Page 1

Medan 23-320C

P. Sidimpuan 19-290C

R. Prapat 24-320C

Penyabungan 20-29 0C

Berastagi 18-280C

Sibolga 23-320C


Hujan guntur

WASPADA Demi Kebenaran Dan Keadilan

Prakiraan Cuaca

BMKG Polonia

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

MINGGU, Kliwon, 13 Maret 2011/8 Rabiul Akhir 1432 H z No: 23444

Terbit 20 Halaman (A1-8, B1-12) z zHarga Eceran: Rp 2.500,-

Tahun Ke-65

Gempa Bumi Dan Tsunami Terkuat Dunia BEBERAPA catatan tentang gempa besar yang pernah melanda dunia di berbagai benua selama 300 tahun terakhir: 11 Maret 2011: Satu gempa bumi 8,9 skala Richter (SR) melanda pantai timurlaut Jepang, yang memicu tsunami di seluruh Pasifik dan menewaskan ratusan, mungkin ribuan jiwa. Oktober 2010: Satu letusan gunung berapi dan tsunami menewaskan lebih dari 500 orang di Indonesia. Februari 2010: Gempa bumi berkekuatan 8,8 SR menggun-cang Chile, yang menimbulkan tsunami dan menewaskan 524 jiwa. September 2009: Gempa bumi 8,0 SR menyebabkan tsunami setinggi 12 meter yang menewaskan 194 orang di Pasifik Selatan, termasuk 34 di Samoa Amerika. September 2007: Gempa bumi 7,8 SR mengguncang Sumatera, memicu peringatan tsunami regional dan merusak sejumlah bangunan. September 2007: Gempa bumi 8,4 SR dekat Sumatera memicu satu gelombang di Padang. Guncangan gempa itu menewaskan sekurang-kurangnya 25 orang dan mencederai sekitar 50 lainnya. Lanjut ke hal A2 kol 6

Tsunami Sampai Ke Jayapura, 1 Tewas

JAYAPURA (Antara): Gelombang tsunami kiriman akibat gempa di Jepang yang sampai di Jayapura Jumat (11/3) malam merusak seluruh bangunan rumah warga yang bermukim di pesisir pantai wisata Holtekamp, distrik Muara Tami, yang berjarak sekitar 75 kilo meter dari pusat kota Jayapura. Selain rumah, puluhan perahu dan jaring milik nelayan ikut terseret gelombang tsunami sejauh radius 50 meter dari bibir pantai Holtekamp. Beruntung jaring dan perahu serta rumah milik warga itu tersangkut batang pohon besar di hutan sekitar pantai holtekamp. Godlief Samallo, warga setempat mengatakan, pada malam kejadian, gelombang tsunami setinggi kurang lebih dua meter tiba-tiba menerjang dan menghantam semua yang dilaluinya. Akibatnya 19 kepala keluarga yang tinggal di daerah itu kehilangan tempat tinggalnya. Lanjut ke hal A2 kol 6

BEBERAPA kapal terdampar di Kesennuma, Miyagi Prefektur, Jepang Utara, Sabtu (12/3) setelah dihanyutkan tsunami yang dipicu gempa bumi keras yang melanda kawasan itu.


SUDAH LEBIH 1.300 TEWAS Ledakan Reaktor Nuklir Menambah Buruk Bencana

SENDAI, Jepang (Waspada): Lebih dari 1.300 orang tewas dan 10.000 dilaporkan hilang akibat gempa bumi yang disusul dengan tsunami yang melanda kawasan timurlaut Jepang, demikian menurut perkiraan jumlah korban akibat bencana yang memporak-porandakan negeri Sakura itu Sabtu (12/3). Gempa susulan yang amat keras melanda lagi hampir tepat di lokasi bencana itu sehari setelah satu guncangan besar yang memicu tsunami menewaskan seribuan orang, mengubah pantai menjadi sema-

Waspada/Muhammad Riza

RUMAH TERTIMBUN: Satu unit rumah di Desa Rantou Panyang, Tangse Pidie tertimbun tanah longsor, Sabtu (12/3).

Korban Banjir Badang Tangse Simpang Siur

Pengungsi Terus Mengalir TANGSE (Waspada): Data korban jiwa sementara disebabkan banjir badang Tangse, Pidie masih simpang siur. Informasi yang diterima Waspada pada Posko Kabupaten Pidie tercatat sebanyak enam orang meninggal dunia dan

enam orang dinyatakan hilang. Sementara pada Posko Kecamatan Tangse, korban jiwa disebabkan banjir bandang mencapai 13 orang, sedangkan korban hilang tercatat enam orang. Jumlah ini sung-

Gagal Ginjal Bakal Jadi Pembunuh Massal Waspadai Maraknya Fast Food

guh membingungkan puluhan wartawan yang meliput bencana tersebut. Sekda Pidie M. Iriawan, kepada Waspada, kemarin membenarkan data terakhir yang Lanjut ke hal A2 kol 1

l A6

Lanjut ke hal A2 kol 1

Lanjut ke hal A2 kol 3

Mungkinkah Bencana Jepang Akibat Bulan Mendekati Bumi SITUS astronomi Space.COM pekan lalu memberitakan bahwa bulan sedang bergerak pada posisi terdekat dengan bumi. Posisi terdekat akan dicapai pada tanggal 19 Maret 2011 nanti, membawa bulan hanya pada jarak 221.567 mil, terdekat selama 18 tahun terakhir. Ketika Bulan sedang ada pada posisi terdekatnya, maka fenomena ini sering disebut “supermoon”. Para ahli mengatakan, akibat dari “supermoon” adalah meningkatnya gelombang pasang air laut beserta meningkatnya aktivitas seismik di Bumi yang bisa berakibat pada meningkatnya potensi gempa bumi dan erupsi gunung berapi. Pada saat yang hampir bersamaan atau 8 hari sebelum puncak kedekatan Bumi dengan Bulan (perigee), Jepang diguncang oleh gempa berkekuatan 8,9 skala magnitude dan menyebabkan tsunami yang tercatat sudah menewaskan Lanjut ke hal A2 kol 1

Lanjut ke hal A2 kol 3

Pesawat ruang angkasa Discovery milik NASA telah menyelesaikan misi terakhirnya, dan Endeavour serta Atlantis bakal menyusul masuk kandang akhir tahun ini.

Lanjut ke hal A2 kol 7

cam tempat pembuangan limbah dan menyebabkan juga dua reaktor nuklir ditutup karena ancaman bahaya yang lebih besar.

Dua Media Australia Muat Klarifikasi SBY

MEDAN (Waspada): Jika para pengambil kebijakan tidak memberi perhatian serius terhadap masalah gagal ginjal, diperkirakan dalam kurun waktu 20 tahun ke depan penyakit ini bakal menjadi ‘mesin’ pembunuh massal. Sebab, penyakit gagal ginjal tersebut tidak memiliki gejala awal yang khas. Akibatnya, banyak kasus baru ditemukan setelah ginjal pasien tersebut sudah mengalami kerusakan sekitar 10 hingga 60 persen. “Padahal, kerusakan ginjal hanya 10 persen saja, sudah dianjurkan untuk cuci darah,” kata Ahli Ginjal dan Hipertensi Prof. dr. Harun Rasyid Lubis, SpPD, KGH pada peringatan Hari Ginjal Sedunia yang diselenggarakan di Klinik Rasyida Medan, Sabtu (12/3).


tah dan mengecam saja. Presiden sendiri yang harus menjelaskan, utamanya kepada rakyat Indonesia,” ujar Din ketika ditemui di Surabaya, Jatim, Sabtu (12/3). Menurut dia, untuk kasus kali ini, diharapkan presiden sendiri yang berbicara langsung dan bukan melalui

JAKARTA (Waspada): Menteri Luar Negeri Marty Natalegawa bertanya kepada para jurnalis Istana Kepresidenan, Jakarta, Jumat (11/3), terkait permintaan maaf Kedutaan Besar AS atas pengiriman informasi mentah terkait pemerintahan Indonesia ke Washington DC. “Apakah cukup dengan permintaan maaf? Saya hanya menyampaikan pernyataan kepada Anda semua. Bagaimana perasaan Anda?” ungkap Marty ketika ditanya soal permintaan maaf yang disampaikan Kedubes AS. Marty sendiri enggan memberikan jawaban lugas ketika ditanya kembali oleh para wartawan, apakah dirinya menganggap permintaan maaf tersebut cukup. Marty mengatakan, Pemerintah Indonesia meminta jaminan kepada Kedubes AS agar kejadian serupa tak terulang lagi

Presiden Jangan Hanya Mengecam SURABAYA (Waspada): Ketua Umum Pengurus Pusat (PP) Muhammadiyah Din Syamsudin meminta agar Presiden Susilo Bambang Yudhoyono tidak hanya mengecam atau membantah berita dari media Australia tentang tuduhan bahwa dirinya menyalahgunakan kekuasaannya untuk kepentingan politik. “Jangan hanya memban-

AS Tidak Membenarkan Dan Tidak Membantah Isi Kawat Diplomatik


Bukan rahasia umum lagi, kalau angkot (angkutan kota) identik dengan kesemrawutan lalu lintas, supir yang ugal-ugalan, serta ketidaknyamanan di dalam angkot itu sendiri.

l B5


Isap Ganja Lima Personel Kangen Band Ditangkap JAKARTA (Waspada): Bertambah lagi daftar artis yang ditangkap polisi. Lima personel Kangen Band (foto) tertangkap basah menghisap ganja seberat 40 gram. Mereka adalah Andika (vokal), Dodhy (gitar), Iim (drum), Tara (gitar), dan Novry (bas). Manajer Kangen Band Lexi, saat dihubungi wartawan, Sabtu (12/3) membenarkan penangkapan itu. Kelimanya ditangkap di markas Kangen Band di Cibubur, pada Sabtu (12/3) dinihari, sekira pukul 02:30 (beberapa jam setelah manggung di Bekasi). Saat ini, mereka sedang diperiksa Tim Unit IV Direktorat IV Narkotika Mabes Polri di Gedung Badan Narkotika Nasional (BNN) Jln. MT Haryono, Jakarta. “Saya masih menunggui mereka,” ujar Lexi. Sampai saat ini Kepala Bagian Humas BNN Sumirat, belum memastikan kapan berakhirnya penyidikan Lanjut ke hal A2 kol 3

Wanita Muda Tewas Dibantai Pengemudi Betor MEDAN (Waspada): Warga mulai was-was menumpang becak bermotor (betor) karena pengemudinya ada yang melakukan aksi kejahatan. Seperti terjadi, Jumat (11/3) pukul 23:00, Seorang wanita Adel Mariani, 21, tewas dibantai pengemudi betor dengan tikaman senjata tajam dan gigitan di Jalan Mataram, Petisah Medan. Awalnya, korban Adel dari Rantauprapat menumpang kereta api dan tiba di stasiun besar Jalan Kereta Api Medan. Selanjutnya dia menumpang betor hendak menuju rumah neneknya di kawasan Simalingkar-B yang dikabarkan masuk rumah sakit. Dalam perjalanan, pengemudi betor mengarah ke Jalan Seriwijaya tidak jauh dari kantor Lurah dan showroom, pengemudi betor berhenti diduga dia hendak Lanjut ke hal A2 kol 6


Bagi pecinta binatang rasa sayang bisa ditunjukkan dengan berbagai cara, salah satunya adalah menciumi hewan peliharaannya. Tapi amankah mencium binatang peliharaan?

l B7

Kian derasnya arus globalisasi yang didorong oleh kemajuan teknologi komunikasi dan informasi, sering menimbulkan pengaruh negatif terhadap seni budaya tradisonal suatu daerah seperti semakin memudarnya penghargaan pada nilai-nilai budaya itu sendiri.

l B10

Medan 23-320C

P. Sidimpuan 19-290C

R. Prapat 24-320C

Penyabungan 20-29 0C

Berastagi 18-280C

Sibolga 23-320C


Hujan guntur

WASPADA Demi Kebenaran Dan Keadilan

Prakiraan Cuaca

BMKG Polonia

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

MINGGU, Kliwon, 13 Maret 2011/8 Rabiul Akhir 1432 H z No: 23444 * Tahun Ke-65

Terbit 20 Halaman (A1-8, B1-12) z zHarga Eceran: Rp 2.500,-

Gempa Bumi Dan Tsunami Terkuat Dunia BEBERAPA catatan tentang gempa besar yang pernah melanda dunia di berbagai benua selama 300 tahun terakhir: 11 Maret 2011: Satu gempa bumi 8,9 skala Richter (SR) melanda pantai timurlaut Jepang, yang memicu tsunami di seluruh Pasifik dan menewaskan ratusan, mungkin ribuan jiwa. Oktober 2010: Satu letusan gunung berapi dan tsunami menewaskan lebih dari 500 orang di Indonesia. Februari 2010: Gempa bumi berkekuatan 8,8 SR mengguncang Chile, yang menimbulkan tsunami dan menewaskan 524 jiwa. September 2009: Gempa bumi 8,0 SR menyebabkan tsunami setinggi 12 meter yang menewaskan 194 orang di Pasifik Selatan, termasuk 34 di Samoa Amerika. September 2007: Gempa bumi 7,8 SR mengguncang Sumatera, memicu peringatan tsunami regional dan merusak sejumlah bangunan. September 2007: Gempa bumi 8,4 SR dekat Sumatera memicu satu gelombang di Padang. Guncangan gempa itu menewaskan sekurang-kurangnya 25 orang dan mencederai sekitar 50 lainnya. Lanjut ke hal A2 kol 6

Tsunami Sampai Ke Jayapura, Sejumlah Rumah Rusak 1 Tewas JAYAPURA (Antara): Gelombang tsunami kiriman akibat gempa di Jepang yang sampai di Jayapura Jumat (11/3) malam merusak seluruh bangunan rumah warga yang bermukim di pesisir pantai wisata Holtekamp, distrik Muara Tami, yang berjarak sekitar 75 kilo meter dari pusat kota Jayapura. Selain rumah, puluhan perahu dan jaring milik nelayan ikut terseret gelombang tsunami sejauh radius 50 meter dari bibir pantai Holtekamp. Beruntung jaring dan perahu serta rumah milik warga itu tersangkut batang pohon besar di hutan sekitar pantai holtekamp. Godlief Samallo, warga setempat mengatakan, pada malam kejadian, gelombang tsunami setinggi kurang lebih dua meter tiba-tiba menerjang dan menghantam semua yang dilaluinya. Akibatnya 19 kepala keluarga yang tinggal di daerah itu kehilangan tempat tinggalnya. “Gelombang bahkan mencapai radius 200 meter dari bibir pantai. Beruntung masyarakat sudah mengungsi terlebih dahulu,” terangnya. Lanjut ke hal A2 kol 6

BEBERAPA kapal terdampar di Kesennuma, Miyagi Prefektur, Jepang Utara, Sabtu (12/3) setelah dihanyutkan tsunami yang dipicu gempa bumi keras yang melanda kawasan itu.


SUDAH LEBIH 1.300 TEWAS Ledakan Reaktor Nuklir Isap Ganja Menambah Buruk Bencana Lima Personel

SENDAI, Jepang (Waspada): Lebih dari 1.300 orang tewas akibat gempa bumi yang disusul dengan tsunami yang melanda kawasan timurlaut Jepang, demikian menurut perkiraan jumlah korban akibat bencana yang memporak-porandakan negara Sakura itu Sabtu (12/3). Gempa susulan yang amat keras melanda lagi hampir tepat di lokasi bencana itu sehari setelah satu guncangan besar yang memicu tsunami menewaskan seribuan orang, mengubah pantai menjadi sema-

Waspada/Muhammad Riza

RUMAH TERTIMBUN: Satu unit rumah di Desa Rantou Panyang, Tangse Pidie tertimbun tanah longsor, Sabtu (12/3).

Korban Banjir Badang Tangse Simpang Siur

Pengungsi Terus Mengalir TANGSE (Waspada): Data korban jiwa sementara disebabkan banjir badang Tangse, Pidie masih simpang siur. Informasi yang diterima Waspada pada Posko Kabupaten Pidie tercatat sebanyak enam orang meninggal dunia dan

enam orang dinyatakan hilang. Sementara pada Posko Kecamatan Tangse, korban jiwa disebabkan banjir bandang mencapai 13 orang, sedangkan korban hilang tercatat enam orang. Jumlah ini sung-

Jailani Tewas Dibacok Anak Tiri BIREUEN (Waspada): Jailani, 50, penduduk Desa Cot Trieng, Kecamatan Simpang Mamplam, Bireuen, dibacok anak tirinya, Nasruddin, 25. Korban tewas bersimbah darah di tempat kejadian perkara (TKP) Sabtu (12/3) sekira pukul 08:00 di desa setempat. Kapolres Bireuen AKBP H Raden Dadik Junaedi SH mengatakan, korban tewas dengan dua bacokan di kepala dan satu bacokan di lehernya. Usai membacok ayah tirinya, tersangka menyerahkan diri ke Pos Polisi di Simpang Mamplam sebelum diamankan ke Mapolsek Samalanga. Keterangan sejumlah warga di sekitar TKP, peristiwa pembacokan terjadi saat Jailani sedang menunggu seseorang menjemputnya di kios milik Murni, 35, di depan meunasah desa setempat dan hendak menuju Keude Simpang Mamplam. Tiba-tiba pelaku mendatangi Jailani dari arah belakangnya. Lanjut ke hal A2 kol 3


Pesawat ruang angkasa Discovery milik NASA telah menyelesaikan misi terakhirnya, dan Endeavour serta Atlantis bakal menyusul masuk kandang akhir tahun ini.

l A6

guh membingungkan puluhan wartawan yang meliput bencana tersebut. Sekda Pidie M. Iriawan, kepada Waspada, kemarin membenarkan data terakhir yang Lanjut ke hal A2 kol 1

tah dan mengecam saja. Presiden sendiri yang harus menjelaskan, utamanya kepada rakyat Indonesia,” ujar Din ketika ditemui di Surabaya, Jatim, Sabtu (12/3). Menurut dia, untuk kasus kali ini, diharapkan presiden sendiri yang berbicara langsung dan bukan melalui

JAKARTA (Waspada): Bertambah lagi daftar artis yang ditangkap polisi. Lima personel Kangen Band tertangkap basah menghisap ganja seberat 40 gram. Mereka adalah Andika (vokal), Dodhy (gitar), Iim (drum), Tara (gitar), dan Novry (bas). Manajer Kangen Band Lexi, saat dihubungi wartawan, Sabtu (12/3) membenarkan penangkapan itu. Kelimanya ditangkap di markas Kangen Band di Cibubur, pada Sabtu (12/3) dinihari, sekira pukul 02:30 (beberapa jam setelah manggung di Bekasi). Saat ini, mereka sedang diperiksa Tim Unit IV Direktorat IV Narkotika Mabes Polri di Gedung Badan Narkotika Nasional (BNN) Jln. MT Haryono, Jakarta. “Saya masih menunggui mereka,” ujar Lexi. Sampai saat ini Kepala Bagian Humas BNN Sumirat, belum memastikan kapan berakhir nya penyidikan

Lanjut ke hal A2 kol 7

Lanjut ke hal A2 kol 3

cam tempat pembuangan limbah dan menyebabkan juga dua reaktor nuklir ditutup karena ancaman bahaya yang lebih besar. Lanjut ke hal A2 kol 3

Presiden Jangan Hanya Mengecam

Dua Media Australia Muat Klarifikasi SBY SURABAYA (Waspada): Ketua Umum Pengurus Pusat (PP) Muhammadiyah Din Syamsudin meminta agar Presiden Susilo Bambang Yudhoyono tidak hanya mengecam atau membantah berita dari media Australia tentang tuduhan bahwa dirinya menyalahgunakan kekuasaannya untuk kepentingan politik. “Jangan hanya memban-

Kangen Band Ditangkap

Mungkinkah Bencana Jepang Akibat Bulan Mendekati Bumi SITUS astronomi Space.COM pekan lalu memberitakan bahwa bulan sedang bergerak pada posisi terdekat dengan bumi. Posisi terdekat akan dicapai pada tanggal 19 Maret 2011 nanti, membawa bulan hanya pada jarak 221.567 mil, terdekat selama 18 tahun terakhir. Ketika Bulan sedang ada pada posisi terdekatnya, maka fenomena ini sering disebut “supermoon”. Para ahli mengatakan, akibat dari “supermoon” adalah meningkatnya gelombang pasang air laut beserta meningkatnya aktivitas seismik di Bumi yang bisa berakibat pada meningkatnya potensi gempa bumi dan erupsi gunung berapi. Pada saat yang hampir bersamaan atau 8 hari sebelum puncak kedekatan Bumi dengan Bulan (perigee), Jepang diguncang oleh gempa berkekuatan 8,9 skala magnitude dan menyebabkan tsunami yang tercatat sudah menewaskan Lanjut ke hal A2 kol 1


Bukan rahasia umum lagi, kalau angkot (angkutan kota) identik dengan kesemrawutan lalu lintas, supir yang ugal-ugalan, serta ketidaknyamanan di dalam angkot itu sendiri.

l B5


Kangen Band

Pemilukada Tapteng Aman

Pasangan Bosur Sementara Unggul TAPTENG (Waspada): Pemilukada Tapteng yang berlangsung Sabtu (12/3) berlangsung aman dan kondusif, hasil perolehan suara sementara yang diperoleh Waspada dari Panwaslucam pasangan Bosur Ungguli pasangan DinaHikmal. Di Kecamatan Sorkam dari seluruh 31 TPS yang merupakan tanah kelahiran Raja Bonaran Situmeang yang berpa-

s a n g a n d e n g a n Sy u k ra n Tanjung nomor urut 1 unggul dengan perolehan suara 5.976, pasangan Tasrif TarihoranRaja Asi Purba nomor urut 2 sebanyak 17 suara dan Dina Riana Samosir – Hikmal Batubara memperoleh suara 2.100. Selain itu daerah tanah kelahiran Himal Batubara kelurahan Sorkam Kecamatan Lanjut ke hal A2 kol 1

Wanita Muda Tewas Dibantai Pengemudi Betor MEDAN (Waspada): Warga mulai was-was menumpang becak bermotor (betor) karena pengemudinya ada yang melakukan aksi kejahatan. Seperti terjadi, Jumat (11/3) pukul 23:00, Seorang wanita Adel Mariani, 21, tewas dibantai pengemudi betor dengan tikaman senjata tajam dan gigitan di Jalan Mataram, Petisah Medan. Awalnya, korban Adel dari Rantauprapat menumpang kereta api dan tiba di stasiun besar Jalan Kereta Api Medan. Selanjutnya dia menumpang betor hendak menuju rumah neneknya di kawasan Simalingkar-B yang dikabarkan masuk rumah sakit. Dalam perjalanan, pengemudi betor mengarah ke Jalan Seriwijaya tidak jauh dari kantor Lurah dan showroom, pengemudi betor berhenti diduga dia hendak Lanjut ke hal A2 kol 6


Bagi pecinta binatang rasa sayang bisa ditunjukkan dengan berbagai cara, salah satunya adalah menciumi hewan peliharaannya. Tapi amankah mencium binatang peliharaan?

l B7

Kian derasnya arus globalisasi yang didorong oleh kemajuan teknologi komunikasi dan informasi, sering menimbulkan pengaruh negatif terhadap seni budaya tradisonal suatu daerah seperti semakin memudarnya penghargaan pada nilai-nilai budaya itu sendiri.

l B10

Berita Utama


WASPADA Minggu 13 Maret 2011

Indonesia Turut Berduka Dan Siap Bantu Jepang �

Rakyat Aceh Ikut Berduka

JAKARTA (Waspada): Pemerintah Indonesia siap memberikan bantuan kemanusiaan bagi korban gempa bumi dan tsunami di Jepang. “Presiden telah meminta Menteri Luar Negeri Marty Natalegawa untuk berkomunikasi dengan pihak Pemerintah Jepang untuk menyatakan kesiapan Pemerintah Indonesia dalam memberikan bantuan,” kata Juru Bicara Presiden Julian A Pasha dalam pesan singkatnya di Jakarta, Sabtu (12/3). Presiden, lanjut dia, menya-

takan bahwa pemerintah dan rakyat Indonesia turut berduka atas gempa bumi yang terjadi di Jepang. Sementara itu berkaitan dengan gempa bumi dan tsunami yang melanda Jepang pada Jumat (11/3), Kementerian Luar Negeri RI pada Sabtu (12/3) malam mengirim tim pendukung guna membantu KBRI Tokyo.

Pengungsi Terus ... diperoleh pihaknya sebanyak enam warga Tangse meninggal dunia dan enam orang masih dinyatakan hilang dalam bencana banjir bandang tersebut. “Untuk jumlah orang meninggal memang sebelumnya terjadi simpang siur pada pendataan. Tetapi data yang dikumpulkan Pemkab Pidie tercatat sebanyak enam orang meninggal dunia, dan enam orang hilang. Ini adalah data terakhir yang sebenarnya yang telah kita datakan” kata Sekda Pidie M. Iriawan. Sedangkan untuk jumlah kerugian secara total disebabkan bencana alam tersebut pihaknya belum dapat melaporkan, karena saat ini tim pedataan dibentuk Pemkab Pidie masih bekerja di lapangan. “Yang pasti kerugian yang disebabkan bencana alam ini sangat besar. Kepada rekan-rekan wartawan kami berharap bersabar,” katanya. Amatan Waspada, di Desa Rantau Panyang, Tangse satu unit tempat ibadah mengalami rusak parah serta puluhan rumah hancur total tertimbun tanah longsor dan bebatuan. Sedangkan arus pengungsian masyarakat terus saja mengalir bergabung di sejumlah titik pengungsian. Para pengungsi dari Desa Blang Pandak yang sebelumnya dilaporkan desa tersebut terkurung karena ada tiga jembatan terputus dan jalan amblas kini masyarakatnya mulai bergerak menuju tempat pengungsian dengan berjalan kaki melalui jalan gunung yang terjal. Banyak pengungsi yang menderita luka lecet dalam perjalanan menuju kamp-kamp pengungsian. Waspada juga melihat beberapa orang jompo yang terpaksa harus dibopong melewati jalanan mendaki di kawasan pegunungan Tangse yang terjal. Aminah, 34, salah seorang warga Blang Pandak Dusun Simpang Kanan, Tangse, kepada Waspada, mengungkapkan kondisi desa tempatnya bernomisili kini sudah rata dengan tanah. Banyak rumah-rumah warga mengalami rusak berat dan bahkan hancur tertimbun tanah longsor dan dihantam bebatuan besar. Namun dia mengungkapkan tidak mengetahui adanya korban jiwa. Saat ini sebut dia, anak-anak balita dan bocah-bocah serta para orang jompo tidur di bawah reruntuhan rumah beratapkan seng –seng bekas reruntuhan. Sedangkan jalur masuk ke perkampungan itu masih tertutup, meskipun saat ini tiga alat berat milik Pemkab Pidie sudah dikerahkan untuk membuka kembali jalan-jalan rusak tertimbun tanah longsor itu. “ Kami sangat berharap ada upaya lain dari pemerintah untuk mengangkut masyarakat kami yang masih terkurung di dalam kampung” pinta Aminah. (b20)

Pasangan Bosur ... Sorkam yang merupakan calon Wakil Bupati Tapteng dari III TPS didominasi Bosur yakni TPS I urut 1. 210 suara, urut 2. 2 suara dan urut 3. 146 suara. TPS II urut 1. 108 suara, urut 2.0 suara dan urut 3 112 suara sedangkan TPS III urut 1. 118 suara, urut 2. 2 suara dan urut 3.101. Dikecamatan Sorkam Barat diseluruh 27 TPS pasangan Bosur juga unggul dengan meraih suara 4.377 suara kemudian pasangan Dina-Hikmal 2089 suara dan pasangan Tasrif-Raja Asi 25 suara. Data yang diperoleh dari ketua Panwaslu Kecamatan Barus Utara bahwa dari seluruh 9 TPS bahwa nomor urut 1 juga unggul memperoleh suara 1.347, pasangan urut 3 meraih 879 suara, sedangkan di kecamatan Sarudik dari seluruh 30 TPS pasangan urut 1 juga unggul memperoleh suara 3.799, nomor urut 3 memperoleh suara 2.788 dan urut 2 meraih 57 suara. Sedangkan di Kecamatan Barus Tanah kelahiran H. Syukran Tanjung Calon Wakil Bupati Tapteng dari seluruh 31 TPS juga diungguli pasangan urut 1 sebanyak 4.981 suara, urut 2 meraih 68 suara dan urut 3 meraih 2.319 suara. Informasi lain Waspada himpun dari beberapa ketua Panwaslukada Kecamatan yakni Kecamatan Tapian Nauli, Pastob, Sosorgadong, Kolang dan Kecamatan Sirandorung bahwa diakui hasil sementara Pasangan Bosur tetap mendominasi. (a24)

