Issuu on Google+

Empat F-16 Kawal SBY MADIUN (Antara): Presiden Susilo Bambang Yudhoyono, Sabtu (14/1) siang, mengakhiri kunjungan kerjanya di Jawa Timur dan kembali ke Jakarta dengan kawalan empat pesawat tempur F-16. Sekitar pukul 12.00 WIB Presiden Yudhoyono beserta rombongan bertolak dari Pangkalan TNI AU Iswahjudi dan menempuh perjalanan lebih kurang 1 jam 10 menit. Dalam perjalanan kembali menuju Jakarta itu Kepala Negara kembali mendapat pengawalan empat pesawat

Lanjut ke hal A2 kol 1

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) MINGGU, Pon, 15 Januari 2012/20 Safar 1433 H z No: 23744

Tahun Ke-66

Terbit 20 Halaman (A1-8, B1-12) z zHarga Eceran: Rp 2.500,-


Kapal Pesiar Kandas Dan Terbalik SATU kapal pesiar mewah yang kandas terlihat di lepas pantai sebelah barat Italia di Kepulauan Giglio Sabtu (14/1). Tiga penumpang tewas 69 orang hilang dan regu pertolongan mencari korban lainnya setelah kapal pesiar raksasa Italia itu yang membawa lebih dari 4.000 orang kandas Jumat malam. Musibah kapal pesiar ini mirip dengan peristiwa kapal Titanic.


Ingin Jadi Penulis Buku

DISIBUKKAN dengan pelajaran di kampus, dara Aceh kelahiran Lhokseumawe, 22 Agustus 1990 ini tak meninggalkan berbagai kegiatan di luar kampusnya. Orin, demikian panggilan akbrab Rinjani Bahri, ternyata sekarang ini sedang menekuni ilmu kepenulisan dengan bergabung di Balai Sastra Samudra Pasai dan Forum Lingkar Pena (FLP) Lhokseumawe. Meskipun bukan juara I, Orin pernah meraih prestasi sebagai juara 2 lomba pembacaan puisi se-Aceh dalam ajang Pekan Seni Mahasiswa Daerah (Peksimida), dan mewakili Unimal untuk mengikuti lomba debat di Padang Oktober 2011 lalu. Lanjut ke hal A2 kol 1

1,5 Ha Ladang Ganja Di Madina


53 Orang Tewas Dalam Ledakan Bom Di Irak ZUBAIR, Irak (AP): Sekurang-kurangnya 53 orang tewas akibat ledakan bom di tengah jamaah Syiah dekat kota pelabuhan Basra di selatan Irak, Sabtu (14/1), demikian menurut seorang pejabat Irak. Serangan itu merupakan yang terakhir dari serangkaian pengeboman pada saat masyarakat Syiah melakukan kegiatan peribadatannya yang menewaskan sejumlah warga. Pengeboman itu mengancam makin tegangnya konflik sekte hanya beberapa minggu setelah AS menarik pasukannya. Serangan tersebut terjadi pada hari terakhir dari 40 hari

Arbain, ketika ratusan ribu jamaah Syiah dari Irak dan luar negewri berkunjung ke Karbala di Irak, serta sejumlah tempat suci lainya. Ledakan Sabtu itu terjadi dekat kota Zubair ketika para jamaah berbaris menuju tempat suci Syiah Imam Ali di pinggiran kota tersebut, kata Ayad al-Emarah, seorang jurubicara gubernur provinsi Basra. Ada laporan bertentangan mengenai sumber ledakan. AlEmarah mengatakan ledakan disebabkan oleh seorang pengebom bunuhdiri atau bom jalanan. Namun seorang intelijen militer Irak yang

bidan desa Hutabarat Sosunggulon, Lamria boru Simbolon. Namun tidak lama setelah menangani persalinan Lamria, langsung mengajak keluarga pasutri untuk berdiskusi karena bayi memiliki kelainan fisik alias cacat. Bayi kemudian dirujuk ke RS Tarutung, dr M Panjaitan, bersama bidan memeriksa

menyelidiki serangan itu mengatakan ledakan disebabkan oleh satu bom jalanan, menjelaskan bahwa jalanraya dari Basra ke Zubair telah digunakan oleh para jamaah telah ditutup bagi lalulintas. RS Basra telah menerima 53 korban tewas dan 137 cedera setelah ledakan, kata Dr. Riyadh Abdul-Amir, kepala Direktorat Kesehatan Basra. Dia mengatakan sebagian korban cedera berada dalam kondisi gawat dan dia memperingatkan angka korban tewas kemungkinan akan meningkat. Ledakan itu terjadi ketika para jamaah Syiah berada pada puncak peringatan Arba’in, yang menandai akhir dari 40 hari berduka sehubungan dengan ulangtahun tewasnya Imam Hussein, seorang tokoh utama Syiah. Para jamaah yang tidak dapat melakukan perjalanannya ke kota suci Karbala, di selatan Baghdad, selalu melakukan perjalanan ke tempat suci lainnya seperti tempat suci di dekat Zubair. Riyadh Abdulamir, kepala bagian kesehatan provinsi Basra, mengakui 53 orang tewas dan 137 orang lainnya cedera akibat serangan pukul

Lanjut ke hal A2 kol 6

Lanjut ke hal A2 kol 7

Bayi Tanpa Anus Dan Batok Kepala Serta Kelamin Ganda Lahir Di Taput TARUTUNG (Waspada): Bayi memiliki kelamin ganda (pria dan wanita) dan tanpa batok kepala, serta tanpa anus lahir di Dusun Lumban Pinasa, Desa Hutabarat Sosunggulon, Kecamatan Tarutung (Taput). Bayi itu lahir dari pasangan M. Sihombing, 24, dan D br Simatupang, 21, Sabtu (14/1) sekira pukul 10:30. Bayi dengan berat 3,7 Kg lahir dengan normal ditangan

Kisah Bocah Bomber Afganistan BEGITU sering kita mendengar aksi bom bunuh diri di Afganistan. Tak hanya orang dewasa, kelompok teroris di balik aksi keji itu juga menyasar sejumlah anak kecil sebagai pelaku. Lewat metode cuci otak, anak-anak dijejali informasi sesat yang membuat mereka dengan rela melakukan aksi bom bunuh diri. Begitu sederhana kaum teroris mencuci otak anakanak kecil di negara tersebut. “Kami diberi tahu bahwa bom tidak akan Lanjut ke hal A2 kol 3

Abdul Samat, seorang bocah 13 tahun, calon bomber di Afganistan.


Perusahaan elektronik Korea LG menimbulkan gejolak di seluruh dunia ketika mengumumkan pembuatan televisi OLED seukuran 55 inci minggu lalu, dan sekarang perusahaanitumemperkenalkan dua gambaran baru yang memperlihatkan kepada Anda kelebihan- kelebihan dari jenis televisi ini.

l A6

PANYABUNGAN (Waspada): Polres Madina kembali menemukan 7.500 batang ganja siap panen di atas lahan 1,5 hektare di Tor Sihite, Desa Rao-rao Panjaringan, Kec. Tambangan, Kab. Mandailing Natal (Madina). Operasi itu dalam upaya peminimalisiran peredaran ganja di kota santri tersebut.

Demikian disampaikan Kapolres Madina melalui Wakapolres Madina, Kompol Hariyamoko dimpingi Kasat Narkoba, AKP Hendra, Kabag OPS Kompol Syarifuddin Lubis, Sabtu (14/1). Dijelaskan, Polres Madina terus berkoor-

dinasi dengan masyarakat di setiap wilayah yang teridentifikasi produsen ganja, untuk memberikan informasi di mana ada penemuan ladang, pengedar hingga ke pemakai. “Ini murni hasil laporan masyarakat kepada Pospol

Tambangan dalam dua hari terakhir, sehingga kita langsung melakukan penelusuran ke lapangan. Petaninya tidak ditemukan karena biasanya mereka meninggalkan lokasi Lanjut ke hal A2 kol 7

Gedung Madrasah Dan Rumah Ludes Terbakar TA N J U N G B E R I N G I N (Waspada): Gedung Madrasah Ibtidaiyah Al Wasliyah di Dusun IV, Desa Nagur, Kec. Tanjung Beringin, Kab. Serdang Bedagai, hangus dilalap sijago merah, Sabtu (14/1) sekira pukul 17:30. Tidak ada korban jiwa dalam peristiwa itu, namun lima ruang Madrasah terdiri empat ruang kelas dan satu kantor ludes terbakar, termaWaspada/Ist

PERSONEL Polres Madina diabadikan bersama barang bukti pohon ganja di lokasi penemuan ladang ganja siap panen, Sabtu (14/1) di Tor Sihite Desa Rao-rao Panjaringan Kecamatan Tambangan.

25 Gunung Api Di Atas Normal PADANG (Antara): Staf Khusus Presiden Bidang Bantuan Sosial dan Bencana Andi Arief menyatakan, sebanyak 25 gunung api yang ada di Indonesia berstatus di atas normal atau tidak normal, baik itu dalam tingkat waspada maupun siaga. “Dari data resmi ada 25 gunung api yang masih dalam

status waspada serta siaga dan gunung api tersebut harus menjadi prioritas perencanaan mitigasi bencana di tingkat daerah baik kabupaten maupun kota,” kata Andi, di Hotel Pangeran Beach Padang, Sabtu (14/1) dalam workshop Peran Jurnalis dalam Penanggulangan Bencana. Dia menambahkan, khu-

Presiden Taiwan Yang Bersahabat Dengan China Menangi Pemilu TAIPEH, Taiwan (AP): Presiden Taiwan berhasil memenangi kembali pemilihan Sabtu (14/1) sehingga dia akan melanjutkan kekuasaannya untuk masa jabatan kedua dan melanjutkan kebijakannya yang bersahabat dengan China. Kemenangannya itu telah menimbulkan kekhawatiran sejumlah kalangan di Taiwan tentang ketahanan kemerdekaan mereka secara de facto. Sampai kira-kira 99 persen suara yang telah dihitung, lembaga resmi Komisi Pemilihan Pusat mengatakan Presiden Ma Ying-jeou berhasil me-


Menikmati pusat perbelanjaan tradisional di Pasar Mayestik Jakarta untuk melihat dan berbelanja aneka bahan busana pilihan impor dan ekspor, rasanya belum lengkap jika tidak mampir ke resto-resto yang ada di sana.

l B1

ngumpulkan 51,6 persen suara, sementara saingan terdekatnya, Ketua Partai Demokrat Progresif Tsai Ing-wen meraih 45,6 persen suara. Kandidat ketiga, James Soong, yang sebelumnya pernah menjadi tokoh partai Ma, Partai Nasionalis, hanya meraih 2,8 persen. Partai Nasionalis Ma juga berhasil mempertahankan mayoritasnya dan mengendalikan parlemen yang beranggota 113 orang, meski harus berkurang jumlah mayoritasnya. Berbicara di depan ribuan pendukungnya Lanjut ke hal A2 kol 3

sus untuk Sumbar ada dua gunung api yang harus diwaspadai masyarakat sebab masih dalam status waspada, yaitu gunung Marapi dan gunung Talang. Selain dua gunung api di Sumbar tersebut, gunung lainnya yang saat ini masuk dalam Lanjut ke hal A2 kol 7

suk rumah dan barang berharga milik Nurasiah alias Wak Itam, 62, yang ditempati bersama anaknya, Nurfadillah, 25, serta menantunya, Ahmad Fauzi, 30. Kerugian sementara diperkirakan mencapai puluhan juta rupiah. Camat Tanjung Beringin, Aminuddin, S.Sos dan Kepala Desa Nagur, Rusli mengatakan Lanjut ke hal A2 kol 7

KIP Banda Aceh Siapkan 700 Kotak Suara Pilkada BANDA ACEH (Antara): Komisi Independen Pemilihan (KIP) Kota Banda Aceh mulai mempersiapkan 700 kotak suara untuk pemilihan kepala daerah gubernur/wakil gubernur, wali kota/wakil wali kota yang dijadwalkan akan berlangsung pada 16 Februari 2012. Ketua Pokja logistik KIP Kota Banda Aceh, Mahfud, Sabtu (14/1) mengatakan bah-

wa lembaga penyelenggara Pilkada 2012 itu telah menyiapkan 700 kotak suara untuk didistribusikan ke 350 Tempat Pemilihan Suara (TPS) yang tersebar di 90 desa. “Mulai hari ini kami melakukan pengecekan kotak suara dan juga sudah saatnya kami mempersiapkan kebutuhan berbagai logistik Pilkada Lanjut ke hal A2 kol 1

Tengku Rafiah 88 Tahun WALAU usianya telah memasuki senja, Hj Tengku Rafiah Syahputra (foto), masih memiliki daya ingat yang cukup tajam. Kepada Waspada yang mengunjungi kediamannya di Jln. Hayam Wuruk Medan, Sabtu (14/1), beliau masih hafal dan lancar merangkai cerita alur demi alur kisah masa mudanya. Istri Almarhum Kolonel (Purn) HT Nurdin ini genap berusia 88 tahun pada hari ini, Minggu (15/1). Te n g k u R a f i a h p u n membeberkan rahasia awet mudanya itu. Kesehatan dan panjang umur adalah karunia Allah SWT yang patut


Pernahkan Anda membayangkan berada di tempat seperti “The Jurassic Park”, film yang bertutur tentang habitat Dinosaurus yang telah punah jutaan tahun lalu dan berhasil dihidupkan kembali hasil besutan sutradara Steven Spielberg itu? Nah, kira-kira seperti itulah saat kita berada di Taman Safari. l B11

disyukuri. Namun, dalam hal mengonsumsi makanan beliau menganjurkan agar tidak berlebihan. ‘’Saya tidak berpantang dalam hal makanan, kecuali tidak makan daging kambing. Saya paling sering makan sayur, buah dan minum air putih. Untuk vitamin-vitamin dan makanan tambahan dalam bentuk pil atau cairan tidak pernah, kecuali jamu,’’ tuturnya. Rafiah menikah dengan pria yang usianya diatas satu tahun yakni HT Nurdin (Alm) pada 3 Juli 1945 dan telah dikaruniai 5 putra dan 2 putri. Lanjut ke hal A2 kol 6


Dunia hiburan di tanah air kembali berduka. Bintang FTV dan presenter Valia Rahma (foto) meninggal dunia akibat kecelakaan lalu lintas di Bali, pekan lalu. Sebelumnya, Valia mengalami koma beberapa hari dan akhirnya meninggal dunia pada Jumat (13/1).

l B12

A2 Suhu Panas Permukaan Laut Saat Ini Meningkat MEDAN (Waspada) : Prakiraan cuaca seminggu ke depan di Sumatera Utara masih terjadi gangguan cuaca di pesisir barat Sumut terutama di kawasan Madina dan Sibolga. Masalahnya, suhu permukaan laut di Selat Malaka mencapai 29 derjat celcius. Akibat suhu permukaan laut meningkat, pumpunan awan menjulang tinggi seperti awan Cumulo Nimbus (CB) semakin aktif dan akan mengarah ke Sumatera Utara bagian barat, dengan demikian potensi curah hujan di sana masih meningkat. Pihak Badan Meteorologi, Klimatologi dan Geofisika (BMKG) wilayah I stasiun Bandara Polonia Medan membenarkan hal itu saat dikonfirmasi di bandara itu, Sabtu (14/1). Hartanto, Kepala data dan informasi (Datin) BMKGWilayah I stasiun Bandara Polonia Medan mengingatkan warga masyarakat pantai barat terutama kawasan Mandailing Natal (Madina) dan Sibolga, bahkan Nias masih perlu meningkatkan kewaspadaan. “Walaupun saat ini intensitas curah hujan kecil dan sedang dia mengingatkan masyarakat meningkatkan kewaspadaan, sewaktu-waktu bisa berpeluang banjir dan longsong, apalagi Madina belakangan ini menjadi langganan longsor saat musim hujan,” ujar Hartanto. Menurut Kepala Datin, dengan kondisi cuaca demikian, gangguan-gangguan lokal seperti cuaca buruk disekitar Selat Malaka masih akan terjadi ke depan. Bahkan curah hujan dibeberapa daerah hingga akhir Januari belum mereda, termasuk kawasan Aceh bagian timur. Bahkan menurut data BMKG, akibat potensi cuaca buruk, dampaknya akan berimbas juga ke pesisir timur Sumut seperti kawasan Medan, Deliserdang, Langkat bahkan Asahan diperkirakan akan meningkat curah hujan dan kondisi hujan merata. Dia minta para nelayan-nelayan tradisional di kawasan pantai barat seperti Sibolga, Aceh Barat, Nias dan Mandailing Natal agar berhati-hati turun ke laut mencari ikan. Tinggi gelombang laut disana mencapai lebih kurang 2 meter dan berpotensi gangguan bagi nelayan. (m32)

Empat F-16 Kawal ... tempur F-16, sebagaimana ketika melakukan perjalanan dari Malang ke Madiun pada Kamis (12/1). Keempat pesawat tempur itu unjuk kebolehan dengan terbang mendampingi pesawat kepresidenan Boeing 737-800 yang membawa Presiden Yudhoyono dan Ibu Ani Yudhoyono, dua di sisi kanan dan dua di sisi kiri. Dari ketinggian sekitar 22.000 kaki, pilot pesawat tempur F16 itu mengucapkan selamat jalan kepada Kepala Negara. “Merupakan satu kehormatan bagi kami, pesawat tempur TNI angkatan Udara untuk melaksanakan tugas escort pesawat Indonesia One,” kata pemimpin skuadron tiga, Letkol Penerbang Ali Sudibyo, dari pesawatnya yang diperdengarkan dalam pesawat kepresidenan. Ia mengatakan bahwa pesawat kepresidenan itu akan meninggalkan kawasan terbatas area Iswahyudi tempat penjaga angkasa bersarang dan menempa diri untuk menghadapi segala ancaman udara. Sambil mengawal pesawat kepresidenan, para pilot itu menyatakan kesiapan TNI AU untuk menjaga setiap jengkal wilayah kedaulatan Republik Indonesia. Para awak F-16 itu kemudian menutup salamnya dengan memberikan hormat kepada Presiden. Ditemui sebelum menerbangkan F-16, Letkol Penerbang Ali Sudibyo mengatakan bahwa pengamanan orang sangat-sangat penting (VVIP) adalah satu tugas pesawat tempur yang berada dibawah TNI Angkatan Udara. “Pengawalan hari ini kurang lebih sampai di luar dari Lanud Iswayudi, kurang lebih sampai di Kota Semarang pada ketinggian hingga mencapai 28.000 kaki,” katanya. Sebelumnya disebutkan bahwa pengawalan akan dilakukan hingga di atas Kota Cirebon. Sekalipun tidak ada ancaman, namun menurut Letkol Penerbang Ali Sudibyo, pesawat yang diterbangkannya tetap dilengkapi oleh peluru kendali. “Apabila ada kemungkinan pelanggaran udara yang masuk ke wilayah kita dan mengganggu dari kegiatan perjalanan Presiden RI, maka kita harus siap mengamankan dan kita harus melakukan pertempuran bila diperlukan,” katanya.

KIP Banda Aceh Siapkan ... gubernur/wakil gubernur serta wali kota/wakil wali kota Banda Aceh,” kata Mahfud. Selain kotak suara, lembaga penyelenggara pilkada itu juga telah mempersiapkan berbagai kebutuhan lainnya seperti formulir, bilik suara dan kertas suara. “Kertas suara juga akan kami cetak dalam beberapa hari ini, namun kami juga melakukan koordinasi dengan KIP Provinsi Aceh. Hingga saat ini kami tetap berpedoman pada Keputusan KIP Aceh nomor 26/2011,” katanya. Mahfud mengemukakan, KIB Banda Aceh dalam waktu dekat juga akan melakukan sosialisasi pencoblosan suara untuk pemilih pemula di sembilan kecamatan. Sebelumnya KIP Kota Banda Aceh telah melakukan pemutakhiran data pemilih sebanyak 157.627 pemilih tetap terdiri dari 79.644 pemilih laki-laki dan 77.983 pemilih perempuan yang ditetapkan dalam Daftar Pemilih Tetap (DPT). KIP kota Banda Aceh juga telah menetapkan empat pasangan calon wali kota/wakil wali kota, yakni T Zulfikar/Lindawati, Aminullah Usman/Tgk Muhibban, T Irwan Johan/T Alamsyah dan pasangan Mawardy Nurdin/Illiza Sa‘aduddin Djamal. Pemilihan wali kota/wakil wali kota periode 2012-2017 itu juga dilaksanakan dengan pemilihan gubernur/wakil gubernur Provinsi Aceh.

T A L E N T A ... Putri dari pasangan Samsul Bahri dan Jamiah yang duduk di semester VII jurusan Komunikasi FISIP Unimal ini sudah pula bekerja secara lepas di The Nielsen Company Of Indonesia yang merupakan lembaga asing. Selain itu, sampai sekarang dia masih memegang sejumlah jabatan di berbagai organisasi di antaranya bendahara di FLP Lhokseumawe, Bendahara Umum di BEM Unimal, anggota eksternal di DPM. Gadis berkulit coklat terang dengan berat badan 45 Kg dan tinggi 151 Cm ini punya hobi travelling dan baca buku. Dia memiliki motto tempatkanlah cita-citamu yang tinggi. Sebaliknya, penantian yang rendah dan tetaplah positif dari hasil yang tidak terduga. Menurutnya, setiap orang sering mengabaikan potensi yang ada dalam dirinya. Bahkan kesempatan yang sejatinya sudah muncul di depan mata, terbuang begitu saja. “Kita harus tahu banyak hal yang bisa membedakan kita dan orang lain. Asalkan ada kemauan, ilmu dan kesempatan pasti akan datang,” ujarnya. Orin yang bercita-cita ingin menjadi penulis buku dan juga dosen, banyak membaca buku apa saja. Bahkan dia juga belajar secara khusus tehnik menulis di Forum Lingkar Pena (FLP) Lhokseumawe dan Balai Sastra Samudra Pasai. Menurutnya, profesi menulis buku dan dosen dapat jalan seiring dan saling mendukung. Yang paling utama dalam hidup ini adalah kemauan. KeJawaban Problem Catur, mauan dan kerja keras menjadi kata kunci yang paling penting Dari Halaman Sport. dalam menentukan keberhasilan, dan ini menjadi sejarah hidup paling berarti bagi setiap 1. ....., Ge2. individu. 2. Bf1 (mengantisipasi Apapun yang ingin dilakukan, asalkan ada kemauan, pasti Bh1+mat), Bh4. ada jalan. Orin meyakinkan, segala sesuatu yang kita jalankan 3. Bg1, Bxd4. itu pasti ada manfaatnya. “Jika kita punya kemauan dan memi4. Bg3+, Gf3. liki ilmu, maka segala usaha akan 5. BxG+, RxB. tercapai dengan lebih baik,” ujarnya. 6. Rf1 (satu-satunya Satu lagi adalah kesempatan. Jika kemauan ada, ilmu langkah), Bd1+mat. ada, maka tinggal kesempatanlah yang memutuskan apakah (Jika 2. ....., GxBf1, kita bisa menjadi apa yang kita Putih mat langkah inginkan. Jadi jangan pernah tertidur saat kesempatan itu ke 8, bukan 6). datang. (Arafat Nur)

Berita Utama

WASPADA Minggu 15 Januari 2012

Dua DPO Kerusuhan Suka Makmur Ditangkap Di Jakarta PANYABUNGAN (Waspada): Polres Madina bekerja sama dengan Polda Sumatera Utara akhirnya berhasil menangkap 2 dari 4 orang yang jadi buronan Polres Mandailing Natal (Madina) terkait kerusuhan masyarakat Desa Suka Makmur dengan PT ALM 14 Desember 2011 lalu. Kedua tersangka masingmasing Izuddin Marjuki Siregar dan Zikron Batubara ditangkap polisi dari salah satu rumah sewa di RT Buaran Baru Jakarta Timur, Kamis (12/1) sekitar pukul 23:00, dan tiba di Bandara Polonia Medan sekitar pukul 20:00. Selanjutnya kedua tersangka tiba di Polres Madina Sabtu (14/ 1) sekira pukul 12:00. Kapolres Madina, AKBP Ahmad Fauzi Sik melalui Kasat Reskrim AKP, Sarluman Siregar, SH membenar-

kan pihaknya telah berhasil mengamankan dua orang dari empat orang DPO atas kejadian konflik antara PT ALM dengan warga Desa Sukamakmur, Kecamatan Muara Batang Gadis. Dijelaskan Sarluman, pihaknya saat ini juga sedang melakukan pengejaran terhadap dua orang DPO lainnya, yakni Parlindungan Hasibuan ketua LSM Badan Investigasi Nasional (BIN) dan Kepala Desa Sukamakmur, Chairum Nasution. “Kami sedang melakukan pengejaran terhadap keduanya di sekitar Tabagsel, yang sudah tertangkap sedang menjalani proses pemeriksaan di Mako Polres Madina,” ucap Kasat Reskrim. Tersangka Zikron Batubara yang sedang diperiksa di ruang sidik Satreskrim Polres Madina saat diwawancara wartawan mengatakan, dia bersama kawannya berangkat ke Jakarta

bukan untuk melarikan diri seperti yang disangkakan kepada mereka. Ke Jakarta hanya untuk meminta perlindungan dan bantuan hukum atas kejadian yang menimpa warga. Mereka berangkat dari Sukamakmur ke Jakarta Via Padang pada hari Jumat 16 Desember bersama ketua LSM BIN. Rencana awal mereka ingin menemui ketua BIN di Pekanbaru untuk memberikan arahan agar memperoleh perlindungan hukum, namun setibanya di Pekanbaru mereka tak menemui Ketua BIN. Lalu Parlindungan Hasibuan menyarankan agar mereka langsung berangkat ke Jakarta untuk meminta perlindungan dari Komnas HAM dan penegak hukum lainnya. Di Jakarta, Zikron bersama rekannya awalnya langsung menuju kantor TV ONE dan sempat melakukan talk show wa-

Darni M. Daud Maju Bukan Incar Jabatan BANDA ACEH (Waspada): Rektor Unsyiah, Darni M. Daud menegaskan ia maju dalam Pilkada bukan mengincar jabatan, melainkan untuk menata masa depan Aceh jauh lebih baik, rakyatnya makmur sejahtera dan bermartabat. Hal itu diungkapkan Prof. Dr. Darni M. Daud, MA di hadapan sekitar 1000 orang yang menghadiri peresmian Sekretariat Darni M. Daud Center di Jl Prof. Dr. Mr. Moh. Hasan, Batoh, Banda Aceh, Sabtu (14/1). Didampingi Dr. Ahmad Fauzi, M.Ag (Wakil Darni di Pilkada), Darni menyatakan, membangun kepentingan bangsa jauh lebih penting dari pada hanya sekedar sebagai Gubernur. Darni Center ini, katanya, bagian dari rencana besar dirinya untuk mengabdi kepada masyarakat. “Dari sini (Darni Center), kita bisa memberi beasiswa, membantu anak yatim dan menciptakan kemandirian ekonomi. Ia mengingatkan Aceh masa silam sangat jaya. Namun, kenapa sekarang terpuruk. Sebab itu, ia akan berjuang mengangkat kembali spirit dan semangat heroik menatap masa depan rakyat Aceh yang jauh lebih baik. Sebab itu, kata dia, untuk membangun komitmen ke depan rakyat tidak salah pemilih. “Uang penting, tapi tidak segalanya. Bila kita komit untuk membaharuan, saya kira dengan spirit ke Acehan dan spririt Islam, pasti kita tolak memberian uang karena untuk jabatan,” tegasnya. Bila memikirkan jabatan, Darni menyadari sederet jabatan yang pernah ia sandang, sudah lebih dari cukup dan ia mengaku sekarang ini sebenarnya sudah waktunya untuk pensiun. Tapi karena melihat kepentingan rakyar lebih besar, ia bersama pasangannyamajudalamPilkada

Aceh untuk memperbaiki keadaan dan membaharuan. Mundur Usai Terpilih Usai peresmian Sekretariat Darni M. Daud, calon Gubernur Aceh yang juga Rektor Unsyiah Prof. Darni M. Daoed kembali menegaskan akan mundur dari jabatannya sebagai rektor ketika terpilih nantinya. “Saya akan ikuti semua peraturan, tetapi kalau tidak ada aturan ngapain mundur,” terangnya kepada wartawan, Sabtu (14/1) usai peresmian Darni-Ahmad Center, di Batoh Banda Aceh. Darni menyebutkan, jabatan rektor yang dipegangnya bukanlah jabatan struktural yang menyebabkan ia harus mengundurkan diri karena menjadi

PORTO SANTO STEFANO, Italia (AP): Kapal pesiar berukuran raksasa kandas di lepas pantai Tuscan, Italia, Jumat malam waktu setempat. Para penumpang yang selamat dari kapal pesiar mewah yang kandas dan terbalik itu — yang menyebabkan sekurang-kurangnya tiga orang tewas dan 69 orang hilang — menjelaskan Sabtu (14/1) evakuasi para penumpang kacau. Mereka mengatakan piring dan gelas jatuh menimpa para penumpang yang merangkak dalam usahanya menyelamatkan diri pada saat kapal mulai miring, yang akhirnya sampai hampir 90 derajat. Tiga mayat ditemukan dari laut setelah Costa Concordia kandas di lepas pantai pulau kecil Giglio dekat pantai Tuscany Jumat tengah malam, sehingga merobek badan kapal yang menyebabkannya dimasuki air.

Kantor berita ANSA yang mengutip keterangan dari kantor pemerintah provinsi Grosseto sebagai mengatakan bahwa pihak berwenang telah menemukan 4.165 dari 4.234 orang yang berada di dalam kapal. Sampai Sabtu pagi, kapal tersebut terkapar hampir-hampir karam di lepas pantai Gigio, dengan posisi sebelah badannya tenggelam dalam air. Para penumpang menggambarkan suasana itu mirip dengan adegan kapal Titanic. Perusahaan pemilik kapal pesiar mewah Costa Crociera, ada sekitar 1,000 warga Italia, 500 warga Jerman, serta sekitar 150 irang Prancis dalam kapal itu. Kapal pesiar ini dilaporkan berangkat dari pelabuhan di dekat kota Roma, Italia, dan dijadwalkan mengunjungi Palermo, Cagliari, Palma, Barcelona dan Marseille. (m10)

Presiden Taiwan ...

ka setelah masa kampanye berakhir Jumat malam. Di antara para pemilih adalah pengusaha yang berbisnis di China Daratan, yang dibatasi oleh selat Taiwan, dan warga Taiwan di luar negeri. Komisi Pemilihan telah menetapkan pasangan Tsai Ingwen dan Su Jia-chyuan dari Partai Progresif Demokratik (DPP) berada di urutan No. 1, pasangan Ma Ying-jeou dan Wu Den-yih Partai Nasional Kuomintang (KMT) dari di urutan No. 2 dan pasangan James Soong dan Lin Ruey-shiung, sebagai calon independen yang didukung partai Rakyat Pertama (PFP) di urutan No. 3. Berdasarkan survei yang dilakukan berbagai media, Ma sebagai presiden petahana (incumbent) mengungguli Tsai, calon presiden wanita pertama

di Taiwan. Dalam pemilihanpemilihan presiden sebelumnya, pemilih di bagian utara Taiwan cenderung memilih Ma, bagian selatan bagi Tsai. Soong mencoba merebut suara di bagian tengah Taiwan. Pemilihan presiden kelima itu dilakukan bersamaan waktunya dengan pemilihan anggota legislatif. Parlemen Taiwan beranggota 113 orang dan saat ini Partai Nasional Kuomintang (KMT) menguasai mayoritas kursi di Legislative Yuan . Cuaca di Taipei, ibu kota Taiwan, berawan Sabtu pagi dan pada siang relatif cerah. Udara di luar gedung dingin dan berangin. Jalan-jalan utama di kota Taipei relatif lengang dan sesekali terdengar sirene mobil polisi yang berpatroli. (m10)

saya.” Pejabat keamanan Afghanistan mengatakan bahwa cerita Abdul bukan rekaan. Pada tahun lalu, serangkaian bom bunuh diri melibatkan anak-anak yang sebagian masih berusia 10 tahun. Cara ini dipilih karena anak-anak cenderung lebih mudah melewati pos pemeriksaan daripada pria dewasa. Seorang pejabat intelijen senior Afghanistan memperkirakan bahwa lebih dari 100 anak dicuci otaknya, dalam 12 bulan terakhir. Para teroris berusaha memanfaatkan keluguan mereka untuk direkrut menjadi ‘senjata’. Anak-anak yang sebagian besar buta huruf itu diambil dari sejumlah keluarga miskin dengan iming-iming pendidikan gratis. Mereka dijejali propaganda antipemerintah dan anti-Barat sampai mereka siap membunuh. “Bagian terburuk adalah anak-anak itu tidak berpikir bahwa mereka itu sedang bunuh diri,” kata pejabat itu. “Mereka sering diberi jimat yang berisi ayat-ayat Alquran, namun dengan pemahaman sesat bahwa saat bom mele-

dak, mereka akan bertahan dan Allah akan membantu mereka bertahan dari api. Hanya orangorang kafir yang akan dibunuh, mereka akan diselamatkan dan orangtua mereka akan pergi ke surga.” Tidak Islami Sepanjang perang melawan Uni Soviet pada 1980-an, yang diikuti konflik sipil, pejuang Afghanistan menolak serangan bunuh diri karena dianggap pengecut dan tidak Islami. Namun, situasi berubah setelah 2001. Taliban menyangkal menggunakan anak-anak sebagai bomber. Salah satu fasilitator Taliban dari Afganistan Utara mengatakan kepada The Daily Telegraph, “Semua bomber kami adalah laki-laki dan mereka semua relawan. Kami tidak pernah menggunakan anak lakilaki pra-puber.” Tapi NATO dan pejabat keamanan Afganistan meyakini taktik bom bunuh diri yang melibatkan anak-anak telah diadopsi secara luas. Kelompok teroris yang dicurigai adalah jaringan Haqqani, sebuah kelompok pemberontak yang selaras dengan Taliban. (vn/m09)

yang diliputi suasana gembira di Taipeh Pusat, Ma mengatakan kebijakannya yang bersahabat dengan China selaras dengan suara para pemilihnya. “Mereka beri dukungan pada kita dan mengesampingkan berbagai perbedaan dengan pulau induk (China). Kita mencari kedamaian dan mengubahnya menjadi peluang bisnis,” katanya. Sejak menduduki jabatan presiden Mei 2008, Ma telah mengikat hubungan akrab dengan China, yang selama 60 tahun telah menjadi ancaman militer, jadi saingan politik bagi negaranya, namun terakhir kedua negara telah menjadi mitra komersial yang amat penting. Sebanyak 18,1 juta pemilih akan memberikan suara mere-

Kisah Bocah Bomber ... membunuh kami, hanya orang Amerika yang akan mati,” kata Abdul Samat, seorang bocah 13 tahun, calon bomber di Afghanistan, seperti dikutip harian Inggris, Telegraph kemarin. Abdul sempat begitu percaya dengan kata-kata sang teroris. Ia pun menurut saat matanya ditutup, lalu tubuhnya dipasangi rompi dengan muatan eksplosif. Namun, beberapa menit sebelum melangkah menuju target serangan di Kandahar, ia tersadar. Bocah asal Quetta, daerah yang berbatasan dengan Pakistan, itu segera menyadari kebohongan sang teroris yang tengah mengubah tubuhnya menjadi bom manusia. “Ketika membuka mata, saya melihat hal-hal menyesatkan, mereka ingin saya melakukannya (mengebom),” Abdul mengingat. “Saya menangis dan berteriak. Orang-orang keluar dari rumah dan bertanya apa yang salah. Saya lalu menunjuk sesuatu di rompi saya. Mereka pun takut dan menelepon polisi untuk melepas bom dari tubuh

calon gubernur melalui jalur perseorangan. Jabatan sekarang ini tidak mengganggu aktivitas di kampus, karena Darni mengaku akan cuti pada saat kampanye. Menanggapi usulan Mendagri meminta pembukaan pendaftaran kembali untuk bakal calon Gubernur/Wakil Gubernur dan Bupati,Wali Kota/wakil, Ia tidak keberatan, “Kami berpikir demokratis jadi apapun keputusan MK kami terima,” terangnya. Pembukaan pendaftaran kembali harus untuk semua partai dan jalur perseorangan sehingga semua orang bisa menggunakan haknya dalam Pilkada 2012 ini. (cb01/b01)

Kapal Pesiar Kandas Di Lepas Pantai Italia, 3 Tewas, 69 Hilang

wancara langsung, lalu mereka berangkat mencari penginapan. Izuddin Siregar mengatakan, peristiwa pembakaran camp dan alat berat milik PT ALM itu bukan karena disengaja oleh warga Sukamakmur, tapi spontanitas. Awalnya, mereka datang ke lokasi kejadian hanya untuk menancapkan plank milik LSM BIN bertuliskan “Dilarang Merambah Hutan Milik Masyarakat Sukamakmur”. Plank merk itu ditancapkan tak jauh dari camp yang dibakar sekitar 100 meter. Pembakaran itu hanya spontanitas tidak ada perencanaan untuk membakar, hanya saja saat mau ditancapkan sudah ada keributan oleh warga yang berakhir pembakaran. Dijelaskan juga, mereka ke Jakarta diajak oleh Parlindungan Hasibuan untuk mencari perlindungan hukum atas sengketa antara warga Sukamakmur dengan PT ALM, karena dikatakan Siregar sengketa ini mulai terjadi sekitar bulan Oktober 2011. Saat itu warga Sukamakmur sudah beberapa kali menyampaikan aspirasi mereka kepada perusahaan dan Pemkab Madina terkait lahan mereka yang mulai “digarap” perusahaan, namun aspirasi yang mereka sampaikan tidak pernah diresfon secara positif. Setelah dilakukan beberapa kali musyawarah dengan seluruh warga, keputusannya tetap akan mempertahankan hakhak milik mereka karena lahan yang mereka klaim itu adalah tanah ulayat milik masyarakat Desa Sukamakmur yang sebelumnya Desa Manuncang sebelum dimekarkan tahun 2008 lalu. Dijelaskannya, beberapa waktu sebelum kejadian warga didatangi oleh yang mengaku LSM BIN yang siap membantu mengadvokasi hak-hak masyarakat.Yang mengaku BIN adalah Parlindungan Hasibuan. Saat itu warga sangat berharap kepada BIN agar bisa membantu mempertahankan hak-hak mereka, hanya saja ide-ide BIN ini belum ada yang berhasil bahkan yang terjadi hanya sengketa berkepanjangan termasuk insiden pembakaran itu. “Kami diperkenalkan Kades kepada LSM BIN, awalnya kami yakin BIN ini lembaga Negara, dan Parlindungan juga menyebutkan bahwa ketua BIN di pusat adalah mantan Kapolri, Jenderal Sutanto, makanya warga yakin persoalan ini akan selesai. Sesampainya di Jakarta, ternyata LSM BIN ini tidak ada sehingga kami bertengkar dengan Parlindungan Hasibuan. Para tersangka saat ini mendekam di Polres Madina dan dijerat pasal 187 subsider pasal 170 KUHP dengan ancaman 10 tahun penjara. (c14)

Bayi Tanpa Anus ... kondisi bayi. Ternyata bayi mempunyai cacat fisik dari kandungan dengan memiliki kelamin ganda, tidak ada batok kepala dan tidak ada anus. Demikian dijelaskan Lamria Simbolon, Sabtu usai menangani persalinan kepada sejumlah wartawan di Tarutung. Katanya si bayi sudah diantar ke RS Tarutung, atas hasil musyawarah dengan keluarga. Dari ilmu medis kata dia, bahwa usia si bayi tidak tahan hidup lama, namun semuanya itu berada ditangan sang Pencipta. Lamria menjelaskan hingga sore, kondisi bayi masih hidup. Dan kondisi ibu si bayi sudah sehat tidak ada masalah namun masih dalam perawatan medis. “Ini pasien baru saya, mereka baru datang dari Pekanbaru. “Kata ibu si bayi, waktu di Pekanbaru, pada saat dia hamil pernah jatuh dan sedikit mengalami sakit. Setelah diperiksa ke dokter kandungan, hasilnya bayi mengalami cacat di bagian kepala,” ujar Lamria mengutip perkataan ibu bayi. (c12)

Waspada/Edi Saputra

RATUSAN warga tampak menyaksikan rumah dan gedung Madrasah Ibtidaiyah Al Wasliyah yang terbakar sebelum petugas Damkar datang di Dusun IV, Desa Nagur, Kec. Tanjung Beringin, Sabtu (14/1).

Gedung Madrasah Dan Rumah ... peristiwa kebakaran diperkirakan terjadi sekitar pukul 17:30 dan setiba dirinya di lokasi kejadian asap yang berasal dari rumah Wak Itam tampak mengepul, terangnya kepada Waspada dilokasi kejadian. “Api terus membesar, walaupun warga sekitar berupaya memadamkan api semampunnya, sembari berusaha menyelamatkan barang-barang korban, hingga akhirnya menyambar sekolah Madrasah yang hanya berjarak sekitar dua meter dengan rumah tersebut,” jelas Aminuddin. Saat disinggung Waspada, terkait drum yang meledak, Fauzi mengakui kalau di bagian belakang rumahnya juga dijadikan tempat penyimpanan minyak tanah yang diperkirakan berjumlah enam jerigen yang dimasukkan ke dalam dua drum itu. Menurut Fauzi yang masih tercatat sebagai warga Desa Paya Perupuk, Tanjung Pura, minyak tanah tersebut dijualnya ke warga desa sekitar yang rata-rata dijual per botol. Kepala BPBD Sergai, Drs. Joni W Manik yang langsung memimpin petugas Pemadam Kebakaran (Damkar), menurunkan tiga unit mobil Damkar berhubung besarnya kobaran api diperparah banyaknya kerumunan warga, api baru bisa dipadamkan total sekitar satu setengah jam dari kejadian. Wakapolres Sergai, Kompol Dahri, didampingi Kabag Sumda, Kompol Des Ando membenarkan peristiwa kebakaran itu, dugaan sementara adanya penimbunan minyak tanah di dalam rumah yang sifatnya ilegal tidak ada surat izinnya dan asal api belum dapat dipastikan menunggu hasil petugas forensik, terangnya ketika dikonfirmasi Waspada di Mapolsek Tanjung Beringin. “Saat ini pihak Kepolisian telah mengamankan menantu pemilik rumah bersama barang bukti, Ahmad Fauzi untuk dimintai keterangan. (c03)

53 Orang Tewas ... 09:00 waktu setempat (13:00WIB) tepat di barat kota Basra. Para wanita dan anak-anak termasuk di antara para korban, katanya, tetapi dia tidak memberikan rincian lebih jauh. Menurut Riyadh, penyerang, yang membagikan makanan kepada para peziarah berjalan ke Khutwa Imam Ali, satu lokasi di pinggiran Basra yang dihormati oleh para peziarah karena dia berdampingan dengan salah seorang dari tokoh-tokoh penting kelompok mereka, meledakkan bom yang dibawanya dekat satu pos pemeriksaan. Para peziarah di Irak Selatan yang tidak dapat mengunjungi tengah kota suci Karbala untuk memperingati Arbain mempersingkat kunjungan ke Khutwa Imam Ali, yang terletak sekitar 12km barat Basra. Arbain menandakan 40 hari setelah Asyura yang memperingati pembunuhan Imam Hussein, salah satu dari tokoh-tokoh paling dihormati kaum Syiah Muslim oleh kalifah Yazid tahun 680 setelah Masehi. Majid Hussein, seorang pekerja pemerintah, merupakan salah seorang jamaah yang bergerak menuju ke tempat suci itu. “Saya melihat sejumlah mayat dan beberapa lainnya dalam keadaan cedera, termasuk anak-anak bergelimpangan di jalanan meminta tolong. I saw several dead bodies and wounded people, including children on the ground asking for help. Di sana juga terdapat sejumlah kereta bayi tertinggal di lokasi ledakan,” katanya. (m10)

1,5 Ha Ladang Ganja ... setelah melakukan penanaman, dan datang kembali setelah sampai waktu panen yang diperkirakan 6 sampai 7 bulan,” ucap Wakapolres. Disampaikannya, Polres Madina tidak akan lelah dan mengenal waktu serta jarak tempuh dan kondisi medan menuju setiap lokasi ladang ganja, agar persoalan ganja di Madina dapat dibasmi. Wakapolres mengimbau agar warga tidak perlu takut dan segan-segan untuk memberikan informasi tentang penanaman ganja di wilayah hukum Polres Madina. Sebab ganja adalah musuh bersama demi untuk menyelamatkan generasi muda. Wakil Bupati Madina, Drs. Dahlan Hasan Nasution menuturkan, upaya yang dilakukan Polres Madina sangat didukung dan akan terus didukung untuk kebaikan masyarakat dan nama daerah Madina. “Kinerja Polres Madina mulai dari pemberantasan lahan, pengedar, dan pemakai patut kita acungkan jempol, yang terbukti dari sejumlah penghuni LP Sipaga-paga Panyabungan, 70 persen adalah kasus ganja. Namun kepada masyarakat juga diharapkan teruslah melakukan koordinasi dengan aparat penegak hukum dan pemeritah daerah agar segera kita bumi hanguskan ganja tersebut dari Madina,” ucap Dahlan.(c14/a28)

25 Gunung Api ... prioritas pemantauan oleh pemerintah bersama dengan Badan Penanggulangan Bencana Daerah (BPBD) diantaranya adalah gunung Papandayan di Jawa Barat, gunung Karangetang dan Lokon di Sulawesi Utara, gunung Ijen di Jawa Timur, gunung Gamalama di Maluku Utara, gunung Krakatau di Banten dan Lampung, serta Lewotolo di Nusa Tenggara Timur (NTT). “Gunung api yang saat ini masih dalam status normal juga tidak tertutup kemungkinan malah berubah menjadi tidak normal, sebab akibat adanya gempa-gempa yang terjadi akan memicu magma yang ada dalam gunung meningkatkan aktivitasnya, sebab itu kewaspadaan dan kesiap siagaan masyarakat harus terus ditingkatkan,” jelas Andi.

Tengku Rafiah 88 Tahun ... Ketujuh putra-putri yang semuanya telah berkeluarga tersebut yakni, Drs HT Burhanuddin/Hj T Sandra Noorliza, Mayjend TNI (Purn) HT Rizal Nurdin, SIP/Hj Siti Mariam, Drg Hj T Rafina Nurdiaty/Dr H Budi R Hadibroto, SpOG, Dr Hj T Sofia Hanum, Sp.THT/Dr HT Syaifuddin, Ir HT Adi Graha Putra/Hj T Erna Fareira, Ir HT Isma Irawadi/ Hj Syarifah Maisyara dan yang paling bungsu Ir HT Erry Nuradi, MBA/Hj Evi Diana. Saat ini, Tengku Rafiah memiliki 18 cucu dan 9 cicit. Kini, putra-putrinya semuanya telah sukses. Namun, perjuangan hidup di masa penjajah dan membesarkan putra-putri sangat sulit dengan penuh risiko serta tantangan yang besar apalagi sebagai isteri seorang prajurit. ‘’Kami sering berpindah-pindah dan lebih sering diting-gal suami bertugas. Ketika membesarkan dua anak, Tengku Nurdin ditangkap Belanda dan dipenjara 5 bulan di Bukit Tinggi hingga akhir-nya dipulangkan ke Medan tahun 1950 dengan status tahanan kota,’’ ujarnya. Ketika lahir anak ke tujuh, pada 30 Juni 1964 di Medan, Tengku Nurdin menjabat Atase Militer di Konjen RI di Singapura. Selama karir kemiliteran suami Tengku Rafiah tersebut, berbagai guncangan dan hal yang tidak menyenangkan dialami hingga peristiwa PRRI dimana Tengku Nurdin divonis 18 tahun penjara. Namun, waktu itu hanya ditahan 4 tahun penjara karena mendapat amnesti abolisi.

