melalui SMS ke

Dari : 0853592xxxxx Hai codealgo, mau tanya ni. Dimana sih situs yang benar untuk mendownload program format factory yang mudah dan gampang? Soalnya udah beberapa kali mendownload di internet gak ada yang bener? Mohon solusinya? Thanks codealgo, semoga makin jaya.

Dari : 0831993xxxxx Assalamualaikum codealgo…aku Dana di deli tua mau nanya ni..Kenapa dilaptopku disaat mau membuka game online flash itu tiba-tiba jadi lambat semua..bahkan saat mouse digerakkan pun jalannya lambat saat membuka tab lain pada browser…

WASPADA Minggu 24 November 2013

Tanya: Kasih – Hp 6287784653xxx Dear mbak Fifi, Salam kenal namaku Kasih. Mbak gimana caranya meminta maaf sama orang yang udah benci banget ke kita. Makasih atas solusinya… Jawab: Dear Kasih Apa yang menyebabkan dia membencimu? Apakah karena kesalahanmu.? Terlepas dari siapa yang salah dan benar, mbak salut atas sikap bijakmu… menghadapi orang yang membenci tidak perlu dibalas dengan sikap serupa. Jadi lakukanlah dengan tulus dan rendah hati. Jadi meminta maaf akan terasa ringan dan tidak merasa kecewa apabila dia belum mau membuka pintu maafnya. Setidaknya kamu sudah bersikap dewasa dan menunjukkan kebesaran hati mencoba menghapus perselisihan atau kesalah pahaman diantara kalian. Jadi apalagi.. tidak perlu ragu buat mencobanya.. salam, semoga berhasil.

drastis, akibatnya komputer kamu menjadi sangat lambat untuk merespon perintah yang kamu berikan. Semoga dapat membantu, terima kasih. Dari : 0878685xxxxx Hai codealgo...Aku Ardi, aku mau nanya kenapa setiap saya mau menginstall modem di laptop saya selalu ada yang valid dan kemudian tidak bisa dikonekkan, padahal saya coba dilaptop teman saya bisa diinstall dengan baik dan bisa dikonekkan..mohon solusinya ya codealgo..Terima kasih. Jawab : Hai Ardi, permasalahan modem tidak bisa digunakan pada laptop bisa terjadi karena beberapa hal, bisa karena modem rusak, komputer bermasalah karena virus, kurangnya software pendukung driver modem, sampai sistem operasi yang tidak kompatible dengan driver modem kamu, dsb. Karena kamu sudah melakukan pengecekan ke laptop kawan kamu dan berfungsi dengan baik, maka modem kamu bukan akar dari masalah ini. Kemungkinan besar, dari penjelasan kamu di atas, ada software tambahan yang perlu diinstall pada komputer kamu agar driver modem kamu dapat berjalan dengan benar. Sayang sekali kamu tidak menyertakan detail merek

PEMBERITAHUAN Kirim pertanyaan kamu terkait bidang komputer dan IT ke nomor 0813703113555, semua jawaban akan diterbit-kan di surat kabar harian WASPADA.Codealgo berencana mengadakan pelatihan skill programming & webmaster di Medan selama 2 bulan full kepada anakanak muda Medan (laki-laki & perempuan) berusia 17 s/d 25 tahun yang putus sekolah. Biaya Pelatihan GRATIS. Apabila anda berminat, kirimkan biodata diri kamu beserta nomor telepon/hp yang bisa dihubungi ke info@codealgo. com atau Materi pelatihan terkait dengan teknologi web modern (HTML5, CSS3, Javascript framework, OOP, CMS Themes, SEO dan Server Configuration).

dan jenis modem kamu sehingga kami tidak dapat memastikan software apa saja yang dibutuhkan oleh modem kamu agar dapat berjalan dengan lancar di komputer/laptop kamu. Kami sarankan agar kamu melihat software apa saja yang terinstall pada laptop kawan kamu atau lakukan searching tentang requirement software yang dibutuhkan untuk bisa menjalankan modem kamu pada laptop. Semoga dapat membantu, terima kasih. Dari : 0857615xxxxx Aslm codealgo, saya mau tanya, kenapa word 2003 gak bisa dibuka di word 2007? Jawab : Wslm, seharusnya file microsoft word 2003 bisa dibuka pada aplikasi microsoft word 2007, karena MS.Word 2007 tetap mensupport ekstensi .doc yang merupakan ekstensi word 2003. Justru seharusnya file word 2007 yang tidak bisa dibuka di 2003 karena format .docx milik 2007 belum dikenal oleh MS.Word 2003. Apabila file word 2003 kamu tidak bisa dibuka pada word 2007, coba tes membuka file tersebut pada komputer lain, apakah bisa terbuka? Apabila bisa, kemungkinan besar ada corrupt terjadi pada MS. Word 2007 kamu sedangkan bila file tersebut tidak bisa terbuka walaupun sudah dicoba di MS.Word 2003 juga, maka file kamu yang mengalami corrupt. Semoga dapat membantu, terima kasih. Dari : 0878698xxxxx Hai codealgo saya Zulham di Binjai. Saya punya hp k-touch, kenapa ya game java saya tidak bisa diinstall? Padahal kan game di java masih sedikit. Terima

kasih ya. Jawab : Kirim pertanyaan kamu terkait bidang komputer dan IT ke nomor 0813703113555, semua jawaban akan diterbitkan di surat kabar harian WASPADA. Waalaikumsalam, hp low end yang sering mati hidup sendiri (restart), tidak responsif, dan tidak bisa menginstall aplikasi bisa disebabkan beberahap hal, pertama, sparepart pada hp kamu tidak cukup kuat dan mengalami kerusakan didalamnya, permasalahan dengan handphone low end saat ini adalah, sparepart/ komponen yang menyokong satu sama lain terkadang terbuat dari bahan-bahan murah yang apabila terkena gangguan listrik, jatuh, atau semacamnya akan rusak (sangat fragile). Nah, coba kamu ingat-ingat, pernahkah hp kamu jatuh, terkena listrik tidak stabil saat mencharger, atau terlalu lama dicharger dan hp kamu terasa panas pada bagian belakang? Apabila iya, maka ada kemungkinan terjadi kerusakan komponen dalam hp kamu. Cara paling mudah, kamu bawa hp kamu ke teknisi resmi provider kamu dan ganti sparepart yang rusak tersebut. Sedangkan tentang masalah aplikasi yang tidak bisa diinstall, pertama pastikan file installer tersebut memang bagus atau jangan-jangan corrupt? Nah, apabila bagus, langkah selanjutnya, lihat dulu spesifikasi game yang ingin kamu install, apakah hardware hp kamu support gak? Jangan coba-coba jalankan games 3d di hp kamu apabila hp kamu tidak disupport dengan hardware display accelerator (semacam kartu vga kalau dikomputer). Semoga dapat membantu, terima kasih.

Tanya: Sandra– hp 6281375845xxx Mbak aku punya teman dekat sejak SD hingga SMP.. Tapi kemudian kami berpisah.. karena pindah sekolah. Aku kangen banget dengan dia.. namanya Dedek lengkapnya Devianti. Dan dengar kabar sekarang dia udah pindah ke kota lain. Aku Tanya sama teman-teman dekatnya, gak ada yang tahu.. dia pindah kemana. Gimana ya mbak.. biar bisa ketemuan atau tahu dimana dia sekarang..? no Hp nya yang dulu juga gak bisa dihubungi lagi.. Makasih atas jawabannya Jawab: Dear Sandra Jangan sedih donk… mudah-mudahan masih bisa ketemu.. Kemungkinan selalu ada kenapa sobat kecilmu belum menghubungimu.. siapa tahu saat ini dia masih sibuk atau mungkin nomor kamu dan teman yang lain hilang..jadi dia kesulitan buat menginformasikan keberadaannya. Apakah adik sudah mencoba mencari informasi lewat sekolah dia yang terakhir..biasanya murid yang pindah ke kota lain memberikan informasi kepindahannya karena berguna untuk mengurus administrasi di sekolah yang baru. Atau lewat jejaring sosial.. dengan media Facebook atau twitter buat mencari temanmu.. siapa tahu ada yang mengetahui dan memberitahu keberadaannya. Mudah-mudahan Dedek (Novianti) membaca rubric ini dan mengcallingmu. Sandra yang baik… biar enggak kangen berat.., coba deh kamu membuka pintu persahabatan baru dengan orang lain.. pasti seru dan menyenangkan punya banyak teman dari berbagai kelompok. Punya banyak sahabat baru… tanpa melupakan sahabat yang lama. Have a nice try. Tanya: Ulfah – Hp 6281377682xxx Assalamualaikum.Dear mba Fifi kenalin aku Ulfah mahasiswa, sejak kuliah.. badan ini rasanya cape jadi buat belajar koq kurang semangat. Apalagi rumahku agak jauh.. sampe rumah dah sore kadang abis magrib. Kalo malam ngantuk… gimana cara ngatasinya mbak.. trims Jawab: Waalaikumsalam, Dear Ulfah Mbak memahami apa yang adik rasakan. Senang menjawab pertanyaanmu.. karena kamu punya niat buat belajar. Engga usah bingung, kamu Cuma butuh Motivasi yang kuat dan kemauan biar tetap semangat menjalani aktivitas belajar. Mbak maklum. namanya manusia kadang kalau fisik uda capek.. bawaannya pengen istirahat. Sepulang kuliah, badan memang udah letih karena energy terkuras buat belajar dan beraktivitas. Tapi bisa diatasi koq, karena tubuh punya ketahanan asal didukung dengan makanan dan nutrisi yang cukup. Gak percaya? Buktinya banyak orang

Konsultasi Remaja

mengalami hal serupa, seperti adik-adik SD yang sekolah full day, yang sekolah dari pagi sampe sore masih ditambah les sepulangnya dari sekolah.. atau orang kantoran yang nyambi kuliah.. mereka masih bisa belajar, semata-mata karena ada motivasi yang kuat dari dalam diri. Ulfah yang baik.. yang perlu kamu rubah adalah bagaimana supaya belajar menjadi suatu kebutuhan dan menyenangkan. Bayangkan belajar itu seperti kamu menghabiskan waktu dengan teman-teman atau melakukan hobby yang kamu suka, pasti waktu berjalan tanpa terasa dan intinya mengubah konsep belajarmu menjadi emosi yang sejahtera. Caranya.. renungkan kembali.. bahwa kamu merasa semakin segar dan menjadi lebih berarti saat prestasimu menjadi lebih baik, IP meningkat.. tentu membuatmu terpacu untuk belajar dan merasa bahagia. So badan pegel, cape dan penat tidak membuatmu patah semangat untuk terus belajar. Juga konsumsi makanan dan vitamin buat menjaga staminamu. Mbak yakin.. jika motivasi udah jreng.. nilai semestermu tambah oke. Semangat ya, salam Tanya: Kasih – Hp 6285263324xxx Mbak Fifi kenalkan namaku Kasih. Mbak aku punya pacar tapi dia pendiam banget dan susah ngomong. Gimana merubahnya supaya dia lebih banyak cerita.. makasih atas jawabannya Tanya: Budi – Hp 6281987945xxx Assalamualaikum, Pakabar mbak Fifi yang manis Saya punya pacar.. tapi orangnya pemalu dan pendiam. Susah sekali ngajak dia cerita, bawaannya senyum malu-malu terus. Gimana ya mbak solusinya. Makasih, Jawab: Dear Kasih dan Budi Punya pacar pendiam memang rada bingung.. Susah menebak maunya. Kalau engga dimulai ya diam.. makanya kamu harus lebih aktif memancing pembicaraan. Biasanya cowok/cewek pendiam dapat pasangan yang lebih rame.. jadi saling melengkapi, kalo sama-sama diam.. kaya nonton film bisu. Jadi kembali ke karakter bawaannya, kalau dari sononya udah kalem, gak banyak bicara.. kamunya yang kudu pintar membawa suasana dan memancing omongannya. Agar dia merasa nyaman di dekatmu. Biasanya nee, kalau orang udah merasa nyaman bisa lebih kebuka buat menyeritakan segala sesuatu, paling tidak dengan orang yang dia sayangi. Sukses selalu Tanya: Bayu – Hp 6281388323xxx Mbak salam kenal.. kenapa yaa, aku cepat bosan kalo pacaran.. padahal aku gak pengen… gimana tuu… trims ya mbakyu yang baik Tanya: Rissa – Hp 628139731xxx Assalamualaikum. Mbak Fifi.. mbak mau curhat, kenapa yaa.. aku koq bosan dengan pacarku.. padahal dia baik… kenapa ya.. trims Jawab: Waalaikumsalam, dear Bayu dan Rissa Duuuh.. tampaknya kalian orang yang belum mau terikat pada satu hubungan makanya disaat mulai jadian dan pacaran, kalian cenderung bosanan. Jadi cari tahu dulu penyebabnya, mengapa susah bertahan lama… Apakah dari dirimu atau dari luar, yakni karena kamu belum menemukan seseorang yang benar-benar klik di hati. Jadi kalau kalian gampang bosenan.. mending engga usah mempunyai pacar.. tapi berteman sebanyakbanyaknya, sampai kamu merasa bahwa dialah soulmatemu.. kasihan kan kalo jadian, nanti banyak yang patah hati.. salam

Konsultasi Sumber Daya Manusia Diasuh oleh Drs. Thoga M. Sitorus, M.Si Pengamat Ketenagakerjaan/Konsultan Ketenagakerjaan Alumni Fisip Universitas Gajah Mada

Ketentuan PKWT Bagi Pekerja Outsourcing Selamat pagi, Pak Thoga. Saya Iman, pekerja di sebuah perusahaan makanan dan minuman di Tanjung Morawa, hendak bertanya kepada Bapak tentang pekerja outsourcing yang ramai sekarang ini dibicarakan dan dituntut oleh serikat pekerja melalui unjuk rasa agar dilaksanakan sesuai peraturan. Pertanyaan saya Pak sebagai pekerja outsourcing tentang pengertian PKWT sebagai dasar yang dipakai oleh perusahaan dalam mempekerjakan pekerja outsourcing. Kemudian apa saja batas-batas dalam memperlakukan PKWT bagi pekerja. Ats pertanyaan Bapak saya ucapkan terima kasih. Jawab: Selamat pagi, Sdr Iman.

Pertanyaan Sdr tentang PKWT, singkatan dari Perjanjian Kerja Waktu Tertentu diatur dalam Undang-Undang No. 13 Tahun 2003 tentang Ketenagakerjaan (UUK) Pasal 64, 65 dan 66 dan peraturan pelaksanaannya dengan peraturan Menteri Tenaga Kerja dan Transmigrasi No. 19 Tahun 2012 tentang Syarat-Syarat Penyerahan Sebagian Pelaksanaan Pekerjaan Kepada Perusahaan Lain, yaitu berupa Pemborong Pekerjaan dengan persyaratannya, dan penyerahan jasa pekerja/ buruh dengan persyaratannya yang diatur berdasarkan PKWT dan PKWTT melalui perjanjian kerja. Sebuah perjanjian kerja dapat dibuat untuk waktu tertentu atau untuk waktu tidak tertentu, perjanjian kerja yang dibuat untuk waktu tertentu didasarkan atas jangka waktu atau

selesainya suatu pekerjaan tertentu. PKWT tidak dapat diadakan untuk pekerjaan yang bersifat tetap, yaitu pekerjaan yang sifatnya terus-menerus, tidak terputus-putus, tidak dibatasi waktu dan merupakan bagian dari suatu proses produksi dalam suatu perusahaan atau pekerjaan yang bukan musiman. Apabila pekerjaan itu tidak terus-menerus, terputus-putus, dibatasi waktu, dan bukan merupakan bagian dari suatu proses produksi, tergantung cuaca atau pekerjaan itu dibutuhkan karena adanya suatu kondisi tertentu, pekerjaan tersebut merupakan pekerjaan musiman yang tidak termasuk pekerjaan tetap, sehingga dapat menjadi objek PKWT. Ciri-ciri pekerjaan yang dapat dilakukan untuk pekerjaan tertentu yang karena menurut jenis dan sifat atau kegiatan

pekerjaannya akan selesai dalam waktu tertentu, yaitu pekerjaan yang : 1. sekali selesai atau yang sementara sifatnya, 2. diperkirakan penyelesaiaannya dalam waktu yang tidak terlalu lama dan paling lama 3 tahun, 3. bersifat musiman, atau 4. berhubungan dengan produk baru, kegiatan baru, atau produk tambahan yang masih dalam percobaan atau penjajakan (Pasal 59 UUK). PKWT untuk pekerjaan yang sekali selesai atau sementara sifatnya adalah PKWT yang didasarkan atas selesainya pekerjaan tertentu, dapat dibuat untuk paling lama 3 tahun. apabila pekerjaan tertentu yang diperjanjikan dalam PKWT dapat diselesaikan lebih cepat dari yang diperjanjikan, PKWT tersebut putus demi hukum pada saat selesainya pekerjaan. Dalam PKWT yang didasarkan atas selesainya pekerjaan

tertentu, dicantumkan batasan suatu pekerjaan dinyatakan selesai. Kemudian PKWT bisa berubah menjadi PKWTT (Perjanjian Kerja Waktu Tidak Tertentu/Pekerja Tetap) apabila : 1. Pekerjaan itu sifatnya terus-menerus, maka pekerja harus menjadi permanen (pekerja tetap) di perusahaan pemberi kerja, 2. Dalam perjanjian pemborongan pekerjaan (Pasal 9) sekurangkurangnya harus memuat : a. hak dan kewajiban

masing-masing pihak; b. menjamin terpenuhinya perlindungan kerja dan syarat-syarat kerja bagi pekerja/buruh sesuai peraturan perundangundangan; dan c. memiliki tenaga kerja yang mempunyai kompetensikompetensi di bidangnya, 3. Dalam perjanjian kerja penyediaan jasa (Pasal 29)

dalam hal hubungan kerja yang didasarkan PKWT, yang objek kerjanya tetap ada sekurang-kurangnya harus memuat: a. jaminan kelangsungan bekerja ; b. jaminan terpenuhinya hak-hak pekerja sesuai dengan peraturan perundangundangan dan yang diperjanjikan; dan c.

Bagi para pembaca yang ingin menanyakan seputar tentang ketenagakerjaan dapat mengirimkan pertanyaan melalui, atau SMS Ke HP:0811632554

jaminan perhitungan masa kerja apabila terjadi pergantian perusahaan penyedia jasa pekerja/buruh untuk menetapkan upah dan terpenuhinya hak-hak pekerja (ayat 3). Tidak memuat hak dan kewajiban dimaksud pada pasal 9 dan pasal 29 maka PKWT berubah menjadi PKWTT.