Mungkinkah Bencana Jepang ... 1000 korban jiwa. Angka yang tewas ini diperkirakan bertambah karena masih banyak lagi yang belum ditemukan. Gempa diakibatkan oleh aktivitas tektonik Bumi. Berangkat dari kebetulan tersebut, beberapa pihak berspekulasi bahwa gempa di Jepang disebabkan oleh Bulan yang hendak menuju titik terdekatnya dengan Bumi. Blogger Mark Paquette misalnya, memulai spekulasinya dengan mengatakan bahwa beberapa peristiwa gempa dahsyat memang terkait dengan kedekatan Bumi-Bulan. Ia mencontohkan gempa yang mengakibatkan tsunami di Aceh pada 26 Desember 2004 lalu. Gempa tersebut terjadi 14 hari sebelum perigee BumiBulan yang terjadi pada 10 Januari 2005. Ia menuliskan, “Jadi, apa yang bisa kita lihat sekarang? Gempa bumi? Erupsi gunung berapi? Sepertinya kita cuma bisa menunggu dan melihat nanti.” Komentar tersebut memang menakutkan. Bagaimana tidak, belum terjadi perigee saja bisa berakibat pada gempa terdahsyat sepanjang sejarah Jepang sejak 1891. Menanggapi spekulasi itu, meteorolog senior di AccuWeather Paul Walker mengatakan, spekulasi bahwa gempa Jepang disebabkan oleh perigee Bumi-Bulan sepertinya tidak benar. “Saya kira Anda tidak bisa menghubungkannya dengan ‘supermoon’ yang masih 6 hari lagi terjadi. ‘Supermoon’ memang bisa berakibat pada gelombang pasang yang luar biasa, tapi tidak bisa begitu saja dikaitkan dengan peristiwa alam yang ekstrim semacam ini,” jelasnya seperti dikutip MSNBC. Astronom NASA David William juga mengatakan bahwa “supermoon” bukan penyebab gempa. “Supermoon itu hanya bulan yang besar dan sangat bercahaya. Tak ada yang spesial dengan itu,” paparnya. John Vidale, seismolog University of Washington dan direktur Pasific Northwest Seismic Network serta Wiliam Wilcock yang juga dari University of Washington pun mengatakan hal serupa. Mantan ilmuwan NASA Phil Plait mengatakan dengan tegas, “Apapun yang orang katakan, yang jelas tak ada kemungkinan gemJawaban Problem Catur, pa ini disebabkan oleh Bulan.” Perigee memang bisa meDari Halaman Sport. nyebabkan peningkatan aktivitas tektonik, namun ia mengatakan bahwa hingga saat ini Bulan Jawaban Problem Catur: belum berada pada titik terde1. Bxg6+, f7xB. kat itu. Pergerakan Bulan bisa membawanya menuju titik ter2. Gd5+, Rh7. dekat dan terjauh dengan Bumi. Titik terdekat disebut peri3. Bf7+, Rg8. gee sedangkan titik terjauh di4. Bc7+, Rh8. sebut apogee. Saat perigee, efek gravitasi 5. Mh6+mat. (Jika Bulan terhadap Bumi meningkat. Efek yang paling bisa dilihat 3. ....., Rh8. adalah gelombang pasang, se4. Mh6+, Rg8. bab air adalah salah satu elemen bumi yang paling mudah dipe5. Mh7/Mg7+mat). ngaruhi gravitasi. (k/m09)

Tim tersebut terdiri atas lima pejabat Kemlu yang bertugas membantu KBRI Tokyo dalam penangangan perlindungan WNI di wilayah-wilayah yang terkena dampak bencana, khususnya wilayah Miyagi dan Iwate yang cukup parah. Pascabencana, KBRI Tokyo mengirim tim untuk membuka posko sementara di Sendai sekitar Miyagi dan Iwate untuk memberikan bantuan bagiWNI yang berada di daerah tersebut. Ikut Berduka Sementara pemerintah Aceh menyatakan turut prihatin dan belasungkawa atas gempa bumi 8,9 skala richter dan tsunami di Jepang pada Jumat (11/ 3) yang memporak–porandakan sebahagian ‘Negeri Matahari Terbit’ tersebut. Wakil Gubernur Aceh Muhammad Nazar dan Wakil Ketua DPRA, H Sulaiman Abda

menyebutkan, Pemerintah Aceh berencana akan memberikan dukungan untuk membantu Jepang sesuai dengan kebijakan nasional. Apalagi, negara tersebut telah banyak memberikan bantuan kepada Aceh saat dilanda gempa dan tsunami pada 2004 silam. “Kita turut prihatin atas gempa dan tsunami yang melanda Jepang. Mereka juga telah banyak membantu Aceh,” katanya kepada wartawan, usai menghadiri peringatan Maulid Akbar yang digelar Partai Golkar Aceh, Sabtu (12/3). Menurut dia, langkah itu akan dilakukan jika ada permintaan dari pemerintah pusat, karena itu berhubungan antar negara. ”Jika pemerintah pusat meminta Aceh untuk ikut maka kita akan ambil peran terdepan,” ungkap dia. Katanya, Pemerintah Aceh, belum dapat memastikan bantuan yang diberikan itu dalam bentuk apa, karena secara materi Aceh tidak memiliki

kemam-puan untuk itu. “Jika pemerintah pusat meminta Aceh untuk ikut berkontribusi secara nasional, kita akan siap secara patungan,” urai dia. Nazar merasa yakni, Negeri Sakura itu akan akan segera pulih setelah gempa bumi yang memicu tsunami. Katanya, Jepang adalah negara yang paling siap dan berpengalaman dalam menghadapi bencana alam. Wakil Ketua DPRA Drs H Sulaiman Abda juga menyatakan rasa dukanya yang mendalam terhadap bencana yang menimpa warga Jepang. “Kita doakan saja semoga mereka cepat bangkit,” ungkapnya di tempat yang sama. Dia juga berharap, warga Tangse, Pidie yang juga menghadapi musibah banjir banding bisa ditangani dengan cepat. “Kita harapkan bantuan segera bisa disalurkan ke sana. Kami dari Partai Golkar (hari Minggured) akan menyerahkan bantuan ke sana,” ungkap Sulaiman Abda. (ant/b05)

Angkola Selatan Banjir, Genangi Pemukiman Warga ANGKOLA SELATAN (Waspada): Hujan deras yang melanda Kecamatan Angkola Selatan, Kabupaten Tapanuli Selatan (Tapsel) hampir 4 jam lamanya, Jumat (11/3) mulai pukul 14:00 menyebabkan air sungai Aek Baringin meluap menggenangi pemukiman warga di Dusun Siboga Baru dan Siburangir, Kelurahan Simarpinggan, Dusun Kampung Lalang di Desa Marpinggan dan merusak sekitar 9,5 hektar lahan persawahan warga. Camat Angkola Selatan, Hamdy S Pulungan kepada Waspada Sabtu (12/3) di lokasi mengatakan bahwa banjir ini merupakan yang pertama kalinya terjadi selama adanya pemukiman di wilayah itu. Air yang meluap dengan ketinggian sekitar lutut orang dewasa menggenangi jalan

dan juga sebagian rumah warga. Hamdy yang berada di lokasi pada saat kejadian mengimbau warga untuk tetap tenang dan membantu warga lainnya untuk mengevakuasi barangbarangnya keluar dari rumah dan menunggu di jalan raya untuk keamanan. Tak berapa lama kemudian air mulai surut secara perlahanlahan dan warga kembali ke rumahnya untuk melihat kondisi rumahnya yang sempat terendam air yang disertai dengan batu-batu kerikil dan lumpur. Dikatakannya akibat banjir itu setidaknya merusak 14 rumah warga, kamar mandi Masjid Nurul Yaqin di Perkebunan Marpinggan rusak. Selain itu 9,5 hektar sawah warga yang siap panen di Kelurahan Simarpinggan juga rusak.

“Memang tidak ada korban jiwa dalam peristiwa banjir itu, tapi kerugian cukup banyak dan kita perkirakan sekitar ratusan juta rupiah,” katanya. Jalan Batu Rosak Longsor Selain itu kata camat pada waktu yang hampir bersamaan atau sekitar pukul 18:00WIB juga terjadi longsor di Batu Rosak, Kelurahan Napa yang mengakibatkan jalan raya ditutupi lumpur danmengakibatkanmacetselama 5 jam hingga pukul 24:00 dan kemacetan sekitar 3 kilometer. Namun, katanya, alat berat milik Dinas PU pada malam itu juga langsung turun dan sampai Sabtu (12/3) masih terus membersihkan jalan dari lumpur agar jalan bisa kembali dilewati meskipun kondisinya saat ini masih licin, tapi sudah bisa dilewati. (c13)

Jailani Tewas ...

Trieng, Muhammad Ali mengatakan, kejadian tersebut baru diketahuinya menyusul pemberitahuan dari warganya. Menurutnya, Jailani dengan Nasruddin sebelumnya sudah terlihat ketidakharmonisan. Namun, hal terakhir yang memicu hubungan keduanya semakin tidak akur setelah Jamilah, (adik Nasruddin) tidak diketahui keberadaannya sebulan terakhir. Iyut Bing Slamet juga kedapatan membawa shabu-shabu seberat 0,4 gram di Hotel Penthouse, Jakarta Barat, 8 Maret. Pada 28 Februari 2011, drummer Padi Yoyok, juga ditangkap Sub Dit V Direktoran Narkoba Bareskrim Mabes Polri di Sudirman Park, Jakarta Pusat. Polisi menyita 0,4 gram shabu-shabu. (vvn)

“Jamilah, adik Nasruddin mengaji di Dayah Arongan, sebulan ini tidak tahu pergi kemana, diduga Jailani yang telah membawa lari Jamilah ke suatu tempat, membuat Nasruddin sangat marah,” kata Muhammad Ali. Sementara tetangga korban, Fauziah, 35, menyebutkan, Jailani adalah suami kedua dari Maryani. Maryani menikah dengan korban setelah suaminya, M Yusuf, warga Pulo Drien Kecamatan Simpang Mamplam menceraikannya. Dari pernikahannya dengan M Yusuf, Maryani memiliki tujuh orang putra-putri, dan satu diantaranya adalah tersangka, Nasruddin. Sedangkan hasil perkawainannya dengan Jailani (korban), Maryani, pasangan ini baru dikarunia seorang anak. (cb03)

kata Wakio Fushima, pemilik salah satu toko di kota pantai berpenduduk 1,02 juta jiwa itu, yang terletak 125 km dari pusat gempa. Di Sendai, sebagaimana daerah timurlaut Jepang lainnya, pelayanan telefon selular tidak bekerja, membuat sulit bagi masyarakat untuk berkomunikasi dengan orang-orang yang disayanginya. Lebih dari 215.000 orang ditampung di tempat-tempat penampungan darurat di daerah-daerah timur dan barat Jepang, Sabtu, sehari setelah gempa dahsyat dan tsunami menghantam negara itu, kata Badan Kepolisian Nasional. Jumlah itu termasuk lebih dari 100.000 orang mengungsi di Prefektur Fukushima, termasuk penduduk yang diperintahkan meninggalkan daerah di sekitar dua fasilitas listrik tenaga nuklir. Jumlah mereka yang kehilangan tempat tinggal diperkirakan jauh lebih banyak, dan polisi mengatakan phaknya belum menerima informasi dari perfektur Miyagi, provinsi Jepang utara yang paling parah di mana ratusan orang dilaporkan tewas. Ribuan orang terperangkap di gedung-gedung yang dikepung air di Miyagi, kata pihak berwenang, setelah satu tembok air ambruk dihantam gempa berkuatan 8,9 skala Richter menghancurkan rumah-rumah, jalan-jalan dan kota-kota. Presiden Barack Obama mengatakan, Jumat, bahwa kapal induk kedua AS telah menuju ke Jepang untuk memberikan bantuan setelah gempa dan tsunami yang menghancurkan yang dilukiskannya sebagai “benar-benar memilukan”. Obama mengatakan ia telah menyampaikan belasungkawa dalam pembicaraan melalui telpon dengan PM Jepang Naoto Kan dan menjanjikan “bantuan apapun yang dibutuhkan”. Ledakan Reaktor Nuklir Satu ledakan di pusat pembangkit listrik nuklir Jepang yang terjadi Sabtu (12/3) menghancurkan salah satu gedung reaktor, namun kebocoran radiasi berkurang meski ada kecemasan krisis dari kerusakan yang disebabkan gempa kuat

dan tsunami, kata para pejabat. Jurubicara pemerintah Yukio Edano mengatakan ledakan menghancurkan dinding bagian dalam gedung di mana terletak reaktor, namun bukan bagian logam yang membungkus reaktor tersebut. Edano mengatakan radiasi di sekitar pembangkit listrik nuklir Fukushima Dai-ichi tidak meningkat setelah ledakan, bahkan kenyataannya menurun. Dia tidak mengatakan mengapa radiasi tersebut tidak seperti apa yang dibayangkan. Sebanyak 3.000 penduduk yang tinggal di sekitar pembangkit tenaga nuklir di Prefektur Fukushima sejauh 240 kilometer di utara Tokyo diungsikan dari kawasan tersebut setelah pemerintah mengumumkan radiasi tingkat kecil dan meluaskan kawasan pengungsian di sekitar pembangkit. Perusahaan pengelola pembangkit listrik tenaga nuklir Jepang, Tokyo Electric Power Co. (TEPCO) mengatakan Sabtu bahwa satu ledakan terdengar di dekat satu reaktor nuklir yang rusak di Prefektur Fukushima sebagai tanda bahwa kehancuran sedang terjadi. Jurubicara Badan Keamanan Perindustrian dan Nuklir dalam jumpa pers mengonfirmasi bahwa ledakan terdengar di dekat reaktor nomor satu di Pembangkit Listrik Tenaga Nuklir Nomor satu, Fukushima. Sejumlah saksimata melaporkan bahwa mereka mendengar ledakan besar dan melihat asap membumbung dari bangunan yang melindungi reaktor. Pada waktu terpisah, lembaga siaran umum, NHK melaporkan bahwa atap bangunan runtuh dan empat orang terluka dalam kecelakaan tersebut. Menurut laporan NHK insiden itu terjadi pada sekitar pukul 15.36 sehari setelah gempa bumi sebesar 8,8 skala Richter melanda Jepang timurlaut yang mengakibatkan tsunami besar di perairan Pasifik. Zat radio aktif telah terdeteksi dan pemerintah setempat menyarankan penduduk untuk menjaga jarak pada radius sejauh sepuluh kilometer dari pembangkit tenaga nuklir.(ap/bbc/ cnn/ant/afp/rtr/m10)

“Saat saya lihat Nasrun mengayun parang, saya langsung lari dengan melompat meja, kemudian saya tidak tahu apa yang terjadi. Setelah banyak orang datang baru saya kembali ke kios, bang Jailani sudah meninggal di bawah pohon jambu, dari kepalanya keluar banyak darah,” jelas Murni. Kepala Desa Desa Cot

Isap Ganja Lima ... personel Kangen Band. “Penyidiknya belum ada yang bisa dihubungi. Laporan sementara, mereka ditangkap setelah manggung di Bekasi,” ujar Sumirat. Ditangkapnya Kangen Band menambah daftar panjang artisartis yang berurusan barang haram ini. Sebelumnya artis

SUDAH LEBIH 1.300 ... Kementerian pertahanan mengatakan, sekitar 1.800 rumah di Minamisoma, Prefektur Fukushima, hancur, sementara di Sendai pihak berwenang mengatakan bahwa 1.200 dihantam tsunami. Di kota kecil Ofunato ke arah utara lagi, 300 rumah dilaporkan roboh atau tersapu gelombang air. Lebih dari 180 kebakaran dilaporkan terjadi di dan sekitar Tokyo dan di Iwate, Miyagi, Akita dan Fukushima, kata Kyodo mengutip Badan Penanganan Bencana dan Kebakaran Jepang. Gempa bumi dahsyat Jumat itu merupakan gempa terkuat yang terekamdikepulauanyangsecara seismik tidak stabil itu, yang terletak di‘Lingkaran Api Pasifik.’ Gempa susulan Sabtu itu berkekuatan 6,8 skala Richter yang disusul dengan serangkaian getaran yang berasal dari tempat yang sama, kata USGS. Belum diketahui apakah gempa baru itu menambah buruk kerusakan yang ditinggalkan gempa sehari sebelumnya. Semuanya merupakan bagian dari lebih 125 gempa susulan sejak gempa sehari sebelumnya, yang merupakan paling kuat menghantam Jepang sejak dimulainya pembuatan catatan resmi gempa akhir tahun 1800an. Gempa itu menempati urutan terkuat kelima dari yang memporak-porandakan Christchurch, Selandia Baru, bulan lalu, demikian menurut para pakar. Angka kematian resmi menyebutkan 413 orang tewas, sementara 784 lainnya dinyatakan hilang dan 1.128 cedera. Sebagai tambahannya, kata polisi, antara 200 dan 300 mayat ditemukan di sepanjang pantai di Sendai, kota terbesar di sekitar pusat gempa. Belum lagi dari berbagai perkiraan bahwa diyakini banyak korban yang terperangkap dalam kendaraan, gedung dan tempat-tempat lainnya. Regu pertolongan bekerja keras untuk mencapai beberapa lokasi yang diperkirakan daerah yang terkena dampak berat bencana itu. “Banjir datang dari belakang toko dan menyapu kedua sisinya. Mobil-mobil hanyut,”

Waspada/Khairul Akhyar

Longsor menutup badan jalan selama 10 jam hingga alat berat dinas PU Aceh Tengah diturunkan untuk membersihkan badan jalan, guna kelancaran melintasnya kendaraan.

Terdapat 19 Titik Longsoran Di Lintas Takengen-Nagan Raya �

31 Rumah Dan 3 H Sawah Terendam Banjir

TAKENGEN (Waspada): Hujan deras yang selama sepekan terakhir melanda kawasan Kabupaten Aceh Tengah, menyebabkan terjadinya banjir di sejumlah lokasi. Selain itu, intensitas hujan yang cukup tinggi menyebabkan terjadinya longsor di sepanjang jalan Takengen - Kecamatan Celala via daerah Kuyun menuju Kabupaten Nagan Raya. 31 Rumah dan tiga hektar sawah terendam banjir di Kampung Isaq, Kecamatan Linge. Sebanyak 19 titik longsoran dijumpai di sepanjang ruas jalan menuju Kampung Kuyun dari arah Kota Takengen. Bahkan, longsor yang terjadi Jumat (11/ 3) malam sekitar pukul 21:00 WIB di Kampung Kuyun Uken menyebabkan akses jalan tersebut sempat terputus selama 10 jam lebih. Amatan Waspada ruas jalan Takengen-Kecamatan Celala via Kuyun, merupakan jalur lintas menuju daerah Beutong, Nagan Raya. Jalan yang beberapa bulan lalu baru dilakukan pelebaran, kembali mengalami kerusakan lantaran banyaknya titik-titik longsoran yang dijumpai di sepanjang jalan itu selama memasuki musim penghujan. Akibatnya kondisi badan jalan mulai mengecil karena banyaknya tumpukan tanah yang jatuh ke ruas jalan. Dan sebagian badan jalan mulai mengalami kerusakan karena banyaknya terdapat lubang yang menganga di tengah lantaran tergerus air hujan. Sementara itu sebagian besar timbunan tanah yang menutupi sebagian ruas jalan TakengenCelala, sebanyak belasan titik hingga saat ini belum dilakukan pengerukan. Hanya di lokasi longsoran yang terjadi malam kemarin di Kampung Kuyun Uken. Sedangkan belasan titik longsoran di sepanjang ruas jalan Takengen-

Wanita Muda ... melakukan perkosaan terhadap penumpangnya. Karena ada perlawanan, pelaku langsung menerkam korban dengan cara menggigit paha sebelah kiri, melukai dada sebelah kiri, tangan kiri dan kepala korban juga luka bekas benturan benda keras. Dalam keadaan berlumuran darah, korban berhasil lompat dari betor dan minta bantuan satpam yang berada di showroom mobil. Kemudian, satpam menyarankan korban masuk ke dalam pagar dan karena sudah lemas, korban langsung terjatuh. Melihat korban minta bantuan kepada satpam, pelaku pengemudi betor sempat melakukan pengancaman. Mendengar ancaman, satpam di showroom mobil mencoba melakukan pengejaran tapi melihat korban jatuh pingsan, niat pengejaran terpaksa digagalkan, sementara pelaku pengemudi betor terus kabur. Seorang pengemudi betor yang melintas di lokasi melihat kejadian terus melakukan pengejaran dan dalam perjalan betornya mogok. Korban Adel kemudian dilarikan ke rumah sakit di Jalan Iskandarmuda. Karena kondisinya sangat kritis, terpaksa di-

Tsunami Sampai ... Menurut dia, hantaman gelombang tsunami itu terjadi mulai sekitar pukul 23:00 WIT sampai 24:00 WIT, ketika peringatan bahaya tsunami dari BMKG sudah dicabut. Sebelumnya diberitakan, gelombang tsunami di Holtekamp juga menewaskan seorang warga bernama Darwanto Odang ,35, yang sehari-harinya bekerja sebagai pengusaha tambak. Dia dilaporkan terseret gelombang tsunami saat sedang mengevakuasi keluarga-

Celala via Kuyun masih dibiarkan bertumpuk di tengah badan jalan. Menurut saksi mata warga setempat yang ditaepnyai Waspada, tanah longsor yang terjadi di daerah Kampung Kuyun Uken, Kecamatan Celala, yang terjadi Jumat (11/3) malam, sempat memutuskan akses menuju Kecamatan Celala maupun ke arah Kota Takengen. Tanah longsor menutup ruas jalan sepanjang 40 meter di Kampung Kuyun, baru bisa dilalui setelah satu unit alat berat diturunkan untuk melakukan pengerukan tanah. Semalam sama sekali nggak bisa lewat kendaraan karena tumpukan tanahnya cukup tinggi menutup badan jalan, kata warga Kuyun Uken. 31 Rumah dan 3 Hektare Sawah Terendam Banjir Sebanyak 31 unit rumah di Kampung Kute Uyem, Kecamatan Linge, Kabupaten Aceh Tengah terendam banjir bandang, luapan air Sungai Wih Nangka dan Sungai Jambo Aye yang mengapit empat kampung di Kecamatan Linge. Selain merendam 31 rumah di Kampung Kute Uyem, seluas tiga hektar sawah di Kampung Kute Rayang Kecamatan Linge juga terendam banjir luapan dua sungai tersebut. Sejumlah perabotan dan alat-alat rumah tangga tidak sempat diselamatkan dan terendam air. Banjir banding melanda Kampung Kute Uyem dan Kute Rayang, Jumat (11/3) sekitar pukul 21:00 WIB, dan air bah mulai berangsur surut setelah lima jam kemudian. Seorang warga Kute Uyem, Mukhti, Sabtu (12/3) mengatakan, sebanyak 31 rumah warga terendam air bandang yang meluap dari Sungai Wih Nangka dan Wih Jambo Aye yang meluap dan masuk ke rumah-rumah penduduk. (cb04/b18/cir)

arahkankeRSUDr.PirngadiMedan dan dalam perjalan korban menghembuskan nafas terakhir. Kapolsekta Medan Baru Kompol Saptono,SH,SIK melalui Kanit Reskrim Iptu Akta Wijaya Pramasaksi,SH kepada Waspada, Sabtu (12/3) malam mengatakan, pihaknya sudah membentuk tim untuk mengungkapkan kasus tersebut. Dalam kasus ini, polisi sudah menginterogasi satpam dan pengemudi betor yang menge-

jar pelaku pembunuhan tersebut. Senin (14/3), pihaknya melakukan pemeriksaan terhadap satpam dan pengemudi betor yang gagal mengejar pelaku pengemudi betor tersebut. “Kita belum mengetahui alamat korban dan menurut keterangan dia dari Rantauprapat datang ke Medan karena melihat neneknya yang sakit,” ujar mantan Kanit Reskrim Polsekta Medan Barat. (m36)

Presiden Jangan ...

orang-orang yang tersangkut kasus korupsi. SBY juga dituding menyalahgunakan kekuasaan. Hanya saja, Din yang juga Wakil Ketua Umum MUI Pusat itu mengaku, menyesalkan sikap pemerintah yang seolah berdiam diri dan tidak melanjutkan beberapa kasus-kasus korupsi kakap, salah satunya kasus Bank Century. Muat Klarifikasi SBY Dua media Australia, The Age dan Sidney Morning Herald, membuat Jakarta gerah dengan memuatbocorandokumenmilik Kedutaan Amerika Serikat di Indonesia tanpa konfirmasi pada Jumat (11/3). Hari Sabtu (12/3), kedua media pun memuat konfirmasi Presiden Susilo Bambang Yudhoyono atas tuduhan korupsi dan penyalahgunaan kekuasaan. Dilansir dari laman The Age edisi Sabtu (12/3), media ini memuat pernyataan sejumlah pembantupresidensepertiMenteriLuar Negeri RI Marty Natalegawa dan Staf Presiden Daniel Sparingga. “Presiden tidak senang dengan berita penuh kebohongan yang dimuatSidneyMorningHeralddan The Age,” kata Daniel Sparingga. “Isi berita penuh dengan sensansi dan omong kosong.” SBY menilai kedua media ini telahmelanggarkodeetikjurnalistik universaldenganmemuatbocoran WikiLeakstersebuttanpameminta konfirmasi padanya. Marty telah mengajukan protes keras secara resmi kepada Kedutaan Amerika Serikat. (ant/vivanews)

pembantu atau juru bicaranya. “Kasus kecil saja biasanya SBY sendiri yang berbicara di hadapan rakyat, masak kasus seperti ini tidak berani angkat bicara,” tutur Din. Bahkan, Din menegaskan, bila perlu media Australia yang memberitakan kasus tersebut dituntut secara hukum. Namun, kata dia, hal itu tidak mudah, sebab membutuhkan perdebatan argumen dan beradu fakta yang sangat panjang. Sebagai rakyat Indonesia, Din sangat menyayangkan pemuatanberitatersebut.Iamengakui, banyak berita miring yang dibuat, di antaranya pada 2009 lalu, SBY selalu memata-matai beberapa rival politiknya dan melakukan pembelaan kepada nya dan mengecek pergerakan tsunami, namun naas saat datang gelombang dia terjatuh dari motornya dan terseret sejauh 50 meter sebelum ditemukan. Sekretaris Badan Nasional Penanggulangan Bencana kota Jayapura,YohanisWemben yang ditemui ketika sedang meninjau lokasibencanadiHoltekampmengatakan,korbanbaruditemukan sekitar pukul 14.30 WIT. “Korban ditemukan sekitar 50 meter dari lokasi awal dia terseret ombak, sedang terhimpit sampah-sampah dan kayu yang ikut terseret tsunami,” jelasnya.

Gempa Bumi Dan Tsunami ... April 2007: Sekurang-kurangnya 28 orang tewas di Solomon Islands ketika terjadi tsunami yang ditimbulkan gempa bumi 8,1 SR. Juli 2006: Gempa bumi 6,1 SR memicu tsunami di selatan lepas pantai pulau Jawa, yang menewaskan sekurang-kurangnya 600 orang. Maret 2005: Gempa bumi 8,6 SR di utara Sumatera menewaskan sekitar 1.300 orang. Desember 2004: Tsunami di Samudra India, yang dipicu oleh gempa bumi 9,0 SR, yang menewaskan 230.000 di lebih 12 negara, terutama di Aceh. Agustus 1976: Guncangan gempa berkekuatan 8,0 SR terjadi dekat pulau Mindanao dan Sulu di Filipina, yang memicu tsunami dan menyebabkan sekurang-kurangnya 5.000 orang tewas. Maret 1964: Gempa bumi 9,2 SR di Prince William Sound, Alaska, AS, menewaskan 131 orang, termasuk 128 dari satu tsunami. Mei 1960: Gempa bumi 9,5 SR di selatan Chile yang diiringi tsunami yang menewaskan sekurang-kurangnya 1.716 orang. November 1952: Satu gempa bumi 9,0 SR di Kamchatka, Rusia, menyebabkan kerusakan, namun tak ada laporan kematian meski menyebabkan gelombang 9,1 meter di Hawaii. Agustus 1950: Assam, India, dan Tibet dilan-

da gempa bumi 8,6 SR yang menewaskan sekurang-kurangnya 780 orang. April 1946: Gempa bumi 8,1 SR dekat Pulau Unimak, Alaska, memicu tsunami, yang menewaskan 165 orang, sebagian besar di Hawaii. Januari 1906: Guncangan gempa bumi berkekuatan 8,8 SR di lepas pantai Ekuador dan Kolombia menimbulkan tsunami yang menewaskan sekurang-kurangnya 500 orang. Agustus 1868: Gempa berkekuatan 9,0 SR di Arica, Peru (sekarang Chile) menimbulkan bencana tsunami, lebih dari 25.000 orang tewas di Amerika Selatan. April 1868: Gempa bumi 7,9 SR mengguncang Big Island, Hawaii, yang menewaskan 77 orang, termasuk 46 di antaranya akibat tsunami. November 1755: Satu gempa bumi 8,7 SR dan menimbulkan tsunami di Lisabon, Portugal, yang menewaskan kira-kira 60.000 orang dan merusak banyak bagian Lisabon. Juli 1730: Dengan kekuatan 8,7 SR, satu gempa bumi menewaskan sekurang-kurangnya 3.000 orang di Valparasio, Chile. Januari 1700: Gempa bumi 9,0 SR mengguncang kawasan yang sekarang ini adalah California Utara, Oregon,Washington dan British Colombia, AS, yang memicu tsunami dan menghancurkan desa-desa di Jepang. (dari berbagai sumber/m10)

Berita Utama


Indonesia Turut Berduka Dan Siap Bantu Jepang �

Rakyat Aceh Ikut Berduka

JAKARTA (Waspada): Pemerintah Indonesia siap memberikan bantuan kemanusiaan bagi korban gempa bumi dan tsunami di Jepang. “Presiden telah meminta Menteri Luar Negeri Marty Natalegawa untuk berkomunikasi dengan pihak Pemerintah Jepang untuk menyatakan kesiapan Pemerintah Indonesia dalam memberikan bantuan,” kata Juru Bicara Presiden Julian A Pasha dalam pesan singkatnya di Jakarta, Sabtu (12/3). Presiden, lanjut dia, menya-

takan bahwa pemerintah dan rakyat Indonesia turut berduka atas gempa bumi yang terjadi di Jepang. Sementara itu berkaitan dengan gempa bumi dan tsunami yang melanda Jepang pada Jumat (11/3), Kementerian Luar Negeri RI pada Sabtu (12/3) malam mengirim tim pendukung guna membantu KBRI Tokyo.