Selama menjalani tahanan di penjara Jln. Sukamulia Medan, perekonomian keluarga ikut terguncang. ‘’Tetapi dihadapan anak-anak hal itu tidak saya perlihatkan. Kebiasaan mereka makan di restoran setiap hari Sabtu tetap saya jalankan. Menjenguk suami dalam tahanan juga selalu saya bawakan masakan enak-enak yang dimasak sendiri,’’ tuturnya. Di usia senja kini, Tengku Rafiah masih tetap hobi memasak dan mengisi TTS (teka teki silang). Lewat memasak pula beliau menjalin komunikasi dengan anak, menantu dan cucu. Terkadang dalam sehari beliau menelefon 4 kali, sekedar menanya kabar hingga membagi resep masakan. ‘’Sering Tengku Nurdin marah karena rekening telefon membengkak. Sedangkan kesukaan mengisi TTS sangat diketahui putra kedua saya, Rizal Nurdin (alm 2005). Beliau setiap berkunjung kerumah pasti membawa setumpuk buku TTS,’’ kenangnya. Kepada generasi muda kini, Tengku Rafiah berpesan agar selalu berbuat baik, jaga nama baik keluarga dan jangan pernah menyakiti hati orang lain. Dalam hal mendidik anak-anak agar mengedepankan perasaan mengasihi tidak dengan kekerasan. Pertengkaran suami-isteri jangan sampai keluar rumah, apalagi diketahui anak-anak. ‘’Jadi anak harus mandiri dan jangan manja. Erry ini sejak kecil sangat mandiri dan tidak manja,’’ tunjuk Tengku Rafiah kepada putra bungsunya Erry Nuradi yang kini menjabat Bupati Serdang Bedagai tersebut. (Surya Efendi)

Sumut - Aceh

WASPADA Minggu 15 Januari 2012

A3 Mobil Angkut Batubata Masuk Parit


Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir

STABAT (Waspada): Mobil cold diesel BK 9086 MJ bermuatan batubata masuk parit di kawasan Payaperupuk Tanjungpura, Kab. Langkat sekira pukul 07:00, Sabtu (14/1). Sopir mobil Edwin bersama dua rekannya hanya menderita luka ringan. Informasi dihimpun, mobil itu memuat batubata dari kawasan Hinai hendak menuju P. Brandan mengantarkan material bangunan pesanan pembeli. Saat melintas di lokasi kejadian besi roda ban depan kiri mobil patah hingga sopir tidak dapat mengendalikan setir dan spontan cold diesel masuk parit. Sopir bersama kedua rekannya beberapa saat kemudian dapat keluardibantumasyarakatsetempat.Kejadianitusempatmengganggu kelancaran arus lalulintas karena masyarakat berkerumun melihat. SementaraitukecelakaanlalulintasjugaterjadidiruasJalanPerdamaian, Kec. Binjai, Kab. Langkat, sekira pukul 10:00, Sabtu (14/1). Sementara itu di tempat terpisah, mobil Toyota Innova BG 1540 K betubrukan dengan mobil angkutan kota BK 1987 PB jurusan Stabat - Kwala Begumit, akibat tubrukan itu kedua mobil samasama ringsek. Menurut sejumlah warga yang melihat kejadian, kedua mobil sama-sama melaju dari arah Kota Stabat menuju Binjai. Tepat di persimpangan Perumahan Kwala Begumit mobil angkot ingin membelok tetapi tidak memperhatikan mobil Innova dibelakangnya yang melaju dengan kecepatan normal. Akibatnya tubrukan tidak dapat dielakkan. Dalam kejadian itu sopir mobil hanya menderita luka ringan dan kasusnya telah ditangani aparat kepolisian. (a03)

Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: Edward Thahir. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Armin R. Nasution. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Sinur Manik (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Feirizal Purba (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi). Wartawan Kota Medan: Umum: Zulkifli Harahap, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, David Swayana, Gito AP, Rizaldi Anwar, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa, Maini Anggita, Silfa Humaira. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Dedek Juliadi, Hajrul Azhari Ritonga. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebing Tinggi: Muhammad Idris, Abdul Khalik. Pematang Siantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Pakpak Bharat: Arlius Tumanggor. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun. Kuala Simpang: Muhammad Hanafiah, Hasanul Hidayat. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar. Lhoksukon: Musyawir. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengon: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Bustanuddin, Wintoni. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan Waspada dilengkapi dengan kartu pers. Tidak dibenarkan menerima uang dalam bentuk apapun. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan: hitam-putih Rp. 33.000,-, berwarna Rp. 90.000,Ukuran kolom: 40,5 mm. E-mail Iklan: Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Waspada/Abdul Hakim

MOBIL Innova dengan angkot tubrukan di ruas jalan Kwala Begumit, Kec. Binjai, Kab. Langkat, Sabtu (14/1) pagi. Tidak ada korban jiwa dalam kejadian.

KIP Aceh Terbitkan Aturan Kampanye BANDA ACEH (Waspada): Tanpa mau terbentur dengan persoalan hukum yang masih berlangsung di Mahkamah Konstitusi, KIP Aceh terus mempersiapkan diri menghadapi kampanye yang akan dimulai pada 30 Januari hingga 12 Februari 2012. Menyongsong masa kampanye itu, KIP Aceh dan KIP Kabupaten/Kota, menyelenggarakan rapat teknis membahas aturan main kampanye di aula KIP Aceh, Sabtu (14/1). Rapat dihadiri Ketua KIP Aceh Abdul Salam Poroh dan Ketua Pokja Kampanye KIP Aceh Zainal Abidin. Sementara dari kabupaten kota dihadiri Ketua dan anggota Pokja masing-masing. Dari pertemuan itu, KIP Aceh akhirnya menerbitkan Surat Keputusan No. 18 tahun 2012 tentang Pedoman Teknis Kampanye Pemilihan Umum Gubernur/Wakil Gubernur, Bupati/ Wakil Bupati danWalikota/Wakil Walikota di Provinsi Aceh. SK tersebut selanjutnya menjadi rujukan dalam melaksanakan kampanye Pemilukada 2012. Untuk lebih jelasnya, SK tersebut bisa diakses di website Media Center KIP Aceh, Di dalam SK itu dijelaskan secara lengkap aturan main yang harus dijalankan para kandidat dan tim suksesnya. KIP juga

merinci dengan detil definisi yang jelas tentang kampanye, tugastugastimkampanye,materikampanyedanstukturtimkampanye. “Khusus untuk tim kampanye ini, identitasnya harus jelas. Mereka harus terdaftar pada KIP Aceh dan KIP Kabupaten/Kota sesuai tingkatannya,” kata Zainal Abidin, Ketua Pokja Kampanye KIP Aceh. Sedangkanmaterikampanye, kata dia, harus memuat visi misi dan program pasangan calon, yang dibuat dalam bentuk tertulis dan wajib disampaikan kepada masyarakat pemilih. “Kampanye harus berlangsung sopan dan tidak mengganggu kepentingan umum. Tidak bisa menyerang pribadi,kelompok,golonganatau pasangan calon lain; dan tidak bersifat provokatif,” imbuhnya. Sedangkan bentuk kampanye, menurut Zainal, bisa dilakukan melalui pertemuan terbatas, tatap muka dan dialog, penyebaran melalui media cetak dan media elektronik, penyiaran melalui radio dan/atau televisi, penyebaran bahan kampanye kepada umum, pemasangan alat peraga di tempat umum, rapat umum di ruang terbuka. Kemudian, dalam bentuk debat publik/debat terbuka antar calon dan atau kegiatan lain yang tidak melanggar peraturan perundang-undangan, antara lain deklarasi atau konvensi pasangan calon, acara ulang tahun/milad, kegiatan sosial dan budaya, perlombaan olahraga, istighosah, jalansantai,tablighakbar,kesenian

dan bazaar serta rapat umum. Selanjutnya, alat peraga kampanye tidak dibenarkan ditempatkan pada rumah ibadah, rumah sakit atau tempat-tempat pelayanan kesehatan, gedung milik pemerintah, lembaga pendidikan (gedung dan sekolahan), jalan-jalan protokol, jalan bebas hambatan, dan tempat-tempat fasilitas umum (misalnya tiang telepon, tiang listrik, dan pohon perindang jalan). “Pemasangan alat peraga kampanye harus berjarak paling sedikit satu meter dari alat peraga pasangan calon lainnya. Untuk itu, KIP Aceh, dan KIP Kabupaten/Kota berwenang memerintahkanpasangancalonyang tidak memenuhi ketentuan jarak tersebut untuk mencabut atau memindahkan alat peraga itu,” tegas Zainal. Selain itu, pemerintah daerah setempat dan aparat keamanan berwenang mencabut atau memindahkan tanpa harus memberitahukan kepada pasangan calon tersebut. Khusus untuk kampanye dalam bentuk rapat umum di ruang terbuka harus diberitahukan secara tertulis kepada KIP Aceh dan/atau KIP Kabupaten/Kota dan Pengawas Pemilu berkenaan dengan hari, tanggal, waktu, tempat, nama pembicara, dan penanggungjawab serta jumlah orang yang akan hadir. Kampanye di ruang terbuka hanya dibenarkan membawa ataumenggunakanfotopasangan calon atau atribut, simbol-simbol,

pataka, dan/atau bendera atau umbul-umbul dari pasangan calon yang mengadakan kampanye. Terkait dengan kegiatan debat pasangan calon akan diseleng-garakan oleh KIP Aceh atau KIP Kabupaten/Kota dan disiarkan langsung oleh media elektronik. “Untuk jadwal kampanye ini akan diatur sepenuhnya oleh KIP Aceh atau KIP Kabupaten/Kota. Tapi KIP sudah merencanakan, hari pertama kampanye dilakukan di dalam rapat paripurna DPRA atau DPR Kabupaten/ Kotadenganacarapenyampaian visi, misi, dan program pasangan calon secara berurutan dengan waktuyangsamatanpadilakukan dialog,” jelas Zainal seraya menambahkan, pasangan calon atau tim kampanye wajib membersihkan alat peraga kampanye palinglamatigaharisebelumhari dan tanggal pemungutan suara. Terkait dana kampanye, selain dana sendiri, pasangan kandidat bisa pula mendapatkan dana kampanye dari pihak lain yang tidak mengikat. Syaratnya, bantuan perseorangan tidak melebihi Rp50 juta. Bantuan kelompok, perusahaan atau badan hukum swasta tidak melebihi Rp350 juta. “Dana kampanye itu akan diaudit oleh lembaga akuntan publik yang akan ditunjuk oleh KIP Aceh dan KIP Kabupaten/Kota. Semua kegiatan tahapan kampanye ini akan diawasi oleh Panitia Pengawas Pemilu (Panwaslu) di semua tingkatan,” demikian Zainal Abidin. (b04)

Harga Minah Di Pijay Dan Pidie Mencekik Leher Capai Rp15.000 Per Liter MEUREUDU (Waspada) : Harga minyak tanah (minah) di Kabupaten Pidie Jaya (Pijay) dan Pidie mencekik leher. Informasi diperoleh Waspada, Sabtu (14/ 1) harga minah mencapai Rp15.000 per liter. Tak ayal, warga pengguna minah pun mengeluh dengan kenaikanhargaminahyangdinilai sangat tak wajar itu, ungkap Syahbuddin,salahseorangwargaUlim kepada Waspada seraya menambahkan harga minyak tanah

di daerahnya meningkat tajam. Kenaikan harga minah sekaligus memicu kenaikan harga bahan pokok kebutuhan masyarakat sehari-hari. Syahbuddin mengaku, dengan kenaikan harga terlalu tinggi itu sangat memberatkan masyarakat terutama yang ekonomi lemah alias keluarga kurang mampu yang hingga kini masih menggunakanBBMjenistersebut untuk keperluan memasak. Bahkanwargasulitmendapatkan

minyak tanah. Dia menyebutkan, kebijakan pemerintah mengkonversi penggunaan minyak tanah ke gas elpiji berdampak buruk terhadap warga miskin. Pasalnya, pembagian kompor gas dan tabung elpiji 3 kilogram yang diberikan secara cuma-cuma oleh pemerintan tidak dilakukan secara merata. Bahkan, secara umum yang mendapatfasilitasgratisituadalah kalangan mampu (kaya), sementara kalangan kurang mampu (miskin) banyak yang tidak kebagian. Komentar miring juga diungkapkan Sumarni, warga Glumpang Minyeuek, Kec. Glumpang Tiga, Kab. Pidie. Menurut dia, selama konversi minah ke elpiji, ia dan beberapa keluarga miskin lainnya tidak mendapatkan kompor dan tabung elpiji. Sementara M Jafar, warga Trienggadeng, Pidie Jaya kepada Waspada mengatakan, mahalnya harga jual mitan di kios-kios pengecer sangat memberatkan warga. “Sekarang minah dijual para pengecer berkisar Rp12.000 hingga Rp15.000 per liter. Padahal,

sebelumnya hanya di bawah Rp5.000 per liter, “katanya. Pantauan Waspada, menyusul dicabut subsidi minyak tanah di Kabupaten Pidie Jaya dan Pidie serta beberapa kebupaten/kota lainnya di Aceh. Khusus di Pidie Jaya dan Pidie, sejumlah pangkalan mitan sudah pada tutup alias gulung tikar menyusul tak adanya lagi pasokan minya tanah dari Pertamina. M. Nasir, salah seorang pemilik pangkalan mitan di Meureudu kepada Waspada mengaku, sejak diberlakukannya pencabutan subsidi mitan, ia terpaksa menutup usaha pangkalannya. Dikatakannya, harga mitan di tingkat pedagang eceran sangat bervariasi dan tak menentu,adayangmenjualRp10.000 per liter, ada pula yang menjual Rp12.000 dan Rp15.000 per liter. Karena kondisi demikian, sejumlah warga berpenghasilan rendah, terpaksa mengalihkan bahan bakar buat memasak dengan menggunakan kayu atau pelepah kelapa sebagai pengganti minah, keluh Ainsyah, warga Desa Meue,Trienggadeng. (b09)

Warga Simpang Mamplam Tewas BIREUEN (Waspada): Zamzami, 35, warga Desa Blang Mane II Meunasah, Kec. Simpang Mamplam tewas tergilas L-300 dalam kecelakaanlalulintasdiJalinsumBireuenkawasanDesaCotKeutapang, Kec. Jeumpa, Jumat (13/1). Kronologis laka lantas yang merenggut korban jiwa Zamzami, pada hari naas itu Zamzami mengendarai sepeda motor Supra X 125 BL 5820 ZI berboncengan dengan Agus Supriadi berangkat dari Simpang Mamplam menuju Lhokseumawe untuk mengurus paspor ke kantor Imigrasi Lhokseumawe. Namun dalam perjalanan setiba di kawasan Desa Cot Keutapang, Kec. Jeumpa di depan Masjid Ridha Cot Keutapang saat menyelip melewati mobil pick-up didepannya tiba-tiba dari arah berlawanan bertabrakandenganmobilpenumpangL-300BL1904ABdikemudikan M Nur asal Takengon. Melihat kejadian itu warga langsung memberikan pertolongan kepada kedua korban dan dilarikan ke RSUD Dr Fauziah untuk mendapat pertolongan medis. Setelah beberapa saat Zamzami beradadiUGDRSUDDrFauziahakibatmengalamilukakritiskepalanya pecah tergilas L-300 Zamzami tidak tertolong. (b12)

Ruko Dan Bank BCA Nyaris Ludes Terbakar T. TINGGI (Waspada): Satu rumah toko (ruko) dan gedung BCA di Jalan OK Alimpia dan Jalan Sudirman, Kota Tebingtinggi nyaris ludes terbakar, Jumat (13/1) malam sekira pukul 21:00. Menurut informasi yang diperoleh, kobaran api tiba-tiba menyembul dari ruko milik Kho Hua alias Dedi Chandra, 45, yang berada persis di belakang gedung Bank BCA. Kobaran api yang disusul dengan kepulan asap tebal keluar dari dalam ruko itu membuat warga sekitar dan warga yang melintas di jalan tersebut geger. Lokasi kejadian langsung menjadi ramai oleh ratusan warga yang ingin melihat kejadian. Tim pemadam Pemko Tebingtinggi, petugas dan tim tagana yang datang kemudian terlihat sibuk memadam api. Tiga unit mobil kebakaran yang diturunkan sempat kesulitanuntukmenjangkaulokasikarenasaatkejadianJalanSudirman sedang padat Camat Tebingtinggi Kota, Sri Imbang Jaya ketika dikonfirmasi mengatakan, api diduga berasal dari alat pemanas dingin untuk kamar mandi. Karena saat kejadian pemilik rumah sedang tidak berada di tempat sehingga api dari alat pemanas tersebut semakin lama semakin membesar. (a11)

Tim Dokter Keluarkan Proyektil Peluru Korban Tembak Di Bireuen BIREUEN (Waspada): Tim dokter RSUDZA Banda Aceh sukses operasi mengeluarkan proyektil peluru yang bersarang di tubuh Hasan, 35, asal Jawa Tengah korban luka tembak di Desa Blang Cot Tunong, Kec. Jeumpa Bireuen, 31 Desembewr 2011. Operasi yang dilakukan tim dokter RSUZA Banda Aceh, Jumat (13/1)Alhamdulillahberjalanlancardansuksesmengeluarkanproyektil peluru di tubuh korban memakan waktu sekitar 20 menit. Sumber yang diperoleh Waspada di RSUD Dr Fauziah Bireuen, Sabtu (14/1) mengatakan, operasi yang ditangani spesialis Konsultan Bedah Digestif dr Jefri, SpBKBD sukses mengeluarkan proyektil peluru dari tubuh Hasan korban luka tembak di Blang Cot Tunong Bireuen menjelang pergantian tahun baru 2012. Setelah dilakukan operasi mengeluarkan proyektil peluru, kondisi Hasan pekerja galian Telekomsel di Desa Blang Coit Tunong, Kec. Jeumpa Bireuen kini sudah berangsur membaik. Dikatakan, saat pertama kali korban terkena tembakan mengalami pendarahan hebat akibat proyektil mengenai bagian levernya. Masa kritis itu sudah terlewati karena operasi awal sudah dilakukan tim dokter RSUD Dr Fauziah Bireuen. Operasi mengeluarkan proyektil peluru yang masih bersarang di tubuh Hasan untuk mencegah infeksi yang akan timbul terhadap korban nanti. (b12)

Warga Keluhkan Air PDAM Keruh Bila Musim Hujan BLANGKEJEREN (Waspada): Sejumlah warga mengeluh dengan kondisi air bersih PDAM Tirta Aih Sejuk ketika hujan turun airnya seringkeruh,merekamenudingpetugaskurangmelakukanperawatan dan pemeliharaan terhadap fasilitas penunjang yang ada, seperti pipa. “Setiap hujan turun kondisi air PDAM itu selalu keruh, terpaksa air yang sudah ditampung harus dibuang kembali karena airnya berwarna kuning dipenuhi bercampur dengan tanah,” demikian dikatakan Naldi warga pengguna PDAM Air Bersih Tirta Aih Sejuk, Sabtu ( 14/1). Menurutnya, dengan kondisi air yang kurang baik itu, ia jadi khawatir untuk menggunakan fasilitas air minum itu. “Terus terang melihat kondisinya saya jadi enggan menggunakannya, terutama untuk minum atau masak. Habis airnya kekuningan dan sedikit berlumpur. Kalau tak percaya ayolah kita cek ke rumah saya bila di musim hujan tiba,” ajaknya. Hal senada juga disampaikan Ida, bila peristiwa ini dibiarkan berlaur-larut dipastikan bagi masyarakat yang mengkonsumsi dapat mengganggu kesehatan seperti diare dan mual-mual, karena kualitas air itu tidak memenuhi standar untuk PDAM. Maka perlu disarankan kepada pengelola PDAM Tirta Aih Sejuk untuk merehabilitasi kembali kualitas air itu. Sementara Kepala PDAM Tirta Aih Sejuk, Arizal Gusnar, SE, belum dapat dikonfirmasi karena tidak berada di tempat. (cjs)

Bentrok Berebut Lapak, 1 Tewas STM HILIR (Waspada): Diduga memperebutkan wilayah tugas pengamanan (lapak), dua kelompok bersenjata tajam, bentrok di Desa Pondok Baru, STM Hilir, Deliserdang, Jumat (13/1) sore. Akibat bentrok itu, Helvan Fauzi Nasution, 25, warga Dusun I, Desa Petangguhan, Kec. Galang, Deliserdang, tewas diduga dianiaya di depan SD Inpres Desa Pondok Baru. Selain itu, 6 unit sepedamotor ditemukan dalam keadaan rusak di Dusun IV, Desa Pondok Baru. Informasi diperoleh, dua kelompok berselisih karena kedua kelompok sama-sama mengklaim lahan PTPN II Tanjungmorawa yang berada di Pondok TB Limau Mungkur adalah lahan di bawah pengamanan mereka, sesuai dengan kontrak kerja dengan PTPN II Kebun Limau Mungkur.\ Sebelumnya, sekira pukul 15:00, sebuah kelompok menyerang kelompok lain yang berada pada bangunan/mess di Dusun Pondok TB, Desa Lau Barus Baru, STM Hilir yang biasanya digunakan sebagai posko oleh kelompok lain. Akibat penyerangan itu, bangunan/mess itu rusak, sedang beberapa orang dari kelompok yang diserang melarikan diri. Selang beberapa jam kemudian, terjadi serangan balasan dari kelompok yang sebelumnya diserang ke sebuah posko di Dusun IV, Desa Pondok Baru, STM Hilir. Beberapa pria yang berada di posko itu langsung melarikan diri, namun enam unit sepedamotor yang diduga milik yang diserang dirusak. Diduga tidak puas, selanjutnya kelompok yang menyerang, mencari kelompok lawan dengan menyisir sepanjang jalan di Dusun IV Desa Pondok Baru. Saat disisir, Helvan Fauzi Nasution bersama empat temannya sedang berada di salah satu warung di simpang tiga Dusun IV, Desa Pondok Baru. Melihat kelompok lawan datang, Helvan Fauzi Nasution bersama empat temannya langsung lari untuk menyelamatkan diri. Saat melarikan diri, Helvan Fauzi Nasution bersembunyi di dalam salah satu kelas SD Inpres Desa Pondok Baru. Ternyata tempat korban Helvan Fauzi Nasution diketahui kelompok lawan sehingga Helvan langsung dianiaya secara beramai-ramai, hingga tewas di depan SD Inpres tersebut. Kapolsek Talun Kenas AKP Julianus Tarigan membenarkan. Kini pihaknya sedang mengadakan pengamanan di seputar lokasi yang bertikai serta menyelidiki pelaku penganiayaan terhadap Helvan Fauzi Nasution. (c02)


A4 Banyolan

WASPADA Minggu 15 Januari 2012


Kelas Bahasa Indonesia.... Kelas yang tadi ribut-ribut tanpa guru, kini menjadi sunyi. Guru Bahasa Indonesia yang paling ditakuti telah masuk ke dalam kelas. Wajahnya garang seperti harimau kelaparan. Murid-murid: Selamat pagi, Bu Guru! Bu Guru (dengan suara melengking): Mengapa bilang selamat pagi saja, Kalau begitu siang, sore dan malam kalian mendoakan saya tidak selamat ya? Murid-murid: Selamat pagi, siang dan sore Bu Guru... Bu guru: Kenapa panjang sekali? Tidak pernah orang mengucapkan selamat seperti itu! Katakan saja selamat sejahtera, kan lebih bagus didengar dan penuh makna? Lagipula ucapan ini meliputi semua masa dan keadaan. Murid-murid: Selamat sejahtera Bu Guru! Bu guru: Sama-sama, duduk! Dengar baikbaik!! Hari ini saya mau menguji kalian semua tentang lawan kata atau antonim kata. Kalau saya sebutkan perkataannya, kamu semua harus cepat menjawabnya dengan lawan katanya, mengerti? Murid-murid: Mengerti Bu Guru... Guru: Pandai! Murid-murid: Bodoh! Guru: Tinggi! Murid-murid: Rendah! Guru: Jauh! Murid-murid: Dekat! Guru: Berjaya! Murid-murid: Menang! Guru: Salah itu! Murid-murid: Betul ini! Guru (geram): Bodoh! Murid-murid: Pandai! Guru: Bukan! Murid-murid: Ya! Guru (mulai pusing): Oh Tuhan! Murid-murid: Oh Hamba! Guru: Dengar ini... Murid-murid: Dengar itu... Guru: Diam!!!!! Murid-murid: Ribut!!!!! Guru: Itu bukan pertanyaan, bodoh!!! Murid-murid: Ini adalah jawaban, pandai!!!

Guru: Mati aku! Murid-murid: Hidup kami! Guru: Saya rotan baru tau rasa!! Murid-murid: Kita akar lama tak tau rasa!! Guru: Malas aku ngajar kalian! Murid-murid: Rajin kami belajar bu guru... Guru: Kalian gila semua!!! Murid-murid: Kami waras sebagian!!! Guru: Cukup! Cukup! Murid-murid: Kurang! Kurang! Guru: Sudah! Sudah! Murid-murid: Belum! belum! Guru: Mengapa kamu semua bodoh sekali? Murid-murid: Sebab saya seorang pandai! Guru: Oh! Melawan, ya??!! Murid-murid: Oh! Mengalah, tidak??!! Guru: Kurang ajar! Murid-murid: Cukup ajar! Guru: Habis aku! Murid-murid: Kekal Kamu! Guru (putus asa): O.K. Pelajaran sudah habis! Murid-murid: K.O. Pelajaran belum mulai! Guru: Sudah, bodoh! Murid-murid: Belum, pandai! Guru: Berdiri! Murid-murid: Duduk! Guru: Bego kalian ini! Murid-murid: Cerdik kami itu! Guru: Rusak! Murid-murid: Baik! Guru (stres): Kamu semua ditahan siang hari ini!!! Murid-murid: Dilepaskan tengah malam itu!!! Muka Bu Guru merah padam dan tanpa bicara lagi mengambil buku-bukunya dan keluar ruangan. Murid-murid merasa lega kerana guru yang paling ditakuti oleh mereka telah keluar. Walau bagaimanapun, mereka merasa bangga karena telah dapat menjawab semua pertanyaan tadi.

Gunakan angka 0 sampai 9 ditambah dua abjad -- A dan B -- untuk mengisi kotak-kotak kosong. Tidak boleh ada pengulangan angka dan huruf pada lajur mendatar dan menurun, serta di dalam kotak 4x3 bergaris tebal. Tidak ada keterlibatan matematika, hanya perlu pertimbangan dan logika. Gunakan pensil dan penghapus pada awal pencarian angka pengisi kotak, sebelum menuliskan angka yang benar dengan pulpen. Tingkat kesulitan: sedang (***). Tersedia hadiah Rp. 50.000,- untuk seorang pemenang. Antar kupon yang sudah terisi angka yang anda yakini benar ke kantor Waspada Jalan Brigjen Katamso 1 Medan paling lambat Jumat. Peserta dari luar kota bisa mengirimnya melalui faksimile ke (061) 4510025. Jawaban dan pemenangnya dimuat pada edisi Minggu (15/1). ------------------------------------------- potong di sini ----------------------------------------------


B 3 5 B

4 9 A 3

A 5 2

3 7

B 6

9 5 8 2

A 3 4 1 5 8 6 6 0 3 B A B 1 A

7 A 9 4 2 B 7 5 6 4

7 9 B 4 6

1 3

A 4

A 5 9

2 0 B 7

5 6 2

07.00 07.30 08.00 08.30 11.00 12:00 12.30 13.00 15.00 15.30 18.00 19.00 21.00 22.30

07.00 07.30 08:00 09:30 10.30 11.00 11:30 12:00 14.30 15:30 16:00 17.00 17.30 18.00

Alamat: ................................................

TTS Berhadiah Jawab dan gunting TTS Berhadiah di atas kemudian kirimkan ke PT Harian Waspada Jalan Brigjen Katamso No.1 Medan/Jalan Letjend Suprapto No.1 Medan. Tulis nama dan alamat lengkap serta nomor pengenal. Jawaban paling lambat diterima Jumat 20 Januari 2012, pukul 16:00. Bagi pengirim yang dapat menjawab semua pertanyaan dengan tepat dan benar akan diberi hadiah berupa uang tunai sebesar Rp50.000,-untuk satu orang pemenang. Semua jawaban yang benar akan diundi. Pengumuman pemenang akan diumumkan pada Minggu 22 Januari 2012 beserta jawaban yang benar di halaman yang sama. Hadiah dapat diambil di kantor Harian Waspada bagian Sekretaris Redaksi (jam kerja), setelah tiga hari pengumuman pemenang diterbitkan. MENDATAR


1. Negeri sakura 5. Bunga khas Jepang 10. Alat tumbuk yang terbuat dari kayu 11. Hampa udara, kosong 12. Nyenyak 13. Mungil 14. Penduduk asli pulau Bali 15. Bambu 16. Tidak muda lagi 18. Semut (Inggris) 21. Pendidikan Anak Usia Dini 22. Biaya,upah,bayaran 24. Adik 25. Khayalan 27. Penyambungan besi dengan cara dibakar 28. Wanita yang melahirkan kita 31. Satu 32. Air yang meluap dan mengalir deras 34. Anak dara 36. Belum jinak 38. Untuk, kepada (Inggris) 39. Manusia pertama 40. Kartu Tanda Penduduk 41. Manchester United 42. Indra perasa 44. Ujung tangan atau kaki yang beruas-ruas 47. Gambar, peta atau foto kecil yang terdapat di dalam koran, peta atau foto yang lebih besar 48. Ikhtisar suatu pelajaran 49. Pekerja kasar 50. Tidak dapat melihat

1. Jaring ikan 2. Anggun, mewah 3. Kembali kerumah 4. Narapidana 5. Pedang panjang dari Jepang 6. Damai, cocok 7. Kredit Usaha Tani 8. Lambang mata uang negara Mauritania 9. Rombongan (pasukan) kapal perang 11. Lewat 16. Permukaan bumi/lapisan bumi paling atas 17. Undang-undang Dasar Sementara 19. Tenaga Kerja Indonesia 20. Tali perut 21. Tiang penyangga 22. Seni melipat kertas 23. Melumur, melumas 26. Gerakan kencang butiran-butiran (tanah dan bebatuan) yang sesuai dengan arah angin 29. Nakal, bandel 30. Abang (Padang) 32. Bachelor of Art 33. Knock out 35. Hari raya China 37. Ikatan Penasehat Hukum Indonesia 38. Ikut 40. Lambang mata uang kuwait 43. Kata tunjuk untuk benda yang jauh 44. Pukulan pendek dalam olahraga tinju 45. Sisa pembakaran 46. Nabi ke-24





....................................................... ....................................................... Kode Pos . . . . . . . . .

No. KTP/SIM : ................. --------------------------------------------- potong di sini --------------------------------------------

2 B 9 8 1 7 0 4 5 6 A 3

7 3 1 0 9 6 8 A B 5 2 4

4 0 A 2 5 B

1 3 6 8 9 7

6 8 B 9 1 8 7 A 2 5 5 0 3 4 6 A 4 1 5 9 3 6 7 B A 4 3 2 8 0 2 9 6 3 7 9 1 5 0 B 7 2 8 A 4 B A 9 7 2 0 B 4 1 3 1 5 0 6 8

5 4 7 3 8



2 0 1 6 9

0 9 B 6 2 5 4 8 1 3 7 A

07:00 Hotwheels Battle Force 07:30 Bakugan Battle Brawlers Gundalian 08:00 Pokemon D&P 08:30 Batle Spirit 09:00 Ben 10: Ultimate Alien 09:30 Inazum Eleven 10:00 Fairy Tails 10:30 Bleach IV 11:00 Gintama 11:30 Highlight Liga Seri A 12:00 Music Bank 13:30 Drama Asia 15:00 KISS Sore 16:00 Fokus Sore 16:30 Bedah Warung 18:00 FTV Spesial Laga Kolosal 20:00 Buaya Show 22:00 Sinema TV

06.30 09.00 09.30 10.30 11.00 12.00 13.00 15.00 16.30 17.00 19.00 20.00 22.00 23.00

Apa Kabar Indonesia Sarapan Pagi Tinju Legendaris Soccer One Prediksi Live News Kabar Siang Damai Indonesiaku Motocross 2011 Sport File Live News Kabar Petang Apa KAbar Indonesia Malam Indonesia Lawyers Club Live News Kabar Malam Documentary One

Pemenang TTS Berhadia Minggu Lalu



Disney Club : Fish Hook The Garfield Show Upin & Ipin Spesial Grebek Nusantara Mata Pancing Pelesir Sidik Kasus Layar Kemilau Indahnya Sore Inspirasi Sore Petualangan Didi Tikus Animasi Spesial Liburan Ceria Animasi Spesial The Owl Nono Forest Shaun The Sheep Sinema Utama Keluarga Music Special Sinema Pilihan

gunting di sini

Khairul Hadi, Jl Medan-B. Aceh No. 78 Manyong Cut Sp 3 Meureudu, Pidie


22.00 23.30

No. KTP/SIM/Kartu Pelajar: ..............................

Pemenang Sudoku Berhadia Minggu Lalu


18.30 19.00 20.00

Nama: ..................................................

Larva Crayon Sinchan Doraemon DAHSYAT Infotainment Intens Seputar Indonesia Siang PR Agama Kristen Barbie As The Princess And The Pauper Seputar Indonesia IPL Dewa Binar Bening Berlian Mega Sinetron : Anugerah Box Office Movie : The Punisher

A 3

1 2 7 0 9 5 6 3 4 8

6 8


4 1 A 7 9 0 5 B 2

Joko Susesno, Security PT Tolan Tiga Indonesia


08.00 08.30 09.00 10.00 12.00 13.00 13.30 14.00 14.30 15.00 15.30 16.00 17.30 18.00 18.45 21.00 22.30

Fairly Odd Parents Menggapai Bintang Mong Chiken Little Awas Ada Sule Gadis PEtualang Teenlicious Ill Feel American Funniest Video Bola Dalam Berita Berita Global MTV 100 % Fokus Selebriti Spongebob Indonesia Premier LEague Big Movies Barclays Premier League

07:00 09:00 10:00 12:00 12:30 14.30 15.00 16.00 16.03 19.00

SCTV Musik : Inbox Hot Shot SCTV FTV Pagi SL Liputan 6 Siang SCTV FTV Siang Status Selebriti Hip Hip Hura Liputan 6 Petang Hip Hip Hura SCTV Sinetron Aliya 20.00 SCTV MUsik Indonesia Boy & Girl Band Indonesia 22.30 SCTV FTV Utama

06:30 Hati Ke Hati Bersama Mamah Dedeh (Live) 07:30 Wooow‌! 08:00 Friends 09:00 Dr.Brady Barr 09:30 Srimulat Junior 10:00 Kampung Gajah 10:30 BP3TI 11:00 Forum Kita 11:30 Topik Siang (Live) 12:00 Klik ! 13:00 Sinema Siang 15:00 Mantap (Live) 16:00 Topik Petang (Live) 16:30 Fenomania 17:00 Warkop Series 18:00 Pesbukers (Live) 19:00 Tawa Sutra Coooyyy‌ 20:00 Deal Or No Deal 21:30 Most Incredible Moments 22:00 Sinema Indonesia 00:00 Worlds Most Amazing Videos IV 00:30 Topik Malam (Live) 01:00 Lensa Olah Raga Malam (Live)

07.05 08.30 09.30 10.05 11.05 13.30 14.05 15.30 16.05 17.05 18.30 19.05 20.05 21.05 22.05 23.05 23.30

Dunia Kita Agung Sedayu Agung Sedayu Showbizz Oprah Winfrey e Lifestyle Rachael Ray Show Kick Andy Kick Andy Metro Hari Ini Metro This Week Mario Teguh Just Alvin! Democrazy Zona Memori Journalist on Duty Metro Sports

07:30 08:30 10:00 10:30 11:00 12:00 12:30 13:00 13:30 14:30 15:00 15:30 16:00 17:00 17:30 18:00 19:00 21:00 23:00 00:00

Ranking 1 Derings Ngulik IBU Insert Reportase Siang Jelang Siang Bingkai Berita Ceriwis 86 Keluarga Minus Sketsa Happy Family Reportase Sore Insert Sore Jika Aku Menjadi Comedy Project Bioskop TransTV Kakek-Kakek Narsis Bioskop TransTV

TRANS 7 07.30 08.00 09.30 10.30 11.00 11.30 12.00 13.30 14.00 15.00 16.30 17.00 19.00 21.00 22.00 23.00

U2 Tabir Sunnah Happy Holiday Jalan Jalan Selebriti Asli Enak Redaksi Siang Selebrita Galeri Sepakbola One Stop Football Mancing Mania Redaksi Sore Paradiso Gara gara Magic Pas Mantab Mister Tukul Theater 7 Spesial **m31/G

Medan Metropolitan

WASPADA Minggu 15 Januari 2012


Dirjen BUK Kemenkes RI:

Rumah Sakit Di Indonesia Hadapi Masalah Besar MEDAN (Waspada): Seluruh rumah sakit di Indonesia se-dang menghadapi masalah be-sar, yakni hilangnya kepercayaan masyarakat terhadap pela-yanan kesehatan di rumah sakit. Hal ini menjadi salah satu pe-nyebab tingginya minat mas-yarakat untuk berobat ke luar negeri. “Bagaimana masyarakat kita tidak berobat ke luar negeri, kalau wajah pelayanan keseha-

tan kita lebih mengedepankan administrasi dan kurang peduli terhadap pasien,” kata Dirjen Bina Upaya Kesehatan (BUK) Kemenkes RI Dr. Supriantoro, Sp.P, MARS saat membuka Pelatihan Sistem Penanggulangan Gawat Darurat Terpadu (SPGDT) di RSUP. H. Adam Malik Medan, Sabtu (14/1). Menurutnya, saat ini laju pasien berobat ke luar negeri cukup banyak, ini tidak hanya

terjadi di Sumut tetapi juga di kalangan masyarakat di Jakarta. “Kita harus akui kalau kita kalah bersaing dengan negara tetangga kita. Kita kalah bersaing bukan karena dokternya lebih bodoh, bukan karena fasilitas kese-hatan kita jelek, tetapi kita kalah dalam service dan pelayanan,” jelasnya. Dalam mengatasi hal ini, dia meminta kepada seluruh rumah sakit untuk lebih peduli

Satu Rumah Di Jalan Puri Terbakar MEDAN (Waspada): Satu rumah semi permanen di Jalan Puri Gang Irama Lingkungan III Kelurahan Kota Matsum Kecamatan Medan Kota, Sabtu (14/ 1) sekira pk 09.00 WIB terbakar. Tidak ada korban jiwa dalam peristiwa itu namun kerugian diperkirakan mencapai pulu-han juta rupiah. Informasi yang diperoleh di kepolisian menyebutkan rumah yang terbakar itu milik Yusnaini ,60, diduga api berasal dari arus pendek. Sebelum kejadian cucu Yusnaini sedang bermain Play Station sedangkan dirinya sedang memasak nasi di dapur dengan menggunakan Magic com, tibatiba dari belakang rumah sudah terlihatkepulanasapdengancepat

1 CM 2 CM

Rp. 12.000 Rp. 24.000

si jago merah melalap bagian rumahyangditempatiolehempat kepala rumah tangga ini. Sementara itu kepala lingkungan setempat Yani mengatakan korban mengalami kerugian puluhan juta rupiah, namun dirinya menyebutkan di rumah Yusnaini yang berstatus janda hanya mengalami kebakaran rumah 60 persen, tidak keseleruhan rumah tersebut ludes terbakar.”Yang terbakar hanya bagian belakang rumahnya saja.Tidak ada korban jiwa.” ucap Yani di lokasi kebakaran. Petugas Dinas Pencegah dan Pemadam kebakaran (DP2K) Kota Medan menurun dua unit mobil pemadam keba-karan, kurang lebih sekitar 25 menit api

3 CM Rp. 36.000 4 CM Rp. 48.000


5 CM 6 CM



Gadis & Janda utk bekerja sebagai jaga anak dan orang tua di Medan, Gaji/ honor 750 s/d 1,2 Jt/ bulan Hub. Pak Jov 0812.6553.5559 or 0821.6552.4355 Start Belajar: 16 Januari 2012

9 CM Rp. 126.000 10 CM Rp. 140.000


Carry Pick Up DP 9 Jt-an Bonus: DVD Audio Kc. Film Mega Carry... DP 14 Jt-an &Aksesories APV Arena..... DP 14 Jt-an Splash........... DP 12 Jt-an Hadiah Kc. Film, Parking Swift ST.......... DP 16 Jt-an sensor&accesories SX-4...............DP 23 Jt-an Proses cepat, Data dibantu & dijemput Hub. 0852.6114.6499 - (061) 9110.0699



(Tatanan Properti Real Estate)

TOYOTA Kijang Super G Merah Metalik, Short 95. P. Steering, P. Window, AC DB, Body kaleng, jok mulus, mesin sehat, tape DVD, Siap pakai. Harga 68Jt. Lihat dulu baru Tawar. Hub. 0812 6568 818 /77305875

selama 36 bln, Tanpa DP Bunga 0% Uk: 15x20: 300m² Setiap bulan Rp. 1 Jt, 350 Rb






: : : : :

Bursa Automotive

Air Condition Ban Radial Central Lock Nippon Denso Double Blower


: : : : :

Power Stearing Power Window Radio Tape Velg Racing Electric Window


All New Xenia DP 15%, Terios DP 20Jt-an, PU DP 8 Jt-an. Luxio, Sirion, Program Hebat dr DAIHATSU. Hub. IQBAL - ASTRA 0813 61007 907 - 0853 6103 1609


All New Xenia - Terios - Sirion - Luxio Luxio - Gran Max Pick Up/Minibus Cash - Credit - Tukar Tambah Proses Cepat - Ready Stock Hub. DIKA (061) 77443877 - 0852 7074 7744



GEBYAR PROMO DAIHATSU 2012 DP Nego Pick Up DP 7 Jt-an Angs. 2 Jt-an Luxio All New Xenia DP 23 Jt-an Angs. 3 Jt-an Terios DP 22 Jt-an Angs. 4 Jt-an Sirion DP 24 Jt-an angs. 4 Jt-an Hub: IRNANDA 0813 7580 2895 / 0821 6761 2659. Proses Cepat, Full Discount.

DAIHATSU Taruna Thn 2002, Warna Silver Metalik, Tape FGX Mobil siap pakai HP. 0812.6000.9496 - 0813.6169.2005 DIJUAL

Salah satu Isuzu Panther Tugas Kita Th. 93. AC, Tape, PS, VR, Tangan pertama. H.43Jt. Nego. dan Civic Wonder Th. 87. AC, Tape, P. Window, mulus, orisinil, siap pakai. H. 28Jt. Nego. Hub. 081 361 430 619 - 061. 777 80 896

BUTUH DANA Jaminan Apa Saja. Sertifikat Tanah Mobil & Sp. Motor. Segala tahun. Hub. 061.8222 774 HP. 0853.6199.1500-0816 314 1807




Informasi Pembaca Bursa Property

G R : Garasi LB : Luas Bangunan KM : Kamar Mandi LT : Luas Tanah KP : Kamar Pembantu RM : Ruang Makan KT : Kamar Tidur RT : Ruang Tamu SHM: Sertifikat Hak Milik

Tinggal 6 kapling, Sekarang bisa kredit

10x35: 350m² Setiap bulan Rp. 1 Jt, 600 Rb Lokasi dpn terminal angkot Mars 70, Hanya 70, Hanya 500m dari Jl. Gatot Subroto Km. 13,8 Ktr Camat Sunggal Hub. 0819.9904.4051 Fax. (061) 7634.8232 Tanpa perantara



KENANGA CITI HOTEL My Residence in Medan

Jl. Sisingamangaraja No. 82 Medan Telp. (061) 734.2106



Dr Robert Valentino Tarigan SPd ketika menyampaikan pendapatnya didampingi Brilan Moktar SE (tengah depan) dan Agus.

Gerakan Pramuka Wadah Pendidikan Karakter MEDAN (Waspada): “Latihan fisik dan mental yang diajarkan di Pramuka (Praja Muda Kirana) sasaran akhirnya adalah kepekaan dan tanggap akan situasi,” tegas dr Robert Valentino Tarigan SPd Pimpinan BT/BS BIMA Indonesia yang berpusat di JalanBantamNo6ASMedanpada kegiatan Lomba Perkema-han Pramuka se-Sumatera Utara, (5/ 1) malam di lokasi Pekan Raya Sumatera Utara (PRSU) Medan. Lomba perkemahan itu diselenggarakan dari 4-7 Januari sekaitan dengan HUT Gudep 13.471-13.472 Pramuka Universitas Negeri Medan. Menurut Robert Valentino, kekuatanfisikdanmentalituakan

Kost VIP Jl. Laksana No. 102 Medan Kota, Lokasi Strategis banyak R. Makan, M. Market, Laundry, Sktr Kost, ±500m dari Yuki S. Raya/ Amaliun Foodcort. 2,5 Km dari Bandara Polonia, Mingguan & Bulanan Hub. 0811.631.234 0813.6221.3622/ 736.4014


S u r a t T a n a h a / n : Tu m b a k Tarigan Jl. Pintu Air VI/6. RT 00 RW 07 Nop. Antara Peringgan Simp. Kuala. Bagi yang menemukan harap Hub. 0813 7505 477. Tidak akan dituntut, diberi imbalan sepantasnya.

Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput



BPKB Spd. Motor Yamaha BK 3612 OT A/n. JANATU. Alamat Jl. Komp. PTPN IV Lingk. VI Kel. Besar. No. Rangka MH35TL2068KI88660. No. Mesin 5TL - 1188438 HILANG/TERCECER BPKB mobil Honda Jazz BK 412 Y a / n . H A R R Y S A H AT M A R U L I ARITONANG. Alamat Jl. Nilam Raya No. 135-B Kel. Mangga Medan No. Rangka: MHR GD 37208J701377 No mesin: L15AZ - 4007123

Pelanggan Yang Terhormat

HA TI-HA TI terhadap penipuan yang HATI-HA TI-HATI mengatas namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk membeli TI-HA TI apabila produk anda, dan HA HATI-HA TI-HATI anda ingin melakukan transaksi jual beli melalui transfer. Segala akibat yang terjadi diluar tanggungjawab PT. Harian WASPADA. Apabila anda mencurigai sesuatu, silahkan hubungi kami di 061-4576602. Terimakasih


Surat Penyerahan Penguasaan Atas Tanah dengan ganti rugi, No. 592.2/ 62/PRB/2008, Tgl. 31-01-2008, A/n. Mukhsin Ibrahim. Yg terletak Desa Sei Buluh Kec. Perbaungan, Luas 184m²




FORUM KOMUNIKASI PARANORMAL DAN PENYEMBUHAN ALTERNATIF INDONESIA IZIN DEPKES. 448/15830 - IZIN KEJATI No. B270/DSP5.08 1. Gendam Asmaradhana (Solusi Kilat) Problem asmra dan rumah tangga 2. Gendam pedotshih (pemutus hubungan asmara dan perselingkuhan PIL dan WIL) 3. Puter Giling (menarik/ memanggil orang yang minggat, kabur) Insya Allah, Suami, Istri atau Pacar dalam waktu singkat akan kembali dengan cepat 4. Asmara Gay/ Lesby/ Hypersex 5. Susuk aura, pemikat, pemanis, pengasihan, kecantikan dan ketampanan 6. Penglarisan dagang, kedai, rumah makan/ restoran jual beli tanah dgn cepat GARANSI 7. Penyembuhan segala macam penyakit medis SAMPAI - non medis (kutukan, keturunan, bawaan dan guna-guna) TUNTAS 8. Keluhan khusus pria (ejakulasi dini dan impotensi) Pengobatan/ penyembuhan bisa jarak jauh

BUKA TIAP HARI DARI PUKUL 08.00 Wib s/d 23.00 WIB Jl. Amaliun, masuk Jl. Nusantara No. 4 Medan (Belakang Hotel Madani SM. Raja di depan Kantor MUI) HP. 0813.6246.7777 0821.6397.9999


RUMAH dan Tanah Permanen Dijual, Uk. 19,75mx11,5m Jl. Makmur Gg. Amal Tembung, SK Camat Hub. 0853.5917.0575 - 0853.5917.0545 - 0813.9644.8515


Setelah sukses di propinsi di Papua, kini hadir di kota Medan, pengobatan nyata luar biasa, bila anda ingin perkasa, ingat jangan salah informasi disini yang pasi ±30 menit kami akan buktikan alat vital menjadi besar dan perkasa. Dengan metode pengurutan disekitar alat vital melalui totok urat-urat kejantanan. Kami tidak mengumbar janji belaka. Tdk ada efek samping, bebas utk semua agama. Bukan janji tapi bukti ditempat


MEDAN: Jl. Serdang Gg. Sado 43B, Tempuling Medan, Sumatera Utara Telp. (061) 6634.2201

Laboratorium Klinik 24 Jam Alat Otomatis Hasil Cepat, Teliti dan Tepat MEDILAB Mitra Kesehatan Keluarga




Hati, Ginjal, Kolesterol, Glukosa, Asam Urat, dll. Check-Up 4 Orang, Gratis 1 Orang Persiapan : Puasa 10 - 12 Jam Laboratorium Klinik Medilab



Tepi Jalan besar, Jl. Banteng Simpang Jl. Budi Luhur (± 300 masuk depan Pomp Bensin Gatot Subroto Tapian Daya), SHM. 24,5x28,5m Rp. 900 Jt Hub. 0853.