Kupon Konsultasi


WASPADA Minggu 24 November 2013


Menolak Kriminalisasi Dokter

Konsultasi Seputar Diabetes Bersama:

DR. Dr. Dharma Lindarto, SpPD, KEMD (Dokter Internis – Konsultan Endokrin, Metabolik, Diabetes)

Apakah Insulin Obat Terakhir ?

Manusia punya rencana, Tuhan juga punya rencana. Bagaimanapun rencana-Nyalah yang terbaik. Je le pansany, et Dieu le guarist (Saya merawat dan Tuhan menyembuhkan)


Dokter Dharma YTH, Saya ibu, berumur 56 tahun, dua minggu lalu saya berobat ke dokter dengan keluhan batuk sudah lebih 4 bulan, badan semakin kurus. Setelah dilakukan pemeriksaan dan foto dada, dokter memvonis saya menderita TBC paru, diakibatkan gula darah saya tidak terkontrol. Saya sudah menderita diabetes sejak 4,5 tahun. Kemudian dokter menganjurkan saya disuntik insulin selama pengobatan. Saya menolak, karena dengar dari kawan sesama penderita, insulin membuat ketergantungan dan diberikan pada pasien diabetes yang sudah parah. Mohon penjelasan dokter? Apa efek samping insulin? (Tety – Jl. Pandu) Bu Tety yang baik, Tidak benar demikian. Memang kelainan dasar terjadinya diabetes akibat kekurangan insulin baik relatif (diabetes tipe 2) ataupun absolut (diabetes tipe 1). Pada diabetes tipe 1 memang benar insulin diperlukan seumur hidup untuk menurunkan dan mengontrol gula darah pasien, karena pankreas penderita tak cukup memproduksi insulin. Sedangkan ibu Teti, menderita diabetes tipe 2, kadang diperlukan insulin untuk mengontrol gula darah, sebenarnya jumlah insulin yang dihasilkan pankreas ibu Tety tetap ada, tetapi fungsinya berkurang. Insulin diabetes tipe 2 keadaan penurunan berat badan yang cepat, hiperglikemia berat disertai ketosis, ketoasidosis diabetik, hiperglikemia hiperosmolar non ketotik, hiperglikemia dengan asidosis laktat, gagal dengan komibnasi OHO/obat oral anti diabetik, stress berat (infeksi sistemik, operasi besar, IMA, stroke), kehamilan dengan diabetes, gangguan fungsi ginjal atau hati yang berat, kontraindikasi dan atau alergi dengan OHO. Dokternya ibu Tety lebih mengenali keadaan yang saya sebutkan diatas. Karena ibu Tety menderita infeksi paru (penyakit TBC), sudah sangat tepat dokter memberikan insulin. Karena dalam beberapa literatur kedokteran, diabetisi menderita infeksi mendapatkan insulin, agar kontrol gula darahnya lebih baik dan infeksinya diatasi segera. Setelah infeksi teratasi baik, nantinya akan dievaluasi. Dokter akan menentukan jenis dan lama kerja insulin yang terbaik buat ibu. Saat ini terdapat insulin yang bekerja panjang selama 24 jam, sehingga hanya disuntikan satu kali sesuai jadwal diinginkan. Efek samping utama terapi insulin terjadinya hipoglikemia (kadar gulah menurun, sekitar dibawah 60 mg/ dl) dan alergi insulin, lipodistropia didaerah suntikan.Tetapi saat ini produk insulin hampir mendekati sistem kerja fisiologis insulin manusia (insulin analog), sehingga efek hipoglikemia jarang kita jumpai. Disarankan ibu tetap mengikuti nasehat dokter menggunakan insulin sementara selama pengobatan TBC, agar gula darah terkontrol baik. Insulin bukan obat terakhir yang ditakutkan, apalagi insulin membuat ketergantungan, itu tidak benar. „ Rubrik Konsultasi Seputar Diabetes: Kerja sama PERSADA CABANG MEDAN dan Harian WASPADA Medan, untuk menjawab segala pertanyaan seputar Diabetes dan Komplikasi „ Pertanyaan dapat dikirim tertulis ke Harian Wasapada, sms ke HP. 08126505336 / 081263852525, dan email : atau dan , Sekretariat PERSADIA MEDAN (KLINIK DIABETES DHARMA) Jl. Beringin Raya No. 1 A-B Telp. 06177688850.


alam seminggu ini media massa dihebohkan tentang dokter spesialis kandungan di Manado dijebloskan ke tahanan pada 8 November 2013 berdasarkan putusan berkekuatan hukum tetap oleh Mahkamah Agung No. 365.K/Pid/2012 tanggal 18 September 2012, sang dokter divonis 10 bulan, dia ditangkap saat bertugas di RS Ibu dan Anak Permata Hati Balik Papan, Kalimantan Timur. Dia bukan sendiri, ada dua dokter yang menurut aparat status DPO. (Padahal kejadian terjadi saat ketiga dokter dalam status residen-mengikuti program studi spesialis), dibawah supervisi supervisor sekitar tahun 2010, dan pengadilan Manado menyatakan ketiga dokter tidak bersalah (bebas murni) dan hasil otopsi pasien adanya embol udara yang merupakan kondisi sulit diprediksi dan tidak bisa dicegah, karena dapat menyebabkan kematian mendadak).

Sampai beginikah perlakukan aparat hukum terhadap

dokter? Apakah dokter disamakan dengan koruptor yang me-

rugikan negara atau bandar narkoba dan seterusnya? Apakah beda malpraktik dan resiko medik? Apakah dokter tidak boleh salah dalam menangani pasien? Malpraktik: Error atau Kelalaian Masih ingat dibenak kita kasus almarhumah Sukma Ayu. Apabila dugaan malpraktik menjadi bahan berita, kadangkala opini publik langsung tergiring seolah-olah dokter pasti salah! Pengadilan masyarakat melalui opini media massa terus bergulir menerpa wajah profesi kedokteran. Saya setuju upaya masyarakat dan pers untuk melakukan kontrol sosial atas profesi dokter adalah sehat dan harus ditanggapi secara terbuka dan positif.

Malpraktik berarti pekerjaan buruk. Malpraktik tidak hanya terjadi di dunia kedokteran saja. Tetapi dapat terjadi di hampir semua profesi, baik hakim, jaksa, guru, politisi, polisi/TNI dan seterusnya. Pada malpraktik medik sangat jelas dokter telah bertindak tidak sesuai dengan prosedur ditetapkan pada standar pelayanan medik di rumah sakit tempat dia bertugas. Malpraktik medik (medical violence) dalam kategori ini jelas dokter lalai. Dalam praktik kedokteran dapat terjadi yang namanya efek tidak diinginkan/ETD (adverse event) pada diri pasien. Efek tidak dinginkan/ETD tersebut meliputi ketidaknyamanan, kecacatan sampai kematian. Tindakan dokter yang benar namun masih mengakibatkan efek tidak diinginkan disebut medical error (ME). Di Amerika, kejadian ETD yang mengakibatkan kematian terjadi 44.000 – 98.000 pasien per tahun. Artinya, setiap hari terjadi kematian sebanyak

Kenali Pertanda Bayi Sakit SALAH satu kesulitan merawat bayi adalah mengetahui apakah bayi sehat atau sakit. Bayi tidak dapat memberi tahu apa yang mereka rasakan, jadi kita harus mengandalkan reaksi tubuh. Bayi selalu memberikan tanda-tanda bila tidak sehat. Tanda itu sangat nyata, bisa juga kurang nyata. Demam, dingin, muntah dan biduran beberapa tanda yang nyata. Tanda kurang nyata antara lain menjadi pasif, cengeng, tidak tertarik dengan apa yang terjadi di sekelilingnya, kurang selera makan, tidak buang air besar dalam beberapa hari. Bila kulit bayi menguning, segera hubungi dokter. Kondisi ini biasanya muncul pada bayi baru lahir dan menandakan liver bayi tidak berfungsi baik. Terkadang gejala tidak muncul sampai bayi di bawa ke rumah. Bila bayi berkali-kali menolak makan atau tidak berselera makan, hubungi dokter. Demikian pula bila bayi menjadi pasif atau sulit dirangsang, mudah menangis/cengeng dan sulit di-

tenangkan. Demam adalah reaksi tubuh terhadap infeksi. Salah satu cara paling baik untuk mengukur suhu tubuh bayi memakai termometer rektal atau oral ditempatkan di dubur atau mulut bayi. Termometer strip di kening atau perabaan kurang akurat mendeteksi demam bayi. Bila temperatur badannya lebih 38 C berarti bayi demam. Bila bayi kurang dari 3 bulan demam, apalagi diiringi gejala lain seperti biduran, segera hubungi dokter. Pada bayi lebih tua dapat diberikan anti demam untuk meredakan panas. Hubungi dokter bila panas tidak turun setelah 24 jam. Muntah berbeda dengan gumoh yang merupakan hal biasa pada bayi. Muntah lebih kuat, volumenya lebih banyak dan tidak terjadi hanya setelah bayi diberi makan. Muntah dan diare dapat disebabkan infeksi, masalah pencernaan dan penyakit lainnya. Keduanya berpotensi membahayakan bayi karena dehidrasi. Tanda-tanda bayi dehidrasi antara lain tidak

mengompol dalam enam jam atau lebih, menangis tanpa air mata dan mulutnya kering tidak berliur. Bayi menjadi lemah, sangat mengantuk dan sulit dibangunkan. Segera membawanya ke dokter bila kondisinya demikian. Bila bayi demam, cengeng dan menarik atau menekannekan telinganya, dia mungkin terkena infeksi telinga. Infeksi telinga hal umum dan tidak selalu membahayakan, tapi perlu berkonsultasi dengan dokter untuk mendapatkan antibiotik bagi bayi. Infeksi telinga yang tidak ditangani dapat menyebabkan masalah pendengaran permanen. Hubungi dokter bila bayi mengalami biduran atau ruam yang luas terutama bila diikuti demam. Setiap bayi memiliki kebiasaan buang air besar sendiri. Ada setiap hari buang air, ada beberapa hari sekali. Bila bayi tidak buang air besar sesuai pola biasanya atau ketika tampak kesulitan saat buang air, hubungi

dokter. Bila salah satu atau kedua mata bayi memerah atau mengeluarkan kotoran periksakan ke dokter. Bayi pasti sesekali pernah jatuh. Semakin besar, semakin sering mereka jatuh. Bila jatuh dari kursi tinggi atau terlepas dari timangan, ibu harus mengecek secara menyeluruh kondisi tubuhnya dan mengamati kondisi kesehatannya dalam 24 jam. Bila dia menangis setelah jatuh, itu tandanya dia tidak terlalu serius mengalami luka. Sebagai saran, segera bawa ke dokter bila bayi dalam keadaan tampak lemah atau bingung, sulit menggerakkan sebagian anggota badannya, memiliki darah mengumpul di bagian putih matanya, mengeluarkan darah dari hidung (mimisan) dan telinga, fokus matanya menjadi bersilangan, ukuran pupil tidak sama, atau muntahmuntah, menangis keras bila bagian tubuhnya tertentu digerakkan/disentuh dan tidur lebih lama dari biasanya.*dr Lily

Gangguan Hipokondria Dan Psikosomatis


Istilah hipokondria masih jarang didengar, namun kasusnya cukup sering muncul ke hadapan meja dokter. Sebagian lagi menyebutnya psikosomatis dalam beberapa tingkatan, namun sebenarnya ini bentuk stress dari penderitanya. Kita sering mendengar orang selalu mengeluh sakit ini dan itu dengan keluhan mulai dari ringan sampai berat, merasa dirinya sakit parah, namun ketika berobat ke dokter, hasil pemeriksaan lebih lanjut menyatakan pasien sama sekali tidak menderita penyakit apapun. Namun, bukan berarti penderitanya tak memerlukan penanganan, apalagi dokter atau kerabat terde-

katnya tak mengindahkan keluhannya. Dasarnya adalah stress, lama-lama bisa juga berkembang menjadi penyakit atas macam-macam efek lanjutnya, bahkan lebih dari sekedar gangguan psikologis. Tentang Hipokondria Secara definitif, hipokondria untuk gangguan dimana penderita merasa betul-betul sakit di salah satu atau lebih bagian tubuhnya meski secara fisik orang tersebut sehat tanpa menderita gangguan fisik apapun. Faktor pemicunya tekanan berupa stress yang membuat penderitanya merasa mengalami gangguan tertentu yang

diterjemahkannya secara subjektif sebagai penyakit. Beberapa riset belakangan ini menyebutkan pertambahan kasusnya, terlebih saat sekarang informasi kesehatan mudah diakses dari banyak media, padahal tak selalu benar. Malah, sebagian berisi penelusuran bombastis yang membuat penderitanya semakin menghubung-hubungkan apa yang dibaca secara salah kaprah. Bentuk awalnya hanya pada masalah psikologis. Seperti dibahas banyak ahli, efek lanjut berupa lingkaran setan dari keluhan semu yang tak ditanggapi, lama-lama bisa berakibat ke banyak hal termasuk penjagaan kesehatan atau menurunnya imunitas, selanjutnya membuat penderitanya benar-benar mengalami banyak gangguan secara fisik. Berdasar banyak literatur, kunci pengobatannya pada masalah kebutuhan simpati untuk mendengar keluh-kesah penderita, yang jarang sekali terwujud karena anggapan pendengarnya akan mengarah ke hal yang salah. Karena itu keadaan ini sering digolongkan penyakit kejiwaan atau psikosomatis yang harus diatasi dengan konsultasi psikodiagnostik secara berkala. Di beberapa negara maju, penderita gangguan ini kerap

memiliki grup konseling untuk saling berinteraksi dibawah bimbingan psikiater. Kebanyakan penderita justru datang dari kalangan berpendidikan dan memiliki karir. Selain stress lebih tinggi, kesadaran untuk mengulik informasi dari ratarata survei lebih besar. Meski ada beberapa riset menyebutkan kebanyakan penderita lebih sering kaum wanita, riset lain memberikan hasil bertolak belakang. Yang jelas, gangguan hipokondria ini mengacu pada keadaan kecemasan berlebihan yang dipicu stress. Bila gangguannya tak tertangani, gangguan fisik bisa muncul sangat bervariasi, dari gangguan fisik sesaat seperti jantung berdebar-debar, pusing, mual, muntah dan bisa berdampak lebih jelek lagi. Peranan Stress Kecemasan dan stress sering dipicu banyak hal karena tekanan banyak aspek termasuk urusan pekerjaan.Walau berupa gejala fisik yang lazim menyertainya dengan berbagai bentuk gangguan awal, ini bisa berkembang ke penyakit sungguhan. Pada keadaan stress , walau dalam tahap awal masih berada dalam batasan fisiologis, jantung biasanya bekerja lebih berat untuk memompa darah

lebih cepat sehingga penderitanya bisa merasa berdebar-debar. Selain itu, efek lain juga muncul pada peningkatan asam lambung, kerja otak dalam keadaan tersebut secara otomatis turut mempengaruhi pengaturan lain dalam tubuh termasuk metabolisme. Beberapa efeknya pada pengaturan hormonal juga membuat gangguan itu bertambah parah, akhirnya selain menimbulkan penyakit, dampaknya terhadap kekebalan tubuh menurun akan merembet ke banyak hal lain. Bagi pelaku medis, kunci penanganannya lebih terletak pada kesabaran lebih dalam memberikan konseling secara terarah. terlebih menyangkut penanganannya membutuhkan banyak bimbingan dan kesabaran lebih. Secara umum, kewaspadaan tinggi terhadap kesehatan pasti banyak manfaatnya, namun bersikap terlalu cemas tanpa latar belakang sama sekali tidak diharapkan. Usaha Penyembuhan Faktor konseling membuat pelaku medis yang menanganinya harus bersedia menelusuri keluhan lebih sabar dan teliti. Walau gejala ke arah gangguan kejiwaan berupa psikosomatis tadi sudah terlihat dengan keluhan psikis melebihi penam-

pakan fisik, perlu ada penerangan lebih bertujuan membuat penderita bisa mengurangi kecemasannya. Ada pula yang benar-benar menderita penyakit tertentu, namun konselingnya kurang komunikatif bisa jatuh ke keadaan ini. Pemberian obat dan pemeriksaan tambahan tertentu bisa saja diperlukan, namun harus disesuaikan dengan berat ringan gambaran penderitanya. Menghindari keluhan yang muncul akan memperparah penyakit penderitanya, karena itu terkadang perlu juga memberikan terapi lain seperti pengalihan aktifitas dan konseling lebih, dimana semuanya menjadi kesatuan untuk penanganannya. Terlalu banyak memperoleh informasi kesehatan tanpa didasari ilmu memadai dampaknya tidak selamanya baik,termasukkewaspadaanberlebihanterhadappenyakit.Walau penjagaan kesehatan tetap perlu dilakukan, namun jangan sampai gejala penyakit yang ditampilkan di banyak media akan membuat penderita gangguan ini berpikir dirinya mengalami salah satu di antaranya apalagi menyangkut penyakit berbahaya, sehingga memunculkan kepanikan dan rasa cemas berlebihan. *dr. Daniel Irawan

Remaja Minim PengetahuanTentang Kesehatan Reproduksi Permasalahan remaja dalam pendewasaan usia perkawinan adalah rendahnya pengetahuan remaja tentang kesehatan reproduksi (Kespro) yaitu tentang masa subur. Remaja perempuan dan laki-laki usia 15-24 tahun yang mengetahui tentang masa subur mencapai 65 persen (SDKI 2007), terdapat kenaikan dibanding hasil SKRRI tahun 20022003 sebesar 29-32 persen. Hal itu diungkapkan Kepala Sub Bidang Advokasi dan Komunikasi Informasi dan Edukasi (KIE) Perwakilan BKKBN Sumut Antoni S.Sos disela-sela sosialisasi pendewasaan usia perkawinan yang dilaksanakan di sekolah Yayasan Perguruan (Yapeg) Panca Abdi Bangsaku (Pabaku) Desa Karang Rejo Kec. Stabat Kab. Langkat baru-baru ini. Kegiatan sosialisasi tersebut merupakan kerjasama BKKBN Sumut dengan radio komunitas (Rakom) Yapeg Pabaku dalam rangka sosialisasi pendewasaan usia kawin bagi siswa-siswa SLTA Pabaku khususnya yang duduk di bangku kelas 12. Sebagai narasumber hadir dr Windy M.Kes dari Dinkes Sumut. Dikatakan Antoni, kencederungan nikah dini dikalangan remaja khususnya bagi remaja putri ‘drop out’ SLTA ataupun yang baru lulus SLTA namun tidak melanjutkan ke Perguruan Tinggi di Kabupaten Stabat cukup tinggi. Sekitar 30 persen remaja di sana melakukan nikah dini.