Pengungsi Terus ... diperoleh pihaknya sebanyak enam warga Tangse meninggal dunia dan enam orang masih dinyatakan hilang dalam bencana banjir bandang tersebut. “Untuk jumlah orang meninggal memang sebelumnya terjadi simpang siur pada pendataan. Tetapi data yang dikumpulkan Pemkab Pidie tercatat sebanyak enam orang meninggal dunia, dan enam orang hilang. Ini adalah data terakhir yang sebenarnya yang telah kita datakan” kata Sekda Pidie M. Iriawan. Sedangkan untuk jumlah kerugian secara total disebabkan bencana alam tersebut pihaknya belum dapat melaporkan, karena saat ini tim pedataan dibentuk Pemkab Pidie masih bekerja di lapangan. “Yang pasti kerugian yang disebabkan bencana alam ini sangat besar. Kepada rekan-rekan wartawan kami berharap bersabar,” katanya. Amatan Waspada, di Desa Rantau Panyang, Tangse satu unit tempat ibadah mengalami rusak parah serta puluhan rumah hancur total tertimbun tanah longsor dan bebatuan. Sedangkan arus pengungsian masyarakat terus saja mengalir bergabung di sejumlah titik pengungsian. Para pengungsi dari Desa Blang Pandak yang sebelumnya dilaporkan desa tersebut terkurung karena ada tiga jembatan terputus dan jalan amblas kini masyarakatnya mulai bergerak menuju tempat pengungsian dengan berjalan kaki melalui jalan gunung yang terjal. Banyak pengungsi yang menderita luka lecet dalam perjalanan menuju kamp-kamp pengungsian. Waspada juga melihat beberapa orang jompo yang terpaksa harus dibopong melewati jalanan mendaki di kawasan pegunungan Tangse yang terjal. Aminah, 34, salah seorang warga Blang Pandak Dusun Simpang Kanan, Tangse, kepada Waspada, mengungkapkan kondisi desa tempatnya bernomisili kini sudah rata dengan tanah. Banyak rumah-rumah warga mengalami rusak berat dan bahkan hancur tertimbun tanah longsor dan dihantam bebatuan besar. Namun dia mengungkapkan tidak mengetahui adanya korban jiwa. Saat ini sebut dia, anak-anak balita dan bocah-bocah serta para orang jompo tidur di bawah reruntuhan rumah beratapkan seng –seng bekas reruntuhan. Sedangkan jalur masuk ke perkampungan itu masih tertutup, meskipun saat ini tiga alat berat milik Pemkab Pidie sudah dikerahkan untuk membuka kembali jalan-jalan rusak tertimbun tanah longsor itu. “ Kami sangat berharap ada upaya lain dari pemerintah untuk mengangkut masyarakat kami yang masih terkurung di dalam kampung” pinta Aminah. (b20)

AS Tidak Membenarkan ... di masa mendatang. “Sesuatu yang mereka dengar dari ngobrol-ngobrol, dan digambarkan sebagai suatu kebenaran. Itu tidak bisa kita terima. Sangat-sangat ceroboh,” katanya. Lantas, apa tanggapan Marty soal sikap Pemerintah AS yang menyatakan tidak membenarkan dan tidak membantah isi kawat diplomatik tersebut? “Memang itu standar pernyataan Pemerintah AS. Tidak mengonfirmasi atau membantah. Itu standar AS karena mereka selalu menyatakan tidak bisa mengonfirmasi informasi yang konon bersumber dari dokumen rahasia. Itu sudah posisi dasar mereka,” katanya. Kecewa dengan media Australia Pada kesempatan tersebut, Marty juga mengutarakan kekecewaannya atas ketidakprofesionalan The Age dan Sydney Morning Herald. Marty mengatakan, kedua media terkemuka di Australia tersebut seharusnya melakukan konfirmasi kepada Pemerintah Indonesia sebelum menayangkan berita. “Kita sangat prihatin, Australia adalah negara yang sangat menjunjung tinggi demokrasi, profesionalisme. Mengapa media massanya bisa terjebak dalam suatu situasi di mana memberitakan sesuatu tanpa memberikan kesempatan kepada pihak yang dirugikan untuk menyampaikan pandangannya. Anda semua dari media massa. Saya yakin, dalam bekerja, Anda melakukan konsep cek dan ricek, mencari informasi dari semua pihak. Itu sudah naluri bagi Anda semua, tapi di Australia belum demikian,” katanya. (kps)

Mungkinkah Bencana Jepang ... 1000 korban jiwa. Angka yang tewas ini diperkirakan bertambah karena masih banyak lagi yang belum ditemukan. Gempa diakibatkan oleh aktivitas tektonik Bumi. Berangkat dari kebetulan tersebut, beberapa pihak berspekulasi bahwa gempa di Jepang disebabkan oleh Bulan yang hendak menuju titik terdekatnya dengan Bumi. Blogger Mark Paquette misalnya, memulai spekulasinya dengan mengatakan bahwa beberapa peristiwa gempa dahsyat memang terkait dengan kedekatan Bumi-Bulan. Ia mencontohkan gempa yang mengakibatkan tsunami di Aceh pada 26 Desember 2004 lalu. Gempa tersebut terjadi 14 hari sebelum perigee BumiBulan yang terjadi pada 10 Januari 2005. Ia menuliskan, “Jadi, apa yang bisa kita lihat sekarang? Gempa bumi? Erupsi gunung berapi? Sepertinya kita cuma bisa menunggu dan melihat nanti.” Komentar tersebut memang menakutkan. Bagaimana tidak, belum terjadi perigee saja bisa berakibat pada gempa terdahsyat sepanjang sejarah Jepang sejak 1891. Menanggapi spekulasi itu, meteorolog senior di AccuWeather Paul Walker mengatakan, spekulasi bahwa gempa Jepang disebabkan oleh perigee Bumi-Bulan sepertinya tidak benar. “Saya kira Anda tidak bisa menghubungkannya dengan ‘supermoon’ yang masih 6 hari lagi terjadi. ‘Supermoon’ memang bisa berakibat pada gelombang pasang yang luar biasa, tapi tidak bisa begitu saja dikaitkan dengan peristiwa alam yang ekstrim semacam ini,” jelasnya seperti dikutip MSNBC. Astronom NASA David William juga mengatakan bahwa “supermoon” bukan penyebab gempa. “Supermoon itu hanya bulan yang besar dan sangat bercahaya. Tak ada yang spesial dengan itu,” paparnya. John Vidale, seismolog University of Washington dan direktur Pasific Northwest Seismic Network serta Wiliam Wilcock yang juga dari University of Washington pun mengatakan hal serupa. Mantan ilmuwan NASA Phil Plait mengatakan dengan tegas, “Apapun yang orang katakan, yang jelas tak ada kemungkinan gemJawaban Problem Catur, pa ini disebabkan oleh Bulan.” Perigee memang bisa meDari Halaman Sport. nyebabkan peningkatan aktivitas tektonik, namun ia mengatakan bahwa hingga saat ini Bulan Jawaban Problem Catur: belum berada pada titik terde1. Bxg6+, f7xB. kat itu. Pergerakan Bulan bisa membawanya menuju titik ter2. Gd5+, Rh7. dekat dan terjauh dengan Bumi. Titik terdekat disebut peri3. Bf7+, Rg8. gee sedangkan titik terjauh di4. Bc7+, Rh8. sebut apogee. Saat perigee, efek gravitasi 5. Mh6+mat. (Jika Bulan terhadap Bumi meningkat. Efek yang paling bisa dilihat 3. ....., Rh8. adalah gelombang pasang, se4. Mh6+, Rg8. bab air adalah salah satu elemen bumi yang paling mudah dipe5. Mh7/Mg7+mat). ngaruhi gravitasi. (k/m09)

Tim tersebut terdiri atas lima pejabat Kemlu yang bertugas membantu KBRI Tokyo dalam penangangan perlindungan WNI di wilayah-wilayah yang terkena dampak bencana, khususnya wilayah Miyagi dan Iwate yang cukup parah. Pascabencana, KBRI Tokyo mengirim tim untuk membuka posko sementara di Sendai sekitar Miyagi dan Iwate untuk memberikan bantuan bagiWNI yang berada di daerah tersebut. Ikut Berduka Sementara pemerintah Aceh menyatakan turut prihatin dan belasungkawa atas gempa bumi 8,9 skala richter dan tsunami di Jepang pada Jumat (11/ 3) yang memporak–porandakan sebahagian ‘Negeri Matahari Terbit’ tersebut. Wakil Gubernur Aceh Muhammad Nazar dan Wakil Ketua DPRA, H Sulaiman Abda

Gagal Ginjal Bakal ... Menurut Harun, setidaknya ada 700-800 kasus gagal ginjal yang ditemukan di Kota Medan. Bahkan, penyakit gagal ginjal ini tidak hanya diderita kelompok masyarakat lanjut usia (lansia), tetapi sudah dialami kelompok usia muda. “Baru-baru ini, kita menemukan kasus gagal ginjal pada seorang wanita berusia 23 tahun,” tambahnya. Sebagian besar kasus gagal ginjal yang ditemukan di Medan memiliki riwayat penyakit diabetes melitus dan hipertensi. Selebihnya disebabkan batu ginjal, mengkonsumsi obat anti nyeri secara sembarangan dan lain-lain. Tingginya kasus gagal ginjal yang dipicu penyakit diabetes melitus dan hipertensi, tidak terlepas dari maraknya produk jajanan jenis fast food di Kota Medan. Pasalnya, jenis makanan ini berpotensi menjadi penyebab diabetes melitus, obesitas (kegemukan) dan hipertensi yang akhirnya bermuara kepada gagal ginjal.

Isap Ganja Lima ... personel Kangen Band. “Penyidiknya belum ada yang bisa dihubungi. Laporan sementara, mereka ditangkap setelah manggung di Bekasi,” ujar Sumirat. Ditangkapnya Kangen Band menambah daftar panjang artisartis yang berurusan barang haram ini. Sebelumnya artis

SUDAH LEBIH 1.300 ... Kementerian pertahanan mengatakan, sekitar 1.800 rumah di Minamisoma, Prefektur Fukushima, hancur, sementara di Sendai pihak berwenang mengatakan bahwa 1.200 dihantam tsunami. Di kota kecil Ofunato ke arah utara lagi, 300 rumah dilaporkan roboh atau tersapu gelombang air. Lebih dari 180 kebakaran dilaporkan terjadi di dan sekitar Tokyo dan di Iwate, Miyagi, Akita dan Fukushima, kata Kyodo mengutip Badan Penanganan Bencana dan Kebakaran Jepang. Gempa bumi dahsyat Jumat itu merupakan gempa terkuat yang terekamdikepulauanyangsecara seismik tidak stabil itu, yang terletak di‘Lingkaran Api Pasifik.’ Gempa susulan Sabtu itu berkekuatan 6,8 skala Richter yang disusul dengan serangkaian getaran yang berasal dari tempat yang sama, kata USGS. Belum diketahui apakah gempa baru itu menambah buruk kerusakan yang ditinggalkan gempa sehari sebelumnya. Semuanya merupakan bagian dari lebih 125 gempa susulan sejak gempa sehari sebelumnya, yang merupakan paling kuat menghantam Jepang sejak dimulainya pembuatan catatan resmi gempa akhir tahun 1800an. Gempa itu menempati urutan terkuat kelima dari yang memporak-porandakan Christchurch, Selandia Baru, bulan lalu, demikian menurut para pakar. Angka kematian resmi menyebutkan 413 orang tewas, sementara 784 lainnya dinyatakan hilang dan 1.128 cedera. Sebagai tambahannya, kata polisi, antara 200 dan 300 mayat ditemukan di sepanjang pantai di Sendai, kota terbesar di sekitar pusat gempa. Belum lagi dari berbagai perkiraan bahwa diyakini banyak korban yang terperangkap dalam kendaraan, gedung dan tempat-tempat lainnya. Regu pertolongan bekerja keras untuk mencapai beberapa lokasi yang diperkirakan daerah yang terkena dampak berat bencana itu. “Banjir datang dari belakang toko dan menyapu kedua sisinya. Mobil-mobil hanyut,” kata Wakio Fushima, pemilik salah satu toko di kota pantai berpenduduk 1,02 juta jiwa itu, yang terletak 125 km dari pusat gempa. Di Sendai, sebagaimana daerah timurlaut Jepang lainnya, pelayanan telefon selular tidak

menyebutkan, Pemerintah Aceh berencana akan memberikan dukungan untuk membantu Jepang sesuai dengan kebijakan nasional. Apalagi, negara tersebut telah banyak memberikan bantuan kepada Aceh saat dilanda gempa dan tsunami pada 2004 silam. “Kita turut prihatin atas gempa dan tsunami yang melanda Jepang. Mereka juga telah banyak membantu Aceh,” katanya kepada wartawan, usai menghadiri peringatan Maulid Akbar yang digelar Partai Golkar Aceh, Sabtu (12/3). Menurut dia, langkah itu akan dilakukan jika ada permintaan dari pemerintah pusat, karena itu berhubungan antar negara. ”Jika pemerintah pusat meminta Aceh untuk ikut maka kita akan ambil peran terdepan,” ungkap dia. Katanya, Pemerintah Aceh, belum dapat memastikan bantuan yang diberikan itu dalam bentuk apa, karena secara materi Aceh tidak memiliki

kemam-puan untuk itu. “Jika pemerintah pusat meminta Aceh untuk ikut berkontribusi secara nasional, kita akan siap secara patungan,” urai dia. Nazar merasa yakni, Negeri Sakura itu akan akan segera pulih setelah gempa bumi yang memicu tsunami. Katanya, Jepang adalah negara yang paling siap dan berpengalaman dalam menghadapi bencana alam. Wakil Ketua DPRA Drs H Sulaiman Abda juga menyatakan rasa dukanya yang mendalam terhadap bencana yang menimpa warga Jepang. “Kita doakan saja semoga mereka cepat bangkit,” ungkapnya di tempat yang sama. Dia juga berharap, warga Tangse, Pidie yang juga menghadapi musibah banjir banding bisa ditangani dengan cepat. “Kita harapkan bantuan segera bisa disalurkan ke sana. Kami dari Partai Golkar (hari Minggured) akan menyerahkan bantuan ke sana,” ungkap Sulaiman Abda. (ant/b05)

Di negara maju seperti Amerika Serikat, kasus gagal ginjal yang disebabkan diabetes melitus mencapai 50 persen dan hipertensi 27 persen. “Tingginya persentase tersebut tidak mengherankan, karena Amerika Serikat termasuk salah satu negara maju yang banyak memproduksi jajanan jenis fast food,” ujar Harun. Dalam beberapa tahun terakhir, lanjut Harun, kaum industrialis berupaya memasarkan produk makanan yang tidak baik bagi kesehatan terutama jenis fast food. Dengan harga murah dan kelezatan yang ditawarkan, tentu akan mengundang masyarakat di Indonesia untuk mengkonsumsinya tanpa mempertimbangkan risiko diabetes, obesitas dan hipertensi, bahkan gagal ginjal. Sebagai dampak maraknya jajanan fast food dan pola hidup masyarakat yang enggan berolahraga, Organisasi Kesehatan Dunia ( WHO) memperkirakan akan terjadi ledakan kasus diabetes melitus di seluruh dunia menjelang tahun 2025. Pada tahun 2004, IndoneIyut Bing Slamet juga kedapatan membawa shabu-shabu seberat 0,4 gram di Hotel Penthouse, Jakarta Barat, 8 Maret. Pada 28 Februari 2011, drummer Padi Yoyok, juga ditangkap Sub Dit V Direktoran Narkoba Bareskrim Mabes Polri di Sudirman Park, Jakarta Pusat. Polisi menyita 0,4 gram shabu-shabu. (vvn)

sia tercatat memiliki 8,4 juta kasus diabetes melitus. Jumlah ini membengkak jadi 21,3 juta kasus pada tahun 2030. “Kondisi ini telah menempatkan Indonesia di urutan keempat penyumbang diabetes melitus terbesar di dunia setelah India, China dan Amerika Serikat,” ujar Harun. Mengenai tindakan pencegahan gagal ginjal, Harun menganjurkan kepada masyarakat agar melakukan olahraga secara teratur minimal 30 menit per hari, banyak mengkonsumsi air putih, mengurangi konsumsi makanan yang tidak sehat seperti fast food dan tidak mengkonsumsi obat secara sembarangan. Bila mengalami gejala buangairkecilyangcepatberkurang, tekanan darah terlalu cepat naik terkadang disertai sesak nafas, makasegeralakukanpemeriksaan ginjal guna dilakukan langkahlangkah antisipasi agar tidak terjadi gagal ginjal. Jika menderita gagal ginjal, maka pasien tersebut harus menjalani terapi cuci darah (haemodialisis) seumur hidupnya. Tindakan lainnya, melakukan transplantasi ginjal yang membutuhkan biaya berkisar Rp200 – Rp300 juta. “Tindakan transplantasi ini pernah dilakukan pada tahun 2003. Namun sangat sulit mencari orang yang bersedia mendonorkan ginjalnya secara sukarela. Bahkan, belum ada regulasi donor jenazah sehingga tindakan transplantasi ginjal ini sulit dilakukan di Indonesia,” demikian Harun. (m25)

bekerja, membuat sulit bagi masyarakat untuk berkomunikasi dengan orang-orang yang disayanginya. Lebih dari 215.000 orang ditampung di tempat-tempat penampungan darurat di daerah-daerah timur dan barat Jepang, Sabtu, sehari setelah gempa dahsyat dan tsunami menghantam negara itu, kata Badan Kepolisian Nasional. Jumlah itu termasuk lebih dari 100.000 orang mengungsi di Prefektur Fukushima, termasuk penduduk yang diperintahkan meninggalkan daerah di sekitar dua fasilitas listrik tenaga nuklir. Jumlah mereka yang kehilangan tempat tinggal diperkirakan jauh lebih banyak, dan polisi mengatakan phaknya belum menerima informasi dari perfektur Miyagi, provinsi Jepang utara yang paling parah di mana ratusan orang dilaporkan tewas. Ribuan orang terperangkap di gedung-gedung yang dikepung air di Miyagi, kata pihak berwenang, setelah satu tembok air ambruk dihantam gempa berkuatan 8,9 skala Richter menghancurkan rumah-rumah, jalan-jalan dan kota-kota. Presiden Barack Obama mengatakan, Jumat, bahwa kapal induk kedua AS telah menuju ke Jepang untuk memberikan bantuan setelah gempa dan tsunami yang menghancurkan yang dilukiskannya sebagai “benar-benar memilukan”. Obama mengatakan ia telah menyampaikan belasungkawa dalam pembicaraan melalui telpon dengan PM Jepang Naoto Kan dan menjanjikan “bantuan apapun yang dibutuhkan”. Ledakan Reaktor Nuklir Satu ledakan di pusat pembangkit listrik nuklir Jepang yang terjadi Sabtu (12/3) menghancurkan salah satu gedung reaktor, namun kebocoran radiasi berkurang meski ada kecemasan krisis dari kerusakan yang disebabkan gempa kuat dan tsunami, kata para pejabat. Jurubicara pemerintah Yukio Edano mengatakan ledakan menghancurkan dinding bagian dalam gedung di mana terletak reaktor, namun bukan bagian logam yang membungkus reaktor tersebut. Edano mengatakan radiasi di sekitar pembangkit listrik nuklir Fukushima Dai-ichi tidak meningkat setelah ledakan, bahkan kenyataannya menurun. Dia tidak mengatakan mengapa radiasi tersebut tidak seperti apa yang dibayangkan.

Sebanyak 3.000 penduduk yang tinggal di sekitar pembangkit tenaga nuklir di Prefektur Fukushima sejauh 240 kilometer di utara Tokyo diungsikan dari kawasan tersebut setelah pemerintah mengumumkan radiasi tingkat kecil dan meluaskan kawasan pengungsian di sekitar pembangkit. Perusahaan pengelola pembangkit listrik tenaga nuklir Jepang, Tokyo Electric Power Co. (TEPCO) mengatakan Sabtu bahwa satu ledakan terdengar di dekat satu reaktor nuklir yang rusak di Prefektur Fukushima sebagai tanda bahwa kehancuran sedang terjadi. Jurubicara Badan Keamanan Perindustrian dan Nuklir dalam jumpa pers mengonfirmasi bahwa ledakan terdengar di dekat reaktor nomor satu di Pembangkit Listrik Tenaga Nuklir Nomor satu, Fukushima. Sejumlah saksimata melaporkan bahwa mereka mendengar ledakan besar dan melihat asap membumbung dari bangunan yang melindungi reaktor. Pada waktu terpisah, lembaga siaran umum, NHK melaporkan bahwa atap bangunan runtuh dan empat orang terluka dalam kecelakaan tersebut. Menurut laporan NHK insiden itu terjadi pada sekitar pukul 15.36 sehari setelah gempa bumi sebesar 8,8 skala Richter melanda Jepang timurlaut yang mengakibatkan tsunami besar di perairan Pasifik. Zat radio aktif telah terdeteksi dan pemerintah setempat menyarankan penduduk untuk menjaga jarak pada radius sejauh sepuluh kilometer dari pembangkit tenaga nuklir. 10.000 Orang hilang Sementara itu, sebanyak 10.000 orang belum ditemukan di kota pelabuhan Minamisanriku di prefektur yang digun-cang gempa di Miyagi, Jepang demikian laporan stasiun siaran publik NHK,Sabtu.Jumlahtersebutadalah lebih separuh dari sebanyak 17.000 warga di kota kecil di pantai Pasifik tersebut, kata NHK. Pemerintah lokal berusaha menemukan mereka dengan bantuan Pasukan Bela-Diri Jepang, kata media elektronik itu. Pihak berwenang sejauh ini telah mengkonfirmasi sebanyak 7.500 orang diungsikan ke 25 tempat perlindungan setelah gempa Jumat,tapimerekabelumbisamenghubungi 10.000 orang lagi. Lebih dari1.700didugatewasatauhilang akibatgempadantsunami,demikian laporan kantor berita Kyodo. (ap/bbc/cnn/ant/afp/rtr/m10)

WASPADA Minggu 13 Maret 2011

Masyarakat Resah Upal Terus Beredar Di Tanjungbalai TANJUNGBALAI (Waspada): Peredaran uang palsu (upal) terus terjadi di Kota Tanjungbalai dan semakin meresahkan masyarakat sehingga aparat kepolisian diminta untuk menyelidiki asal upal tersebut. “Saya merasa sangat dirugikan akibat banyaknya uang palsu yang beredar di Kota Tanjungbalai,” ucap Herman Hasibuan, 40, warga Desa Seinangkan, Kec. Seikepayang, Kab. Asahan yang berbisnis jaul beli ikan di Kota Tanjungbalai, Sabtu (12/3). Dikatakan Herman, kurun waktu beberapa bulan terakhir, dirinya telah lima kali mendapati uang palsu dari konsumen yang tersebar di kota itu. Menurut Herman, nominal uang palsu yang pernah diterimanya antara pecahan Rp20 ribu sampai Rp50 ribu dan semua uang itu ketika mengutip dari pelanggannya. Dijelaskannya, upal baru diketahui saat Herman menyetorkan ke petugas bank dan ternyata dikembalikan karena tidak asli. Dikatakan Herman, ciri uang upal tersebut yakni, ukuran kertas yang tipis dan kusut, namun bisa dibelah menjadi dua bagi-

Waspada/Rasudin Sihotang

Uang palsu pecahan Rp50 ribu (disobek) kembali ditemukan di Kota Tanjungbalai, Sabtu (12/3). an, kemudian jika diterawang tidak ada bayangannya. Oleh karena itu, Herman berharap agar aparat kepolisian segera melacak peredaran uang palsudiTanjungbalaidanjikatidak warga lainnya akan menjadi korban. “Saya belum pernah melaporkan penemuan ini ka-rena kesibukan dan waktu yang tidak luang,” ujar Herman kesal seraya merobek uang palsu tersebut. Sementara, anggota DPRD

Kota Tanjungbalai Said Budi Syafril dikonfirmasi Waspada meminta kepada aparat Polres Tanjungbalai untuk mengambil tindakan terhadap peredaran uang palsu yang telah menimbulkan keresahan warga. Kepada masyarakat, politisi Partai Golkar itu mengimbau agar lebih berhati-hati dan memperhatikan keasliannya saat menerima uang ketika melakukan sebuah transaksi. (a32)

Guru Penganiaya Siswa SD Belum Ditahan �

Korban Trauma Pergi Ke Sekolah

MEDAN (Waspada): Bengkel Sembiring, 35, warga Bandar BaruKecSibolangitorangtuaangkat Zefanya, 11, siswa SD korban penganiayaan yang dilakukan guru olahraganya, Senin (12/2) lalu, Sabtu (12/3) kembali datang ke Polsek Delitua. Dia minta kepada kepolisian untuk segera menangkap pelakunya. Keterangan di Polsekta Delitua, Bengkel Sembiring mengadukan Favsco alias Anggara alias Gusgur warga Tanjung Selamat Kec Medan Tuntungan yang jugaanaktirinyaitudenganno-mor polisi STBL : 128/II/2011/SU/ RESTA MEDAN/SEK Delitua. Menurut Bengkel Sembiring, pihak kepolisian belum juga menangkap pelaku penganiayaan tersebut, karena semenjak dilaporkan (23/2) hingga saat ini pelaku belum juga ditangkap. Akibatnya, anak angkatnya itu takut masuk sekolah karena trauma disebabkan pelakunya belum juga diamankan.