Jl. Jamin Ginting No. 194 Medan, Telp. 8361040



Jl. Kpt. Muslim/ Jl. Bakti Luhur Medan, Posisi sudut No. B-1 (7x12m), 2 Tingkat, 3 KT, 2 KM, SHM, 1300 watt, PAM, Row 10 mtr, Security 24 jam Hub. 0821.6434.0856

penanggulangan bencana alam. “Gerakan Pramuka tidaklah sekadar berkemah tetapi membentuk SDM jadi sebuah pribadi yang tanggap. Saya bisa seperti sekarang ini tak terlepas dari Pramuka,” tutur Brilian yang menamatkan SD hingga SMA di Jambi. Pada kesempatan itu,Valentino menceritakan tentang Bapak Pramuka Dunia Baden-Powell yang dilahirkan di Paddington, London pada 1857. “Di bawah usaha gigih Baden Poell, gerakan Pramuka dunia berkembang. Pada tahun 1922 terdapatlebihdarisejutaPramuka di 32 negara; pada tahun 1939 jumlahPramukamelebihi3,3juta orang,” imbuhnya.(m25)




Hub. (061) 7781.0174 - (061) 788.2825

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

menemukan kesempur-naanya dengan moralitas. Jika ada tetangga yang mendapat kesulitan,Pramukayangbaikakan berusaha membantunya sedaya mungkin. Seiring dengan itu, Brilian Moktar SE yang ikut Pramuka sejak Siaga, Penggalang menekankan,gerakanPramukasu-dah punyaUndang-Undang.“Karena saat ini pendidikan ka-rakter yang paling baik ada di gerakan Pramuka,” tegas Ben-dahara Fraksi PDI Perjuangan DPRD Sumut Komisi B. Brilian mengingatkan, jika Pramuka dimobilisasi, akan memungkinkan SDM (sumber daya manusia)nya ikut serta dalam

Penanganan khusus pria: - Memperbesar, panjang, keras, kuat dan tahan lama - Kencing manis, diabetes, L. syahwat - Ejakulasi dini/ impotensi Khusus Wanita: - Memperbesar/ kencang payudara - Ingin punya keturunan/ gurah vagina - Ingin kembali perawan/ keputihan Konsultasi umum - Ajian semar mesem/ buka aura - Penglaris/ penghasihan/ cari jodoh - Pasang susuk, karir/ jabatan

DIJAMIN 100% Alamat Jl. Halat / Masuk Jl. Senam No. 19C. Belakang Makam Pahlawan H P. 0 8 2 1 . 6 6 5 5 . 1 2 2 2

Ingin Promosikan Produk Anda Harian

WASPADA Media yang Tepat untuk Iklan Anda




Jl. Karya Bakti No. 57 Pangkalan Masyhur, Luas: 1400m², SHM, Ada IMB, Bangunan induk, 4 KT, Dapur, Tempat cuci pakaian dan jemur, Garasi untuk 2 mobil dan Spd. motor, Kamar tidur Supir, Gudang, Dua ruang praktek atau Pos satpam di bagian depan, Lantai keramik, Telepon, Internet, Zincolum genteng, KM Bath tub dan shower (2 Kmr), Plafon gypsum, Perabotan lemari kayu. Harga 2.2M (Bisa Nego)

11 CM Rp. 165.000 12 CM Rp. 180.000


Dibutuhkan 2 orang tamat Sarjana Hukum yang belum dan sudah Berpengalaman untuk bekerja di kantor Notaris dan PPAT di Kab. Samosir Hub. 0813.9716.4443

Jl. M. Nawi Harahap No. 23B Medan (dekat Simpang Limun) Tgl. 16 s/d 18 Januari 2012. Pukul 10.30-14.00 WIB. CEPAT & MENDESAK !!!


Rp. 91.000 Rp. 104.000

Bebas banjir, Jalan komplex 7 mtr, bisa selisih 2 mobil, Ada 373 Kapling, SK Camat,

Untuk pembukaan kantor baru, perusahaan industri & managemen bisnis buka cabang di Medan, membutuhkan SDM Potensial untuk posisi: ADM/ STAF, GUDANG, PEMBUKUAN, RESEPSIONIS, SUPERVISOR, WAKIL & KEPALA CABANG, syarat: - P/W Single, usia max. 27 thn - Pend. minimal SMU/ SMK sederajat - Tidak sedang bekerja, pengalaman tidak diutamakan - Mengikuti pelatihan (ada karir, bukan kerja kontrak) - Mandiri - Bagi pelamar dari luar kota disediakan mess Segera datang langsung, bawa lamaran lengkap ke:


7 CM 8 CM


TOYOTA Corona Mark II Thn. 81/82 W. Hitam AC, TP, VR, BR Hrg. 17Jt. Hub. 0821 6407 6474


tem kesehatan di daerah-daerah, ini diakibatkan oleh otonomi daerah. “Sistem komando tidak berjalan, karenanya koordinasi akan kita perkuat dengan memanggil seluruh jajaran kesehatan kab/kota untuk berdiskusi setiap tiga bulan sekali,” katanya. Dikatakannya, untuk mengurangi masyarakat berobat ke luar negeri, Dinas Kesehatan Propinsi Sumatera Utara akan mengembangkan pelayanan kesehatan tradisional (yankestra) melalui akupuntur dan obat-obatan dari bahan baku herbal. “Permasalahan kesehatan kita masih banyak, untuk itu mari kita perkuat SDM kesehatan kita, meningkatkan sarana dan prasarana untuk meminimalisir orang berobat ke luar negeri,” katanya. Menghadapi masalah besar ini, RSUP H. Adam Malik meng-gelar pelatihan Sistem Penanggulangan Gawat Darurat Terpa-du (SPGDT). Adapun peserta dari Dinkes Medan, Dinkes Su-mut serta beberapa petugas rumah sakit se Sumut. “Mari kita tumbuhkan semangat untuk mengikuti pelatihan ini dengan baik,” ujar Dirut RSUP HAM dr. Azwan Hakmi Lubis, Sp.A, MKes.(h02)


Rp. 65.000 Rp. 78.000



di rumah semi perma-nen berhasil dijinakkan. Di tempat terpisah, satu unit mobil KIA Picanto dengan Nomor Polisi BK 1088 CN yang dikendari oleh Icha Warga Jalan Manunggal, Kecamatan Labuhan Deli Kabupaten Deliser-dang ludes terbakar di Jalan Hel-vetia Rayapersisinyadipersim-pangan Zipur Medan, Sabtu (14/1) sekira pk 13:30. Penyebab kebakaran mobil tersebut diduga karena arus pendek pada mesin mobilnya. Seorang warga menyebutkan,percikanapiterlihatkeluar dari bagian mesin mobil. Api sen-diri tampakmarakdikapbagiandepan mobil tersebut. (h04)

terhadap pasien, karena membentuk kepedulian itu bukan upaya yang memerlukan biaya banyak, tetapi cukup dengan hanya membangun komitmen di seluruh petugas di rumah sakit. “Dengan peduli kepada pasien, saya yakin kita bisa merebut kembali kepercayaan masyarakat untuk berobat di dalam negeri,” katanya sembari meminta birokrasi di rumah sakit tidak mengedepankan administrasi, serta meminta pihak manajemen harus sering-sering memonitoring SDM yang ada di rumah sakit. Sementara itu, Kepala Dinas Kesehatan Sumut Candra Syafei menambahkan, lambatnya penegakkan diagnosa di rumah sakit juga menjadi alasan masya-rakat Sumut berobat ke luar negeri. “Banyak orang berobat ke luar negeri, karena kepastian yang didapat masih lemah. Harusnya, apabila ditanya, dokter cepat menjawab, seperti sakit apa, diagnosanya, apa obatnya, kapan dilakukan tindakan, berapa hari. Ini merupakan kelemahan-kelemahan kita,” katanya. Selain itu, katanya, masalah lainnya adalah pelemahan sis-




Terapi keperkasaan seksualitas Pria hasil permanen tanpa efek samping, alami, bebas pantangan, untuk semua usia Hasil langsung reaksi ditempat, cukup satu kali berobat


Panjang: 13, 14, 15, 16, 17, 18, 19, 20 cm Besar: 3,5. 4,5. 5. 5,5. 6 diameter Memperkeras, Tahan lama Ejakulasi dini, Mani encer Impotensi, Lemah syahwat Diabetes, kencing manis/ batu

Juga melayani problem asmara, mempercepat jodoh, pengasihan, penglaris, buka aura, pasang susuk, dll ALAMAT KELINIK TETAP: Jl. SM. Raja Masuk ke Jl. Utama No. 18 Medan Dari Toko Roti Majestik ±100meter Izin Kejaksaan: B/DSP.5/12/2008 Izin Dinkes: No. 448/0649/I/2008 HP. 0812.6388.7999 Buka setiap hari


Dengan H. TEJA SAEFUL Cucu Asli Mak Erot Bersama


BILA anda ingin perkasa ingat jangan sampai salah masuk carilah yang benar-benar pewaris ilmu Mak Erot Sejati, karena keahlian H. Teja Saeful sudah tidak diragukan lagi dalam menangani keluhan seputar alat vital bahkan pengobatan H. Teja Saeful, sudah terkenal Indonesia dan kota-kota besar di Indonesia, sudah ribuan pasien tertolong dipengobatan Mak Erot ini yang aman tanpa efek samping, bahkan dimanca negara sekalipun pengobatan Mak ERot sudah tidak diragukan lagi keberhasilannya. INGAT untuk Kaum Pria jangan sampai Anda terhina Kaum wanita karena kondisi alat vital yang kurang sempurna Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041 KONSULTASI UMUM: KHUSUS PRIA: - Buka Aura - Ejakulasi dini - Cari Jodoh - Impotensi - Sesama jenis - Memperbesar “Alvit” - Pelaris - Memperpanjang “Alvit” - Memikat lawan jenis - Keras dan tahan lama dll - Besar PYDR KHUSUS WANITA: - Ingin punya keturunan - Memperkencang & memperbesar payudara - Mengobati keputihan dll

DIJAMIN 100% Hanya Tempat Kami Klinik Mak Erot Jl. Laksana No. 55J masuk dari Jl. Amaliun Yuki Simpang Raya Medan (Praktek Tetap) HP. 0 8 1 2 . 4 0 3 8 . 3 3 3

Mau Menjual Rumah, Tanah, Kendaraan, Barang Kerajinan Tangan atau Barang Dagangan Lain? Ya Tentu...Pasang Iklan di... Surat Kabar Tercinta:


WASPADA Untuk informasi lebih lengkap hub

TEL. (061) 4576602 FAX. (061) 4561347


A6 5 Gadget Unik Dari CES masing perusahaan memamerkan produk terbaru dan paling mutakhir, ada televisi portabel, gitar plastik, kompor dan sarung e-reader tenaga surya. Berikut lima gadget unik yang menurut CNN menarik untukdisiarkanpadamasyarakat: Nest Thermostat Selama ini, termostat (alat pengukur suhu) rumah lebih

Dyle juga akan dimasukkan dalam ponsel Android Samsung berikutnya untuk MetroPCS.

Gadget Tinke, yang dihubungkan ke bagian bawah iPhone, akan memberitahukan detak jantung, siklus pernapasan dan tingkat oksigen dalam darah Anda.

Tas musik ini berisi stereo portable dengan komponen canggih.

Nest termostat memiliki dial elegan sederhana yang berubah biru saat pendinginan dan oranye saat penghangatan.

sering berfungsi sebagai aksesoris belaka. Dengan warna putih atau krem,termostatmenyatudengan dindingdanhanyamendapatkan perhatian ketika seseorang merasa perlu untuk mengubah suhu ruangan. Dengandialelegansederhana, alat ini berubah biru saat mengubah suhu ruang menjadi dingin danoranyesaatinginmenjadikan kamar terasa lebih hangat, Sarang Termostat digital baru ini mencoba untuk mengubah kesan biasa saja. Jika terlihat seperti produk buatan Apple, itu karena Sarang Termostat ini dirancang oleh mantan pejabat eksekutif Apple, Tony Fadell, orang di balik tampilan iPod. “Kami ingin menampilkan disainsederhananamunmenarik untuk dilihat,” ujar Ahli Laboratorium pembuat Nest, Kristin Bickett. Alat ini membantu penggunanya menghemat energi karena memiliki sensor pelacak gerak yang mendeteksi ketika orang memasuki atau meninggalkan ruangandanmenyesuaikansuhu ruangan. Gadget ini juga bisa merekampemakaianlistrikAnda, sehingga Anda bisa menghemat energi. Ketika alat itu terhubung keWi-Fi, maka alat itu mengunduh pembaruan perangkat lunak secara otomatis. Dan jika Anda malas, Anda dapat mengontrol secara nirkabel dari sofa Anda lewat telepon Anda atau tablet. Nest Termostat Ini dijual seharga $ 249 dan tersedia di toko-toko penjual alat pemanas dan pendingin ruangan atau di Marley Bag of Rhythm “Kami memperkenalkan kembali tape dari tahun 80-an!” kata juru bicara House of Marley, Karen Korponai dengan wajah sumringah. Tas musik ini cukup banyak muatannya - stereo portabel dengan komponen tercanggih dilengkapi dengan kayu kemas yang mulus serta sandaran iPhone/iPod–semuabisamasuk dalam tas tenteng dari bahan kanvas ini. Tas ini bisa Anda bawa ke pantai, ke pertemuan resmi atau hanya untuk santai sambil mendengarkan musik dan lagu di tempat favorit Anda. Tas ini juga dilengkapi dengan baterai isi ulang yang tahan sampai lima hingga enam jam. Tas music ini dijual seharga $300ketikadipasarkanpadabulan Februari, kata Korponai. House of Marley, perusahaan yang juga membuat earbud dan headphone, dioperasikan di bawah kemitraan dengan keluarga almarhum Bob Marley. Salah seorang putranya, Rohan Marley, hadir pada CES untuk membantu mempromosikan produk tersebut. Dyle TV Tuner Sebuah perangkat baru yang disebut Dyle dapat menghidupkan TV di ponsel Android, iPhone, atau iPad. Alat terbuat


ditampilkan layar televisi ini lebih cerah karena terbuat dari empat warna pixel, sehingga gambar terlihat lebih alami dan akurat dibanding televisi OLED lainnya. Setiap pixel mengeluarkan warna merah, hijau, biru dan putih, bukan merah/hijau/biru seperti digunakan dalam pixel televisi OLED lain dan sebagian besar televisi yang diproduksi saat ini. Layar televisi OLED (Dioda Penghasil Cahaya Organik) sebenarnya bukan hal baru, namun tentu ada inovasi-inovasi baru yang diembannya, misalnya: sampai sekarang, masih sulit untuk menciptakan layar dengan ukuran sebesar itu, dengan harga yang wajar dan tahan lama. Yang menjadi masalah sekarang: LG belum mengumumkan kapan layar televisi ini tersedia di pasaran, berapa

harganya atau sampai berapa lama televisi tersebut akan bertahan. Atau jangan-jangan ini hanya sekedar pameran produk yang tidak akan pernah bisa dipajang di rumah para konsumen? Namun, dari pantauan CNN, LG benar-benar serius dalam memproduksi tv OLED. Perusa-haan ini menginvestasi 226 ju-ta dolar pada pertengahan ta-hun 2010 untuk menciptakan fasilitas produk baru, sehingga meningkatkan tiga kali lipat kapasitas OLED. Banyak perusahaan lain yang membisikkantentanglayarOLED. Sebenarnya layar tv OLED yang lebih kecil sudah dilempar ke pasaran, sekalipun dengan harga cukup tinggi. Misalnya jutaan smartphone (ponsel cerdas) sudah menggunakan layar OLED. Fakta yang menjanjikan: la-



Penggunaan jejaring sosial seperti Facebook meningkat di negara berkembang disbanding di negara kaya.



Hawaii Kepulauan shall Marshall


Bom terbang terkendali


Ion Audio menampilkan produk baru berupa gitar plastik dengan alat baru yang disebut Gitar Apprentice. dari plastik seukuran gabus ini memiliki jackheadphonediujung kawat pendek, yang menutupi antena sehingga bisa menangkap sinyal TV digital. TransmisiTV nirkabel ini bisa disalurkankerumah-rumahyang tidak berlangganan tv kabel. Itu berarti tidak ada biaya bulanan, dan menonton video selama berjam-jam tidak akan menambah mahal biaya seluler. Mobile Content Venture (MCV), perusahaan yang dibentuk selama bertahun-tahun oleh raksasa media seperti Fox Broadcasting dan NBC Universal, membuat layanan tv mobile. Perusahaan ini mengharapkan orang akan mengakses TV dari ponsel mereka di samping untuk semua konten on-demand yang tersediasecaraonline.Siaranoverthe-air Dyle hanya terbatas pada 12 saluran atau chanel. MCV dan Belkin International, yang membuat aksesoris itu tidak bersedia mengumumkan harga atau tanggal pasti alat tersebut dilepas ke pasaran. Keterangan lebih rinci akan disampaikan dalam beberapa bulan mendatang, kata Moreno. Dyle juga akan dimasukkan dalam ponsel Android Samsung berikutnya untuk MetroPCS, sebuah prototipe yang telah diperlihatkan MCV pada pameran sebelumnya. Sebuah antena logam dapat diperpanjang dari bagian atas ponsel untuk meningkatkan daya penerimaan sehingga membuat penggunanya serasa melangkah keluar dari mesin waktu tahun 1992. Guitar Apprentice Activision Blizzard, perusahaan penghasil“Guitar Hero” menutup operasionalnya setahun lalu, namun perusahaan pembuat peralatan Audio Ion memperlihatkan produk baru

berupa gitar plastik dengan alat baru yang disebut Apprentice Guitar. Tubuh gitar bergaya-Gibson memiliki slot di papan suara untuk memasukkan iPad. Menggunakan aplikasi pendamping, pemetik Gitar Apprentice dapat menggerakkan jari-jari mereka di senar gitar virtual sambil memegang tombol pada setiap fret sepanjang leher untuk memainkan nada-nada musik. Tombol-tombol tersebut akan menyala guna mengajari pemula dalam menempatkan jari pada tempatyangtepatuntukmemetik setiap senar. Gitar Apprentice akan dijual dengan harga $ 99 pada bulan Juni atau Juli, kata seorang juru bicara Ion. Tinke Vital-Signs Monitor Seperti beberapa gadget kesehatan serupa, monitor Tinke adalah alat kecil dengan sensor yang dihubungkan ke bagian bawah iPhone. Tidak seperti perangkat kesehatan lain, Anda tidak harus meletakkan penjepit di jari Anda untukmembacatanda-tandavital pada diri Anda. Cukup hanya dengan menempatkan ibu jari Anda pada sensor Tinke selama 60 detik, ia akan memberitahukan detak jantung, siklus pernapasan dan tingkat oksigen dalam darah Anda. Moniter Tinke juga akan menyimpan data Anda pada ponsel Anda sehingga Anda bisa memantau detak jantung atau pernafasan dalam hitungan jam atau hari. ProdusenZensorium,sebuah perusahaan berbasis di Singapura, berencana meluncurkan gadget ini pada pertengahan 2012 dan menjualnya dengan harga sekitar $ 100. * Syafri/CNN

Seorang jubir LG memperlihatkan layar tv OLED berukuran 55 inchi. yar raksasa OLED bisa dicetak ke atas permukaan yang sangat tipis dengan menggunakan proses serupa mesin cetak inkjet, sehingga secara teori akan membuat biaya produksinya lebih murah dibanding layar LCD dan plasma saat ini. Dan layar ini memiliki masa respon jauh lebih cepat, dengan

rata-rata penyegaran yang bisa mencapai 100.000 Hz.Warnanya lebih cerah, lebih cas dan fleksibel. Dengan memilikinya maka Anda memiliki televisi masa depan,danpertanyaannyabukan tentang seberapa besar ukuran tv yang tersedia dan harganya, tapi kapan tv tersebut tersedia di pasaran. * Syafri/CNN

Penggunaan SMS Jadi Fenomena Global MASYARAKAT di negaranegara miskin dan berkembang mengirimkan pesan teks atau sms lebih banyak daripada orang-orang di negara-negara kaya. Laki-laki di Spanyol dan Jerman mengakses internet pada ponsel mereka dua kali lebih banyak dibandingkan dengan kaum wanitanya. Menggunakan situs jejaring sosial online meningkat secara dramatis di Mesir dan Rusia selama beberapa tahun belakangan ini. Hal ini disebabkan perubahan kondisi politik yang terjadi di negara-negara tersebut. Data-data di atas merupakan hasil dari satu laporan baru yang menyelidiki penggunaan komunikasi digital di 21 negara. Survei ini dilakuan Pew Research Center’s Global Attitudes Project yang menemukan bahwa penggunaan sms sekarang ini tersebar menjadi fenomena global. Di banyak negara 75 persen pemilik ponsel mengakui mereka lebih menyenangi menggunakan pesan pendek. Di sebahagian besar negarnegara yang disurvei menunjukkan penggunaan situs jejaring sosial semacam Facebook dan Twitter tidak banyak berubah dari tahun 2010 sampai 2011.

Laut Bering

A S I AHipersonik

OLED TV Terbesar Di Dunia PERUSAHAAN elektronik Korea LG menimbulkan gejolak di seluruh dunia ketika mengumumkan pembuatan televisi OLED seukuran 55 inci minggu lalu, dan sekarang perusahaanitumemperkenalkan dua gambaran baru yang memperlihatkan kepada Anda kelebihan-kelebihan dari jenis televisi ini. Jika Anda pernah melihat layar OLED, Anda akan mengetahui betapa indahnya warnawarna yang ditampilkan televisi ini.DanlayartelevisiOLEDsangat tipis. Lihat pada gambar, tv yang Anda lihat tersebut tebalnya hanya 4 milimeter – perhatikan pada sisi kanan gambar dan Anda akan melihat jari wanita tersebut mengarah pada ujung layar. Pada blog resminya LG UK, LG mengatakan warna yang

Apakah Masih Ada Ujicoba Senjata Di Atol Kwajalein?


TERMOSTAT sederhana pada abad ke-21. Begitu juga halnya dengan tas musik unik (benda ini wujud berkat andil seorang putra sang legendaris reggae Bob Marley, Rohan Marley). Dua gadget tersebut termasuk di antara sekian gadget yang dipamerkan pada International Consumer Electronics Show (CES) untuk tahun 2012. Di ballroom hotel masing-

WASPADA Minggu 15 Januari 2012

Kecuali dua negara seperti Mesir dan Rusia dimana 28 persen responden saat ini menggunakan media sosial meningkat dari 18 persen dari tahun lalu, sementara Rusia dimana pemakai situs jejaring sosial meningkat dari 33 sampai 34 persen dari tahun sebelumnya. Facebook dan perangkat jejaring sosial lainnya memainkan peran penting dalam revolusi yang menumbangkan presiden Mesir Hosni Mubarak Februari lalu. Para demonstran mengorganisasikan diri secara efektif di media sosial yang mendorong pemerintah Mesir menutup internet selama lima hari dalam satu percobaan untuk menghentikan aksi unjuk rasa masyarakat, namun tidak berhasil. Para peneliti mengatakan situs jejaring sosial juga telah membantu memobilasi para demonstran di Moskow beberapa waktu lalu dimana puluhan ribu demonstran memenuhi jalanan guna memprotes pemilihan parlemen yang dituduh tidak jujur. Survei Pew menemukan bahwa hanya enam persen pengguna internet di Rusia bukan anggota media online. Para pengamat menghasilkan data survei itu dengan cara bertanya langsung atau

melalui telepon pada musim semi lalu pada 700 responden di Jepang dan lebih dari 4.000 di India. Di antara penemuan survei yang lain seperti Indonesia dan Kenya, penggunaan sms sangat memasyarakat di mana 89 sampai 96 persen masyarakat Indonesia mengatakan mereka secara beraturan menggunakan sms. Sebaliknya, 67 persen orang Amerika Serikat jarang menggunakan sms. Di Spanyol, 29 persen kaum pria pemilik ponsel menggunakan perangkat teknologi mereka untuk mengakses internet diban-dingkan 13 persen wanita peng-guna internet. Sementara laki-laki di Jerman menggunakan ponsel mereka untuk mengakses internet sebanyak 26 persen, sedangkan kaum perempuan pengguna internet sebanyak 11 persen. Di Turki sebesar 30 persen laki-laki pemilik ponsel memakai ponsel mereka untuk mengakses internet, sementara wanitanya sebesar 14 persen. Situs jejaring sosial umumnya lebih biasa digunakan di negara-negara kaya. Survei membuktikan orang-orang di negara kaya memiliki peringkat lebih tinggi mengakses internet. * Nurhayati Baheramsyah/CNN


tol (rangkaian pulau karang) Kwajalein, bagian dari Kepulauan Marshall, berada di 3.700 kilometer barat laut Hawaii. Atol itu lokasi pertempuran utama antara tentara AS dan Jepang dalam Perang Dunia II. Menjelang invasi Amerika ke Kwajalein, atol itu dihujani lebih dari 36.000 peluru meriam dalam pemboman paling bom hebat dalam perang Pasifik. Setelah perang, atol itu menjadi lokasi militer tempat AS mengendalikan Operasi Crossroads, program ujicoba senjata nuklir. Ketika ujicoba nuklir berkurang pada 1960-an, fasilitas di Kwajalein dialihkan untuk ujicoba rudal anti balistik. Lokasi itu sekarang berperan sebagai salah satu stasiun

pengendali engendali bumi untuk Sistem Posisi Global (GPS). (GPS) Awal 2011 senjata generasi baru muncul si Kwajalein. Senjata Hypersonik Canggih, peluru kendali berkecepatan lima kali kecepatan suara yang belum diberi nama, diluncurkan dari Kepulauan Hawaii dan mencapai atol itu dalam waktu kurang dari 30 menit. Peluru kendali itu menggunakan roket pendorong tiga tingkat dan mencapai sasaran di mana saja di muka bumi ini dalam waktu satu jam. Peluru kendali hipersonik yang diujicoba ditembakkan dari Hawaii, mencapai lapisan atas atmosfer sebelum jatuh dengan kecepatan 6,000 km per jam dan mencebur ke Pasifik dekat Kwajalein.

Bill Pitzer - • Copyright © 2012 The New York Times Syndicate

Kondisi Televisi 3D Tahun 2012 TELEVISI 3-D disebutsebut sebagai terobosan teknologi Consumer Electronics Show (CES) tahun 2010. Terlebih-lebih ketika James Cameron merilis film ‘Avatar’ dalam versi tiga dimensi, HDTV 3D menjadi populer secara global. Setahun kemudian pada pertunjukan CES tahun 2011, 3-D muncul lagi. Para pengamat melihat HDTV 3D menjadi lebih besar dan pertunjukan tiga dimensi tidak membutuhkan kacamata khusus namun mampu melihat tayangan 3D dengan baik. Kini timbul pertanyaan bagaimana kondisi tv tiga dimensi di tahun 2012 ini ? Para pengamat menyarankan agar produsen tv tiga dimensi meninjau ulang segala sesuatunya tentang produknya. Banyak hal yang membuat pemasaran HDTV 3D terkendala di pasaran yaitu opini masyarakat bahwa nonton film-film tiga dimensi tidak harus di rumah, namun lebih baik di bioskop. Pandangan ini menjadi problem karena tayangan-tayangan tiga dimensi sebenarnya tidak hanya dapat disaksikan di layar lebar, tapi juga dapat disaksikan di rumah melalui HDTV 3D. Opini yang ini tentu saja merusak pemasaran televisi high definition itu. Masalah lain yang meliputi tv tiga dimensi ini adalah harganya mahal, program tayangan kurang berkualitas dan penggunaan kacamata tiga dimensi yang tidak menyenangkan menjadi penyebab tv 3D mengadopsi hanya satu digit penjualannya di seluruh dunia. Produsen tv ini dan provider sedang bekerja untuk menghilangkan imej ini. Pada tahun 2010, konsumer membeli 1,1 juta unit tv 3D, meskipun penjualan meningkat dalam dua tahun sejak perilisannya, tapi penyebaran tv tiga dimensi tidak memasya-

rakat. Menurut laporan January Display Search lebih dari 23 juta tv tiga dimensi dipasarkan pada tahun 2011 dengan hanya 3,6 juta disebarkan di Amerika Serikat. Paul Gagnon, analis dari Display Search mengatakan bahwa penetrasi rumahtangga di AS untuk tv tiga dimensi sekitar tiga persen. Diperkirakan tv 3D hanya mendapat penjualan yang signifikan selama 18 bulan, maka mengapa penetrasi tv itu begitu rendah bahkan lebih rendah dari yang diharapkan pihak produsen, kata Gagnon. Pemasaran seperti di China dan Eropa Barat terlihat jauh lebih antusias untuk tv tiga dimensi jika dibandingkan dengan pasar Amerika Utara, namun secara global adopsi pemasaran hanya kurang dari dua persen. “ Kita telah berulangkali mengecewakan penonton tv ini dan karena itu saya kira, masalah yang terjadi dengan pemasaran tv tiga dimensi karena adanya ketidakpercayaan yang abadi. Sementara satu setengah tahun lalu ada motivasi, antusiasme dan penghargaan untuk group pertama penonton filmfilm 3D yang biasanya menonjolkan kualitas,” kata Jeffrey Katzenberg, bos animasi Dreamworks pada satu interview dengan The Hollywood Reporter. Setelah ‘Avatar’ memang tidak ada film tiga dimensi yang bermutu dan menarik seperti film ‘Clash of the Titans’. Namun ketika film ‘Tron : Legacy’, ‘Tin Tin’ dan ‘Hugo’ direkayasa dalam tiga dimensi telah memperbaiki imej tentang tayangan 3D kembali. Baru-baru ini ada 55 canel 3D di seluruh dunia termasuk ESPN 3D. Sekitar 35 canel tiga dimensi lain menawarkan permintaan tayangan tiga dimensi. Jika tayangan dan ketidaknyamanan menonton tayangan tiga dimensi jadi problem terbesar penonton, hal itu menjadi berita buruk bagi produsen tv ini. Sebab itu,

pihak produsen melakukan usaha-usaha terbaik untuk mereformasi tv 3D yang mampu menyenangkan konsumer. Misalnya, jika sebelumnya menonton tv tiga dimensi mengenakan kacamata tiga dimensi yang mahal dan tidak menyenangkan, belakangan ini produsen merekayasa tv 3D tidak menggunakan kacamata tiga dimensi lagi. LG malah membuat kacamata tiga dimensi dengan harga terjangkau dan dibuat agar dapat dipakai dengan nyaman yaitu lebih ringan dan modis. Kacamata khusus 3D tidak menyakitkan kepala dan menimbulkan rasa penat yang diderita penonton tayangan 3-D juga diciptakan. Apapun alasannya, studi baru-baru ini mengindikasikan konsumer lambat laun mulai menyenangi tv tiga dimensi. Laporan dari Digital Entertaiment Group menemukan bahwa mayoritas pemilik tv 3D mengatakan pengalaman mereka positif. Sekitar 88 persen pemirsa tv tiga dimensi yang disurvei menyatakan kualitas gambar baik dan 85 persen pemilik tv tiga dimensi lebih suka menyaksikan lebih separuh program dalam tiga dimensi. Ketika harga tv 3D mulai terjangkau, kualitas tayangan tv tiga dimensi harus dijaga dan diperbaiki. Kacamata 3D hendaknya lebih nyaman dikenakan atau pihak produsen hen-daknya merekayasa tv tiga dimensi yang bebas memakai kacamata khusus untuk itu. Jika usaha-usaha semacam itu dilakukan dapat dipastikan penjualan tv tiga dimensi akan meningkat. Peningkatan penjualan 50 persen tv 3D dapat diproyeksikan untuk tahun 2014 dan 2015. * Nurhayati Baheramsyah/cnn

TV 3 Dimensi semakin diminati konsumen.Or better still, visualize her pseudo dance of the seven veils in the Return of the Jedi in holographic 3D. Sadly, this will NOT catch on in the mainstream until it the porn industry demands it. Computers, internet, etc. anything that jas not gotten buy in from the porn makers, goes by way of the dodo. Sad, but true. less



15 Januari 2012


Persiraja Kembali Berbagi Angka BANDA ACEH (Waspada): Persiraja belum lepas dari puasa kemenangan. Lini depan skuad Laskar Rencong belum pulih, meski para pecinta menyatakan haus akan nilai penuh saat tampil di kandang sendiri. Pekan keenam lanjutan Indonesian Premier League (IPL) 2011/2012 di Stadion Harapan Bangsa, Banda Aceh, Sabtu (14/ 1), berakhir imbang. Patrick Ghigani dkk harus puas berbagi angka dengan tim Singo Edan Arema dengan skor 1-1. Menjamu Arema, Erik Saputra dkk tampil lebih baik dari pertandingan sebelumnya. Terbukti semangat tanding skuad racikan Herry Kiswanto itu mampu mengimbangi mantan juara LigaIndonesiamusim2009/2010.

Persiraja menutup babak pertama dengan keunggulan 10. Gol kemenangan dipetik dari titik putih. Hadiah penalti diberikan wasit Daryanto setelah gelandang Persiraja Patrick Ghigani dijatuhkan Gunawan Dwi Cahyo di area kotak terlarang. Sang kapten, Abdollaye Djibrilsuksesmengeksekusitenda-ngan 12 pas di masa injury time, setelah sepakanpemainberpasporGuinnea itu tak mampu dibendung Kurnia Meiga, meski dia sempat menyentuh bolanya. 1-0.

Penampilan apik Andria dkk di babak pertama tidak menular ke babak kedua. Bahkan, sebaliknya, Legimin Raharjo dkk menguasai penguasaan bola.Tak jarang, Putra Habibi dkk berani membangun serangan ke area pertahanan Persiraja. Kolektivitas tim tamu pun tidak sia-sial. Berawal dari kesalahan barisan pertahanan bawah Persiraja,RomanCameloberhasil menyamakan skor 1-1. Tendangan Camelo pada menit 56 tak mampu dihalau kiper Zulbahra. Dalam kondisi imbang 1-1, tuan rumah lebih meningkatkan lagi tensi serangannya. Namun mandulnya barisan penyerang, membuatskor1-1bertahanhingga pertandingan berakhir.

Tambahansatupoininimembuat Pasukan Singo Edan yang dibesut pelatih Abdurrahman Gurning mempertahankan status sebagai salah satu tim yang belum terkalahkan dalam kompetisi IPL 2011/12 ini. Sementara satu angka bagi tuanrumah,kianmenambahrekor seri bagi Persiraja. Hingga kini, LaskarRencongsudahmengoleksi enam poin, tiga kali seri dan sekali menang serta dua kali kalah. “Kitasudahtampilmaksimal. Apalagi di atas kertas, Arema satu tingkat di atas Persiraja. Anakanak sudah tampil penuh tanggung jawab,” kata Asisten Pelatih Persiraja,MamanSuryaman,usai laga. Diamengakuicukuppuasde-

ngan hasil imbang, bila mengacu padakedalamanskuadSingoEdan. “Tapikitatidakinstruksikanpemain untuk bertahan di babak kedua setelahunggul1-0.Merekatakbermain seperti babak pertama, ini akankitaevaluasilagi,”katamantan Pelatih Persikabo Bogor ini. Sedangkubutimtamucukup puas juga dengan hasil imbang. “Saya salut dengan permainan tuan rumah yang mengandalkan kecepatan. Hasil satu poin sudah maksimal bagi kami,” kata Pelatih Arema IPl, Rahman Gurning. Dia mengakui, semua tim di IPL bagus-bagus dan memiliki kedalaman skuad. “Tidak ada tim di liga ini yang jelek, semua punya karakter bagus,” tukas mantan pelatih PSPS Pekan Baru itu. (b07)

PSAP Kontra Persipura ‘Tanding Siraturrahmi’

Waspada/Muhammad Riza

BEBERAPA pemain Persipura melakukan uji coba lapangan Stadion Kuta Asan, Sigli, Sabtu (14/1) pagi. Hari ini, Minggu (15/1) sore tim berjuluk Mutiara Hitam akan menghadapi tuan rumah PSAP Sigli.

Harga Tiket Mencekik Leher SIGLI(Waspada): Harga tiket masuk guna menyaksikan PSAP kontra Persipura Jayapura di Stadion Kuta Asan, Sigli, Pidie,Minggu,(15/ 1) dinilai mencekik leher dan tidak manusiawi. Untuk tribun tertutup dijual Rp 50.000/lembar dan terbuka dijual Rp.30.000. Tingginya harga jual tiket tersebut, menyebabkan ribuan publik Kuta Asan pendukung tim tuan rumah mengeluh. Ketua suporter Laskar Aneuk Nanggroe (The LAN) untuk PSAP Zukhri, MA mengatakan, harga jual tiket yang telah ditetapkan tersebut oleh Panitia Pelaksana (Panpel) perlu segera ditinjau ulang. Sebab, harga tersebut sangat melambung dan sulit dijangkau masyarakat Pidie yang mayoritas berpenghasilan menengah ke bawah. MenurutZukhri,yangdidampingiSekjenThelanT.MuklisBenzema, harga tiket masuk senilai Rp 30.000 untuk tribun terbuka dan tertup Rp 50.000, sangat memberatkan bagi masyarakat. Padahal, mereka sudah jauh-jauh hari menantikan pertan dingan ini, untuk memberi semangatdandukungankepadatimtuanrumahPSAPyangpadamusim ini promosi di kompetisi paling bergengsi di Indonesia. Apabila keluhan masyarakat ini tidak diperhatikan, maka animo masyarakat untuk menyaksikan langsung pertandingan itu menurun. “Harapan kami ini dengan memperhatikan tingkat ekonomi masyarakat kita. Dan harga tiket PSAP kontra Persipura ini, merupakan harga termahal di kompetisi ISL,” ujar Zukhri. Sekretaris Umum PSAP, Sigli Muklis mengatakan, pada dasarnya pihaknya tidak menaikan harga tiket masuk. “Namun, karena itu sudah menjadi keputusan bersama Panpel dan pengurus PSAP maka harus tetap dilaksanakan,” demikian Muklis. (b10)

SIGLI(Waspada):Minggu(15/ 1) sore nanti, PSAP Sigli akan menjamu Persipura Jayapura di Stadion Kuta Asan, pada laga lanjutan kompetisi Liga Super Indonesia (LSI) musim 2011/2012. Pertandingan ini, tentunya menjadi pertemuan siraturrahmi bagikeduatimyangletaknyasaling berjauhan. Satu dari ujung timur (Persipura Jayapura, red) dan satunyalagidariujungbaratIndonesia (PSAP Sigli, red). Namun, pertemuan kedua tim bersaudara jauh ini,diramalkanakanketatdimana keduatimakantampilalloutuntuk memperoleh poin tiga. Betapa tidak, Persipura yang datang jauh dari ujung timur IndonesiatidakinginpulangkeKota Jaya Pura dengan tangan kosong. Oleh-oleh dari Sigli berupa poin penuh tiga angka menjadi target anak-anak asuhan coach asal Brazil Jacksen F. Tiago. Terlebih,timberjulukMutiara Hitam itu diperkuat oleh beberapa pemain tim nasional, seperti Boaz Salossa, Titus Bonai, Lucas

Mandowen, Ricardo Salampessi, Stevi Bonsavia, serta beberapa pemain lokal lainya yang kualitasnya diatas rata-rata. Lalu ditambah empat pemain asing Persipura seperti AlberthoGonsalfes(Beto)dariBrazil yang berposisi penyerang, Zah Rahan berposisi gelandang asal negara Nigeria, dan bek tangguh asal Camerun Bio Paoulin, serta penjaga gawang asal Korea Yoo Jae Hoon. “ Kita datang ke Sigl jauh-jauh, target menang” tegas Coach Jacksen F. Tiago. Menurut pelatih asal Brazil tersebut, kendati tim asuhanya diperkuat beberapa pemain tim nasional, namun ia tetap merendah seraya memuji beberapa pemain PSAP Sigli yang perlu diwaspadai. Menurutnya, meski tim tuan rumah pada musim ini baru promosi ke ISL, tetapi dengan berhasil menahan imbang Persib Bandung 1-1, di Stadion Sijalak Harupat, Soreang, Bandung beberapa waktu lalu, perlu kerja keras bagi

Saatnya PSAP Belajar Dari Persipura

Kodrat Aceh Peringati HUT IX BANDA ACEH (Waspada): Pengurus Provinsi Keluarga Olahraga Tarung Derajat (Pengprov Kodrat) Aceh merayakan peringatan HUT IX dalam suatu acara sederhana di aula BKPP Aceh, Banda Aceh, Sabtu (14/1). Peringatan HUT kali ini ditandai dengan pemutaran video perjalanan Kodrat Aceh mulai dari berdirinya tahun 2003 hingga sekarang dengan berbagai kendala yang dihadapi dan prestasi yang diraihnya, serta penyerahan cenderamata dari pengurus kepada Ketua Umum Pengprov Kodrat Aceh, Drs. Nuzuli, MS. Dalam sambutannya, Nuzuli menyebutkan, secara pribadi dirinya memberikan apresiasi kepada para pengurus yang telah bekerja keras sehingga tarung derajat bisa masuk dalam jajaran cabor prioritas pertama di KONI Aceh. “Kita cukup berbesar hati. Karena diusianya yang masih seumur jagung, Kodrat Aceh telah berhasil mempersembahkan prestasi yang cukup membanggakan bagi dunia olahraga Aceh,” katanya. Menurut Nuzuli, pada usia setahun, tarung derajat merupakan salah satu cabang yang lolos ke PON XVI, meski saat itu belum berhasil meraih medali. Namun, pada usia 5 tahun, tarung derajat menjadi penyumbang medali terbanyak bagi kontingen Aceh di PON XVII/ 2004 Kaltim. “Terus terang, saya belum pernah melibat cabor yang bisa seperti ini,” imbuhnya. Dengan tekad mempertahankan tradisi emas pada PON XVIII/ 2012mendatang,KepalaBidangKeolahragaanDisporaAcehinimerasa optimis tarung derajat kembali akan membuat kejutan di Riau nanti. “Untuk mewujudkan tekad tersebut, para petarung harus berlatih lebih serius lagi dan tetap menjaga kekompakan,” tegas Nuzuli. Pelatih Utama Kodrat Aceh,Yanyan Rahmat mengatakan, pada PON XVIII/2012 di Riau nanti, Aceh berhasil meloloskan sembilan atletnyadarienamkelasmelaluiKejurnasPraPONyangdilangsungkan di Balikpapan, Desember lalu. Atlet tersebut masing-masing M. Iqbal, Iwan Rahmat, Heni Fitria dan Siti Sarawiyah (Seni GerakTarung Beregu Campuran), serta Adi Sapta Roni, Suhermansyah, Azman Fauza, M. Saepul Anwar (tarung putra), dan Agus Maisurah (tarung putri). (b04)

Problem Catur Hitam melangkah, mematikanlawannya enam langkah.

Jawaban di halaman A2. 8







1 A








anak-anak asuhannya untuk meraih target tiga angka. Terlebih PSAP bermain di Kuta Asan disaksikan ribuan pendukungnya. “ Artinya pemainpemain kami perlu kerja keras untuk mendapat poin dari tour kami ke Sigli,” jelas Jacksen. Lain lagi dengan Pelatih PSAP Sigli Arman, kendati tim tamu Persipura mayoritas diperkuat sejumlah pemain bintang. Namun ia bersama anak-anak asuhannyatidakterpengaruhdengan nama-nama besar tim tamu tersebut. PSAP, kata Arman, yakin mampu mengatasi serangan anak-anak Kota Jaya Pura. Menurut pelatih lokal asal Desa Lampoih, Lada Kec. Pidie tersebut menyatakan seluruh anak asuhannya telah siap menampilkanpermainanterbaiknya dalam usaha mempertahankan poim penuh tiga angka. “ Kita tetap gunakan formasi 3-5-2 menghadapisaudara-saudarakitayang datang jauh dari Kota Jaya Pura.” demikian Arman. (b10)

Waspada/Muhammad Riza

Bintang Timnas Indonesia yang juga kapten Persipura, Boas Salossa terlihat akrab bersama Wakil Bupati Pidie Nazir Adam, pada acara jamuan makan malam di Pendopo bupati Pidie, Jumat, (13/1). SIGLI (Waspada): PSAP Sigli diharapkan dapat belajar pada Persipura Jayapura yang sudah tiga kali menjuarai Indonesia Super League (ISL), dan satu kali Inter Island Cup (IIC) serta SCTV Cup. “ PSAP harus dapat memanfaatkan pertemuan dengan Persipura untuk belajar pengalaman menjadi sang jawara. Ini pengalaman paling berharga bagi anak-

anak PSAP” kata Wakil Bupati Pidi,e Nazir Adam, pada acara jamuan makan malam di Pendopo bupati Pidie, Jumat (14/1). Kehadiran tim elit sekelas Persipura diakui Nazir, memang sangat didambakan oleh jutaan publik Kuta Asan. Sebab pemainpemain tim berjuluk Mutiara Hitam tersebut mayoritas diisi pemain-pemain tim nasional. “Namun yang paling penting dalam

pertemuan ini, bagaimana caranya kita belajar dari mereka untuk menjadi tim juara,” katanya lagi. Bagi masyarakat Pidie umumnya,selamainimerekahanya dapat menyaksikan bintang sepakbolatimnasionalIndonesia di televisi. Namun, kini Boaz Salossa dan kawan-kawan dapat dilihat langsung di Stadion Kuta Asan, Sigli. Hadir pada acara jamuan makan malam tersebut Wakil Bupati Pidie Nazir Adam, Sekda Pidie M. Iriawan, Asisten Tiga Said Muliyadi,KetuaUmumPSAPSigli, MuhammadYasin Amin, Manager PSAP Nazaruddin, Bos PT Liga Indonesia Djoko Driono, Manager Persipura Rudi Masui, Pelatih Persipura Jacksen F.Tiago, Asisten Pelatih Mettu Duaramuri dan seluruh pemain Persipura dan PSAP Sigli. Dalam acara tersebut Wakil BupatiPidieNazirAdambersama jajarannya berphoto bersama pemain Persipura dan PSAP Sigli serta ofisial kedua tim. Dalam kesempatanitu,WakilbupatiPidie juga menyerahkan cindera mata berupa logo Kabupaten Pidie kepada tim tamu Persipura yang diterima Asisten Pelatih Mettuwarapuri. (b10)

Waspada/Munawardi Ismail

Gelandang serang Persiraja, Patrick Ghigani berusaha mengontrol bola dari serbuan lawan, dalam lanjutan pertandingan IPL di Banda Aceh, Sabtu (14/1).

Tontowi/Lili Tersingkir Indonesia Tanpa Wakil Di Final KUALA LUMPUR (Waspada): Indonesia harus menelan pil pahit kedua di awal 2012 dan mengulang kegagalan serupa di Korea Open 2012. Kali ini, wakil Merah Putih Tontowi Ahmad/ Liliyana Natsir tersingkir pada semifinal turnamen bulutangkis Malaysia Open 2012. Tontowi/ Natsir dikandas ganda campuran Cina, Xu Chen dan Ma Jin dalam dua set langsung, 17-21, 14-21. Kegagalan ini membuat Indonesia sama sekali tidak mengirimkanwakilpadapartaifinal,Duta IndonesialainsepertiTaufikHidayatdanMarkisKido/HendraSetiawan gagal di pe-rempat final kemarin. Sebelumnya,pada12Januari, AlventY Chandra/Hendra A Gu-

bolanya dan atletnya. Ini sesuai denganUndangUndangKeolahragaansertaSistemKeolahragaan Nasional (KSN),” katanya. Dalam mekanisme arbitrase itu, lanjut Alifian, akan diketahui siapa yang salah dan siapa yang benar. Jika memang nanti ada

kebijakan-kebijakan yang dianggap tidak memuaskan PSSI pasti akandiketahuidalammekanisme arbitrase itu dan juga akan ada putusan-putusan yang mengikat dan harus diterima seluruh yang bertikai. Sebelumnya, KPSI menca-

Raih Emas Di Kejuaraan Shiroite Karate-do MEDAN (Waspada): Berhasil menyabet medali emas dan perunggu pada Kejuaraan Junior Antar Dojo Shiroite Karate-do di GOR Pasar X Tembung, Deliserdang, Sabtu (14/1), Aja bersaudara, yakni Aja Nuraini Surbakti dan Aja Hanwar Fazri Surbakti termotivasi untuk serius menggeluti cabang olahraga bela diri inidanbertekadmenjadikarateka nasional. “Saya ingin menjadi karateka nasional,” kata Aja Nuraini. Siswa kelasV Sekolah Dasar An-Nizzam ini berhasil meraih medali emas di nomor kumite pra pemula putri di bawah 30kg, setelah mengalahkan lawan-lawannya dari berbagai dojo se-Sumatera Utara. Tekad Nuraini menjadi karateka nasional juga disampaikan abangan, Aja Hanwar Fazri Surbakti. Walaupun memperoleh medali perunggu di nomor kumitepemuladibawah47kgputra, Hanwar yang duduk di kelas 2 SMP An-Nizzam memiliki motivasi tinggi untuk terus bergelut di cabang olahraga bela diri. Kedua abang beradik yang membawa dojo Aan Brother ini sudah hampir dua tahun menggeluti olahraga karate. Kemauan Aja bersaudara ini disahuti positif kedua orang tua, Aja Melhan Surbakti dan Rosmala Dewi Pasaribu. “Saya mendukung bakat ke-

nangkan Kongres Luar Biasa PSSI pada 6 Maret 2012 dengan membawapermasalahanitukeKomisi XDPR.KalanganDPRsendirimenyampaikan kekhawatirannya terhadap kemungkinan konflik sepak bola dibawa ke wilayah politik. (ant/m47)

PS PiJay Matangkan Persiapan MEUREUDU (Waspada) : Guna menghadapi jadwal guliran kompetisiDivisiIPSSILigaAmatir Indonesiamusim2011/2012yang sudah di depan mata, yakni akhir Januari 2012 ini. Tim Laskar Japakeh, PS PiJay terus mematangkan persiapan dengan berbagai latihan di Lapangan Sepakbola Trienggadeng. Menjelang laga menghadapi putaran divisi I musim tahun ini yang direncanakan berlangsung khirJanuari2012secarahomeand away. Manajemen PS PiJay terus meningkatkanporsilatihandibawah kendalipelatihkepalaMulyaPutra yang dibantu dua asistennya. “Anak-anak terus melakukan persiapanmenjelanggulirankompetisi,” kata Sekretaris Umum (Sekum)PSPiJay,HelmiDaudkepada Waspada, Jumat (14/1), PS PiJay melakukanporsilatihanterutama para pemain digenjot teknik dan

fisik. “Saya yakin anak-anak akan bermainpenuhtanggungjawabdan sesuaiharapanbersama,”kataputra Trienggadeng, Pidie Jaya itu. Ketua Umum PS PiJay, Drs. H. Muhammad Gade Salam menyatakan, menghadapi putaran kompetisi divisi I musim tahun ini, PS PiJay semakin serius mempersiapkan diri. Hal ini dibuktikan dengan tidak henti-hentinya melakukan latihan dan memantapkan lini-lini yang masih lemah. Untukmemenuhitekadtembus ke Divisi Utama pada musim tahundepan,PSPiJaybertekadmemenangkan setiap pertandingan atas tim yang menjadi lawannya. Karenanya, PS PiJay terus menggemblengparapemainnyasecara serius.“Selamaduapekanterakhir, parapemainkonsentrasimengikuti latihanpemantapan,“ungkapBupatiPidieJayamenyangkutpersiapan timnya menghadapi Divisi I.

peningkatan. Bahkan mereka harustertinggal3-0diawalsetkedua. Terjadi saling mencuri poin hingga akhirnya skor sama kuat 10-10. Namunsepertidisetpertama,pada situasiinipasanganIndonesiamalah kedodoran, dan membuat pasanganCinadenganmudahmencuri poin hingga me-nang 14-21. Kemenangan tersebut membuat Xu Chen/ Ma Jin melaju ke final dan menciptakan final sesama wakil Cina karena bersua ZhangNan/ZhaoYunLei.Sementara bagi Indonesia, hal ini tentu menjadi pil pahit kedua setelah padaVictor Korea Open Indonesia juga gagal meraih juara, dan sekaligus bukti penurunan prestasi olahraga Indonesia di cabang bulu tangkis. (oz/m47)

Aja Bersaudara Ingin Jadi Karateka Nasional

Menpora Tolak KLB PSSI MAKASSAR ( Waspada): Menteri Pemuda dan Olahraga (Menpora) Andi Alifian Mallarangeng menegaskan, pihaknya menolak Kongres Luar Biasa (KLB) PSSI yang diusung Komite PenyelamatSepakBolaIndonesia (KPSI. “Pemerintah tidak sepakat dengan kongres luar biasa karena kami fokus pada pembinaan dan jangansampaisemuanyaterjebak pada struktur pengurus yang berpolemik,” ujar Andi Mallarangeng di kampus Universitas Muslim Indonesia (UMI) Makassar, Sabtu (14/1). Ia mengatakan, pemerintah sudah lama mengurusi kepengurusan PSSI, maka dari itu dirinya menegaskan akan fokus pada pembinaan kepemudaan dan atlet-atlet yang mengharumkan nama bangsa ini. Salah satu upaya yang ditempuh untuk menyelesaikan polemik di tubuh PSSI yakni dengan cara melakukan arbitrase. Upaya itu dilakukan sesuai denganUndangUndangKeolahragaansertaSistemKeolahragaan Indonesia yakni arbitrase. Langkahtersebutditempuhjikamediasitidakkunjungmembuahkanhasil. “Biarlah kalau ada masalah diantarapengurus,itudiselesaikan lewatarbitrasesehinggakitafokus pada urusan olahraganya, sepak-

nawan dan Angga Pratama/Ryan Agung Saputra gagal di babak kedua.Sementaraitu,pasangangandaputriAnnekeFeinyaAgus-tine/ Nitya Krishinda Maheswari dan pemain tunggal putra Dyonisius HayomRumbakaterpaksaundur diri dari turnamen karena cedera. Sejatinya, Tontowi/Natsir mampu memberikan perlawananketatbagipasanganXuChen/ Ma Jin. Pada permulaan set pertama,terjadikejarmengejarangka yang sengit, hingga akhirnya skor sama kuat 10-10. Mulai dari sini, pasangan Cina tampil tanpa cela dan terus mengungguli wakil Indonesia tanpa bisa terkejar dengan skor 17-21. Padasetkedua,performaTontowi/Natsir tidak mengalami

Menurut dia, berbeda ketika parapemaintampilpadalagadivisi IItahunlalu,dimanamerekatampil maksimaldantanpabeban.Bahkan, permainan anak-anak Pidie Jaya bisa dikatakan sangat menawan. Namun, kata Gade Salam, menghadapi putaran divisi I yang memiliki lawan berimbang dan sangat ketat itu, apalagi target bisa promosi ke Divisi Utama, PS PiJay perlu kerja keras dan serius mempersiapkan tim serta konsentrasi penuh dijalani para pemain, dirinya merasa optimis timnya bisa melangkah ke kasta kedua sepakbola Indonesia. Sementara menurut pelatih PSPiJay,MulyaPutra,menghadapi putarankompetisiDivisiInantipara pemainterusdigenjot.Dimanalatihanlebihditerapkanpadapenguasaansemualinidanpenyerangan, selain tetap melakukan latihan pemantapan fisik. (b09)

duaanaksayainidicabangkarate. Keberhasilan memperoleh medali emas dan perunggu membuktikkan bahwa keduanya memiliki bakat di cabang olahraga bela diri ini,” kata Aja Melhan Surbakti. Melhan yang merupakan mantan pengurus PABBSI Kota Medan berharap keberhasilan kedua buah hatinya ini memperoleh prestasi pada Kejuaraan Shiroite Karate-do merupakan awal untuk mencapai prestasi yang lebih baik lagi di masa mendatang.