Hal ini bisa terjadi karena pemahaman generasi berencana (Genre) belum sampai ke mereka, kata Antoni. Banyak hal yang menjadi penyebabnya antara lain petugas lapangan KB yang sangat minim, kepedulian Badan PP dan KB setempat yang kurang memberikan informasi ke sekolah-sekolah lewat sosialisasi, seminar maupun workshop. “Sejauh ini program generasi berencana kurang diperhatikan oleh SKPD di Badan PP dan KB Langkat,”papar Antoni yang menyebutkan hal ini juga menjadi kendala dari lemahnya advokasi dan KIE di sana. Dijelaskan Antoni, tujuan dari program pendewasaan usia perkawinan adalah memberikan pengertian dan kesadaran kepada remaja agar dalam merencanakan keluarga, mereka dapat mempertimbangkan berbagai aspek berkaitan dengan kehidupan berkeluarga, kesiapan fisik, mental, emosional, pendidikan, sosial, ekonomi serta menentukan jumlah dan jarak kelahiran. Jika pendewasaan usia perkawinan ini tidak disosialisasikan, maka remaja cenderung terkena dampak kesehatan reproduksi. Remaja yang rentan ini mencakup remaja putus sekolah, remaja jalanan, remaja penyalahgunaan napza, remaja yang mengalami kekerasan seksual, korban perkosaan dan pekerja seks komersial. Dengan mendapat informasi yang benar mengenai

resiko kesehatan reproduksi maka diharapkan remaja akan semakin berhati-hati dalam melakukan aktifitas kehidupan reproduksinya, jelas Antoni. Antoni juga mengatakan risiko mengancam kesehatan remaja yang melakukan nikah dini akan timbul kemungkinan risiko medik yakni keguguran, preeklamsia yakni tekanan darah tinggi, cedema dan proteinuria, eklamsia yakni kerancunan kehamilan, timbulnya kesulitan persalinan, bayi lahir sebelum waktunya, berat bayi lahir rendah, fistula vasikovaginal yakni merembesnya air seni ke vagina, fistula retrovaginal yakni keluarnya gas dan feses/ tinja ke vagina dan kanker leher rahim. Sebaiknya, kata Antoni, perkawinan dilakukan pada usia dewasa karena akan menjamin kesehatan reproduksi ideal bagi perempuan sehingga kematian ibu melahirkan dapat dihindari. Perkawinan di usia dewasa juga akan memberikan keuntungan dalam hal kesiapan psikologis dan sosial ekonomi. Keuntungan lainnya ada masa menjarangkan kehamilan terjadi pada periode pasangan usia subur (PUS). Secara empirik diketahui PUS sebaiknya melahirkan pada periode 20-35 tahun, sehingga risiko medik yang diuraikan tadi tidak terjadi, kata Antoni. *Ayu Kesumaningtyas

120-168 pasien per hari karena tindakan dokter yang benar. Tolak Kriminalisasi Dokter Pantaskah dokter ditangkap seperti layaknya bandar narkoba, apalagi dokter lagi menjalankan profesinya yang luhur? Saya menolak keras dokter dikriminalisasi, khususnya dalam pelayanan kesehatan. Karena sepengetahuan saya tidak pernah ada dokter dalam hati nuraninya menginginkan pasiennya mengalami kesakitan apalagi kematian. Dunia kedokteran memang rumit, serumit sosok tubuh manusia itu sendiri, yang tak pernah habis untuk dipahami dan dipelajari. Banyak kali variabel yang terjadi dalam tubuh seseorang ketika jatuh sakit. Ilmu pengetahuan kedokteran hanya mampu mendekati kebenaran karena pendekatan ilmiah yang ada belum tentu seluruhnya benar. Dalam dimensi hukum terutama hukum pidana jelas perbuatan seseorang mungkin termasuk dokter yang menyebabkan seseorang menjadi cacat atau meninggal harus dihukum. Disinilah mulai muncul perdebatan dalam perpektif ilmu hukum. Apakah benar setiap perbuatan dokter dengan niat membantu menyembuhkan penderitaan pasiennya, lalu setelah dibantu, pasien meninggal dunia serta merta dokter dihukum pidana. Kalau begini keadaannya, saya yakin tidak ada seorangpun di dunia ini yang mau menjadi dokter. Sehingga diperlukan kekhususan kajian dan penanganan persoalan atau

kasus hukum seputar kedokteran. Kesimpulannya, mekanisme untuk menilai penyebab kematian atau kecacatan pasien yang diobati dokter tidak dapat dilakukan di lembaga peradilan umum. Obyektivitas penyelesaian kasus oleh hakim peradilan pidana -secara umum tidak mempunyai keahlian dalam hal teknis ilmu kedokteran- tidak dapat terjamin dengan baik. Akibatnya, seringkali untuk membuat keputusan, referensi hakim sangat tergantung pendapat saksi ahli. Dengan alasan ini Majelis Kehormatan Disiplin Kedokteran Indonesia (MKDKI) merupakan lembaga independen harus terus disosialisasikan. Lembaga ini sudah berjalan seputar tahun 2004 setelah terbentuknya Konsil Kedokteran Indonesia (KKI). MKDKI ini menempatkan tiga dimensi permasalahan yaitu etik, hukum dan disiplin kedokteran. Akhir tulisan saya menolak keras kriminalisasi dokter khususnya dibidang pelayanan kesehatan mengingat kesembuhan seseorang mutlak di tangan sang Khalik, dokter hanya perantara mencapai kesembuhan pasien. Bagaimanapun juga dokter juga manusia. *M. Aron Pase, sekretaris Ikatan Dokter Indonesia Wilayah Sumatera Utara dan Dokter Spesialis di Departemen Ilmu Penyakit Dalam FK-USU/ RSHAM dan email: atau dan HP. 0812 650 5336)


Balita Sehat Menetukan Masa Depan Bangsa Masa Balita merupakan periode emas yang sangat menentukan pertumbuhan seorang manusia baik dari segi fisik, emosi, intelektual dan budi pekerti. Oleh karena itu setiap keluarga perlu diberdayakan agar menyadari periode emas ini hanya datang satu kali dan tidak bisa diulang, sehingga secara maksimal kita harus berusaha memenuhi kebutuhan pertumbuhan fisik dan perkembangan mental anak Balita. Sebagai orang paling dekat dengan Balita, sosok ibu lebih banyak mengetahui perkembangan anaknya. Apa jadinya bila seorang ibu tidak memiliki pengetahuan tentang pola asuh dan tumbuh kembang anaknya. Untuk itu seorang ibu haru memahami apa itu Bina Keluarga Balita (BKB) yang merupakan program peningkatan kualitas kehidupan keluarga sehat dan sejahtera. BKB memberikan pengetahuan tentang tumbuh kembang anak sesuai tingkatan umur guna menyiapkan generasi penerus bangsa sehat, cerdas dan berakhlak mulia sesuai cita-cita bangsa, karena anak merupakan investasi bangsa dan negara. Program BKB yang diusung BKKBN merupakan salah satu upaya mewujudkan pembangunan keluarga sejahtera yang menempatkan keluarga sebagai wahana pendidikan pertama dan utama bagi anak-anak Balita melalui rangsangan fisik, mental, intelektual, spiritual, sosial, emosional serta moral yang bertumpu pada nilai-nilai agama dan nilai luhur budaya bangsa sebagai upaya membina tumbuh kembang anak Balita secara menyeluruh dan terpadu. Program BKB dari BKKBN ini merupakan pelaksanaan dari upaya peningkatan pengetahuan, keterampilan dan kesadaran ibu serta anggota keluarga lain dalam membina tumbuh kembang anak Balitanya. Oleh sebab itu, program ini merupakan bagian integral untuk meningkatkan kualitas manusia Indonesia menuju terbentuknya manusia Indonesia seutuhnya. Sebagai orang tua banyak di antara kita yang tidak mengenyam pendidikan secara memadai, belum memahami pola asuh anak dan tumbuh kembang anak yang baik. Untuk itu pemerintah dalam hal ini BKKBN menyediakan program ini yang tujuannya memberikan manfaat kepada mereka, dengan ikut BKB diharapkan orang tua akan menjadi lebih terampil dalam mengurus, merawat serta pandai membagi waktu dalam mengasuh dan mendidik anak Balitanya. Dengan mempelajari perubahan biologis dan psikologis yang terjadi pada usia awal Balita, ibu akan lebih tahu tentang apa yang harus diperhatikan dari proses tumbuh kembangnya, seiring bertambahnya usia Balita. Sebagai orang tua akan memiliki rasa percaya diri yang lebih ketika Balita bisa melakukan hal-hal sesuai tahapan tumbuh kembang dan ibu akan mampu memilih makanan, mainan serta kegiatan yang tepat untuk mendukung tumbuh kembang Balita. Tahapan tumbuh kembang adalah titik panduan untuk memahami sudah sampai tahap mana Balita berada. Apakah ia sudah mengalami kemajuan belajar ? Tahapan tumbuh kembang dapat dijadikan referensi relevan karena di usia awal kehidupan seseorang umumnya gen dan nutrisi akan membentuk tulang, otot, dan organ lainnya dalam pola yang teratur dan terprediksi. Pertumbuhan yang terprediksi ini akan menentukan apa yang bisa dan belum bisa dilakukan oleh Balita pada jenjang waktu tertentu. Selain itu sistem saraf juga mengalami perkembangan pesat yang mempengaruhi perubahan perilaku secara signifikan di usia 2, 6 hingga 12 bulan. Perubahan ini menghasilkan perbedaan kemampuan berpikir, kemampuan motorik dan kemampuan sosial/emosional yang dapat diamati. Pola perilaku anak dapat dikelompokkan dalam tiga kategori yakni perkembangan berpikir/berbahasa mengacu pada kemampuan menyerap informasi seperti kemampuan memperhatikan, mengingat dan mengelompokkan serta penggunaan bahasa untuk berkomunikasi dan memahami dunia sekitarnya. Perkembangan fisik/motorik/sensorik termasuk perubahan pada sistem otot dan saraf yang memungkinkan anak untuk melakukan berbagai gerak anggota tubuh, berinteraksi dengan benda disekitarnya, memonitor suara dan informasi visual. Perkembangan emosional/sosial berhubungan dengan kemampuan pribadi anak yang memungkinkan ia berinteraksi dengan orang lain dan untuk mengalami serta menunjukkan emosi.*Syamira Alina P Lubis net



WASPADA Minggu 24 November 2013

Guru Harus Lebih Sabar Dan Lebih Profesional


Suasana pelantikan Pengurus CTF Student Council (SCS) yang merupakan OSIS SMA Unggulan CT Foudation Periode 2012/2013 yang dilaksanakan di aula sekolah itu, Sabtu (23/11).

CTF Student Council Periode 2013/2014 Dilantik UNTUK menjalankan roda organisasi di lingkungan sekolahnya siswa SMA Unggulan CT Foundation di JalanVeteran Pasar VII Manunggal, Kecamatan Labuhan Deli, Kabupaten Deliserdang, Sabtu (23/11) melaksanakan pelantikan Pengurus CTF Student Council (CSC) yang merupakanOrganisasiSiswaIntra Sekolah (OSIS) sekolah itu. Acara yang dilaksanakan di Aula SMA Unggulan CT Foundationinidimulaidenganmasuknya pengurus CSC demisioner dan

pengurus CSC Periode 2013/2014 yang akan segera dilantik. Sebelum dilantik dan membacakan sumpah jabatan Pengurus CTF Student Council Periode 2013/2014 dilaksanakan acara serah terima jabatan yang ditandai dengan penandatangan berita acara serah terima jabatan daripengurusdemisionerkepada pengurus CTF Student Council yang baru periode 2013/2014. Pelantikan ini diisi dengan pembacaan laporan pertanggungjawaban departemen yang

berada di bawah CTF Student Council periode 2012/2013. Kepala SMA Unggulan CT Foundation Drs. Daulat Siregar, M.Pd., M.Si dalam sambutanya menyampaikan terima kasih kepada Pengurus CTF Student Council Periode 2012/2013 yang telahbertugasdenganbaikselama satu tahun, dan berharap kepada M. Rinal Fahlevi sebagai Ketua CSC terpilih serta seluruh kepengurusan yang telah dibentuk dapat membuktikan diri dengan bertugas dan menjalankan

kinerjanya dengan lebih baik lagi sehingga dengan demikian diharapkan untuk satu tahun kedepan CSC dapat lebih maju dari sebelumnya. Daulatberharapditahunyang akan dapat CSC dapat lebih aktif lagidalammenjalankanperannya sebagai organisasi kesiswaan di SMA Unggulan CT Foundation dengan menggelar berbagai kegiatan yang lebih kreatif dan inovatif sehingga muncul ide-ide yang bisa mendidik siswa kearah yang lebih baik. * Erzilmarkos

Menghadapi Haters IDEALNYA kita ingin disukai dan dicintai semua orang. Sayangnya hal ini jarang terjadi. Selalu ada saja orang yang membenci kita. Duh, gimana, dong? Dunia pasti akan sangat indah kalau hidup kita dikelilingi oleh orang-orang yang menyenangkan dan penuh cinta. Sayangnya itu enggak selalu terjadi. Apa pun yang kita lakukan, selalu ada orang-orang yang tidak menyukai kita. Kita menghabiskan waktu bertanya-tanya apa kesalahan yang sudah kita lakukan. Introspeksi diri pun seakan tidak membawa perubahan. Sang hater ini pun muncul menghiasi harihari kita. Satu hater saja sudah berpotensi bikin hidup kita jadi tidak bahagia. Kenapa Mereka Membenci Kita Ada beberapa alasan orang membenci kita. Pertama, mereka merasa iri dengan apa yang kita miliki, baik materi maupun prestasi. Ada saja komentar negative yang terlontar dari hater ketika kita memakai sesuatu yang lucu atau unik yang dipuji semua orang. Begitu juga ketika kita dapat nilai tinggi saat ulangan bahasa Inggris sampai kita jadi kesayangan guru. Yang terjadi adalah mereka iri dengan apa yang kita miliki , tapi dalam hati mereka menyangkalnya. Pelampiasannya adalah melancarkan komentar negative. Bisa secara langsung mengatakannya di depan kita, lewat komentar


kepuasan pada dirinya. Terdengar menyedihkan, ya?

miring sosial media sampai menyebarkan gossip di belakang kita, Saking bencinya mereka enggak melihat sisi-sisi positif dari kita. Runyam ya? Tanpa Alasan Alasan lain yang juga sering terjadi adalah benci tanpa alasan yang jelas. Rasa tidak suka hater muncul begitu saja. Mereka sengaja mengamati gerak-gerik kita lalu menyebarkan gossip di belakang kita. Kegiatan ini membuat mereka senang karena merasa bisa menguasai hidup kita. Orang yang membenci tanpa alasan ini juga biasa enggak bahagia dengan hidup mereka. Di bawah sadar mereka ingin orang lain pun merasakan apa yang mereka rasakan. Dengan membuat orang lain sedih atau susah, hal itu bisa memberikan rasa

23 Okt – 22 Nov


ENGGAK baik terus terusan kesal sama teman, pacar, atau mungkin keluarga kita. Belajar untuk memaafkan, yuk! LO VE : Cari target baru. Hi hi Hi. MONEY : Siapin uang lebih di dompet UCKY DA buat jaga-jaga di jalan . LLUCKY DAYY : Jumat.

: Rabu.



23 Nov – 21 Des

COBA aktivitas baru memang seru, tapi enggak ada salahnya kalau kita memperdalam pengalaman dulu di kegiatan sebelumnya. LOVE : Sssttt… diam-diam si dia perhatian, MONEYY : Yeay, siap nabung buat liburan! lho. MONE Lucky Day : Selasa.

Cara menghadapi Hater 1. Abaikan : Ini cara efektif menghadapi hater. Orang yang penuh kebencian punya banyak energi negatif dalam dirinya. Energi negative ini bisa mempengaruhi mood kita. Kita bisa ketularan jadi pembenci juga. Jadi ketika ada orang yang membenci kita lebih baik menjaga jarak atau menghindar. 2. Jangan masukkan ke hati : Mungkin ada saat kita sulit membedakan antara kritik membangun dan respon hater yang penuh kebencian. Dalam kasus ini dengarkan komentar mereka tapi jangan terlalu di masukkan ke hati. Kalau kita merasa bisa memperbaiki diri karena ktitik tersebut, itu akan jadi hal yang luar biasa.

DA DAYY : Senin.