“Kami ini orang bodoh, janganlah dibodoh-bodohi, sampai sekarang pelakunya belum tertangkap,anaksayatakutmasuk sekolah karena trauma bertemu denganguruolahraganya”ujarBengkel saat dimintai keterangannya di Mapolsek Delitua, Sabtu. Menurut Zefanya, peristiwa tersebut terjadi ketika dirinya tinggal bersama guru olahraganyadiTanjungSelamatjugaabang tiri korban yang merangkap kerja sebagai penjaga sekolah . Dia kemudian disuruh abang tirinya membeli beras sebanyak 1 kg dan diberi uang Rp25 ribu, karena lupa dan tidak tahu beras yang akan dibeli maka dia membeli beras sebanyak 2 kg dan memberikan uang tersebut semuanya kepada penjaga warung. Saat Zefanya pulang dengan membawa beras tersebut, tibatiba abangnya meminta uang kembalian kepada adiknya. Namun, karena uang sudah dibelanjakan semuanya dan tidak

tersisa, abangnya naik pitam dan memukuli adiknya itu pakai sapu hingga bagian kepalanya bocor serta memar di sekujur tubuh. Pelaku juga menyekap adiknya selama satu hari satu malam di dalam ruang kelas sekolah tersebut.Namun,saatpelakusedang mandi, adiknya mengambil kesempatan untuk melarikan diri dengan memanjat jendela gedungsekolah dankaburkerumah bapak angkatnya di Bandar Baru. Bengkel mengaku, sempat tidak percaya bahwa pelaku mengadukandirinyakePolsektapancurbatu dengan tuduhan penculikan anak. Saat diperiksa pihak kepolisian Pancurbatu, tuduhan terhadap bapak tirinya tersebut tidak benar karena korban mengaku tidak diculik melainkan melarikan diri dari kekejaman abangnya. KapolsekDelituaKompolSPSinulinggasaatdikonfirmasi mengatakan akan kembali memanggil pelaku dan kalau pelaku tidak mau menghadiri panggilan pihak kepolisian akan menjemputnya. (cba)

Wanita Muda ...

nya sangat kritis, terpaksa diarahkankeRSUDr.PirngadiMedan dan dalam perjalan korban menghembuskan nafas terakhir. Kapolsekta Medan Baru Kompol Saptono,SH,SIK melalui Kanit Reskrim Iptu Akta Wijaya Pramasaksi,SH kepada Waspada, Sabtu (12/3) malam mengatakan, pihaknya sudah membentuk tim untuk mengungkapkan kasus tersebut. Dalam kasus ini, polisi sudah menginterogasi satpam dan

pengemudi betor yang mengejar pelaku pembunuhan tersebut. Senin (14/3), pihaknya melakukan pemeriksaan terhadap satpam dan pengemudi betor yang gagal mengejar pelaku pengemudi betor tersebut. “Kita belum mengetahui alamat korban dan menurut keterangan dia dari Rantau-prapat datang ke Medan karena melihat neneknya yang sakit,” ujar mantan Kanit Reskrim Polsekta Medan Barat. (m36)

Presiden Jangan ...

beberapa rival politiknya dan melakukan pembelaan kepada orang-orang yang tersangkut kasus korupsi. SBY juga dituding menyalahgunakan kekuasaan. Hanya saja, Din yang juga Wakil Ketua Umum MUI Pusat itu mengaku, menyesalkan sikap pemerintah yang seolah berdiam diri dan tidak melanjutkan beberapa kasus-kasus korupsi kakap, salah satunya kasus Bank Century. Muat Klarifikasi SBY Dua media Australia, The Age dan Sidney Morning Herald, membuat Jakarta gerah dengan memuatbocorandokumenmilik Kedutaan Amerika Serikat di Indonesia tanpa konfirmasi pada Jumat (11/3). Hari Sabtu (12/3), kedua media pun memuat konfirmasi Presiden Susilo Bambang Yudhoyono atas tuduhan korupsi dan penyalahgunaan kekuasaan. Dilansir dari laman The Age edisi Sabtu (12/3), media ini memuat pernyataan sejumlah pembantupresidensepertiMenteriLuar Negeri RI Marty Natalegawa dan Staf Presiden Daniel Sparingga. “Presiden tidak senang dengan berita penuh kebohongan yang dimuat Sidney Morning Herald dan The Age,” kata Daniel Sparingga. “Isi berita penuh dengan sensansidanomongkosong.” SBY menilaikeduamediainitelahmelanggarkodeetikjurnalistikuniversaldenganmemuatbocoranWikiLeakstersebuttanpamemintakonfirmasi padanya. (ant/vivanews)

melakukan perkosaan terhadap penumpangnya. Karena ada perlawanan, pelaku langsung menerkam korban dengan cara menggigit paha sebelah kiri, melukai dada sebelah kiri, tangan kiri dan kepala korban juga luka bekas benturan benda keras. Dalam keadaan berlumuran darah, korban berhasil lompat dari betor dan minta bantuan satpam yang berada di showroom mobil. Kemudian, satpam menyarankan korban masuk ke dalam pagar dan karena sudah lemas, korban langsung terjatuh. Melihat korban minta bantuan kepada satpam, pelaku pengemudi betor sempat melakukan pengancaman. Mendengar ancaman, satpam di showroom mobil mencoba melakukan pengejaran tapi melihat korban jatuh pingsan, niat pengejaran terpaksa digagalkan, sementara pelaku pengemudi betor terus kabur. Seorang pengemudi betor yang melintas di lokasi melihat kejadian terus melakukan pengejaran dan dalam perjalan betornya mogok. Korban Adel kemudian dilarikan ke rumah sakit di Jalan Iskandarmuda. Karena kondisi-

Tsunami Sampai ... “Gelombang bahkan mencapai radius 200 meter dari bibir pantai. Beruntung masyarakat sudah mengungsi terlebih dahulu,” terangnya. Menurut dia, hantaman gelombang tsunami itu terjadi mulai sekitar pukul 23:00 WIT sampai 24:00WIT, ketika peringatan bahaya tsunami dari BMKG sudah dicabut. Sebelumnya diberitakan, gelombang tsunami di Holtekamp juga menewaskan seorangwargabernamaDarwanto Odang ,35, yang sehari-harinya bekerjasebagaipengusahatambak. Dia dilaporkan terseret ge-

pembantu atau juru bicaranya. “Kasus kecil saja biasanya SBY sendiri yang berbicara di hadapan rakyat, masak kasus seperti ini tidak berani angkat bicara,” tutur Din. Bahkan, Din menegaskan, bila perlu media Australia yang memberitakan kasus tersebut dituntut secara hukum. Namun, kata dia, hal itu tidak mudah, sebab membutuhkan perdebatan argumen dan beradu fakta yang sangat panjang. Sebagai rakyat Indonesia, Din sangat menyayangkan pemuatanberitatersebut.Iamengakui, banyak berita miring yang dibuat, di antaranya pada 2009 lalu, SBY selalu memata-matai lombang tsunami saat sedang mengevakuasi keluarganya dan mengecek pergerakan tsunami, namun naas saat datang gelombang dia terjatuh dari motornya dan terseret sejauh 50 meter sebelum ditemukan. Sekretaris Badan Nasional Penanggulangan Bencana kota Jayapura,YohanisWemben yang ditemui ketika sedang meninjau lokasibencanadiHoltekampmengatakan, korban baru ditemukan sekitar pukul 14.30 WIT. “Korban ditemukan sekitar 50 meter dari lokasi awal dia terseret ombak, sedang terhim-pit sampah-sampah dan kayu yang ikut terseret tsunami,” jelasnya.

Gempa Bumi Dan Tsunami ... April 2007: Sekurang-kurangnya 28 orang tewas di Solomon Islands ketika terjadi tsunami yang ditimbulkan gempa bumi 8,1 SR. Juli 2006: Gempa bumi 6,1 SR memicu tsunami di selatan lepas pantai pulau Jawa, yang menewaskan sekurang-kurangnya 600 orang. Maret 2005: Gempa bumi 8,6 SR di utara Sumatera menewaskan sekitar 1.300 orang. Desember 2004: Tsunami di Samudra India, yang dipicu oleh gempa bumi 9,0 SR, yang menewaskan 230.000 di lebih 12 negara, terutama di Aceh. Agustus 1976: Guncangan gempa berkekuatan 8,0 SR terjadi dekat pulau Mindanao dan Sulu di Filipina, yang memicu tsunami dan menyebabkan sekurang-kurangnya 5.000 orang tewas. Maret 1964: Gempa bumi 9,2 SR di Prince William Sound, Alaska, AS, menewaskan 131 orang, termasuk 128 dari satu tsunami. Mei 1960: Gempa bumi 9,5 SR di selatan Chile yang diiringi tsunami yang menewaskan sekurang-kurangnya 1.716 orang. November 1952: Satu gempa bumi 9,0 SR di Kamchatka, Rusia, menyebabkan kerusakan, namun tak ada laporan kematian meski menyebabkan gelombang 9,1 meter di Hawaii. Agustus 1950: Assam, India, dan Tibet dilan-

da gempa bumi 8,6 SR yang menewaskan sekurang-kurangnya 780 orang. April 1946: Gempa bumi 8,1 SR dekat Pulau Unimak, Alaska, memicu tsunami, yang menewaskan 165 orang, sebagian besar di Hawaii. Januari 1906: Guncangan gempa bumi berkekuatan 8,8 SR di lepas pantai Ekuador dan Kolombia menimbulkan tsunami yang menewaskan sekurang-kurangnya 500 orang. Agustus 1868: Gempa berkekuatan 9,0 SR di Arica, Peru (sekarang Chile) menimbulkan bencana tsunami, lebih dari 25.000 orang tewas di Amerika Selatan. April 1868: Gempa bumi 7,9 SR mengguncang Big Island, Hawaii, yang menewaskan 77 orang, termasuk 46 di antaranya akibat tsunami. November 1755: Satu gempa bumi 8,7 SR dan menimbulkan tsunami di Lisabon, Portugal, yang menewaskan kira-kira 60.000 orang dan merusak banyak bagian Lisabon. Juli 1730: Dengan kekuatan 8,7 SR, satu gempa bumi menewaskan sekurang-kurangnya 3.000 orang di Valparasio, Chile. Januari 1700: Gempa bumi 9,0 SR mengguncang kawasan yang sekarang ini adalah California Utara, Oregon,Washington dan British Colombia, AS, yang memicu tsunami dan menghancurkan desa-desa di Jepang. (dari berbagai sumber/m10)

Sumut - Aceh

WASPADA Minggu 13 Maret 2011

Perlengkapan Makan Buatan Belanda Ditemukan Di Sungai Silau


Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini dan Artikel: Dedi Sahputra. Redaktur Edisi Minggu & Akhir Pekan: Hendra DS. Redaktur Berita: H. Akmal AZ, H. Halim Hasan. Redaktur Kota Medan: Muhammad Thariq. Redaktur Sumatera Utara: M. Zeini Zen. Redaktur Aceh: Rizaldi Anwar. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: Edward Thahir. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Armin R. Nasution. Redaktur Agama: H. Syarifuddin Elhayat. Kalitbang: Hj. Emma Sujianti Tarigan. Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumut), Aji Wahyudi (Aceh). Asisten Redaktur: David Swayana (Kota Medan, Infotainmen); Irwandi Harahap (Kota Medan); Feirizal Purba, Diurna Wantana (Sumatera Utara); H.T. Donny Paridi (Aceh); Armansyah Thahir (Aceh, Otomotif); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); Hj. Ayu Kesumaningtyas (Kesehatan). Wartawan Kota Medan: Umum: Zulkifli Harahap, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, David Swayana, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Hasanul Hidayat, Rustam Effendi, Mursal Alfa Iswara. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Dedek Juliadi, Hajrul Azhari, Syahrial Siregar, Khairil Umri Batubara. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian W, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebing Tinggi: Muhammad Idris, Abdul Khalik. Pematang Siantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Pakpak Bharat: Arlius Tumanggor. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Asahan: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun. Kuala Simpang: Muhammad Hanafiah. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, Agusni AH, H. Samsuar. Lhoksukon: Musyawir. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin. Takengon: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapak Tuan: Zamzamy Surya. Blang Pidie: Sudarmansyah Putra. Kutacane: Ali Amran. Blangkejeren: Bustanuddin, Wintoni. Bener Meriah: Irham Hakim. Singkil: Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan Waspada dilengkapi dengan kartu pers. Tidak dibenarkan menerima uang dalam bentuk apapun. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan: hitam-putih Rp. 33.000,-, berwarna Rp. 90.000,Ukuran kolom: 40,5 mm. E-mail Iklan: Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

PWI Aceh Buka Posko Peduli Bencana Tangse BANDA ACEH (Waspada): Sebagai bentuk wujud kepedulian wartawan kepada korban banjir bandang yang melanda masyarakat kawasanTangse, Pidie, PersatuanWartawan Indonesia (PWI) Cabang Aceh membuka Posko Peduli Bencana Tangse. Posko peduli bencana banjir bandang Tangse ini, bermarkas di gedung Sekretariat PWI Aceh, Jl. T. Angkasah No. 3 Simpang Lima, Kuta Alam, Banda Aceh. Posko ini dibuka hingga 18 Maret 2011. Direncanakan 20 Maret 2011 bantuan disalurkan. “Posko ini bagian kepedulian organisasi kewartawanan sesama masyarakat Aceh yang terkena musibah. Wartawan tidak hanya bisa meliput bencana tapi bisa juga melakukan aksi kemanusiaan meringankan beban korban,” ujar Tarmilin Usman. Untuk itu, Ketua PWI Cabang Aceh dalam pernyataannya, Sabtu (12/3) di Banda Aceh, mengajak semua pihak untuk menyalurkan bantuannyadalambentukapapun.“Bantuanituakandiantarlangsung oleh PWI ke lokasi bencana,” sebutnya. Wakil Ketua Bidang Kesejahteraan dan Sosial PW Aceh, H T Anwar Ibrahim, selaku penanggungjawab Posko Peduli, HT Anwar Ibrahim menambahkan Posko Peduli Bencana Tangse PWI Aceh akan menampung berbagai bantuan dari siapapun. “Posko ini akan menampung bantuan dalam bentuk apapun dan dari siapun yang menyumbangkannya. Kami mengimbau semua lapisanmasyarakatdandermawanyanginginmemberikansumbangan bisa mengantar langsung ke Posko PWI,” pintanya. Posko PWI juga, ujar H.T Anwar, siap menjemput segala bantuan dari dermawan dan masyarakat di Banda Aceh, yang ingin menyumbang berbagai bantuan untuk korban bencana banjir bandang yang melanda kawasan Tangse, Pidie, Kamis (10/3) lalu. “Sampai saat ini, jumlah bantuan dari kalangan keluarga besar PWI dan IKWI Aceh telah terkumpul sekitar Rp.300 ribu,” ungkap Anwar yang menginformasikan penerimaan bantuan akan ditutup pada tanggal 18 Maret 2011. (b04)



KOIN NEDERLANDSCHtahun 1897 ditemukan di Sungai Asahan oleh warga, namun sebagian koin itu dijual dengan pembeli barang bekas dengan harga Rp15 ribu perkilogram. Foto direkam, Jumat (11/3).

Kijang Innova Tubruk Dump Truk, 1 Tewas, 5 Luka-luka RANTAUPRAPAT (Waspada): Mobil Kijang Innova BM1052 PP bertubrukan dengan dump truk BK 8381 BO di Jalinsum Desa Perbaungan, Kec. Bilah Hulu, Jumat (11/3) pukul 00:30. Akibatnya, satu orang tewas dan 5 luka-luka.

Korban tewas, Zuraidah, 43, warga Dusun Bakti, Desa Batara Makmur, Kec. Bagan Sinembah, Kab. Rokan Hilir, Riau. Sedangkan korban luka-luka yakni, Saminawati, 40 dan Nurhalizah, 8, keduanya warga yang sama, Hj Jahwiah, 70, warga Desa Rantau Pan-

jang, Kec. Kubu, Zainal Abidin, 52, warga Dusun Bakti, RT 03/ RW 02, Kec. Bagan Sinembah dan Muhammad Lufti, 50, warga kompleks PT Kura Bagan Batu, (kelimanya warga Kabupaten Rokan Hilir, Riau). Keterangan yang dihimpun dari Polres Labuhanbatu, semula mobil Kijang Innova yang dikemudikan Zainal Abidin datang dari arah Riau menuju Medan hendakmenyambangifamiliyang sedang melaksanakan hajatan pesta, melaju dengan kecepatan tinggi dalam keadaan hujan gerimis. Sementara dump truk yang dikemudikan Sukino ini, melaju dari arah berlawanan. Saat mobil Kijang Innova yang berpenumpang 8 orang itu di Jalinsum Desa Perbaungan,

persis di KM 310-311 (MedanKotapinang), di mana kondisi jalan tikungan ke kiri (arah ke Medan) serta turunan dengan kondisi hujan mengakibatkan jalan licin, secara tiba-tiba datang dump truk dari arah yang berlawanan, sehingga mobil Innova mengambil jalan terlalu ke arah kanan jalan yang melewati garis pembatas jalan yang mengakibatkan terjadi“laga kambing”. KapolresL.BatuAKBPRobert Kennedy,SIK.SH.MHummelalui Kasat Lantas AKP Triyadi dan KanitLakaIptuGMSiagianmembenarkan. “Korban yang tewas itu memang sempat dibawa ke RSU Rantaprapat namun di perjalanan langsung menghembuskan nafas terakhirnya”, kata Iptu GM Siagian. (a18)

Aceh Selatan Butuh RSJ

Jumlah Penderita Gangguan Jiwa Capai 1.253 Orang TAPAKTUAN (Waspada): Bupati Aceh Selatan HusinYusuf mengaku sangat prihatin, terhadap jumlah korban penderita gangguan jiwa di daerahnya belakangan ini cendrung meningkat tajam,pascakonplikdanbencana alam gempa bumi dan tsunami. “Bayangkan, dalam tahun 2010 saja, jumlah korban penderita gangguan jiwa mencapai 1.253 orang,”kata Bupati Husin Yusuf kepada wartawan seusai membuka Musyawarah Perencanaan Pembangunan (Musrembang) 2012, di Tapaktuan, Rabu lalu. Jumlah tersebut kata bupati belum termasuk yang berpotensi terkena gangguan jiwa, hampir seluruh warga Aceh Selatan yaitu sebanyak 190.512 orang. Kondisi ini diperburuk lagi dalam rangka menghadapi Pemilukada maupunpemilulegislatifdimasamendatang, sehingga bakal menambah jumlah orang-orang“stress”. Untuk mengantisipasi dan

memperbaiki kondisi ini, pihaknya telah meminta kepada pihak provinsi, dalam hal ini Kepala Rumah Sakit Jiwa (RSJ) Banda Aceh yang ikut hadir dalam acara pembukaan Musrenbang tadi, membangun sebuah RSJ di daera ini. Menurut dia, indikasi gangguan jiwa bisa terjadi akibat berbagai sebab. Bisa karena bencana atau musibah, problema rumah tangga maupun faktor lainnya, seperti gagal meraih kemauan dan cita-cita. “Yang pasti, apa pun sumber dan penyebabnya, gejala gangguanjiwainiharussegeradiakhiri, melalui terapi pembangunan sebuah unit RSJ yang representarif,”tambahnya seraya menyebutkan ia mengaku terkejut menerima laporan dinas terkait menyangkut jumlah penderita gangguan jiwa tersebut. Sebelumnya ketika membukaMusrembang,bupatisecara detil menguraikan berbagai ke-

majuan sejumalah sekotor pembangunandalambeberapatahun terakhir seperti sektor pendidikan, ekonomi dan pemberdayaan perempuan. Dalam sektor misalnya diarahkan menjadi manusia berotak Jerman dan berhati Mekkah serta menjunjng tinggi nilai luhur ke-Acehan dan berwawasan kebangsaan. Perkembangan dunia pendidikan katanya dilihat dari indicator pendukung seperti angka melek huruf (AMH) dari 97,02 persen tahun 2008 menjadi 97,86persentahun2010.Sehingga tingkat jumlah warga buta aksara menurun dari 2,92 persen menjadi 2,14 persen. Demikianpulalajupertumbuhan ekonomi (LPE) meningkat dari 3,63 persen tahun 2008 menjadi4,20persentahun2010,meski masih di bawah LPE nasional sebesar 6,5 persen. Sedangkan pendapatanperkapitameningkat dari Rp 9.433.255,- (2008) menjadi Rp 11.692.016,- tahun 2010. (b19)

Maulid Di SD Harapan 3 Kampus Johor

Siswa Harus Teladani Sifat-sifat Rasulullah DELITUA (Waspada): Sebanyak 1.000-an siswa SD Harapan 3Yaspendhar Kampus Johor mengikuti peringatan Mauild Nabi Muhammad SAW 1432 H di sekolahnya, belum lama ini. Acara yang dikemas secara sederhana ini dihadiri Kepala SD Harapan 3 Drs. Anwar, Kepala SMP Surya Hadi Marwan, SPd, Kepala SMA Abdul Djalil, SPd, MS dan Al Ustadz Asmuni beserta seluruh guru dan siswa. Dalam tausyiahnya Al Ustadz Asmuni menjelaskan melalui peringatan Nabi Muhammad SAW ini kiranya siswa dapat mengaplikasikan sifat-sifat yang contohkan Rasulullah, seperti berbuat shiddik. Kita harapkan siswa dapat bicara benar dan berkata betul di lingkungan sekolah, keluarga dan masyarakat, karena akhlaknya sangat baik. Fathonah sifat rasul yang kedua, akalnya panjang sangat cerdas sebagai pemimpin selalu berwibawa menyelesaikan masalah dengan tangkas. Kemudian tabligh sifat rasul yang ketiga, cara dan metodenya agar ditiru sasaran pertama adalah keluarga, lalu berdakwah ke segenap penjuru.Yang keempat bersifat amanah menyampaikan semua perintah Tuhan.


SISWA SD Harapan 3 saat mengikuti peringatan maulid Nabi Muhammad SAW di sekolahnya, belum lama ini. Kepala SD Harapan 3 Drs. Anwar ketika ditemui mengharapkankepadasiswadapatmeneladani sifat-sifat Rasulullah. Mengetahui sifat-sifat ini diharapkansiswa menyadari siapa sebenarnyaRasuldankemudiandapat mengikutinya. Di jelaskan Anwar, sebagai sekolah nasional yang berwawasan keagamaan, SD Harapan 3 selalu memberikan ruang lebih

siswa untuk mengikuti berbagai kegiatan keagamaan di sekolah, seperti praktek shalat, mengaji, hafiz Juz’Amma, surat yasin dan manasik haji. “Hal ini kita lakukan untuk memberikan pemahaman sejak dini kepada peserta didik, agar kelak ketika mereka melanjutkan pendidikan dapat menjadi penopang dalam kehidupannya,” katanya.(m43)

KISARAN (Waspada): Perlengkapan alat – alat pecah belah seperti piring makan merk Nederlandsch (Belanda) ditemukan dari dasar Sungai Silau Kisaran, dan banyak barang antik lainnya, namun sebagian besar dijual kepada pembeli barang bekas keliling. Peralatan itu ditemukan Sarudin, 63, bersama putranya, Idris, 28, dan tetangganya Irwansyah Pait, warga Lingkungan IV, Kelurahan Tegalsari, Kisaran beberapa waktu lalu di Sungai Silau, saat mereka sedang mandi. Benda-benda itu terdiri dari piring, mangkuk, sendok yang terbuat dari batu, di belakangnya bertuliskan Nederlandsch beserta logo singa warna biru, kemudian periuk dengan bentuk memanjang seperti tabung, serta lesung batu dan beberapa koin yang bertuliskan Nederlandsch Indie tahun 1897 bernilai satu sen. “Kamimenemukannyaterkuburdalamtanah didasarSungaiSilaudanmenurutperkiraanmasih banyak lagi yang terkubur,” ungkap Indris, Jumat (10/3) Menurutnya, sebagian besar barang-barang yang ditemukan warga terbuat dari logam, seperti koin, pedang, parang, atau batangan besi,namun dijual dengan pedagang barang bekas keliling dengan harga Rp15 ribu per kilogram. ‘’ Jika ditemukan berbentuk guci, piring, cang-

kir yang terbuat dari batu, malah dibuang atau dipecahkan, disebabkan kami tidak mengerti barang itu dari mana,’’ kata Idris. “Rekan saya pernah menemukan tongkat besi, dan keris berukirannaga.Dansekarangbelumdiketahuiapakah masih ada atau sudah dijual,” imbuh Idris. Idris tidak berniat untuk menjual barangbarang itu.Ia menyimpannya karena yakin barang itu sangat berharga dan langka. Idris berharap Pemkab Asahan segera memperhatikan masalah ini, agar benda-benda yang terkubur di dasar sungai dapat digali dan diselamatkan. “Dengan adanya benda-benda itu, kita bisa pelajari sejarah peradaban Asahan dan berapa bangsa yang pernah memijakkan kaki di tanah ini,” kata Idris. Sebelumnya, menurut Sejarawan Asahan Zasnis Sulungs, pinggiran Sungai Silau, tepatnya di Desa Tanjung Alam, Kecamatan Seidadap, Kabupaten Asahan, terdapat Pelabuhan Kerajaan Kesultanan Asahan Ke-5, Dewasyah (1800-an) dan warga asing selalu singgah, karena sungai merupakan jalur transportasi di masa itu. Jadi ada kaitannya benda-benda berharga yang ditemukan di Sungai Silau dengan sejarah Asahan dan itu harus digali untuk penyelamatan aset sejarah Asahan. (a15)

Satu Rumah Hangus Dilalap Si Jago Merah Di T. Balai TANJUNGBALAI (Waspada) : Satu unit rumah semi permanen milik Yusuf BatubaradigangsempitLingk V, Kel. Matahalasan, Kec.TanjungbalaiUtara,KotaTanjungbalai, hangus dilalap si jago merah, Sabtu (12/3) sekira pukul 10.00. Informasi dihimpun Waspada, api diduga berasal daritungkumemasakairyang ditinggalkan pemiliknya belum sepenuhnya padam dan masih menyisakan bara. Diperkirakan sebuah kayu bakar yang diletakkan berdiri di samping perapian mengenai bara dan sedikit demi Waspada/Rasudin Sihotang sedikit kayu tersebut menjalar DUA warga menyiramkan air ke bara api yang masih menyala ke atas dan menyambar kain di sebuah kasur menggunakan sebuah ember pada kebakaran yang sedang dijemur. rumah di Lingk.V, Kel. Matahalasan, Kec. Tanjungbalai Utara, “Pertama kulihat asap Kota Tanjungbalai, Sabtu (12/3) sekira pukul 10:00. mengepuldidapur,lalukarena penghuni rumah tidak ada, kudobrak saja pintu- bangunan telah steril dari api. Akibat kejadian, nya dan api sudah membesar dari tungku masak,” diperkirakan kerugian mencapai Rp15 juta rupiah ujar Lian Pulungan, 55, seraya menunjukkan karena uang hantaran pinangan dan seluruh peralatan pernikahan yang akan dilangsungkan kakinya yang terluka saat menendang pintu. Dikatakannya, api dengan cepat melalap 23 Maret mendatang habis terbakar. Kapolres Tanjungbalai AKBP Puja Laksana seluruh isi rumah karena pada umumnya banyak pakaian sedang digantung ditambah lagi kayu melalui Kasubbag Humas AKP Y Sinulingga didampingi Kapolsek Tanjungbalai Utara AKP bangunan yang telah lapuk. Berkat bantuan sejumlah warga akhirnya S Nainggolan membenarkan. Dikatakan, hingga apiberhasildipadamkanNamunmobilpemadam kini penyebab kebakaran masih dalam penyebaru tiba di lokasi sekitar 20 menit tetap menyi- lidikandenganmemintaketerangandaribeberapa ramkan air untuk memastikan agar seluruh saksi. (a32)

Nota Kesepahaman Pasar Dwikora Tidak Berubah P. SIANTAR (Waspada): Pemko Pematangsiantar melalui Kepala Bappeda Herowhin TF Sinaga, AP. MSi menyatakan tidak mengambil alih pembangunan kios di Pasar Dwikora sesudah kebakaran, Minggu (27/2) malam. “Pemko Pematangsiantar tidak pernah menyatakan akan meninjau ulang nota kesepahaman dengan pedagang Pasar Dwikora, sebab nota kesepahaman sampai saat ini tidak berubah,” tegas Kepala Bappeda seperti dikutip Kabag Humas dan Protokoler Pemko Drs Daniel H Siregar, Jumat (11/3). Karena itu, sebut Herowhin, Pemko masih mempedomani nota kesepahaman yang dibuat Walikota Hulman Sitorus, SE dengan perwakilan pedagang, Senin (28/2) yang isinya menyebutkan pedagang Pasar Dwikora yang menjadi korban kebakaran diberikan izin membangun kiosnya masing-masing secara swadaya dengan bentuk seragam dengan bahan dari batu dan atap seng. Kemudian, Pemko tidak akan melakukan pembangunan kios baru Pasar Dwikora selama periode masa jabatan Walikota Hulman Sitorus danWakilWalikota Drs. Koni Ismail Siregar serta partisipasi Pemko akan diserahkan di kemudian hari dan teknis pelaksanaannya dibicarakan lebih lanjut. Menurut Herowhin, perencanaan yang di-

buat Bappeda untuk Pasar Dwikora sudah dilakukan sejak tahun 2006, dimana pasar itu akan menjadi pasar tradisional modern, namun akibat keterbatasan anggaran, pembangunan tidak dilaksanakan sampai saat ini. “Karena itu, pasca kebakaran Pasar Dwikora itu,Pemkohanyadapatmembantuparapedagang melalui pembuatan nota kesepahaman yang sudah ada dan Pemko berupaya mencari dana untuk membantu kesusahan dan kesulitan para pedagang,” ujar Herowhin. Mengenai rapat yang dilaksanakan, Rabu (9/ 3) antara DPRD dengan Pemko, Herowhin menyebutkan belum menghasilkan kesimpulan hingga nota kesepahaman pihak Pemko dengan pedagang tetap berlaku dan dilaksanakan, sebab Walikota berharap yang intinya para pedagang harusbisasecepatmungkinmelakukanaktifitasnya untuk berjualan kembali seperti semula. “Pemko dalam penanganan Pasar Dwikora pascakebakaran tetapmemperhatikandanmempertimbangkan aspirasi para pedagang.” DanielHSiregarmenambahkandanabantuan Pemko Rp 2 miliar untuk membantu para pedagang Pasar Dwikora itu akan diserahkan, namun peruntukannya masih dalam pembicaraan dan dana bantuan itu bersumber dari anggaran tidak terduga.(a30)

APBK Aceh Timur Tahun 2011 Berselemak Dosa LANGSA (Waspada) : Anggaran Pendapatan dan Belanja Kabupaten (APBK) Aceh Tim ur tahun 2011 yang segera di sahkan oleh kalangan Dewan, dilaporkan berselemak dosa. Pasalnya ada item anggaran bantuan yang diperuntukkan bagi yayasan pengajian atau Dayah, dengan jumlah angka yang sangat fantastis dan tidak realistis. “Bukankitatidakmendukung yayasanpengajian atau pelaksanaan Syariat Islam di Aceh. Hanya saja anggaran yang digunakan untuk itu harus terukur dong. Janganlah Syariat Islam juga dikomersilkan dan ini berselemak dosa,” demikian diungkapkan anggota DPRK Aceh Timur dari Partai Golkar Muslim A Gani kepada Waspada, Jumat (11/3). Dikatakannya, pada tahun anggaran 2010 lalu, APBK Aceh Timur telah mengalokasikan bantuan sebesar Rp 5 milyar kepada Yayasan Dayah Al-Madinatul Munawarrah Al-Waaliyah ( Amal), dengan rincian Rp 3,7 milyar untuk biaya pengajian dan Rp 1,3 milyar untuk pembangunan Dayah. Sementara Dayah tersebut milikYayasan yang dikelola oleh sekelompok orang dan tidak terlibat Pemkab Aceh Timur didalamnya. Bahkan dana sebesar Rp 5 milyar yang dialokasikan pada tahun anggaran 201o itu, hingga kini belum ada pertanggungjawabannya, kata Muslim A Gani. Dikatakannya, pada tahun anggaran 2011 yang akan segera disahkan ini, Pemkab Aceh Timur juga telah mengalokasikan bantuan dana tambahan sebesar Rp 5 milyar lagi untuk kepentingan yang sama dan kepada yayasan yang sama.