Tekad Hanwar dan Nuraini untuk menjadi karateka nasional diakui Melhan akan didukung sepenuhnya. Melhan yang memiliki empat anak ini menambahkan, Hanwar dan Nuraini sering mengikuti kejuaraan. “Mudah-mudahan tekad Hanwar dan Nuraini dapat terwujud,” harap Melhan. Kejuaraan Junior Shiroite Karate-do diikuti sekitar 21 peserta dari berbagai dojo di Sumut seperti Medan, Deliserdang, Karo,Tapanuli Utara dan Serdang Bedagai. (m18)

Waspada/Setia Budi Siregar

AJA bersaudara, Aja Hanwar Fazri Surbakti (kanan) dan Aja Nuraini Surbakti berfoto bersama setelah memperoleh medali emas dan perunggu pada Kejuaraan Junior Antar Dojo Shiroite Karate-do di GOR Pasar X Tembung, Deliserdang, Sabtu (14/1).

Grand Opening Distro Futsal WaWa Sport P. BRANDAN (Waspada):Wawa Sport yang mensponsori sekaligus pendiri distro futsal, yakni satu wadah tempat penjualan perlengkapan futsal, menggelar grand opening di Jalan Sutomo, Pangkalanbrandan, Sabtu (14/1). Hadir dalam acara grand opening tersebut Camat Babalan, Ketua KNPI Babalan, Lurah Brandan Timur Baru dan puluhan undangan lainnya. Di sela-sela acara tersebut Wawa Sport juga memperkenalkan sarana perlengkapan futsal mulai dari kostum, sepatu, celana, kaos kaki, bola, tas dan lainnya. Pimpinan Wawa Sport, Wan Faisal mengatakan, perlengkapan futsal tersebut sengaja didatangkan dari Kota Jakarta dan Bandung. “Jakarta dan Bandung memiliki bahan yang berkualitas dan sudah punya nama memproduksi bahan-bahan untuk perlengkapan futsal. Dia menambahkan, keterbatasan sarana perlengkapan futsal di Kota Brandan dan minat yang tinggi mengakibatkan warga susah mendapatkan sarana perlengkapan futsal. “Dengan adanya distro futsal ini maka warga tidak lagi susah-susah ke luar kota untuk mendapatkannya,” ujar Faisal. (c01)


Jl. Gaperta Gg. Rukun No. 67 Helvetia, Medan. L.T. 24 x 24 M2, 4 KT, 2 KM, RT, Dapur, RK, SHM. Harga Rp. 400 juta (nego) Hub. : 0852 607 04569

Pasang Iklan Telp. 4528431 HP. 081370328259 Email:



WASPADA Minggu 15 Januari 2012

The Swans Akan Sulitkan Arsenal DUEL The Gunners Arsenal pada pekan ke-21 bakal ekstra keras untuk menembus empat besar dan menjaga jarak pemuncak klasemen Liga Utama Bertandang ke Liberty Stadium, Liga Inggris Inggris. Minggu (15/1) markasnya Swansea City, Malam Ini pasukan Arsene Wenger sedang bermasalah di posisi fullback menyusul absennya Bacary Sagna, Carl Jenkinson, Kieran Gibbs dan Andre Santos yang cedera. Wenger“memutarotak”mengisiabsennyaliniutamadifullback. Vermaelen,Squllaci,Mertesacker,KoscielnydanSongbakalmenjadi pilihan utama di lini belakang. Untungnya, comeback-nya Thierry Henry menjadi motivator bagi Arsenal. Memasuki usia 34 tahun, Henry masih menunjukkan kemampuannya di sektor depan. itu dibuktikkan pemain asal Perancis dengan menciptakan gol penentu atas Leeds United 1-0 dalam laga putaran ketiga FA Cup. Wenger pun memberikan sanjungan bahwa Henry masih memiliki finishing touch atau penyelesaian akhir. Sebagai bomber, Henry sudah mencatat 175 gol untuk Arsenal dari


Gerrard Ingin Kontrak Baru Steven Gerrard baru saja menandatangani kontrak baru bersama Liverpool. Meski begitu, dia sudah mulai memikirkan kontrak baru berikutnya yang ingin dia dapat pada masa depan. Seperti diberitakan sebelumnya, The Reds memberikan kontrak anyar kepada Gerrard dengan durasi yang tak disebutkan. Yang pasti, Gerrard sudah menegaskan komitmen jangka panjangnya bersama klub yang dikapteninya tersebut. Meski kontrak tersebut masih akan berlaku dalam waktu yang cukup lama, Gerrard sudah berangan-angan untuk menjalani kontrak lain bersama Liverpool. “Saya berharap untuk bermain di luar durasi kontrak ini. Saya merasa fit, kuat, dan bermain selama saya bisa,” aku Gerrard kemarin (14/1). “Saya tak mau menentukan waktunya. Selama saya merasa baik dan saya tampil pada level top, maka saya akan terus lanjut,” sambung gelandang berusia 31 tahun ini.

Neymar Di Santos Hingga 2014 SAO PAULO – Neymar da Silva akhirnya telah menandatangani kontrak barunya dengan Santos FC hingga tahun 2014. Kabar ini sekaligus menepis rumor yang menyatakan bahwa dirinya akan pergi ke salah satu klub di Eropa. Pemain yang telah mengantarkan Santos merebut gelar juara Copa Libertadores ini telah menerima kesepakatan kontrak baru dengan Santos, pada bulan November tahun lalu. Tetapi, kontrak barunya tersebut baru diserahkan oleh pihak klub ke Federasi Sepakbola Brasil (CBF). Seperti yang diberitakan Goal, Sabtu (14/1), sebenarnya pemain berusia 19 tahun itu telah memiliki kontrak yang akan berakhir Februari 2015. Tetapi, dalam kontrak barunya yang sekarang Neymar hanya akan bermain hingga musim panas 2014. Meskipun, secara durasi kontrak Santos mengalami kerugian, namun dari segi finansial mereka dapat meraih keuntungan cukup besar. Pasalnya, gaji Neymar akan mengalami kenaikan dan klausul buy-out pun akan tinggi. Neymar hanya dapat pergi dari Santos dengan status bebas transfer usai digelarnya Piala Dunia di Brasil.

Malaga Boyong Kameni Klub ambisius Malaga mendapatkan tambahan tenaga pada bursa transfer Januari ini. Los Boquerones memboyong kiper asal Kamerun, Carlos Kameni, dari Espanyol. Lewat situsnya, Espanyol mengumumkan bahwa mereka mencapai kesepaka-tan pemutusan kontrak de-ngan Kameni. “Espanyol dan Carlos Kameni telah mencapai kesepakatan pemutusan kontrak. Kameni mengakhiri kariernya di klub yang sudah diperkuatnya selama tujuh setengah tahun,” demikian keterangan Espanyol. Setelah dilepas Espanyol, Kameni kemudian bergabung dengan Malaga. Kiper berusia 27 tahun itu diikat dengan kontrak hingga akhir musim 2013/2014. Meski tidak menerima biaya transfer, Espanyol akan mendapatkan sejumlah uang tergantung penampilan Kameni dan pencapaian akhir Malaga di klasemen Liga Spanyol. Selama memperkuat Espanyol, Kameni telah merasakan satu gelar Copa del Rey pada musim 2005/2006. Musim ini, dia kehilangan tempatnya di tim inti gara-gara mengeluh akan kurangnya ambisi klub.

Allegri Janjikan Milan Titel Massimiliano Allegri akhirnya mendapat kontrak baru dari AC Milan. Allegri pun merasa bahagia dan ingin membalasnya dengan memberikan gelar juara bagi Rossoneri di akhir musim ini. Setelah sempat terkatungkatung akhirnya masa depan Allegri pun dipastikan tetap bersama Milan hingga 2014, setelah kontrak lamanya ber-

akhir musim panas ini. Ini merupakan wujud terima kasih Milan atas kesuksesan Allegri membawa tim itu meraih Scudetto musim lalu, setelah puasa selama tujuh musim. Sebuah kejutan juga mengingat Allegri tak punya latar belakang menangani klub besar. “Saya senang dengan kesempatan bekerja di Milan untuk dua tahun mendatang,” sahut pelatih 45 tahun itu di Milan Channel. “Saya ingin berterima kasih kepada presiden Silvio Berlusconi dan wakil presiden Adriano Galliani atas kepercayaan mereka kepada saya. Saya percaya kami memiliki segalanya untuk melanjutkan apa yang telah dilakukan sejak 1,5 tahun lalu,” lanjutnya. Setelah mendapat kepercayaan menangani Zlatan Ibrahimovic cs untuk hingga dua musim mendatang, Allegri pun tak ingin menyia-nyiakannya. Target terdekatnya adalah membawa Milan berjaya di musim ini, baik di kompetisi lokal maupun Eropa. (ds/afp/m47)

255 penampilan bersama The Gunners. Dengan status pinjaman dari klub New York Red Bulls selama dua bulan ke depan, Wenger menilai Henry menjadi motivator bagi Arsenal. “Bisa saja Henry diduetkan dengan Robin van Persie di lini depan saat bertandang ke Swansea City,” kata Wenger dalam situs Arsenal, Sabtu (14/1). Dalam laga yang disiarkan langsung Global TV pukul 23.00 WIB, sebagai tuan rumah The Swans (Si Angsa) julukan Swansea tentunya sudah siap mencuri poin bahkan menilai poin penuh. Dalam lima pertemuan terakhir, Arsenal mencata tiga kemenangan dan Swansea dua kemenangan. Laga terakhir 10 September 2011, Arsenal menang 1-0 di Emirates Stadium. Skor tipis yang diperoleh The Gunners dalam laga perdana melawan Swansea menjadi pertimbangan laga kedua tim bakal berjalan alot dengan prediksi 45:55 untuk tim tamu The Gunners. Pengalaman menjadi kunci sukses Arsenal yang saat ini menduduki posisi lima klasemen dengan nilai 36 dan 36 memasukkan serta 28 kemasukkan. Sebaliknya Swansea yang ditukangi Brendan Rodgers menduduki posisi ke-12 dengan nilai 23. Bahkan Leon Britton Cs mengalami minus 3 gol dalam selisih gol, yakni 20 memasukkan

dan 23 kemasukkan. Brendan Rodgers mengakui bahwa dia membutuhkan striker yang produktif. Dari 20 gol yang dilesakkan, lebih banyak dihasilkan pemain gelandang. Sedangkan Arsenal memiliki striker subur, Robin van Persie yang menduduki pemuncakn topskor sementara dengan 17 gol mengalahkan pesaing Debam Ba (Newcastle United) dan Sergio Aguero (Manchester City). Untuk Robin Van Persie, Wenger juga ingin menjaga momentum gol penyerang asal Belanda itu. Apalagi dia sudah diistirahatkan di tengah pekan ini dengan tak tampil di babak ketiga FA Cup. Perkiraan pemain Swansea: Michel Vorm (kiper); Ashley Richards, Ashley Williams, Caulker, Neil Taylor, Routledge, Rangel, Leon Britton, Joe Allen, Dyer, Danny Graham. Arsenal: Wojciech Szczesny (kiper); Vermaelen, Per Mertesacker, Thomas Vermaelen, Alexander Song, Aaron Ramsey, Squllaci, Arteta, Theo Walcott, Thierry Henry dan Robin van Persie. # Setia Budi Siregar

5 Pertandingan Terakhir Swansea: 7/1/2012 FA Cup; Barnsley vs Swansea 2-4 2/1/2012 Liga; Aston Villa vs Swansea 0-2 31/12/2011 Liga;Swansea vs Tottenham 1-1 27/12/2011 Liga; Swansea vs QPR 1-1 21/12/2011 Liga; Everton vs Swansea 1-0 5 Pertandingan terakhir Arsenal: 9/1/2012 FA Cup; Arsenal vs Leeds 1-0 2/1/2012 Liga; Fulham vs Arsenal 2-1 31/12/2011 Liga; Arsenal vs QPR 2-1 27/12/2011 Liga; Arsenal vs Wolves 1-1 21/12/2011 Liga; Aston Villa vs Arsenal 1-2

MU Terus Menekan

LONDON (Waspada): Dua klub papan atas, masing-masing Manchester United (MU) dan Chelsea memetik kemenangan dalam lanjutan kompetisi Liga Premier Inggris, di Manchester, Sabtu (14/1) malam. Sementara satu klub lagi, Tottenham Hotspurs bermain imbang dan bersama MU terus meningkatkan tekanan dalam perburuan gelar juara. MU menang 3-0 ketika menjamu Bolton Wanderers, dan Chelsea unggul 1-0 atas tamunya Sunderland, sedangkan Hotspurs ditahan Wolverhampton Wanderers 1-1. Hasil ini membuat MU meningkatkan tekanan kepada pemimpin sementara klasemen, klub sekota Manchester City, yang baru akan bermain Senin. MU kini menyamai poin City di puncak klasemen dengan nilai 48, sementara Hotspurs hanya terpaut dua angka, dengan Chelsea kokoh di peringkat keempat berkat 40 poin yang dimiliki. Menghadapi Bolton di stadion Old Trafford, pelatih Sir Alex Ferguson menurunkan Paul Scholes dan Michael Carrick di lini tengah yang membuat tik berjulukan Red Devils ini cukup dominan di babak pertama. Scholes dan Carrick menyumbang masing-masing satu gol dalam laga ini, dengan

satu gol lagi dibuat striker muda Danny Welbeck. Setelah beberapa peluang, MU mendapatkan kesempatan emas di menit ke-20, ketikaWelbeck disenggol oleh Zat Knight di dalam kotak penalti. Knight mendapatkan kartu kuning dan MU mendapatkan penalti. Namun, dieksekusi Rooney berhasil dibaca arahnya oleh Adam Bogdan dengan membloknya. MU akhirnya unggul di menit ke-45 dengan diawali sebuah serangan dari sisi kanan. Bola yang jatuh di kaki Rooney kemudian diberikan kepada Scholes yang berada di sisi kiri. Dengan tenang, Scholes membawa timnya unggul 1-0. ‘Setan Merah’ kembali mendapatkanbanyakpeluangdiawalawal babak kedua. Namun, baru pada menit ke-74 mereka bisa memperlebar keunggulan. Berawal dari sebuah operan rapi di lini tengah, bola kembali jatuh di kaki Rooney. Ia terjatuh, sebelum akhirnya berhasil memberikan umpan terobosan kepada Welbeck. Mendapatkan ruang tembak yang cukup luas, Welbeck pun memperdaya Bogdan. Keunggulan MU kembali bertambah di menit ke-82. Carrick, yang bergerak naik dari lini kedua, menyambut bola yang dioper kepadanya dengan

sebuah tendangan yang tidak kencang namun terarah. Sepakannya masuk ke pojok kanan bawah gawang Bolton tanpa bisa dijangkau Bogdan. Di Stamford Bridge, Chelsea menang 1-0 atas Sunderland berkat gol pemain gelandang Frank Lampard di menit ke-13. Gol tersebut bermula dari tembakan FernandoTorres yang membentur tiang gawang, dan Lampard berhasil me-reboundnya dari jarak dekat. Setelah itu tak ada lagi gol tambahah, meski tim tuan rumah tampil dominan, memenangi 62% ball possession, melepaskan 13 tembakan, tapi hanya tiga yang tepat sasaran. Torres sedikitnya memiliki dua peluang. Sementara, Hotspurs yang tertinggal 0-1 di babak pertama dari Wolverhampton, berhasil mencetak gol balasan di menitmenit awal babak kedua, ketika Luka Modric menjadi pahwalan bagi timnya di menit 51. Gol itu membuat kedudukan menjadi 1-1. Wolves lebih dulu mencetak gol di menit ke22 melalui Steven Fletcher. Hasil lain: Aston Villa - Everton 1-1 Blackburn - Fulham 3-1 Liverpool - Stoke City 0-0 Bromwich - Norwich 1-2 (ap/m47)

PSMS, Persiwa Ngotot Menang MEDAN (Waspada): PSMS Medan saat menjamu Persiwa Wamena dalam lanjutan Indonesia Super League (ISL) di stadionTeladan, Medan, Minggu (15/1) malam ini pukul 19.00 WIB, harus mampu meraih kemenangan, ungkap manajer tim Ayam Kinantan, Drs Benny Tomasoa Sabtu (14/1). “Menjamu Persiwa, PSMS bertekad memberikan tiga poin bagi pendukungnya, Kendati di awal musim sempat diragukan karena materi pemain mayoritas pemain debutan, harus mampu menjawab keraguan para pendukungnya” sebut Benny. Sementara, kubu Persiwa melalui manajer timnya Agus Santoso, juga menyatakan tekad timnya untuk mencuri poin di Medan. ”PSMS Medan adalah sebuah tim besar di kancah sepakbola nasional. Namun, kami datang ke Medan juga dengan keyakinan untuk bisa meraih poin,” ucap Agus. Dari empat laga PSMS menghadapi empat tim berbeda yang berisi para pemain bintang, Ayam Kinantan sukses melaluinya dengan meraih lima poin, dari hasil satu kali menang, dua kali seri dan satu kali kalah. Trend positip ini dipastikan akan kembali berlanjut saat

menjamu Persiwa Wamena. Apalagi tim sedang dalam kondisi siap tempur baik secara teknis maupun non teknis. Dari sisi teknis, seluruh pemain siap tampil. Kekalahan menyesakkan atas Persib Bandung sudah dilupakan. “Lawan Persiwa, PSMS harus dapat tiga angka,” tambahnya optimis. “Kekalahan melawan Persib telah dilupakan. Saat ini fokus hanya Persiwa,” ucap Benny Tomasoa serta menegaskan tiga angka adalah target yang harus direalisasikan. Target ini disokong oleh kondisi tim yang lebih siap. Dua pemain yang tak bisa diturunkan saat menghadapi Persib lalu, Zainal Anwar dan Arie Supriatna sudah bisa kembali diturunkan, setelah menjalani hukuman. Penyerang Osas Saha yang gagal mencetak gol di tiga laga pertama pun sudah mulai menunjukkan taji dengan mencetak gol indah ke gawang Persib Bandung. Dengan komplitnya kembali skuad yang ada, membuat dirinya serta pelatih Raja Isa berkeyakinan tiga angka tidak akan lepas. Skema 4-2-3-1, di mana posisi kiper tetap dipercayakan kepada Markus Maulana haris

Horison. Lini pertahanan akan dipercayakan kepada Wawan, Novi Handriawan, Sasa Zevecic dan Rahmad. Meski sama-sama menempati posisi full back, tampaknya suplai bola dari sisi lapangan akan lebih banyak dilakukan Wawan ketimbang Rahmad yang lebih berkonsentrasi pada lini pertahanan. Sebagai dua gelandang bertahan, tampaknya duet Zainal Anwar dan Luis Pena akan kembali diturunkan seperti saat menahan imbang Pelita Jaya. Sementara tiga gelandang bertahan diisi Inkyun Oh, Zulkarnain dan Choi Dong Soo. Ketiga gelandang ini terbukti kerap menjadi momok bagi pertahan lawan dalam menyokong Saha yang berposisi penyerang. Zulkarnain yang kerap muncul dari second line, bahkan menjadi pemain tersubur PSMS dengan kemasan dua gol yang diciptakannya saat bertemu Persisam dan Pelita Jaya. Ketua Umum PSMS Drs H Rahudman Harapah melalui CEO PSMS Idris SE, mengimbau kepada kelompok suporter dan masyarakat Medan untuk memberi dukungannya kepada PSMS dengan tetap menjaga ketertiban. (m17)

Sasa Zecevic:

Persiwa Punya Kelas Dan Fair Play MEDAN (Waspada): Palang pintu PSMS Medan asal Serbia Sasa Zecevic menilai Persiwa Wamena tidak seperti Persib Bandung yang pemainnya bermain kasar, brutal dan main tendang seperti yang ia rasakan ketika menghadapi tim Maung Bandung itu Senin (9/1). Menurut Sasa di sekretariat stadion Kebun Bunga Medan Sabtu (14/1), sehari jelang menghadapi tim tamu di stadion Teladan Minggu (15/1) malam ini, Persiwa yang adalah mantan klubnya di Liga Super tahun lalu, memiliki pemain yang berkelas dan tahu aturan (fair play). Sambil memperlihatkan luka-luka di bagian paha dan kakinya, sebagai bukti keganasan Hariono dan kawan-kawan, dia sangat antusias menghadapi tim dari Papua itu. Sasa mengaku dia suka dengan mantan klubnya itu karena Persiwa adalah klub pertamanya di Indonesia. Namun saya sekarang di PSMS, dan saya ingin memenangkan pertandingan. Saya juga mencintai klub dan teman-teman baru saya di sini,” ujarnya di dampingi pelatih Raja Isa dan asistennya Suharto.

Dia tidak membantah Persiwa adalah tim yang kuat. Mereka tim yang lebih mempertahankan pemain-pemain lama dan kalaupun ada pergantian itu hanya satu atau dua pemain tidak seperti klub-klub lainnya. “Persiwa tidak banyak berubah, “ tambahnya dan dipertegaskan oleh Raja Isa yang juga sempat menangani Persiwa. Menanggapi kekuatan calon lawannya ini, menurut Sasa dia tahu persis pemain mana yang perlu diwaspadai. Hanya Boakay Edi Voday yang perlu dijaga khusus. “Dia punya skill yang baik dan kontrol bolamua juga sangat baik. Saya perlu berhatihati dengannya, “ tambah Sasa. Dia sependapat akan berjuang sekeras-kerasnya untuk membawaPSMSmemenangkan laga malam ini “Seluruh pemain pasti mau menang. Untuk mencapai itu, kami terus berlatih keras supaya pada penampilan nanti tidak ada lagi kesalahan. Sasa juga mengakui menghadapi Persiwa menjadi tantangan buatnya dan para pemain. Diakuinya dia mengetahui tentang kopndisi Persiwa sebab selama ini dia pernah bermain

di klub itu, sehingga dia mengenal betul tipikal dan kekuatannya termasuk Persiwa. “Persiwa sangat menonjol terhadap bola-bola mati dan selalu mengandalkan serangan dari sayap ,” ujarnya. Sementara Persiwa Wamena tak banyak melakukan perubahan dalam susunan pemain, dengan hanya mengandalkan Shibakoya Yuichi serta kunci permainan ada di Erick Weeks Lewis serta Pieter Romaropen yang bergerak dari belakang. Permainan bola-bola pendek menjadi pangkal mereka untuk menekan lawan serta berusaha menguasai ball position dan mencari ruang di sayap untuk menggalang serangan,” cetusnya. Mereka selalu pula bergerak hingga tiga perempat lapangan dan mencari celah ruang untuk melepaskan tembakan ke gawang. “Bahkan jika mendapat peluang menembak pasti mereka lakukan,” tambahnya. PSMS harus bisa menekan dan tidak memberi ruang shoring bagi lawan apalgi untuk menguasai ball possesion dan menyerang. (m17)


KIPER Bolton Wanderers, Adam Bogdan (L) membuat penyelamatan atas usaha striker Manchester United Danny Welbeck dalam laga liga Liga Premier Inggris di stadion Old Trafford, Manchester, Sabtu (14/1) malam.

Lorenzo: 1.000 Cc Sajikan Tantangan Baru J A K A RTA ( Wa s p a d a ) : MotoGP 2012 memasuki era baru dengan digunakannya motor 1.000cc. Untuk Yamaha, ini disebut juga akan memberi tantangan baru di setiap lintasan. Setelah era motor 990cc dalam kurun waktu 2002-2006, dan 800cc selama 2007-2011, penggunaan motor 1.000cc di musim 2012 akan menandai awal sebuah era baru. Dengan keluaran tenaga lebih besar pada musim 2012, sejumlah penyesuaian tak ayal mesti dilakukan oleh para tim di kelas MotoGP. Tak terkecuali Yamaha yang dibela oleh Jorge Lorenzo (foto) dan Ben Spies. “Tugas kami adalah bagaimana caranya untuk bisa mendayagunakan tenaga yang lebih besar (dengan motor 1.000cc),” tukas Hiroo Saito Manajer Divisi Pengembangan Motor Sports Yamaha MotoGP di acara Meet and Greet Jorge Lorenzo di Atrium Plaza Epicentrum, Kuningan, Jakarta. “Dengan big power, bagian depan motor akan naik. Jadi bagaimana agar kontrol bisa tetap bagus,” lanjut Saito mema-

parkan tantangan terbesar yang dihadapi oleh timnya. Perubahan kapasitas menjadi 1.000cc juga dinilai akan membuat tim mesti beradaptasi lagi dengan karakteristik yang ada di setiap lintasan balap. Artinya, sebuah tim yang tadinya “cocok” dengan sebuah sirkuit niscaya harus mencari pengaturan yang berbeda. Hal itulah yang membuat Saito enggan membeberkan prediksi di sirkuit-sirkuit mana sajaYamaha akan bersinar pada musim 2012 mendatang, termasuk pula kans kembali juara. “1.000cc akan memberikan tantangan berbeda (di setiap lintasan) karena ada tenaga yang lebih besar, jadi kita akan lihat bagaimana nanti.” “Saya ingin bilang kami akan

menang, tapi saya tidak tahu (bagaimana hasilnya nanti). Kalau hasilnya bagus ya kami akan menang,” simpulnya. Sembilan Tim Sementara Federasi Internasional Motorcycle (FIM) telah mengeluarkan daftar sementara pembalap MotoGP 2012. Ada sekira sejumlah perubahan, serta sembilan tim yang menggunakan motor CRT. Ada sekira 21 motor yang akan mengikuti kompetisi MotoGP 2012. Dalam kompetisi kali ini, Casey Stoner akan menggunakan nomor satu di motornya. Sedangkan Jorge Lorenzo, akan memakai nomor 99. Ada sejumlah rider baru yang akan tampil di MotoGp 2012. Mereka diantaranya adalah James Ellison dan Anthony West yang akan memakai mesin Aprilia (ART). Selain itu, ada empat pembalap lain yang akan menggunakan mesin CRT. Mereka adalah Danilo Petrucci, Yonny Hernandez dan Ican Silva ditambah Michele Pirro. (dc/oz/m47)

UNIVERSITAS ISLAM SUMATERA UTARA Kampus Almunawwarah, Jln. SM Raja Teladan Barat, Medan Telp/Fax 7869790

Yayasan dan Rektor beserta Civitas Akademika Universitas Islam Sumatera Utara (UISU) mengucapkan:


atas partisipasi dalam rangkaian peringatan Milad ke-60 tahun UISU 7 Januari 1952 7 Januari 2012 sebagai penyampai orasi ilmiah, pembicara, kehadiran, ucapan selamat dan dukungan serta bantuan kepada yang terhormat : 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. 13. 14. 15. 16. 17. 18. 19. 20. 21. 22. 23. 24. 25. 26. 27. 28. 29. 30. 31. 32. 33. 34.

Bapak Syarief Hasan (Menteri Koperasi dan UMKM RI) Bapak Deny Indrayana Wakil Menteri Hukum dan HAM RI Bapak Sutan Bathoegana (Anggota DPR RI) Bapak Ir. Jend. Pol. Saud Usman Nasution, SH, MH (Kadiv Humas Polri) Bapak Surya Paloh (Alumni UISU) Bapak H. Anif (Pengusaha) Bapak H. Saleh Bangun (Ketua DPRD SU) Bapak Drs. H. Rahudman Harahap, MM (Wali Kota Medan) Bapak Ir. Chaidir Ritonga, MM (Wakil Ketua DPRD SU) Brillian Mochtar (Ketua Komisi B DPRD SU) Kombes Pol. DR. H. Heri Subiansauri, SH, MH, Msi (Dir. Binmas Poldasu) AKBP Raden Heru Prakoso (Kabid Humas Poldasu) Bapak Kombes Pol. Tagam Sinaga (Kapolresta Medan) Baldwin Bc. IP, SH, MH (Ka. Kanwil Kemenkumham Prov. Sumatera Utara) Jhoni Pasaribu (Kadis Koperasi Sumatera Utara) Drs. H. Zulhifzi Lubis (Ketua KONI Medan) Kadis Pendidikan Kota Medan Bapak Sofyan Tan Yayasan H. Agus Salim Yayasan dan Rektor Universitas Quality Yayasan dan Direktur Potensi Utama Rektor ITM Rektor UMA Rektor Universitas Pancabudi Rektor UDNAS Direktur Pasca Sarjana UMA Arnold Budiman Hutasoit (USBM) H. Ali Umri (Ketua Partai Nasdem Sumut) Bank Danamon Bank Mandiri Cahaya Advertising Griya Dome Majestik Bakery and Cake Pihak-pihak yang tak disebutkan.

Semoga atas partisipasinya menambah motivasi dan semangat Civitas Akademika UISU terus berkarya dalam pendidikan anak-anak bangsa untuk menghasilkan sumberdaya unggul.

Ketua Yayasan UISU


Ir. H. Helmi Nasution, M.Hum

Prof. Ir. H. Zulkarnain Lubis, MS, PhD

Mode & Masakan


Minggu 15 Januari 2012


Tabrak Corak Untuk Fall-Winter PARA model beraksi dengan gaun-gaun tabrak corak karya terbaru dari Alessa yang menjadi koleksi musim gugur dan dingin dalam Pagelaran Fashion Rio di Rio de Janeiro, Brazil. **Neneng K.Zen/AP

Santapan Mie Masih Jadi Idola

Kreasi Muffin MUFFIN bisa dijadikan hidangan teman minum teh di sore hari, agar tidak bosan dengan rasa muffin yang biasa, kreasikan bahan-bahan di dalamnya dengan sayuran seperti wortel atau jagung manis. Tambahkan frosting atau whipping diatasnya agar menambah citarasa dan tampilan.

Muffin Wortel

MENIKMATI pusat perbelanjaan tradisional di Pasar Mayestik Jakarta untuk melihat dan berbelanja aneka bahan busana pilihan impor dan ekspor, rasanya belum lengkap jika tidak mampir ke resto-resto yang ada di sana. Meski tempatnya sangat sederhana dengan jajaran kursi yang tidak terlalu banyak, namun rasa hidangannya terbilang enak. Sajian mie rebus dan soto ayam plus bihun menjadi makanan yang banyak dipesan pendatang. Umumnya kawasan pasar jajanan di tempat ini menyajikan makanan ini. Mie rebus yang dipadu dengan aneka bumbu ditaburi sedikit kerupuk membuat makanan ini terasa lebih nikmat. Aroma daun bawang dan irisan tomat mampu menggugah selera. Naskah dan foto : Anum Saskia

Bahan-bahan: 230 gr margarin 110 ml air 225 gr gula pasir 300 gr terigu 400 gr wortel parut, peras airnya 3 butir telur 1 sdt garam 2 sdt kayu manis bubuk 2 sdt baking powder 1 sdt baking soda

Muffin Jagung

Muffin Jagung 350 g tepung terigu selfraising 150 g tepung terigu protein tinggi (cakra) 1 sdt soda kue 1/2 sdt garam halus 6 butir telur 150 g gula halus, ayak 250 g jagung manis pipilan kalengan, tiriskan, dan keringkan 250 g keju, iris dadu halus 200 ml susu cair 200 g mentega, cairkan Cara membuat : Campur kedua macam tepung dan soda kue, aduk rata, kemudian ayak. Tambahkan garam dan gula bubuk, aduk rata. Masukkan keju iris dan jagung manis pipilan (sisakan untuk taburan), aduk rata. Sisihkan. Kocok telur lhingga putih dan kuningnya tercampur rata. Lalu masukkan susu cair dan mentega cair (sudah dingin), aduk hingga tercampur rata. Tuang campuran telur (bahan 2) ke dalam campuran tepung (bahan 1),

aduk perlahan menggunakan kawat hingga rata. Olesi cetakan muffin dengan sedikit margarin. Tuang adonan ke dalam cetakan hingga hampir penuh.

Taburi jagung manis pipilan dan keju iris. Panggang dalam oven yang sudah dipanaskan selama kurang lebih 30 menit hingga matang. Angkat, keluarkan muffin dari cetakan.

Cara membuatnya Didihkan air, garam, margarin dan gula dengan api kecil sampai gula larut Setelah larut, angkat dari kompor, masukkan terigu yang telah dicapur dengan kayu manis bubuk, baking powder dan baking soda. Masukkan wortel parut. Aduk dengan sendok kayu, jangan terlalu lama, asal nyampur masukkan telur, aduk asal tercampur rata Masukkan dalam loyang cup yang telah dialasi cup kertas. Panggang 30 menit. * Tri K/Taste

Soto ayam

Mie Rebus Muffin Wortel




Minggu 15 Januari 2012

Lidia Meril

Sukses Kelola Usaha Lewat Keterampilan MEMILIKI keterampilan seperti menjahit,membordir dan membatik ternyata mampu menambah penghasilan ekonomi rumah tangga. Meski awalnya terasa sulit, namun dengan semangat dan kegigihannya, semua usaha yang dia la-

kukan membuahkan hasil. Bukan hanya itu, setelah usahanya mulai maju, ia mengajarkan keterampilan itu untuk ibu-ibu lainnya di kelurahan tempat tinggalnya, Pulau Brayan Bengkel Medan. Adalah, Lidia Meril, seorang ibu rumah tangga yang tinggal

di Komplek DPR Blok D Medan, yang mampu mengelola usaha setelah memanfaatkan keahlianya dibidang menjahit, membordir dan membatik. Ditemui di rumahnya, Kamis lalu, isteri Drs Hamzah yang sehari-hari PNS di BKKBN Sumut, Lidia mengaku usahanya

Waspada/ Anum Saskia

Bersama Konjen Malaysia ,Norlin dan peserta pelatihan membatik yang sudah mendapatkan order.

kini berkembang. Bukan hanya itu, diapun bisa menularkan pengetahuannya itu untuk kaum ibu di lingkungan tempat tinggalnya. Berkat kegigihannya, saat ini Lidia sudah menikmati hasil jerih payahnya dan membentuk kelompok wira usaha bersama kaum ibu di kelurahan Pulau Brayan Bengkel. Ia mendapat dukungan dari berbagai pihak, utamanya organisasi perempuan yang memberinya kesempatan untuk mendapatkan modal usaha. “Saya sadar sebagai ibu rumah tangga biasa dan punya cita-cita agar turut serta menopang ekonomi rumah tangga, maka saya memanfaatkan pengetahuan yang saya miliki. Alhamdulillah, dengan memiliki keterampilan menjahit,membordir, menyulam dan saat ini bisa membatik, saya bisa membantu ekonomi keluarga, khususnya untuk keperluan kuliah anakanak,”kata Lidia Meril Kamis lalu. Ibu dari Afrida, Arif Rahman dan Safwanul ini mengaku suksesnya tidak diraih begitu saja. Awal merintis usaha, banyak sekali kendala yang dia dapati. Modal usaha sampai

pemasaran yang harus dilaksanakan sendiri. Untunglah, kata Lidia, suaminya turut serta memberikan dukungan atas usaha ini, sehingga kesulitan sekecil apapun bisa diatasi. “Mengelola usaha, tidak semudah yang dibayangkan. Tetapi, tidak boleh putus asa, harus terus berusaha dan berdoa. Di samping itu, rajin mengikuti berbagai kegiatan di luar rumah, aktif di organisasi atau menjalin silaturahim dengan teman-teman lama. Dari mereka, promosi usaha bisa terjadi, hasilnya cukup memuaskan,” ujarnya. Saat ini usahanya sudah membuahkan hasil apa rencananya kedepan ? “Seperti yang saya inginkan semula, bahwa keterampilan yang saya miliki harus ditularkan pada ibu-ibu rumah tangga laiinnya. Karena itu sayapun membentuk kelompok usaha dan memberikan pendidikan keterampilan kepada mereka, apalagi kegiatan ini secara langsung mendogkrak ekonomi rumah tangga. Sudah banyak yang mulai merintis usaha seperti saya. Mereka juga bisa mendapatkan penghasilan seperti yang saya rasakan,” katanya.

Dikunjungi Konjen Malaysia Usaha dan kegiatan keterampilan yang dikelola Lidia ternyata memberikan perhatian dari berbagai pihak. Konjen Malaysia, Norlin yang berkunjung ke tempat ini bersama mantan Ketua Badan Kerjasama Organisasi Wanita (BKOW ) Sumut, Ny Zakaria Siregar dan Rozalinda Bunas Sekretaris Yayasan Murni Gus Irawan. Kedatangan mereka sekaligus menutup kegiatan membatik yang dilaksanakan Lidia terhadap 20 orang perajin yang belajar selama beberapa hari di kediamannya. Norlin Otman mengakui jika keterampilan yang dikelola dengan baik bisa membantu perekonomian rumah tangga. Apalagi, sebut Norlin, usaha rumahan seperti ini bisa dikerjakan setelah semua urusan rumah selesai dikerjakan.” Rumah terurus, uang dapat,” kata Norlin yang berharap usaha keterampilan ini diperhatikan oleh berbagai pihak agar sirkulasinya tetap lancar sehingga perajinnya terus mendapatkan penghasilan. Sementara Rozalinda Bunas memberikan peluang kepada kaum ibu yang sudah belajar


keterampilan untuk mendapatkan modal usaha dari yayasan Murni Gus Irawan dengan beberapa ketentuan. “ Jelas saja usaha seperti ini perlu menda-

pat dukungan, nanti akan ada proses yang pasti bagaimana kelompok ini bisa mendapatkan bantuan modal usaha,” kata Rozalinda. * Anum Saskia

Kaum Ibu Perlu Tahu Manajemen Dan Kurikulum Majelis Taklim KAUM ibu yang banyak mengikuti kegiatan majelis taklim perlu tahu tentang manajemen dan kurikulum yang dimiliki mejelelis taklim yang diikuti. “ Majelis taklim itu sebuah lembaga pendidikan non formal yang memiliki jamaah dengan jumlah relatif banyak dengan usia yang beragam dan memiliki basis keagamaan serta waktu yang fleksibel sesuai kebutuhan jamaah. Sedangkan kurikulum, sejumlah mata pelajaran yang harus ditempuh murid untuk mendapatkan ijazah, tetapi menurut pandangan modern, kurikulum bersifat luas, tidak hanya terpaku pada mata pelajaran semata, tetapi meliputi semua kegiatan dan pengalaman yang menjadi tanggung jawab sekolah. Tetapi dalam kurikulum majelis taklim merupakan rencana untuk mencapai tujuan, dimana rencana itu dilaksanakan dengan cara dan prosedur tertentu agar

tujuan tercapai. Demikian antara lain disampaikan nara sumber Hj Yusmaini MAg Ketua Komisi Pemberdayaan Wanita MUI Sumut saat berlangsungnya Seminar kurikulum dan manajemen majelis taklim muslimah dilaksanakan PW Muslimat Al Wasliyah serangkaian dengan HUT ke 77 organisasi ini. Kegiatan berlangsung Sabtu (14/1) di Auditorium UNIVA Jalan SM Raja Medan. Hadir Ketua Umum PW Muslimat Al Wasliyah, Dra Hj Nurliati Ahmad,MA dan Sekretaris Hj Murni Nila Kesuma, Anggota DPD-RI, Prof Darmayanti Lubis, PP Muslimat AlWasliyah diwakili DR Fahriani yang membuka secara resmi kegiatan. Lebih lanjut disebutkan bahwa kurikulum itu sebagai upaya untuk bisa menarik kesimpulan tentang apa yang dipelajari selama ini di majelis taklim.“Misalkan dalam modul

kurikulum dimuat materi pelajaran ahlak yang memuat komponen pendahuuan, tujuan, peta atau konsep serta deskripsi metode dan evaluasi. Hal ini bertujuan agar jamaah majelis taklim memahami bagaimana ahlak yang diajarkan dalam Islam serta bagaimana hubungan ahlak dengan ilmu lainnya, dengan begitu semakin mudah mengamalkan aspek ilmu ahlak tersebut dalam kehidupan sehari-hari. Jadi sudah saatnya majelis taklim memiliki kurikulum,”kata Yusnaini. Nara Sumber Prof Dr Hj Sri Sulistyawati menyebutkan, manajemen majelis taklim suatu proses mengatur/merencanakan, mengorganisasikan, melaksanakan dan mengawasi terhadap suatu lembaga pendidikan non formal Islam untuk menjalankan kurikulum yang diselenggaran secara berkala dan teratur agar dapat membina jamaah. Dia juga menjelaskan bahwa dasar hukum majelis

ta’lim sesuai dengan PP No 19 tahun 2005 tentang standar pendidikan nasional. Sedangkan nara sumber Hj Tjek Tanti Lc,MA dalam paparannya tentang peluang dan hambatan dalam berdakwah melalui majelis taklim menyebutkan, bahwa berdakwah itu tetap memerlukan manajemen dan kurikulum agar materi yang disampaikan bisa berkesinambungan dan dipahami oleh jamaah. Ketua PW Muslimat Al Wasliyah, Dra Hj Nurliati Ahmad MA bersama ketua seminar Dra Arlina Sirait MA menyebutkan, kegiatan seminar diikuti lebih dari 250 peserta dari Medan dan utusan daerah, di samping itu akan dilaksanakan pula kegiatan perlombaan cerdas cermat dan lomba mengolah makanan beragam, bergizi dan berimbang yang dilaksanakan Minggu (15/1) hari ini. “Semua kegiatan ini serangkaian dengan HUT Mus-

limat Al Wasliyah ke 77, pesertanya nampak sangat semangat. Mudah-mudaha mereka bisa mengaplikasikan ilmu yang didapat ini untuk kehidupan sehari-hari sehingga nampak jelas manfaat yang diperoleh dalam mengikuti kegiatan,”kata Nurliati Ahmad. Anggota DPD-RI, Prof Darmayati Lubis menyambut baik berbagai program yang dilaksanakan kemarin dan hari ini oleh PW Al Wasliyah Sumut untuk memberi kesempatan kepada kaum perempuan saling memberi dan menerima ilmu pengetahuan. Hal ini, kata Darmayanti sebagai bentuk keperdulian untuk mencerdaskan perempuan dalam berbagai bidang. “Selama ini kalau mengikuti majelis taklim atau yang akrab disebut pengajian, ya hanya mengikuti saja. Tapi dengan diungkapkan bahwa majelis taklim itu perlu sebuah ma-

Waspada/Anum Saskia Prof Darmayanti bersama peserta lainnya saat kegiatan seminar berlangsung dalam rangkaian HUT ke 77 Muslimat Al Wasliyah. najemen dan kurikulum semakin memberi arah yang jelas terhadap suatu kegiatan yang diikuti oleh seorang perempuan. Jadi, kegiatan itu tidak monoton tapi ada warna

tersendiri karena ada aturanaturan dan target yang akan dicapai. Saya bangga dengan pokok pikiran penyelenggara kegiatan ini. Kedepan diharapkan ada

lagi gagasan lain yang cenderung untuk mencerdaskan kaum perempuan dalam berbagai aspek,”kata Darmayanti kemarin. * Anum Saskia

Linda Agum Gumelar

Pengadilan Masih Terkesan Kurang Pro Anak

Waspada/Anum Saskia AUDIENSI : KPPI Sumut berpose bersama Kepala Badan Kesbangpol dan Linmas usai kegiatan audiensi.