22 Des – 20 Jan

JADI ketua acara di sekolah enggak hanya nambah pengalaman, tapi juga memberi pelajaran tentang O VE : kepemimpinan. LLO Siapin kado special. MONEY : Duh, lagi boros. LUCKY DA DAYY

21 Jan – 19 Feb

PRACTICE makes perfect! Apapun yang lagi kita tekuni, latihan dan terus belajar itu penting lho. LO VE : Kangen ngobrol sama gebetan. MONEY : Bikin catatan pengeluaran harian. LUCKY

Peringatan Hari Guru biasanyadiisidenganupacarabendera dan pemberian penghargaan pada guru berprestasi, kepala sekolah maupun pengawas sekolah. Bermacam kegiatan digelar siswa dengan melibatkan para guru, seperti puisi, drama parodi, menyanyi, lomba memasak, memberikan kado, karangan bunga dan sebagainya. Memperingati hari guru pada Senin 25 November 2013 besok beberapa siswa berharap denganperingataniniakansemakin menambah kecintaan serta rasa hormat murid kepada gurugurunyayangtelahmendidikdan mengajar mereka dengan sabar

sehingga guru pantas mendapat gelar pahlawan tanpa tanda jasa. Seperti yang dikatakan M. Insan Gunawan Lubis pelajar kelasVIII SMP Al-Azhar (foto) hari guru bisa dijadikan sebagai saranaintrospeksimelihatkembali kebelakangtentangapayangtelah kitalakukanterhadapguruselama ini, bagaimana tingkat laku kita terhadap guru dan saat inilah kita menunjukkan bakti kita kepada guru dengan cara mendoakan yang terbaik untuknya. “Semoga guru di Indonesia dapat lebih lebih maju, lebih kreatif dan inovatif,” ungkapnya. Hal yang sama juga disampaikan Shahnaz Zalsabila (foto) siswa kelas Al-Azhar lainnya baginya guru merupakan sosok yang pantas untuk diteladani baik dari segi bersikap, berpakaian maupun bertingkah laku. “Kita sangat pantas untuk menghargai jasa guru yang telah bersusah payah mendidik kita setiap harinya, apapun yang kita berikan kepada guru tidak akan bisa membayar apa yang telah diberikannya kepada kita, karena ilmu yang dberikannya adalah bekal yang sangat berharga dan tak akan terbalas jasa-jasa seorang guru,” ucapnya. Sementara itu Ayumi (foto) siswa kelas XI yang juga ketua OSIS SMA Harapan 3 mengatakan, setiap peringatan hari guru di sekolahnya siswa menggelar berbagai kegiatan, hal ini sebagai wujud bakti siswa kepada guru yang telah mendidik dan mengajar mereka. Salah satu kegiatan yangrutindigelardiSMAHarapan 3 menurutnya adalah lomba

memasak yang dilaksanakan di lingkungan SMA Harapan 3 dan hasil dari masakan tersebut nantinya diberikan kepada guru. “Ayumi berharap meski saat ini kualitas dan pengembangan guru di sekolah sudah cukup bagus namun dia tetap berharap semoga guru-guru di Indonesia lebih meningkatkan lagi ilmu pengetahuannya baik itu dari segi menyayian materi maupuan dari segi penguasaan teknologi, sehingga diharapkan kualitas pendidikan kita dapat lebih ditingkatkan,” ungkapnya. Demikian juga dengan Rifqi Syauqy (foto) siswa kelas XII Harapan 3 baginya guru merupakan sosok yang sangat berjasa dalam hidupnya yang telah memberikan ilmu dan pengetahuankepadanya.MenurutRifqi guru suatu profesi yang sangat mulia dan mereka sangat berjasa dalam menentukan masa depan suatu bangsa, selain itu menurutnya guru adalah orang yang sangat sabar. Sebab dengan berbagaimacampoladantingkah anak didiknya namun guru tetap bersabar dalam mendidik mereka. “Tanpa ada guru kita tidakberartiapa-apakarenaitulah jasa seorang guru sangat berarti bagi kita,” ucapnya. Kepala SMP Al-Azhar Drs H Agustono MA berharap peringatan hari guru tidak hanya sebatas seremonial semata, namun lebih dari itu bagaimana siswa bisa menghormati guru sebagai penyampai ilmu agar anak-anak bisa tumbuh menjadi siswa yang berakhlakul karimah. Selainitugurujugaharuslebih

sabar dan lebih profesional serta mampu mengembangkan ilmu pengetahuan mereka sesuai perkembangan zaman terutama dari segi SDM dengan terus mengikuti perkembangan teknologi. Apalagi saat ini guru telah mendapatkandanasertifikasidari pemerintah sebagai suatu usaha meningkatkan kualitas guru tersebut. “Guru harus menjadi sosok idola atau panutan bagi siswa baik dalam kehidupan sehari-hari maupun dalam kehidupan bermasyarakat,” ucapnya. Sementara itu Kepala SMA Harapan 3 Jalan Karya Wisata Ujung Abdul Jalil menyatakan momen peringatan hari guru diharapkan sebagai wadah untuk pembaharuan kebijakan dari pemerintah, karena menurut AbdulJalilselamabanyakkebijakanpemerintahkhususnyadibidang pendidikan yang kurang tepat salahsatunyamengenaisertifikasi. Menurutnyasertifikasibukan malah membuat aspek positif malam cendrung negatif, contohnya soal pemberkasan yang terus diperbaharui setiap 3 bulan sekali, sehingga guru malah disibukan dengan urusan pemberkasan dari pada mengurus anak didiknya. Selainitumenurutnyakebijakan tentang Ujian Nasional (UN) yang menurutnya malah membuat pendidikan tidak semakin bagus, hal ini disebabkan karena guru tidak rela siswanya tidak lulus sehingga mereka harus menghalalkan segala cara agar siswa mereka lulus sehingga terjadi kebijakan yang kurang fair. * Erzilmarkos

Siswa SMK As-Syafiiyah

Harus Mampu Menjawab Tantangan Industri

Kalau tidak, ya abaikan saja. 3. Tidak perlu terpancing : Salah satu keinginan terbesar hater adalah kita bereaksi atas tindakannya. Jadi tidak usah terpancing karena waktu dan energi kita jauh lebih berharga daripada meladeni aksi mereka. 4. Ketika level kebencian hater sudah makin tinggi, aksinya pun makin menyeramkan. Selain menyebarkan gossip yang menyudutkan mereka bisa melakukan tindakan fisik yang menjurus pada bahaya dan kriminalitas. Kalau ini sudah terjadi, kita harus melapor pada guru atau orangtua. Biar enggak dianggap memfitnah, kumpulkan juga sejumlah bukti. Misalnya surat, coretan atau twit yang dia buat. NZ


HARI guru rutin diperingati setiap tahun diberbagai negara-negara di dunia dengan tanggal yang berbeda. Di Indonesia hari guru diperingati setiap tanggal 25 November bersamaan dengan hari ulang tahun Persatuan Guru Nasional Indonesia (PGR). Peringatan ini merupakan salah satu upaya pemberian penghargaan oleh siswa kepada guru atas jasa guru mereka.

20 Feb – 20 Mar

SEJAK awal tahun ajaran 2013-2014 SMK As-Syafiiyah Internasional, mampu bersaing dan meraih prestasi yang cukup menggembirakan. Hal ini terbukti dengan keberhasilan siswanya, Rafiyandi peraih juara harapan 2 bidang IT Support di ajang Lomba Kompetensi Siswa (LKS) SMK tingkat kota Medan yang digelar beberapa waktu yang di lalu di SMK Tritech Medan. Kepala SMK As-Syafiiyah Internasional Drs Ramlan mengatakan, keberhasilan ini tentunya sebuah prestasi yang cukup membanggakan mengingat usia sekolahnya yang belum mencapai satu tahun, namun telah mampu bersaing dengan SMK lainnya yang cukup terkenal di kota Medan. Ramlan mengatakan, SMK As-Syafiiyah merupakan sekolah kejuruan yang mempunyai progam berbeda dengan sekolah lain dengan memakai pola industri, di mana dalam proses pembelajaran siswa dibagi ke dalam dua bagian yaitu siswa jurusan Teknik Kendaraan Ringan (TKR) akan belajar selama 2 minggu di Industri atau praktek lapangan bekerja sama dengan beberapa industri motor yang telahpunya nama di kota Medan dan 2 minggu lagi belajar di sekolah, hal ini dilakukan setiap bulannya selama tiga tahun pelajaran. Sedangkan untuk jurusan Teknik Komputer dan Multi Media pihaknya juga berusaha untuk bekerja sama


SALAH paham sama teman itu hal yang wajar, kok. Asal bisa menghadapi dengan kepala dingin, pasti bakal baikan lagi. LO VE : Lebih memilih jomblo? No problem, girls. MONEY : Happy! Dapat uang jajan tambahan dari om dan tante.

DA DAYY : Jumat.



21 Mar – 19 Apr

ENGGAK ada salahnya nyoba pergi ke tempattempat unik dan enggak biasa pas weekend, seperti museum atau pameran seni. LOVE : Berduaan melulu, nih, cihuy! MONEY : Ayo lebih disiplin mengatur uang jajan. LUCKY DA DAYY : Sabtu.


Kepala SMK As-syafiiyah Drs Ramlan Rafiyandi sisiwa berhasil meraih juara harapan 2 dalam ajang Lomba Kompetensi Siswa (LKS) SMK se kota Medan yang digelar SMK Tritech baru-baru ini. dengan beberapa perusahaan seperti Telkom, Indosat dan beberapa stasiun swasta lainnya. “Ini semua sesuai harapan pembina yayasan yang menginginkan SMK AsSyafiiyah untuk tampil beda dengan SMK lainnya,” ungkap Ramlan. Untuk mencapai program tersebut beberapa waktu yang lalu siswa SMK As-syafiiyah melakukan study

20 Apr – 20 Mei

SELESAIKAN dulu pekerjaan yang sudah kita mulai.Tenang aja, proyek sekolah yang baru OVE : bisa menunggu kok. LLO Masak bareng bisa jadi ide nge-date yang seru. MONEY : udah tipis aja, huff! LUCKY

21 Mei – 21 Jun

UT AR AK AN ide-ide gila pas UTAR ARAK AKAN rapat organisasi nanti. Tapi ingat ya, girls, kita enggak bisa memaksakan kehendak pada orang lain. LOVE : Wih ada gebetan baru yang cute banget. MONEY : Setelah rajin nabung, jadi bisa beli baju idaman, deh. LUCKY DA DAYY : Minggu.


wisata ke PT Inalum dalam rangka menjalin kerja sama sekaligus melihat-lihat serta memperkenalkan siswa dengan peralatan moderen serta sistem kerja yang telah memiliki aturan keselamatan kerja yang memadai yang dilaksanakan diperusahaan tersebut. Ramlan menambahkan SMK As-Syafiiyah dalam proses pembelajarannya dilengkapi sarana praktek 22 Jun – 23 Jul

ENGGAK melulu mikirin diri sendiri, sekarang saat yang tepat buat ngasih perhatian ke oramg-orang terdekat kita. LOVE : Selalu bikin kita semangat dan senyumsenyum terus. MONEY : Nikmatnya beramal dengan uang jajan tambahan. LUCKY DA DAYY : Kamis.


24 Jul – 23 Agt

MENGASAH kreativitas dan daya imajinasi di bidang seni seru dan patut dicoba lho, girls. LOVE : Kalau memang sayang enggak perlu malu untuk ngasih perhatian lebih. MONEY : Banyak pengeluaran, tapi kantong tetap aman. LUCKY DA DAYY : Senin.


dengan standar internasional, hal ini agar siswa terbiasa menggunakan peralatan yang biasa dipakai di semua industri besar dan diharapkan siswa mampu belajar lebih baik dan lebih serius lagi hingga mampu menjawab tantangan yang dibutuhkan industri yang teknologinya selalu berubahubah setiap saat, sesuai kebutuhan. Erzilmarkos 24 Agt – 23 Sep

KARENA kita selalu ulet dan tekun ngerjain tugas-tugas, kita bisa nikmatin, deh, hamil yang memuaskan banget. Selamat, ya! LO VE : Selalu kasih si dia semangat dan dukungan. MONEY : Asyik, pemasukan lagi banyak dan bisa untuk nabung. LUCKY DA DAYY : Kamis.


24 Sep – 22 Okt

SUP SUPAAYA acara sekolah lebih sukses, coba gali ide-ide yang enggak biasa tapi menarik.Think outside the box! LO VE : Kejujuran penting dalam suatu hubungan. MONEY : UCKY DA Dapat traktiran pas duit lagi tipis. LLUCKY DAYY : Rabu. **NZ/ KW

B9 Remaja Santri Ar-Raudlatul Hasanah Demontrasikan Bahasa Arab Dan Inggris

WASPADA Minggu 24 November 2013

BAHASA Arab dan bahasa Inggris merupakan dua bahasa yang tak bisa dipisahkan dari kehidupan sehari-hari santri Pondok Pesantren Ar-Raudlatul Hasanah (Raudhah) Medan. Pasalnya, selain bahasa Indonesia dua bahasa tersebut dijadikan sebagai sarana komunikasi sehari-hari di pesantren itu.


Tiga siswa Al-Azhar bersama guru pembimbing Tri Adinata, Spd saat mengikuti kegiatan Gebyar Multi Talenta PK-LK di Bali belum lama ini.

3 Siswa Al-Azhar Wakili Sumut Dalam Gebyar Multi Talenta Di Bali TIGA siswa Al-Azhar Medan mewakili Sumut mengikuti ajang Gebyar Multi Talenta PK-LK Dikdas tingkat Nasional yang digelar di Bali sejak tanggal 17 hingga 21 November 2013. Ketiga siswa tersebut akan mengikuti tiga cabang lomba yaitu lomba menari, menyanyi, dan multi media. Ketiga siswa yang ikut jadi peserta lomba adalah Nispuraiyan siswa SMP Al-Azhar kelas Akselerasi membawakan tari- tari sigale-gale dari Batak Toba, M Afif Harefa siswa SMP Al-Azhar kelas Akselerasi mengikuti lomba multi mediaataudisainkomunikasidan fisualisasi, serta Elsa Nia Hasugian siswa SD Al-Azhar kelas Akselerasi yang mengikuti lomba nyanyi. Salah seorang siswa yaitu Nispuraiyan ikut dalam dalam ajang lomba tari yang membawakan tari sigale-gale dari Batak Toba mampu menembus partai final diajang lomba yang diikuti oleh 33 peserta dari 33 provinsi

tersebut. Kepala SMP Al-Azhar Drs H Agustono mengaku bangga dengan prestasi siswanya tersebut meski belum mampu menjadi juara, namun bisa masuk final inimerupakansuatuprestasiyang patut di syukuri. Menurut Agustono dipercayainya siswa-siswi Al-Azhar mewakili Provinsi Sumut dalam ajang Gebtar MultiTalenta Dikdas ini karena Perguruan Al-Azhar selama ini memang mempunyai prestasi yang cukup baik dalam bidang seni baik itu tari, nyanyi maupun kesenian lainnya. Hal ini tidak terlepas dari binaan yang dilakukan selama ini, dimana untuk kegiatan kesenian seperti tari, siswa Al-Azhar selain dilatih oleh guru-guru ekskul juga mengambil masukkan dari Dosen Unimed. Sedangkan untuk multi media menurut Agustono siswa AlAzhar dilatih oleh guru-guru,

selain itu juga dibimbing oleh tenagaprofesionaldibidangmulti media,untukkeseniandilatiholeh Matondang seorang pakar seni suara dari dinas kebudayaan. Agustono menjelaskan Gebyar MultiTalenta PK-LK merupakan kegiatan dengan menampilkan kreativitas siswa dengan Pendidikan Khusus dan Pendidikan Layanan Khusus (PK dan PLK).Sebelummengikutikegiatan ini peserta harus diskripsi informasi singkat tentang produk unggulanyangakanditampilkan,bagi peserta tari akan menampilkan tarian berdasarkan tradisi setempat. Untuk kegiatan kali ini siswa Al-Azhar mengikuti tiga lomba diantaranyatari,nyanyidanmulti media. Agustono berharap siswasiswi dapat berlatih lebih giat lagi sehingga mampu meraih prestasi yang lebih baik lagi di masa-masa yang akan datang. Erzilmarkos


TIM sepak bola SMAN 1 Sunggal, Kabupaten Deliserdang usai menjuarai Turnamen Coca-Cola regional Binjai beberapa waktu lalu.

SMAN 1 Sunggal Juara Regional Binjai TIM sepak bola SMA Negeri 1 Sunggal berhasil menjuarai turnamensepakbolaantarpelajar Sekolah Menengat Atas (SMA) regional Binjai,dalam turnamen Coca-cola yang digelar di lapangan Korem Binjai Minggu lalu. Dalamturnamenyangdibagi ke dalam lima wilayah atau regional yaitu regional Kisaran, Pematang Siantar,TebingTinggi, Binjai danMedanSMANegeri1Sunggal yang berlokasi di Jalan Sei.Mencirim Km 15,5 Diski, Kecamatan Sunggal, Kabupaten Deliserdang tergabung ke dalam regional Binjaiyangdiikuti64timdariberbagai sekolahdiBinjai,LangkatdanDeliserdang. Pada turnamen dengan sistemgugurtersebuttimsepakbola SMA Negeri 1 Sunggal tampil sebagai juara setelah di final berhasil menyingkirkan SMAN 7 Binjai yang merupakan juara bertahan tahun lalu dengan skor 3-0. Esra Bakti, Spd guru olah raga sekaligus pelatih SMA Negeri 1 Sunggal merasa bangga dengan

keberhasilantimnyamerekabaru per-tamakalimengikutiturnamen itu dan berhasil menjadi juara sekaligus berhak mewakili regional Binjai untuk berlaga dengan juara maupun runner up 4 regional lainnya di Sumatera Utara bulan Januari 2014 nanti. “Keberhasilan ini tidak terlepas dari dukungan penuh Kepala SMA N 1 Sunggal, hal ini dibuktikandengankehadirannyauntuk memberi dukungan di setiap pertandinganyangdigelartimSMAN 1 Sunggal ini,” ucapnya. Kepala SMAN 1 Sunggal Drs Ramli Siregar didampingiWakilnya Ibrahim Nasution, S.Ag menyampaikanrasaterimakasihnya kepada anak-anak yang telah berjuang tanpa kenal lelah demi mengharumkan nama SMAN 1 Sunggal. “Perjuangananak-anaksungguh luar biasa saya sangat bangga dan memberikan apresiasi atas perjuangan mereka semoga mereka bisa mempertahankan prestasi ini dengan tampil lebih mak-

simallagidipertandinganberikutnya pada Januari tahun depan, saya yakin mereka mampu bersaingditingkatregionalnantimudah-mudahan kita bisa mewakili Sumut ke tingkat nasional,” ucapnya. RamliSiregarmenambahkan sebelumnya tim Pusat Informasi Konseling (PIK) SMAN 1 Sunggal juga berhasil meraih prestasi terbaik lomba PIK remaja tahap tumbuh tingkat Sumut. Dalam lomba itu tim PIK SMAN 1 Sunggal yang diketuai Jem Lamindo Sembiring menampilkan Drama, dankekompakanmasalahkebersihan,konselingsertakotakcurhat. “ Semua prestasi yang diraih siswa SMAN 1 Sunggal tentu tidak terlepas dari kerja keras semua pihak baik siswa maupun guru bidang studi yang bersangkutan, semoga dengan keberhasilan ini akan semakin menambah kepercayaan diri siswa untuk meraih prestasi yang lebih baik lagi,”katanya. Erzilmarkos

Untuk menguatkan pemakaian kedua bahasa tersebut sekaligus menambah kepercayaan diri para santri akan keseriusan dan kesungguhan dalam penguasaan bahasa asing tersebut belum lama ini para santri Ponpes Raudlatul Hasanah menggelar kegiatan demontrasi bahasa bertajuk Languange Expo, dalam kegiatan yang berlangsung selama 7 hari sejak Jumat 15 November hingga Rabu 21 November 2013 malam. Kepala Biro pembimbing bahasa santri Ar-Raudlatul Hasanah, Rahmat Hidayat Lc, disela-sela kegiatan menyampaikan, tujuan digelarnya kegiatan tersebut untuk menambah motivasi sekaligus mengasah kemampuan santri dalam berbahasa Arab dan bahasa Inggris. Menurutnya, kegiatan tersebut akan memberikan stimulus untuk menumbuhkan semangat berkompetisi bagi setiap santri. “Kami mengajak para santri untuk mengasah bakatnya dalam penguasaan

dua bahasa asing ini. Lombalomba yang kami selenggarakan seperti Debat, Scrabble, Muhadasah, Cerdas cermat dan Singing like star akan sangat membantu tumbuhnya motivasi santri berkompetisi dan berprestasi,” ungkapnya. Direktur Pesantren ArRaudlatul Hasanah, Drs H Rasyidin Bina MA, pada saat pembukaan kegiatan memberikan apresiasi yang sangat mendalam atas terselenggaranya kegiatan yang berlangsung selama tujuh hari itu. Menurutnya, meski cukup sederhana namun kegiatan ini sangat memberikan manfaat yang luar biasa, dengan kegiatan alumni Ar-Raudlatul Hasanah diharapkan mampu berkomunikasi dengan dunia luar. “Anak-anak sekalian, ini memang acara sederhana tapi sangat luar biasa. Ikutilah jejak santri alumni yang saat ini telah dan sedang melanjutkan studi di luar negeri seperti Mesir, Yaman, Saudi Arabia, Jepang, Inggris, India, Singapura dan Malay-