“Kita heran, kok untuk pengajian bisa sampai dianggarkan bantuan mencapai Rp 10 milyar, apalagi untuk yayasan yang sama. Bukannya kita tidak mendukung pengajian, tapi bantuan yang diberikan tidak realistis dan mencurigakan,” kata Muslim A Gani. Karena itu Muslim A Gani meminta pihak berwenang termasuk aparat hukum untuk dapat menyelidiki penggunaan anggaran yang telah diberikankepadaYayasanAmalyangnotabenenya tidak ada hubungannya dengan Pemkab Aceh Timur baik secara fungsional maupun secara struktural itu. “Kita mensinyalir ada upaya untuk mengkomersilkan Syariat Islam di Aceh Timur dalam bentuk bantuan anggaran yang nilainya tak terukur kepada Yayasan tertentu. Kalau ini benar, maka APBK Aceh Timur tahun 2011 telah berselemak dengan dosa,” demikian Muslim A Gani. SementarahalyangsamajugadikatakanKetua Fraksi Demokrat DPRK Aceh Timur T Zakaria. Menurutnya, seharusnya alokasi dana sebesar Rp5miliaryangdiberikanpadatahun2010kepada yayasan Amal harus dipertanggungjawabkan terlebih dahulu penggunaannya. Tapi anehnya, hal itu belum dilakukan dan malah pada tahun anggaran 2011 justeru dianggarkan kembali dana tambahan Rp 5 milyar lagi. “ Ini patut kita curigai ada apa dibalik semua ini. Belum pernah ada dalam sejarah anggaran daerah yang dananya terkesan dipaksakan mengucur dengan jumlah yang besar kepada satu Yayasan tertentu,” kata T Zakaria.(ts)


A4 Banyolan

Istriku Dan Pacar Gelapku Bapak Ucok: “Ya Ucok yang bayarin…” Pelayan : “Pak jangan bertengkar… di sini” Bapak Ucok: “Oke, kami mau cincang!” (makanan khas Batak) Pelayan : “Apa itu Cincang??” Ucok : “Makanan khas kami.” Pelayan : “Oh maaf Pak, Cincang tidak ada, yang ada Cacing.”

Memeriksakan Komplikasi Penyakit ke Dokter Hewan

Seorang Bapak - Bapak Batak naek Metromini dari Kramat Sentiong menuju Manggarai, tidak mendapat tempat duduk, bapak tersebut bergelantungan bersama penumpang lain di dekat pintu depan. Didepan RSU Cikini, si Kondektur mulai sibuk menagih ongkos dari para penumpang sambil menkrincing-krincingkan uang logam yang ada ditangan nya. Kondektur : Ongkos Pak Bapak Batak : nih !!! Sambil meyodorkan uang Rp. 1.500. Kondektur : Kurang Pak, Rp. 500 lagi. Bapak Batak : Ah diam kau !!! Setengah jalan nya aku naek, Anjing !!! Kondektur : Wah, Bapak ini gimana sih, udah bayar ongkos kurang malah maki orang lagi ngomongin orang anjing segala ! Bapak Batak : BAH !!! Masih bagus kau kubilang Anjing, Kubilang Taik, dimakan Anjing Kau !!!

Tidak Boleh Terburu-Buru Hilman bersama temannya Harry sedang makan di sebuah Restauran. Tiba-tiba Hilman merasa sakit perut setelah makan steak Kelinci : “Pelayan, tolong tunjukan kamar kecilnya!” teriak Hilman. Setelah di beritahu, Hilman segera masuk selama beberapa saat. Beberapa menit kemudian, dia kembali ke meja semula. Tetapi pelayan Restauran menegurnya dengan sopan : “Maaf, Tuan. Seharusnya Tuan jangan terburu-buru keluar dari kamar kecil itu…” “Lho, memangnya kenapa? Kok kamu melarang saya!” jawab Hilman. “Anu…, maaf Tuan. Tuan tidak bercelana. Celana Tuan tertinggal di kamar kecil. “

Batu Baterai Dan Banci Sepulang dari supermarket seorang anak bertanya pada ibunya: Anak : “Bu, Ibu tau nggak, apa bedanya batu baterai dan Banci?” Ibu : “Hus, sudah jelas beda dong.” Anak : “Iya… di mana bedanya?” Ibu (Setelah mencoba berfikir namun gagal) akhirnya berkata : “Nggak tau ah!” Anak (sambil tersenyum-senyum) : “Kalau batu baterai tahan lama sedangkan kalau banci ‘mana tahan la yauow’…”

Kami Mau Cincang Suatu malam Ucok dan Bapak nya makan di restoran. Mereka berdua ribut untuk memesan makanannya. Pelayan : “Mau pesan apa pak.” Bapak Ucok: “Kau pesan apa Gi?” Ucok : “Kok bapak Tanya aku…” Bapak Ucok: “Kan kau yang ajak Cok!” Ucok : “Jadi kalau aku yang ajak…kenapa?”

Bayar Ongkos Mikrolet Kurang!

Pada suatu hari libur anak-anak pak Sabam mau mengunjungi keluarganya di Medan, perencanaan mereka berangkat bersama keluarga dengan mengendarai mobil Pribadi dari Jawa ke Medan. Tanya punya tanya (kebetulan mereka belum pernah ke Medan sebelumnya) alternatif perjalanan menembus rute Jakarta - Lampung - Pekanbaru - P.siantar - Saribu dolok - Kabanjahe - Medan (katanya sekaligus refreshing). Mereka pun memulai perjalanan dan beberapa hari mereka tiba di Saribu dolok Kab. Simalungun. Keluarga pak Sabam sejenak istirahat dan makan siang untuk mengisi perut yang sudah mulai keroncongan. Setelah mereka kenyang mereka pun melanjutkan perjalanan sambil melihat-lihat kiri kanan nama kota yang dilalui, kira-kira 2,5 jam mereka terperanjat melihat kota yang dilalui yaitu desa tiga dolok. Tersentak kaget Pak Sabam langsung memberi Perintah kepada Driver untuk kembali ke Jawa : Pak Sabam : “Mas Selamet kita pulang aja“ Selamet : “ … (heran) kenapa pak? kan belum ke Medan ?” Pak Sabam : “ 2.5 jam yang lalu kita berangkat dari tempat kita makan yaitu saribu dolok, sudah 2.5 jam kita baru melewati tiga dolok, berarti 1 dolok kita menempuh dengan lebih kurang 50 menit, kalau seribu dolok berapa ????” Selamet : “…(1000 x 50 = 50.000 menit / 60 menit =……. jam?) ##&%$@%” Pak Sabam : “ Sudah pulang saja nanti keburu masa liburan habis “ Selamet : “ oke Pak siap dilaksanakan!!”


6 8

7 5 8 4 1 0 2 3 7 3 0 4 2 1 2 B 7 3 B 9 4 A 6 3 A

Ada seorang pelaut asal Ambon bernama Bram Hehanusa. Ketika dia ada di tengah laut sepertinya cuaca tak bersahabat, karena sepertinya akan datang badai di tengah laut saat itu. Hehanusa berdiri di tiang layar tertinggi sambil berteriak keras ke atas langit sbb: Hehanusa : “Tuhan…, Beta (aku) akan persembahkan kambing asal Ose (KAU) jangan marah dengan menurunkan badai”. Angin agak mereda saat itu, ia lalu turun ke tangga sedikit sambil bergumam: “Ah Beta cuma mau kasih Ose ayam saja, karena beli kambing sungguh Beta tidak mampu”. Angin makin mereda dan badai tidak jadi datang, Si Hehanusa turun dari tiang kapalnya. Dan ia turun sambil bergumam sbb: Hehanusa: “Kena tipu Kau...Tuhan, Beta tak akan kasih kambing atau ayam sama Ose. Rasain ku tipu, emang enak ketipu nii yee….” Sambil tersenyum puas sekali setelah berhasil m e n i p u Tu h a n p i k i r n y a , d i a p u n l a l u mendaratkan perahu ke daratan untuk pulang

kerumahnya. Sewaktu hampir sampai di rumah, dia melihat orang sedang ramai ramai memadamkan api yang sedang membakar rumahnya. Dia jadi bingung dan dengan gemas berteriak ke langit sbb : “TUHAN…, urusan dilaut jangan dibawa bawa kedaratan dong. OSE jadi sungguh sungguh, padahal BETA cuma main main”.

Dolok Saribu Dari Saribu Dolok Setelah menginjakkan kaki di kota Jakarta, Duga bermaksud mendapatkan teman sebanyak-banyaknya. Maklum Duga belum fasih berbahasa Indonesia. Menurutnya semua perkataan dalam bahasa Batak harus diterjemahkan ke bahasa Indonesia termasuk identitas diri. Sambil bersalaman lalu dia memperkenalkan diri dan berkata: “Gunung Seribu dari Seribu Gunung”. Sejak itu para sahabatnya pada takut dan segan, mereka menganggap Dolok Seribu bersaudara dengan gunung Kidul.


2 9

3 1

3 4

2 8 4 B 0 6 1 2 1 3 B 7 8 0 A 5 1 8 2 B 9

5 9

7 9 0 5 A 3

Alamat: ................................................ No. KTP/SIM/Kartu Pelajar: ..............................

gunting di sini TTS Berhadiah Jawab dan gunting TTS Berhadiah di atas kemudian kirimkan ke PT Harian Waspada Jalan Brigjen Katamso No.1 Medan/Jalan Letjend Suprapto No.1 Medan. Tulis nama dan alamat lengkap serta nomor pengenal. Jawaban paling lambat diterima Jumat 18 Maret 2011, pukul 16:00. Bagi pengirim yang dapat menjawab semua pertanyaan dengan tepat dan benar akan diberi hadiah berupa uang tunai sebesar Rp50.000,-untuk satu orang pemenang. Semua jawaban yang benar akan diundi. Pengumuman pemenang akan diumumkan pada Minggu 20 Maret 2011 beserta jawaban yang benar di halaman yang sama. Hadiah dapat diambil di kantor Harian Waspada bagian Sekretaris Redaksi (jam kerja), setelah tiga hari pengumuman pemenang diterbitkan. MENDATAR 1. Bon-bon, gula-gula 4. Tumbuhan berdiri yang biasa hidup di tempat yang kering/tandus 8. Salah satu negara penghasil minyak terbesar di dunia 9. Ikatan pada tali atau benang 12. Perebutan kekuasaan (pemerintahan) secara paksa 15. Debu sisa pembakaran 17. Bertindih-tindih 20. Jumlah barang cetakan yang diedarkan 22. Bagian badan yang tidak boleh kelihatan (menurut hukum Islam) 23. Raden Ajeng 24. Satu, tunggal 25. Rambut putih 27. Angkatan Darat 28. Nusa Tenggara Timur 30. Liga Primer Indonesia 31. Perubahan reaksi tubuh karena sesuatu seperti debu, makanan, dan lain-lain 34. Tumbuhan penghasil beras 36. Kata tunjuk untuk benda yang dekat 37. Ingin, hendak 38. Panas atau cahaya yang keluar dari benda yang terbakar 40. Gaji, uang balas jasa 41. Menusuk hingga tembus 44. Kode/lambang penerbangan internasional Afrika Selatan 45. Binatang kecil pemakan daun 46. Saya (Arab) 47. Universitas Terbuka

48. Jalan bebas hambatan 49. Untuk, kepada (Inggris) MENURUN 1. Tepat, cocok 2. Alat untuk memperlambat/menghentikan gerakan atau putaran 3. Biru keungu-unguan 4. Keras tidak dapat dilentukkan, kejang 5. Saya 6. Dasi (Inggris) 7. Jumpa 10. Sesuatu yang ada di dalam benda 11. Penyubur tanaman 13. Hadapan, muka 14. Telungkup 16. Barang rongsokan 17. Pending 18. Tepung jagung 19. Sisa pembakaran yang berwarna hitam 21. Semua perkataan, perbuatan dan ketetapan Nabi Muhammad SAW 26. Gaya, model 29. Tidak tenggelam 30. Berlainan warna pada benda yang berlapis-lapis 32. Rangkap, ganda 33. Istirahat 34. Putih seperti kurang darah 35. Colek, colet (Inggris) 39. Tenaga listrik yang ada di tubuh manusia 40. Universitas Sumatra Utara 42. Kendaraan (kereta) yang dijalankan dengan motor, mobil 43. Tim atau regu penolong

Pemenang TTS Berhadiah Hj. Nispaniah, Letter Pres No: 12







....................................................... ....................................................... Kode Pos . . . . . . . . .

No. KTP/SIM : . . . . . . . . . . . . . . . . . --------------------------------------------- potong di sini --------------------------------------------

Terdengar percakapan dua sahabat Roy dan Galih : Roy : “Hai kawan, aku kasih pertanyaan ya? Ada 9 burung di pohon, ditembak satu, masih sisa berapa?” Galih : “Yaa, itu ma pertanyaan untuk anak kecil. So pasti sisanya 2 burung”. Roy :”Salah Bro! Sisanya 1, soalnya lainnya kabur semua” Galih : ??!!%#!?%(!?!#???

6 3 7 2 5 1 4 8 9

B 0 2 6 9 4 5 A

7 B 1 A 8 0 3

8 1 A 3 B 7 0 6 2 9 4 5

5 3 7 1 4 8 2 9 9 5 B 4 A 4 0 8 0 6 1 A 8 2 9 3 B 9 3 2 1 0 5 7 3 B A 6 2 A 4 5 7 1 6 0 6 7 8 B

0 2 A 5 6 0 B 9 7 4 5 6 1 7 4 B 8 1 3 8 9 3 2 A

4 7 3 1 8


6 2 5 0



A 6 1 5 3 B 8 9 0 7 2 4

9 B 8 7 2 0 A

3 4 6 5 1

Disney Clubhouse Pentas Sirkus Dunia Dora Emon DAHSYAT Infotainment INTENS Seputar Indonesia Siang Penyegaran Rohani Film Keluarga nGe-H1ets X0re X0re Seputar Indonesia Silet Ketika Cinta Bertasbih Putri Yang Ditukar Box Office Movie National Treasure

07:00 07.30 08.00 09.00 10.00 11:30 12:00 13.30 15:00 16:00 16.30 18.00 19.30 20.30

Nama: ..................................................

Andy L. Mahasiswa, Taput.


Teka Teki Burung

12:30 13.00 15:00 17:00 17.30 18:30 19:30 22.30

Pemenang Sudoku Berhadia Minggu Lalu


Kena Batunya! Seorang mahasiswa yang terkenal sombong akan menyelesaikan pendidikannya dan diharuskan mengikuti kegiatan KKN yang terletak di sebuah pelosok yang jauh dari kota. Dalam perjalanan dengan bus penumpang umum menuju desa tujuannya, mahasiswa itu duduk berdekatan dengan seorang petani yang memangku sebakul jagung. “Bu, jagung sebakul saja kok dipangku seperti itu. Kenapa tidak ditaruh di lantai saja?” kata pemuda kota ini. “Ini makanan pokok kami yang paling berharga, Nak,” jawab ibu petani itu. “Makanan berharga? Huh, kalau di kota, jagung hanya untuk makanan kuda, Bu,” ujarnya dengan nada sombong. Ibu petani itu hanya diam saja sambil berpikir dalam hati betapa sombongnya anak muda ini. Saat bis mulai memasuki jalan menurun yang berkelok-kelok, pemuda tersebut mulai terserang pusing dan mual sampai akhirnya ia muntah-muntah. Rupanya pagi hari itu dia sempat sarapan bubur sayur campur jagung yang kini keluar semua. “Supirrrrrr, berhentiiiii! Nih ada kuda lagi muntah-muntah di samping saya!” teriak ibu petani.

06.30 07.30 08:00 08.30 11:00 12:00

Liburan Ke Saribudolok

Gunakan angka 0 sampai 9 ditambah dua abjad -- A dan B -- untuk mengisi kotak-kotak kosong. Tidak boleh ada pengulangan angka dan huruf pada lajur mendatar dan menurun, serta di dalam kotak 4x3 bergaris tebal. Tidak ada keterlibatan matematika, hanya perlu pertimbangan dan logika. Gunakan pensil dan penghapus pada awal pencarian angka pengisi kotak, sebelum menuliskan angka yang benar dengan pulpen. Tingkat kesulitan: sedang (***). Tersedia hadiah Rp. 50.000,- untuk seorang pemenang. Antar kupon yang sudah terisi angka yang anda yakini benar ke kantor Waspada Jalan Brigjen Katamso 1 Medan paling lambat Jumat. Peserta dari luar kota bisa mengirimnya melalui faksimile ke (061) 4510025. Jawaban dan pemenangnya dimuat pada edisi Minggu depan (20/3). ------------------------------------------- potong di sini ----------------------------------------------


Minggu 13 Maret 2011

Pelaut Kualat

Pada saat pesta ada 2 laki-laki sedang asyik membicarakan tentang selingkuhan mereka. Pada saat sedang enak-enaknya ngobrol tibatiba wajah orang yang pertama menjadi pucat melihat 2 wanita sedang asyik mengobrol, lalu dia berkata pada temannya, “Hei, jangan kesana, disana ada istriku bersama pacar gelapku” Setelah beberapa saat temannya berkata “Kau tahu aku juga mau bilang begitu”.

Ibu Lizzy membawa anaknya menemui Dokter Hewan. “Tolong, Dok. Anak saya mengidap komplikasi,” kata Ibu Lizzy. “Ibu salah tujuan. Saya kan, Dokter Hewan.” kata sang Dokter. “Saya tahu, Dok. Justru itu saya kemari.” jawab ibu Lizzy. “Lho, emangnya kenapa?” kata Pak Dokter. “Anak saya kan mengidap Cacingan dan Malaria, Dok. Coba, apakah Cacing dan Nyamuk itu bukan Hewan?”


Bimbingan Rohani Disney Club Tom & Jerry Upin & Ipin Grebek Nusantara Sidik Kasus Layar Kemilau Cerita Siang Indahnya Sore Lintas Petang Zona Juara Sinema Spesial Animasi Spesial Sinema Utama Keluarga 22.00 Sinema Pilihan 23.30 Cerita Pilihan

07.30 Metal Fighr Beyblade 08.00 Pokemon 08.30 Ben 10 Alien Force 09.00 Power Rangers Jungle Fury 09.30 Dragon Ball 10.00 Arti Sahabat 12.00 FTV Siang 14.00 KiSS Minggu 15.00 Liga Premier Indonesia 17.00 1 Lawan 100 18.00 Dia Anakku 19.00 Nada CInta 20.00 Cinta Fitri 21.00 Antara Cinta Dan Dusta 23.00 Sinema Sinema 01.00 Fokus Malam

06.30 Apa Kabar Indonesia 08.30 Journey Of Hope 09.00 World Boxing Miguel Cotto vs Ricardo Mayorga 12.00 Kabar Siang 13.00 Damai Indonesiaku 15.00 Sampoerna Hijau Voli Proliga 2011 17.00 Surat Untuk Presiden 17.30 Kabar Petang 19.00 Bukan Jalan Jalan Biasa 20.00 Apa Kabar Indonesia Malam 21.00 Catatan Seorang Jurnalis 22.00 World Boxing 22.50 Liga Spanyol ( Live )

07:00 09:00 10:00 12:00 12:30 14.30 15.00 17:00 17:30 18:00 21.00

Inbox Hot Shot SCTV FTV Pagi SL Liputan 6 Siang SCTV FTV Status Selebriti Hip Hip Hura Liputan 6 Petang Uya Emang Kuya Islam KTP Pesantren & Rock n Roll 22:30 Liputan 6 Terkini 22.33 SCTV FTV Utama

07.00 Ripleys’s Believe It Or Not 08.00 Captain Tsubasa 09.00 Mati Gaya 10.00 Dapet Deh 11.30 Topik Siang 12.00 Klik! 13.00 Mantap 14.00 My Assistant 15.00 Djarum Super Indonesia 17.00 Topik Petang 18.35 Djarum Indonesia Super League 21.00 Ripley’s Believe It Or Not 21.45 Fear Factor 23.00 World Amazing Video 00.00 Topik Malam

07.05 08.30 09.30 10.05 11.05 13.30 14.05 15.30 16.05 17.05 18.30 19.05 20.05 21.05 22.05 23.05 23.30

Dunia Kita Agung Sedayu Agung Sedayu Showbizz Oprah Winfrey e Lifestyle Rachael Ray Show Kick Andy Kick Andy Metro Hari Ini Metro This Week Mario Teguh Just Alvin! Democrazy Zona Memori Journalist on Duty Metro Sports

07.30 08.00 08.30 09.00 10.00 11.00 12.00 12.30 13.00 13.30 14.30 15:30 16.00 17.00 18.15 19:00 21.00 23.00 01.00

Harmoni Alam Jelajah Celebrity On Vacation Ceriwis Ala Chef Insert Bosan Jadi Pegawai Ngulik Peppy The Xplorer Belajar Indonesia Diary IMB 2 Para Pemburu John Pantau Reportase Minggu Termehek Mehek Bioskop TRANS TV Bioskop TRANS TV Bioskop TRANS TV Sinema Dinihari

TRANS 7 07.30 08.00 09.30 10.30 11.00 11.30 12.00 13.30 14.00 15.00 16.30 17.00 18.00 18.30 19.00 20.00 22.00 23.30

U2 (Uje & Udin) Tabir Sunnah Masked Rider Jalan Jalan Selebriti Asli Enak Redaksi Siang Selebrita Galeri Sepakbola One Stop Football Mancing Mania Redaksi Sore Paradiso Ogah Ngeyel Wara Wiri Mister Tukul Suami Idola Scary Job Horror

08.00 The Penguin Of The Madagascar 09.00 One Piece 10.30 The Magic Cube 12.30 Awas Ada Sule 13.30 Teenlicious 14.00 Sentuhan Kasih 14.30 Petualangan Panji 15.00 Ill Feel 15.30 Ugly Betty 16.30 Berita Global 17.00 Spongebob 18.00 Super Hero Kocak 19:00 Big Movies 21.30 Big Movies **m31/G

Medan Metropolitan

WASPADA Minggu 13 Maret 2011

Oknum TNI Jurtul Togel Diringkus

Waspada/Andi Aria Tirtayasa

Oknum anggota TNI berinisial MFL juru tulis dan agen togel, menjalani pemeriksaan di Polsekta Medan Timur sebelum diserahkan ke Kodim 0201/BS, Kamis (10/3) malam.

Polisi Bekuk Spesialis Jambret MEDAN (Waspada): Seorang anggota spesialis jambret jalanan, yang sudah sebulan menjadi buronan polisi akhirnya diringkus dalam penyergapan di Jalan Singa, Medan, Senin (7/3) sore. Tersangka Z alias Armen, 22, warga Jalan Sei Kera, Kec. Medan Perjuangan kemudian diboyong ke Polsekta Medan Area, setelah itu tersangka diserahkan ke Reskrim Unit Jahtanras Polresta Medan. Menurut Panit Jahtanras Ipda Adi Pranoto kepada wartawan, Selasa (8/3), sebulan lalu tepatnya Jumat 25 Februari 2011, tersangka bersama temannya (masih diburon-red) melakukan aksinya merampok tas milik seorang ibu rumah tangga di Jalan Cokroaminoto Medan. Waktu itu korban, Sanny, 41, warga Jalan Pukat Gang Durian Medan dibonceng suaminya naik sepeda motor bermaksud pulang ke rumahnya. Saat melintas di TKP ( Tempat Kejadian Perkara) Jalan Cokroaminoto Medan tiba-tiba dari arah belakang datang dua orang pemuda mengendarai sepeda motor RX King BK 6194 HZ. Setelah dekat, salah seorang diantaranya merampok tas sandang yang dipegang korban. Akibat sentakan itu, korban terjatuh dari boncengan sepeda motor suaminya. Pengguna jalan lainnya yang mengetahui kejadian tersebut langsung mengejar pelaku namun gagal. Kemudian korban membuat pengaduan ke Mapolresta Medan. Setelah sebulan lamanya menjadi buronan polisi, akhirnya Polsekta Medan Area yang mendapat informasi dari masyarakat tentang keberadaan tersangka langsung menangkapnya. Lalu tersangka diserahkan ke Mapolresta Medan. Sementara, teman tersangka sampai sekarang ini masih dalam pencarian. Menurut Panit, tersangka adalah residivis kasus yang sama dan pernah menjalani hukuman penjara selama satu tahun. Sekeluarnya dari penjara, tersangka mengulangi perbuatan yang sama hingga akhirnya tertangkap lagi. “Untuk mempertanggungjawabkan perbuatannya. Tersangka dijerat pasal 365 KUHPidana dengan ancaman hukuman penjara diatas lima tahun,” jelas Ipda Adi Pranoto. (m39)

1 CM 2 CM

Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000

5 CM 6 CM

MEDAN ( Waspada): Tertangkap basah jadi juru tulis togel, seorang oknum TNI diringkus petugas Polsekta Medan Timur, Kamis (10/3) sekira pukul 18:00. Selanjutnya, tersangka berinisial MFL diserahkan ke Kodim 0201/BS. Informasi yang diperoleh di kepolisian, tersangka MFL ditangkap petugas kepolisian yang dipimpin Kanit Reskrim Polsekta MedanTimur AKP Nimrot Apr-win Simanjuntak di Jalan Bambu V, Kecamatan Medan Timur. Saat itu, oknum TNI tersebut sedang berada di satu warung dan menjadi juru tulis sekaligus mengantar rekap togel. Sejumlah tokoh masyarakat dan

warga di Jalan Bambu V, Kampung Durian itu, lalu mengirim SMS kepada Kapolsekta Medan Timur Kompol Patar Silalahi. “Pak Kapolsek tolong ditindaklanjuti. Pengaduan kami ini, karena tingkah aparat keamanan itu sudah sangat meresahkan kami. Siang togel, malam KIM. Sekali lagi kami atas nama tokoh masyarakat di kampung Durian Bambu 5, mohon kepada bapak untuk ditindak lanjuti.” demikian isi pesan singkat tersebut. Berdasarkan informasi dari tokoh masyarakat ini, Kapolsek langsung melakukan penyidikan. Hasilnya, polisi bersama tokoh masyarakat Jalan Bambu

Universitas Al Azhar Akan Gelar Wisuda

V berhasil menangkap MFL saat mengedarkan togel. Meski mencoba melarikan diri saat akan ditangkap, namun puluhan warga serta polisi berhasil meringkusnya. “MFL ditangkap berkat informasi dari tokoh masyarakat yang meminta polisi untuk menangkap tersangka,” ujar Kompol Patar Silalahi, Jumat (11/3). Daritangantersangka,tam-bah Patar Silalahi, pihaknya mengamankan telepon genggam merek Nokia tipe 1112 yang di dalamnya berisi nomor-nomor pesanan togel. “Tersangka sudah diserahkankeKodim0201BSka-rena yang bersangkutan bers-tatus anggota TNI,” jelasnya. (h04)

Wagubsu Ajak Kepala BKKBN Buat Terobosan MEDAN (Waspada): Wakil Gubernur Sumatera Utara H Gatot Pujonugroho, ST mengajak Kepala Badan Kependudukan dan Keluarga Berencana Nasional (BKKBN) Sumut, untuk melakukan perubahan sekaligus menciptakan terobosan yang mampu menyosialisasikan berbagai masalah di bidang kependudukan dan Keluarga Berencana (KB). Khususnya dalam hal revitalisasi program kependudukan dan KB seperti yang sudah dicanangkan Pemerintah Provinsi Sumatera Utara (Pemprovsu) sejak tahun 2009. Hal ini disampaikan Wagubsu pada acara pengambilan sumpah jabatan dan pelantikan Kepala BKKBN Sumut, di Aula Martabe Kantor Gubernur, Jumat (11/3). “Kepada pejabat yang baru dilantik saya menyampaikan selamat bertugas. Apa yang menjadi prioritas pembangunan keluarga berencana Provinsi Sumatera Utara

oleh pejabat yang lama untuk disikapi dan dilanjutkan serta ditingkatkan,” katanya. Kepala BKKBN Sumut yang dilantik Nofrijal, SP, MA yang sebelumnya menjabat Kepala BKKBN Gorontalo, menggantikan Indra Wirdhana yang akan melanjutkan tugasnya di BKKBN pusat. Pengambilan sumpah dan pelantikan dilakukan Wagubsu Gatot Pudjonugroho berdasarkan Surat Keputusan (SK) Kepala BKKN Nomor 292/III/P/2011. Wagubsu juga mengingatkan Kepala BKKBN yang baru akan menghadapi tantangan terkait masalah pertumbuhan anak di Sumut yang saat ini mencapai 3,5% per tahun. Hal ini diperkirakan mempengaruhi laju pertumbuhan penduduk. “Pertumbuhan anak yang di atas angka nor mal itu menyebabkan pertambahan penduduk di Sumut mulai mengkhawatirkan dan kurang terken-

dali,” lanjutnya. Kondisi ini, sebutnya, menempatkan Sumut sebagai provinsi terpadat keempat dengan jumlah penduduk sekitar 13 juta jiwa. Sedangkan Jawa Barat menempati peringkat pertama dengan jumlah penduduk sekitar 43 juta jiwa disusul Jawa Timur dan Jawa Tengah masing-masing dengan jumlah penduduk 38 juta jiwa dan 35 juta jiwa. Pengambilan sumpah dan pelantikan oleh Wagubsu atas nama Gubsu tersebut didasarkan pada Peraturan Pemerintah Nomor 19 Tahun 2010 tentang Tata Cara Pelaksanaan Tugas dan Wewenang serta Kedudukan Gubernur Sebagai Wakil Pemerintah di Wilayah Provinsi. Dalam ketentuan tersebut, gubernur mempunyai kewenangan melantik kepala instansi vertikal dari kementerian dan lembaga pemerintah non-kementerian.(m28)

MEDAN (Waspada): Universitas Al Azhar Medan akan melaksanakan wisuda sarjana bagi Fakultas Pertanian, Hukum, Ekonomi dan Teknik di Hotel Garuda Plaza, Jalan Sisingamangaraja No. 18 Medan pada Mei mendatang. Demikian Rektor Universitas Al Azhar Sinto, SE, MM (foto) didampingi Ketua Panitia Wisuda Iwan Hasrizart, SP, MP kepada wartawan, Jumat (11/3). “Pendaftaran ulang bagi calon wisudawan dimulai 3 Maret hingga batas terakhir 28 April di

7 CM 8 CM

Rp. 91.000 Rp. 104.000


9 CM Rp. 126.000 10 CM Rp. 140.000

11 CM Rp. 165.000 12 CM Rp. 180.000

MEDAN ( Waspada): Dua pimpinan Yayasan Universitas Sumatera Utara (UISU) yang berseteru, H. Helmi Nasution dan Hj. Sariani SA yang diwakili anaknya Ikhwan, dipertemukan guna mencari solusi memecahkan persoalan yang sudah berjalan lama itu. Pertemuan difasilitasi Kapolsekta Medan Kota Kompol Sandy Sinurat, di Aula Mapolsekta Medan Kota, Kamis (10/3). Helmi Nasution ditanya wartawan mengatakan, bahwa pertemuan itu hanya silaturrahmi. “Hanya silaturrahmi

saja,” kata dia, kemudian memasuki aula bersama seorang stafnya. Kepada wartawan, mereka tidak menjelaskan rinci pertemuan itu. Tetapi dikatakan bahwa mereka setuju melakukan musyawarah besar, untuk menyelesaikan konflik yang terjadi. Kapolsekta Medan Kota Kompol Sandy Sinurat ditanya wartawan, mengatakan, hanya menfasilitasi pertemuan itu. “Kami berinisiatif mempertemukan kedua pimpinan UISU untuk mencari solusi memecahkan masalah yang terjadi,”

kata Sandy. Dalam pertemuan itu disepakati akan mengundang Ketua Kopertis Wilayah Sumut-Aceh Prof. Nawawi sebagai mediator. “Kita berharap kisruh yayasan UISU bisa diselesaikan dengan tidak merugikan salah satu pihak,” kata dia. Sebelumnya, antara dua kubu sudah dilakukan islah pada 21 Juli 2008, diksaksikan Menkokesra, ketika itu dijabat Aburizal Bakrie. Namun islah tidak berjalan, karena masing-masing mengatakan, punya legalitas hak atas yayasan tersebut.(m27)

MEDAN ( Waspada): Oknum polisi yang bertugas di Polsekta Medan Kota melakukan penganiayaan terhadap Hendra Tampubolon, 22, mahasiswa Nommensen di Jl HM Said, Gg Mesjid, Kec Medan Timur, Selasa (8/3) siang. Informasi di Polresta Medan, peristiwa terjadi sekira pukul 13:30. Saat itu pelaku Aiptu Z, yang mengendarai sepedamotor melintas dari Jln HM Said Medan dan melihat Erwin alias Songo yang sudah menjadi target (TO) pihak kepolisian.