Siapkan Kemampuan Politik Perempuan Menuju Pemilu 2014 KAUKUS Perempuan Politik Indonesia (KPPI),Sumut akan terus memperkuat potensi dan kemampaun perempuan menyongsong Pemilu 2014 mendatang. Demikian antara lain disampaikan Ketua KPPI Sumut, Nurhasanah bersama pengurus lainnya, Sri Rahayu, Efwita Nasution, Dermawati Zebua, Tia Aisyah, Ida Budiningsih, Rosta Sianturi dan Ida Nababan, saat melaksanakan kegiatan Audiensi ke Kesbangpol Dan Linmas Sumut,sekaitan akan dilaksanakannya pelantikan KPPI 3 Februari mendatang,Jumat (13/1) yang diterima langsung Kepala Badan Kesbangpol Dan Linmas Sumut,Bukit Tambunan MAP dan Kabid Pembinaan Politik Dalam Negeri, Ahmad Firdausi Hutasuhut,SH,MSi. “KPPI akan membuat

berbagai program yang mengarah pada pembinaan dan penguatan kemampuan kaum perempuan yang akan menjadi calon wakil rakyat di Pemilu mendatang. Untuk itu, akan dilakukan sosialisasi sekaligus pembentukan di kabupaten kota. Targetnya setahun ini akan selesai sehingga mempermudah realisasi program kerja kedepan. Kita harus sama perduli terhadap perempuan yang ingin menjadi wakil rakyat dengan saling shering dan memberikan pencerahan bidang politik. Karenanya, setiap partai politik boleh berperan serta mengirim utusannya agar bergabung di KPPI daerah kabupaten kota. Nanti, mereka bisa menjadi jembatan kepada masyarakat untuk memberikan pendidikan dan memperkuat wawasan politik,serta

mempersiapkan diri untuk mendapatkan peluang di legislatif pada Pemilu 2014,”katanya sembari berharap Parpol memberi kesempatan pada anggotanya memberi kesempatan untuk bergabung di KPPI, setelah pelantikan ini pihaknya akan ada road show dan pembentukan korda dan menemukan calon-calon yang akan membentuknya dikabupaten kota. Kepala Badan Kesbangpol dan Linmas, Bukit Tambunan MAP menyambut baik kegiatan audiensi ini dan berharap rencana KPPI untuk melaksanakan berbagai program yang sifatnya mendukung kaum perempuan untuk aktif du ranah politik akan terwujud. “KPPI membuktikan kemampuan perempuan berpolitik semakin diperhitungkan,”kata Bukit Tambunan. (m37)

MARAKNYA kasus-kasus pidana yang menimpa anakanak belakangan ini mendapat perhatian khusus dari Kementerian Pemberdayaan Perempuan dan Perlindungan Anak (KPP dan PA). Aspek penanganan hukumnya, kadang berjalan tidak pro anak. Seringkali anak-anak yang berhadapan dengan hukum, kehilangan hak-haknya untuk tetap diperlakukan sebagai anak-anak. “Anak seringkali dipaksa menghadapi pengadilan yang menjadi momok. Kadangkala pula, anak diperlakukan seperti layaknya penjahat kambuhan. Hal-hal seperti itu sangat mengguncang jiwa anak,”kata Menteri Negara PP dan PA, Linda Amalia Sari Gumelar dalam acara dialog awal tahun tentang program KPP dan PA 2012, di Jakarta, Kamis (12/). Keprihatinan pemerintah pada nasib anak-anak berhadapan dengan hukum, kata

Linda Amalia Sari Gumelar akan diwujudkan dalam upaya dan tekad merampungkan pembahasan Rancangan UndangUndang Sistem Peradilan Pidana Anak (RUU SPPA). SPPA akan mengatur apa dan bagaimana semestinya peradilan yang semestinya bagi anak-anak. “Targetnya, awal tahun 2012 ini sudah disahkan. Kami mendorong betul, supaya RUU ini segera disahkan DPR dalam hal ini Komisi III juga punya keinginan yang sama,” kata Linda. Kehadiran RUU ini sangat penting lantaran selama ini sistem peradilan anak masih m e n g a c u m e l a l u i Su r a t Keputusan Bersama (SKB) dan Undang-Undang Perlindungan Anak (UU PA). “Sayangnya, SKB dan Undang-UU PA belum menganut sistem restoratif justice. Nah, nantinya, RUU SPPA ini akan menganut sistem tersebut yang memperbolehkan perdamaian

antara pelaku dan korban,” imbuh Menneg PP dan PA. Selama ini, banyak media massa yang memuat kasuskasus pidana pada anak-anak di bawah umur yang menurut Linda, sangat tidak manusiawi. Yang paling hangat adalah kasus pencurian sendal di Palu, dimana anak usia 15 tahun menjadi korban keangkuhan orang dewasa. “Seperti itu adalah contoh hukum yang tidak pro anak. Jangankan mencuri sendal, membunuh pun, bagi seorang anak perlu dipikirkan apa penyebabnya. Dari situ, timbul pemikiran untuk memberikan solusi yang tepat demi kepentingan terbaik si anak yang melakukan pidana atau yang menjadi korban,” kata Linda. Linda mencontohkan peradilan anak dalam kasus pembunuhan.Menurutnya kasus tersebut nantinya akan diproses pada pengadilan khusus anak yang bentuknya

akan dibahas setelah jadi undang-undang. “Dari pengadilan, nanti anak tersebut akan dibawa ke Lembaga Pembinaan Khusus Anak (LPKA) menggantikan Lapas. Dan Lembaga Penempatan Anak Sementara (LPAS) menggantikan Rumah Tahanan (Rutan). Tujuannya untuk menghindari perampasan hak anak,” katanya. Selain rencana melahirkan UU baru di awal tahun ini, KPP dan PA juga terus memikirkan bagaimana supaya ada kerjasama yang lebih baik dengan media televisi, khususnya yang terkait industri sinetron. Linda mengaku gemas dengan tayangan-tayangan sineteron yang mengeksploitasi kekerasan dalam kehidupan sehari-hari. Apalagi jika tayang di jam utama, di mana anakanak masih dapat menyaksikan kare Kesetaraan Gender Selain itu pemerintah juga

menargetkan pengesahan Rancangan Undang-Undang Kesetaraan Gender tahun ini juga. “Kita masih menanti undangan DPR untuk membahas RUU Kesetaraan Gender. Sebab, RUU ini merupakan inisiatif dari DPR. Kami belum mendapat lagi undangan dari Komisi VIII DPR,” katanya Linda mengaku telah selesai menyusun draft RUU Kesetaraan Gender. Menurutnya, jika RUU Kesetaraan G ender sudah disahkan menjadi undang-undang maka ada payung hukum yang kuat untuk melaksanakan pengarusutamaan gender. Saat ini, pelaksanaan pengarusutamaan gender di Indonesia hanya mengacu pada Instruksi Presiden Nomor 9 Tahun 2000 tentang Pengarusutamaan Gender dalam pembangunan nasional dan beberapa peraturan daerah.(dianw)

Selamatkan Anak Dari Jeratan Kanker ORANG tua di mana saja berada pasti ingin anaknya dalam kondisi sehat selalu. Anak yang sehat pasti ceria, lebih cerdas dan berprestasi. Lantas bagaimana kalau anak kita ternyata divonis mengidap penyakit kanker? Apakah dunia akan seperti kiamat? Ternyata tidak selamanya begitu. Ira Soelistyo, salah satu pendiri Yayasan Kasih Anak Kanker Indonesia (YKAKI), justru senantiasa mengingatkan kepada orang tua untuk tidak menganggap dunia kiamat kalau anaknya terkena kanker. “Di awal-awal tahu mungkin kita panik bahkan stres. Berapa biayanya, apakah bisa diselamatkan hingga kerepotan luar biasa saat si kecil harus menjalani pengobatan, terba-

yang di depan mata. Tapi kalau kita berpikir jernih, akan membuka jalan pikiran untuk tabah mencari solusi terbaik bagi kesembuhan anak kita,” kata Ira, saat menjadi pembicara dalam dialog tentang mewaspadai kanker pada anak, di kantor Kementerian Kesehatan (Kemkes), Jumat (13/1) lalu. Bersama lebih dari 300 anak di ‘Rumah Kita’, sebuah rumah singgah yang digalang YKAKI, Ira bersama volutir kanker lainnya, bersama bahu membahu meyakinkan kepada orang tua, betapa kanker harus dilawan. Di tempat itu, Ira dan kawankawan juga membangun komunitas pecinta anak penderita kanker, mencari donatur bagi kesembuhan anak-anak penderita kanker dari kalangan tidak mampu serta memberi rasa

aman dan nyaman selama proses penyembuhan. Dalamcatatan merehabilitasi psikis anak-anak dengan kanker, 30 persen penderita kanker anak tidak terselamatkan. Penyebabnya, salah satunya adalah ketidakmampuan mengendalikan emosi. “Jadi jangan biarkan anak stres dengan perilaku orang tu yang cemas. Lebih baik semangati anak-anak untuk terus maju melawan penyakitnya,” tegas Ira. Spesialis anak dari RS Kanker Dharmais, dr Edy Setiawan Tehuteru, Sp.A (K), MHA, IBCLC mengatakan, kanker adalah suatu kondisi dimana sel telah kehilangan kendali terhadap mekanisme normalnya, sehingga mengalami pertumbuhan yang abnormal. Sel-sel yang

abnormal ini, berubah menjadi parasit dalam tubuh, menggerogoti dan menyebar ke seluruh tubuh lewat aliran darah. Setiap tahun, kata Edy, di dunia ini ada lebih dari 400 ribu kasus kanker anak. Di Indonesia sendiri, diperkirakan jumlahnya mencapai 4100 kasus setiap tahunnya. Lantas, apa saja yang masuk kategori kanker anak? Kanker anak sama artinya kanker yang seringkali terjadi pada anak. Diantara yang paling serinf terjadi adalah leukemia (kanker darah), retinoblastoma (atau yang sering disebut kanker mata), neuroblastoma, limfoma, nasofaring (letaknya di tenggorokan) serta osteosarkoma (kanker tulang). Hingga saat ini, belum

diketahui secara pasti faktor risiko dan penyebab kanker pada anak. Diduga, kanker terjadi karena 4 faktor, yakni genetik, zat kimia, virus dan radiasi. Seringkali kita lupa kalau di sekeliling kita banyak zat kimia dan radiasi yang dapat memicu kanker. Jajanan anak yang berwarna-warni misalnya, kini banyak menggunakan pewarna tektil. Itu jelas berbahaya. Demikian juga dengan piring, cangkir atau dot bayi yang terbuat dari plastik, apakah sudah aman dari efek berbahaya dari bahan latex yang memiliki racun karsinogenik? “Hal-hal itu harus diwaspadai. Kalau didiamkan, ibarat membangunkan macan tidur yang namanya sel kanker itu tadi,” imbuh Edy. (Dian W)


WASPADA Minggu 15 Januari 2012

Puisi Puisi Karya: Muliadi

Waspada Sejarah Presiden dan Calon Presiden Coba lihat, pada usia 65 tahun Padahal Waspada sudah waspada, tapi masih bisa seperti ini Coba lihat Padahal Empu Gandring sudah waspada Tapi Empu mati oleh kerisnya sendiri

Karya: Ratna Sari Mandefa

Di Bawah Batu Nisan

Sajadah bercerita tentang sang hamba Lelah mengemis cinta pada Robb-Nya Mengeluh pada cobaan yang ada Lalai janji lima kali sehari semalam Bosan lantunkan do’a Apakah dapat cium aroma surga?

Ingin rasanya kumengunyah semua hal yang ada di sekitarku Aku tak tau gerangan apa yang menggedor pikiranku Bahkan menghempas jiwaku Aku tak bisa menafsirkannya Bahkan memilihnya Bagiku begitu banyak masalah yang kuhadapi sekarang

Di bawah batu nisan ini Kau telah selipkan kenangan indah Yang memoar di jantung hati

Anti Korupsi

Kemudian aku hanya bergumam Dan menggigit jemariku Seraya melepas rasa geregetku

Coba lihat Bung Karno sewaktu jadi Presiden beliau bijak dan waspada Tapi Bung Hatta mundur jadi wakil presiden

Sandal Berbuntut Petaka

Karya: Susanto

Hanya perkara kecil Prasangka buruk bawa petaka Pantaskah bocah kurus Dikenai jurus? Lantas, kasus ini baik diulas pada orang tua atau dibina Negara Mahasiswi FKIP UMSU

Karya: Siro_Rs

Berdiri dan Bermimpi

Coba lihat Bung Wiranto, Bung Amin Rais, dan Bung Prabowo, mereka cukup aktif dan senantiasa waspada Tapi kenapa.................... jadi presiden

Hari-hari telah bersamaku di sini Semuanya berwarna-warni Tapi tak sempat ingin kukatakan semua ini Namun yang harus kita sadari Bahwa kita harus berani bermimpi

Coba lihat Gusdur waktu jadi Presiden juga waspada dikenal pengayom semua agama Walau begitu Gusdur lupa di istana pakai celana pendek

Taukah kau teman.... Apa yang kau rasakan Di kala mimpi-mimpimu buram Bagaikan tertutup kabut malam

Coba lihat Sewaktu Ibu Mega jadi Presiden dikenal paling waspada Tapi rakyat banyak yang bingung mana Ibu Presiden dan mana Bapak Presiden

Mungkin semua bisa berdiri, Berdiri di atas telapak kakinya sendiri.... Tapi, apakah mereka bisa berdiri Untuk bermimpi di masa depan nanti

Coba lihat Sekarang SBY jadi Presiden, dikenal rakyat paling waspada Besannya pun sampai masuk penjara Tak ada istilah ipar jadi ini menantu jadi itu, Family jadi ini dan anak jadi itu Walau semua bencana dapat diaasi dan korupsi terus dibasmi Tapi kenapa kepopulerannya kok turun Untuk bang Prabowo Untuk mbak Tutut Untuk mas Joko Widodo Untuk bang Dede Yusuf Bila esok engkau jadi presiden Tanamkan di dalam hati tetap waspada dan waspada Agar rakyat selalu mendoakanmu.

Satu pesanku dihati: ‘Berdiri dan bermimpi, Karena dari mimpi semua bisa terjadi’

CAPRICORN (22 DES – 20 JAN) JANU ARI : Ada banyak kejadian di awal tahun.Yakin aja kita pasti JANUARI bisa memberikan yang terbaik. FEBRUARI : Kesehatan mulai terganggu nih. Sebanyak apa pun aktivitas, jangan pernah lupa istirahat. MARET : Udah berapa lama enggak ngumpul bareng teman? Mereka mulai kangen sama keceriaan kita. APRIL : Kontrol dulu emosi, biar semua keinginan terwujud.Yakin aja semuanya pasti bisa kita lewati. AQUARIUS (21 JAN – 19 FEB) JANUARI : Ngumpul bareng teman agenda utama kita bulan ini, guna menemukan sesuatu yang baru. FEBRUARI : Banyak kebahagiaan dan kejutan yang bakal kita alami bulan ini. Enjoy! MARET : Semua perhatian tertuju pada kita. Mafaatkan bulan ini untuk mewujudkan keinginan kita. APRIL :Tenang,masalah gak bakal membuat kita mundur.Lakukan yang kita suka atau jumpai sahabat.

PISCES ( 20 FEB – 20 MAR)

JANU ARI : Awal tahun, tugas sekolah bertumpuk.Tetap semangat! JANUARI FEBRUARI : Kita butuh liburan, Bersama sahabat pasti menyenangkan. MARET : Sedikit masalah enggak bakal membuat kita terpuruk. Never give up! APRIL : Punya banyak mimpi dan harapan boleh aja, tapi lakukan sesuatu biar mimpi jadi kenyataan.

Merahnya tanah berguguran dari julangan tebing Menyosor menerpa rumah-rumah penuh hina Hilang ludes semua Nyawa terbata-bata Kilat pekatpun menyambar Apalagi yang akan terjadi? Di tahun yang tua ini Kita hanya mampu Menanti hari-hari misteri

Karya: Ratna Sari Rambe

Masih bungkam kau pada ketakutan Batinmu mencengkam Ini realita kehidupan Yang jelata tetaplah di bawah Tunduk pada kekuasaan Menjilat kebohongan Kini persitiwa belum usai semua saling tuding Aku hanya kaki tangannya Namun semua sekenario dari ‘ sang Penguasa’


Karya: Nurfirman AS

Ruangan Bisu

Dedaunan Mulai Mati tak lagi ku dengar dedaunan bernyanyi sedang untuk sekadar menyapa dia seolah layu dengan enggan kemudian dari ranting nafasnya, tatapan yang tajam menembus tatapan yang padam

Kebusukan pasti tercium baunya Semakin disimpan semakin menyengat pula Kau tuding aku, membalik fakta Jangan kau simpan bangkai begitu lama Karena Aroma akan membawa jalan ke mana Kebenaran berasal Karya: Ayu Sundari Lestari

Peri Dari Surga Mak, Serupa rembulan kepada malam Begitu juga hadirmu dalam hidupku Ya, kau seberkas cahaya yang menyoroti relungku Berjalan di kerikil tajam menantang matahari Membiarkan tapak kaki memuntahkan merah hingga taman surga menggelepar Sejuta asa kau gantungkan setinggi atap bumi Selalu ada harap terpatri di dadamu “Semoga bahagia tersemat di raut wajah anakku.” Adalah pangkuanmu tempat aku terlelap semasa kecil Muara kasihmu kerap mengalir bak lautan Seperti telaga sejuknya Butir do’a untukku selalu kau titipkan dalam sujudmu Meski beragam corak luka kuukir di jiwamu Kerut senja jelas mengukir lelah Tapi senyum tetap bermekaran seindah selendang pelangi Kaulah peri dari surga yang dikirimkan kepadaku Bait cinta buat Mamak

Waspada/Anum Saskia

Zodiak Kamu Minggu Ini

Peristiwa Yang Belum Usai

aku tak lagi mendengar dedaunan berisik karena klorofilnya mulai terbawa jauh dibenam polusi yang ku kira manisan dari produk cantik

Pramuka SMPN 1 Medan terpilih sebagai juara terbanyak dalam berbagai even perlombaan. dan menjadikan siswa lebih tangkas serta menumbuhkan minat dan kecintaan yang tinggi terhadap alam. Sebelum ini, kata Suyono, peserta Pramuka juga mengikuti kegiatan Jambore Internasional di Malaysia. Hal itu semakin memberikan bukti bahwa peserta dengan segala kemampuan yang, mampu menjalin komunikasi dengan remaja (usia penggalang) dari berbagai negara untuk bersatu dan berkumpul dalam kegiatan perkemahan. “Orang tua

Awal tahun mengusik hati Bencana berat berkompetisi Meluas menghancurkan ilalang bumi Hati meronta Apa yang terjadi?

nanti, di tempat ini telur menetas dan kan saling bertanya cerita kabar dari setiap arah dan dari ujung seberang lalu kan terbuka ranah dengan tempat hijau yang ramah tempat yang biarkan semuanya hinggap di ranting angin dan rerumputan

Ayo kawan kita belum terlambat Untuk mengubah apa yang ingin kita ubah Selagi matahari masih tetap cerah Mari sama-sama kita melangkah

Ibu, mengapa kau begitu cepat Menunduk pada kematian Sementara aku di sini Masih terkatung dalam kasih sayangmu Dapatkah aku memulai waktu yang kini kian berputar Meski kau telah dipinang dengan kematian

sebut saja, kecuali di sini di ruang persegi, tempat burung-burung dan lebah-lebah mencari sarapan pagi mereka

Maka dari itu kau harus sadari Dan tanyakan pada dirimu sendiri Apakah kau kuat atau......... lemah Saat kau ingin berdiri dan melangkah

Di bawah batu nisan ini Ku labuhkan segala rindu Yang membias tarian airmata

Jemari Hati

semua tempat mulai enggan menjadi ruang hinggap termasuk di bagian atap rumah tua tak terawat dan aneka bentuk yang tertahan lalu larut dalam-dalam

Pramuka SMPN 1 Medan The Best PRAMUKA SMPN 1 Medan terpilih sebagai peraih kejuaraan terbanyak dalam berbagai event lomba Perkemahan Pramuka prestasi ke XI Unimed se Sumatera yang berlangsung sejak 4 s/d 7 Januari lalu. Dalam perlombaan itu, sekolah ini berhasil meraih juara I lomba cepat tepat Pramuka, juara I lomba penjelajahan, juara I lomba karikatur Pramuka dan juara I tarik tambang. Sedangkan perlomban lainnya, pionering, topografi dan desain jembatan, mereka hanya mampu meraih juara III. “Selama tiga tahun berturut-turut Pramuka sekolah ini berhasil meraih juara pertama dengan begitu tahun ini piala bergilir dari Rektor Unimed akan menetap di SMPN 1 Medan. Alhamdulillah Pramuka SMPN 1 Medan, the best,” kata Pembina Putra Drs Bangun Suryono didampingi Aprilda Tanjung Spd kemarin. Suyono menyebutkan, siswa di sekolah ini sangat gemar mengikuti kegiatan Pramuka dilaksanakan di sekolah dan kegiatan di luar sekolah untuk pengenalan alam. Pramuka, menjadikan siswa mandiri

Karya: Tri Harun Syafii


Coba lihat Raden Wijaya cukup aktif dan waspada jadi raja Majapahit Tapi kawan seperjuangan semua memberontak

Coba lihat Waktu Pak Habibie jadi Presiden, beliau juga waspada Walau cukup waspada, tapi Timtim lepas dari NKRI

Karya: Muhammad Risnan

Lalai Janji Lima

Dipilah-pilah nyata kerugian Negara Simpan rapi dalam buku dosa Ungkap kasus yang ada Berantas nara kenyang hak bangsa Jangan biar lalu lalang memangsa

Coba lihat Padahal waktu Pak Harto jadi Presiden, cukup waspada Rakyat enak cari makan, aman di mana-mana Pembangunan jalan terus Dari anak-anak sampai orangtua hapal Pancasila Rakyat diajari hukum, rakyat disuruh KB Penduduk ditransmigrasikan, walau ada Petrus Tapi begitupun mungkin tidak diakui sebagai Pahlawan Nasional


turut memberikan dukungan atas program Pramuka ini, hal itu membuktikan kegiatan ini sangat positif,” kata Suyono. Sebelumnya Kepala SMPN 1 Medan, Drs H Ahmad Siregar menyebutkan prestasi bidang Pramuka ini termasuk kegiatan bergengsi di sekolah ini. Pesertanya sangat antusias mengikuti berbagai kegiatan yang didukung oleh pembina yang berpengalaman. “Saya sangat bangga dengan prestasi yang diraih siswa yang bergabung

dalam Pramuka. Saya berharap berbagai program yang mereka ikuti memberikan kontribusi positif bagi dunia pendidikan yang mereka geluti saat ini maupun akan datang. Diusia ini mereka dipersiapkan memiliki kemampuan dalan berbagai bidang yang termuat dalam berbagai kegiatan kepramukaan. Saya memberikan apresiasi atas keberhasilan mereka ini,”kata Ahmad Siregar. ** Anum Saskia

ARIES (21 MAR – 19 APR) JANUARI : Kita berusaha focus dengan apa yang kita kerjakan, awal bagus untuk tahun yang baru. FEBRUARI : Masalah dengan orangtua hanya perlu diselesaikan pakai hati. Mereka pasti akan mengerti. MARET: Wah, kita lagi mementingkan urusan sekolah. Sibuk banget,ngumpul sama teman aja jadi lupa.APRIL : Tahun baru adalah awal baik untuk urusan percintaan. Walau harus melewati berbagai masalah.

Tumbuh Kembangkan Keterampilan Dalam Dunia Remaja MENUMBUH kembangkan keterampilan dalam dunia remaja merupakan suatu proses pembelajaran sains. Dimana hal ini tidak hanya sekedar mengingat melainkan memahami dan mampu menerapkan pengetahuan yang telah dipelajari. Dalam keterampilan mereka harus mampu memecahkan masalah sendiri, menemukan (discovery) sesuatu untuk dirinya sendiri, dan berkutat dengan berbagai gagasan. Dimana keterampilan merupakan belajar secara konstruktivisme dimana siswa harus menemukan dan mentransformasikan informasi komplek ke dalam dirinya sendiri. Biasanya metode belajar akan lebih efektif jika disertai dengan pendekatan pembelajaran dalam hal ini keterampilan karena metode dan pendekatan ini memiliki peran penting dalam proses belajar mengajar. Ada beberapa pendekatan yang bisa dan cocok bagi pelajar khususnya mereka yang bertengger di sekolah menengah pertama (SMP), dan sekolah menengah atas (SMA) adalah pendekatan konsep, keterampilan proses, pendekatan discovery serta pendekatan induktif dan dedukatif. Pendekatan Konsep dan pendekatan Proses Konsep adalah suatu ide atau gagasan yang digeneralisasikan dari pengalaman manusia dengan beberapa peristiwa benda dan fakta. Konsep itu adalah hasil berfikir manusia yang merangkum beberapa pengalaman (Memes, 2000: 40). Konsep dalam fisika sangat penting untuk memperoleh dan mengkomunikasikan pengetahuan. Dengan menguasai konsepkonsep kemungkinan untuk memperoleh pengetahuan baru pada siswa tidak terbatas. Salah satu keunggulan dari model pencapaian konsep ini ialah dalam meningkatkan kemampuan untuk belajar dengan cara lebih mudah dan lebih efektif di masa depan

(Winataputra, 1992: 35). Pendekatan Keterampilan Proses Pendekatan keterampilan proses adalah suatu pendekatan dalam pembelajaran IPA yang beranggapan bahwa IPA itu terbentuk dan berkembang melalui suatu proses ilmiah yang juga harus dikembangkan pada peserta didik sebagai pengalaman yang bermakna yang dapat digunakan sebagai bekal. Pendekatan Diskaveri Cara menemukan sendiri atau diskaveri ini bertujuan untuk memberikan kesempatan pada peserta didik untuk memperoleh pengalaman, penyelidikan sendiri masalah-masalah dengan menggunakan keterampilanketerampilan yang sesuai dengan metode ilmiah. Bagi seorang siswa untuk membuat penemuanpenemuan ia harus melakukan proses-proses mantal, misalnya mengamati, menggolong-golongkan, membuat dugaan, menjelaskan,mengukur,menarik kesimpulan dan sebagainya. Pengajaran“discovery”harus meliputi pengalamanpengalaman belajar untuk menjamin siswa dapat mengembangkan proses-proses“discovery”.”Inquiry”dibentuk dan meliputi“discovery”karena siswa harus menggunakan kemampuan-kemampuan “discovery” dan lebih banyak lagi (Amien, 1987:126)..

Para siswa MTsN Lubukpakam menampilkan kreatifitas mereka didalam lomba alat peraga sain.

Pendekatan Induktif dan Deduktif Model berfikir induktif dirancang dan dikembangkan oleh Hilda Toba dengan tujuan untuk mendorong para pelajar menemukan dan mengorganisasikan informasi, menciptakan nama suatu konsep, dan menjajagi berbagai cara yang dapat menjadikan para pelajar lebih terampil dalam menyingkap dan mengorganisasikan informasi dan dalam melakukan pengetesan hipotesis yang melukiskan antar

hal (Winataputra , 1992: 35-36). Pada pendekatan induktif ini dimulai dengan memberikan bermacammacam contoh. Dari contoh-contoh tersebut siswa mengerti keteraturan dan kemudian mengambil keputusan/kesimpulan yang bersifat umum. Sebaliknya yang disebut dengan pendekatan deduktif pembelajaran adalah yang mulai dengan memberikan sesuatu yang bersifat umum, kemudian peserta didik

CANCER (22 JUN – 23 JUL) JANUARI : Introspeksi diri dulu, siapa tahu masih ada sifat jelek kita yang terbawa ke tahun 2012 ini. FEBRUARI : Kesehatan lagi enggak oke, bantu dengan yoga yuk! MARET : Wah, saatnya berhemat supaya bisa beli barang yang kita mau, jangan terlalu boros ya. APRIL : Cieee ada yang CLBK. Asal belajar dari pengalaman ya.

TAURUS (20 APR – 20 MEI)

JANUARI : Kini saatnya kita mulai mengevaluasi diri. Coba ingat lagi rencana yang belum terwujud. FEBRUARI : Bulan ini bisa jadi bulan cinta untuk kita. Urusan cinta kayaknya makin indah nih. MARET : Waduh kita lagi sibuk banget. Ada aja tugas dan PR yang harus segera diselesaikan. APRIL : Coba deh mulai belajar lagi dengan lebih giat. Gagal sekali biasa, yang penting sering berlatih.

GEMINI (21 MEI – 21 JUN) JANUARI : Saking sibuknya kita sampai lupa untuk hangout bareng teman, yuk rencanain di awal bulan ini. FEBRUARI : Hati-hati tergiur diskon. Tahan dulu keinginan belanja, daripada harus ngutang ke temankan? MARET : Setiap masalah harus dilihat dari sudut pandang berbeda, jadi kita tahu solusi paling tepat. APRIL : Sepertinya ini awal yang indah untuk memulai hubungan yang baru.

LEO (24 JUL -23 AGS) JANUARI : Saatnya memutuskan dan mengambil sikap tegas. Jangan labil, ah. FEBRUARI : Jangan berprasangka buruk dengan pacar, mungkin dia ingin bergaul aja.Berikan waktu. MARET : Batuk dan pilek mulai menyerang. Hindari gorengan dan es. APRIL : Kayaknya kita masih terperangkap masa lalu.

VIRGO (24 AGS - 23 SEP)

JANUARI : Coba lebih aktif di sekolah dan kurangi sifat pasrah kita . Apa yang kita mau bakal terwujud. FEBRUARI : Ada yang lagi bertengkar nih dengan si dia. Selesaikan dengan kepala dingin ya. MARET : Pola makan enggak teratur bikin pencernaan terganggu jangan biasakan telat makan ya. APRIL : Hayo, jangan lupa nabung! Biar barang idaman bisa dibeli. Sabar sebentar lagi, ya.


diminta memberikan contoh-contoh yang sesuai dengan pernyataan semula (Memes, 2000: 43-44). Pembelajaran akan mudah diingat oleh siswa jika disertai dengan contohcontoh kongkrit yang dapat dialami dalam kehidupan sehari-hari. Pembelajaran akan efektif jika disesuaikan dengan lingkangan siswa dalam kesehariannya sehingga akan mudah dipahami. (m38/I)

LIBRA (24 SEP – 23 OKT) JANUARI : Luangkan waktu untuk memanjakan diri. Curhat sama sahabat pasti bikin hati lebih adem. FEBRUARI: Hasil kerja kurang maksimal nih.Tambah semangat ya,kita pasti bisa. MARET : Sering jalan-jalan bikin kondisi tubuh menurun. Jangan lupa luangkan waktu untuk istirahat. APRIL: Sabar, sabar, dan sabar menghadapi tugas sekolah yang banyak.Tenang aja, semuanya pasti beres tepat waktu. SCORPIO (24 OKT – 22 NOV) JANUARI : Makan teratur dan tidur cukup. Enggak susah kan hidup lebih sehat? FEBRUARI : Ada sesuatu yang enggak menyenangkan antara kita dan si dia. Jangan terbawa emosi. MARET : Mengalah gak berarti kalah. Sabar aja. Nanti sahabat pasti tahu kita gak bermaksud sakiti dia APRIL : Walaupun banyak hambatan menghadang di depan, maju terus pantang mundur. Berpikir positif. SA GIT ARIUS (23 NO SAGIT GITARIUS NOVV – 21 DES) JANUARI : Kita lagi romantis-romantisnya dengan si dia. ARI : Mulai sakit-sakitan. Jogging Teman-teman jadi iri tuh. FEBRU FEBRUARI di pagi hari yuk. Plus jangan lupa minum vitamin ya. MARET : Kita lagi sedih dan kesepian. Coba ajak kakak atau adik jalan-jalan ke mal sekalian cuci mata. APRIL : Sukses udah di depan mata.Yang penting kita bisa melewati setiap hambatan. **m31/KW



WASPADA Minggu 15 Januari 2012

Apa Akibatnya Jika Lansia Hidup Dalam Lamunan?

ORANG yang pada masa mudanya aktif dan banyak kegiatan, tentu akan merasa sangat tertekan jika pada masa lanjut usia (lansia) tidak mempunyai kegiatan-kegiatan lagi dan sering melamun. Banyak orang yang di masa menjalani pensiunnya benarbenar tidak mempunyai kegiatan-kegiatan lagi sebagaimana halnya sebelum pensiun, sehingga kondisi kesehatannya cepat mengalami penurunan. Menurut Ilmu kesehatan lansia (Geriatri) bahwa peningkatan kualitas hidup lansia pada umumnya dan kualitas otak khususnya dapat diperoleh dengan memberikan stimulasi (perangsangan) yang kontinu dan terarah, atau dengan perkataan lain bahwa organ otak khususnya pada lansia perlu mendapat stimulasi lingkungan yang banyak, misalnya dengan cara melatih otak untuk dapat mengingat dengan baik. Oleh karena itu, melakukan ak-

tivitas dengan cara melakukan hobi yang dulunya tidak sempat dikembangkan karena kesibukan, pada masa lansia perlu dikembangkan dan dilakukan sehingga kondisi kesehatan dan daya ingat tidak cepat menurun, demikian juga masalah kejiwaan seperti cemas dan depresi lebih sulit terjadi. Sudah barang tentu hobi yang dikembangkan harus disesuaikan dengan kondisi kesehatan tubuh. Hobi untuk berolahraga berat dan berusaha untuk menang (kompetitif) sudah tidak cocok lagi untuk dikembangkan pada lansia, seperti sepak bola, bulu tangkis, bola voli, bola basket, tenis dan lain-lain. Sebaliknya, hobi berupa membaca, menulis, melukis, memancing, berkebun di halaman rumah, beternak, rekreasi dan lain-lain kegiatan yang tidak berat dapat dilakukan. Kegiatan beribadah, beriman dan beramal perlu

ditingkatkan. Hal ini tidaklah berarti bahwa hanya pada masa lansia kegiatan-kegiatan ini perlu dilakukan, tetapi dari sejak kanak-kanak dan usia muda kegiatan kerohanian sudah sewajarnya dilakukan, namun biasanya pada masa lansia kegiatan semacam ini perlu lebih ditingkatkan. Dengan adanya kegiatankegiatan pada masa lansia maka para lansia tidak lagi merasa sedih, sepi dan tertekan jiwanya, merasa dijauhi oleh teman-temannya, merasa tidak berguna lagi dan perasaanperasaan negatif lainnya. Akan tetapi, kondisi tubuh yang awet, segar bugar, energetik, cerah, semangat hidup yang tinggi dengan optimisme yang membara akan dimiliki oleh para lansia dan tubuhpun lama bertahan dalam keadaan sehat. Ya n g m e n j a d i p o k o k permasalahan adalah agar para lansia jangan menjadi orang-orang yang hidup tanpa kegiatan dan terlalu banyak melamun, melainkan jadilah lansia yang mandiri dan produktif, yang dapat mengerjakan sendiri aktivitas kehidupannya sehari-hari dan juga dapat memberikan penghasilan bagi diri dan keluarganya serta tidak menjadi beban bagi orang lain. Sebagaimana semboyan dari Organisasi Kesehatan Sedunia (WHO) bahwa peningkatan usia harapan hidup bukan hanya sekedar add years to life, tetapi haruslah merupakan add life to years, yang artinya bukan hanya sekedar hidup lebih lama melainkan juga seharusnya hidup lama dan masih tetap produktif serta mandiri. Kemandirian dan produktivitas adalah hal-hal yang menyebabkan para lansia dapat tetap hidup sehat dengan mempertahankan kualitas hidup yang baik. Lansia yang tidak mandiri dan produktif lagi sering dianggap sebagai orang-orang yang mengalami krisis kehidupan yang besar, yang dapat menyebabkan lansia tersebut cepat mengalami kemunduran kesehatan

jasmani maupun rohaninya, dan tidak jarang pula dapat terjadi kematian yang lebih dini. Dengan perkataan lain, kemandirian dan produktivitas pada lansia dapat merupakan obat mujarab untuk memperlambat kemungkinan terjadinya kemunduran kesehatan jasmani dan rohaninya, sebab dengan adanya kemandirian dan produktivitas maka para lansia sering merasa bahwa mereka masih berguna bagi lingkungannya. Tidak dapat disangkal lagi bahwa kemandirian dan produktivitas merupakan dua hal yang sangat erat kaitannya di dalam menentukan baik tidaknya kualitas hidup dari lansia.

membuka-nya. Hal yang sama pula dengan aktivitas-aktivitas lainnya. Kemandirian dari lansia akan semakin baik jika lansia tersebut dapat melakukan sendiri aktivitas dengan alat yang lebih sulit tanpa bantuan orang lain (AKS instrumental) seperti membaca, menulis, memasak, berbelanja, menaiki anak tangga rumah, mengkonsumsi obat-obat yang diperlukannya, mengendarai kendaraan, berkebun, berternak, memancing, dan lain-lain. Tambahan lagi, jika lansia masih dapat mengatur perbelanjaannya sehari-hari atau mengatur keuangannya menunjukkan kemandirian yang cukup baik dari lansia tersebut.

Kemandirian Seorang lansia dapat dikatakan mandiri jika dapat melakukan aktivitasnya tanpa bantuan orang lain. Aktivitas yang dapat dilakukan oleh para lansia secara garis besar dapat dikelompokkan atas aktivitas kehidupan sehari-hari (AKS) atau disebut juga sebagai activity of daily living/ADL dan aktivitas kehidupan seharihari dengan memakai instrumen (AKS instrumental) atau disebut juga sebagai instrumental activity of daily living/ IADL 1. AKS merupakan kemampuan dari lansia untuk melakukan aktivitas-aktivitas mendasar di dalam kehidupan sehari-hari, seperti makan, minum, berpakaian, buang hajat, berkomunikasi dan lain-lain. Dalam hal makan, seorang lansia harus mampu untuk menyiapkan makanan bagi dirinya sendiri, menyendokkan makanan ke dalam piring atau mangkuk, memilih makanan yang dihidangkan, kebersihan peralatan untuk makan serta kerapian untuk meletakkan peralatan tersebut pada tempatnya, pendek kata kemandirian lansia dalam hal makan adalah sebagaimana layaknya seorang yang telah dewasa jika makan. Demikian juga dalam hal berpakaian, seorang lansia diharapkan mampu untuk mengambil pakaiannya dari rak dan memakainya serta dapat mengancing dan

Produktifitas Seorang lansia dapat dikatakan produktif jika ia masih dapat melakukan pekerjaan yang dapat menghasilkan uang baik bagi diri sendiri maupun keluarganya, masih mampu berkarya yang bermanfaat bagi orang banyak, dapat menciptakan lapangan kerja bagi orang lain, mampu memberikan bimbingan dan nasehat bagi orang lain. Kesehatan Kemandirian dan produktivitas harus pula didukung oleh faktor kesejahteraan, yaitu terpenuhinya kebutuhan dari lansia tersebut, baik lahiriah maupun batiniah. Kebutuhan lahiriah adalah kebutuhan yang bersifat material seperti sandang, pangan, dan lain-lain, sedangkan kebutuhan batiniah adalah perlunya seseorang lansia masih dihargai oleh orangorang yang berada di lingkungan sekitarnya, dengan hak dan kewajiban yang sama sebagaimana halnya pada orang-orang yang lebih muda. Selain daripada itu, peran sertanya di dalam kegiatan masyarakat, kesehatan dan kebugaran jasmani dan rohani, dan lain-lain merupakan juga kebutuhan batiniah . (dr.Pirma Siburian Sp PD, K Ger, spesialis penyakit dalam dan penyakit lansia, dokter pada klinik lansia Klinik Spesialis Bunda dan RS Permata Bunda Medan).

Mengenal Penyakit Rabies Lebih Dekat SELAMA ini kebanyakan orang mungkin cuma mengetahui rabies hanya sebatas identik dengan penyakit anjing gila yang disebabkan oleh gigitan anjing atau segelintir hewan lain. Yang belum pernah melihat penderitanya pun tak mengetahui sejauh mana akibat serangannya. Dan beberapa waktu belakangan ini media berita terutama di Sumatera Utara dipenuhi dengan laporan dari dinas terkait tentang tingginya kasus Rabies dimana Sumatera Utara menjadi propinsi tertinggi kedua dari jumlah kasus yang ditemukan setelah Bali. Lantas banyak lagi headline-headline berita seputar masalah ini, dari yang biasa hingga yang sedikit dibalut bombastisme media termasuk yang menyorot ada berapa kasus meninggal dalam jangka waktu tertentu. Kewaspadaan memang perlu, namun lebih dari itu, kita harus mengenali dulu lebih dekat tentang penyakitnya. Sekilas Tentang Rabies dan Virusnya Rabies merupakan penyakit infeksi akut yang diakibatkan oleh virus rabies dan menyerang susunan saraf pusat. Penularannya dapat terjadi secara zoonotik, yaitu ditularkan dari hewan ke manusia, melalui gigitan. Dan rabies bukan hanya ditularkan lewat gigitan anjing atas sebutannya sebagai penyakit anjing gila. Beberapa hewan lain seperti kucing atau kelelawar, kera, rubah atau sigung yang kemungkinannya lebih kecil, juga bisa menularkannya lewat gigitan. Penyakit ini sudah dikenal dari peradaban awal manusia sebagai kuman yang ada di air liur hewan. Virusnya sendiri secara penggolongan termasuk ke dalam keluarga Rhabdovirus dengan spesies hewan yang bervariasi tergantung letak geografis. Dibanding negara-negara yang sudah benar-benar maju, beberapa negara Asia, Afrika dan Amerika Latin masih belum bisa mengelimi-

nasinya terkait regulasi yang membuat masih banyaknya hewan-hewan seperti anjing atau kucing liar berkeliaran bebas di jalanan. Dari air liur hewan perantara, rabies bisa menginfeksi penderitanya baik manusia atau hewan lain lewat gigitan atau jilatan pada kulit yang terluka. Dari sini, virus akan masuk melalui sistem persarafan ke pusat persarafan di otak dan tulang belakang sambil bereplikasi ke jaringan lain termasuk air liur, dan hewan yang terinfeksi bisa mengalami perubahan perilaku menjadi agresif atau ganas. Air liurnya kerap menetes terus dan mati dalam waktu cukup singkat. Karena itu penderita-penderita gigitan hewan biasanya juga memerlukan pemantauan terhadap hewan pelakunya untuk memprediksi resiko penularan serta infeksinya. Selain dari sana, sebagian ahli juga menganggap virus rabies bisa ditularkan secara inhalasi dari udara di tempat-tempat dengan resiko pencemaran tinggi, walaupun ini masih sangat jarang terjadi dan tak perlu dirisaukan. Gejala Yang Dialami Penderitanya Pada manusia, masa inkubasi rabies rata-rata terjadi dalam 30-40 hari setelah terinfeksi namun pada beberapa kasus juga bisa sangat lama hingga hitungan bulan. Luka pada setiap daerah dari mukosa, badan, tangan atau kaki pada tempat gigitan terutama yang lebar atau dalam akan meningkatkan resiko infeksinya. Dari stadiumnya, pada stadium awal atau prodromal, gejalanya biasanya tidak terlalu jelas berupa demam, pusing-pusing atau kelelahan seperti infeksi virus lain. Selanjutnya, karena menyerang persarafan, pada stadium selanjutnya yang dikenal dengan istilah stadium sensoris akan muncul rasa nyeri dan panas seperti terbakar di daerah luka diikuti gejala gangguan saraf lain mulai dari kelebihan produksi

air liur (hipersalivasi), banyak berkeringat (hiperhidrosis), serta air mata (hiperlakrimasi) hingga pelebaran pupil. Lebih lanjut, pada stadium berikutnya yang disebut eksitasi, penderita bisa kejang-kejang didahului rasa gelisah dan fobia terhadap rangsangan luar termasuk udara, cahaya, suara atau air. Proses pernafasan dan pencernaan yang diatur oleh sistem saraf juga ikut terganggu. Stadium akhirnya adalah stadium paralitik dimana kelumpuhan bisa terjadi secara progresif, dan pada beberapa kasus, bisa mengarah pada kemungkinan paling fatal terutama yang tidak ditangani secara adekuat dalam rentang waktu bervariasi mulai dari hitungan hari atau lebih lama. Penanganan dan Pencegahan Infeksi Penyakit rabies, bagaimanapun, bukan penyakit yang tidak bisa diobati. Kuncinya ada pada penanganan dini sebelum infeksi meluas ke otak dengan gejalagejala berat. Jangan menganggap remeh gigitan hewan baik hewan peliharaan pribadi sekali pun, terlebih yang

memiliki kemungkinan kontak dengan hewan lain di sekitarnya. Tindakan pertama adalah dengan mencucinya dengan sabun (lebih baik antiseptik) di bawah air mengalir selama 10-15 menit, atau segera beri antiseptik pada luka. Individu-individu yang belum mendapat vaksin antirabies juga biasanya memerlukan suntikan anti tetanus. Sementara tindakan pencegahan lain yang terkait dengan pemberian vaksin, karena masih cukup sulit didapat dan harganya mahal, lebih difokuskan pada orangorang yang memiliki resiko tinggi terhadap gigitan hewan seperti pekerja ternak, dokter hewan, petugas laboratorium maupun penduduk di lingkungan yang beresiko tinggi sekali pun. Mengenai pemberiannya, biasanya vaksin bisa diberikan secara tunggal maupun kombinasi, dan adanya kemungkinan penurunan antibodi dalam jangka waktu tertentu, kadang pemberian ulangnya diperlukan setelah tiga tahun berikutnya. Vaksinasi terhadap hewan juga boleh diberikan sebagai tindakan pencegahan. Seperti yang dikatakan

Manfaat Daun Sukun Bagi Kesehatan DAUN sukun mempunyai khasiat buat kesehatan, efektif untuk mengobati berbagai penyakit seperti liver, hepatitis, sakit gigi, gatal-gatal, pembesaran limpa, jantung, dan ginjal. Bahkan, masyarakat Ambon memanfaatkan kulit batangnya untuk obat mencairkan darah bagi wanita yang baru 8-10 hari melahirkan. Beberapa pakar obat tradisional memang meragukan khasiat daun sukun. Namun masyarakat sudah percaya dan membuktikan khasiat daun sukun yang dapat menyembuhkan penyakit liver, jantung dan ginjal. Daun sukun diyakini mengandung beberapa zat berkhasiat seperti asam hidrosianat, asetilcolin, tanin, riboflavin, dan sebagainya. Zat-zat ini juga mampu mengatasi peradangan. Selain itu secara empiris, daun sukun mampu menyelamatkan ginjal yang sakit. Sebuah riset yang dilakukan LIPI dengan peneliti asal Cina juga mengungkapkan daun sukun sangat berguna bagi proses penyembuhan penyakit kardiovaskular. Bambang Indro Mardi, ahli tanaman obat sekaligus pengobat alternatif dari Jakarta mengakui bahwa daun sukun memiliki beragam manfaat untuk menjaga maupun meningkatkan kinerja ginjal, sebagai penurun kolesterol, sekaligus cocok untuk menjaga kesehatan pembuluh darah maupun jantung. Daun sukun juga dipercaya untuk pengobatan penyakit jantung. Karena daun sukun cocok untuk menjaga kesehatan pembuluh darah maupun jantung. Caranya dengan memanfaatkan satu lembar daun sukun tua yang masih menempel di pohon. Daun sukun tua mempunyai kadar zat kimia maksimal. Daun sukun juga bermanfaat sebagai penurun kadar kolesterol dan sebagai antikanker. Selain melindungi jantung, daun sukun terbukti mencegah inflamasi atau peradangan. Berbagai sumber menyebutkan tentang khasiat daun sukun sebagai antiinflamasi. Dalam riset itu membuat semua tikus mengalami oedema atau peningkatan cairan di interstisial. Untuk memanfaatkan daun sukun dalam pengobatan caranya bermacam macam. Langkah awal, siapkan tiga lembar daun yang berwarna hijau tua, namun masih menempel di dahan. Kemudian cuci bersih pada air mengalir. Selanjutnya dirajang lalu jemur sampai kering. Siapkan pula wadah lalu isi dengan air bersih dua liter. Usahakan wadah tersebut terbuat dari gerabah tanah liat, tapi jika pun tak ada bisa juga memakai panci stainless steel. Masukkan dedaunan kering itu lalu dimasak sampai mendidih, sisakan air tersebut sampai volumenya tinggal separuh. Selanjutnya, tambahkan air bersih satu liter, dan didihkan lagi sampai separuh. Kemudian saringlah rebusan daun sukun itu. Warna airnya merah, mirip teh. Rasanya agak pahit. Silakan diminum sampai habis, tak boleh disisakan untuk kesesokan harinya. Demikian seterusnya. Agar tidak repot bolak-balik mengambil tiga lembar daun, sebaiknya sediakan rajangan daun sukun kering untuk seminggu. Caranya, siapkan lembar daun hijau tua sebanyak 3 x 7 = 21 lembar. Proses selanjutnya persis seperti cara di atas, sehingga kita punya sejumlah rajangan daun sukun kering, tapi dibagi-bagi menjadi tujuh bungkus. Tiap hari ambil sebungkus, rebus, saring, dan minum. Jika Anda termasuk tak tahan pahit, bisa ditambahkan sedikit madu setiap kali minum. Daun sukun juga bisa untuk mengobati penyakit jantung. Caranya, ambillah satu lembar daun sukun tua yang masih menempel di pohon. Daun sukun tua mempunyai kadar zat kimia maksimal. Cucilah sampai bersih lalu dijemur hingga kering. Kemudian rebus sampai mendidih dengan lima gelas air dan sisakan sampai tinggal separuh. Tambahkan air lagi hingga mencapai volume lima gelas. Setelah disaring, rebusan air itu siap diminum dan harus habis tak bisa disisakan untuk esok hari. Untuk lever, petiklah beberapa lembar daun sukun yang sudah tua, lalu cuci hingga bersih. Setelah itu rebus dengan air secukupnya sampai berwarna merah tua. Bila sudah dingin, minumlah airnya. Lakukan setiap hari 2 kali, yaitu tiap pagi dan sore dengan dosis sekali minum 1 gelas. Perlu untuk diingat daun sukun muda tidak dapat digunakan sebagai makanan lalapan, melainkan yang bermanfaat adalah daun sukun tua dan hanya digunakan dengan cara direbus atau dicelur ke dalam air panas dan di gunakan sebagai obat tradisional. Dari daun yang lebar tersebut memiliki khasiat tersendiri bagi kesehatan dan dengan mengkonsumsinya sehari satu gelas maka penyakit seperti gengguan ginjal, kolesterol tinggi, asam urat, dan lain sebagainya dapat diatasi dengan ramuan ini. Selain baik untuk ginjal, daun sukun ternyata juga jitu untuk meredam laju kolesterol jahat dalam darah. Penting juga untuk diingat selama meminum ramuan daun sukun, hindari makan sayur bayam, daun singkong dan kangkung serta jeroan atau daging merah, karena dapat meningkatkan kekentalan darah yang membuat otot menjadi kram. *Fahmi Isya

Dinkes Aceh Fokus Kabupaten Tertinggal Bidang Kesehatan DINAS Kesehatan (Dinkes) Aceh akan memfokuskan upaya peningkatan pelayanan dan sumber daya manusia (SDM) terhadap 13 kabupaten yang tertinggal di bidang kesehatan melalui program “Kalakarya” mulai tahun 2012. “Terdapat 13 kabupaten di Aceh yang bermasalah dengan kesehatan. Wilayah itu menjadi salah satu fokus perhatian kita untuk ditingkatkan pada 2012 ini,” kata Kepala Dinkes Aceh M Yani. Tolok ukur wilayah yang bermasalah dengan kesehatan itu terkait dengan gangguan gizi bagi Balita, rendahnya capaian imunisasi dan angka kematian ibu dan bayi yang masih tinggi, seperti di Kabupaten Aceh Barat, Nagan Raya dan Aceh Jaya. “Daerah bermasalah dengan kesehatan itu akan terus dikejar pada 2012 sehingga ke depan akan lebih baik. Jika itu tercapai maka Aceh yang berada di peringkat 10 terburuk bidang kesehatan secara nasional, akan hilang,” kata dia menjelaskan. Melalui program “Kalakarya” itu M Yani mengatakan Dinkes Propinsi Aceh akan melakukan pendampingan terhadap kabupaten yang bermasalah dengan kesehatan. Namun

beberapa dinas terkait termasuk dinas kesehatan ataupun peternakan, terutama di daerah dimana kasuskasus rabies masih tinggi terutama Bali (nomor 1) dan Sumatera Utara (nomor 2), menuju program-program bebas rabies di tahun-tahun mendatang, masih banyak kendala dalam pemberantasannya secara keseluruhan. Selain regulasi yang sulit terpantau serta kurangnya kesadaran serta kewaspadaan masyarakat terutama di daerah-daerah tinggi resiko, penyediaan Vaksin Anti Rabies (VAR) juga masih sangat terbatas. Untuk sementara ini, agaknya cukup dengan meningkatkan kewaspadaan atas tingginya jumlah kasus yang terjadi melalui laporanlaporan tadi. Namun sebagai masyarakat di luar pihak yang bertanggung jawab untuk program-program itu, yang terpenting adalah memahami rantai penularannya serta karakteristik infeksi yang terjadi. (dr. Daniel Irawan)

terhadap program “Kalakarya” itu masing-masing wilayah bisa mencarikan nama lain yang dinilai lebih cocok untuk melaksanakannya. Artinya, kalau secara nasional program peningkatan kesehatan diberinama “Kalakarya” maka pemerintah kabupaten dapat menganti dengan nama lain sesuai kemauan daerah masing-masing. Di Aceh Barat, program “Kalakarya” diberi nama dengan “Bulen boh hatee” (bulan buah hati),” jelasnya. Dalam program “Kalakarya” itu diharapkan seluruh komponen masyarakat termasuk bupati dan wali kota dan DPRK sampai ke kepala desa agar menghadiri setiap adanya urung rembuk sebagai upaya bersama meningkatkan derajat kesehatan masyarakat di masa mendatang. Saat dilakukan urung rembuk, M Yani menyebutkan pemerintah akan mempresentasikan berbagai program untuk dijelaskan kepada masyarakat dengan harapan penduduk dapat berpartisipasi dalam upaya peningkatan derajat kesehatan tersebut. Melalui program itu maka pemerintah dan masyarakat akan melacak bayibayi sampai ke pelosok desa untuk diberi imunisasi,” kata Kepala Dinkes Aceh itu. *Sayuti, aktivis kesehatan di Aceh

DPRD Medan Soroti Buruknya Pelayanan Kesehatan Di Medan MELALUI rapat paripurna DPRD Medan, Drs Irwanto Tampubolon ditetapkan menjadi Ketua Fraksi Medan Bersatu (F MB) DPRD. Rapat ini dipimpin Ketua DPRD Medan Drs Amiruddin didampingi wakil Ketua Ikrimah Hamidy, Sabar Sitepu dan Augus Napitupulu. Sedangkan dari kalangan eksekutif dihadiri Wakil Walikota Medan Drs Dzulmi Eldin, Sekda Ir Syaiful Bahri dan seluruh SKPD jajaran Pemko Medan. Dalam rapat paripurna perubahan komposisi Fraksi Medan Bersatu DPRD Medan yang dibacakan Sekwan DPRD Medan OK Zulfi, tertanggal 4 Januari 2012, NO. 039/ F.MB/ DPRD-Medan/1/2012. Selain Ketua Irwanto Tampubolon, Wakil Ketua Janlie, Sekretaris Dra Lily MBA, anggota Remon Simatupang dan Godfried Lubis. Usai paripurna penetapan komposisi, Ketua Fraksi Medan Bersatu DPRD (Partai PPRN) Irwanto Tampubolon kepada wartawan menyampaikan sejumlah sorotan terhadap kinerja SKPD Pemko Medan. Seperti, keprihatinan masalah pendidikan khususnya Penerimaan Siswa Baru (PSB) dan sarana prasarana. Juga masalah pelayanan kesehatan terbukti masih dikeluhkan masyarakat miskin. Menurut Irwanto, adapun masalah pendidikan terkait system PSB di kota Medan selama ini dinilai sarat kepentingan yang muaranya berpihak kepada penguasa dan merugikan masyarakat bawah. Ke depan

diharapkan PSB lebih transparan dan koordinasi yang melibatkan seluruh elemen masyarakat. Sistem PSB hendaknya dilakukan dengan sistem online sehingga mudah diakses calon siswa dan masyarakat luas sehingga terhindar kecurangan. Begitu juga kepada Kepala Dinas Pendidikan Kota Medan yang baru dijabat oleh Drs Rajab Lubis diharapkan lebih serius memperhatikan masalah pendidikan khususnya system PSB dan sarana di kota Medan yang selama selalu bermasalah. “Pejabat yang baru ini kita harapkan lebih peduli dari pejabat lama”, ujar Irwanto. Ditambahkan Irwanto, untuk tahun ini Kadis Pendidikan yang baru diharapkan dapat mengatasi masalah pendidikan. Seperti halnya dapat merealisasikan perbaikan beberapa gedung sekolah dan mobilernya. Karena, sebelumnya banyak temuan DPRD Medan mobile SDN di Jl Ayahanda banyak kupak kapik tak layak pakai. “Kita harapkan seluruh bangunan SDN dan SMPN di kota Medan dapat diperbaiki dengan bagus dan mobile diganti sehingga sarana pendukung peningkatan mutu pendidikan di kota Medan dapat terwujud”, harap Irwanto. Ditambahkan, Kadis Pendidikan juga disarankan punya kebijakan dan dapat mengalihkan rencana perbaikan MCK ke pengadaan mobiler. Begitu juga masalah kesehatan, diharapkan untuk tahun 2012 ini, Walikota Medan dapat memperhatikan lebih serius. Sehingga tidak didapati lagi masyarakat gizi buruk dan buruknya pelayanan kesehatan warga miskin di Medan.(m30)

WASPADA Minggu 15 Januari 2012


B5 Melintasi Kemacatan Kota Medan RUDI, 34, menghela napas. Laju sepeda motornya dihentikan di depan traffic light Simpang Empat antara Jl. Brigjend Katamso dan Jl. Pemuda. Angka menunjukkan 150 pada settingan timer lampu lalu lintas.