PARA pemenang lomba demontrasi bahasa diabadikan bersama Wakil Direktur Pesantren ArRaudlatul Hasanah, Ust. H. Sholihin Addin, S.Ag usai penyerahan hadiah, Rabu (21/11). sia.”, katanya. Rasyidin juga menambahkan bahwa untuk menguasai dua bahasa asing tersebut, para santri harus berdisiplin menggunakan bahasa resmi Ar-Raudlatul Hasanah itu dengan tidak takut salah dan jangan malu (don’t be afraid and don’t be shy), berbicara sebanyak

mungkin (speak a long) dan banyak bertanya (ask more). Selain menyampaikan tips untuk mahir dalam berbahasa, ia juga tidak lupa menyuruh para santri untuk tidak lupa berdoa dan meningkatkan ibadah. Acara grand final yang di gelar Rabu (21/11) dihadiri ribuan santri dan guru-guru

itu, ditutup secara resmi dengan pembacaan doa oleh Wakil Direktur Pesantren ArRaudlatul Hasanah, Ust. H. Sholihin Addin, S.Ag kemudian dilanjutkan dengan pembagian award dan souvenir kepada setiap pemenang lomba. Erzilmarkos

Konjen China Terkesan Dengan YPSA KONSULAT Jenderal (Konjen) China untuk Sumatera Mrs. YANG LING ZHU berkunjung dan memberikan kuliah umum dihadapan siswa SMP dan SMA YP. Shafiyyatul Amaliyyah (YPSA) Selasa (19/11) lalu. Pada kegiatan yang turut di hadiri PembinaYPSA Drs. H. Sofyan Raz, Ak.M.M., Ketua Harian YPSA Hj. Rahmawaty, dan Sekretaris Umum YPSA Hj. Rizki Fadilah Raz, M.Psi.Psikolog., Ketua HarianAddaratulHasanah,S.Sos., S.Pd., dan staf guru dan siswa SMP dan SMAYPSA tersebut Mrs. Yang Ling Zhu sangat terkesan dengan suasana di lingkungan YPSA yang terlihat hijau dan bersih. “Suatu kehormatan bagi saya dapat mengunjungi sekolah ini. Saya terkejut, lingkungannya hijau dan bersih. Begitu masuk saya teringat saat saya sekolah di Tiongkok. Sekolah merupakan tempat orang dididik menjadi pintar dan berbudi baik sehingga sudah sepantasnya sekolah itu harus bersih dan rapi,” ujarnya. Pada kesempatan itu Mrs. Yang Ling Zhu juga menceritakan tentang sejarah hubungan Republik Rakyat China (RRC) dan Indonesia yang sangat panjang. RRC di Asia Timur dan Indonesia di Asia Tenggara merupakan negara tetangga yang baik. Hubungan kedua negara telah dimulai


KONJEN China Mrs.YANG LING ZHU berfose bersama Pembina YPSA Drs. H. Sofyan Raz, Ak.M.M., Ketua Harian YPSA Hj. Rahmawaty, dan Sekretaris Umum YPSA Hj. Rizki Fadilah Raz, M.Psi.Psikolog dalam kunjungannya ke YPSA belum lama ini. sejak 2000 tahun yang lalu pada abad IV, dimulai dari pelayar Tiongkok. Mereka berlayar dan singgah di pulau Jawa, Sumatera dan pulau lain yang ada di Indonesia. Mrs.Yang Ling Zhu menjelaskan RRC dan Indonesia membentuk hubungan diplomatik sejak tanggal 13 April 1950, dan sempat dihentikan sementara tanggal 30 Oktober 1967 karena terjadi peristiwa 30 September PKI 1965.

Kemudian hubungan bilateral kembali pulih sejak 1980-an. Diawali dengan pertemuan Menteri Luar Negeri Qian Qichen dari Cina bertemu Presiden Soeharto dan Menteri Dalam Negeri Moerdiono tahun 1989 untuk mendiskusikan kelanjutan hubungandiplomatikkeduanegara. DanbulanDesember1989,kedua negara membicarakan masalah teknis mengenai normalisasi hubunganbilateraldanmenandatangani perjanjian. Pada Juli 1990

Menlu Indonesia yang saat itu dijabat Ali Alatas menerima undangan China dan mereka membicarakanperjanjianpenyelesaian obligasi utang Indonesia ke China dan komunike kelanjutan hubungan diplomatik antar kedua negara. Kedua negara meresmikan “Komunike Restorasi Hubungan Diplomatik Antar Kedua Negara”. “Secara resmi RRC mengumumkan pembukaan Kantor Konsulat RRC di Medan, Sumatera Utara, Kamis 8 September

2011, bertempat di Hotel JW Marriot Medan.” Konsulat RRC yang fasih berbahasa Indonesia itu. Pembina YPSA Drs. H. Sofyan Raz, Ak.M.M., dalam sambutannya mengucapkan selamat datangkepadaMrs.YangLing Zhu Konsulat Jenderal (Konjen) China untuk Sumatera.YPSA sangat terbuka menerima semua informasi dari negara-negara sahabat.YPSA juga senantiasa rutin mengundang konsulat-konsulat negara yang ada di Medan untuk memberikan dan berbagi ilmu pengetahuan dengan siswa-siswiYPSA. Ini dilakukan agar siswa-siswi dapat berjumpa secara langsung dengan tokoh-tokoh negara luar. Selain itu, kegiatan ini dilakukan dalam rangka mempererat silaturahmi dengan negara lainnya, yang saat ini tamu kehormatan kita dari Republik Rakyat China. Semoga siswa-siswiYPSA dapat bertanya apa saja kepada Konjen China untuk menambah ilmu pengetahuan mereka. Usai acara Pembina YPSA serahkan buku biografi “Sofyan Raz Membangun Generasi Emas”, Ketua Umum YPSA serahkan plakatYPSA, Sekretaris Umum serahkan cenderamata dan salah satu siswi berikan gambarkarikaturwajahMrs.Yang Ling Zhu yang ia gambar saat acara berlangsung. Erzilmarkos

Unpri Fiesta Ajang Pengembangan Bakat Mahasiswa SUDAH menjadi kegiatan rutin setiap tahunnya, Civitas Akademika Universitas Prima Indonesia (Unpri) menggelar kegiatan Unpri Fiesta sebagai acara penyambutan mahasiswa baru serta sebagai ajang pengembangan bakat dan kreatifitas mahasiswa. Salah satu ajang yang paling primadona dalam Unpri Fiesta tersebutadalahpemilihanMrdan Ms Unpri 2013, dimana dalam final pemilihan tersebut Mahasiswa Fakultas Hukum Unpri CalvinZhundanMahasiswiFakultas Keguruan dan Ilmu Pendidikan Pretty Grace Zalukhu terpilih sebagai juaranya. Calvin Zhun dan Pretty Grace Zalukhu terpilih sebagai juara pada final pemilihan Mr dan Ms

Unpri 2013 dalam kegiatan Unpri Fiesta 2013 yang digelar di Grand Elite Hotel Medan, baru-baru ini. Sebagai pemenang, mereka memperoleh plakat serta hadiah beasiswa pendidikan. FinalpemilihanMrdanMsUnpridigelarbersamaandengankegiatan New Student Party serta perayaanDiesNataliske-12Universitas PrimaIndonesia(Unpri)dalamsatu gelaran Unpri Fiesta 2013. Selain Calvin dan Pretty yang terpilihsetelahmenyisihkanfinalis lainnya,terpilihjugaStevenKosiadi mahasiswa Fakultas Ekonomi sebagai juara kategori fotogenic, serta Naomi Santa Theresia mahasiswaFakultasPsikologisebagai pemenang kategori good talent. Acara tersebut turut dihadiri

Koordinator Kopertis Wilayah I Prof Dian Armanto, KetuaYayasanPerguruanTinggiPrimaIndonesia dr I Nyoman Ehrich Lister MKes AIFM, Ketua BPH Unpri Tommy Leonard SH MKn, Rektor Prof dr Djakobus Tarigan AAI DAAK,Wakil Rektor I Prof Dr Drg Monang Panjaitan,Wakil Dekan III FK Unpri dr Ali Napiah Nasution, Direktur Rumah Sakit Royal Prima dr Deli Theo SpPK MARS dan Kepala Humas Ramli J Marpaung SH MM. Ketua Yayasan Perguruan TinggiPrimaIndonesiaINyoman

Ehrich Lister dalam kesempatan itu, meminta kreativitas mahasiswa terus dikembangkan, sembari menghindari hal-hal negatif yang dapat merusak masa depan seperti narkoba. “Jangan pernah berpikir untuk mencoba walau hanya sekali. Yakinlah, barang terlarang itu pasti akan menghancurkan masa depan,” tegas Nyoman. Dia pun meminta seluruh mahasiswa yang hadir pada Unpri Fiesta 2013 harus benarbenar menjadi figur yang berkualitas. “Kalau tidak, kita akan

terpinggirkan, posisi kita hanya sebatas pekerja kasar, tidak mampu menjadi pemikir apalagi sebagai pengendali,” ujar Nyoman. Sementara itu, Koordinator Kopertis Wilayah I Prof Dian Armanto menyatakan senang melihat kreativitas mahasiswa Unpri yang ditunjukkan pada acaraUnpriFiestaini.“Inimenandakan mahasiswa Unpri berani tampilbedadanbakat-bakatyang ada pada mahasiswa Unpri ini harus dikembangkan lebih baik lagi,” katanya. (m41)

Undhar Gelar Kuliah Umum Jurnalistik Dan Publik Speaking


MAHASISWA Sosial Politik (Sospol) jurusan komunikasi Universitas Dharmawangsa terlihat serius mendengarkan paparan yang disampaikan pembicara dalam kuliah umum yang dilaksanakan di kampus itu beberapa waktu yang lalu.

PUBLIK speaking atau kemampuan berbicara di depan umum saat ini tidak lagi harus seorangwartawanakantapiorangorang yang bergerak di bidang bisnis juga perlu menguasainya. Karena keterampilan seseorang dalam bidang tertentu boleh jadi sangat menentukan karier seseorang. Namun hal itu juga harus didukung kemampuan berbicara dan presentasi karena dengan ilmu itu materi akan terasa lebih hidup dan tepat sasaran. Hal itu disampaikan Meutya Hafid dalam kuliah umumnya dihadapan seratusan mahasiswa Sosial Politik (Sospol) jurusan komunikasi Universitas Dharmawangsabeberapawaktuyanglalu.

Dalam kuliah umum yang turut dihadiri Rektor Universitas Dharmawangsa Kusbianto, M.Hum, Wakil Rektor II Salahuddin Has, SH, MA, Ketua Prodi Administrasi Niaga Fakultas Sospol Dra. Hj. Farida Hanum Nasution, M. AP. Meutya menjelaskan kemampuan berbicara di depan umum merupakan salah satu penunjang keberhasilan seseorang.Khususnya mereka yang menggeluti pekerjaan yang senantiasa bersinggungan dengan orang lain. Karena manusia harus berkomunikasi dengan cara menyatakan ekspresi lewat kemampuan presentasi dan berbicara. Usai kegiatan itu Ketua Prodi Administrasi Niaga Fakultas Sospol Dra. Hj. Farida Hanum Nasu-

tion, M. AP mengatakan, sebagai upaya mengembangkan ilmu pengetahuanmahasiswanyaUniversitas Dharmawangsa senantiasa menggelar kegiatan kuliah umum dengan menghadirkan tokoh-tokoh baik lokal maupun nasionalyangberasaldarikalangan akademisi maupun profesional. Hal ini bertujuan untuk menambah wawasan dan kemampuan mahasiswa terutama dalambidangjurnalistikdanpublik speaking khususnya bagi mahasiswa jurusan komunikasi dengan demikian diharapkan mahasiswa dapat lebih memahami ilmu komunikasi tersebut secara umum dan mampu mengaplikasikannya dalam kehidupan sehari-hari.Erzilmarkos


PEMENANG Mr dan Ms Unpri 2013 Calvin Zhun dan Pretty Grace Zalukhu foto bersama dengan Ketua Yayasan dr I Nyoman Ehrich Lister didampingi Ketua BPH Unpri Tommy Leonard dan lainnya usai menerima penghargaan.



WASPADA Minggu 24 November 2013

Sastra Remaja Terus Bergairah Oleh: Jones Gultom


INAMIKA perkembangan sastra Indonesia di genre remaja semakin progresif. Dapat dilihat dari semakin meningkatnya produksi buku-buku sastra. Juga dapat dilihat dari ketersediaan ruang bagi sastra remaja yang lebih banyak dibandingkan sastra “serius”. Misalnya di koran maupun majalah.DiMedansendirihampir semua koran menyediakan halaman sastra remaja pada edisi Minggu,termasukHarianWaspada. Demikianjugadenganmajalah maupun tabloid terbitan Jakarta. Tidak heran jika peluang jenis sastra ini lebih potensial. Selain itu, genre juga terus mengalami inovasi.Diantaranyaadalahteenlit (teen literature) dan chicklit (chick literature). Meski baru populer di awal-awal tahun 2000-an, keduanya langsung mendapat responluarbiasadarimasyarakat. Contohnya “Dealova” karya Dyan Nuranindya langsung terjual sebanyak 10 ribu eksemplar hanya dalam waktu sebulan setelah dicetak. Padahal ketika menulis bukunya, Dyan masih duduk di bangku SMP. Begitu juga buku “Me vs High Heels!” (“Aku vs Sepatu HakTinggi”) karya Maria Ardelia yang saat

menerbitkanbukunyamasihberumur 16 tahun. Buku ini termasuk salah satu best seller di Gramedia. Data dari Gramedia juga mengejutkan.Selama15bulanmemproduksi buku-buku teenlit, mereka telah menjual 520 ribu eksemplardari34judulbuku. Dalam arti, setiap tahun nyaris tiga buku jenis ini yang diterbitkan. Seperti kita tahu, teenlit dan chicklit adalah jenis sastra yang menyasar kaum remaja sebagai pasarnya. Keduanya sama-sama mengangkat tema-tema seputar dinamika psikologis remaja. Hanya saja, chicklit lebih sedikit dewasadibandingkanteenlit.Baik tema mapun gaya penulisan. Teenlit sendiri masih lebih “cair” serta di dalamnya masih kental dengan unsur “kekanakan”. Ditandai dengan adanya ciriciri komikal di dalamnya secara komikal. Dalam arti, bisa dikata-

kan pembaca teenlit adalah seseorang yang mulai meninggalkan fase kanak-kanak. Sedangkan chicklit adalah fase remaja awal. Tidak heran, chicklit sendiri mulanya ditujukan bagi remaja putri.Mengingatsecarapsikologis remaja putri umumnya lebih introvert dalam hal perkembangankepribadiannya.Sehingga chikclit sering juga disebut sebagai “catatan buku harian. Tetapi kenyataannya, remaja laki-laki juga menikmati chicklit. Tidakheranjikakemudianbanyak buku chicklit yangdigubahdalam bentuk film layar lebar. Sebut saja “Dealova” dan “Eiffel… I’m In Love” karya Rachmania Arunita. Belakangan, chicklit kembali berevolusi menjadi jenis sastra baru.Yakni dengan memadukan cihicklit dengan komik. Saya menyebutnya “ciko”. Sasaran “ciko” adalah para maniak komik yang mulai menyasar chicklit. Para pembaca jenis ini, belum sepenuhnya rela melepas komik merekadanmenggantinyachiclit. Jadi bisa dibilang “ciko” adalah alternatif bagi pembaca yang berada di antara teenlit dan chikclit. Ia menjadi ruang psikologis di antara fase remaja tahap awal. Unsur-unsur komik di dalam chicklit itu antara lain, pertama terlihat dari penggambaran atau

karakter tokoh yang hitam putih. Jarang sekali ditemukan“desain” psikologis di dalam perwatakan. Baik antagonis maupun protagonis dipaparkan secara terang benderang. Kedua, alur yang dipakai adalah maju-mundur, sebagaimana ciri komik. Alur ini sangat sesuai dengan perkembangan remaja yang memang suka mengingat masa lalu dan membandingkannya dengan saat sekarang. Ketiga, bahasa yang spontan. Memang bahasa dalam“ciko” menjadi sangat penting, karena berhubungan langsung dengan“languange” kaum remaja. Itu sebabnya bahasa yang dipakai adalah bahasa yang sedang populer di kalangan remaja. Keempat, munculnya sisilife style. Life style merupakan instrument penting dalam “ciko”. Life style menjadidayatersendiri.Misalnya gadget, aliran musik serta fashion. Kelima, setting tempat pada umumnya tidak berada jauh dari remaja. Tempat yang paling sering dikisahkan adalah sekolah, kursus dan tempat tongkrongan. Sekalipun misalnya “Eiffel… I’m In Love” mengambil setting di Paris, tetapi pada dasarnya lebih bersifat proyeksi penulisnya. Sebagai ruang imajinasi penulis tentangParisyangdianggapseba-

gai negara teromantis. Beberapa contoh“ciko” adalah “Pengurus MOS harus Mati” karyaLexieXu.“SeparuhBintang” karya Evline Kartika. “Dua Pasang Mata” karya Alexandra Leirissa Yunadi. “Rahasia Bintang” karya Dyan. Nuranindya. “Summer in Seoul” karya Ilana Tan dan sebagainya. Pada “Summer in Seoul” kita bisa melihat indikasi life style itu secara gamblang. Ceritanya seputar percintaan seorang penyanyipriaKoreayangtampan dengan segala lika-likunya. Trend boy band dan K-pop, di masa penerbitan buku ini (2006) memang mulai muncul. Di Medan, pengarang “ciko” mulai bermunculan, khususnya sejak5tahunterakhir.Nama-nama seperti Embar T Nugroho dan T SandiSitumorang,termasukpaling produktif menerbitkan bukunya. Embarsaatinisedangmeluncurkan buku “When I Fall in Love”. Baik Sandi maupun Embar dikenal sebagai penulis novelete di halaman remaja, salah satu harian di kota Medan. Barangkali kebiasaan menulis novelet inilah yang mengarahkan keduanya memilih untuk di genre “ciko”. Salah Persepsi Ada persepsi yang salah di kalangan penulis sastra, karena

Catatan Budaya

Pers Kita Oleh: S Satya Dharma

memandang jenis sastra ini sebagai kelas dua. Bahkan tak sedikit yang menganggap sastra remaja, sebagai media pembelajaran untuk memasuki dunia sastra serius. Padahal, sastra remaja juga digarap secara serius yang memiliki peminat tak hanya para remaja. Demikian juga para penulisnya yang tak melulu remaja. Bahkan di antaranya juga ditulis oleh sastrawan yang sebelumnya dikenal serius dalam bersastra. Di Medan sendiri tak sedikit yang mengambil peran itu dan merupakan pilihan sah. Di salah satu media di Medan, kolom remajanya seringkali diisi oleh penulis-penulis yang telah berumur. Toh para penulis itu juga menulis di halaman sastra yang dikesankan “serius”. Menulis sastra remaja juga memiliki keterampilan tersendiri. Gaya penulisan, warna, dan pemilihanbahasanyaspesifikdan disesuaikan psikologis remaja. Samahaldengangenresastralain, sastra remaja mempunyai dunianya sendiri. Setiap orang berhak untuk memasuki beragam pilihan itu, meski temporal. Dengan demikian, sastra remaja harus dipandang sebagai jenis sastra yang utuh sehingga tak lagi dicap sebagai subordinat sastra lainnya.