Kemudian Aiptu Z memutar arah sepedamotornya. Dalam jarak yang cukup dekat, Aiptu Z melihat Songo berdiri bersebelahan dengan Hendra yang sedang mengambil rantangan. Karena melihat kehadiran oknum polisi tersebut, Songo spontan melarikan diri. Melihat Songo kabur, oknum polisi tersebut bertanya kepada Hendra. Karena tidak mengenal Songo, Hendra mengatakan tidak mengenal pria yang tadi berdiri di sebelahnya. Mendengar jawaban Hen-

dra, oknum polisi itu emosi dan turun dari sepedamotornya. Tanpa banyak tanya, pelaku langsung memukuli Hendra. Tidak hanya itu, Sofyan, 71, pemilik rumah yang mencoba melerai nyaris menjadi sasaran kemarahanoknum polisi terse-but. Melihat ayahnya, akan dipu-kul, Surya, 34, menghalanginya. Kasie Propam Polresta Medan, AKP Beno Sidabutar mengaku akan coba memeriksa laporan korban. “Saya cek dulu ya, saya baru pulang dari Polda,” tegasnya. (m39)

Oknum Polisi Aniaya Mahasiswa

HA TI-HA TI terhadap penipuan yang HATI-HA TI-HATI mengatas namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk membeli produk anda, TI-HA TI apabila anda ingin dan HA HATI-HA TI-HATI melakukan transaksi jual beli melalui transfer. Segala akibat yang terjadi diluar tanggujawab PT. Harian WASPADA. Apabila anda mencurigai sesuatu, silahkan hubungi kami di

061-4576602. Terimakasih




AUTOMOTIVE Informasi Pembaca


Bursa Automotive

: Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower


: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

MITSUBISHI 6 Roda, AC Nippon Denso, Karoseri Cipta Karya, Ex Bus sekolah. BK Medan asli, mulus. Putih Kombinasi. Hub. 0813 6215 1688

TOYOTA Twin Cam 1.6 Dijual. Tahun 88 AC, Tape, P. Window, P. Steering. Mobil sangat mulus. Siap pakai. Harga 40 Jt Nego / TP dan SMS. Hub. 081 361 430 619.

TOYOTA Corolla SE Salon Thn. 86. W. Biru, BK Mdn, aC, Tape, BR, VR, Kondisi terawat. Orisinil. Siap pakai. TP. Hub. 0811 656 313 JUAL SALAH SATU Grand Deluxe 95. Murah Maron Metalic. P. Ster, P. Wind, Jok, remote, mulus. H. 63/Nego. Total Assy 93. Hijau metalik. P. Ster, P. Wind, jok, Remote, dll. Mulus H. 53/ Nego. Hub. 0812 6568818 / 7730 5875

MITSUBISHI L300 Dijual Mobil Box Thn 2001, Kondisi siap pakai, Harga 78 Jt/nego Hubungi 0878.6817.4000

DIJUAL SALAH SATU 1) Kijang Commando NCH, Short thn. 88/89. 6 speed. Lampu Dpn Gren Extra. C. clock Remot. H. 40Jt. 2) Isuzu Panther Miyabi. Laksana thn. 94 P. Steering, P. Window, AC, C. Lock. Remot, Velg Racing. H. 40Jt. Mobil mulus, cantik, rapi. Hub. Ibu Dokter. HP. 061.7624 7369 - 0852 9641 9233 (maaf sms TP).

MITSUBISHI Lancer ‘84 Dijual, Warna Hijau Mulus, AC, Tape, Ban 15, Mesin Ok, Harga 18 Jt/ nego Berminat hubungi (061) 7708.5838/ 0812.6322.9958

SUZUKI Carry Futura 1.3 Pick Up Thn. 96/97 Biru mulus, mesin sehat, jok kulit baru. Siap pakai. Bak Super Cargo Rp. 35Juta/nego. 0812 6578 790 - 0852 9607 9988



Kondisi mobil tdk masalah harga pantas Yg niat jual serius SMS HP. 0852.7571.6864

BUTUH UANG 1 Bh Carry Adi Putro Thn. ‘90. Warna Hijau metalik. Mulus. AC ada. Hub. 0813 7018 7701

W. Abu², Mulus, RP. 30 Jt Hub. 0812.6362.9081 / 7787.2324


Capster/ Creambath untuk salon “The Guh Wijaya Negara” ditempatkan di Medan Plaza Lt. 2 segera Hub. 0812.6396.444


Door to Door Domestik & Int’l. SRT-MOVING Telp. (061) 7711.8811 Jl. B. Katamso 557 Medan - Ritra Group


Ingin Promosikan Produk Anda Harian

WASPADA Media yang Tepat untuk Iklan Anda

TERCECER BPKB spd motor Yamaha BK 6014, A/ n.Kartono, alamat Jl. P. Kemerdekaan Dsn. IV No. 137 Ds. Tg. Morawa, No. Rangka: MH35TIP0044k331646, No. Mesin: 5T2411883







1 (Satu) Buah Surat Tanah SKT Bupati Deli Serdang Tahun 1973 atas nama Bahut Ginting, Tanah terletak di Dusun-VI Desa S.M. Diski Kecamatan Sunggal seluas 1.370. M2. Tercecer pada Tanggal 04 Januari 2011. Disekitar Bintang Terang sampai simpang Kp. Lalang.








FAX.4561347 Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput


IKLAN KHUSUS 6x1,5 kolom Rp. 120.000



Pelanggan Yang Terhormat


fakultas masing-masing un-tuk pengambilan toga dan perlengkapan lainnya,” katanya. “Untuk gladi resik akan dilaksanakan, Rabu 4 Mei 2011 pukul 15:00 hingga selesai di Hotel Garuda,” sebutnya lagi. Untuk itu, Sinto mengimbau kepada seluruh mahasiswa Fakultas Pertanian, Hukum, Ekonomi dan Teknik yang telah menyelesaikan skripsi dan sudah dimeja-hijau agar segera mendaftarkan diri ke panitia wisuda untuk segera didata ulang di Biro Rektor. (m43)

Dua Pimpinan UISU Bertemu Di Polsekta Medan Kota


Rp. 65.000 Rp. 78.000



Informasi Pembaca Bursa Property

GR : Garasi KM : Kamar Mandi KP : Kamar Pembantu KT : Kamar Tidur SHM: Sertifikat Hak Milik


Bale Batik Indonesia Menyediakan Bakal dan Busana Pria/ Wanita Jl. Sei Muara No. 15/ 24 Medan Baru

: Luas Bangunan : Luas Tanah : Ruang Makan : Ruang Tamu






Telp. (061) 455.1217 / 0815.3374.7930 0815.3371.0880

RUMAH DIJUAL CEPAT Rumah 2 Tingkat, Luas Tanah: 200m², Luas Bangunan: 160m² Fasilitas: 3 Kamar Tidur, Dapur, Kamar Mandi, Garasi mobil, Ruang tamu Jl. Ibrahim Umar Gg. Reda Hati No. 8 Medan Hubungi HP. 0852.9670.9192 Tanpa SMS/ Tanpa Perantara, Harga 400 Jt

Permanen, SHM 10x16m², Omset lumayan, Lokasi Strategis didepan Pabrik Jl. Pasar III No. 132 (Krakatau), RP. 750 Jt/nego Telp. (061) 662.6731 HP. 0852.6299.3232









Ingin Promosikan Produk Anda Harian

WASPADA Media yang Tepat untuk Iklan Anda





Kami memberi bukti bukan janji, alat vital besar dan panjangditempat, no suntik, no silikon dan bukan bahan kimia, murni tradisional, ramuan alami dan Do’a, dijamin paten dan permanen tanpa ada efek samping bebas pantangan. Untuk semua usia, ras dan agama. Untuk Pria: Besar dan panjang disesuaikan dengan ukuran yang di inginkan, dijamin joss, menjadikan alat vital keras, kuat, tahan lama, menyembuhkan impotensi, ejakulasi dini, lemah syahwat, lemah karena diabetes dan mengatasi ereksi, loyo dan kurang gairah, kembali perkasa menangani bekas suntik/ silikon, mani encer, plek cur, mati total, spilis, mandul, ingin punya keturunan, dan menangani yang gagal ditempat lain. Untuk Wanita: (Bisa berdarah lagi) menghilangkan keputihan becek, bau tidak sedap, ingin menceng-kram, wangi. Buktikan disini (Bergaransi) HP. 0812.8481.8889 Alamat praktek: Jl. SM. RAJA SAMPING UISU MASUK JL. SEMPURNA 300M NO. 49 MEDAN

Jangan Lewatkan Interaktif langsung dengan PASAK BUMI di DELI TV Setiap Sabtu Malam Pkl. 22.30 Wib (Live)

Call Center: 0818 090 73481



Cucu Asli Mak Erot Bersama


BILA anda ingin perkasa ingat jangan sampai salah masuk carilah yang benarbenar pewaris ilmu Mak Erot Sejati, karena keahlian H. Teja Saeful sudah tidak diragukan lagi dalam menangani keluhan seputar alat vital bahkan pengobatan H. Teja Saeful, sudah terkenal Indonesia dan kota-kota besar di Indonesia, sudah ribuan pasien tertolong dipengobatan Mak Erot ini yang aman tanpa efek samping, bahkan dimanca negara sekalipun pengobatan Mak ERot sudah tidak diragukan lagi keberhasilannya. INGAT untuk Kaum Pria janga nsampai Anda terhina Kaum wanita karena kondisi alat vital yang kurang sempurna Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041 KONSULTASI UMUM: KHUSUS PRIA: - Buka Aura - Ejakulasi dini - Cari Jodoh - Impotensi - Sesama jenis - Memperbesar “Alvit” - Pelaris - Memperpanjang “Alvit” - Memikat lawan jenis - Keras dan tahan lama dll - Besar PYDR KHUSUS WANITA: - Ingin punya keturunan - Memperkencang & memperbesar payudara - Mengobati keputihan dll

DIJAMIN 100% Hanya Tempat Kami Klinik Mak Erot Jl. Laksana No. 55J masuk dari Jl. Amaliun Yuki Simpang Raya Medan (Praktek Tetap) HP. 0812.4038.333


WASPADA Minggu 13 Maret 2011

Skylon Pengganti Discovery

Inilah gambaran pesawat ruang angkasa di masa datang, Skylon./CNN PESAWAT ruang angkasa Discovery milik NASA telah menyelesaikan misi terakhirnya, dan Endeavour serta Atlantis bakal menyusul masuk kandang akhir tahun ini. Bersandarnya tiga pesawat ruang angkasa milik NASA itu bakal menandai berakhirnya babak sejarah perjalanan ruang angkasa, namun pesawat ruang angkasa baru dengan rancangan inovatif sehingga bisa digunakan secara penuh berulang kali bisa mengambil alih peran ketiga pesawat ruang angkasa tersebut. Skylon mungkin menjadi satu-satunya konsep yang ada untuk menjawab era baru eksplorasi dan penelitian ru-

ang angkasa, kata perancang pesawat ruang angkasa yang bermarkas di Inggeris, Reaction Engines Ltd. Kunci utama kelebihan Skylon adalah mesinnya digerakkan dengan bahan bakar hidrogen yang disebut SABRE (Mesin Roket Bernafaskan Udara Sinergistis) yang dirancang oleh direktur perusahaan itu Alan Bond. SABRE, yang pertama kali digambarkan Bond awal tahun 80-an, merupakan ‘perpaduan mesin roket dengan dua mode operasional’. Mark Hempsell, direktur program masa depan di Reaction Engines Ltd, mengatakan “Mesin tersebut dihidupkan lewat pembakaran hydrogen dengan udara dan disempurnakan dengan pembakaran hydrogen dengan oksigen

cair seperti halnya mesin roket.” Kedua proses ini berlangsung pada ruang mesin yang sama, kata Hempsell, sehingga memungkinkan Skylon lepas landas dan mendarat dengan cara yang sama seperti halnya pesawat konvensional, bukan seperti pesawat ruang angkasa NASA dan lima roket Ariane milik Badan Ruang Angkasa Eropa (ESA), yang membutuhkan pendorong roket berbiaya mahal sekali pakai guna melontarkan pesawat itu ke orbit. Hempsell mengatakan, ide awalnya untuk mengangkut penumpang, satelit dan barang (kargo) ke stasiun ruang angkasa Internasional, namun dia juga menggambarkan ke depannya Skylon – yang mampu membawa be-

ban sampai 12 ton beratnya – membantu misi ke bulan dan Mars. “Ide Bond ini ‘sangat original’,” kata Richard Brown, Direktur Center for Future AirSpace Transportation Technology (Pusat Teknologi Angkutan Ruang Angkasa Masa Depan) di Universitas Strathclyde Inggeris – penyedia peralatan teknologi dan bantuan rancangan bagi Reaction Engines Ltd. “Ini masalah yang telah dipertimbangkan cukup lama – ide bagaimana Anda bisa menghasilkan mesin yang bisa berfungsi dengan sangat efisien untuk bisa meluncur ke orbit. Ada ide-ide lainnya yang terkait dengan pesawat ruang angkasa namun ide dari Bond sepertinya yang paling efisien,” kata Brown.

“Kita perlu melakukan penelitian mendasar untuk memahami beberapa aspek pesawat dengan lebih baik namun Bond perlu diberi dana yang cukup untuk memungkinkan mesin ini diujicobakan,” tambahnya. “Sistem kerja mesin sangat luar biasa,” kata Hempsell. “Dasar dari mesin adalah keseluruhannya terpancang dan tereksplorasi, sehingga tidak akan membahayakan jika mesin tersebut tidak berfungsi.” Begitupun, dia memuji pesawat ruang angkasa yang selama ini digunakan, dengan mengatakan mesin tersebut telah melakukan pekerjaan luar biasa, namun kekurangan penanam modal dalam hal rancangan pembuatannya, katanya. “Rancangan awal adalah memiliki dua kenderaan seperti pesawat yang bergendongan, yang memungkinkan penggunaannya dilakukan berulang-ulang secara menyeluruh,” katanya. Dalam teori, setidaknya, Reaction Engines berharap Skylon bisa melakukan pekerjaan itu dalam bentuk satu kenderaan, namun pesawat ini membutuhkan lebih banyak dana guna mewujudkan proyek tersebut. Sekitar 80 persen dana yang mengalir saat ini berasal dari pihak swasta, dan sisanya dari dana publik. Reaction Engines Ltd memperkirakan pembuatan Skylon menelan total biaya 10 miliar dolar (Rp 89 triliun) – dana yang sangat besar, namun nilainya sangat sangat tinggi, kata Brown. “Jika Anda membandingkan dengan biaya pembuatan pesawat seperti Airbus A380, maka kita tidak akan menganggap jumlahnya terlalu besar,” katanya.Dia menambahkan “Saat ini, biaya untuk masuk ke ruang angkasa memang sangat mahal. Jika Anda bisa meran-cang ulang pesawat ruang angkasa se-hingga Anda bisa mengguna-kannya selamanya, maka biayanya akan berkurang secara dramatis. ”Syafri/CNN

Sepuluh Persen Masyarakat AS Miliki Akses Internet BAGAIMANA akses sinyal dan frekuensi dalam jaringan komunikasi atau broadband di masyarakat anda? Untuk menjawabnyasekarangandadapat melihat informasi itu via sebuah National Broadband Map Interaktif yang diluncurkan 17 Februari lalu oleh National Telecomunications and Information Administration dan Federal Communications Commission. Akses internet broadband merupakan satu alat untuk bisnis dan keperluan segala macam aktivitas manusia yang makin meningkat untuk mengakses banyak layanan dasar. Namun tidak semua masyarakat Amerika Serikat memiliki akses sinyal dan frekuensi yang luas dalam komunikasi. Terbukti sebuah laporan administrasi telekomunikasi baru,DigitalNation2010mengatakan bahwa sekitar sepertiga rumahtangga di AS masih mengalami kekurangan koneksi internet broadband. Selanjutnya, hanya lima sampai sepuluh persen masyarakat AS memiliki akses layanan internet itupun sangat lambat untuk mendukung fungsi online seperti downloading halaman situs, foto atau video. Sinyal dan frekuensi mobile merupakanbagian terbesarakses internet masa depan dimana administrasi presiden AS, Barrack Obama mendorong proyek NationalWirelessInitiativeyangakan mengembangkan jaringan broadband tanpa kabel untuk meliput 98 persen kehidupan masyarakat AS. Tersedianya sinyal dan frekuensi yang luas dalam komunikasi dan netralitas jaringan yang lemah bagi perusahaan tanpa kabel khususnya mengang-gu pengalaman internet bagi pengguna mobile. Menurut adminsitrasi telekomunikasi, 36 persen masyarakat AS memiliki akses pada layanan internet tanpa kabel pada kecepatan maksimum download 6 Mpbs atau lebih besar yang bagi sebahagian orang memutuskan kecepAtan minimum dihubungkan dengan layanan broadband 4G tanpa kabel. Pengguna mobile biasanya

Inilah gambaran dari peta akses sinyal internet dan jaringan komunikasi di AS./ifc tidak pernah melihat kecepatan maksimum seperti yang dilaporkan tahun lalu. Sebahagian besar pengguna yang sudah menggunakan ujicoba kecepatan pada ponsel mereka (sesuatu yang dapat konsumen lakukan dengan sebahagian besar ponsel cerdas dan ponsel lainnya ) khususnya kecepatan aktual yang lebih rendah. The National Braodband Map didasari pada data yang dikumpulkan dari provider broadband dan sumber data lain. Maka lebih menarik membandingkan peta jaringan sinyal dan frekuensi ini dengan peta lainnya yang didapat dari berbagai sumber. Peta broadband didasari data-data tentangkekuatansinyaldankecepatan jaringan yang terkumpul dari pemakai ponsel mobile yang menonjolkanaplikasisepertiOpen Signal Map atau Rootmetrics. Sebahagian besar yaitu hampir 95 persen masyarakat AS tinggal di lokasi-lokasi yang kurang memiliki akses jaringan tanpa kabel kecepatan 3G dengan kece-

patan minimum sekurang-kurangnya 768 Kbps, namun meningkat karena tidak cukup untuk broadband tanpa kabel. The National Broadband Map mengatakan adminsitrasi telekomunikasi termasuk lebih dari 25 juta masyarakat AS membutuhkan layanan penyediaan internet broadband. Teknologi digunakan untuk menyediakan layanan, kecepatan maksimum layanan dan nama-nama penyedia layanan. Pengguna dapat mencari dengan alamat untuk mendapatkan penyedia sinyal dan frekuensi yang luas dan tersedianya servis dalam hubungan bloksensusatausegmen perlengkapan internet lain untuk membandingkanaksesbroadbandmenurut geografi seperti negara, kota atau distrik. Sangat menarik untuk memutuskan implikasi demografi lokal yang dapat dengan mudah dieksplorasimelaluipetainteraktif data sensus AS. Dalam beberapa kasus ada koreksi menarik antara tersedianya opsi broadband da-

lamkawasantertentu,pendapatan atau tingkat pendidikan masya-

rakat yang tinggal di kawasan itu. Nurhayati Baheramsyah/cnn

A6 Seberapa Langka Mineral Langka?


alau namanya logam langka – 16 elemen metalik yang memiliki kesamaan struktur dan kimia – sebenarnya stoknya lumayan melimpah. Kesulitannya adalah logam-logam itu jarang ditemukan dalam deposit terkonsentrasi yang mudah ditambang. Logam langka penting untuk pembuatan beragam material berteknologi tinggi dan militer seperti magnet khusus, campuran logam, kendaraan bertenaga listrik dan produk-produk energi alternatif lainnya. Tambang logam langka dibuka di Australia, Kanada dan A.S. dalam upaya bersaing di pasar global dengan China, yang saat ini menguasai 96 persen cadangan dunia mineral-mineral tersebut. Menemukan lokasi deposit logam langka Amerika yang bisa ditambang secara komersial merupakan

bagian dari penelitian di seluruh negara yang dilakukan oleh Badan Survei Geologi AS. Survei yang dilakukan pertama kali di AS itu menemukan kira-kira 13 juta metrik ton mineral langka berlokasi di 14 negara bagian. Deposit terbesar berada di Alaska, California dan Wyoming. Kebanyakan unsur berada di deposit bebatuan, tetapi sejumlah deposit berpasir – tanah endapan dan fosforit – juga mengandung mineral-mineral tersebut dalam konsentrasi tinggi. AS kini mengkonsumsi kira-kira 10.000 metrik ton mineral langka setahun. Mengembangkan sendiri deposit mineral langka yang melimpah akan memenuhi kebutuhan memproduksi kebutuhan di samping meningkatkan ekonomi wilayah tempat deposit berada. 80

Produksi global oxida langka



Produksi dalam kiloton (1950-2000)


Deposit mineral langka Lainnya

A.S. 1950

MEXICO Layar LCD, jendela & cermin • Cerium • Europium • Yttrium

Mineral langka digunakan mobil hibrida Generator dan motor listrik • Dysprosium • Neodymium • Praseodymium • Terbium




Konverter katalitik • Cerium • Lanthanum • Zirconium





0 2000

Unsur logam langka • Cerium • Dysprosium • Erbium • Europium • Gadolinium

Baterai NiMH hibrida • Cerium • Lanthanum

• Holmium • Lanthanum • Lutetium • Neodymium • Praseodymium • Samarium • Scandium • Terbium • Thulium • Zirconium • Yttrium

Bill Pitzer - • Copyright © 2011 The New York Times Syndicate

Inilah fosil bakteri yang baru-baru ini ditemukan pada tiga pecahan batu meteor./reuters

Ilmuwan NASA: Tanda Kehidupan Ditemukan Pada Batu Meteor SATU laporan ilmuwan NASA mendeteksi adanya fosil bakteri kecil pada tiga pecahan batu meteor, dan menyatakan ini bentuk kehidupan yang tidak ditemukan di Bumi. Jika benar, penelitian ini akan membuktikan ada kehidupan di alam semesta ini dan kehidupan di Bumi mungkin berasal dari tempat lain dalam system tata surya, datang ke planet kita dengan menumpang di bebatuan ruang angkasa seperti komet, bulan, dan benda-benda bintang lainnya. Penelitian ini, yang disiarkan di Journal of Cosmology, dipandang sangat controversial sehingga disertai satu pernyataan dari sang redaktur jurnal yang meminta masukan ilmiah lainnya. Pernyataan inti dari penelitian yang dilakukan pakar astrobiology Richard Hoover adalah terdapat bukti tentang fosil mikro yang sama dengan cyanobacteria – alga berwarna biru hijau, yang dikenal sebagai buih air kolam – di permukaan tiga pecahan batu meteor. Struktur mikroskopis batuan meteor ini mengandung kadar karbon yang tinggi, tanda bagi kehidupan seperti di bumi, dan hampir tidak ada kandungan nitrogen, kata Hoover. Nitrogen bisa menjadi tanda kehidupan yang membumi, namun ketidakberadaan zat tersebut bisa berarti struktur ini terurai menjadi bentuk gas dalam waktu lalu, kata Hoover. “Selama ini kita sudah tahu bahwa ada tanda kehidupan yang sangat menarik pada meteor yang mengandung karbon dan deteksi struktur yang sangat mirip..lalu mendapati cyanobacteria yang menunjukkan bahwa kehidupan itu tidak terbatas hanya di planet Bumi,” kata Hoover.