MENGATUR ARUS LALU LINTAS: Polisi sibuk mengatur arus lalu lintas jika kemacatan panjang terjadi.

Waspada/Surya Efendi

Beberapa kenderaan sepeda motor lainnya mengikuti Rudy bahkan menyalip ke sisi kanan dan kirinya. Tidak terkecuali kenderaan roda empat yang menyempiti beberapa kenderaan sepeda motor lainnya. Sampai hitungan timer lalu lintas warna merah berganti menjadi hijau, namun Rudy dan pengendara sepeda motor lainnya juga tidak dapat berjalan. Klakson pun bersahut ria, namun pengendara yang mengarah Jl. Pemuda. “Woy, sudah masuk saja,” ujar salah seorang pemuda pengendara dari belakang. Akhirnya para pengendara menerobos pengendara yang menyilang mereka sedikit demi sedikit. Tak bisa dielakkan kemacatan panjang pun terjadi. Inilah gambaran sedikit kemacatan lalu lintas di kota Medan. Menurut sejumlah pengendara seharusnya settingan timer lampu lalu lintas (traffic light) yang paling optimal harus mengadopsi jumlah volume lalulintas yang melintasi persimpangan sehingga menghasilkan waktu tunggu terendah dengan antrean kendaraan terpendek. “Untuk mengetahui penghitungan rentang waktu (timer) lampu lalulintas settingnya dilakukan dengan survey terhadap kaki-kaki persimpangan ditambah dengan volume lalulintas yang masuk ke kaki persimpangan tersebut lengkap dengan klasifikasi jenis kendaraannya,” ujar Konsultan Retimer Traffic light Medis Surbakti kemarin di Medan. Setelah dihitung dengan kajian volume lalulintas di kota Medan baru bisa dibuat atau diatur mensetting timer lampu lalu lintas yang paling optimal yakni mengadopsi volume lalulintas yang masuk

ke persimpangan sehingga mempunyai waktu tunggu yang terendah dan antrian terpendek. Selain itu, lanjutnya, masalah hambatan samping yakni parkir, aktivitas pedagang kaki lima, aktivitas bisnis yang ada di daerah pertokoan. “Akibat aktivitas ini menyebabkan kapasitas jalan yang tadinya bisa melewatkan 500 kendaraan perjam akan berkurang berbanding lurus dengan berapa besar badan jalan itu terganggu akibat hambatan itu,” ujarnya. Dan ketiga, menurutnya, karena mistraffic yakni kendaraan yang melalui ruas jalan tersebut tercampur antara kendaraan mempunyai akselerasi tinggi serta bisa rendah contohnya betor, sepeda dayung dan seterusnya. “Kita tahu akselerasi dari becak ini tidak sama dengan akselerasi mobil penumpang ataupun sepedamotor sehingga becaknya itu tertinggal dengan kendaraan yang ada di depannya dan ini akan mengganggu pergerakan kendaraan yang ada di belakangannya,” ujar Surbakti kembali. Kemudian pergerakan antar lajur. Kalau pengendara itu tidak sain lampunya tidak jelas kemana arahnya. “Masih ada lagi masalah kualitas jalan yang berlubang mengakibatkan perlambatan pergerakan. Kalau ini terjadi di persimpangan perlambatan itu akan mengurangi kapasitas persimpangan,” jelasnya. Kemudian masalah jalan lagi, ada perbedaan tinggi antara jalan kita dengan jalan kereta api. Ini pun mengakibatkan perlambatan pada persimpangan contohnya di Jalan Pandu.Ketika kita akan naik dan turun akan mengakibat lambat laju sehingga kendaraan. Sementara Rudy, pengendara sepeda motor menyatakan kemacatan lebih banyak diakibatkan ketidaksabaran masyarakat kota Medan ketika menunggu pada saat jeda waktu lampu merah sehingga kebanyakan mereka menerobos. “Kita berharap polisi lalulintas selalu ada di setiap persimpangan lampu merah sehingga bagi mereka yang melanggar langsung ditindak di tempat dengan menilangnya,” ujarnya. (m38)

Waspada/Surya Efendi

JAM PULANG KERJA: Kemacatan terjadi di Jln. Palang Merah menuju simpang gedung Uniland hampir setiap hari pada saat jam pulang kerja.

Waspada/Surya Efendi

MACAT JALAN PANDU: Pemko perlu mencari solusi atas kemacatan yang setiap sore terjadi di Jln. Pandu terutama di kawasan persimpangan PDAM Tirtanadi Jln. SM Raja.

Waspada/Surya Efendi

MACAT JALAN CIREBON: Macat di sepanjang Jln. Cirebon dikarenakan banyaknya jalan-jalan kecil di kiri kanan jalan tersebut.

Waspada/Surya Efendi

BEREBUT SALING MENDAHULUI: Kemacatan juga disebabkan sesama pengemudi kendaraan berebut saling mendahului.

Waspada/Surya Efendi

BERTAMBAH PARAH: Bertambahnya jumlah kendaraan dengan semakin kecilnya badan jalan menambah parah kemacatan.



Konsultasi Teknologi Informasi Diasuh oleh Codealgo

Dari : 0878070xxxxx Hai codealgo, gimana ya caranya menginstall windows 7 ke laptop acer tipe 4736. Terima kasih! Jawab : Hai, cara menginstall windows 7 ke dalam laptop acer tipe 4736 sama saja seperti menginstall sistem operasi lain, pertama pastikan anda sudah memasukkan drive yang berisi master sistem operasi sebagai first boot. Langkah selanjutnya adalah menentukan partisi dimana windows akan diinstall, apabila pada partisi tersebut sudah ada sistem operasi windows, maka anda akan ditanyakan untuk menimpa partisi tersebut atau menghapus partisi tersebut.

Minggu 15 Januari 2012

Bantuin Aku, Dong?! BUAT yang punya problem, khusus remaja atau pelajar tapi susah buat dipecahkan, seperti masalah sekolah, pacar, ortu yang suka ngomel atau teman yang nyebelin, jangan bingung dulu. Tim Remaja Waspada dan Mbak Fifi yang nama lengkapnya Fidia Rizki, S.Psi, psikolog lulusan Universitas Medan Area akan mencoba membantu kamu mencari jalan solusinya. Silahkan kirim pertanyaan melalui SMS ke

Dari : 0819904xxxxx Assalamualaikum codealgo, aku Bayu di Perbaungan, mau nanya nih, notebook hp mini 110-3000. Masalahnya, kenapa ya, notebooknya gak bisa nyimpan baterai, kecuali sambil di cas, istilahnya, kayak komputer PC biasa. Harus pakai arus listrik, gimana ya dengan notebooknya, apa yang harus aku buat, soalnya aku udah kehabisan akal, ditunggu ya jawabannya, makasih codealgo. Jawab : Waalaikumsalam Bayu, melihat penjelasan yang kamu berikan, ada beberapa kemungkinan yang bisa terjadi sehingga baterai laptop kamu tidak bisa terisi. Pertama, bisa saja baterai kamu mengalami kerusakan fisik (bocor, rusak komponen, dll) sehingga tidak bisa terisi atau bisa saja inverter laptop kamu mengalami masalah sehingga arus listrik dari adaptor tidak bisa masuk ke dalam baterai kamu. Kami sarankan kamu membawa laptop kamu ke service centre hp terdekat untuk mengetahui mana yang merupakan masalah kamu. Apabila yang mengalami kerusakan adalah baterai, kami sarankan untuk mengganti baterai kamu, biasanya saat ini kisaran baterai laptop hp mini adalah 500-600 ribu rupiah, sedangkan bila inverter kamu yang rusak, maka sebaiknya inverter tersebut diganti komponennya. Semoga dapat membantu, terima kasih.


No 082161353595, Jawaban akan dibalas melalui Harian Waspada, jadi dimohon sabar menunggu. Tanya: Kiki- Hp 6281362843xxx Assalamualaikum. Salam kenal buat mbak Fifi. Mbak saya mau curhat… saya punya mama yang sangat saya sayangi… tapi sifat mama suka emosian dan mau mukul. Gimana supaya mama lebih sabar dan gak emosian.. karena sebenarnya mama tuu baik dan penyayang. Makasih atas sarannya.

Setelah memilih partisi maka sistem operasi akan mengcopy file yang dibutuhkan dari driver master ke dalam partisi harddisk untuk menjalankan instalasi. Saat instalasi, kamu akan diminta untuk memasukkan serial key produk windows kamu. Apabila instalasi telah selesai, kamu akan dibimbing untuk mensetup environment windows kamu untuk pertama kali. Setelah itu kamu bisa menggunakan windows kamu, semoga dapat membantu, terima kasih. Dari : 0877138xxxxx Hai codealgo, saya mendownload anti virus gratis kaspersky AV12.0.0.374en 2012/76,4MB, gimana cara menginstallnya dan cara menggunakannya? KAV-nya minta kode aktivasi sebanyak 3 kolom berapa kodenya? Laptop saya ACER ASPIRE 4920, mohon bantuannya, terimakasih. Jawab : Kaspersky setahu kami bukanlah anti virus gratis, master instalasi mungkin gratis, tapi key aktivasi yangdiminta tersebut harus kamu beli dari kaspersky. Kami menyarankan agar kamu membeli key tersebut pada website resmi mereka. Semoga dapat membantu, terima kasih. Dari : 0853586xxxxx Assalamualaikum codealgo, saya Aqilla bagaimana caranya lagu dari kaset tercopy di laptop saya dan satu lagi bagaimana cara masukin

PEMBERITAHUAN : NB : Kirimkan pertanyaan kamu ke codealgo melalui nomor 081370311355 atau ke email Setiap pertanyaan yang masuk akan kami jawab menggunakan metode FIFO (First In First Out). Codealgo hanya akan menjawab pertanyaan konsultasi melalui rubrik konsultasi Waspada. Kunjungi website kami untuk mengetahui produk dan jasa yang kami tawarkan di yang akan segera dilaunching dalam waktu dekat.

foto supaya terupload ke facebook. Trims. Jawab : Waalaikumsalam Aqilla, untuk mengcopy lagu dari kaset yang dibutuhkan adalah perangkat recording dan tidak bisa melalui komputer. Hal ini disebabkan karena media penyimpanan pada kaset berbeda dengan media penyimpanan komputer baik jenis simpanan file maupun media penyimpanannya. Dengan menggunakan perangkat recording, kaset kamu akan diputar dan lagu kamu akan direkam lalu akan disimpan kedalam media penyimpanan baru yang support untuk komputer. Sedangkan untuk memasukkan foto ke dalam facebook, pertama sekali kamu harus terkoneksi ke internet, lalu mendaftar ke facebook. Setelah mendaftar ke facebook, langkah selanjutnya kamu tinggal mengupload foto menggunakan menu photos pada facebook. Semoga dapat membantu, terima kasih. Dari : 0813702xxxxx Hai codealgo, saya mau tanya, bagaimana caranya memproteksi flash disk agar tidak gampang terserang virus. Tolong dijawab ya. Thks Jawab : Hai juga, biasanya pada metode penyerangan virus untuk flash disk dan semacamnya (removable storage), kebanyakan dari virus tersebut menggunakan file autorun seperti AUTORUN.INF sebagai basis untuk menyebarkan diri. Salah satu cara agar dapat memproteksi removable storage dari penyebaran virus adalah dengan tidak membiarkan file autorun.inf masuk ke dalam flash disk kita. Untuk itu, ada banyak trik yang bisa anda terapkan agar flash disk anda dapat terproteksi dari file tersebut,

salah satunya adalah, pada root direktori partisi atau flash disk anda, buat sebuah folder bernama AUTORUN.INF. kemudian ubah atribut folder tersebut dengan “read only” dan “hidden”. Hal ini dapat menghambat virus yang hendak menginfeksi flash disk karena windows tidak memperbolehkan pembuatan nama file yang sama dengan nama folder. Selain itu, cara mendelete folder sangat berbeda dengan file sehingga virus tidak akan mudah menghapus folder tersebut. trik ini, walau sederhana, dapat berguna untuk mencegah penularan pada flash disk. Selain trik tersebut, anda juga bisa menggunakan softwaresoftware seperti flasdisinfector, USB disk security yang berfungsi untuk menghapus file-file yang aneh yang masuk ke removable storage. Selamat mencoba dan terima kasih. Dari : 0878671xxxxx Hai codealgo, saya heran laptop saya koq baru saja saya install drivernya koq tiba-tiba jadi uninstall ya Jawab : Hai, sebelumnya kami harus mengetahui jenis driver apa yang sedang kamu install? Apakah kamu baru install ulang? Apa jenis OS yang kamu gunakan? Bagaimana spesifikasi hardware laptop kamu? Kemungkinan yang dapat kami tangkap dari pertanyaan kamu adalah driver kamu tidak kompatibel dengan OS atau driver kamu tidak terinstall dengan sempurna sehingga driver kamu langsung rollback. Pastikan driver yang kamu gunakan memang dibutuhkan oleh laptop kamu dan sesuai dengan jenis sistem operasi yang kamu gunakan, semoga dapat membantu, terima kasih.

Jawab: Waalaikumsalam, dear Kiki yang baik.. Mbak senang membaca curhatmu.. masih muda tapi bersikap bijak. Kiky.. setiap orang tua punya respon masingmasing dalam mengasuh anaknya. Ada yang lebih sabar, cukup sabar dan tidak sabaran kembali lagi ke karakter beliau dan bagaimana pola asuh orang tuanya membesarkan cukup memberi andil dalam mengasuh anak-anaknya. Jadi mengubah mama untuk jadi lebih sabaran dan tidak emosian agak susah juga, kecuali kesadaran mama untuk merubah perilakunya. Seberapa parah sikap mama nyakitin kamu? Kalau sangat mengganggu, kamu bisa meminta bantuan pihak yang lebih netral, seperti nenek, tante.. mudah-mudahan beliau bisa menasehati dan membantu. Atau ciptakan suasana kedekatan antara kamu dan mama, missal disaat santai kamu cerita sama mama, apakah ada masalah yang bikin beliau jadi emosian? Atau ada harapannya yang kurang kesampaian supaya dipenuhi agar mama bersikap lebih sabaran? Kadang orang tidak menyadari kalau perilakunya sudah menyakiti orang lain.. jadi tidak ada salahnya diberi tahu..asal cara penyampaiannya baik dan tidak menyinggung perasaannya. Menjadi orang tua sulit loh.. karena tidak ada sekolah menjadi orang tua, pengalaman yang membentuk orang bersikap lebih bijak dan dewasa. Tapi percaya deh.. setiap orang tua pasti menginginkan yang terbaik buat anaknya, Cuma caranya kadang kurang berkenan di hati kita. Siapa tahu dengan ngobrol bareng.. mamamu jadi sabar dan mau merubah kearah yang lebih baik. Dan buat Kiky.. ambil yang baiknya dari mama, jangan meniru yang kurang baik, agar pola asuh itu tidak berlanjut ke generasi berikutnya, caranya kamu perlu punya model yang tepat untuk ditiru, yakni dengan rajin membaca buku atau menonton film bagaimana orang-orang cerdas menyalurkan kemarahannya. Baca buku tentang motivasi dan pengembangan diri, atau biografi orang-orang sukses, supaya kamu bisa lebih baik dan bijaksana. Begitupun tetap hormati dan sayangi kedua orang tuamu.. Mbak yakin kamu bisa.. salam buat mamamu.. Tanya: Khairoel – Hp 6285267883xxx Assalamualaikum, Dear mbak Fifi yang manis.. bantu aku ya. Aku punya teman di sekolahan tapi sifatnya aku engga suka karena suka jahatin aku, sok jagoan dan mau menang sendiri. Menurut mbak aku harus gimana supaya dia tidak sesuka hati lagi. Makasih sebelumnya. Jawab: Waalaikumsalam .. Helo Khairoel Memang engga enak diperlakukan tidak baik oleh orang lain apalagi teman sendiri. Karena dalam kamus pertemanan tidak ada pemaksaan dan bertindak sesuka hati pada orang lain. Nah kalau kelakuannya udah enggak banget.. missal sampai mau mengancam segala perlu campur tangan pihak lain yaitu guru, agar tahu perbuatannya salah dan merugikan orang lain. Tapi kalau masih mampu mengatasi sendiri, kamu harus berani bersikap tegas dan berani mengatakan tidak, saat dirimu merasa sudah dirugikan. Bila perlu tidak usah terlalu dekat dengannya, karena masih banyak orang lain yang dapat dijadikan teman baik. Begitupun kamu perlu instropeksi diri, apakah selama ini kamu terlalu mengalah dan mudah dipengaruhi? Mengalah boleh asal kamu tidak merasa terpaksa dan dirugikan. Tapi kalau sudah keterlaluan .. ada saatnya kamu belajar bilang tidak untuk menunjukkan kamu tidak setuju dengan perbuatannya. Salam Tanya: Bebby- Hp 628577688xxx Selamat pagi Mbak Fifi… mbak.. kenapa yaa aku merasa

Konsultasi Remaja

sepertinya aku sering disepelekan (enggak dianggap) sama teman-temanku. Gimana cara mengatasinya? Makasih atas sarannya Jawab: Pagi.. dear Bebby Mbak turut prihatin.. Semoga setelah ini kamu tidak lagi merasa disepelekan oleh orang lain. Apa yang membuat kamu merasa tidak dianggap oleh orang lain? Jangan-jangan hanya penilaian kamu sendiri? Sebelum keburu men-judge ada baiknya kamu simak hal ini. Segala sesuatu di dunia merupakan hubungan sebab akibat, aksi reaksi atau stimulus respon. Maksudnya saat teman-temanmu menyepelekan .. janganjangan karena dirimu menunjukkan tanda-tanda bisa disepelekan. Jadi mulai belajar mengatakan tidak saat menurutmu sikap dan perlakuan teman-temanmu sudah merugikan atau tanpa hormat padamu. Kamu dapat mengontrol perlakuan orang karena setiap orang dibekali nurani yang membantu menentukan apakah tindakan tindakan seseorang pada kita masih pantas atau tidak. Bila kita berani bilang tidak setuju atas sesuatu yang berhubungan dengan dirimu.. semestinya orang lain harus bersedia menerimanya. Perlu tambahan buat Bebby.. cari kelebihan dan kekurangan dirimu.. gunanya untuk meningkatkatkan kualitas dirimu. Kelemahannya kita tutupi dengan menggali segala potensi yang ada dalam dirimu. Semangat ya.. salam Tanya: Liandha – Hp 6285262241xxx Assalamualaikum .. Hii.. Mbak Fifi Yang baikk, Nama saya Liandha.. aku mau tanya aku nih orang nya susah banget bergaul .. Gimana cara nya supanya aku bisa PD Kayak temanteman yang lain ?? Trimms Wasalammm Jawab: Waalaikumsalam, dear Liandha Salut dengan usahamu.. Tips supaya bisa PD seperti temanteman.. Diawali dengan nyaman dan enggaknya kamu dengan dirimu sendiri. Nah supaya merasa nyaman kamu butuh latihan. Coba mulai memikirkan apa kelebihan yang ada dalam dirimu.. supaya kamu merasa lebih berarti, bisa dilihat dari potensi fisik, bakat , kepribadian atau apapun yang membuat dirimu menjadi lebih PD. Kalau kesulitan.. kamu boleh Tanya sama orang disekitarmu. Bisa memulai dengan mengikuti beberapa kegiatan ekskul atau klub di luar sekolah, tujuannya untuk mengembangkan potensi bakat dan hobby yang mungkin belum terasah. Disaat kamu mulai merasakan mampu melakukan sesuatu kamu akan merasa lebih kompeten dan mbak yakin Percaya Dirimu semakin oke. Biasanya kalau sudah PD tentu rasa malu untuk bergaul menjadi berkurang.. nah kamu siap berteman sebanyak-banyaknya.. selamat mencoba, salam Tanya: Tiara – Hp 6281376554xxx Assalamualaikum, mbak Fifi.. kenalkan aku Tiara. Mbak gimana caranya supaya punya pacar yang baik dan pengertian… makasih Tanya: Armand – Hp 6285376322xxx Assalamualaikum.. Mbak Fifi yang ayu, salam kenal.. namaku Armand.. pelajar SMU. Mbak gimana caranya supaya punya pacar yang baik, cantik dan mengerti keadaan seorang cowok.. Makasih atas jawabannya Jawab: Waalaikumsalam, Dear Tiara dan Armand Waduh.. pertanyaannya sama… bahwa semua orang baik cewek maupun cowok sama-sama menginginkan kekasih yang baik dan pengertian. Tapi kadang harapan engga semuanya kesampaian.. Kembali ke individunya, apakah dia benar-benar tulus menyayangi.. tentu kalian punya kepekaan untuk merasakannya. Jadi sebelum pacaran ada masa penjajakan supaya kalian lebih saling mengenal karakter masing-masing. Selama pendekatan itu jadikan acuan buat ngelihat doi apakah dia serius atau cuma sekedar fun.. baru diputuskan buat dijadikan pacar atau sekedar just friend.

Konsultasi Sumber Daya Manusia Diasuh oleh Thoga Sitorus

Karyawan Outsourcing yang Teraniaya Selamat pagi Pak Thoga. Kami berjumlah 1.400 orang karyawan Mobil Oil, masa kerja 22 tahun dan di Exxon 3 tahun, artinya merger system kerja di bawah enam perusahaan kontraktor penunjang jasa. Bekerja secara terus-menerus sebagai karyawan outsourcing selama 25 tahun dan ganti-ganti kontraktor, kemudian di-PHK dan hanya menerima fee. Kami merasa sudah teraniaya dan kasusnya sudah 8 tahun di Disnaker Aceh Utara/Banda Aceh. Bagaimana sebenarnya ketentuannya Pak. Mohon penjelasannya dan terima kasih. Jawab: Selamat pagi para karyawan Mobil Oil dan Exxon. Ketentuan tentang karyawan yang bekerja di bawah perusahaan kontraktor sebagai karyawan outsourcing diatur dalam Undang-Undang No.13 tahun 2003 tentang Ketenagakerjaan (UUK) pasal 50, pasal 59, pasal 64, pasal 65 dan pasal 66. Dalam pasal 50 disebutkan, hubungan kerja terjadi karena adanya Perjanjian Kerja (PK) antara pengusaha dan pekerja. Jadi para karyawan yang 1.400 orang membuat PK dengan perusahaan mobil oil/Exxon berdasarkan Perjanjian Kerja Bersama antara perusahaan kontraktor dan pe-

rusahaan mobil oil/Exxon, yang isinya menyangkut syarat-syarat kerja seperti lamanya kontrak kerja (paling lama 3 tahun sesuai pasal 59 UUK) yaitu Perjanjian Kerja Waktu Tertentu (PKWT), besarnya upah kesejahteraan, Jamsostek dan lainlain yang tidak boleh bertentangan dengan Peraturan Perusahaan (PP) atau PKB perusahaan atau syarat-syarat kerja ini sekurang-kurangnya sama dengan perlindungan kerja dan syarat-syarat kerja pada perusahaan pemberi pekerjaan atau sesuai dengan peraturan perundang-undangan yang berlaku (pasal 65 ayat 4 UUK). PKWT (karyawan kontrak/ outsourcing) hanya dapat diadakan paling lama dua tahun dan boleh diperpanjang satu kali untuk jangka satu tahun. PKWT yang tidak memenuhi ketentuan sebagaimana dimaksud pada ayat 1b yaitu paling lama 3 tahun, maka demi hukum menjadi Perjanjian Kerja Waktu Tidak Tertentu (PKWTT) dan hubungan kerja antara pekerja perusahaan penyedia jasa (kontaktor) beralih menjadi hubungan pekerja dan pemberi pekerjaan (dalam hal ini mobil oil/exxon), pasal 65 ayat 8 atau pasal 66 ayat 4. Maka sesuai dengan masalah yang dihadapi oleh karyawan kontraktor yang bekerja di perusahaan Mobil Oil/Exxon selama 25 tahun statusnya beralih menjadi karyawan pemberi pekerjaan dan bila diputuskan hubungan kerja (PHK), maka PHK yang dilakukan perusahaan harus sesuai dengan

pasal 151 ayat 3 yaitu, pengusaha hanya dapat memutuskan hubungan kerja dengan pekerja setelah memperoleh penetapan dari lembaga penyelesaian hubungan industrial (di bawah Pengadilan Negeri Setempat). Pasal 155 ayat 1, pemutusan hubungan kerja tanpa penetapan sebagaimana dimaksud dalam pasal 151 ayat 3 batal demi hukum. Apabila masalah yang dihadapi karyawan sesuai dengan kenyataan yang dilaporkan maka karyawan berhak mendapat pesangon sesuai pasal 156, bukan dibayar dengan fee. Kemudian kasusnya 8 tahun di kantor Disnaker adalah bertentangan dengan UUK. Karena kasusnya tidak selesai di tingkat kantor Disnaker, sebaiknya Sdr mengadukan kasus ini ke tingkat yang lebih tinggi yaitu Menteri Tenaga Kerja dan Transmigrasi RI dan/ atau sesuai dengan otonomi khusus kepada Bupati/Gubernur NAD.

Ingin Mendapat Pekerjaan Selamat pagi, Pak Thoga. Saya Hendra Silalahi. Saya membaca opini Bapak tentang SDM di Koran Waspada, dan tertarik membacanya. Pada saat ini saya belum bekerja atau pengangguran. Saya butuh pekerjaan tetapi tidak ada yang membantu saya, karena saya dari daerah merantau ke Medan bermodalkan kemampuan yang tidak memadai, untuk itu berharap bantuan Bapak bagaiman supaya saya mendapat

pekerjaan. Atas bantuan dan penjelasan Bapak, saya ucapkan terima kasih. Jawab: Selamat pagi Sdr Hendra Silalahi. Atas masalah yang Sdr hadapi belum mendapat pekerjaan atau masih menganggur, untuk mendapat pekerjaan sekarang ini memang sulit karena lowongan kerja sangat terbatas dan bersaing dan biasanya kalau ada lowongan kerja hanya diisi oleh orang-orang yang memiliki keahlian/keterampilan dengan sertifikat. Agar Sdr mendapat kesempatan untuk bekerja, maka Sdr harus mengikuti pelatihan kerja agar memiliki keahlian/keterampilan tertentu sesuai dengan keinginan/bakat Sdr dan untuk itu Sdr dapat mendaftarkan diri ke Balai Besar Latihan Kerja Industri (BBLKI) milik pemerintah dengan biaya gratis yang terletak di Jalan Jend. Gatot Subroto km 7.8, telp. 8451520. BBLKI Medan memiliki 8 kejuruan pokok yang masingmasing memiliki sub kejuruan, yaitu: a. Teknologi Mekanik Kejuruan ini bertujuan untuk mewujudkan peserta pelatihan di bidang teknologi mekanik yang profesional dan didukung dengan standar pelatihan yang berkualitas serta mendorong tersedianya tenaga kerja yang profesional dan berdaya saing tinggi. Kejuruan Teknologi Mekanik terdiri atas empat sub kejuruan: 1. Fabrikasi/Plumbing; 2. Mesin Logam; 3. Las; 4. Programmer Pneumatic. b. Listrik Kejuruan ini bertujuan

untuk mewujudkan peserta pelatihan di bidang listrik yang profesional dan didukung dengan standar pelatihan yang berkualitas serta mendorong tersedianya tenaga kerja yang profesional dan berdaya saing tinggi. Kejuruan Listrik terdiri atas tujuh sub kejuruan: 1. Instalasi Penerangan; 2. Instalasi Tenaga; 3. PLC; 4. Elektronika, Teknisi HP; 5. Elektronika, Audio Video; 6. Elektronika, Digital dan Industri; 7. Teknik Pendingin. c. Otomotif Kejuruan ini bertujuan untuk mewujudkan peserta pelatihan di bidang otomotif yang profesional dan didukung dengan standar pelatihan yang berkualitas serta mendorong tersedianya tenaga kerja yang profesional dan berdaya saing tinggi. Kejuruan Otomotif terdiri atas tiga sub kejuruan: 1. Sepeda Motor; 2. Mobil Bensin; 3. Mobil Diesel. d. Tata Niaga Kejuruan ini bertujuan untuk mewujud-

kan peserta pelatihan di bidang administrasi dan bahasa inggris yang profesional dan didukung dengan standar pelatihan yang berkualitas serta mendorong tersedianya tenaga kerja yang profesional dan berdaya saing tinggi. Kejuruan Tata Niaga terdiri atas empat sub kejuruan: 1. Administrasi Perkantoran; 2. Komputer Perkantoran; 3. Akuntansi; 4. Bahasa Inggris. e. Teknologi Informasi Kejuruan ini bertujuan untuk mewujudkan peserta pelatihan di bidang teknologi informasi yang profesional dan didukung dengan standar pelatihan yang berkualitas serta mendorong tersedianya tenaga kerja yang profesional dan berdaya saing tinggi. Kejuruan Teknologi Informasi

terdiri atas tiga sub kejuruan: 1. Teknisi Komputer; 2. Teknisi Jaringan Komputer; 3. Programming. f. Aneka Kejuruan/Industri Kreativitas Kejuruan ini bertujuan untuk mewujudkan peserta pelatihan di aneka kejuruan yang profesional dan didukung dengan standar pelatihan yang berkualitas serta mendorong tersedianya tenaga kerja yang profesional dan berdaya saing tinggi. Aneka Kejuruan terdiri atas enam sub kejuruan: 1. Menjahit Pakaian; 2. Bordir; 3. Packaging; 4. Video Editing; 5. Sablon; 6. Handycraft. g. Ag-roindustri Kejuruan ini bertu-juan untuk mewujudkan peser-ta pelatihan di bidang budidaya jamur dan processing yang pro-fesional

Bagi para pembaca yang ingin menanyakan seputar tentang ketenagakerjaan dapat mengirimkan pertanyaan melalui, HP:0811632554

dan didukung dengan standar pelatihan yang berkualitas serta mendorong tersedianya tenaga kerja yang profesional dan berdaya saing tinggi. Kejuruan Agroindustri terdiri atas dua sub kejuruan: 1. Budidaya Jamur; 2. Processing. h. Konstruksi Kejuruan ini bertujuan untuk mewujudkan peserta pelatihan di bidang konstruksi yang profesional dan didukung dengan standar pelatihan yang berkualitas serta mendorong tersedianya tenaga kerja yang profesional dan berdaya saing tinggi. Kejuruan Konstruksi terdiri atas lima sub kejuruan: 1. Design Autocad; 2. Meuble/ Furniture; 3. Konstruksi Kayu; 4. Konstruksi Batu; 5. Konstruksi Besi.

Kupon Konsultasi


WASPADA Minggu, 15 Januari 2012


Pembelajaran Berbasis Agama TK Assyifa UNTUK memberikan pembelajaran berbasis agama, siswa/i TK Assyifa Jalan Bajak II H, Gg Coklat I No. 67 Medan Marindal melakukan wisata iman ke Masjid Raya dan Istana Maimun, baru-baru ini. Rombongan siswa dipimpin Kepala TK Assyifa Dra. H. Farida Hanum Nasution langsung melihat dari dekat bukti sejarah perkembangan agama Islam di Masjid Raya selain melihat berbagai bentuk ornament bangunan peninggalan Sultan Deli

tersebut. Menurut Farida Hanum, kunjungan ke Masjid Raya dan Istana Maimun ini untuk menambah pengetahuan bagi anakanak sekaligus mengenal dari dekat bukti-bukti sejarah perkembangan agama Islam di Sumatera Utara dan kebudayaan Melayu. “Kita harapkan kelak melalui kegiatan ini setelah mereka beranjak dewasa dapat lebih mendekatkan diri kepada Allah SWT dan mengenal sejarah

perkembangan Islam di Sumatera Utara,� sebut Farida sembari mengatakan pada kegiatan ini juga siswa diberikan cerita-cerita dongeng tentang ketakwaan. Dikatakan Farida, kegiatan ini merupakan program tahunan dari sekolah, di mana setiap tahunnya kita laksanakan kegiatan wisata-wisata seperti ini, yakni mengunjungi pebrik-pabrik pembuatan roti, minuman, makanan, tempat-tempat wisata dan objek-objek pembelajaran lainnya. ** m43


Siswa TK Assyifa foto saat mendengarkan dongeng ketika mengunjungi Masjid Raya, barubaru ini.

CERIT A ADIK Adik-adik, berikut Redaksi memuat cerita-cerita berkaitan tentang malaikat. Malaikat adalah makhluk Allah yang taat dan setia kepada Nya. Semoga bisa menambah wawasan dan menambah keimanan kita pada kekuasaan Allah SWT.

Malaikat Tunjukan Surga Kepada Asiah WALAU seluruh rakyat telah menyembahnya sebagai tuhan, ada seorang yang paling dekat hubungannya dengan dia berani mengingkari dirinya sebagai tuhan yaitu isterinya sendiri, Asiah. Dialah satu-satunya orang yang beriman kepada Allah di istana Firaun. Rahasia keimanannya yang disembunyikan selama ini telah terbongkar dari ucapan perkataannya“Allah“ yang keluar dari mulutnya secara tidak sengaja. Firaun berusaha membujuk supaya dia kembali kepada kekafirannya. Ia berkata : “Wahai isteriku, tahukah engkau akibat orang yang mengingkari diriku sebagai tuhan? Sebelum engkau menyesal, ubahlah pendirianmu!� Asiah menjawab dengan tegas : “Wahai Firaun, pendirianku tidak akan berubah walau apapun yang akan menimpa diriku dan perlu engkau ingat bahwa engkau dan aku adalah sama-sama manusia biasan. Tuhanmu dan Tuhanku adalah Allah.� Firaun berusaha membujuknya dengan kata-kata lemah lembut tetapi tetap tidak berhasil. Lalu digunakan kekerasan. Kata Firaun : “Hai Asiah, jika engkau tidak mau mengubah perndirianmu, pastilah engkau akan aku pancung!� Jawab Asiah :“Wahai Firaun, lakukanlah apa yang engkau mau tetapi tidak sedikitpun engkau tidak akan dapat mengubah pendirianku dan dengarkanlah sekali lagi aku nyatakan bahwa Tuhanmu dan Tuhanku adalah Allah.� Bersambung **m31/Darul Nu’man


                Â      Â? Â?Â?   Â? Â?  

 ‹       €  

  † � �†

    ­ � €    � �   ‚ � ƒ      �‚ ƒ� € �  �� �� �‚

 „       …† Â?  ‡ €ˆ Â?  Â? Â?Â? Â?Â?

  ‹     ††     €     ˆ  Â?   Â?   ‹  ™    —     

       Â? —†† 

Â? —††   ‹  •

 ‰      Š   Â?  ‹  ‚† Š† Â? ˆ  ÂŒ  ˆ Â? ˆ   ‚ˆ Â? ˆ Â? „†            ÂŽ    †   ‘   ‘    Â’  †     Â? Â? Â?Â? ‚ ‹†    Â’“  ‹”     Â?       Â?   Â? „ †    Â?  ˆÂ? ÂŽ  †   †      Â?      Â?  ƒ ‹   •  –  

 –   „ 

 –   „—˜—     † ††     Â?  



   ˆ    †  




š     †      Â?    Â?   ‹  •

 †    —           Â?   Â?    Â? ‹  •

›ˆ †    —  €   Â?     Â?  ‚ ‹  •

Âœ       †††   Â?Š Š Â? ŠÂ?Š

  Â?ŠŠ Â? ŠÂ?Šƒ Â? ‹  •

       — ž    Â?     Â?  ƒ “      —     ˆ€    Â? ††    Â?   Âœ     ˆ —Â&#x;       

Â? Š Â? Š Â&#x;

 ‡  Â’ˆ       ‡      Â’

Â? † Â?   Š †   

”  —   ‡Â’ˆ  

  ‡Â’ˆ Â? ‡ Â’  ˆ   

Â? ‡ Â’  ˆ   

Âœ       €        Â?    Â? 

 ÂŚ  ¢ £š    †   †Œ¤ š ¢ ÂŁÂĽ   „ ¤ ÂŚ  ¢ £§   „ Œ¤ š ¢ £‹ Â’ ¤ ÂŚ  ¢ £¨Œ¤ š ¢ £‹           ¤ ÂĽ ˆ   š†   ‹š    Â? š „  Â? ÂŚ  š



„›–   Â’ ‡ ˜ Â?ÂĽ Π     £Š¤ £„¤Âœ” „›–  ‹ ‹ ‡†† ”  ‹‹‡”„ †      – Â’

Â?†Â? ‹   †  ÂĄ Â? ¢ ÂŁ ÂĄ     ¤ ÂĄ ÂĄ ¢   Â?£–Â?Œ¤ Â? ¢ £” ¤ ÂĄ ¢    † £”  Œ¤ ˆ Šˆ    „ ¢    ÂĄ   £”ÂĄŒ¤ ÂĄ ¢ ÂŁˆ ‡Š    ‹    ¤ „ ¢ ÂŁ‹ † Œ¤ ÂĄ ¢ £„‹Â?‡  ¤ „ ¢ ÂŁ† •‹ ¤ ÂĄ ¢ÂŁÂĽ‡” Â? ¤            ‡ †       †            Â? ÂĄÂ’†   Â?    Š†  


  ‚   ‚ ‘  ¢  ÂŞ   ‘   ‘ ‚  ÂŞ  œ„ ÂŞ  „” ÂŞ ¢  œ‹ ÂŞ œ„‘„”

 ÂŞ ‘   

ƒ ÂĽ Š  ” †    †   ŠÂ’ 

ÂŞ   ˆ‘    ÂŞ

‹       €             †       Â? ‹Š   Â?       

  ”†       Â’   ‹       †…  ‚


 Š Â’ ¢ ÂŁ         Œ¤ ‹ ¢ £” †      Â’¤ Š Â’ ¢ £” Œ¤ ‹  ¢ £‹ †…


 –     „–  ÂŁÂ’¤  ÂŁ¤   Â…›–   Â’‡

Â? „   Â’ Â? ”„›–  ‹‹‡” „ †

‹  €  ‡Š†Š Â’Â’ˆ    ÂĽŠ  Š †   Â? ÂĽŠŠ    Â? ”     Â’ 

  ÂŞ  ÂŞÂ?ˆ

  ÂŤ  ÂŹ Â? p p    







Âœ     ˆ ‚ÂŤ 


 24 12 6 3 1 1 1

2 2 2 3 5 5


KPK dari 24 & 50 = 2 Ă— 3 Ă— 5 

50 25 25 25 25 5 1

 24 36 2 12 18 3 4 6

42 21 7

FPB = 2 Ă— 3 = 6

Â?  30 – 35 – 40 15 – 35 – 20 15 – 35 – 10 15 – 35 – 5 5 – 35 – 5 1– 7– 1 1– 1– 1

KPK = 2 Ă— 3 Ă— 5 Ă— 7 = 840 menit = 14 jam

‹    ”  ¢ ÂŞ­ ÂŞ‚



Â? †  —     Â?      Â? 

 �¢‘ ª


‚  †ˆ Š   †   Â? ˆ — ‹      „    ‡†††  Â?   Š  Š   Â?       

�‘ ¢ ª�‘


‘˜­˜ƒÂޘ Â?­˜ƒÂޘÂ? 


 ”   †—    —             —††

‘ ª 


 ­  ˜ ÂŞ  ˜

  ÂŞ ˜ ÂŞ   

   Â’       ˆ    Â’  ††           —  Â’   o     †††    Â?  ˆ —       ¢ Â?Â?‹  ‹  ‡   „     Â?  ‡

        „     Â? † †      Â’ Â? Â’ † —†ˆ   ¯¢     ˆÂ’  –  ˆÂ’  – —  Â…   †† Â?††¢ˆ Š

°Â’¢ÂŽ  ÂŽ ˆ  °   ¢ ÂŽ   Â?  ‹          †        †—†† Ӡ††Â’  …† †…†   Ӡ††Â’ †…†  …†  Ӡ   ††  …†     † ‹     ˆˆ „  ˆ 

   ‹  —Š   ¢   —  ¢   — Â?¢   —

­ €‚ƒ„…ƒ­ ”¢    

2 2 2 3 5 7

    —     Â?  Š    Â? 

ÂŽ ”‡‡ ‹¢ †  ÂŽ  Âœ ”†¢ ˆ ÂŽ „ ‡–” ˆ¢ ˆ ÂŽ ‹¢ˆ Â’ ÂŽ Â’  ‹ ¢

  ‹ ††Â’ • „ 

     –ˆ œ

‹†† Â’         …†    ܠ†   —  ÂŽ

 Â? ¢

Â? Â’ † —†ˆ   ¯¢    ˆÂ’  – ˆÂ’  –   Â?††¢  ˆ†

  Â?  —   ††   ‹ ††  Â’ Â’     —‹ ††    —       ††

  ÂĽ    †  †    Â’   †¢  –     Â?††¢  ÂŤ  ÂŤ†   ‹    Â?††¢ ÂŤˆˆ    ÂŤ ——  ÂŤ   Ӡ   Â?††¢°† ÂŤ †ÂŤ  ††

ˆ ¢  —Š  ¢  —Š Â?¢  —Š

Â?               †   °¢†† Â&#x;†††ˆ   




Â?†­†­‡ ƒ­ˆ‰Â? ÂĽ††ˆ††   

        ˆ      „  ¢        

­Šƒ ƒ­Â… ‹ Â…Š€ÂŒ­Ž ‰Š



WASPADA Minggu 15 Januari 2012

Naza Andika

Pelajar Gwangju Belajar Kunjungi Medan DUA pelajar Gwangju, Korea Selatan program Sister City belajar di SMA YP Shafiyyatul Amaliyyah, Selasa (10/1). Kehadiran pun mereka di sambut baik Pembina YPSA Drs. H. Sofyan Raz, Ak. MM dan Ketua Umum YPSA Hj. Rahmawaty Sofyan Raz.

Happy Birthady Waspada Ke-65 HAPPY Birthady Harian Waspada, itulah yang pertama diutarakan Naza Andika, model yang kini nangkring di Andika Production ketika mengetahui, Rabu 11 Januari 2012 lalu merupakan hari ulang tahun ke-65 Harian Waspada.