Alasan Digelar Pasar Malam Musikalisasi Puisi Oleh: Hasan Al Banna PALING tidak, ada dua keterusterangan singkat yang ingin saya kabarkan pada tulisan ini. Terus terang yang pertama, ide “Pasar Malam Musikalisasi Puisi” 21-23 November 2013 sesungguhya muncul dari, katakanlah dari keputusasaan saya melacak sekaligus menentukan peristiwa alternatifterkaitmengembangkan musikalisasi puisi selain festival (lomba) atau konser tunggal. Catatan-catatan sebelumnya membeberkan jika kalender festival (lomba) bolehlah dikalim sudah demikian semarak di Medan dan sekitarnya. Tercatat Balai Bahasa Sumatera Utara, Teater LKK Unimed, SMAN 3 Medan, SMAN 4 Medan, YP Yayasan Syafiyyatul Amaliyyah, SMAN 1 Binjai, dan SMAN 2 Model Binjai termasuk yang kerap menggelar festival (lomba) musikalisasi puisi, khususnya bagi para pelajar. Bagaimana dengan konser tunggal? Aduh, konser tunggal musikalisasi puisi bisa dihitung dengan jari. Komunitas Home Poetry (KHP)—yang hakikatnya bukan komunitas ‘penggaung’ musikalisasi puisi—baru dua kali ‘mengangkut’ konser tunggal ke panggung pertunjukan. Pertama, memanggungkan Sanggar Rumput Hijau di Medan tahun 2011 (Konser “Lukisan Binjai). Kemudian, tahun 2012, KHP membuka‘panggung besar’ untuk kelompok yang serupa bekerja sama dengan 7 keliling yang unjuk konser tunggal di Medan, Binjai dan Pekanbaru. Lantas, setelah dipikir-pikir danselanjutnyasayamenyimpulkan kalau pada keduanya; festival (lomba) dan konser tunggal, terdapat kelemahan sekaligus kele-

bihan. Benar, festival sangat memungkinkan para kontestan melahirkan keberagaman pada karya masing-masing. Namun di sisi lain, festival (lomba) melalui batasan-batasan baku yang meliputinya, tidak dapat dipungkiri sedikit banyak akan mengungkung keleluasaan para kreator. Sebaliknya, peristiwa konser memang dapat memamerkan hasil dari manuver-manuver proses kreatif, tetapi kurang memberi kesempatanterhadapterciptanya hasil cipta yang beragam dari kreator yang berbeda. Plus minus festival (lomba) dan konser tunggal seolah-olah ‘menjewer’ telinga kesadaran bahwa saya masih dan akan terus memerlukan ge(b)rakan lain agar keberagaman musikalisasi puisi dapat dihadirkan ke tengah-tengah khalayak. Di kepala saya, kesegeraan menggali sekaligus menyaksikan keberagaman adalah ‘rengekan’ yang terus mengganggu dan cenderung bising. Terus terang yang kedua, saya penasaran mengapa musikalisasi puisi sebagai genre teranyar selaku media pengantar puisi kepada orang banyak tidak berkembang di kalangan mahasiswa,teramatkhususbagimahasiswa sastra dan musik? Padahal, dalam catatan saya, sanggarsanggar musikalisasi puisi di sejumlah sekolah di Medan dan sekitarnya mampu melahirkan kreator-kreator musikalisasi puisi yang kebanyakan berkutat di bidang eksakta dan sosial, bukan bahasa. Bisa jadi karena agenda rutin musikalisasi puisi, terutama festival(lomba)lebihseringdialamatkan bagi para pelajar ketimbang

bagi kaum mahasiswa bahkan khalayak umum. Begitupun, kondisiinitidakdapatdidudukkan sebagai alasan absolut untuk melegalkankemacetanperkembangan musikalisasi puisi di luar kalangan pelajar. Keinginan ‘egois’ saya terhadap kreator-kreator musik agar sudiberbagikemungkinandalam penciptaan karya musik yang seiring-sejodoh dengan produk sastra (puisi) juga lumayan bikin saya kewalahan. Hampir saya pastikanbahwamusikalisasipuisi bukan hadir sebagai peristiwa sastra semata, melainkan sebuah kesatuan dari dua kata; musikalisasi dan puisi. Oleh karena itu, keterlibatan kaum cendekiawan musik dengan segala keberagaman latar belakangnya mutlak diperlukan. Muaranya apa? Agar tercipta kemungkinan-kemungkinan lain, capaian-capaian baru yang tentu saja setelah melewati kurun tertentu dan proses yang berkesinambungan,bakal‘menghidangkan’ keanekaan, penemuan-penemuan yang membahagiakan, bahkan mengagumkan. Bertolakdarikeinginan‘judes’ tersebut, maka saya pun memberanikan diri membangun komunikasidengan,katakanlahdua pihak di atas (mahasiswa dan cendekiawan musik) untuk rela melapangkan waktu, tenaga dan pikiran dalam proses penciptaan karya musikalisasi puisi. Memang, hampir pasti kalau komunikasi yang saya bangun masih pada pihak dalam jumlah yang terbatas dan bertahap. Hasilnya? Pada satu rezeki, ada satu-dua kreator yang menyambut baik, tetapi di lain rezeki, ada tiga-empat pihak yang hanya pura-pura antusias karena pada akhirnya perlahan-lahan ditelan


KELOMPOK Metronom saat tampil memeriahkan acara “Pasar Malam Musikalisasi Puisi” di Taman Budaya Sumatera Utara. bumi. Namun sudahlah, itu risiko yang lumrah dari sebuah upaya dan syukurnya risiko itu juga sudah saya pikirkan. Maka terima kasih kepada kelompok musik Metronom pimpinan Irma Karyono yang bersedia terlibat aktif menyumbangkan keberagaman pada “Pasar Malam Musikalisasi Puisi”. Ungkapan serupa saya haturkan juga kepada Geomusika gagasan Rizhka Rachmaini, kelompok musik yang diisi oleh kreator berlatar belakang lumayan unik; gabungan dari mahasiswa musik, sastra dan pelajar. Seterusnya, terima kasih pula bagi rekan-rekan kelompok musik 7 Keliling yang sudah lebih dulu menyediakan diri terlibat dalam melahirkan produk-pro-

duk musikalisasi puisi. Tidak lupa kepada Musikalinea, Cut Seorang dan Sanggar Rumput Hijau yang dapat dikatakan memang lahir dari rahim proses musikalisasi puisi.Keenamkelompokdarilatar belakang berbeda ini sengaja saya deretkan di “Pasar Malam Musikalisasi Puisi”, semacam menggelar‘dagangan’ yang mudahanmudahan berhasil memosisikan pengunjung berhadapan dengan pilihan-pilihan menarik. Selain itu, “Pasar Malam Musikalisasi Puisi” tidak semata deretan persitiwa musikalisasi puisi, melainkan juga pentas baca sastra (Andy Mukly, Putrie Aura Hermawan) dan panggung tari tunggal (Agung Suharyanto). Delapan belas orang yang turut dalamprogram‘penontonpilihan’

sekaligus“duta musikalisasi puisi” juga sengaja diundang dari Unimed,USU,UMSU,UMNdan UMAyangbekerjasebagaipengamat khusus yang bertugas merekamperistiwapasarmalamdalam tulisan-tulisan jurnalistik mereka. Program ini merupakan‘cari akal’ saya yang lain agar musikalisasi puisi lekas menular ke kampuskampus. Saya pikir, rentetan alasan di atasmasihakanterus‘menyudutkan’ saya, sehingga agenda“Pasar Malam Musikalisasi Puisi’ masih akan terus digelar di tahun-tahun mendatang. Selamat datang di “Pasar Malam Musikalisasi Puisi” tahun 2014! *Penulis Direktur Program “Pasar Malam Musikalisasi Puisi”

KEBEBASAN pers satu dari beberapa butir buah manis reformasi yang kini dinikmati masyarakat Indonesia. Sejak pemerintahan Presiden BJ Habibie, Abdurrahman Wahid, Megawati Soekarnoputri, dan kini Susilo BambangYudhoyono, pers tidak lagi memiliki tembok pembatas apa pun yang menghalanginya dari membuat dan menyebarluaskan informasi. Pers berkembang sedemikian pesat dan bahkan cenderung menjadi liar. Itulah mungkin yang menyebabkan Presiden SBY akhirnya mengeluh. Padahal kebebasan itu sebenarnya positif selama dijalankan dengan penuh pertanggungjawaban. Artinya, bila muncul keberatan dari seseorang atau sekelompok orang atas pemberitaan yang disiarkannya, maka pers harus berani mempertanggungjawabkannya di depan Pengadilan. Sebab itulah memang resiko yang harus dipikul pers sebagai akibat kebebasan yang dimilikinya tersebut. Namunfaktamenunjukkantakbanyakinsanpers,wartawan, redaktur, pemimpin redaksi atau bahkan pemilik media massa yang diseret ke pengadilan oleh subjek pemberitaan yang merasa dirugikan. Sebagian besar orang yang merasa dirugikan oleh pemberitaan pers justru itu lebih memilih main hakim sendiri. Menyewa preman atau orang bayaran untuk menuntut balas. Maka wartawan pun tak hanya diteror lewat surat kaleng, telepon gelap atau SMS bernada ancaman. Tapi juga diculik, digebukin dan bahkan dibunuh. Apa penyebab munculnya tindakan kekerasan itu? Salah satunya adalah karena pers sudah diangap “kebablasan” dalam mengekspresikan kebebasan yang dimilikinya. Artinya, dalam melakukan tugas-tugas jurnalistiknya insan pers seringkali mengabaikan batasan-batasan normatif sebagaimana yang tertuang dalam kode etiknya. Terus terang saja, banyak sekali perusahaan pers dan dengan demikianparawartawannyayangtidakmemperdulikanpanduan normatif, sebagaimana tertuang dalam Kode Etik Wartawan Indonesia (KEWI) itu dalam menjalankan tugas-tugasnya. Padahal kode etik itu justru mereka sendiri yang membuatnya. Memangkodeetik,sebagaimanalazimnya,hanyalahsekadar ketentuan-ketentuan normatif untuk membatasi prilaku insan pers. Karenanya, tak aneh jika kode etik wartawan Indonesia itu, pada pelaksanaannya, tidak memiliki kekuatan hukum apa pun kecuali sekadar memberi sanksi moral manakala ada insan pers yang melanggar kode etik tersebut dalam menjalankan tugas dan profesinya.

Pers yang baik adalah pers yang berani bukan saja karena menyiarkan informasi apa adanya, tapi juga karena kejujurannya dalam menyebutkan narasumber dari informasi yang dimilikinya.

Padahal, kebebasan pers yang dijalankan secara kebablasan itu, tak jarang berwujud pada pencederaan terhadap subjek berita. Hal itu terjadi karena dalam menjalankan tugas-tugas sosial kontrolnya, wartawan seringkali kehilangan ketelitiannya. Ironisnya, ketika seseorang atau sekelompok orang memprotes pemberitaan yang disiarkan itu sebagai akibat fakta-fakta yang tidak lengkap, data-data yang tidak akurat, sumber informasi yang tidak jelas, pers malah berlindung di balik hak tolak yang dimilikinya. Bahkan seringkali hak jawab pun tidak mendapat proporsi yang semestinya. Beritanya dimuat di halaman pertama, tetapi hak jawab hanya dimuat di kolom surat pembaca. Kesan yang timbul, antara berita dan hak jawab mendapat porsi dan ruang yang tidak berimbang. Kasus antara majalah Tempo dengan pengusaha Tomy Winata (TW) yang disebut sebagai “Pemulung Besar” dalam pemberitaan majalah ini beberapa tahun lalu, adalah suatu pencederaan kode etik yang menjurus pada penghinaan dan fitnah besar terhadap pribadi seseorang, jika tidak disertai dengan pembuktian. Konsekuensinya, wartawan atau perusahaan pers yang bersangkutan harus berani mempertanggung jawabkan apa yang diberitakannya itu di Pengadilan. Dalam konteks inilah kita mestinya menolak pemberitaan yang menggunakan kata-kata kurang jelas atau kabur, atau kata-kata yang mengesankan ketidakjelasan sumber informasi tersebut. Pers yang baik, menurut saya, adalah pers yang berani bukan saja karena menyiarkan informasi apa adanya, tapi juga karena kejujurannya dalam menyebutkan narasumber dari informasi yang dimilikinya. Tanpa keberanian seperti itu, maka pers akan terjebak hanya menjadi institusi penyebar fitnah, kabar burung, rumors dan gosip murahan. Itulah sebabnya mengapa pers, dalam melakukan tugas sosial kontrolnya, harus berani mengatakan “ya” atau “tidak” terhadap informasi yang diperolehnya. Informasi yang samar-samar tanpa dukungan fakta-fakta yang lengkap, atau informasi dari narasumber yang tak mau disebutkan identitasnya, sebaiknyalah tidak dipublikasikan demi menghindarkan pers dari perbuatan fitnah. Pada akhirnya, kebebasan pers yang terjadi sekarang ini bagaimana pun telah menempatkan kontrol terhadap pers sepenuhnya berada di tangan masyarakat. Jika dulu pemerintah melakukan kontrol dengan berbagai peraturan perundangundangan yang dibuatnya, kini masyarakat sendirilah yang melakukan kontrol tersebut. Konsekuensinya jelas. Jika ada sekelompok masyarakat yang kemudian berunjuk rasa, melapor ke polisi, menggugat ke pengadilan karena merasa dirugikan oleh pemberitaan media massa, maka masyarakat pers tidak perlu marah. Sebab itulah resiko yang harus ditanggungnya sebagai akibat dari kebebasannya itu. Nah! *Penulis adalah Wartawan Freelance

Yang Bergaduh Di Pasar Malam Oleh: Sartika Sari KITA tidak sedang mempersoalkan bagaimana akhirnya pesona musik yang digarap oleh masing-masing kelompok mampu membius telinga, hati dan mata penonton. Tidak pula tentang siapa yang diakui penampilannya sebagai yang terbaik dari yang lain. Jadi, berhatihatilah! Seyogyanya musikalisasi puisi, kerja keras menjodohkan puisi denganmusikadalahtanggungjawabyangmustiditunaikan.Keseriusan menemukanjatidiripuisidanmusikyanglayakbersandingdengannya harus diakui bukan kegiatan yang sekali tindak dijamin selesai. Secara keseluruhan, kira-kira demikian yang berhasil diamini bersama dalam Pasar Malam Musikalisasi Puisi. Meski sempat ricuh pendapat, pada akhirnya prosesi‘pernikahan’ puisi dan musik berhasil dilangsungkan dengan khidmat dan nikmat. Pasar Malam, tidak dipadati penonton dengan telepon seluler dan kamera yang pendar cahaya lampunya berkeliaran. Tidak juga diramaikan bising suara perempuan, laki-laki yang meneriaki salah seorang dari artis panggung. Pasar Malam, Musikalisasi Puisi sejak dimulakan pada Kamis, 21 November 2013 di Gedung Pameran Taman Budaya, punya keramaian yang berbeda. “Ini niat seseorang yang punya ambisi besar untuk tetap memotori pergerakan musikalisasi puisi di Sumatera Utara,” ujar Hasan Al Banna, Direktur Program “Pasar Malam Musikalisasi Puisi”. Setelah sekian lama dan banyak perbincangan soal Sumatera Utara sebagai sarangnya sastrawan-sastrawan fenomenal, tentu saja pembicaraan ihwal perkembangan sastra dalam bentuk lain,

yakni musikalisasi puisi harus menjadi trend topic selanjutnya. Banyak hal yang mendasari‘pemaksaan’ ini. Namun yang paling urgen adalah soal pencapaian visi memasyarakatkan sastra secara luas. Omong kosong jika berniat menjadikan sastra sebagai hal yang dekat dengan masyarakat jika cuma melalui karya-karya serius dan bersenjata doa serta beberapa usaha persuasif untuk menulis atau berteater. Ada cara lain yang mujarab memikat hati masyarakat pada puisi atau karya sastra. Salah satunya adalah yang telah dilakukan oleh segenap pemikir dan penyelenggara Pasar Malam, Musikalisasi Puisi. Seperti pernah diungkapkan Nenden Lilis A (2004), bahwa musikalisasi puisi bermanfaat untuk memudahkan upaya sosialisasi puisi kepada masyarakat, lebih merangsang minat masyarakat untuk memasuki dunia sastra, memberi alternatif kandungan suatu puisi dan memperkuat daya sentuh puisi lewat representasi musik. Maka, ini menjadi pekerjaan baru yang menunggu campur tangan pegiat sastra Sumatera Utara lainnya. Gaduh Tafsir Musikalisasi Puisi “Musikalisasi puisi tentu tidak sama dengan musik ditambah puisi. Sebab musikalisasi adalah upaya penggalian isi puisi untuk menemukan kebatiniahannya lalu disandingkan dengan musik yang satu dengan kandungan puisi sebagai upaya mempertajam isi puisi. Selain itu, sebagai bentuk apresiasi dan penghargaan terhadap puisi, maka mengubah puisi menjadi bentuk lagu harus tetap sesuai dengan susunan dan jumlah larik puisi, tanpa mengulang isi puisi.” ungkap salah seorang dari Musikalinea. Pernyataan tersebut menjadi pedoman Musikalinea dalam menggarap musikalisasi puisi. Terbukti, sepanjang membawakan