Hoover, yang bermarkas di Marshall Space Fligth Center NASA di Alabama, mengkhususkan diri dalam penelitian bentuk kehidupan mikroskopis yang mampu bertahan hidup di lingkungan eks-trim seperti glasier, geiser dan lapisan bumi yang selalu berada pada titik beku. Hoover bukanlah orang pertama yang men-gklaim temuan bentuk kehidupan mikroskopis dari dunia lain. Di tahun 1996, para ilmuwan NASA menye-rahkan penelitian yang menunjukkan temuan batu meteor berusia 4 miliar tahun di Antartika yang menunjukkan bukti kehidupan mikroba dari Mars. Temuan awal dari meteor yang disebut Mars itu disambut dengan gembira dan batu tersebut diperlihatkan pada pertemuan di markas NASA di Washington. Sejak itu, kritisi terus dilakukan seputar pene-muan batu tersebut dan bukti akhir masih sulit diterima. Penelitian Hoover mungkin akan menemui nasib yang sama. Dalam satu pernyataan yang disiarkan di Journal of Cosmology, sang redaktur, Rudy Schild berkomentar: “Dr. Richard Hoover adalah seorang ilmuwan yang sangat terhormat dan ahli astrobiology dengan catatan prestasi luar biasa di NASA. Dengan adanya temuannya yang controversial ini, kami mengundang 100 pakar dan telah mengeluarkan undangan umum kepada lebih 5.000 ilmuwan dari komunitas ilmiah untuk mengulas temuan tersebut dan memberikan analisa kritisnya. ”Syafri/reuters

YouTube Tayangkan Even Olahraga Dunia Secara Langsung YOUTUBE kini tidak hanya sebagai video lipsing yang menonjolkan gerak-gerik mulut dan anggota tubuh lainnya, tempat chatting para remaja atau meliput berbagai peristiwa dunia saja, namun YouTube makin berkembang sebagai media penyiaran secara langsung even-even olahraga dunia. Sekarang ini YouTube dilaporkan dalam tahap perundingan dengan National BasketballAssociationdanNational Hockey League untuk menayangkan pertandingan olahraga itu secara langsung. Sebenarnya, tahun lalu YouTube sudah mulai siaran

langsung pertandingan kriket Indian Primer League, satu even olahraga kriket yang sangat berhasil. Menurut majalah Business Week, pertandingan ini disaksikan 55 juta penonton dari lebih 250 negara. Gautam Anand, direktur GoogleuntukkawasanAsiaPacific baru-baru ini mengatakan bahwaYouTube merencanakan lebih banyak penayangan siaran olahraga secara langsung namun menolak untukmenyebutkansecara detail perundingan khususnya dengan NBA dan NHL. Google juga tidak mau ketinggalan dalam penayangan secara langsung pertandingan-pertandingan olah-

raga dunia dengan mengadakan pembicaraan dengan liga pro olahragasepertiliga-ligasepakbola Eropa. Tidak berlebihan jika dikatakan bahwa sekarang ada banyak even olahraga yang dapat disaksikansecaralangsung diYouTube. “Kami juga melakukan lobi-lobi yang sama. Kami terus melakukan kerjasama dan perjanjian siaran langsung acara olahraga dunia,” jelas seorang pejabat YouTube. Dengan menayangkan even olahragasecaralangsung,Youtube danGoogledapatmenaikkanpendapatan dari iklan jika keduanya mampu menarik perhatian pe-

mirsaberlama-lamamenyaksikan pertandingan olahraga. Belakangan iniYouTube kelihatan lebih serius cenderung menjadi satu pusat hiburan lebih dari se-kedar tempat shooting video. Ada isu mengatakan CEO YouTube, Salar Kamangar akan merilis situs yang menonjolkan program talenta. Sedangkan Juli lalu situs videosharing mengumumkan bahwaYouTube Partner Grants Program dimaksudkan untuk menambah kualitas YouTube dengan menawarkan bintang-bintang dunia terkenal pada canel YouTube sendiri. Sementara itu, Google baru-

YouTube baruinimendapatkanWidevine, satu layanan video permintaan yang dikenal dengan multiplatform DRM-nya dan teknologi streaming adaptif. Sebenarnya situs layanan video permintaan ini sudahada sebelumnyayang diproduksi perusahaan New Next Networks. Nurhayati Baheramsyah/cnn


WASPADA Minggu 13 Maret 2011

Sumut Mampu Jadi Barometer Atletik SEKRETARIS Umum Persatuan Atletik Seluruh Indonesia (PASI) Pengprov Sumut Irwan Pulungan SSos mengatakan pihaknya komit ingin membawa Sumatera Utara (Sumut) menjadi barometer cabang olahraga atletik di Indonesia. Irwan mengatakan dari lima nomor atletik, yaitu lari, lempar, tolak, lompat dan jalan cepat, PASI akan menfokuskanpadacabanglariyang dikatakannya paling produktif menghasilkan emas dan prestasi di tingkat nasional. “Lari dalam hal ini ada dua,yaitularijarakmenengah dan sprint. Dua nomor ini memang kita fokuskan karena paling berprestasi di tingkat nasional,” ujarnya, Sabtu (12/ 3). Pria asal Padangsidimpuan ini mencontohkan, beberapa nama seperti Yogi Triyono yang kini menjadi atlet pada lari jarak 3000 meter St Chase (halang rintang), dipanggil Pelatnas menuju persiapan SEA Games XXVI di Jakarta. Selain itu, Edi Herianto, Mari Yusuf Gulo, Nyai Agita Prima dan Zulkarnain Pura yang kini menjadi atlet di nomor lari 400 meter gawang, juga dibidik karena sudah tiga kali meraih medali pada pagelaran PON di Surabaya, Palembang dan Kaltim. “Tetapi, cabang olahraga ini banyak ditekuni oleh kalangan pelajar dan mahasiswa. Sementara masyarakat umum kurang meminati olahraga ini. Itu pula sebabnya kita hanya membuat kejuaraan tingkat pelajar,” ujarnya. Irwan, juga melatih nomor lari jarak menengah dan jauh, mengatakan serius menekuni cabang olahraga tersebut. Ini dibuktikannya dengan menjamin seluruh atlet yang ada di bawah naungannya dipekerjakan di Bank Sumut dengan catatan mampu berprestasi di tingkat nasional (minimal tiga besar). “Terakhir saya bermain di PON Jakarta (1993), saya pernah dapat tiga emas di nomor lari 1.500 meter. Kebetulan saya bekerja di Bank Sumut, maka itu saya serius merekrut atlet berprestasi untuk ikut bekerja di sini untuk memotivasi semangat mereka,” ujarnya. (m18)

Panpel Rampungkan Persiapan Langkat Rally MEDAN (Waspada): Persiapan perhelatan besar kejuaraan Langkat Rally 2011 yang berlangsung di kawasan perkebunan Kab. Langkat pada 9 dan 10 April, semakin rampung. Sabtu (12/ 3), unsur Panpel kembali melakukan audiensi dengan perangkat SKPD Kab. Langkat untuk merampungkan persiapan kejuaraan yang bakal diikuti para pereli nasional tersebut. Wakil Ketua Panpel Kisharyanto Pasaribu mengatakan di Medan kemarin, Panitia Penyelenggara (OC) Sabtu kembali berjumpa semua jajaran Satuan Kerja Perangkat Daerah Kab. Langkat di rumah dinas Bupati Langkat, di Stabat, guna membericarakan persiapan. Sebelumnya, Selasa (8/3) unsur Panpel yang dipimpinIjeck,jugatelahmengadakanrapatdenganBupatiLangkat. “Persiapan kita sudah masuk ke hal-hal teknis, seperti soal pengamanan, guna kelancaran event,” sebut Kisharyanto. Dalam pertemuan tersebut, Kisharyanto didampingi Sekretaris Panpel Prihatin Kasiman, dan Pimpinan Perlombaan Elwin Siregar. Dikatakan, segala persiapan harus dimaksimalkan sejak dini, termasuk sosialiasi kepada warga di perkebunan Maryke dan Turangie yang dilewati soal pentingnya keamanan. “Kita optimis sosialisasi soal keamanan juga bisa mencapai sasaran, mengingat daerah Langkat ini dulunya pernah menjadi bagian dari kejuaraan Asia Pasifik di tahun 1988 dan 89 dulu. Kita sangat gembira, karena jajaran SKPD sangat respek dengan tekad mensukseskan event,” ucap Kisharyanto. Langkat Rally 2011, sebagai bagian dari rencana tiga event serupadiSumuttahunini,mendapatdukunganpenuhdariPemkab Langkat, di mana Bupati Langkat H. Ngongesa Sitepu juga duduk dalam untuk OC, yakni sebagai Ketua Kehormatan. “Bupati mendukung kegiatan ini, karena dianggapnya bakal mengangkat perekonomianwargayangdaerahmerekamenjadilintasanpeserta, danjugamenjadisaranapromosilokasiwisata,mengingatkejuaraan juga menyinggahi Bahorok”. Pimpinan Lomba Elwin Siregar menambahkan, meski berlabel Kejuaraan Sumatera Utara, level kejuaraan Langkat Rally setingkat kejurnas, mengingat para peserta reli tidak hanya peserta Sumut. “Beberapa pereli nasional asal P. Jawa, Kalimantan serta Sulawesi sudah menyatakan kesediaan untuk tampil. Kita harapkan setidaknya ada 50 peserta yang berlaga, untuk meramaikan event,” ungkap Elwin. Langkat Rally 2011 merupakan kejuaraan speed reli (reli jarak jauh) selama dua hari penuh, di mana para peserta harus menempuh spesial stages (SS) berjarak total lebih dari 100 km. Kejuaraan dimulai dari alun-alun Kota Stabat pada 9 September pagi, kemudian harus menempuh 9 SS (Spesial Stages) berjarak tempuh total 122,6 km. Di hari pertama ada 3 SS berjarak tempuh 40,8 km yang diperlombakan, yakni di Maryke 1, Turangie A1 dan Turangie B1, sedangkan pada hari II keesokan harinya sudah menunggu 6 SS lain sejauh 81,8 km yang juga berlokasi di Maryke danTurangie. Kelas-kelas yang diperlombakan yakni grup N, grup GR 2, grup N 15, Grup S, grup J (jip) serta kelas Retro. (m47)

Problem Catur Putih melangkah, mematikan lawannya lima langkah. Jawaban lihat halaman A2 .


Semifinal All England Tanpa Wakil Indonesia JAKARTA (Waspada): Indonesia tidak menyisakan wakilnya pada semifinal All England, Sabtu, setelah dua ganda putra yang tersisa di perempat final gagal mengatasi lawanlawan mereka. Pasangan unggulan keempat Markis Kido/Hendra Setiawan yang tampil dalam pertandingan pembuka babak delapan besar di National Indoor Arena, Birmingham, Sabtu (12/3) dinihari Wib kalah oleh pasangan Malaysia Koo Kien Keat/Tan Boon Heong 19-21, 25-23, 1121. Sedangkan adik Kido, Bona Septano yang berpasangan dengan Mohammad Ahsan, menyerah kepada pasangan China Chai Biao/Guo Zhendong 18-

21, 17-21. Pasangan Kido/Hendra sempat mengembalikan peluang mereka untuk menang saat bangkit setelah tertinggal 4-11 dan memenangi game kedua 25-23 sekaligus memaksakan digelarnya game penentuan. Namun pada game ketiga, pasangan juara Olimpiade dan Asian Games tersebut melakukan banyak kesalahan sehingga tidak mampu mengulang seperti yang terjadi pada game kedua ketika kembali tertinggal 6-11 saat interval. Ganda putra Malaysia yang menjadi unggulan kelima itu akhirnya maju ke semifinal setelah bermain selama 49 menit. “Tidak tahu mengapa, mainnya sedang tidak enak nih,” ujar Hendra Setiawan saat ditanya penyebab permainan mereka yang banyak menghasilkan ke-

salahan terutama pada game penentuan. Sementara Kido mengakui, akibat tertekan oleh permainan lawan —yang mengalahkan mereka untuk keenamkalinya dari sembilan pertemuan— mereka menjadi banyak melakukan kesalahan sendiri. Kekalahan dua ganda itu membuat Indonesia tidak mempunyai wakil di semifinal turnamen bergengsi dengan total hadiah sebesar 350 ribu dolar AS tersebut. Namun, meskipun sudah kehilangan semua pemain nasionalnya, Merah Putih masih tampak pada turnamen All England setelah pemain profesional Hendra Setiawan mencapai semifinal bersama pasangannya asal Rusia Anastasia Russkikh. Pada partai terakhir babak delapan besar di National Indoor

Arena, Birmingham, Inggris, Sabtu pagi WIB, Hendra/Anastasia mengalahkan pasangan Denmark Joachim Fischer Nielsen/Christinna Pedersen 21-16, 12-21, 21-14. Saat ditanya bagaimana menjaga kekompakan padahal mereka nyaris tidak pernah berlatih bersama —karena Hendra berada di Indonesia dan Anastasia di negaranya, Rusia— Hendra hanya menjawab pendek, “Nggak tahu juga”. Ia bahkan mengaku tidak sempat berlatih bersama menjelang turnamen bulu tangkis tertua itu. “Langsung saja main,” katanya. Pada semifinal, pasangan tersebut akan menghadapi unggulan ketiga asal Thailand Sudket Prapakamol/Saralee Thoungthongkam yang menyisihkan unggulan kelima asal China Tao Jiaming/Tian Qing 4-21, 21-18, 21-14. (ant/m47)

Jerry, Angelina Sementara Memimpin Final Kejuaraan Boling Terbuka Waspada Cup MEDAN (Waspada): Peboling nasional asal Jawa Barat, Jerry R, untuk sementara memimpin perolehan angka pada delapan game pertama babak final master open putra pada Kejuaraan Boling Terbuka Waspada Cup (PBI Series), di Lintasan Persai SuperBowl Medan, Sabtu (12/3). Jerry tampil di urutan teratas setelah mengemas 1872 poin. Mengawali game pertama dengan torehan 232, Jerry terus memimpin hingga game kedelapan. Posisi kedua juga dihuni peboling nasional asal DKI Jakarta, WilliamWijaya usai membukukan 1818 poin. Posisi ketiga ditempati atlet asal Sumatera Barat, Udrizal dengan mencatat 1728 poin. Peboling nasional asal DKI lainnya, Erick Ngo menghuni peringkat keempat dengan torehan 1705 poin diikuti atlet nasional asal Jawa Barat, Adhiguna di urutan kelima dengan 1695 poin. Peboling junior andalan Sumut, Imam Wiguna, tampil di urutan keenam dengan 1693 poin, diikuti Hengky (1679/DKI), Budi Halim (1599/Sumut), Jaen Barts (1564/DKI), Rudi Rusli (1558/Sumut), Ronald Lazuardi (1553/Sumut), Aswin (1515/ Kaltim), Sabaruhum (1470/Su-

mut), Lie Chock Hing (1468/ Sumut), Ihsan (1401/Sumut). Pada nomor master open putri, terjadi persaingaan ketat, di mana perolehan angka masing-masing finalis tidak terpaut jauh. Peboling tuan rumah Sumut, Angelina Karto, untuk sementara memimpin dengan raihan 1590 poin. Posisi kedua

ditempati atlet Sumut yang kini memperkuat DKI, Jessica Florensia, dengan 1559 poin. Atlet nasional asal DKI, Ivana Hie, sementara harus puas menghuni posisi ketiga dengan 1538 poin, diikuti AndinY (1530/ DKI), Sheanny (1492/DKI), Marwiati Ningrum (1456/Sumut), Aldila Indryati (1415/Su-

Waspada/Dedi Riono

10 finalis nomor master open putri diabadikan bersama usai menyelesaikan final delapan game pertama Kejuaraan Boling Terbuka Waspada Cup, Sabtu (12/3). Mereka akan bersaing ketat untuk merebut gelar juara hari ini.

SIWO PWI Sumut Kalah Tipis MEDAN (Waspada): Kesebelasan SIWO PWI Sumut menelan kekalahan tipis 1-2 atas tim U-30SSBPatriotMedanpadalaga persahabatan di Lapangan Air Bersih, Sabtu (12/3) sore. Tim SIWO yang turut diperkuat pemain berusia di atas 30 tahun itu mencetak gol lebih dahulu saat pertandingan baru berjalan tiga menit. Gol cepat tersebut disumbangkan Setiabudi Siregar lewat tendangannya memanfaatkan bola liar di area kotak penalti langsung mengarah ke sudut kanan atas gawang lawan. Keunggulan tim SIWO yang dikoordinir kapten tim Halomo-

mut), Suanty (1384/Sumut), Etty (1324/Sumut) dan R Nia (1278/ Kaltim). “Semua peboling masih memiliki peluang menjadi juara dengan memanfaatkan pertandingan final delapan game kedua hari ini,” jelas Ketua Panpel Kejuaraan, Austin Tumengkol, kemarin. (m42)

an Samosir didukung Hendra DS dkk itu tidak bertahan lama. Lewat serangan balik, SSB Patriot berhasil membuat kemelut di area penalti tim SIWO. Binsar yang berdiri tepat di depan gawang dengan mudah membobol gawang SIWO memanfaatkan umpan mendatar rekannya dari kiri gawang. Selang tiga menit, SSB Patriot kembali mencetak gol. Lemahnya pertahanan M Syamsir cs membuat R’Lan dengan mudah menggiring bola sendiri menerobos ke kotak penalti dan langsung melepaskan shooting yang tidak mampu diamankan kiper.

Masuknya David Swayana dan Dedi Sahputra di babak kedua cukup meningkatkan permainan SIWO. Beberapa peluang menambah gol pun didapat Austin Tumengkol cs. Begitu juga sebaliknya, beberapa tembakan pemain SSB Patriot kerap membahayakan gawang SIWO. Namun hingga laga usai, skor bertahan. Pada pertandingan kedua, tim gabungsan SIWO PWI Sumut dan mahasiswa Sekolah Tinggi Ilmu Komunikasi “Pembangunan”(STIK-P)jugaharusmenelan kekalahan tipis atas tim SSB Patriot B dengan skor 0-1. (m42)

Waspada/Khairil Umri Batubara

Tim SIWO PWI Sumut (atas) diabadikan bersama tim SSB Patriot Medan sebelum melakoni laga persahabatan, Sabtu (12/3).

Gol Irfan Menangkan Persema MALANG (Waspada): Persema Malang menang tipis 1-0 atas tim tamu Bali Devata dalam laga lanjutan Liga Primer Indonesia di Stadion Gajayana, Sabtu (12/3) malam. Tim berjuluk Laskar Ken Arok itu terselamatkan oleh gol semata wayang Irfan Bachdim pada menit ke-87 yang gagal diantisipasi oleh penjaga gawang Bali Devata Ngurah Komang Arya Perdana. Bali Devata nyaris membuyarkan impian anak asuh Timo Schuenemann itu jika pada menit-menit akhir babak kedua para pemain Bali Devata berkonsentrasi dan mampu menghalau tendangan Irfan Bachdim yang meluncur deras ke arah gawang Ngurah Komang Arya. Selama 45 menit babak pertama pertandingan berlangsung monoton, serangan demi serangan yang dibangun kedua tim belum mampu membuahkan gol. Bahkan hingga turun minum pertandingan yang dipimpin wasit asal Macedonia Tiwkowshi Todor tersebut skor masih 0-0. Memasuki awal-awal 45 menit babak kedua, kedua tim juga masih saling menjajaki karena keduanya sudah sama-sama tahu pola permainan masing-masing. Meski ada bebera-pa peluang yang membahayakan gawang kedua tim, tidak satupun yang mampu merobek jala gawang masing-masing. Tidak diturunkannya pemain tengah Persema Robby Gaspar oleh Timo Schuenemann benar-benar membawa perubahan cukup drastis dan suplai bola yang bisa mengalir dengan baik, menjadi terhambat karena penggantinya Yogi Alfian belum mampu membagi bola dengan baik, sehingga suplai bola terpaksa dilakukan secara langsung mengarah ke lini depan. Meski pertandingan berlangsung monoton, wasit asal Macedonia itu mengeluarkan lima kartu kuning yang dihadiahkan untuk M Kasan Soleh, Irfan Bachdim dan Kim Jeffry Kurniawan (Persema) serta Agus Purwanto dan Nengah Sulendra (Bali devata). Pada menit ke-55 pertandingan sempat berhenti sekitar tiga menit karena penjaga gawang Bali Devata Ngurah Komang Arya Perdana mengeluarkan darah dari hidungnya setelah diterjang kaki Irfan Bachdim ketika mengamankan bola di area kotak penalti. Tiga menit menjelang berakhirnya babak kedua atau menit ke-87 gawangnya harus kebobolan, sehingga target menggapai poin di kandang Persema harus pupus. Di Bandung, Bandung FC mengakhiri kebuntuan dengan meraih kemenangan pertama setelah mengalahkan Minangkabau FC 1-0. Gol kemenangan tim berjuluk “Laskar Siliwangi” itu dicetak oleh striker asal Liberis, Perry N’Somah menit ke-49 setelah melakukan kerjasama dengan Lee Hendrie. Sementara Solo FC hanya bisa bermain imbang dengan skor 0-0 saat menjamu Cendrawasih Papua FC di di Stadion Manahan Solo. (ant/m47)

Duo Methodist Di Final Pop Mie Basketball 2011 MEDAN (Waspada): SMA Methodist Binjai melaju ke final kejuaraan basket antar pelajar Pop Mie Basketball 2011 Regional Sumbagut setelah menaklukkan SMA Hang Kesturi Medan 6448 di GOR Samudera, Jl. Pancing Medan, Sabtu (12/3). Dengan kemenangan itu, tim asuhan pelatih Samuel Hutape di final akan bertemu SMA Methodist 2 Medan, Minggu (13/ 3) sore ini. Methodist 2 melaju setelah meraih kemenangan atas Sutomo 1 Medan dengan skor akhir 68-48. “Anak-anak memang pantas menang, mereka berjuang dengan penuh semangat dan berupaya menghindari kesalahan. Saya berharap penampilan mereka tetap stabil saat tampil di final nanti,” ujar Samuel Hutapea ditemui usai pertandingan, kemarin. Dikatakan, menghadapi Methodist 2 di final, timnya akan bermain dengan kekuatan penuh. “Semua pemain bisa tampil, kami sangat termotivasi untuk bisa mengalahkan Methodist 2 yang saat ini sedang bagus-bagusnya. Mereka juga diarsiteki pelatih berpengalaman dan menjadi satu kebanggaan bisa meraih kemenangan dari mereka,” ujar Samuel, penuh semangat. Bermaterikan salah satu pemain yang memperkuat tim DBL IndonesiaAllStar2010,Youngki,MethodistBinjailangsungmenerapkan permainan cepat dan berhasil unggul telak 25-5 di kuarter pertama. Hang Kesturi berhasil bangkit pada dua kuarter berikutnya untuk memperkecil ketertinggalan menjadi 39-47. Tapi anak-anak Binjai kembali tampil trengginas di kuarter keempat untuk menambah 22 poin berbanding sembilan poin torehan Hang Kesturi. Pada laga sarat gengsi ini, Youngki tampil sebagai pemain terproduktif dengan mengemas 24 poin bagi Methodist Binjai. Pertandingan kemarin juga dimeriahkan dengan kompetisi cheers & dance yang diikuti 21 tim talent. (m42)

Sport A8 Cesar Selamatkan Inter Bolton Tembus ROMA (Waspada): Penjaga gawang Julio Cesar menggagalkan tendangan penalti pada akhir pertandingan yang berkesudahan 1-1, untuk menyelamatkan poin bagi 10 pemain Inter Milan yang bertandang ke Brescia di laga lanjutan kompetisi Serie A Liga Italia, Sabtu (12/3).

Samuel Eto‘o mencetak golnya yang ke-31 musim ini untuk membawa tim juara bertahan itu unggul pada babak pertama sebelum Andrea Caracciolo menyamakan kedudukan enam menit menjelang pertandingan usai. Akan tetapi kemudian pemain cadangan Ivan Cordoba diusir dari lapangan karena menjatuhkan Eder di kotak penalti, namun Cesar berhasil menyelamatkan hasil tendangan Caracciolo dari titik penalti. Caracciolo pun pada akhirnya harus keluar lapangan karena mendapat kartu kuning kedua. Dengan poin yang diperoleh tersebut berarti AC Milan bisa memperpanjang kepemimpinannya dalam Liga Utama Italia (Serie A) menjadi tujuh poin jika mereka mengalahkan tim terbawah Bari pada Minggu. Pelatih Inter Leonardo mengklaim timnya pantas meraih hasil lebih dari sekedar seri. “Kami mempunyai banyak peluang dan mestinya hasilnya berbeda,” katanya. “Pada babak pertama kami bermain seperti yang kami harapkan, unggul lebih dulu dan mengatur permainan dengan baik tetapi pada babak kedua kami kemasukan satu gol dan itu mengubah permainan. “Saya tidak terlalu bersemangat dengan hasil imbang, ini hasil imbang yang aneh karena kami menciptakan banyak peluang dan ini bukan pertandingan khas yang berakhir imbang. “Tetapi yang sudah kami

selesaikan: 11 kemenangan, satu imbang, dan dua kekalahan, kami melakukan pekerjaan dengan baik.” Brescia tetap berada di tempat kedua dari bawah. Tanpa menunjukkan efek dari trauma dan tragedi yang melanda negaranya, Jepang, pemain belakang Yuto Nagatomo melaju ke kotak penalti Brescia pada menit ke-13. Tetapi umpan menyilangnya dibelokkan Jonathan Zebina dan kiper Michele Arcari menerkam bola di belakang. Tim juara bertahan itu unggul lebih dulu pada menit ke18 saat tendangan pojok Wesley Sneijder diteruskan oleh Andrea Ranocchia dan Eto‘o mendorong ke gawang dari dalam kotak penalti. Peluang terbaik Brescia pada babak pertama yang membosankan terjadi pada menit ke-34 saat Panagiotis Kone memainkan bola ke dalam kotak penalti tempat Caracciolo mengangkatnya melewati Cesar tetapi juga melampaui mistar gawang. Inter dengan cepat kembali bangkit dan tendangan Giampaolo Pazzini tidak mencapai sasaran sebelum Arcari keluar dengan cepat untuk menyelamatkan tendangan Goran Pandev. Sneijder kemudian menembak melewati kerumunan pemain dari jarak lebih dari 14 meter namun tendangannya langsung menuju Arcari. 10 Menit menjelang usai Pandev mendapat peluang besar berikutnya dari jarak sekitar tujuh meter ketika diberi umpan oleh Eto‘o namun tembakannya menumbuk wajah Arcari. Namun hanya empat menit kemudian tendangan pojok Alessandro Diamanti diarahkan kembali ke zona rawan oleh Zebina dan Caracciolo menyundul masuk dari jarak dekat. Keadaan bisa lebih buruk

Genoa Tertarik Boateng Kevin-Prince Boateng menjadi salah satu pemain penting di AC Milan musim ini, meski statusnya di San Siro hanya sebagai pemain dengan kepemilikan bersama dengan Genoa. Di awal musim, pemain kelahiran Jerman ini diboyong Genoa dari Portsmouth. Tapi, langsung dipinjamkan ke Milan hingga akhir musim. Tak lama,Wakil Presiden Adriano Galliani memutuskan membeli Boateng dengan status co-ownership. Penampilan pemain 24 tahun ini pun berkembang di bawah asuhan Massimiliano Allegri. Melihat penampilan impresif Boateng, Genoa tertarik mengambil alih secara penuh kepemilikan mantan punggawa Tottenham Hotspur. “Kita akan lihat Mei nanti. Galliani tahu saya tak memberinya hadiah dan dia pun demikian. Ini akan menjadi pertarungan menarik,” tandas Presiden Genoa Enrico Preziosi terkait wacana pembelian Boateng. “Dia akan memberikan penawaran dan saya akan lihat jika memang cukup memuaskan. Tapi, saya pikir kami sudah membuat beberapa perjanjian dengan Galliani jadi kami tak perlu saling berargumen,” pungkasnya.

bagi Inter saat Kone mendekati gawang untuk menjatuhkan satu tendangan voli ke tanah yang menantul dan melebar dari gawang. Drama terakhir terjadi ketika Diamanti mengarahkan Eder menuju gawang dan Cordoba menjegalnya dari belakang, yang langsung mem-buahkan kartu merah. Namun Cesar menjatuhkan diri ke kanan untuk menghentikan hasil tendangan penalti Caracciolo dan berhasil mempertahankan satu poin penting. Saat injury time Caracciolo diusir dari lapangan sebelum Stankovic kembali melakukan penyelamatan bagi Inter setelah Eder berhasil menghindari Cesar. (ant/afp/m47)

Minggu 13 Maret 2011

Semifinal Piala FA BIRMINGHAM, Inggris (Waspada): Bolton Wanderers melangkah ke babak semifinal Piala FA setelah menang atas Birmingham City 3-2 di stadion St Andrews, Birmingham, Sabtu (12/3) malam. Bertandang ke St Andrews, Bolton unggul terlebih dahulu melalui striker Johan Elmander menit ke-21. Elmander sukses lolos dari jebakan offside untuk menerima umpan sundulan Ivan Klasnic dan dengan tenang membobol gawang Birmingham Ben Foster. Birmingham menyamakan kedudukan menit ke-38 melalui Cameron Jerome memanfaatkan kesalahan David Wheater dalam membuang bola. Kedudukan 1-1 bertahan hingga jeda babak pertama. Bolton kembali memimpin menit ke-66 melalui penalti kapten Kevin Davies. Penalti diberikan wasit Phil Dowd setelah Curtis Davies melanggar Davies di kotak terlarang. Kembali tertinggal tidak membuat tuan rumah panik. Terbukti menit ke-80 Birmingham berhasil menyamakan kedudukan melalui Kevin Phillips yang mencetak gol spektakuler dari luar kotak penalti. Kemenangan Bolton akhirnya ditentukan pemain pengganti asal Korea Selatan,

Lee Chung-Yong. Striker internasional Korea Selatan itu berhasil melepaskan sundulan hasil umpan Davies tanpa bisa dihentikan Foster. Kemenangan ini membuat Bolton berhak melangkah ke babak semifinal. Partai perempatfinal lainnya dimainkan Minggu dinihari antara Manchester United melawan Arsenal. Perempatfinal lainnya akan mempertemukan antara Stoke City melawan West Ham United dan Manchester City melawan Reading, yang dimainkan Minggu (13/3) hari ini. Dengan kemenangan ini, Bolton pun berhak maju ke babak semifinal Piala FA yang akan digelar pada 16 dan 17 April mendatang. Birmingham: Foster, Parnaby, Davies, Jiranek (Ridgewell, ’28), Murphy (Derbyshire, ’83), Larsson, Ferguson (Redmond, ’29), Mutch, Beausejour, Phillips, Jerome. Bolton: Jaaskelainen, Steinsson, Cahill, Wheater, Robinson, Elmander, Holden, Muamba (Sean Davies, ’61), Petrov (Taylor, ’90), Kevin Davies, Klasnic (Lee, ’61). (vn/ap/m47)

Marseille Perketat Persaingan Gelar


PEMAIN-pemain Bolton Wanderers mengerubungi Chung-Yong Lee, (tidak terlihat) setelah pemain asal Korsel tersebut mencetak gol ketiga klubnya yang memastikan Bolton menang 3-2 atas Birmingham di perempatfinal Piala FA di stadion St. Andrew’s, Birmingham, Inggris, Sabtu (12/3) malam.