Pembina YPSA Buya Drs H Sofyan Raz, Ak. MM didampingi Ketua Umum Hj. Rahmawaty Sofyan Raz menyambut baik atas kehadiran kedua pelajar

“Sebagai harian yang tertua di Sumatera Utara, kehadiran Waspada banyak memegang peranan penting dalam setiap elemen kehidupan. Tidak saja dalam segi politik, hukum, sosial, ekonomi, kesehatan, pariwisata, tapi juga dalam perannya memajukan dunia pendidikan, khususnya para pelajar,� sebut pria kelahiran Aceh, 15 Mei 1992 ini. Selama ini menurut saya, Waspada sudah cukup baik dan profesional dalam penyajian berita. Beritaberitanya cukup baik dan terkini, bahkan cukup eksklusif juga. Namun, tutur cowok yang pernah menyandang finalis Gastby, finalis Cover Boy Aneka Yes, juara II top model Medan dan pemeran film pendek Andika Production ini, kalau dibolehkan memberi saran, maunya rubrik-rubrik untuk remaja ditambah. Bukan hanya kegiatan-kegiatan sekolah, anak-anak berprestasi. Juga dibuat komentar atau pendapat siswa tentang keadaan ekonomi, politik, sosial dan apa saja yang terjadi di Indonesia. Apalagi, koran Waspada sangat berpengaruh di dalam mencerdaskan anak bangsa, terutama masalah pendidikan. Saya menganggap koran Waspada dapat


DUA pelajar Gwangju Park Jung yo dan Oh Siung Eun saat berbaur dengan pelajar SMA YPSA ketika berbincangbincang dengan Ketua Umum YPSA Hj. Rahmawaty Sofyan Raz didampingi Kepala SMA Rudi Sumarto, SSi. Gwangju, Korea Selatan yang mengikuti program sister city di YPSA. “Kami sangat bersyukur atas terpilihnya YPSA sebagai sarana pembelajaran dari pelajar Korea Selatan, hal ini tentunya tidak terlepas dari komitmen YPSA sebagai sekolah Rintisan Sekolah Berstandar Internasional (RSBI) untuk terus membuka peluang kepada seluruh pelajar luar negeri agar datang dan belajar ke YPSA,� katanya sembari menambahkan ini sebagai usaha kita untuk terus mempertahankan dan membentuk wawasan global kepada siswa,� katanya. Di samping itu, terang Sofyan Raz, kehadiran pelajar Korea Selatan ini juga kiranya bisa menjadi motivasi bagi pelajar-pelajar lainnya untuk dapat mengikuti program

Nyaman Dengan Rajutan RAJUTAN kembali trend dan digemari kaum muda. Aplikasikan rajutan dengan gaya kita yang akan memberi kehangatan di setiap kesempatan. **Neneng K.Z/AP

memberikan informasi yang jelas dan aktual yang dibutuhkan semua orang. Apalagi kehadirannya sangat membantu di dalam proses pembelajaran di Indonesia, khususnya di Sumatera Utara dan NAD. “Pokoknya, Waspada will be the best!! Oh ya, semoga Waspada nggak cuma dikenal di sekitar Sumatera Utara dan Nanggroe Aceh Darussalam, tapi bisa ke luar daerah lainnya dengan berita yang eksklusif. Maju terus buat Waspada‌!!!, cetus Naza yang bercita-cita ingin menjadi actor ternama ini mengakhiri. Naskah dan foto dede

sister city seperti yang telah diikuti Talitha Assyura dan Erysa Alifah Maharamis Poetry tahun lalu yang terpilih mengikuti program Sister City di Gwangju, Korea Selatan. Kepala SMA YPSA Rudi Sumarto, SSi menambahkan, pelajar Gwangju yang bernama Park Jung yo dan Oh Siung Eun ini berada di Indonesia selama 1 minggu. Dalam dua hari ke depan mereka akan belajar dan berbaur dengan siswa SMA YPSA. “Satu hari selanjutnya mereka mengadakan City Tour bersama pelajar gwangju lainnya mengelilingi Kota Medan. Selanjutnya dua hari terakhir berada di Indonesia, Sumatera Utara mereka akan ke Danau Toba, Parapat,� sebutnya. ** m43

22 1.


Pak Luwung membeli sepeda seharga Rp500.000,00. Sepeda tersebut diberi aksesoris dengan biaya Rp150.000,00. Jika Pak Luwung berencana menjual kembali sepeda itu dan mengharapkan untung sebesar 20%, maka harga jual sepeda tersebut adalah .... (A) Rp630.000,00 (B) Rp700.000,00 (C) Rp730.000,00 (D) Rp780.000,00 Suatu lingkaran mempunyai panjang jari-jari 8 cm dan panjang busur pendek AB = 20 cm, seperti pada gambar di bawah. Luas juring kecil AOB adalah ....


Perhatikan gambar di bawah ini!

Di depan sebuah cermin cekung ditempatkan sebuah benda. Dengan menggunakan data seperti tercantum pada gambar, dapat dihitung perbesaran bayangan adalah .... (A) ½ kali (C) 2 kali (B) 1 kali (D) 3 kali 7.

(A) 80 cm2 (B) 85 cm2 3.

Supaya perpotongan sinar-sinar yang masuk ke lensa mata jatuh di retina, maka orang yang mempunyai cacat mata seperti pada gambar di atas harus menggunakan lensa kacamata .... (A) normal (C) negatif (B) positif (D) silindris


(C) 90 cm2 (D) 100 cm2

Perhatikan gambar!







Prisma ABCD.EFGH, dengan ABFE sejajar DCGH. Panjang AB = 12 cm, BC = 11 cm, AE = 10 cm, dan BF = 5 cm. Luas permukaan prisma adalah .... (A) 530 cm2 (C) 620 cm 2 (B) 550 cm2 (D) 650 cm 2 4.

Perhatikan gambar! D




ABCD adalah jajargenjang dengan panjang AD = AE = 29 cm dan CD = 9 cm. Panjang garis CE adalah .... (A) 20 cm (C) 23 cm (B) 21 cm (D) 25 cm 5.

Gradien garis m yang mempunyai persamaan 3y – 9x – 12 = 0 adalah .... (A)

1 3

(C) –3


1 3

(D) 3


13. Bagian alat kelamin jantan yang berfungsi sebagai tempat pembentukan sperma adalah .... (A) ovarium (B) vas deferens (C) testis (D) vas deferens 14. Perhatikan gambar berikut!

19. Berikut ini yang tergolong bahan pemanis alami, kecuali‌. (A) sukralosa (C) gula batu (B) gula aren (D) madu 20. Keuntungan menggunakan zat pewarna alami dibandingkan dengan zat pewarna sintetis adalah‌. (A) zat pewarna alami umumnya tidak menimbulkan penyakit (B) zat pewarna alami memberikan warna yang homogen (C) zat pewarna alami memiliki banyak ragam (D) dapat digunakan dalam jumlah yang besar

Perhatikan gambar di bawah ini!



12. Gangguan sistem ekskresi berupa ditemukannya protein pada urine disebut .... (A) uremia (B) diabetes mellitus (C) diabetes insipidus (D) albumiuria

Putri, seorang siswa SMP menggunakan lensa kacamata dengan kekuatan –0,5 dioptri. Benda-benda terjauh yang masih dapat dilihat dengan jelas oleh Putri tanpa menggunakan kacamata adalah .... (A) 200 cm (C) 50 cm (B) 100 cm (D) 25 cm Sisir plastik digosok pada rambut kering, sehingga sisir tersebut dapat menarik sobekan- sobekan kertas. Ini berarti sisir plastik menjadi bermuatan listrik .... (A) negatif, karena elektron pada sisir pindah ke rambut (B) negatif, karena elektron pada rambut pindah ke sisir (C) positif, karena elektron pada sisir pindah ke rambut (D) positif, karena elektron pada rambut pindah ke sisir

10. Dua benda bermuatan listrik Q1 dan Q2 terpisah pada jarak r dan gaya tolak-menolak yang dihasilkan adalah F. Jika besar masingmasing Q1 dan Q2 dijadikan dua kali besar muatan semula sedangkan jaraknya 2r, maka gaya tolakmenolaknya menjadi .... (A) Ÿ F (C) tetap F (B) ½ F (D) 2 F 11. Berikut adalah organ ekskresi pada manusia: 1. paru-paru 2. kulit 3. ginjal Organ ekskresi yang berfungsi untuk membuang limbah metabolisme, berupa air adalah .... (A) 1 dan 2 (C) 2 dan 3 (B) 1 dan 3 (D) 1, 2, dan 3

Bagian yang berlabel X, berfungsi untuk .... (A) penghasil sel telur (B) penghasil estrogen dan progesteron (C) tempat terjadinya fertilisasi (D) tempat perkembangan embrio 15. Jumlah sel gamet yang dihasilkan dari pada peristiwa spermatogenesis adalah .... (A) empat buah sel yang bersifat fungsional (B) empat buah sel yang bersifat tidak fungsional (C) tiga buah sel yang bersifat fungsional dan satu sel tidak fungsional (D) tiga buah sel yang tidak bersifat fungsional dan satu sel fungsional 16. Berikut ini yang merupakan cara pengawetan makanan dengan bahan aditif kecuali‌. (A) pengalengan (B) pengasapan (C) penggaraman (D) pengasaman 17. Supaya makanan terlihat menarik dan memiliki citarasa yang khas, maka bahan aditif yang harus ditambahkan adalah‌. (A) BHA dan MSG (B) natrium benzoat dan HVP (C) tartrazin dan MSG (D) sakarin dan MSG 18. Perhatikan komposisi bumbu makanan instan berikut ini: 1. bubuk lada 2. monosodium glutamat 3. bubuk bawang 4. gula 5. hidrolisis vegetable protein 6. perisa ayam 7. garam 8. TBHQ 9. tartrazin Cl Zat yang tergolong bahan alami adalah .... (A) 1, 3, 4, 5, dan 6 (B) 1, 3, 4, 5, dan 8 (C) 1, 3, 4, dan 6 (D) 1, 3, 4, dan 7

Read the text carefully for number 21 to 24. The Jaguar (Panthera onea) Although the jaguar is an animal that is found in Asia, it is famous in Asia because of the cat named after the animal. This report provides information on the characteristics, habitat, and life of the jaguar. The jaguar belongs to the cat family. It is one of the four big (roaring) cats: the lion, the tiger and the leopard. Because it has spots, a jaguar is often mistaken for the leopard. However, a jaguar has larger rosette markings, a stronger body, and a shorter tail. A rosette is a rose shaped spot on an animal. The rosettes of jaguars sometimes look like the print of an animal paw. The jaguar is brownish-yellow in colour an has spots on the head, neck and legs, and rosettes on other parts of its body. It can weight up to 100 kilograms and has a powerful jaw that it can easily crush the skull of its prey. 21. Which paragraph tells about the differences between a jaguar and a leopard? (A) Paragraph 1 (B) Paragraph 2 (C) Paragraph 1 and 2 (D) Paragraph 2 and 3 22. How do people differentiate between a jaguar and a leopard? (A) A jaguar has larger marking on its body (B) A leopard has a stronger body (C) A jaguar only lives in Asia (D) From she shape of their bodies 23. “Because it has spots, a jaguar is often mistaken for the leopard.� The underlined word has the same meaning with .... (A) lines (C) scratches (B) dots (D) rosettes 24. Which statement is not true based on the text? (A) Jaguar weight is mostly 100 kgs (B) Jaguar belongs to the cat family (C) Jaguar can be found in Asia

Winda, untuk mengetik laporan yang berada di mejanya. Kalimat memo yang tepat adalah (A) Winda, tolong ketik laporan yang ada di meja saya untuk besok. Jangan lupa ya. Ok. (B) Tolong segera ketik laporan yang ada di meja saya. Terima kasih. (C) Winda, saya membutuhkan laporan. Tolong diketik ya. (D) Tolong segera rapikan dan ketik laporan yang ada di ruangan saya.

(D) Jaguar has larger rosette marking 25. ... and Nove did too. (A) Yani didn’t lose her pen (B) Yani lost her pen (C) Yani doesn’t lose her pen (D) Yani loses her pen


Asep : Aku selalu bisa memenangkan setiap balapan. Joni : Ah, yang benar. Asep : Kau tidak percaya? Joni : Tidak pernah kalah? Asep : Sekalipun tidak pernah. Joni : Nggak pernah? Kau ingat pada saat kau berlomba di lintasan balap di kota sebelah lima bulan lalu? Kau terjatuh dan tak bisa melanjutkan lomba. Asep : Tapi, itu bukanlah kesalahan. Itu kesalahan montir. Watak Asep pada kutipan dialog di atas adalah (A) sederhana. (C) sombong. (B) pembohong. (D) pelupa.

30. Berikut ini adalah bagian penutup sebuah surat resmi yang tepat adalah (A) Atas perhatiannya, saya mengucapkan terima kasih. (B) Atas perhatian dan atensinya Saudara, kami mengucapkan terima kasih. (C) Atas perhatiannya, kami mengucapkan terima kasih yang sebanyak-banyaknya. (D) Atas perhatian Saudara, saya mengucapkan terima kasih.


Jawaban: B B C

AB = 60 cm AC = 20 cm F


Dengan menggunakan persamaan: F u BC = w u AC F u 40 cm = 240 N u 20 cm F = 120 N

10. Jawaban: C

Gerak dari A o B o C = setengah getaran




Taring-Anto-Ponakan-EerytAmat-Quning-karena-belumsunnat-di KFCf

18. Jawaban: B Bahan sintetis: Garam benzoat, tartrazin, dan TBHQ

19. Jawaban: B Pemanis Buatan: - dulsin - sakarin - siklamat - aspartam - kalium acesulfam - sorbitol - sukralosa


manitol maltitol flavohoid isomalt laktiol xilitol


20. Jawaban: C

11. Jawaban: D Ekskresi adalah pembuangan limbah metabolisme, contoh: pembuangan urea dalam bentuk urine.

Pemanis, warna kuning, warna coklat, dan aroma pisang: gula, tartrazin, caramel, amil asetat.

12. Jawaban: D


27. Kalimat pembuka pidato yang tepat pada saat acara peringatan hari jadi sekolah adalah (A) Peringatan hari jadi sekolah kita ini selayaknya kita jadikan momentum untuk dapat lebih bersemangat dalam memajukan sekolah kita. Tahun depan pada saat kita bertemu kembali di acara peringatan ini, maka saya harapkan, sekolah ini sudah dapat mengoleksi lebih banyak gelar. (B) Hari ini saya mengajak semua elemen sekolah untuk memajukan sekolah ini. Karena apabila kita bisa bersatu untuk memajukan sekolah ini, maka kita dapat mewujudkan misi sekolah kita yaitu sekolah terbaik di kota ini. (C) Yang terhormat Kepala Sekolah, yang terhormat guru-guru, serta siswa-siswi SMPN 55 yang saya cintai. Marilah kita mengucapkan syukur kepada Tuhan yang telah memberikan limpahan rahmatnya pada hari jadi sekolah kita ini. (D) Terima kasih kepada semua pihak yang telah membantu kami dalam acara peringatan hari jadi sekolah kita ini. Atas perhatian Bapak, Ibu dan semua yang hadir di sini, kami mengucapkan terima kasih.


28. Metode berpidato dengan membawa catatan singkat yang berisikan inti-inti pidato disebut juga dengan metode (A) naskah. (C) impromptu. (B) menghafal. (D) ekstemporan.


29. Edo adalah seorang kepala bagian pemasaran suatu perusahaan. Ia menginginkan sekretarisnya,

Didapatkan nilai p (tekanan) 400 N F terbesar adalah p= = = A 0, 6 m2 666,67 N/m 2

Jawaban: B

43 x 34   101 x 52

2. 3.

1 1 4

11 4

(18 : 3 ) + (–6 u 2 ) – (–4 ) = 6 – 12 + 4 = –2

Jawaban: D x


40.60  40.20  40 60  20  8

4x(2 – x ) – (–3x – x – 1) = 8x – 4x 2 + 3x + x2 + 1 = –3x 2 + 11 x + 1

No. 1. 2. 3. 4.

Jawaban: D Besaran massa intensitas cahaya waktu suhu

Tahap pembentukan urine adalah: Reabsorpsi – Filtrasi – Augmentasi DiREmas, diFILin, Auwwww ... Urine sekunder merupakan urine primer yang sudah mengalami reabsorpsi (penyerapan kembali) zat yang diperlukan tubuh, jadi urine ini hanya ditemukan air, mineral, dan limbah metabolisme. Sehingga pada kasus normal zat seperti glukosa, asam amino dan vitamin tidak pernah ditemukan.

16. Jawaban: D Satuan Jawab gram kandela jam kelvin

salah benar salah benar

Jawaban (2) dan (4) benar

Jawaban: C Massa benda = 1000 gram + 400 gram + 70 gram =1470 gram


14. Jawaban: A

21. Jawaban: D

Pernyataan yang benar adalah bahwa orang misterius tersebut adalah sebenarnya seorang putri kerajaan lihat paragraf kedua kalimat terakhir.

22. Jawaban: B

Pelaku dalam cerita tersebut adalah Mbok Rondo dan seorang putri (Mbok Rondo and a Princess).

23. Jawaban: A

Tujuan cerita berupa naratif adalah untuk menghibur para pembacanya (to entertain the readers ...).

24. Jawaban: D

Kata it merujuk pada keong emas (a golden snail).

25. Jawaban: B

Bagaimana sifat gadis tersebut adalah cantik dan juga rajin (beautiful and dilligent) paragraf kedua kalimat keenam.

15. Jawaban: A

40.40  40 10 org 32

Jawaban: A



Yang dimaksud label X pada gambar adalah glomerulus yang berfungsi untuk filtrasi darah.

Jawaban: C

Misalkan jumlah tenaga yang ditambah x orang


13. Jawaban: B

Jawaban: A

–6x + 8y = –6.8 ( bagi –2 ) 3x – 4y – 24 = 0


Berikut adalah nama organ ekskresi dan limbah metabolisme yang dibuangnya: Hati : urea Ginjal : urea, mineral, dan air Paru-paru : karbondioksida dan air Kulit : air dan mineral

Jawaban: C Dengan menggunakan persamaan: p F A

Kelompok zat adiktif makanan: Pewarna-asidulan(pengasam)penyedap-pemantap-pengawetpengemulsi-pemutih-pemanisantioksidan-pemucat-antikempalpengeras-sekuestran (pengikat logam) Waria–Asal–pekalongan– mantap – awet– muda– putih– manis–dan–pucat–anti– kekerasan–sek

17. Jawaban: A

Zat pewarna sintetik Ta r t r a z i n - a n a t o - p o n c e a u Erytrosim-Amaranth-QuinolinKarmoisin-Blue Brillian-Sunset Yellow-Kuning FCF.

26. Jawaban: D Pernyataan tersebut bertentangan dengan teks tersebut. Vonis seharusnya hukuman mati atau seumur hidup tidak lebih ringan dari itu.

27. Jawaban: B Pesan dari kutipan cerita tersebut adalah Kita harus selalu berhatihati dan waspada.

28. Jawaban: D Kalimat (6) mengungkapkan nada marah.

29. Jawaban: A Konflik pada penggalan novel tersebut adalah konflik batin. dalam hati = konflik batin

30. Jawaban: D Latar kutipan tersebut di puskesmas karena membicarakan pengobatan anaknya yang demam panas.


WASPADA Minggu 15 Januari 2012


Yang Perlu Diperhatikan Dalam Pendidikan Seksualitas BEBERAPA kalangan tidak menyetujui adanya pendidikan seks diberikan pada anak karena khawatir akan semakin membuat anak ingin tahu dan melakukannya namun ada kalangan yang menyetujui pendidikan seks diberikan sejak usia dini justru untuk menghindari hal-hal yang tidak diinginkan terjadi pada anak mereka. Dalam memberikan pendidikan seks pada anak ada rambu-rambu yang harus diperhatikan, diantaranya adalah penyesuaian materi dengan usia anak. Selain hal tersebut, yang harus diperhatikan adalah sbb: Tanamk an rrasa asa per ca anamkan perca cayya pada anak kita Apa yang anda pikirkan jika ada seorang anak sekolah dasar kedapatan menyimpan beberapa komik dan VCD porno? Pernahkah terpikirkan oleh anda mengapa hal tersebut bisa terjadi? Ini terjadi kemungkinan karena anak tersebut tertutup serta tidak adanya kepercayaan terhadap orang tuanya. Mengapa demikian? Seringkali ketika anak menanyakan sesuatu tentang apa yang ia dengar dan ia lihat dari lingkungannya, dan kita anggap itu sebagai sesuatu yang tabu dan memalukan, dengan serta merta kita membentaknya, memarahinya, dan menyuruhnya untuk tidak menanyakan hal-hal seperti itu lagi. Hal ini membuat anak mencari-cari jawaban dari teman-temannya atau sumber-sumber yang tidak bertanggung jawab. Tinggalkan saru dan tabu Perasaan tabu, saru, malu, dan kaku biasanya timbul karena kita masih beranggapan bahwa masalah seksualitas (termasuk didalamnya seks) adalah jorok atau memalukan. Namun, kita harus menyadari bahwa seksualitas adalah bagian dari diri kita yang mesti dipahami oleh kita, juga anak kita. Sehingga kita dan anak kita tahu, mengerti, puas dengan peranannya, dan mampu menyikapinya dengan wajar dan benar.

Tambah Pede Dengan Kontrol Diri PERASAAN enggak pede atau enggak berani melakukan sesuatu pasti sering menghinggapi kita. Supaya lebih pede, kita harus mengendalikan diri dulu dengan : Kontrol sikap tubuh :Tubuh dan pikiran adalah kesatuan yang saling mempengaruhi. Apa yang kita rasakan pasti akan terlihat dari sikap tubuh kita. Kalau postur tubuh kita menunduk seperti enggak pede, kita pun akan merasa enggak pede beneran. MAkanya, berdirilah lebih tegak.Tatap setiap orang dengan keyakinan penuh. Kepercayaan diri pun akan terpancar dari diri kita. Berbicara dengan diri sendiri : Cari tahu apa sebenarnya yang bikin kita enggak pede. Misal, kita takut dengan anggapan orang lain, makanya jadi enggak berani bertindak. Dengan mengetahui apa penyebab kita enggak pede, kita akan lebih memahami perasaan sendiri, dan mengenal siapa diri kita sebenarnya. Punya konsep diri positif : Kalau kita berpikir negative tentang diri kita, iamge yang kita tampilkan di depan orang lain pun jadi negative. Padahal dengan terus berpikiran negative, kita jadi enggak tahu apa kelebihan kita.Yuk cari kelebihan dan kekurangan kita. Misal kita enggak jago olahraga, enggak perlu ngotot harus jago basket, sementara kita tahu kita sebenarnya lebih suka menulis cerpen. Lebih baik manfaatkan kelebihan kita dalam menulis cerpen. Kita bisa ikutan lomba cerpen atau workshop menulis. Jadi, ada prestasi yang bisa kita raih, kan? Ujung-ujungnya jadi lebih pede, deh. Berusaha menerima diri apa adanya : Enggak perlu membandingkan diri dengan si A yang pintar matematika atau si B yang lebih cantik. Dengan terus melihat kelebihan orang lain, yang ada kita malah jadi meniru orang lain. Padahal, setiap orang memiliki kelebihan dan kekurangan masing-masing. Si B boleh aja ditaksir banyak cowok, tapi dia belum tentu kan jago menyanyi seperti kita. See, kita juga enggak kalah kan dengan teman-teman? Apa yang harus dilakukan saat mulai merasa enggak pede? 1.Tentukan dulu tujuannya : Kita harus menentukan dulu apa tujuan yang ingin kita capai.Katakan dengan jelas keinginan kita.Setiap keinginan harus dalam kalimat poitif, aktif, di masa sekarang, dan memotivasi kita. Contoh :“Aku akan membuka percakapan sama gebetan dengan tenang.� Kalimat positif ini bakal memotivasi otak lebih positif. Hasilnya, kita pun jadi lebih yakin bahwa kita memang bisa. 2. Latihan dulu : Peragakan apa yang ingin kita lakukan di depan cermin. Misal, coba deh latihan ngomong selayaknya kita ingin mempresentasikan makalah di depan temanteman. Ini berguna sebagai latihan awal sebelum tampil. Apalagi kita bisa langsung melihat bagaimana ekspresi dan sikap tubuh ketika berbicara. Jadi, kalau ada yang kurang, kita bisa langsung mengevaluasi dan mengubahnya. 3. Gerakan titik positif : Letakkan tangan di depan tubuh.Tutup mata, lalu ucapkan tujuan kita berkali-kali dalam hati. Gerakan titik positif berfungsi untuk menenangkan dan membangun sikap positif dalam tubuh. Biasanya ketika mau ngobrol dengan orang baru ada aja anggapan negative di kepala. Nah, dengan meletakkan tangan di depan, kita akan menstimulasi darah dan energy ke otak depan. Otak depan sendiri mengatur logika, sementara otak belakang mengatur kecemasan. Ketika mulai enggak pede, sebenarnya diri kita diliputi kecemasan, jadi logika enggak bekerja. Makanya, gerakan ini menstimulasi otak depan agar bisa lebih menerima dan membuat kita lebih yakin. **m31

Jawablah secukupnya Sebelum memberi jawaban atas pertanyaan yang diajukan oleh anak kita, sebaiknya cari tahu lebih dulu maksud dan kejelasan dari pertanyaan tersebut pada anak. Sehingga kita tahu benar, jawaban apa yang diinginkan anak. Tidak berlebihan, dapat dimengerti, dan sesuai dengan apa yang diharapkan anak. Jangan pernah melebihlebihkan jawaban yang tidak diharapkan anak. Hal ini akan memberi kesan bahwa kita sedang menceramahinya. Jawablah jika ditanya Ada kalanya kita tidak mesti menunggu sampai anak kita bertanya pada kita untuk menjelaskan apa yang sudah seharusnya mereka ketahui.Tetapi, saat anak bertanya merupakan kesempatan emas bagi para orang tua untuk menjawabnya. Karena saat anak bertanya adalah saat dimana anak sangat membutuhkan informasi tersebut. Anak akan merasa senang apabila hal yang ingin diketahuinya terjawab. Sisipkan norma agama Menyisipkan norma agama adalah jalan teraman dalam memberikan pendidikan seksualitas pada anak dan sebagai upaya mendekatkan anak pada sang pencipta. Karena agama merupakan jalan hidup bagi setiap manusia agar tidak berlaku semaunya yang nantinya akan membahayakan diri sendiri. Bersikaplah konsisten dan jadilah model yang baik Sebagai orang tua perlu kita sadari anak akan lebih mempercayai apa yang ia lihat dibandingkan apa yang ia dengar.Terlebih jika anak melihat ketidaksesuaian antara perkataan dengan perilaku orang tuanya. Jadi jangan pernah menyalahkan anak jika anak tidak lagi mempercayai kita. Maka mulailah bersikap

Profil Guru

Nurhalimah Sibuea MPd

Anjurkan Siswa Lebih Peduli Lingkungan

konsisten terhadap perkataan dengan perilaku sehingga kita bisa menjadi model yang baik bagi anak kita. Gunakan lingkungan sebagai contoh Banyak kejadian di lingkungan sekitar kita yang sebenarnya bisa kita manfaatkan dengan baik untuk menjelaskan hal-hal yang berkenaan dengan seks dan seksualitas.Tapi, seringkali kita tidak sadar,panik,risih,dan menganggapnya sebagai suatu hal yang bisa merusak mental anak kita.Selama kita mampu bersikap wajar, maka anak akan menangkapnya sebagai hal yang wajar.

MENGANJURKAN siswa untuk lebih perduli terhadap lingkungan, bagian dari komitmen yang dilakukan Kepala SMPN 3 Medan, Nurhalimah Zebua MPd. Ditemui di sekolah itu belum lama ini, Nurhalimah mengaku bangga dengan disiplin siswa terhadap kebersihan lingkungan sekolah. “ Ya, sejak saya bertugas di sekolah ini, para siswa sudah dibiasakan untuk perduli terhadap kondisi lingkungan. Setiap mereka datang kesekolah mereka turut serta memperhatikan halaman maupun ruangan kelas. Jika ada sampah berserakan,ataumerekainginmembuangsampah, harus pada tempat yang sudah disiapkan. Demikian juga penggunaan air saat mereka ke kamar mandi atau saat berada di musholla untuK melaksanakan shalat. Perhatian dan keterlibatan mereka menjaga kebersihan lingkungan membuat sekolah ini sangat bersih. Jika sudah bersih, suasana belajar pasti lebih nyaman,� kata Nurhalimah. Hal lain yang ditekankannya, agar setiap siswa menyadari bahwa menjaga kebersihan bukan hanya di sekolah, tetapi harus diterapkan di rumah masing-masing. Agar apa yang didapatkan di sekolah membias dalam kehidupan sehari-hari. “Menjaga lingkungan agar tetap bersih adalah kewajibanbersama,membangunkesadaranuntuk hidup bersih di sekolah dan diterapkan di rumah menjadi sangat penting agar apa yang mereka ketahui tentang manfaat hidup bersih dapat dilaksanakan di rumahnya masing-masing. Karena itu siswa juga diingatkan untuk menjaga kebersihan dikediamannya masing-masing,�kata Nurhalimah sembari menambahkan selalu memberikansosialiasipadasiswasoallingkungan,� ujarnya. Diajugaberharap,setelahsiswamenyelesaikan

Saa ang Tua Tak M ampu aatt Or Orang Mampu Semua bentuk pendidikan pada dasarnya adalah tanggung jawab utama orang tua sebagai kepala keluarga, termasuk pendidikan tentang seksualitas. Keluarga sebagai faktor utama pembentukan kepribadian seorang anak agar menjadi sosok yang diharapkan. Karena dari lingkungan keluarga anak mulai belajar mengenal dirinya, membentuk dirinya menjadi seseorang yang memiliki pandangan diri yang baik atau buruk (konsep diri). Tetapi,masih banyak orang tua yang tidak dapat memenuhi kebutuhan pendidikan tersebut (termasuk pendidikan seksualitas) bagi anak-anaknya. Banyak orang tua yang masih enggan untuk memberikan informasi tentang seksualitas pada anak-anaknya. Selain merasa risih dan tabu, mereka juga merasa tidak mempunyai cukup pengetahuan tentang hal tersebut. Permasalahan diatas bisa disiasati dengan menjalin kerjasama antara orang tua dengan berbagai pihak yang dapat dipercaya, antara lain pihak guru sebagai Pembina bagi anak saat di sekolah, lingkungan sekitar tempat tinggal sebagai komunitas kontrol, maupun orang-orang profesional di bidangnya. (m38/i)

pendidikannya di SMPN 3 ini, mereka tetap menerapkanrasacintaterhadaplingkungandengan tidak mencemarinya atau merusaknya. “Bagaimana lingkungan harus dipelihara kebersihan dan keutuhanya. Menjaga dan memelihara adalah langkah awal yang baik daripada memperbaiki ketika lingkungan sudah rusak. Ibarat pohon yang rimbun akan berguna sebagai penyimpan air, tapi saat pohon itu kering dan mati akan hilang sumber mata air, maka harus dijaga dan dipelihara sejak dini,â€? ucapnya. ďż˝ Anum Saskia

Siswa SMAN 2 Medan Terima Tali Asih Dari Alumni PARA alumni SMAN 2 Medan dari berbagai kota hadir dan berkumpul bersama di sekolah itu Senin lalu guna memberikan tali asih bea siswa kepada siswa berprestasi. Ketua Umum Ikatan Alumni SMAN 2, yang berada di Jakarta, Rosnawaty Hasibuan mengaku dalam wadah yang mereka sebut IKADA Jakarta ini menjadi sebuah wadah yang memberikan motivasi khusus bagi para siswa untuk lebih giat belajar. Selama ini, sebut dia, keinginan untuk berbagi terhadap siswa di SMAN 2 sudah digagas, hanya saja penetapan waktu dan kesempatan itu belum ada. “Kami sangat berbangga hati dengan siswa di sekolah ini yang mengukir prestasi. Karena itu, kami sengaja memberikan

Waspada/Anum Saskia

Para siswa dan alumni dari Jakarta berpose bersama usai penyerahan bea siswa bagi yang berprestasi sekolah itu.

penghargaan kepada siswa dengan pemberian bea siswa bagi pelajar yang duduk di kelas XII dan meraih rangking 1,2 dan 3. Mereka diberi uang sekolah selama 6 bulan atau satu semester.Ada 30 siswa yang mendapatkan bea siswa,�kata Rosnawaty sembari menambahkan kegiatan ini sekaligus kepedulian para alumni khususnya yang berada di Jakarta,diharapkan bisa menjadi contoh bagi almuni di kota-kota lainnya. Kepala SMAN 2 Drs M Abduh menyambut positif kegiatan ini dan berharap program ini bisa berkelanjutan sehingga memberikan motivasi bagi siswa untuk lebih giat belajar. Prestasi siswa, kata Abduh semakin tinggi nilainya, tatkala mereka mendapatkan apresiasi dari berbagai pihak.

“Alhamdulillah atas perhatian para alumni, hal ini membuktikan bahwa para lulusan sekolah ini tetap memberikan perhatian terhadap sekolah yang menjadikan mereka sukses menapaki kehidupannya. Jika ada alumni lainnya yang melakukan hal seperti ini, semakin membuktikan keperdulian kita terhadap dunia pendidikan cukup tinggi sehingga anak-anak bangsa ini lebih termotivasi untuk belajar. Saya mengucapkan terimakasi kepada panitia penyelenggara dan para alumni yang berasal dari Jakarta, semoga apa yang mereka berikan mendapat imbalan setimpal dari Allah SWT,� kata M Abduh.

** Anum Saskia


ĂŚ  Ăś ˜ŽÂ’ p ç  -  á Â? è ø  -  Â?   ˜ŽÂ’ p  -  Â?



 3N  3N

     ˜ Â’­ p   +   Â?   ˜ Â’­ p    -   Â?

˜ Ž’ p

60° 60°





Â?   Â?    Â?Â?  

            Â?    ­€‚ Â?Â?  

v(ms 1) ƒ 16 ƒ ­ƒ 8 ƒ „ t(s) ƒ 0  € t


Â…Â?     ‚     Â? †‚‡ˆ‚  ‰

500 kg

M 40 ms

10 ms


‹Â?      Š‚    Â?  Â?™š    V1


 ‡ €  ­



‡  ‡


­„Š ‡Š ‡€Š „­Š  †Š

‘        Š € ›Š Â?  ‡™šÂ?

   ­ˆ‚ Â?  


­™š „™š  †™š ‡™š „‡™š

m = 2 kg A

V = 2 m/s 3m B


‹Š     ÂŒÂ?

    ˆ‡Œ ÂŽ    ‡    ‘  Â?Â’‚‡ˆÂŒ‚Â? Â’ ˆÂŒ‚“Â’€ˆ‚  Â? ” ‡ ‡  •„  †

Q1 800 K

ÂŽ Â?Ž– Â?‚ —Â’„ŠÂ?Â?


‡ŠÂ? „ŠÂ? ŠÂ?  •„ŠÂ? „ŠÂ? †



Â?Â?   Š           ” 

ÂŽ ž‘ ‚  Š ÂŽ žÂ&#x;  Š Â…    Â&#x;   Š  Â&#x;   Š  Â&#x;        Š  Â&#x;    Â&#x; 


 +  = 

ƒ­   ÂĄ  ‘ Â’­‚‡Â?    ‚‡ Â?‚  ÂŽ  

 Âœ   +  =     +  =  •œÂĄ‡Â’ • †  ‡ € „     Â’   ‚Â’ -      ‚Â’ - -  ‘ƒÂ’‚ÂœÂĄÂ’  ‡  † ­ „



    ƒ€ †ƒ‡  ‘        ­„ ­­  ­­­ ­€ ­­ Â? Â?Â?Â? œ’œƒ„œÂĄ•œÂĄ    Âœ¢ƒÂœÂŁ ƒ¢Âœ¢ Âœ¢ƒÂœÂŁ  ¢Âœ¢ Âœ¢ÂœÂŁ ¤       ÂĽÂ&#x;Â&#x;Â&#x;Ž‹

Tinggi (cm) 150 – 155 156 – 161 162 – 167 168 – 173 174 – 179

 ¤ ÂœÂ?Â? ÂŚÂ?Â?       

ƒ    ÂĄ  ƒ 


 �� ��†‰ � †˜� 

—  Â?Â?Â?Â?   ‹ ¨  ¤ Â?  Â?Â?Â?  ¤  Â?Â?Â?  ¤ Â?Â?Â?Â?Â?Â? Â?  ¤  Â? Â?Â? Â?  ÂŽ    ¤  Â? œÂ? §Â?Â?Â? Â?Â? Â? 

¤  Â?Â?Â?Â?Â?Â? Â?    Â? „ ‹Â?Â?Â? Â?  Â?   Â? Â? Â?Â?Â?Â?¤ Â?   

Â?  Â?   Â?Â?        Â?Â?

 ‚Â?   Â?     Š  Â?  Â? ™Â?   ‚      Â? Â?Â?   Â?Â?Â?  ŠÂ?Â? Â?     Â?  Â?Â?Â?  Â?  Â?  Â?  Â?   Â?¤     Â? Â?Â?   Â?Â?  Â?  Â?         ÂŞ   Â?  Â?     Â?  Â?       Â?   

Frekuensi 6 20 30 28 16

‰Â?    „‡‚ „„‚  „„‚† „‡‚€ „„‚‡

—      Â? Â?Â?   Â?Â?¨  ¤Â?Âœ      ¤Â?   Â?   ¤Â? Â?Â?    Â?  Â?Â?  ¤Â?     Â?

Â?   Â?Â?Â?Â?   ¤Â? Â?Â? Â? Â?  Â?Â?˜Â? 

 ¤ ÂœÂ?Â? ÂŚÂ?Â?‡



™ ž


 Â? œÂ? §Â?Â?Â?

Ž¤Â? Â&#x;Â?

 ƒ      ‡œ  ÂĄ Âœ ƒ ­ Â’    Âœ     Âœ  +                    



300 K V



™Š       ÂœÂ?  ÂœÂ?Â?  šÂ?  šÂ?Â?   Â?

§  Â?Â?Â?Ž¤Â? Â&#x;Â?






‹   Â?       ˜Â?Â?  Â?Â?      Š     


§  Â?Â?Â? Â? Â?Â?Ž¤Â? Â&#x;Â? Â? Â?Â?š Âœ Â?  Â?   Â?  Ž¤Â? Â&#x;Â?  Â? Â?Â?       Â?  —  Â?Â? Â?  Â?  Â?Â?Â?  Â?  Â?Â? Â?  Â? Â&#x; Â?‚   Â?Â?   — Â?Â?Â?Â?Â? Â?Â? ÂŚÂ?Â?Âœ—   Â?Â?Â?Â?Â? Â?Â?Â?Â? Â?‚ Â?

Â?Â?Â?Â?  Â?Â?Â? Â? Â&#x;Â?Â? Â? Â?  Â?Â?Â? Â?Â?   ¤ Â?Â?Â? Â?  Â? ‰ Â?Â?  Â?  Â?   



ÂŽ   Â?   Â?Â?ÂŽ   ‚‡Â?Â? ŠÂ? Š Â?Â?Â?‚Š Š Â?Â?Â?  ‚‡Â?‚   Â?Â?   Â?Â? ‹Â’‡Â?

 ‡‡  €€ ­­ „„

ÂŽ  Â?Â?    ƒ‚‡  ‚•  Â’Âœ ÂĄ­œÂĄ• Â’ÂœÂĄ­œÂĄ Â’ÂœÂĄ­œÂĄ Â’ÂœÂĄ­œÂĄ  Â’ÂœÂĄ­œÂĄ  +  Â&#x;   Â?Â? œ’  -    š   Â?ƒ œ’  +    š    -    +    š    -    +    š    -    +    š    -    +    š     -  


— Â?Â? Â?¨  ¤ Â?    ¤ Â?Â?Â?   Â?Â?Â?Â?Â?Â?  Â?Â? Â?      Â?        ÂŽÂ? Â? Â?   Â?         Â? Â?    Â?Â? Â?   Â? Â? Â?Â?   Â?Â?Â?  ¤  Â?Â?Â? 

Â?Â? Â?Â?     ÂŤ —  Â?Â?   Â? ¨

�   �  

 Â?Â?Â? Â  

 ¤ ÂœÂ?Â? ÂŚÂ?„Â?€   ‰ Â…Â? ‰    ‚ Â? Â?Â&#x; ‚   Â?  ÂŹŠ ÂŽ  ‹  Â?ÂŚÂ?Â? ž Â?‚  ‰ Â?  Â?Â?Â?      Â?  Â?  Â? Â?Â?Â?    

 Â?Â?    Â? §‚  Â?Â?Â?  Â? Â?ÂŞ ‚ Â? Â?   Â?     Â? Â?   Â?Â?   Â?  ¤   Â? Â? Â?Â? Â?Â? Â?Â? 

 Â?Â?Â? Â? Â? Â?Â? ¤ ÂŚÂŽ Â?     Â?Â?    Â?Â?Â? Â?   Â?Â? Â?‚  ÂŚÂ?Â?Â? Â?Â?Â?Â? Â?  

Â?Â?    Â?Â? 

Â?Â? Â?Â?  Â? —  Â? Â?Â?Â?Â?  Â?Â?  Â?‚Â?   ‚ Â?Â?Â?  Â?ÂŽ Â?Â?¤   Â?Â?  Â?Â?Â? Â?Â?ÂŽÂ?  Â?‚Â? Â?Â?Â?Â?   Â?  ‚ Â?Â?Â? Â?Â? Â?™


 Â?Â?Â? Â?       Â?Â?Â?Â? Â&#x;  Â?  

 Â?Â?       ™ÂŚÂ?Â?  Â?   Â? Â?™ Â?    Â?     Â?‚Â?  ™     Â?Â?Â? 

ÂŽÂ?Â? Â?  ¤  ÂŚ Â?  Â? §  Âœ‚  Â?  Â?Â? ¤   Â?Â?    Â?Â? Â?  Â…¤    Â?   Â?ÂŽ  Â?Â? Â?Â?     Â? Â?‚ÂŹŠ  ÂŽ Â?  Â?Â?Â?  Â?    Â?—  

    Â?Â? ‚ Â? Â?¤   Â?Â?Â?


Â?Â?     Â?¤ Â?Â?   Â? Â? “ “ Â?Â?‚     

Â? ÂŽ   „



¤ Âœ Â? ÂŹŠ ÂŽ

¤ ‰  

¤ ÂŽ Â?ÂŽÂŽ Â?Â? ¤ ‹‹ ¤ Â?Â?  ¤   —   Â? Â? Â? Â?¨  Â?  Â?Â? Â?Â?  Â? Â?Â?   

  Â?Â?Â? Â? Â?Â?Â?   Â?Â?     Â?          Â? Â? ÂŚ — Â?      Â?Â?Â? Â? Âœ¨  ¤  Â? Â?

  ÂŚ  ¤   Â?  Â?  Â? Â? Â? Â?Â?   

 Â?Â?  ¤  Â?Â?    Â?Â?Â? Â?‰ Â…  ¤  Â? Â?     ¤  Â? Â? Â?

 ¤ Â?Â?Â? ÂœÂ?Â? ÂŚÂ?•

  § �     ‚   �

 Â? ÂĽÂˆÂ? ÂĽˆ‡‚Â?  Â? Â?Â? Â?Â?

Â? ‚‰„‚Â? Â?Â?Â? ‰•¤ Â?   Â? ÂĽÂˆ Â? ÂĽÂˆÂ­   Â?‰ÂŞ Â?    Â?‰‡„ 

• ¤ Â?Â? Â? Â? Â?    

Â? Â?    Â?

  �� �

 —   Â?   Â?  ÂĽÂˆÂ? ÂĽÂˆÂ­  ¨ ‰„ ‰  ‰„ ‰• ‰‡


Â?Â? ­   ĂŚ  Ăś ĂŚ  Ăś ĂŚ  Ăś = = ç  á - ç - á = ç  á ç - á ç  á ç - á è ø è ø è ø   ĂŚ - Ăś ĂŚ  Ăś ĂŚ - Ăś  =

= ç  á - ç - á = ç  á ç - á ç  á ç - á è ø è ø è ø    ‰ Â?       ĂŹ ĂŚ  ÜÌ - Ăś ç  áç  á ĂŹ Ăź  ĂŻ ç áç á  ĂŻ ĂŻ ĂŻ ĂŻ è - øè  ø  = Ă­ Ă—  Ă˝ =  = Ă­    ĂŻ  ĂŻ ĂŻ  - +  +  -  ĂŽ Ăž ĂŻ ĂŻ ĂŽ


 =   -  Ăž  =   -     ‹  

ò  =  ò     

Â’  Ă—   + =  +

       Â’  -  +   -  +  +

„Â? Â?Â? ­Â… ‰ Âœ   

     Š  ž ÂœÂĄ ÂŁ  Â’ƒ ÂœÂĄ ÂŁ  Â’ƒ ÂœÂĄ ÂŁ † Âœ Âł  Âł  ÂŞ  Â? œ‚Â’ÂœÂĄ ÂŽ Â’ -  Â’ƒ‚‡ Â… ƒ¢ƒ‚‡¢ƒ Â?Â? ÂœÂĄÂ’ ÂœÂĄÂ’†ÂŻ œ’‡ Ăž Â’ Â…  ‡Â?    Â?  †Â? Â?Â? ­ Â’ÂœÂĄÂ&#x;  -  - =   - +    -  -  -   

       - - = - -  +    - - =  -+ -+  

- - - +  +  Ìç  Üá =  Ìç  Üá ç - á  ç - á  è ø è ø  - +  -  



a  b   a  ÂĄ b  Â’ ƒ‚ ab Â’ƒÂĄ   a Â’ b  b ÂĄ b Â’ƒ   b Â’ƒ  a Â’ ƒÂ’ƒ  ‘ ƒ ƒÂ’ƒÂĄ Ăž Â’ -  €Â? Â?Â? ­   =  Ă—  =  Ă— -     ÂŽ -  -      +  Â’ƒ„ ‚Â? Â?Â? ­ƒ ‰ž Â’ÂœƒÂœÂĄ­

ß ï ïï çÌ - áÜ ýç  á ï è - ø ï ï Þ


�� ­…

 =  Ì   Ü = ç  á è ø

 -       - 

          Ăž   =    ’œœ’ ‹ Âœƒƒ‡Â’Š °ƒϡƒ‡Â’ƒÂœƒ‡Â’ ÂœƒÂĄ‡Â’ ‰Â?

�� ­


A= 4 5


B = 12 13




A= 3 4


A 4



B 12

B= 5 12

¥¥’¹¹  +  +  =  ×  × 

     +  =  

    = -   = -  Ăž    ŠÂ? Â?Â? ­ ÂœÂĄÂœÂ?Â?ÂœƒÂ’ ÂœÂĄÂœƒÂ’

    +     -  =     œ’ƒÂœÂ’  œ’‡Œ‚‡ŒÂœÂ’‡Œ‚†‡Œ‚•‡Œ‚‡‡Œ


�� ­ƒ H








P 1 3

‘ Ž ™ª Š Ž   P 1 C

D 3 2



ÂŽ    Â?     ž Â? Â?Â?  Â?    Š    ‚ ‚   Â?€Â? Â?Â? ­ƒ ‹Â?Â?  Â?Â?      ‚       Â?Â?   Â… Â?Â? ž   ŠŠÂ? Â?Â?     ŠŠ   Â?‚Â? Â?Â? ­ Â…Â?Â?

   Š     Š        ²   Š            ŠÂ?Â?  ž Â… ŠÂ?


 žŠ Â?ž ­  ž Kebijakan Fiskal 1. Tingkat bunga bank (diskonto) 2. Pasar terbuka 3. Cadangan giro minimum 4. Syarat kredit

INFLASI DEFLASI TUrun naIK Beli juAL TUrun naIK LONGgar ketAT IkAL IkAT TuBi TuLong

Â… ŠÂ? ‰   ‰Š Â?„Â?

Â?Â? ­     Â?       Â?Â?  Â?™   Â? ž         Š    Š Â?†Â? Â?Â? ­  ž Â’ÂĄ‚€­˜ ˜ Â’ ž‹Â’¨ ‘  ž  Â’ÂĄ‚€­˜ ‹ Â’ƒÂĄ ƒ‚€­˜ Â’ƒÂĄ‚„˜ ‹ Â’ƒÂĄ‚„  Â’ƒÂĄ Â’ Â?‡Â? Â?Â? ­ ÂŽ ž    Â?    ÂŽ  ÂĄ‚Â? ÂĄ       Â?‚       ÂŽ   ÂĄ‚ ƒ‚ ÂĄ        ÂŽ  ƒ‚ Â? ƒ     Â? ÂŽ  ƒ‚  ÂĄ ÂŽÂ?     



(dalam ribuan rupiah)


D Ž¤  D § Â?Â? =  Ăž Â?Â? =     


�� ­…



1 20.000,00 5 (5.000,00) 12 (6.000,00) 20 (3.000,00)

Perlengkapan Peralatan 3.000,00



20.000,00 20.000,00 15.000,00 (6.000,00) -

Â?ˆÂ? Â?Â? ­ ‰Â?  Â’‰Â? ÂĄ“    ƒ   Â’‰Â? ÂĄ“ Â?Â? ÂĄ ˆƒ  ˆƒ  

Â’‡ÂĄ‡­‡ÂĄ ‡‡ƒ ­†ÂĄ ƒ†‡ Â’‡ Â?‰Â? Â?Â? ­Â…  Š   ‚Â?  