Kidung Anak Bangsa karya Ali Rahman Kaban, Tong Potong Roti karya Wiji Thukul dan Sepisaupi karya Sutardji Calzoum Bahri, hal terdepan yang ingin disampaikan Musikalinea adalah tentang kekhidmatan sebuah puisi. Meski cuma melalui gitar, pianika dan rithem kazon, ketiga puisi sampai ke telinga, hati dan membius mata penonton. Kesederhanaan yang selaras, manis dan harmonis, tanpa pengulangan. Kerja kreatif yang dimulakan dari melakukan penafsiran terhadap puisi kemudian mengambil saripati batin yang terkandung dan mengaransemen menjadi musik berhasil dibuktikan sebagai sebuah karya yang padat dan khusuk sekali. Berbeda dengan Musikalinea, Metronom sepakat mengartikan bahwa musikalisasi puisi adalah upaya mendeklamasikan puisi dalam bentuk musik. Maka, sepenuhnya alat musik yang digunakan dan permainannya musti benar-benar berakarakter puisi. Soal bagaimana teknis menyanyikan atau membacakan puisi adalah kefleksibelan. Ketikapuisiyangdinyanyikanterasakurangkuatuntukmenyergap perasaan penonton, maka kehadiran puisi yang dibacakan adalah hal yang musti dilakukan. Sepertinya ini menjadi strategi Metronom untuk mempertahankan kemaksimalan penampilan dengan durasi yang pas, musik khas, namun tetap tak meninggalkan pembacaan puisi sebagai simbolis dari identitas pertunjukannya. Terbukti dalam musikalisasi Pada Kenduri Laut karya OK Sahril, dan Pada Langit, Pada Bumi dan Pada Segala serta Tetabuh di Huta Tinggi Laguboti karya M Raudah Jambak yang ditampilkan. Gendang pakpung, tagading, dollTapsel, dan sulim berpadu menjadi musikbercitarasaArabdanMelayu.Ramaidannikmatsekali.Lantunan puisi yang dinyanyikan menyergap sepi, membangun sayatan-sayatan kepiluan. Namun secara tiba-tiba, dimasuki seorang pembaca puisi,

dengan puisi yang sudah dinyanyikan. Begitu seterusnya. Sejak dikenal pada tahun 90-an tatkala sajak-sajak Sapardi Djoko Darmono yang terkumpul dalam Hujan Bulan Juni menjadi populer di kalangan mahasiswa dan pencinta sastra, istilah musikalisi puisi memang telah memancing berbagai penafsiran. Ari Kpin dalam Musikalisasi Puisi (2008), menafsirkan musikalisasi puisi sebagai bentuk pengekspresian puisi ke khalayak dengan cara musikalisasi, beralatbantuutamapadamusik(irama,nada,tempo,dansebagainya). Musik diolah sedemikian rupa sebagai hasil dari penafsiran puisi yang dilakukan oleh pembuat musikalisasi puisi. Musik ini dibuat semata untuk kepentingan puisi. Sehingga dapat menyampaikan pemahaman dan penghayatan tentang puisi itu kepada apresian, seperti halnya deklamasi dan pendramatisiran puisi. Berdasar tafsiran tersebut, menurut beliau, musikalisasi dapat digolongkan menjadi beberapa jenis, yakni Musikalisasi Puisi Awal (Musikalisasi puisi yang dibawakan dengan cara pembacaan puisi yang dilatarbelakangi atau yang diiringi komposisi musik, baik musik vokal maupun instrumental), Musikalisasi Puisi Terapan (Musikalisasi puisi yang mana syair-syair puisi diterapkan menjadi lirik lagu, sama halnya dengan lagu-lagu popular) dan Musikalisasi Puisi Campuran (Musikalisasi puisi yang ditampilkan dengan cara menyuguhkan komposisi musik, yang di dalamnya ada sebuah puisi yang syairsyairnya ada yang dilagukan dan dinarasikan). Baiklah, kegaduhan tafsir ini, menjadi keseutuhan untuk Pasar Malam Musikalisasi Puisi. Terlepas dari bagaimana sebuah kemenanganitutercipta,terpentinglebihpentingadalahkeberagaman yang berhasil diciptakan. Termasuk soal tafsiran. Masih banyak keberagaman lain yang akan dikuak. Ini tantangan yang menyehatkan! *Penulis adalah mahasiswa Sastra Indonesia Unimed, penyuka puisi.


WASPADA Minggu 24 November 2013


Menyusuri Terowongan Penghubung Menara Kembar Petronas PENULIS tidak akan pernah tahu kalau menuju Menara Kembar Petronas yang menjadi ikon kota Kuala Lumpur, Malaysia, bisa dilalui lewat terowongan bawah tanah. Adalah seorang rekan dari Jakarta yang memberi usul tersebut. Karena rasa ingin tahu bagaimana suasana dan model jalan terowongan bawah tanah itu, saya bersama tiga rekanrekan lain dari Medan serentak menyatakan setuju walau harus berjalan kaki sepanjang hampir tiga kilometer, atau enam kilometer pulang-pergi. Ternyata melintasi jalan sejauh itu benarbenar menguras keringat dan membuat semua sendi kedua kaki seakan mau copot. Kalau hendak ke Menara Kembar Petronas itu waktu paling tepat sore menjelang malam. Karena, selain cocok untuk menikmati udara sore dan malam di kolam Petronas, juga pengguna jalan layang dan terowongan khusus bagi pejalan kaki akan memadati lintasan yang katanya baru dibangun dan diresmikan sekitar satu tahun lalu itu. Dengan semakin ramainya pejalan kaki pada jalan tembus Parkson Pavilion Kuala Lumpur dan Menara Kembar Petronas, jarak hampir tiga kilometer itu tidak begitu terasa jauhnya, karena satu sama lain berjalan saling mendahului tanpa memikirkan kekuatan pergerakan kedua kaki . Memang jalan layang dan terowongan itu khusus dirancang untuk pejalan kaki. Tidak boleh atau dilarang masuk kendaraan dari jenis apapun. Dengan lebar sekitar 4 meter yang pada ruas tertentu ditempatkan seorang petugas keamanan atau sekuriti atau SATPAM istilah

Indonesia, siapapun yang menggunakan jalan lintasan itu tidak akan tersesat baik jika hendak ke Menara Kembar Petronas ataupun jika hendak kembali ke hotel tempat menginap di Jalan Bukit Bintang. Seperti yang dialami penulis, sewaktu hendak kembali ke hotel tempat menginap terpaksa sendirian karena tiga rekan lainnya masih bertahan di Petronas sambil menikmati keindahan dan kebersihan air kolam tanpa terlihat ada pedagang asongan. Namun karena tidak segan-segan bertanya kepada setiap petugas yang siap siaga di ruas-ruas tertentu, akhirnya penulis berhasil sampai di kamar hotel walau sempat nyaris nyasar karena tidak begitu jelas rambu-rambu yang dipasang pada setiap persimpangan di jalan layang dan jalan terowongan itu. Sepanjang hampir tiga kilometer jalan layang dan jalan terowongan itu terlihat cukup terpelihara kebersihannya. Tak satu lembarpun kertas bekas terlihat di sepanjang jalan, apalagi puntung rokok yang dibuang di sembarang tempat. Memang lintas jalan penghubung yang khusus bagi pejalan kaki ini berada pada areal larangan merokok. Begitu juga terhadap orangorang yang dicurigai mengintai untuk merampok barang bawaan para pejalan kaki yang entah dari mana asal negaranya, juga “haram” terlihat. Alasan itu pula kekuatiran tentang sesuatu yang mungkin mencelakakan pejalan kaki hilang semua. Kalau dikalkulasikan dengan hitungan-hitungan kasar, memang cukup besar dana yang diperlukan pemerintah Kuala Lumpur untuk membangun

jalan khusus bagi pejalan kaki ini. Namun jalan ini jelas punya azas manfaat, selain para pejalan kaki lebih sehat karena bisa mengadakan sport jantung dan kaki di sore sampai malam hari, atau setiap saat, tetapi juga bisa menghemat biaya transportasi bila hendak ke Menara Kembar Petronas dari Gedung Pavilion Bukit Bintang. Jika pelancong yang sedang berwisata di ibukota Kuala Lumpur ingin mengirit biaya untuk tidak naik taksi ke Menara Petronas, tempuh saja jalur khusus lewat jalan layang dan terowongan yang khusus bagi pejalan kaki. Yang perlu diingat adalah, sebelum berangkat ke Menara Petronas dari kawasan Bukit Bintang, jangan lupa membawa air mineral, karena bila haus , sambil berjalan bisa minum air kemasan siap saji itu. Yang belum terungkap adalah bila salah seorang atau beberapa pejalan kaki mengalami gangguan kesehatan seperti keletihan saat berjalan, apakah pihak pengelola jalan layang dan terowongan ini punya klinik khusus atau ada ahli medis yang tergabung dalam tim pertolongan emergensi . Ketika dicari nara sumber yang bersedia memberikan penjelasan, penulis tidak menemukan. Keterbatasan waktu dan rasa capek yang luar biasa saat kembali usai menyelesaikan tahapan pertama sepanjang hampir tiga kilometer dan melanjutkan tahap kedua untuk kembali ke kamar hotel Grand Millenium tempat penginapan mengakibatkan hal-hal yang ingin dipertanyakan tidak terungkap semua. Semoga lain waktu bisa berkunjung lagi ke Kuala Lumpur. (Aidi Yursal)

Suasana Jalan Terowongan yang menghubungkan Pusat Perbelanjaan Parkson Pavilion dengan Menara Kembar Petronas Kuala Lumpur, Malaysia

Haus Di KNIA Minum Gratis Di KLIA SEJAK bandara Kuala Namu International Airport (KNIA) diresmikan beberapa bulan lalu sebagai pengganti Bandara Polonia, keberangkatan ke ibukota Kuala Lumpur, Malaysia Kamis lalu cukup bersejarah bagi penulis karena itulah pertama kali masuk ke bandara internasional baru yang telah difasilitasi dengan peralatan serba modern itu. Memaklumi bandara baru itu sekarang berada sekitar 39 kilometer dari Medan dan makan waktu sedikitnya 60 menit

jika tidak macat, tidak heran kalau calon penumpang yang hendak berangkat mesti melengkapi diri dengan logistik seperti roti dan air mineral. Bagi calon penumpang yang sering bolak-balik ke luar negeri, sudah paham dengan peraturan di pabean atau imigrasi termasuk mengenai larangan membawabendatertentu.Namunbagi yang baru atau yang sudah lama tidak ke luar negeri, inilah yang menjadi masalah. Hal itu dialami sendiri oleh penulis, air min-

eral kemasan yang hendak dijadikan pelepas dahaga sewaktu berada di ruang tunggu menjelang boarding ke dalam pesawat,nyatanyadijegalpetugas imigrasi di bagian pemeriksaan barang dan tiket sewaktu checkin di Bandara KNIA untuk tidak dibawa. Masih untung dalam pesawat milik maskapai penerbangan Malaysia System itu disajikan minuman ringan beserta satu bungkus kacang gurih buatan Malaysia. Kalau seandai-

Permukaan laut terlihat jelas dari jendela pesawat ketika hendak mendarat di bandara internasional Kuala Namu (KNIA).

nya seperti tujuan Medan- Jakarta atau Batam dengan menumpang pesawat milik swasta, penumpang harus siap “berpuasa” karena yang namanya minuman ringan, makanan ringan harus beli dalam pesawat, kerongkongan penulis dan penumpang lainnya akan kekeringan sampai di bandara tujuan. Pengelola Kuala Lumpur International Airport (KLIA) sepertinya sudah mengerti dengan persoalan sebagian penumpang pesawat yang entah dari mana saja asal kota dan negaranya. Fasilitas penyediaan air mineral siap saji (minum) secara gratis lengkap tersedia di ruang perlintasan menjelang memasuki kounter imigrasi bagian pemeriksaan paspor. Bagi yang pertama kali memasuki ruang ini memang akan terlewatkan jika tidak melihat tanda bacaan “Air Minum, DrinkingWater”. Ketika melihat fasilitas ini, penulis merasa gembira karena perasaan haus yang terlanjur ditahan karena air kemasan yang ditahan pihak imigrasi di KNIA bisa dihilangkan dengan meminum air minum gratis ini di KLIA. Semoga bandara internasional KNIA yang menjadi kebanggaan warga Medan memperhatikan soal fasilitas semacam itu dan mengupayakan keberadaannya, yang sangat berarti bagi orang yang tengah dahaga. Aidi Yursal

Panorama Angkasa Nyaris Terlewatkan ADALAH jauh berbeda kondisinya saat pesawat Singapore Airlines (SIA) melintas di kawasan udara Laut Cina Selatan dalam penerbangan dari Manila, Filipina, menuju Bandara Changi Airport, Singapura, di kawasan ini sering terjadi udara hampa yang mengakibatkan pesawat oleng dan agak terhempas ke bawah. Namun tidak demikian kondisinyapenerbangan dari Yogyakarta menuju Bandara Soekarno-Hatta, Jakarta dan kemudian dilanjutkan menuju Bandara Kuala Namu, pengganti Bandara Polonia Medan, dengan menggunakan pesawat yang sama. Kecerahan angkasa dalam penerbangan hampir empat jam itu telah memamerkan keindahan awan yang cukup mengasyikkan dinikmati dari balik jendela pesawat pada ke-tinggian hampir 10 kilometer dari permukaan laut. Kesempatan menyaksikan keindahan hamparan awan putih yang berubah-ubah bentuk bahkan terkadang terlihat bagaikan bukit atau juga bahkan sepertiasaprokokcerutuyangindah membumbung ke udara, nyaris terlewatkan. Karena keberangkatan pesawat milik maskapai penerbangan swasta nasional itu telah berulang kali diundur selama dua jam sejak dari Bandara Adi SuciptoYogyakarta sampai transit di Bandara Soekarno Hatta Jakarta, sehingga menimbulkan rasa kesal penumpang. Namun, rasa kesal dan kekecewaan saya segera

Tumpukan awan putih bersih dalam cuaca cerah dan matahari lagi bersinar keras dibidik ketika pesawat tengah melintas kawasan angkasa pulau Sumatera. lenyap dan berganti dengan rasa senang menyaksikan panorama angkasa dari dalam pesawat. Melihatkeindahaninipe-nulis tersadar semuanya itu adalah karena kebesaran Allah Tuhan YangMahaKuasa.Walaupesawat yang saya tumpangi itu merupakan buatan ma-nusia, namun sewaktu mena-brak tumpukanawanputihatauawan gelap dalam bentuk kabut yang entah seberapa ting-gi dan tebalnya, telah membuat goyang badanpesawatsehing-gamuncul pengumumandariawakpesawat yang menyaran-kan agar semua penumpang kembali ke tempat duduk ma-sing-masing dengan memasang sabuk atau sabuk pengaman (seat-belt). Ketika mengamati keberadaan tumpukan- tumpukan

awan putih yang berjejer sepanjang hampir sepertiga kawasan udara Pulau Sumatera, dalam renungan saya sendiri muncul pertanyaan terselubung, kenapa dalam cuaca cerah dan lagi matahari bersinar keras serta terik luar biasa, di situ pula muncul tumpukan awan yang berjejer bagaikan tempat pemukiman penduduk di angkasa. Padahal secara logika, manusiapun tidak akan berani ke luar rumah dengan badan terbuka tanpa alat pelindung seperti payung pada saat matahari bersinar dengan terik seperti itu. Walaupun perjalanan dengan pesawat udara sering disebut membosankan karena yangdi lihat hanya awan dan laut atau lainnya kalau cuaca bagus, dan tidak seperti naik mobil atau

bus yang menyajikan pemandangan silih berganti dari daerah yang dilewati, namun dengan pesawat kita cepat sampai di kota tujuan. Dan dengan perjalanan udara itu juga kita punya kesempatan untuk menatap bumi dari udara, dan menyaksikan keindahan matahari sewaktu hendak tebit diwaktu pagi dan tenggelam di waktu sore menjelang malam. Ini bisa disaksikan dalam cuaca cerah dalam penerbangan subuh dari Bandara Kuala Namu menuju arah timur seperti Jakarta, atau sewaktu penerbangan sore dari Solo, Semarang atau Yogya untuk menyaksikan keindahan alam di ufuk barat saat matahari hendak kembali ke peraduannya. Aidi Yursal