    Perlengkapan Tanggal

Keterangan Ref Debit

Des 31 J. Pembelian


Saldo Debit Kredit

50.000,00 50.000,00

Piuang Dagang Tanggal


Des 31

Penjualan kredit






Saldo Kredit


Utang Dagang Tanggal


Des 31

Pembelian kredit Retur Pembelian





Saldo Kredit





�Š� �� ­ Ž�    Š   (Dalam ribuan rupiah) No

Nama akun

(A) (B) (C) (D) (E)

Perlengkapan Persediaan barang dagang Retur penjualan Pembelian Biaya Iklan

Daftar Sisa Penyesuaian DS.disesuaikan Rugi–Laba D 500 2.300 200 1.500 200

K – – – – –

D K D – 300 200 1.500 2.300 1.500 – – 200 – – 1.500 75 – 125

K – – – – –

D 200 – 200 1.500 125

K – – – – –

Neraca D 200 1.500 – – –

K – – – – –

€‹Â? Â?Â? ­ ‘    ž Ikhtisar rugi–laba Rp 4.100.000,00 Beban gaji Beban air, listrik, telepon Rp 900.000,00 Beban sewa Beban asuransi Pendapatan jasa Rp 5.000.000,00 Ikhtisar rugi–laba

Rp 1.000.000,00 Rp 1.000.000,00 Rp 1.200.000,00 Rp 5.000.000,00

BAHASA INDONESIA €Â?Â? Â?Â? ­ƒ               “  ” €€Â? Â?Â? ­Â… Â&#x;               €‚Â? Â?Â? ­ Â&#x;Â?Â?      Â?Â&#x;Â?Â?    Â?   Â&#x;Â?Â?  Â?     €„Â? Â?Â? ­ ÂŽ               ۠Â? Â?Â? ­Â… ‹   Š    §  ‚      

   Â…     Š     Â?Â?  Â?  €‡Â? Â?Â? ­ Â…   Š     Â?   Â?   Â?         Â? Â?  €ˆÂ? Â?Â? ­Â… ‹ Â?Â?        Âł Â?   €‰Â? Â?Â? ­  Â?              €ŠÂ? Â?Â? ­Â… Â…ˆ     ‚ ‚   ‚‹Â? Â?Â? ­Â… ÂŽ      Â?      



WASPADA Minggu 15 Januari 2012

Catatan Budaya

Berhala Oleh: S. Satya Dharma

Waspada/Arianda Tanjung

ATRAKSI BARONGSAI. Sejumlah pemain barongsai melakukan atraksi dalam acara Imlek Fair 2012 di Central Business District (CBD) Polonia Jl Padang Golf Medan, 6-15 Januari. Sejumlah pertunjukan yang mengangkat budaya Tionghoa seperti musik dan tarian, juga ditampilkan di sana.

Salam Kesenian Pak Gatot Oleh: Mihar Harahap KABAR dari seniman dan media, periode kedua kepengurusan Dewan Kesenian Sumatera Utara (DKSU) telah berakhir. Malah sudah tiga tahun melampaui batas periode. Tampaknya, seniman dan masyarakat peduli seni mulai resah. Sebab, mereka mengharapkan agar kepengurusan DKSU yang baru segera dibentuk. Masalahnya, mengapa sampai hari ini kepengurusan baru DKSU belum juga terbentuk? Tanyalah Pak Gatot selaku Plt Gubsu. Bagi saya, apa pun alasannya, yang penting ada niat untuk membentuk dan bermanfaat bagi kesenian di Sumut. Menurut keyakinan saya, Pak Gatot, telahmengantongibeberapa nama calon Ketua DKSU. Bagi saya, siapa pun yang diangkat, harus diterima seniman dan masyaraka peduli seni.Tetapi kita berharap calon ketua hendaknya seniman agar tetap terpilihara identitaslembagadankeprofesionalannya. Tak usahlah pengusaha atau pejabat, kecuali ia seniman. Lebih baik pengusaha atau pejabat itu berperan sebagai induk semang kelompok seni yang hidupnya jatuh bangun di tengah masyarakat daerah. BilaCalonKetuaDKSUsudah diperoleh,makalangkahselanjutnya adalah menerbitkan Surat Keputusan (SK) Susunan Pengurus, mulai dari Ketua, Sekretaris,

Bendahara, dan Komite (Sastra, Teater, Tari, Musik, Lukis, dan lainnya). Kemudianmelantik/mengukuhkan pengurus secara formal atau semiformal. Di gedung mewah atau di lapangan terbuka sehinggadapatdisaksikanmasyarakat luas. Yang pasti harus ada pelantikanagartumbuhrasatanggungjawab para pengurusnya. Selanjutnyaadalahmenghormati proporsional dan profesional seniman. Caranya, berikan hak- hak normatifnya, seperti honor,uangmakandantransportasi agar dapat bekerja dengan baik. Jangan biarkan mereka meminta-minta mencari lahan bantuan.Ataumelakukankorupsi dana kesenian hanya untuk kebutuhan itu. Kemudian, memberikan kantor dengan segala fasilitasnya. Harus jelas di mana kantornya, alat-alat kantor dan pegawai yang juga seniman. Bahkan bila mungkin,adaruangperpustakaan,baca tulis dan istirahat untuk para seniman luar kota yang bertamu.

Tidak kalah penting adalah merumuskan kewenangan seni agar tidak terjadi istilah tumpang tindih, misalnya kesenian di dinas pendidikan yang bersifat mendidik untuk siswa, lalu di dinas pariwisata yang bersifat komersil untuk turis. SementarakeseniandiDKSU lebih bersifat membangun untuk masyarakat.Bentuk-bentukkesenianinilahyangperludirumuskan tim Pak Gatot atau bersama pengurus dewan yang diangkat. Menurut saya, DKSU adalah lembaga yang mampu membina dan mengembangkan eksistensi kesenian di Sumut. Untuk itu, perlu dilakukan evaluasi hasil kerja minimal pertahun untuk melihat sampai sejauhmana manfaat DKSU sebagai mitra kerja Gubsu. Sistem evaluasi per-unit, unit mana yang baik/kuat dan perlu dipertahankan serta unit mana yang kurang baik/lemah dan perlu ditingkatkan. Kalau hasil evaluasi menunjukkansemua/sebagianbesarunit tak bermanfaat, maka pengurus bersedia mundur dan dilakukan reshuffle. Setelah Pengurus DKSU dikukuhkan dan mulai bekerja, maka langkah pertama yang harus dilakukan adalah konsolidasi antar-pengurus. Penting Pak Ketua DKSU membuat Surat Perjanjian Kerja (SPK) agar tiap pengurus memiliki tanggungjawab, dedikasi, integrasi, dan profesionalisme. Selanjutnya menyosialisasikanperaturansekaligusresikonya bila melanggar peraturan. Menyatukan persepsi tentang visi

misi yang harus dicapai dalam kaitan dengan arah pelaksanaan pembangunan segala bidang di daerah ini. Berikutnya adalahmelakukan pemetaan wilayah kerja. DKSU wajibmenghasilkanbeberapahal, di antaranya penerbitan Pedoman KerjaTahunan (PKT) selama periode dengan menitikberatkan pada skala prioritas. Selanjutnya membentuk Satuan Program Kerja Tahunan (SPKT) berdasarkan PKT. Satuan program harus dapat mendeskripsikan jenis kegiatan yang bersifat membangun/mengembangkan kesenian. Terakhir adalah membuat Kalender KegiatanTahunan(KKT)berdasar PKT dan SPKT. Kalender kegiatan berisi jenis kegiatan, tempat/ waktu pelaksanaan, peserta/ audiens, dan tujuan kegiatan. Menurut hemat saya, keberhasilan membuat PKT, SPKT, dan KKT ini merupakan bukti nyata bahwa pengurus telah menyelesaikan40persentugasnya.Tinggal 60 persen lagi waktu pelaksanaan kegiatan. Karena itu, disarankan supaya dalam pembuatan langkah kedua ini cukup waktu, kondisi baik, bahan lengkap, akurat, dan saling membantu. Ketua DKSU ke depan juga harus melakukan pemerataan kesempatanuntukmengisikegiatankeseniandewan.Halinisering dikeluhkan bahwa dewan tidak/ jarang memberi kesempatan kepada kelompok seniman lain, kecuali kelompok seniman dewan/oknumsenimandewanyang memiliki kelompok seni atau mengorder kelompok langganan

yang mungkin berisi komisi. Juga dalam menentukan wilayah kegiatan, sering mengambil tempat/daerah yang itu-itu saja, terutamadikabupaten/kotayang mapan. Padahal seharusnya dewan seniman serta masyarakat peduli seni tidak membedakan kelompok dan wilayah kegiatan. Langkah selanjutnya adalah sistem pengelolaan keuangan. Hal ini sangat prinsip sebab tak ada duit tak ada kegiatan. Juga paling sensitif, sebab tak ada kegiatan, niscaya diisukan orang dewan ‘mati suri’ dan dananya dikantongi pengurus atau ‘bagibagi jatah’ dari atas ke bawah. Karena itu, mulai dari pemasukan (APBD, sumber/bantuan dandanalainyangtidakmengikat), pengeluaran (dana rutin, honor, kegiatan dan lainnya) serta saldo (plus-minus) sebaiknya transparan. Bahkan siap diverifikasi oleh akuntan publik. DKSU juga harus menjalin kerjasama yang baik antardaerah dalam negara maupun antardaerah luar negara. Hasil kerjasama harus dapat mengangkat harkat dan martabat masyarakat (asli-pendatang) dan kesenian (tradisional-modern) Sumut di Indonesia maupun manca negara. Alangkah bangganya Pak Gatot dan masyarakat Sumut bila harapan itu dapat terwujud. Karenaitulah,KetuaDKSUkedepan wajibmelakukankerjasamadengan berbagai pihak yang terkait. *Penulis adalah Kritikus Sastra dan Dekan FKIPUISU Medan

Berjalan Pelan Di Pecahan Kaca Oleh: Tandi Skober Kaki angin yang putih berjalan pelan di pecahan kaca tenang dan berwibawa. Bayang tubuhmu atas air—menyelinap ke lubuk lenyap membasuh percik darah di tubuh ikan-ikan (“Kaki Angin” Ahda Imran)

YUDHOYONO adakah daun jambu yang lepas dari cabang sejarah atau Kaki Angin yang berjalan pelan di pecahan kaca? Hmm, saya tidak tahu.Tapi Pecahan kaca itu ada di ruang ruang Istana Merdeka Jakarta. Meja Marmeruntukpenandatanganan naskah berita acara pelantikan pimpinan lembaga negara dan pejabat itu ambruk pecah saat Presiden Yudhoyono melantik Wantimpres Albert Hasibuan. (Antara, selasa 10-1). Bisa jadi Yudhoyono terkesiap kamitenggeng ketika ritual kenegaraan berjalan tak elok. Ia sesaatmenunduk,terustengadah membaca Indonesia, yang “berjalan pelan di pecahan kaca,” tulis penyair Ahda Imran. Tapi ada darah ketika kewibawaan negara terpuruk di ruang tak berbentuk. Negarabatin Jawa mengadop hal ini sebagai.“nagari pager doyong’. Nagari Pager Doyong ini bernama Indonesia itu dengan indeks kumulatif 83,1 diposisikan Majalah Foreign Policy danYaya-

sanFundforPeacesebagainegara gagal (Failed States). Ini ditandai dengan adanya banyak hal tentang luka kultural yang diciptakan para penguasa bergincu culas. Suara bruk saat marmer pecah itu isyaratkan suara risau yang tuturkan tentang ilalang kering. Ketika kemarau tiba, dengan sedikit percikan api, Indonesia hanya tinggal asap, abu dan debu di ruang peradaban tanpa jenis kelamin. Simak di sudut-sudut ruang yang muram selalu saja ada amarah yang tumbuh dari akar perseteruan antar elit (factionalized elites). Yang malang, tiap kali ada persetruan antar elit, maka yang terkalahkan selalu saja anak-anak akar rumput. Rakyat tiarap, megap-megap! Sebab demokrasi di nagari pager doyong selalu alirkan hipokrisme sebagai pembenaran bahwa wong duwurlah yang layak langgeng menjadi bendera merah putih di ujung tiang yang mangmung. “Seperti ular yang melata di hutanyangberembun,”bisikAhda Imran dalam sajak Dalam Peti Kayu,”Begitulah suaramu, lalu aku mengetahui sebuah negeri.” Ini tentu aneh! Tapi itulah sudah! Nagari Pager Doyong sedang menapaki takdir yang ia ciptakan sendiri. Telah sirna tanpa karna nilai, etika dan tatakrama demokrasi. Padahal hal yang tiga itu, itulah hakikat dari kedaulatan rakyat.Nilaibisadimaknaisebagai

piranti akal. Etika bergerak di ruang nurani. Nafsu menari di pusaran tatakrama. Sinerjitas nan tiga itu, holistismenantigaitu,masihjauh panggangdariapi.Nyarisdisemua lini yang terjadi adalah paternalisme dan feodalisme! Politik identitas berbasis primordialisme etnik dan golongan masih cukup kuat. Tokohtokoh budayawan tidak lagi terposisikan sebagai sosok sang pencerah. Sedang cendekiawan seperti diungkap James Baldwin dalam “Notes of a Native Son” telah terjerat dalam sejarah dan sejarah terjeratdalamdirimereka. Tidak aneh manakala sejarah kadang bagaialbumpenuhdebu. Sindrom disorientasi telah mencakarmanusiahingga keakar paling primodial. Orang memosisikan“orang”sebagai tuhan sekaligus hantu. “Bahkan dalam sejarah peradaban barat, agama telah tercoreng,” tulis Prof. McInner “Relegion in The 21 Century “ Itulah sudah! Ini pulak yang membuat bumi Nagari Pager Doyong sarat dengan raja-raja kecil yang petantang-petenteng menintingpolitikfeodalismeyang dari selangkangannya mengucur pipis pesing saat kekuasaan sedang ngaceng! Apa artinya? Demokrasi di Nagari Pager Doyong telah melahirkan kaum borjuis di berbagai struktur birokrasi. Hmm, saya jadi ingat John Naisbitt (1994) yang muncratkan hipotesis prediktif “Global Paradox” tentang binasanya kebang-

saan, wafatnya konsepsi negara kesatuan. Juga membuat saya mantuk-mantuk membenarkan hipotesis “Benturan antar Peradaban” Samuel P.Huntington (1993) yang paparkan seputar ladang keroyokan, pertarungan serta pertumpahan darah akan terjadi di sepanjang garis pemisah antarperadaban. Tak pelak, nalar Huntington dan Naisbitt diseputar paradoksi “tanah air peradaban” ini patut diwaspadaisebagai pertandaning jaman nagari pager doyong. Kenapa? Paradok global telah menyeret awal abad 21 pada titik terpuruk abad barbarisme. Sementara “The Clash of Civilization”sejenishipotesisyangmengikhlaskan bumi sebagai pusat granat, amarah abnormal sniper dan pertarungan antarketakutan di pusat pereferial kekuasaan tribalisme. Di dataran ini,politisi, birokrat, militer dan penegak hukum cenderung kolutip dalam mengobsesikan diri menjadi bintang yang namanya akan dicatat sepanjang jaman. Mereka memanipulasi ramalan cuaca menjadi amalan cuaca, memanipulasi masa depan melalui berbagai hipoteis prediktif yang berakar pada jaringan doktriner. Hingga tak aneh bila pepatah latin mengatakan “Corruption optime pessima” *** Ketika marmer ambruk pecah, adakahYudhoyono menyadari bahwa dari sebuah marmer licinmengkilattidakakantumbuh

rumput dan ilalang. Ah, saya teringatpenyair AhdaImranyang kini ada di Medan,” Kaki angin yang putih berjalan pelan di pecahan kaca,”bisiknya,”tenang dan berwibawa. Bayang tubuhmu atas air—menyelinap ke lubuk lenyap, membasuh percik darah di tubuh ikan-ikan.” Percik darah tentu isyaratkan banyak hal. “Seperti seekor ikan yang terdampar dan ditinggalkan,” kembali ujar Ahda Imran, kerap tebarkan aroma laut melipat mayat.” Begitulah suaramu laluakumengetahuikisahsebuah negeri— langit yang hilang di dasar danau, mahluk jahat yang berdiam di balik kata-kata, dan peti kayu yang terapung-apung. Di dalamnya aku hidup.” Ini skeptis, tentu! Tapi masih ada waktu. Sebab era kini adalah era jogregan. Seperti pagelaran wayang selalu saja ada saat jeda ketika petruk gareng nala genggong bergoyang guyon. Kita tertawa terkencing-kencing saksikananekdotyangtakberbasis pada alur cerita. Tapi kita juga terisak menangis. Dan bertanya, “Kenapa kau lepas aku dari cecabang pagi dan didamparkan di sini?”tulis Bunyamin Fasya dalam sajak Selembar Daun Jambu. Sebab, “Ada seikat lidi yang belum mengenalmu. Lepas oleh sebitanpisau!”.Yudhoyonoadakah daunjambuyaglepasdaricabang sejarah atau Kaki Angin yang berjalan pelan di pecahan kaca? *Penulis adalah Dewan Penasihat Kebudayaan Indonesia Police Watch

KITA memang tak lagi hidup di abad lampau. Ketika manusia masih mengandalkan ototnya dan peradaban merupakan kosakata yang belum ditemukan padanannya. Kini manusia hidup dalam pengagungan akal dan menempatkan kecerdasan otak sebagai sumber pemberdayaan dalam semua aspek kehidupan. Di masa lampau, jauh sebelum Muhammad SAW dipilih Allah sebagai pembawa risalah kenabian, yang mengajuk jiwa setiap manusia pada pengesaan Al Khalik, manusia hidup dalam kotak-kotak tafsirnya sendiri atas eksistensinya sebagai makhluk. Maka yang kuat menguasai yang lemah.Yang berkuasa menindas yang tak berdaya. Kekuatan dan kekuasaan pada masa itu jadilah “berhala” yang menguasai benak dan jiwa setiap manusia. Dan ketika peradaban kemudian berkembang, makna kata itu tak lebih dari sekadar personifikasi dari si berkuasa, apapun wujudnya. Berabad kemudian, peradaban mengalami metamorfosa. Berbagai kosakata baru lahir dari proses peradaban tersebut. Macam-macam pula bentuknya. Di semua bidang kehidupan terjadi perubahan yang ekstrem dari proses peradaban tersebut. Baik dalam perilaku individual maupun sosial. Manusia pun tak hanya tumbuh dalam kelompok atas dasar ras dan warna kulit, tetapi juga negara dan bangsa. Ada banyak istilah yang menyertai perubahan peradaban itu. Ada banyak telaah ilmiah dan disiplinilmuyanglahirseiringperubahantersebut. Namun tragisnya, kedigdayaan otak tetap tak mampu meredusir apalagi mengenyahkan “berhala” kekuasan dalam hidup manusia. Kini, manusia memang tak lagi menyembah patung-patung, pohon-pohon besar, gunung menjulang atau kuburan keramat. Tapi pemberhalaan terhadap personifikasi kebendaan, baik yang abstrak dan lebih-lebih yang nyata, terus berlangsung. Di negeri ini, pemberhalaan itu bahkan semakinmenjadi-jadipadabeberapatahunbelakangan. Tak peduli apakah dia bergelar professor doktor, kyai haji atau rakyat jelata, terhadap kekuasaan misalnya, tak sedikit manusia Indonesia yang memberhalakan dirinya. Menikmati sanjungan dan rasa hormat orang lain terhadap dirinya. Kekuasaan di negeri ini adalah berhala abstrak yang dipuja-puja. Maka berbondong-bondong orang ingin jadi anggota parlemen. Berduyunduyun orang ingin jadi lurah, camat, bupati, wali kota, gubernur, presiden. Berbagai cara dilakukan orang untuk bisa menduduki kursi jabatan di birokrasi. Bahkan bila perlu tak hanya dengan menyekutukan Allah dengan para dukun, paranormal atau cenayang, tetapi juga dengan menyogok, menyuap dan

memanipulasi sistem ketatanegaraan. Berjuta-juta pula orang rela saling sikut dan saling tinju demi untuk bisa dekat dengan sang pemegang kekuasaan. Maka di banyak daerah,sabankaliadapemilihankepaladaerah, kita pun disuguhi dengan berita-berita tentang tawuranparapendukungsangcalonpenguasa. Bahkan seringkali, demi dukungan itu, mereka harus menggadaikan akal sehat dan hati nuraninya. Berhala lain dalam abad super canggih sekarang ini adalah uang dan harta. Berjutajuta orang di republik ini rela mendzalimi saudaranya sendiri bahkan saling bunuh demi berhala yang satu ini. Ironisnya, bila ditanya apakah mereka manusia yang beragama, yang percaya pada Al Khalik, umumnya mereka menjawab percaya. Tapi faktanya uang dan harta justru telah menyingkirkan eksistensi Tuhan dalam hidupnya. Mereka bukan tak pernah mengaji di masjid-masjid, mengikuti kebaktian minggu di gereja atau pergi sembahyang ke vihara. Kebanyakan dari para pemuja uang dan harta ini justru orang-orang secara akademis cukup baik kedudukannya dan secara teologis seringkali terlihat sangat rajin beribadah. Tapi semua itu ternyata cuma topeng belaka. Pemujaan mereka terhadap Tuhan hanyalah kamuflase. Ibadah mereka sesungguhnya hanyalah pada uang dan harta benda. Memasuki tahun 2012 ini, kondisi pemberhalaan manusia Indonesia terhadap kekuasaan, uang dan harta itu tampaknya akan semakin parah keadaannya. Dan itu berarti potensi terjadinya disintegrasi kemanusiaan dalam kehidupan bangsa ini akan semakin besar peluangnya. Baik dalam bentuk pembangkangan atas aturan-aturan, maupun pemberontakanataspenyelenggarakekuasaan Negara yang tak lagi bisa dipercaya. Tak sedikit kemudian orang yang mencemaskanbahwadisepanjangtahun2012 iniakanterjadiperistiwa-peristiwakemanusiaan maha dahsyat, yang akan menghancurkan sendi-sendi ke-Indonesia-an kita sebagai sebuah bangsa yang katanya beradab. Maka, sebelum kecemasan itu sungguhsungguh terjadi, marilah kita tafakkur sejenak, wahai saudaraku. Merenungi apakah kita termasuk salah seorang dari manusia Indonesia yang memuja berhala-berhala itu. Jika iya, tak peduli apakah kita seorang presiden, gubernur, bupati, lurah anggota DPR atau rakyat jelata, segeralah bertobat sebelum ajal datang menjemput, dan negeri ini semakin carut marut keadaannya. Camkanlah! *Penulis adalah Sekjen Multiculture Society

Ipa Maakroef Dan Korek Api Oleh: Azmi BEGINILAH gaya eksentrik sewaktu membuat sketsa, sekali dayung dua pulau terlampaui. Begitu kilahnya suatu saat. Dengan memantik korek api yang setia mendampinginya kemanapun ia pergi. Sang korek api akan selalu ada dan siaga apabila ia hendak menyeket, teknik ini mungkin satusatunya di dunia coret-coret ini. Dengan tatapan mata yang liar dan tajam ia siap melahap dan menerpa objek di hadapannya, setiap lintasan objek pun tak akan luput bahkan terlewatkan sedikit pun oleh Ipe, pria berusia 70an tahun itu. Semua jadi kumpulan coretan yang penuh makna dan ketika kita memandanginya. Ternyata bahwa sketsa itu bukanlah karya asal jadi, tetapi murni sebagai karya kualitas nomor satu sejajar dengan karya seni rupa lainnya. Ciri khas karya sketsa adalah peneraan garis yang esensial dan tidak mengumbar khayalan itu, menjadikan sosok gambar di atas akan lebih mendekatkan seseorang untuk lebih memahami garis tidak hanya sebatas torehan kasat mata saja. Namun, dibalik goresan itu terhampar ribuan makna simbolik, keterampilan mengolah imajinasi agar garis tidak mubajir adalah suatu syarat buat orang yang ingin menyekets. Sketsa suatu isyarat Sketsa juga dapat menerangkan atau menjelaskanapakahsosokdantampilanfisikyangdiinginkan diremehkan, diagungkan atau sama sekali tidak ada manfaatnya. Sosok Ipe Maakroef adalah satu bukti yang pantas menjadi guru sketsa yang baik buat pengikutnya. Beliau lebih banyak mencontohkanbagaimanamengusaiemosiuntukmengendalikan imajinasi liar agar tersimpul dalam wujud goresan yang bermakna. Simbol garis lebih dominan pada setiap sisi sketsanya,sementarapadalatarbelakangterkadang dibiarkan melompong, namun di balik kekosongan itu tersirat makna keutuhan karya. Sketsa bagaikan suatu isyarat karena setiap guratan yang tercipta justeru memunculkan tafsiran baru. Seorang yang bersahaja dan sederhana hampir samadengankebersihanhatinyauntukmenghadirkan goresan yang yang tegas, tidak ragu dan apa adanya. Sisi yang seperti ini mungkin sudah sangat langka dan sulit ditemui pada dekade terakhir. Sosok para pemimpin seolah-olah tampil berbeda jauh dengan sosok Ipe, mereka lebih senang menjadi parasit buat kaumnya sendiri. Bahkan mereka juga senang mempertontonkan retorika yang sering membodohi masyarakat, mereka tak segan atau malu menyerobot hak rakyat hanya karena haus kekuasaan. Sketsa suatu identitas Identitas yang semu alias sosok perkasa di mata oranglainadalahcita-citanyauntukdipuji,disanjung atau disucikan. Bagi Ipe hal demikian tak pernah adadalambenaknyabahkanterlintaspuntidak,tetapi cita-citanyaadalahbagaimanagayadanketekunannya suatu saat ada yang mau melanjutkan. Sosok itu seolah sudah paham bahwa usia tak akan bisa dibohongi, di usia yang sudah sepuh ditambah kemajuan zaman yang cepat, hanya bisa disikapi dengan tidak melawan alamiah dan

sujud syukur kepada Sang Kuasa maha Pencipta. Saat ini ia hanya terus berusaha mengisi sisa umurnya dengan hal yang positif “berkarya tanpa putus”, masalah lain yang di luar jangkauannya tidak menjadi prioritasnya. Siapa yang bisa meramal kapan dan di mana batas seseorang, bagaimana ke depan dan mau jadi apa! Yang lebih mengherankan lagi adalah tidak tampak raut wajah kelelahan walaupun ia bukanlah sebentar menekuni dunia coret coret ini. Berawal dari pekerjaan memenuhi setiap edisi terbitan suatu mediacetakhinggailustrasisuatumajalah “Kuncung” ia pun sudah kenyang makan asam garam dan pahit getirnya kehidupan seorang seniman. Namun tidak sedikit pun ia surut atau berhenti menyekets, usia bukanlah menjadi penghalang baginya. Selagi nafas berhembus, jantung masih berdetak, mata masih berbinar terus berjalan dan tentunya kuasa Ilahilah yang harus memacu semangat hidupnya agar tetap bergelora. Sketsa suatu Gaya Dengan santai tapi pasti iapun menyeruput sang pengepul asap, secara otomatis tangannya ikut meliuk-liukkan arah dan torehan yang dalam sekejap tertangkap oleh visual mata, sudah tak berbilangberapajumlahkaryasketsayangiahasilkan. Serutan asap dan kelincahan tangan seolaholah menyatu menjadi satu kekuatan tambahan sehingga spirit yang dihasilkan oleh kedua benda itu. Saling menunjang satu sama lainnya ditambah sapuan selembar kain menjadi pelengkap semua gaya dan teknik yang dipertontonkan Ipe dihadapan orang-orang, terutama mahasiswa yang mendalami studi gambar. Kesetiaan Ipe dalam bidang seni sketsa menambah panjang urutan para maestro dunia ia bahkan bisa ditabalkan predikat pelukis yang sejati. Gaya seseorang tidaklah datang dengan sendirinya akan tetapi melekat dan dekat dengan ketekunan, kegigihansekaligusketaqwaanseorangdalammenyikapi hidupnya. Semua orang punya stilis berbeda-beda ada yang ingin disebut popular ada pula yang biasabiasa saja ketika orang menjadi panutan yang menggila. Bagi seorang Ipe hal yang terakhirlah barangkali yang membuatnya dapat bertahan di tengah gelombang pasang surutnya perkembangan dan pergulatan maraknya globalisasi. Dengan alat yang sangat sederhana dan bahkan tak pernah dilirik orang sebatang rokok, sebuah anak korek api, sekotak arang dan sejemput kain lap yang usang bagi Ipe dapat menghasilkan karya sketsa.Terkadang Ipe juga mampu membuat karya sketsa pesona berwarna yang sangat luar biasa dandayatariknyasekaligusmenambahdaftarpelukis handal di tanah air. Satu hal yang pasti adalah Ipe Maakroef tak mautundukpadasituasi,tetapiiajustrumenciptakan situasi, dalam artian di tangan Ipe sketsa dapat menurunkan berbagai tafsiran tentang mimpimimpinya dan juga makna baru. SemogaIpemasihmaumemburuberbagaisasaran objeknyawalaupunsampaikepelosokyangjauhdari hingar bingarnya kehidupan kota yang sesak. *Penulis adalah dosen seni rupa Universitas Negeri Medan


WASPADA Minggu 15 Januari 2012

Obyek Wisata Cipanas di bawah kaki Gunung Guntur.


Rumah-rumah penginapan bernuansa natural yang banyak disewakan kepada para pelancong.

Wisata Cipanas Garut Menyajikan Panorama Alam Alami KOMENTAR pertama yang terlontar saat mengunjungi Garut, kota ini sangat asri sekali. Kota Garut ternyata tidak hanya terkenal dengan penganan kecilnya yaitu dodol Garut. Tentang alam Kota Garut yang sangat indah dan udaranya yang sejuk ditambah lagi Cipanas yang menawarkan pemandian air panas menjadi pemikat bagi

pelancong untuk berkunjung ke sini. Cipanas Garut di Kecamatan Tarogong Garut Jawa Barat banyak menawarkan objek wisata pemandian yang memiliki kolam renang berair panas. Daerah pemandian Cipanas Garut adalah daerah tujuan wisata lokal. Selain tempatnya berada di satu wilayah, juga jalan menuju ke Cipanas

sudah sangat bagus, ada penginapan, hotel, rumah makan dan lain sebagainya dan pastinya banyak kolam renang dan pemandian yang tersebar di beberapa tempat. Pemandian Cipanas merupakan tempat wisata sekaligus tempat beristirahat. Sejumlah objek wisata Cipanas Garut yang menyuguhkan pemandian dan

Obyek wisata Cipanas Garut.

kolam renang air panas tampak rampai dipadati wisatawan dari berbagai kalangan usia. Bahkan pelataran parkir di sekitar lokasi pemandian air panas tampak dipenuhi kenderaan roda dua dan empat dengan plat nomor daerah Garut serta luar kota seperti Bandung, Bogor, Jakarta dan sejumlah daerah lainnya. Objek wisata Cipanas Garut yang berada di kaki Gunung Guntur dengan status aktif normal itu terlihat tampak ramai pengunjung sedang berenang di pemandian Cipanas serta kolam renang lainnya dengan berbagai macam fasilitas arena bermain air. Sejumlah pengunjung Cipanas Garut mengaku sengaja mengisi hari libur dengan membawa anggota keluarganya ke Cipanas Garut untuk menikmati suasana alam serta menikmati kehangatan air panas yang mengalir dari kaki Gunung Guntur. “Sengaja datang ke Cipanas Garut hanya untuk berendam di air panas,” kata Tuti, warga Jakarta yang memboyong anggota keluarganya dari Medan, Pekanbaru dan Ciamis untuk berlibur ke Cipanas. Salah seorang karyawan penginapan Nugraha, Wu-

lan mengatakan pada hari libur bersama mengalami peningkatan pengunjung dibandingkan hari-hari biasa. Pengunjung yang datang dari berbagai daerah kata Wulan sudah mulai ramai sejak Sabtu dan Minggu dan tingkat keramaian pengunjung memuncak hingga hari libur pergantian tahun 2011-2012 yang lalu. “Ya ada peningkatan pengunjung pada hari libur Senin ini. Mereka kebanyakan datang dari luar daerah yang membawa anakanak,” kata Wulan. Karena ramainya pengunjung jajaran anggota Polisi tampak bersiaga melakukan penjagaan di sejumlah tempat di sekitar lokasi wisata yang menjadi pusat keramaian masyarakat serta sejumlah anggota lainnya melakukan pengaturan lalu lintas jalan di kawasan objek wisata Cipanas Garut. Bagi penulis, Cipanas mirip sekali dengan keadaan di Yogyakarta terutama di Jalan Malioboro. Di sini banyak penginapanpenginapan yang menyatu dengan perumahan masyarakat setempat dan harganya sangat Terjangkau dengan fasilitas air panas dari sumber alam yang terdapat di Kota Garut.

Harga rata-rata penginapan di sini bervariasi antara Rp 150-300 ribu dengan fasilitas kolam renang air panas dan semuanya menggunakan atau memanfaatkan sumber air panas yang terdapat di Kota Garut. Namun saat weekend atau hari libur tutup tahun harganya bisa mencapai Rp 400-500 ribu per malam. Jika para pelancong

bermalam di Cipanas dan ingin menikmati jajanan yang ada di luar penginapan hendaknya bertanya dulu soal harganya karena kejadian yang kami alami yaitu ketika kami memesan nasi goreng kosong, artinya tanpa asessori telur dadar atau mata sapi, tomat, mentimun atau pun sea food, sepiring dihargai Rp 10 ribu. Karena sudah terlanjur

dipesan semua akhirnya kami membayar dengan tidak ikhlas karena harganya diluar perkiraan kami. Kami pun sangat menyayangkan sekali dengan tingkah laku para pedagang tersebut, ingin untung besar hanya pada saat itu selanjutnya warung yang ada di sekitaran penginapan Cipanas sepi pengunjungnya. *Ayu Kesumaningtyas

Ami, siswa kelas 4 SD Harapan 3 Medan bersama sepupunya Sarah dan Alvie berlibur ke Cipanas Garut menikmati pemandian air panas.

Taman Safari Andalan Satwa Pada Alam Bebas PERNAHKAH Anda membayangkan berada di tempat seperti “The Jurassic Park”, film yang bertutur tentang habitat Dinosaurus yang telah punah jutaan tahun lalu dan berhasil dihidupkan kembali hasil besutan sutradara Steven Spielberg itu? Nah, kira-kira seperti itulah saat kita berada di Taman Safari yang berlokasi di Desa Cibeureum Kecamatan Cisarua. Hewan-hewan liar yang bebas berkeliaran dengan pembatas parit dan dijaga para “hunter” yang selalu bersiaga dengan mobil jeep hunternya, sedangkan pengunjung menaiki mobil pribadi atau pun bus yang disediakan oleh pengelola Taman Safari bebas menyak-

sikan kehidupan para hewan liar ini sambil memberi makan hewan-hewan zebra, unta yang mendatangi mobil pengunjung. Keasrian alam lingkungan memang sangat kental terasa begitu kita menjejakan kaki ke Taman Safari. Hutan yang berkesan alami ditambah air yang mengaliri anak sungai kecil. Sesaat gambaran itu persis seperti yang ada di Jurassic Park. “Aku baru pertama kali kemari. Dan aku jika masih ada kesempatan tetap ingin kembali kemari dan tidak pernah merasa bosan untuk mengunjungi tempat ini lagi. Untuk melihat banyak jenis hewan dari hampir semua benua di seluruh dunia. Aku merasa gembira ketika melihat binatang-binatang dari

dalam mobil dan memberi mereka makan. Kita pun dapat mengambil foto dengan hewan liar seperti harimau putih atau orangutan,”kata Aga Lubis, siswa kelas 8 SMP Harapan 3 Jalan Karya Wisata Medan saat berlibur semester ganjil berasama sang adik Alit Lubis dan Ami Lubis dan keluarganya. Taman Safari merupakan wisata keluarga yang berwawasan lingkungan dan berorientasi habitat satwa pada alam bebas. Objek wisata Taman Safari Cisarua ini merupakan perpaduan antara kebun binatang modern dan wisata alam. Taman Safari ini dibangun tahun 1980 dengan menempati areal seluas 138,5 hektar dan resmi dibuka untuk umum

Seorang pengunjung dari dalam mobil mengabadikan dua ekor satwa langka harimau Sumatera.

Para bocah ini juga mengambil kesempatan berfoto bersama harimau putih. tahun 1986. Taman ini didirikan di atas sebuah perkebunan teh yang sudah tidak produktif lagi dan terletak pada ketinggian 900 m sampai 1800 m di atas permukaan laut dengan suhu 16 derjat C – 24 derjat C dan sekaligus menjadi penyangga Taman Nasional Gunung Gede Pangrango. Selain sebagai lokasi rekreasi, Taman Safari juga mempunyai berbagai fungsi yaitu ikut aktif di dalam membantu usaha perlindungan dan pelestarian populasi jenis satwa yang terancam punah karena kehilangan habitat. Selain itu berfungsi juga untuk meningkatkan ilmu pengetahuan dengan melakukan berbagai penelitian untuk mendukung pelestarian satwa serta melakukan kampanye pendidikan dan penyuluhan mengenai konservasi. Bagi pelancong yang berkunjung ke Jakarta, Taman Safari Cisarua ini menjadi

pilihan favorit. Karena daerah Puncak telah menjadi tempat rekreasi favorit bagi masyarakat pelancong yang datang ke Jakarta karena letaknya yang tidak terlalu jauh berkisar 80 km dari Jakarta dan dapat ditempuh dalam waktu 1-2 jam jika jalanan tidak macet. Banyak objek menarik yang terdapat di kawasan ini yang banyak mengkoleksi beragam jenis satwa di antaranya safari park, taman burung, animal education show, primates and reptiles, baby zoo, kincir raksasa, gajah tunggangan, safari trek, caravan dan hotel dan wild-wild west. Fasilitas lainnya yang ada di Taman Safari antara lain bus safari, kolam renang dengan seluncur ombak, danau buatan, kano, sepeda air, kereta api mini yang melintasi perkampungan ala Afrika dan terdapat juga air terjun. Taman Safari memiliki

koleksi satwa lebih dari 2500 ekor yang terdiri dari 250 spesies dan sebagian besar merupakan satwa langka. Beberapa macam satwa langka antara lain Harimau Sumatera, Gajah Sumatera, Curik Bali, Anoa dan berbagai jenis reptil. Koleksi satwa lokal maupun satwa dari luar negeri juga ada di sini. Satwa lokal dan luar negeri antara lain komodo, bison, beruang hitam madu, harimau putih, gajah, anoa dan lainnya. Untuk wahana wild-wild west merupakan wahana yang menarik untuk disaksikan. Selama ni pelancong mungkin sering melihat atraksi koboi dalam film di televisi. Adegan kejar-kejaran, saling tembak dan adu mulut tersebut tentunya

menjadi tontonan menarik dan menjadi hiburan di rumah. Tapi pernahkah Anda menyaksikan atraksi koboi itu secara langsung ? Jika ingin melihatnya Anda tak perlu jauh-jauh ke negeri asalnya di Amerika sana, tapi cukup ke Taman Safari . Pertunjukannya dilakukan d dalam arena disetting ala koboi, dengan atraksi koboi yang memukau. Pertunjukkan ini dapat disaksikan secara gratis setiap hari, selama kurang lebih 15 menit. Pertunjukkan koboi ini digelar setiap hari pada pukul dua siang. Penonton disediakan tempat duduk di tribun dengan setting setengah melingkar. Jadi semua pertunjukkan bisa terlihat jelas dari atas tribun. Suara ringkihan kuda, pistol dan dinamit

para koboi seakan berada begitu dekat karena efek dari sound system yang dipasang. Selain wahana tersebut ada lagi wahana menarik lainnya seperti elephant adventure. Program ini mengajak para pengunjung dengan menunggang di atas punggung gajah mengelilingi kawasan Taman Safari selama hampir satu jam. Setiap ekor gajah didampingi oleh pawangnya dan bisa ditumpangi empat orang dewasa. Gajah itu akan melewati jalan yang berrumput dan melewati arus air sehingga pengunjung benar-benar bisa menikmati panorama alam yang ada di Taman Safari. *Ayu Kesumaningtyas

Pengunjung dari dalam mobil bebas memberi makan zebra-zebra yang datang mendekat.



WASPADA Minggu 15 Januari 2012

6 Selebritis Tewas Di Jalan Raya DUNIA hiburan di tanah air kembali berduka. Bintang FTV dan presenter Valia Rahma meninggal dunia akibat kecelakaan lalu lintas di Bali, pekan lalu. Sebelumnya, Valia mengalami koma beberapa hari dan akhirnya meninggal dunia pada Jumat (13/1).


Nike Ardila




Adi Firansyah

Kecelakaan terjadi saat wanita kelahiran 31 Januari 1985 itu berada di boncengan sepedamotor yang dikendarai adik iparnya, pada Rabu (4/1) sekitar pukul 10:00 WITA. Menurut penuturan keluarga, keduanya ditabrak seorang pengendara sepedamotor yang ugal-ugalan di jalan. Saat itu, sepedamotor yang dikendarai Valia dan adik iparnya sedang berhenti di depan sebuah gerbang hotel. Pada saat bersamaan, dua pengendara sepedamotor yang sedang balapan di ruas jalan tersebut. “Tiba-tiba ada orang menyeberang. Akibatnya, kedua sepedamotor itu menghindar ke kiri dan kanan. Nah, yang ke arah kiri menabrak Valia,” kata mertua Valia, Anshori.

Sophan Sophiaan

Kecelakaan yang merenggut nyawa selebritis ini bukan pertama kali terjadi. Sedikitnya, ada lima selebritis yang tewas di jalan raya akibat kecelakaan. Nike Ardila Pelantun tembang ‘Bintang Kehidupan’ ini meninggal di puncak popularitasnya. Mobil yang dikemudikannya menabrak beton di tepi jalan, di Bandung pada 19 Maret 1995. Nike Ardila meninggal dunia akibat luka berat pada bagian kepala. Taufik Savalas Komedian multitalenta ini meninggal dunia akibat kecelakaan maut dalam perjalanan dari Yogyakarta menuju Purbalingga untuk keperluan syuting iklan produk yang dibintanginya. Saat itu, mobil yang membawa Taufik bersama kru, bertabrakan dengan sebuah truk di Bagelen, Purworejo pada 11 Juli 2007. Adi Firansyah Bintang sinetron ini menghembuskan nafas terakhir di usia 22 tahun setelah menga-

Sophan Sophiaan Aktor film lawas yang sempat aktif sebagai politisi ini mengalami kecelakaan maut di tengah touring Harley Davidson, Sragen, Jawa Tengah pada 17 Mei 2008. Sepedamotor yang dikendarai Sophan Sophiaan terguling dan menimpa tubuhnya di tengah jalan berlubang di kawasan itu. Touring tersebut digelar dalam rangka menyemarakkan 100 Tahun Kebangkitan Nasional. Virginia Anggraeni Dia memang bukan artis. Namun, nama Virginia Anggraeni populer setelah menikah dengan penyanyi dangdut Saipul Jamil. Wanita 21 tahun itu meninggal dunia sesaat setelah mobil yang dikemudikan Saipul Jamil terguling di tol Cipularang Km 97, usai merayakan Lebaran pada 3 September 2011.(vvn)



Taufik Savalas

lami kecelakaan sepedamotor di jalan raya Bekasi pada 23 Desemeber 2006. Adi Firansyah mengalami luka berat pada bagian kepala dan dada setelah tabrakan dengan pengendara sepeda motor lain.

Virginia Anggraeni

Valia Rahma


Valia, Istri Yang Tak Tergantikan KEPERGIAN bintang FTV dan presenterValia Rahma meninggalkan kesedihan yang mendalam bagi keluarga dan kerabatnya. Suasana duka terlihat pada proses pemakaman Valia di TPU Tanah Kusir, Jakarta Selatan, Sabtu (14/1). Isak tangis keluarga dan kerabat mengiringi kepergian Valia selama prosesi pemakaman berlangsung. Jenazah Valia tiba di Jakarta pada Sabtu (14/1) dinihari pukul 02:00 WIB. Pada pukul 08:00, jenazah Valia dishalatkan di Masjid Al-Ikhlas Bintaro, kemudian dibawa menuju TPU Tanah Kusir. Sang suami Aria Swastika sangat terpukul dan mengaku tidak punya firasat akan ditinggal selamanya oleh sang istri. Baginya Valia adalah istri yang tak tergantikan. “Valia itu nurut sama suami dan jago masak. Dia bisa nyemangatin di saat-saat paling sulit sekalipun. Benar-benar nggak bisa dilupaiin banget,” ujar Aria di TPU Tanah Kusir. Aria menceritakan kronologi terjadinya kecelakaan yang menewaskanValia.“Saat kecelakaan terjadi,Valia dibonceng sama adik aku. Baru mau masuk parkiran, ada sepedamotor dari arah berlawanan, dia ditabrak. Mungkin karena dia dibonceng, jadi nggak siap. Dia pakai helm, tapi mengalami benturan keras pada kepalanya, jadi ada luka dalam,”ujarnya. Kecelakaan sepedamotor tersebut terjadi di daerah Legian pada Rabu (4/1) pukul 11:00. Dalam kondisi tidak sadarkan diri, Valia dibawa ke rumah sakit. “Setelah menjalani pemeriksaan dengan CT scan, pukul 13:00 dioperasi. Dokter sudah maksimal menangani kondisi Valia, tapi Tuhan berkehendak lain,” ujarnya. Saat dirawat di rumah sakit, menurut Aria, kondisi Valia sempat mengalami kemajuan, namun tidak berlangsung lama. “Sempat ada kemajuan. Sempat bisa nafas sendiri, ada respon. Tapi itu cuma terjadi sekitar 24 jam,”ujarnya.(vvn/inc)

Zooey Deschanel, Si Dermawan BINTANG serial televisi New Girl, Zooey Deschanel, 31, dikenal sebagai sosok selebritis yang sangat dermawan. Setiap bulan, Deschanel selalu menyisihkan AS$1.500 dari pendapatannya untuk beramal. Sebagaimana dilansir Look To The Stars, Jumat (13/1), uang itu didonasikan untuk kegiatan amal bagi nak-anak. Deschanel dikenal aktif memberi dukungan untuk kegiatan amal Help Haiti Home. Deschanel mendapat bayaran AS$95.000 per bulan dari perannya di serial komedi New Girl. Dia ingin jadi sosok yang bisa diterima banyak orang. Kendati dikenal sebagai sosok dermawan, Deschanel mengakui masih ada orang yang tidak menyukainya. ”Bagiku, itu bukan masalah. Adakalanya kita menghadapi situasi yang sulit, dimana seseorang mengatakan sesuatu yang buruk tentang kita,” ujarnya. ”Menurut aku, tidak perlu khawatir. Banyak orang senang beropini dan itu bagus. Namun, kita tak perlu harus selalu menanggapinya,” demikian Deschanel.(k/m25)


Pakaian Dalam Untuk Nirina

Jennifer Lopez

Rp92 Juta Per Minggu Untuk Kekasih PENYANYI berdarah Latin, Jennifer Lopez sedang dimabuk asmara dengan kekasih barunya, Casper Smart. Kabar terbaru, Lopez sangat mencintai sang kekasih yang berusia jauh lebih muda dari dirinya. Lopez memberi uang kepada Casper sebesar AS$10 ribu atau sekitar Rp92 juta per minggu. Menurut sebuah sumber, ada alasan khusus mengapa mantan istri Marc Anthony ini memberikan uang sebanyak itu kepada kekasihnya tersebut. “Lopez benci karena setiap makan malam dia harus menggunakan kartu kreditnya,” kata sumber kepada Majalah Star, Jumat (13/1). Dengan memberi uang kepada Smart, Lopez berharap tidak lagi mengeluarkan uang saat mereka berkencan. “Lopez tidak berharap Smart membelikan hadiah untuk anak-anaknya atau mengajak mereka berlibur di akhir pekan sebagai suatu kejutan,” ucap sumber itu lagi.(vvn/m25) celebs101

PASANGAN gitaris Ernest Fardiyan Sjarif alias Ernes “Cokelat” dan presenter sekaligus artis peran Nirina Zubir kehabisan pakaian setelah lantai dua rumah mereka musnah terbakar, Kamis (12/1) malam. Musibah yang dialami Ernest dan Nirina itu menjadi perhatian Titi Kamal dan Marcella Zalianty. “Dengan hadirnya kami di sini, akan menjadi support bagi Nirina,” kata Marcella usai mengunjungi rumah Nirina-Ernest di Permata

Mediterania Cluster Diamond, Jakarta Barat, Jumat (13/1). Istri pembalap nasional Ananda Mikola menyadari bahwa sahabatnya membutuhkan pakaian sehari-hari. Sebab. seluruh pakaian beserta barang berharga lainnya ikut terbakar hingga nyaris tak bersisa. Karena itu, Marcella menyumbang pakaian dan makanan. “Ya, support bajunya, dalamannya (pakaian dalam), support makanan,” tambahnya.


Nirina dan anaknya.

Ikhlas Sementara itu, Nirina dan Ernest berusaha ikhlas atas musibah kebakaran rumahnya. Kini, mereka jadi lebih berhati-hati. “Insya Allah belajar ikhlas. Berhati-hati dan belajar yang lain, seperti instalasi listrik. Jadi kalau mau bangun rumah, maka konstruksinya harus diperhatikan,” jelas Ernes di lokasi kebakaran, Jumat (13/1). Seperti diberitakan sebelumnya, rumah pasangan satu anak ini terbakar pada Jumat (13/1). Musibah itu membuat keduanya terpukul. “Kami renovasi mental, drop banget. Kehilangan pasti ya, tapi lebih karena aku belum pernah lihat api di depan mata jadi kaget banget,” ujar Nirina. Bukan semata-mata pakaian sebanyak tiga lemari ludes, Nirina dan Ernest memiliki kesedihan lain. “Rumah belum diasuransi, belum kepikiran. Ini jadi pembelajaran juga, mungkin next time diasuransi. Surat dan memori, foto-foto kecil, beberapa piagam penghargaan, saya lebih ke memori, buku pelajaran,” ujar Ernest.(vvn/inc)


Marcella Zalianty

Waspada, Minggu 15 Januari