Menatap Pesona Candi Prambanan Yogyakarta NADA panggil melalui pesan singkat SMS ponsel membuyarkan tidur nyenyak penulis di kamar hotel Eastparc International kota Yogyakarta. Setelah melihat isi SMS itu ternyata ada informasi baru berupa pengumuman dari pimpinan rombongan “tour leader” yang mengajak peserta media tour kota terang hemat energy bersama Philips LED untuk berwisata mengunjungi Candi Prambanan besok pagi, dengan jadwal kerangkatan pada pukul 06:00 Wib dan kembali ke hotel tempat penginapan pukul 08:00 Wib. Pengumuman itu sempat membuat kesal penulis karena tidak diumumkan dari sore atau sewaktu masih berada di lokasi acara penyalaan Gedung Pergelaran Kraton dan Gedung Serangan Umum 1 Maret dengan lampu hias Philips LED hemat energi sebelum kembali ke kamar hotel untuk istirahat. Namun tanpa berdebat panjang dengan pikiran, akhirnya penulis membalas SMS itu

untuk ikut dalam acara wisata ke Candi Prambanan yang memang belum pernah dikunjungi walau penulis sering bolak-balik Semarang dan Solo, dua kota tetangga Yogyakarta. Walau sudah menyatakan ikut dalam rombongan ke Prambanan, namun penulis masih tetap mempersoalkan dalam pikiran mengenai jadwal waktu berangkat dan kembali. Sebab pada pukul 08:15 00 Wib, sudah mesti check out dari hotel menuju Bandara Adi Sutjipto untuk kembali ke Medan via Jakarta. Untuk memastikan berapa jam waktu terpakai untuk mengunjungi tempat bersejarah kota Yogykarta itu, melalui telepon kamar, penulis mengubungi pihak resepsionis yang menjelaskan perjalanan ke sana makan waktu 1,5 jam normal, dan 2,5 jam jika macat. Ketika balik bertanya, apakah anda pernah berkunjung ke Candi Prambananan itu, resepsionis hotel itu mengaku belum penah. Jadi penulis mulai merasa kebingungan, orang

yang belum pernah ke sana, nyatanya sudah berani memberi informasi tentang Candi sebagai objek wisata terkenal di kotaYogya. Karena, kalau memang waktu 2,5 jam yang digunakan, berarti penulis akan ketinggalan pesawat. Dengan pertimbangan tidak mau ketinggalan pesawat dan jika terjadi, jelas tiket akan hangus dan harus beli lagi dari uang kocek sendiri. Akhirnya penulis harus puas melepas keberangkatan rombongan dengan menumpang bus pariwisata. Namun penulis tidak mau menyerah, pikiran terus tertuju ke Candi Prambanan ‘sudah jauh-jauh datang dari Medan, kok nggak menginjakkan kaki di bumi tempat bersejarah itu’. Dengan mengambil keputusancepat,penulislangsungmencari taksi di luar hotel dan setelah diketahuidarisupirnyahanyasatu jambisadiusahakansampaikembali di hotel, akhir-nya Candi Prambanan yang berjarak 17 kilometer dari hotel mewah Eastparc itu

berhasildisaksikan wajahnyadari jarak dekat walau dalam suasana pagi yang belum seberapa pengunjung. Dengan tariff tiket masuk Rp 25.000 yang dibayarkan tour leader karena akhirnya jumpa juga dengan rombongan rekan-rekan yang duluan naik bus pariwisata, penulis dengan buru-buru bersama rekanrekan pers dari berbagai media cetak dari berbagai kota di Indonesia menikmati keanggunan objek wisata peninggalan masa purbakala itu. Suasana yang nyaman dan cuaca yang lagi bersahabat dengan kecerahannya, Candi Prambanan yang tingginya 47 meter itu begitu jelas terlihat, anjungan bangunan kuno dengan arsitek menarik yang dilengkapi dengan beberapa stupa di atasnya ,menjulang ke udara bagaikan pencakar langit. Prambanan yang dibangun sekitar 850 Masehi itu, dalam sejarahnya merupakan bangunan ritual yang menonjolkan Dewa Siwa sebagai bagian uta-

ma dan Brahmana dan Wishnu berada pada kiri kanan Siwa. Selain itu cukup banyak lagi candi-candi kecil berdiri di lokasi induk Candi Prambanan sehingga tercatat sebagai Candi termegah di AsiaTenggara. Candi yang berada pada beberapa desa itu, yakni Bukoharjo, Prambanan dan Sleman dengan gerbangnya berada di Desa Tlogo, sudah masuk dalam warisan dunia pada badan PBB. Dibandingkan dengan lokasi Candi Brobudur yang berjarak 40 kilometer dari Kota Yogyakarta, Candi Prambanan merupakan candi terdekat dari begitu banyak lokasi candi terkenal di kota Kraton ini. Namun karena informasi kurang begitu jelas, malah terkesan pihak pengelola layananan kepariwisataan di sana kurang menguasai informasi sebenarnya tentang objek-objek wisata seperti Candi, menyebabkan kalangan wisatawan domestik dan manca negara bisa melewatkan kesempatan untuk mengunjunginya. Aidi Yursal

Penulis dengan latarbelakang Candi Prambanan saat melawat objek wisata terkenal kota Yogyakarta dalam rangkaian acara Kota Terang Hemat Energi bersama Philips LED awal November 2013 lalu.



WASPADA Minggu 24 November 2013

Lagu Mirasantika Dipelajari Di Berbagai Negara LAGU berjudul Mirasantika karya Rhoma Irama kini dipelajari dan menjadi rujukan sejumlah perguruan tinggi di berbagai negara karena dianggap mampu mempengaruhi karakter dan perilaku manusia. “Ketertarikan perguruan tinggi di dunia bermula dari karya Rhoma Irama yang dinilai menggambarkan kenyataan dan tidak hanya sekedar lirik, tapi mampu mengubah karakter seseorang,”

ujar Ketua Umum DPP “Fans of Rhoma and Soneta” (Forsa), Surya Aka Syahnagra, kepada Antara, Jumat (22/11). Lagu berjudul Mirasantika (minuman keras dan narkotika) memiliki lirik menggambarkan bahwa seseorang yang awalnya suka pada minum keras dan obat terlarang. Namun, gara-gara hal itu semua, maka seseorang terancam kehilangan masa depan. Tidak hanya itu, sejumlah karya penyanyi yang dijuluki Raja Dangdut tersebut juga menjadi bagian dari pelajaran mahasiswa, khususnya jurusan musik. Antara lain berjudul Keramat, Judi, Begadang, Laailaahaillallah dan sebagainya. “Dijadikannya rujukan dan masuk dalam buku karya

profesor dunia merupakan sebuah kebanggaan. Kami berharap semua penyanyi atau pencipta lagu lainnya tidak sekadar membuat lirik, tanpa ada hikmah,” kata Surya Aka. Mantan Komisioner KPID Jatim itu mengatakan, Guru Besar Musik pada Pittsbergh University Amerika Serikat Prof Andrew Weiintraub berbicara dengannya dan mengakui saat ini dunia sedang mengkaji lagu Rhoma Irama. “Alasannya, lagu karya Rhoma memiliki makna yang mendalam terhadap perilaku manusia secara universal. Itu sulit ditemukan di kalangan artis lain di dunia,” ujarnya meniru ucapan Andrew. Kemudian, lanjut Surya Aka, Andrew menyebut buku karya ilmuwan yang menulis

biografi Rhoma Irama dan memberikannya lampirkan contoh buku-buku pelajaran yang termasuk biografi dan analisa lagu Rhoma. Sejumlah buku dan literatur yang di dalamnnya mengupas biografi lirik-lirik karya Rhoma, yakni : Pertama, Broughton, Simon, and Mark Ellingham. 2000. Rough Guide to World Music; Volume 2: Latin and North America, the Caribbean, Asia and the Pacific . Kedua, Capwell, Charles. 2004. “The Music of Indonesia.” Ketiga, Manuel, Peter. 1988. Popular Musics of the Non-Western World . Keempat, Sutton, R. Anderson. 2002. “Asia/Indonesia.” In Worlds of Music Kelima, Sweeney, Philip.

Rhoma Irama

1991. The Virgin Directory of World Music. Keenam Taylor, Timothy. 1997. Global Pop: World Music, World Markets “Prof Andrew mengakui pada buku literatur kedua dan keempat sering dipakai dan dianggap pelajaran wajib di ratusan universitas di dunia. Yang ketiga masuk kurikulum musik dunia,” kata dia. Semisal, katanya, kuliah “Introduction to World Music” di Universitas Pittsburgh, yang termasuk dalam setiap semester. “Di setiap semester ada 300 mahasiswa berkuliah. Kalau jumlahnya 600 mahasiswa per tahun, maka berapa mahasiswa yang sudah pernah belajar lagu Rhoma Irama melalui buku-buku ini,” kata Surya.(ant)

Owen Wilson Dan Pierce Brosnan Selamat Dari Kebakaran

Owen Wilson


BINTANG papan atas Hollywood Owen Wilson dan Pierce Brosnan lolos tanpa cedera saat terjadi kebakaran di lokasi syuting film mereka di Thailand Utara. Wilson dan Brosnan baru saja selesai syuting untuk aksi-thriller “The Coup” ketika kebakaran terjadi di sebuah ruko tiga lantai yang disewakan untuk film di kota Lampang. “Baik Owen Wilson maupun Pierce Brosnan atau (co-star) Lake Bell berada di dekat lokasi ketika terjadi kebakaran. Peristiwa itu terjadi setelah syuting selesai sehingga tidak ada aktor kami yang berada di sana,” kata Chris Lowenstein dari perusahaan produksi Living Film yang membantu pengambilan gambar, Jumat (22/11). Polisi setempat mengatakan, kebakaran diduga telah dimulai setelah efek khusus digunakan dalam syuting. “Polisi forensik memeriksa tempat itu untuk menemukan penyebab sebenarnya,” menurut Kolonel Polisi Thanakorn Khumwong seperti dilansir kantor berita CNA. Film “The Coup” mengisahkan keluarga Amerika yang terjebak di negara Asia Tenggara di tengah pemberontakan militer.(ant)


FFI Umumkan Nominasi Film Bioskop blog

Pierce Brosnan

Slank: Penyadapan Bukti Indonesia Lemah PARA personel Slank menilai penyadapan yang dilakukan Australia membuktikan kelemahan intelijen Indonesia. Abdee Negara Nurdin, gitaris Slank, menilai terungkapnya penyadapan ini seharusnya menjadi koreksi bagi pemerintah Indonesia. “Lihat bagaimana mekanisme kerja dari intelijen Indonesia, cara kerja teknologinya sudah baik apa belum?” kata Abdi Kamis (21/11). Menurut Abdee, kebijakan Presiden seharusnya diambil berdasarkan pertimbangan yang matang. Jangan sampai kebijakan itu malah menjadi bom waktu bagi Indonesia. “Memutuskan kerjasama dengan Australia bukan solusi,”

kata Abdee. Pria berambut gondrong ini bahkan sangat menyayangkan Indonesia memutuskan hubungan kerja dengan Australia. “(Saya) Tidak menafikan, wisatawan Australialah yang mendominasi (pariwisata) Indonesia,” jelas Abdee. Sementara itu, Bimbim, drummer Slank menilai SBY berlebihan dalam menanggapi penyadapan yang dilakukan Australia. “Kesannya jadi lebay dan kekanak-kanakan. Seharusnya disikapi dengan bijaklah,” ujarnya. “Enggak usah kebakaran jenggot, deh,” tambah Kaka, sang vokalis Slank. “Kerja intelijen memang begitu. Monitor sinyal pada

target-target asing adalah hal wajar,” ujar Bimbim yang dibenarkan personel Slank lainnya yakni Abdee, Ivan dan Ridho. Slank tidak menafikan bahwa Indonesia juga melakukan hal yang serupa. “Pasti kita juga melakukan penyadapan, sama seperti Australia. Hanya saja kita kalah canggih. Buktinya mereka bisa menjebol Indonesia,” kata Bimbim. Seperti beritakan sebelumnya, terungkapnya penyadapan Australia terha-dap Indonesia pertama kali dimuat dalam harian Sydney Morning Herald


Bimbim dan Kaka


FESTIVAL Film Indonesia 2013 telah mengumumkan nominasi-nominasi film bioskop yang terbagi dalam beberapa kategori. Untuk kategori Film Terbaik, ada lima judul yang diunggulkan menjadi calon pemenang, yaitu “5 CM”, “Belenggu”, “Habibie dan Ainun”, “Laura & Marsha” serta “Sang Kiai”. Para sutradara yang dinominasikan menjadi Sutradara Terbaik adalah Dinna Jasanti (Laura & Marsha), Hanung Bramantyo & Hestu Saputra (Cinta Tapi Beda), Rako Prijanto (sang Kiai), Rizal Mantovani (5 CM) dan Upi (Belenggu). Sementara Pemeran Utama Pria dan Wanita Terbaik adalah Abimana Aryasatya (Belenggu), Ikranagara (sang Kiai), Joe Taslim (La Tahzan), Lukman Sardi (Rectoverso) dan Reza Rahadian (Habibie & Ainun). Adinia Wirasti (Laura & Marsha), Happy Salma (Air Mata Terakhir Bunda), Imelda Therine (Belenggu), Laudya Cynthia Bella (Belenggu), dan Laura Basuki (Madre). Kategori Pemeran Pendukung Wanita Terbaik diperebutkan oleh Ayushita (What They Don’t Talk About When They Talk About Love), Dewi Irawan (Rectoverso), Jajang C Noer (Cinta Tapi Beda), Meriza Febriani (Sang Kiai) dan Poppy

Sovia (Merry Go Round). Sedangkan Adipati Dolken (Sang Kiai), Alex Komang (9 Summers 10 Autumns), Didi Petet (Madre), Igor Saykoji (5 CM), dan Norman R Akyuwen (Tak Sempurna) bersaing dalam kategori Pemeran Pendukung Pria Terbaik. Ketua Dewan Juri Film Bioskop, Slamet Rahardjo, menegaskan, para juri berusaha seadil mungkin dan menepis semua kemungkinan kecurangan. “Tidak ada film ‘pesanan’,” ujarnya di Gedung Film, Jumat (22/11). Slamet menilai 53 judul film bioskop bersama Tommy F Awuy, Didi Petet, Norman Benny, Armantono, Roy Lolang, Arswendo Atmowiloto, Hartanto, dan Remy Sylado. Meski salah seorang juri, yaitu Didi Petet, masuk menjadi nominasi, dia menegaskan bahwa yang bersangkutan tidak diizinkan ikut membahas kategori tersebut. Malam penganugerahan Piala Citra akan dilangsungkan di Semarang, Jawa Tengah pada 7 Desember mendatang. Kategori Baru Sementaraitu, Festival Film Indonesia tahun ini membuat kategori baru untuk nominasi, yaitu film animasi. Sebanyak 93 judul film

animasi pendek diseleksi oleh tim juri yang terdiri dari Gatot Prakosa, Bambang Gunawan Santoso, Deddy Syamsuddin, Adi Nugroho dan Rachmat Rizal. “Ini adalah kategori baru, selama sebulan lima juri menilai 93 film,” ujar Gatot sebelum membacakan nominasi di Gedung Film, Jumat (22/11). Lima daftar judul film animasi yang diunggulkan adalah, Florist (M Paji Sofiullah), Hebring (Marlin Sugama & Dennis Adhiswara), Inspektur Jonni (Mohamad Fajar), Kripik Sukun Mbok Darmi (Heri Kurniawan) dan Sang Supporter (W Darmawan). Selain animasi, Festival Film Indonesia 2013 juga menilai beberapa kategori lain dari 53 film bioskop, 75 film televisi, 119 film pendek, 80 film dokumenter pendek dan 21 film dokumenter panjang. Arthur S. Natan, ketua dewan juri film dokumenter mengatakan, film- film yang dinilainya sudah mulai mewakili keberagaman tema kehidupan Indonesia. “Film dokumenter kini bisa diterima di tanah air, tidak hanya sebagai catatan audio visual atau sejarah, tapi bentuk dokumenter bisa hadir jadi ekspresi karya personal,” paparnya.(ant)

Rahasia Fatin Jaga Kualitas Vokal PENYANYI jebolan X Factor Indonesia, Fatin Shidqia Lubis, 17, memiliki rahasia dalam menjaga kualitas vokalnya. Dia rajin mengkonsumsi kencur dengan cara dimakan maupun diolah menjadi minuman. “Jadi siapkan kencur dulu sebelum take vokal. Ada tiga atau empat kencur gitu, aku kunyah juga,” kata Fatin di Jakarta, Rabu (20/11). Fatin mendapatkan saran ini dari rekannya, Novita Dewi. Sebelum lulus dari X Factor Indonesia, Fatin telah mengikuti resep tersebut. Awalnya, Fatin merasa mual ketika memakan kencur. “Awalnya ingin muntah karena banyak banget. Itu aku dapat dari kak Dewi (Novita),” tambahnya. Ternyata saran dari Novita Dewi ini sangat ampuh. Saat take vokal album pertamanya yang berjudul Fatin: For You, Fatin menghabiskan empat jam dan suaranya kembali seleb

segar setelah mengkonsumsi kencur. “Terasa khasiatnya. Apalagi take vokal butuh waktu lama,” jelasnya. Fatin meluncurkan album perdananya yang diberi judul Fatin: For You. Kata “for you” dipilih menjadi judul album karena menjadi ciri khas Fatin. Saat audisi X Factor Indonesia, Fatin menyanyikan lagu “Grenade” milik Bruno Mars. Dalam lagu itu, terdapat kata “for ya”, yang kemudian dilafalkan “foya” dan juga menjadi yel-yel penggemar Fatin. “Imejku kan ‘foya’,” kata Fatin saat meluncurkan albumnya. Fatin mengerjakan album ini sejak Juni lalu. Dia harus pandai membagi waktu antara sekolah dan rekaman ketika menggarap album ini. “Ngerjainya sore atau malam. Itu rawan suara serak makanya harus jaga banget,” kata Fatin. Album ini berisi 12 lagu yang menceritakan kesenangan hingga

kesedihan anak muda seusianya. Fatin menjagokan “Dia Dia Dia” sebagai single-nya. Fatin tidak menyanyi sendiri. Dalam album pop ini, dia juga berduet dengan Mikha Angelo, sesama finalis X Factor Indonesia, dalam lagu “Kaulah Kamuku”. Dia juga berkolaborasi dengan New Kingz di lagu “Jangan Kau Bohong”. Kerja keras menggarap album pertama ini membuat Fatin puas dengan hasilnya ini. Termotivasi Sementara itu, akting adalah hal baru bagi Fatin. Baginya, bermain film dengan aktris senior Acha Septriasa merupakan kebanggaan sekaligus motivasi yang baik untuknya. Menjadi bagian dalam film 99 Cahaya di Langit Eropa dan beradu akting dengan Acha Septriasa dan Abimana, membuat Fatin merasa deg-degan. Awalnya, dia tidak yakin

bisa berlakon di film yang berdasarkan dengan cerita novel yang sama. Namun berkat dorongan dan semangat dari Acha, Fatin bisa melewati proses syuting dengan baik. “Ada dari kak Acha wejangan. Aku take dua sampai tiga kali. Benar-benar susah. Kata Acha pasti bisa. Anggap saja kamu akan omong sendiri. Aku langsung bilang sama diri aku pasti bisa. Ingat terus kata-kata itu jadi aku bisa walau agak deg-degan,” papar Fatin. Bagi Fatin, pengalaman pertamanya dalam bermain film dan syuting di Eropa sangat berharga. Meski ketidakpercayaan diri sempat menghampirinya. Setelah menjalankan proses syuting selama seminggu, Fatin justru merasa ketagihan berakting dan bermain film. “Antara ketagihan dan enggak. Karena lihat skrip banyak gimana gitu. Tapi pas dijalani, jadinya kayak

kurang, jadi pingin lagi dan lagi,” ujar Fatin. Tidak hanya mengambil andil berperan pada film yang diadaptasi dari novel karya Hanum Rais dengan judul yang sama, Fatin juga didaulat membawakan soundtrack film tersebut. Rencananya, film 99 Cahaya di Langit Eropa akan rilis di Bioskop pada 5 Desember 2013. Kesulitan Mengenai kendala, Fatin mengaku sempat kesulitan berbahasa Jerman saat syuting film 99 Cahaya di Langit Eropa. Film perdananya ini mengambil lokasi syuting di Eropa. “Sempat kesulitan sih, soalnya bahasa Jerman. Tapi aku kan bisa bahasa Inggris, jadi bisa diatasi,” tambahnya. Selama menjalani syuting, Fatin berada di Eropa kurang lebih satu minggu. Meski tidak lama, Fatin sempat belanja oleholeh untuk keluarga dan teman-teman.(ant/k/inc)

Waspada, minggu 24 november 2013  
Waspada, minggu 24 november 2013