NEW YORK, AS (Waspada): Spencer Hawes dan Elton Brand masing-masing menghasilkan 14 angka untuk membawa Philadelphia 76ers meraih kemenangan 89-86 atas Boston Celtics, di Philadelphia, Sabtu (12/3) Wib. Andre Iguodala menyumbang 13 angka dan Jodie Meeks mencetak 12 angka saat 76ers dengan rekor bermain 34-31 berhasil mengungguli Celtics (46-17), tim pemimpin klasemen Wilayah Timur Celtics.. Celtics bangkit dari defisit 10-poin pada kuarter ketiga sehingga memimpin 81-79 ketika Ray Allen menghasilkan lemparan tiga angka saat waktu tersisa enam menit. Akan tetapi, Philadelphia mengungguli Boston 10-5 dalam perolehan angka ketika Jrue Holiday dan Louis Williams keduanya

PARIS (Waspada): Marseille mengukuhkan kembali usaha mereka meraih gelar dengan kemenangan tandang 2-0 atas Rennes Sabtu (12/3), yang mengangkat tim juara bertahan itu ke urutan ketiga klasemen sementara Liga Utama Prancis. Perjuangan Marseille untuk meraih kejayaan pada tiga turnamen musim ini — pada liga, piala liga dan Liga Champions — pada awal pekan ini tertutup oleh berita tidak menyenangkan di luar lapangan. Pemain asal Brazil Brandao dicoret dari daftar tim setelah ia dituduh melakukan perkosaan. Kemudian digenapi oleh laporan bahwa pelatih Didier Deschamps mungkin meninggalkan Marseille dan kembali ke klub lamanya Juventus. Dan di lapangan, mereka kalah oleh

pemimpin klasemen liga Lille pada akhir pekan lalu. Kendati kehilangan Brandao, Marseille tampil hidup mulai dari babak pertama dengan unggul 1-0, dan bermain bagus usai gol yang dicetak pemain yang dikontrak pada musim panas Loic Remy pada menit ke-24 itu. Marseille akhirnya membuahkan gol kedua hasil kerjasama Jordan Ayew, saudara kandung Andre yang mengantikan Gignac pada menit ke-80, memanfaatkan kesalahan pertahanan dari Jean-Armel Kana-Biyik. Ayew kemudian menahan bola di sisi kiri sebelum mengarahkannya kepada Lucho yang berhasil memperdaya Douchez dengan tendangan rendahnya. Marseille naik ke urutan ketiga dengan 48 poin.(ant/afp/m47)

Para Mantan Juara Melaju Di Indian Wells

76Ers Kalahkan Celtics menghasilkan “jump shoot” untuk memastikan kemenangan. Jeff Green mencetak angka tertinggi dalam pertandingan tersebut, 18 poin, bagi Celtics sementara Nenad Krstic menyumbang 16 poin dan 15 rebound. (ant/rtr/m47) Hasil pertandingan Sabtu: NEW JERSEY 102 LA Clippers 98 (OT) PHILADELPHIA 89 Boston 86 TORONTO 108 Indiana 98 CHARLOTTE 97 Portland 92 CHICAGO 94 Atlanta 76 MINNESOTA 122 Utah 101 OKLAHOMA CITY 104 Detroit 94 SAN ANTONIO 108 Sacramento 103 GOLDEN STATE 123 Orlando 120 (OT)

Juve Bidik Mazzari

INDIAN WELLS, California (Waspada): Para petenis putri mantan juara di turnamenWTA Masters 1000 Indian Wales, di California, AS, terus melaju tak tertahankan ke putaran ketiga setelah berhasil mengatasi hadangan lawan masing-masing dengan kemenangan dua set langsung Sabtu (12/3) Wib. Petenis peringkat dua dunia Kim Clijsters yang merupakan juara turnamen ini pada 2003 dan 2005 mengalahkan Alla Kudryavtseva dari Rusia dengan kemenangan meyakinkan 6-2, 6-0 pada putaran kedua turnamen lapangan keras itu. Juara bertahan Jankovic secara dominan berhasil mengalahkan Coco Vandeweghe dari Amerika Serikat 6-2, 6-1 dengan pukulan-pukulan kerasnya. Sementara pada pertan-

dingan sebelumnya Ana Ivanovic, yang merupakan juara turnamen ini tiga tahun lalu, juga berhasil mengalahkan petenis Jepang Kimiko DateKrumm 6-4, 6-2, pada Jumat. Unggulan kedua Clijsters hanya membutuhkan 52 menit untuk menundukkan Kudryavtseva, dan selanjutnya dia akan bertemu Sara Errani petenis Italia yang mengalahkan Jarmila Groth 7-5, 4-6, 6-2. Ketika menjadi juara turnamen ini pada 2005 Clijsters hanya merupakan petenis peringkat 133 dunia. Clijsters berhasil meluncurkan tiga kali servis yang tak bisa dikembalikan oleh Kudryavtseva, mencuri enam dari sembilan “break-point” dan merebut 65 persen poin keseluruhan, dan menyelesaikan babak kedua

hanya dalam waktu 21 menit. Jankovic memulai upaya mempertahankan gelarnya dengan cara yang tidak kalah meyakinkan, meluncurkan empat “ace” dan merebut 80 persen (20 dari 25) poin dari servis pertama. Jankovic sedang mencoba menjadi wanita pertama setelah Martina Navratilova pada 1990-91 yang jadi juara Indian Wells dua kali berturut-turut. Pada putaran ketiga nanti Jankovic sudah ditunggu oleh Julia Goerges dari Jerman yang sebelumnya mengalahkan Sybille Bammer 6-1, 6-3. Pertandingan lain, juara Prancis Terbuka Francesca Schiavone dari Italia mendominasi petenis Rep. Ceko Zuzana Ondraskova 6-2, 6-0. (ant/afp/m47)

MLS Berupaya Pikat Lebih Banyak Lagi Bintang

Walter Mazzarri, menjadi salah satu kandidat untuk menjadi pembesut klub serie A Liga Italia Juventus musim depan, seandainya klub itu jadi memecat Luigi Del Neri di akhir musim. Seperti diketahui, masa depan Del Neri bersama Juven-tus memang tengah terancam. Pasalnya, prestasi yang diraih Bianconeri belakangan ini sangat buruk. Beberapa nama mencuat untuk mengisi posisi itu musim depan. Mereka adalah Luciano Spalletti, Andre Villas Boas, Claudio Gentile, mantan bintang Juventus, Gianluca Vialli dan Fabio Capello. Kini, nama Mazzarri juga sudah mulai masuk ke dalam bursa calon pelatih Bianconeri pada musim depan. Mazzarri bergabung dengan Napoli, pada Oktober 2009 lalu. Sejak kedatangannya, prestasi tim berjuluk Partenopei mulai melejit. Salah satunya, membawa Edinson Cavani dkk ke pentas Europa League awal tahun ini. Namun, ketertarikan Juventus itu membuat Aurelio De Laurentiis kebakaran jenggot. Presiden Partenopei menegaskan tidak akan melepas Mazzarri, karena sang pelatih masih memiliki kontrak untuk melatih Cavani dkk. “Jangan dekati pelatih kami. Jika ada seseorang yang tidak berada dalam bursa transfer, maka orang itu adalah Mazzarri. Ini sangat sederhana seperti itu. Juventus tidak bisa mendapatkannya hingga 2016 mendatang,” tandas De Laurentis.

Ledley King Belum Pulih Lama tidak terdengar kabar kondisi Ledley King, yang masih berada di bawah pantauan tim medis Tottenham Hospur, sang arsitek, Harry Redknapp akhirnya mengeluarkan statement yang bernada mengkhawatir-kan. Secara terang-terangan, Redknapp mengatkan bahwa salah satu palang pintu itu diragukan bisa pulih seperti sedia kala. Redknapp memang patut cemas terkait persoalan klasik yang menimpa pemain berusia 30 tahun itu. Betapa tidak, King tidak bermain sejak 16 Oktober 2010 silam. Artinya, lima bulan sudah King tergolek di ruang perawatan untuk mengatasi cedera pangkal paha yang membebatnya Sabtu (12/3), Redknapp mengatakan King tidak bisa menjalani sesi latihan dengan maksimal. “Dia memiliki masalah dengan pangkal pahanya dan saya benar-benar tidak yakin. Saya berjudi dengan dia pada Rabu malam (lawan AC Milan),” sungut Redknapp yang sempat mencandangkan King saat jumpa Milan di leg kedua Liga Champions.(goal/fi/m47)



PEMAIN Boston Celtics, Kevin Garnett (5) mempertahankan bola dari upaya pemain Philadelphia 76ers’ Andre Iquodala (9) ketika dia mencoba mencetak angka di lanjutan kompetisi NBA di Philadelphia, AS, kemarin (12/3). 76ers menang 89-86.

SETELAH datangnya bintang asal Inggris David Beckham (foto), dan pengatur serangan dari Prancis Thierry Henry, Major League Soccer (MLS) berusaha dan memikat lebih banyak lagi pemain berbakat dari tim-tim Eropa untuk mengangkat status mereka di dunia. “Kami harus membawa nama-nama yang lebih besar dan pemain internasional yang lebih populer jika kami ingin menjadi liga seperti yang kami inginkan,” kata komisaris MLS Don Garber, kemarin (12/3), empat hari sebelum liga Amerika Utara itu memulai musim ke-15. Beckham memasuki musim terakhirnya bersama Los Angeles Galaxy pada musim ini sementara Henry mengawali musim penuh pertamanya bersama New York Red Bulls. Garber mengatakan, dikontraknya Beckham telah menjadi sukses besar bagi liga tetapi diperlukan lebih banyak kontrak-kontrak besar lagi untuk mengangkat liga tersebut di antara saingan-saingannya secara global dan meningkatkan status sepak bola di antara ligaliga olah raga AS. “Anda akan mulai melihat makin banyak dan makin banyak nama pemain yang mengikuti MLS karena kami mampu bayar mereka,” kata Garber. “Para pemain terbaik di dunia sebagian besar tidak ada disini. Agar kami berkompetisi... kami harus mengembangkan bisnis sehingga beberapa orang terbaik di dunia ada di sini. “Kami berharap kami akan membawa liga kami lebih dekat menuju tujuan kami menjadi salah satu liga sepak bola terbaik di dunia.” Liga yang diikuti 18 tim tersebut di antaranya debut tim Vancouver dan Portland musim ini dan menambah tim di Montreal tahun depan. Sementara, Beckham mengatakan ia dalam keadaan sehat memasuki musim terakhirnya bersama Los Angeles Galaxy namun belum pasti apakah ia akan main untuk terakhir kalinya bagi klub Inggris. Dalam pembicaraan secara “online” dengan fans melalui laman ESPN, bintang sepak bola berusia 35 tahun itu mengatakan ia siap menghadapi pertandingan pembuka musim Major League Soccer, Selasa, di Seattle, musim kelimanya di liga AS. “Saya gembira. Saya siap menghadapi musim

ini,” kata Beckham. “Saya ingin memastikan bahwa kebugaran saya benar. Itulah mengapa saya pergi ke Tottenham. Saya bekerja keras.” Beckham, yang sudah mencetak sembilan gol bagi Galaxy setelah sebelumnya menjadi bintang di Manchester United dan Real Madrid, absen enam bulan karena cedera pada otot Achilles kiri. “Saya katakan saya 100 persen saat ini,” kata mantan kapten timnas Inggris itu. “Musim lalu sulit karena cedera. Tetapi saya sudah berlatih keras musim ini dan badan saya sudah kembali ke kondisi yang saya butuhkan,” tambahnya. (ant/afp/m47)

Mode & Masakan

WASPADA Minggu 13 Maret 2011

Tumisan Praktis Menu tumisan praktis yang satu ini mudah dibuat dan memiliki cita rasa yang lezat. Bahannya juga mudah didapat. Praktekan dan sajikan untuk keluarga sehingga menjadi salah satu lauk favorit mereka.

Tumis Daging dan Jamur Bahan : 250 gr jamur champion 100 gr daging sapi (direbus & dipotong2 ) 1 buah cabe hijau, iris serong 1 buah cabe merah besar, iris serong 2 buah cabe merah kecil, iris serong 3 buah bawang merah, iris 2 buah bawang putih, iris 1/2 bawang bombay ukuran sedang, iris tipis garam gula kecap, saos tiram Cara membuat : Tumis, bawang bombang, bawang putih, bawang merah, cabe sampe harum masukkan daging, beri air sedikit tambahkan garam, gula, kecap, saos tiram, cicipi rasanya terakhir masukkan jamur, masak hingga matang jamur dimasak sebentar aja, dan airnya jgn banyak2 krn jamur nya sdh berair.

Tumis Daging dan Jamur

Tumis Daging dan Brokoli

Bahan: 150 g brokoli, potong menurut kuntum 200 g daging sapi, potong tipis 100 g paprika merah, potong dadu 50 g bawang bombay, potong bentuk korek api 3 siung bawang putih, cincang 150 ml air 1 sdt biji wijen 4 sdm minyak goreng

2 sdm saus tiram ½ sdt lada halus ½ s dt garam halus Cara Membuat: Panaskan minyak, tumis bawang putih, bawang bombay dan wijen hingga harum. Masukkan potongan daging, masak hingga daging berubah warna. Tuang air, brokoli, paprika, lada, garam, dan saus tiram. Masak sambil diaduk-aduk hingga semua bahan matang. Angkat. Tuang ke dalam pinggan saji. Hidangkan. * Tri / Taste


Sajian Nan Sedap Dan Gurih

AlA PelitA Resto

MENCARI makanan berselera di arena hiburan di Genting Kuala Lumpur, ternyata tidaklah sulit. Mampir ke Resto Pelita adalah alternatif yang tepat untuk mendapatkan makanan Melayu dan sedikit bumbu Indonesia yang terasa enak dan gurih. Sistem pesan makanan dan pilih menu yang disukai memberi kemudahan tersendiri bagi pengunjung restoran yang dikelola oleh Suradi Disar . Pilihan menu seperti nasi ayam dara, semangkuk tomyam seafood, gulai ikan asam manis, mie kuah dan sepiring lalapan aneka sayur mayur mampu menggugah selera. Jika ingin mencoba minuman hangat seperti teh tarik tanpa gula, atau perpaduan teh tarik dengan sedikit kopi bisa dipesan di tempat ini. Namun kebanyakan para pengunjung memilih teh dipadu dengan sedikit es batu. Rasanya akan lebih segar bila disiram sedikit perasan lemon yang bisa pesan kepada petugas di resto itu. Harga makanan di tempat ini lumayan murah antara 6 sampai 10 Ringgit saja. Naskah dan foto : Anum Saskia

Mie kuah

Seorang pengunjung nampak menikmati aneka makanan pilihannya.

Tumis Daging dan Brokoli

Nasi Ayam Dara

Tomyam seafood




Minggu 13 Maret 2011

Dra Hj Elsa Susanti

Memilih Usaha Di Rumah Demi Anak KEGIGIHANNYA memanfaatkan dan mengelola keterampilan bidang desainer selama bertahun-tahun, mulai menuai hasil. Meski awalnya hanya kecilkecilan dan mengandalkan pelanggan teman sejawat, tetapi akhirnya usaha jahit menjahitnya semakin berkembang. Berkat dukungan keluarga dan kesabarannya mempertahankan usaha yang dirintisnya ini, kini Elsa merasa semakin mampu menjalankan usahanya ini bahkan sudah mencoba mengembangkan bisnis lainnya. Ditemui Jumat lalu di ruang usaha menjahit sekaligus tempat tinggal di Jalan Tri Tura Medan, Elsa menuturkan perjalanan usahanya yang tidak mudah, tetapi dia selalu berupaya agar apa yang dia inginkan dapat terwujud. Pilihannya untuk berkarir di rumah meski menyandang gelar sarjana menurutnya adalah

langkah yang tepat. Meski awalnya, dia juga ingin seperti teman kulihanya yang berlomba-lomba mencari pekerjaan dengan karir di luar rumah. Namun akhirnya dia dapat meredam keinginan itu dan yakin bahwa Allah telah menetapkan rezeki seseorang dengan cara yang berbeda. “Ya, kebetulan saya punya kemampuan bidang desainer, langsung saja dimanfaatkan. Sambil membuka usaha jahitan di rumah. Pekerjaan itu sekaligus mempermudah saya untuk bisa mendampingi anak-anak dalam setiap perkembangan mereka,” ujarnya yang mengaku meski sibuk dengan usaha, tapi menyempatkan diri untuk berlibur bersama keluarga . Elsa mengakui , dalam perjalanan usahanya ini, ia tidak berjalan sendiri. Artinya, seluruh keluarga turut memberikan dukungan. Utamanya suami tercintanya, Trisna Yusrizal

SE, yang terus memberikan dukungan dan perhatian penuh terhadap berbagai hal yang dia inginkan. Demikian juga buah hatinya, Fitria Febrina, M Rizky Fadhillah, Asyita Salsabilla, Raissa Khansa Shafira, adalah permata yang selalu menjadi sumber inspirasi baginya untuk berkarya bidang desainer ini. “Saya sangat bersyukur diberikan Allah anak-anak yang cerdas dan ceria seperti mereka. Dari aktivitas yang mereka lakukan sehari-hari dan dari beragam keinginan mereka yang harus dipenuhi, seringkali menjadi ide terbaru bagi saya untuk melahirkan karya jahit menjahit ini. Unik dan menarik, begitu yang terpikir oleh saya saat karya saya itu disampaikan pada pelanggan dan mereka menyetujuinya,” tukas Elsa yang mengaku promosi usahanya ini dari teman,keluarga dan pelanggan setianya . Apalagi dari empat orang buah hatinya itu, seorang dari mereka sudah ada yang

ingin mengikuti jejaknya menjadi seorang desainer. Melihat peluang usaha dibidang desainer ini mengalami kemajuan,akhirnya Elsa memutuskan untuk membuka boutiqe sekaligus usaha loundry dry cleaning. Hal itu, kata Elsa seiring sejalan dengan karir yang sedang dia geluti. Isteri Trisna Yusrizal SE ini tidak menepis jika akhirnya semua impiannya menjadi seorang pengusaha berbakat terwujud. Meski begitu, dia mengaku belum ada apaapanya, karena apa yang dia raih saat ini harus dipertahankan dan disyukuri dengan terus melakukan inovasi dan kreasi terhadap usahanya. Apalagi, seiring kemajuan zaman, tentulah masyarakat selalu punya keinginan yang berbeda terhadap hasil karya seorang desainer seperti dirinya. “Saya tidak boleh puas dengan apa yang saya miliki saat ini. Artinya, saya harus mengembangkan potensi

diri dan kemampuan dibidang desainer ini, seiring perubahan waktu tentu semakin banyak keinginan masyarakat bidang desain dan mode, sehingga dengan pengembangan dan pembelajaran yang saya lakukan, maka kreasi saya tidak ketinggalan zaman,” turturnya yang mengaku dalam menjalankan usaha ini banyak sekali kendalanya, namun berkat keyakinannya bahwa usaha itu akan sukses, maka dia mampu melewati berbagai masalah yang dia hadapi dan selalu berdoa kepada Allah untuk diberikan kemudahan dalam melakukan niatnya . Bagaimana dengan pendidikan anak-anak? “Pendidikan untuk mereka, saya utamakan pendidikan agama. Sejak kecil, anak-anak harus belajar mengaji.Bahkan anak pertama saya, sekolahnya di madrasah aliyah. Semua ini saya harapkan menjadi bekal buat mereka untuk menjalani hidup. Dalam

keseharian saya selalu memantau kegiatan keagamaan mereka. Insyaallah semua berjalan lancar dan mereka tumbuh menjadi anak yang melaksanakan kegiatan keagamaan dan menjadi sosok yang penurut pada orang tua dan menjadi sosok yang disukai keluarga besar lainnya,” ucap perempuan yang juga aktif dalam berbagai kegiatan pengajian dan sosial di Medan ini. * Anum Saskia


Kualitas Hidup Perempuan Masih Rendah

Kunjungan Remaja Cares Ambassador ke pasien kanker servik di RSCM Jakarta


Beri Pemahaman Remaja Perduli Kesehatan Reproduksinya DI TENGAH arus modernisasi dan kemudahan teknologi seperti saat ini, kepedulian generasi muda pada masalah kesehatan reproduksi sudah menjadi keharusan. Pasalnya, arus modernisasi yang tidak diimbangi dengan pengetahuan dan benteng keimanan, akan membawa remaja pada jalan yang salah. Seks bebas dan jeratan narkoba senantiasa mengancam kesehatan reproduksi remaja dan masa depan mereka. Semangat menebarkan pengetahuan dan kepedulian remaja tentang kesehatan reproduksinya itu yang mengilhami sebuah organisasi sosial bernama Inisiatif Pencegahan Kanker Serviks Indonesia (IPKASI) untuk fokus pada usaha pencegahan kanker serviks di Indonesia, khususnya di kalangan remaja. Ketua IPKASI, dr Fredrico Patria, SpOG saat kunjungan Cares Ambassador kepada sejumlah pasien kanker serviks di RS Cipto Mangunkusumo, Jakarta mengatakan, saat ini posisi penyakit menular sudah

bergerser sebagai penyebab kematian utama di Indonesia. Kanker serviks, kata dia, merupakan salah satu kanker pada perempuan yang paling banyak. Setiap satu jam, 1 perempuan meninggal karena kanker serviks. “Sayangnya, pada umumnya perempuan Indonesia memeriksakan dirinya saat sudah terkena kanker serviks pada stadium lanjut sehingga menyebabkan kematian. Akibatnya, kanker serviks menimbulkan beban kesehatan, ekonomi dan sosial bagi perempuan dimanapun dan juga bagi keluarganyam,”kata Fredrico. Ditambahkan, setiap perempuan berisiko terinfeksi human papilloma virus (HPV) penyebab kanker serviks (onkogenik). HPV onkogenik tipe 16 dan 18 secara bersamaan merupakan penyebab terbanyak kejadian kanker serviks. Adapun masa inkubasinya bervariasi antara 5-15 tahun. “Tapi kanker serviks sangat dapat dicegah, melalui pencegahan primer yaitu

informasi dan vaksinasi, serta pencegahan sekunder yaitu deteksi dini melalui pap smear atau IVA. Vaksinasi yang dilakukan bersamaan dengan deteksi dini dipercaya dapat menurunkan angka kanker serviks,” kata dia. Di sisi lain, yang lebih penting adalah melakukan gaya hidup sehat seperti sering berolah raga, makan makanan bergizi, tidak merokok, tidak minum alkohol. Bila perlu, melakukan cek pap smear dan vaksinasi kanker serviks. Jovanka, salah satu dari 10 cares ambassador yang datang mengunjungi pasien kanker serviks di RSCM mengaku sangat bangga bisa terpilih sebagai salah satu nominasi cares ambassador. Gadis 14 tahun asal Jakarta itu mengaku akan menularkan pengetahuannya seputar kesehatan reproduksi remaja kepada teman-temannya. “Yang penting kita jadi bisa jaga diri. Jaga kehormatan kita adalah yang utama, supaya masa depan lebih baik,” ujar Jovanka. (dianw)

BELUM lama ini, tepatnya 8 Maret 2011, sebagian besar perempuan di sejumlah belahan dunia memperingati 100 tahun peringatan Hari Perempuan Internasional (HPI). Di Indonesia, sejumlah aksi demonstransi oleh kaum perempuan mewarnai derap langkah pembangunan yang dinilai masih belum sepenuhnya berpihak pada kaum hawa. Berbagai catatan buram kondisi perempuan di Indonesia saat ini, sepertinya masih mengemuka di tengah sekian banyak kemajuan yang sudah dicapai dalam era kesetaraan gender seperti saat ini. Berbagai kebutuhan dasar seperti pendidikan, kesehatan hingga keterlibatan sebagai pengambil keputusan di tingkat elit politik seolah masih menjadi harga mahal. Tidak mengherankan kualitas hidup perempuan pun secara umum masih rendah, termasuk jika merujuk pada tingginya angka kematian ibu (AKI) yang kini masih sebanyak 207/100 ribu kelahiran serta angka putus sekolah dan buta aksara di kalangan perempuan yang dua kali lipat lebih banyak dari kaum pria. Di sektor pekerja informal seperti para TKW yang bekerja sebagai penatalaksana rumah tangga (PLTR) di berbagai negara di Asia dan Timur Tengah kondisinya pun banyak yang memilukan. Kasus terbaru adalah yang menimpa Darsem. Kisah darsem kembali menarik perhatian publik terhadap

TKI karena dia diancam hukuman mati akibat terbukti membunuh majikan yang hendak memperkosanya. Darsem terbukti bersalah karena membunuh majikan yang akan memperkosanya. Dia bisa bebas jika bisa membayar denda kompensasi terhadap keluarga majikannya sebesar dua juta riyal atau setara dengan Rp 4,7 miliar. Lembaga Bantuan Hukum (LBH) Jakarta, melalui Kepala Divisi Penelitian dan Pengembangan, Restaria Hutabarat mempertanyakan keseriusan pemerintah dalam menangani berbagai kasus yang dialami TKI di luar negeri. Dari catatan yang ada, kematian TKI akibat berbagai kasus angkanya masih signifikan. Pada 2007 jumlahnya mencapai 2081 kasus; 2008 turun menjadi 494 kasus; 2009 naik lagi menjadi 1107 kasus; 2010 kembali turun menjadi 908 kasus hingga totalnya mencapai 4.590 kasus. “Karenanya, dalam HPI tahun ini, perlindungan TKI harus menjadi perhatian utama Pemerintah dan DPR RI. Sebab 79% TKI adalah perempuan yang 88% bekerja di sektor informal. Mereka ini adalah pekerja perempuan yang luput dari perhatian dan perlindungan hokum,” kata Restaria saat temu pers peringatan HPI ke-100 tahun di Kantor Komnas Perempuan, Jakarta, Selasa (8/ 3). Kisah Para Migran Hari perempuan Internasional (HPI) yang dirayakan se-

Waspada/Anum Saskia

pada tahun 2010 meningkat sebanyak 32% yang didominasi seputar kasus kekerasan dalam rumah tangga dan pelanggaran hak perempuan dalam perceraian. “Itu tidak termasuk perempuan yang di-PHK dengan korban sebanyak 11 orang pelanggaran hak atas tempat tinggal dengan korban sebanyak 470 KK, hak atas kesehatan dengan korban sebanyak 2 orang, kekerasan dalam rumah tangga 3 orang serta pelanggaran hak TKI 5 orang,” imbuh dia. Dilihat dari pekerjaan para pengadu (stakeholder) yang datang ke LBH Jakarta, peringkat tertinggi ke-3 ialah ibu rumah tangga dan 40% pengadu LBH Jakarta berjenis kelamin perempuan. Jumlah dan persentasi tersebut menggambarkan bahwa perempuan adalah subjek aktif pencari keadilan di Jakarta dan sekitarnya. Abainya Pemerintah dan DPR dalam memperjuangkan kesetaraan kedudukan antara kaum laki-laki dan perempuan di Indonesia juga terlihat dalam sistem penegakkan hukum yang sampai hari ini masih belum berpihak pada perempuan. Dalam proses penanganan kasus-kasus perempuan di LBH Jakarta seringkali dalam penegakkan hukum mengalami kendala yang sama yaitu “undue delay” dan “revictimisasi” (menjadi korban berulang kali). Restaria mencontohkan, dalam penanganan kasus perkosaan, seorang perempuan

yang sudah bersusah payah menjadi saksi dan berjuang demi kebenaran terpaksa harus gigit jari karena kasusnya tidak segera ditindaklanjuti oleh aparat berwenang. “Aparat penegak hukum yang belum memiliki perspektif yang benar dalam penangan kasus-kasus perempuan mengakibatkan korban kembali mengalami tekanan secara psikis, proses penyidikan yang sangat lamban hampir memakan waktu 1 tahun samapai akhirnya dinyatakan P-21,” kata Restaria. Dalam keseluruhan kasus tersebut, dia mengatakan betapa negara telah terlibat sebagai pelaku kekerasan secara tidak langsung, karena tidak menindaklanjuti bahkan mengabaikan pengaduan perempuan. Sementara di level kebijakan, LBH Jakarta menemukan sejumlah RUU yang ditujukan untuk melindungi perempuan mandek dalam proses legislasi seperti RUU Hukum Acara Pidana, RUU Kitab Undang-undang Hukum Pidana, RUU terkait TKI, RUU Pekerja Rumah Tangga, serta Ratifikasi Konvensi Migran 1990. “Berdasarkan data-data di atas, maka kami menilai bahwa negara telah gagal menciptakan sistem hukum yang melindungi perempuan. Untuk itu, perbaikan-perbaikan di bidang hukum harus segera dilakukan, khususnya yang berdampak langsung terhadap perempuan,” tandas dia. (dianw)

IIDI Bakti Sosial

Periksa Mata Dan Beri Kacamata Pada Siswa UNTUK memastikan kondisi kesehatan mata ratusan para pelajar SD di Kelurahan Ladang Bambu Medan Tuntungan, Ikatan Isteri Dokter Indonesia (IIDI) Cabang Medan menggelar bakti sosial pemeriksaan kesehatan mata dan pemberian vitamin A. Kegiatan berlangsung 14 Februari lalu di SD 06402

bekerjasama dengan FK USU yang dihadiri langsung oleh Kepala Bidang Pengabdian Masyarakat dr Mutiara Indahsari M.Kes. Program yang diselenggarakan IIDI ini sekaligus memastikan bahwa para pelajar di sana bebas dari penyakit yang berhubungan dengan mata. Menurut Ketua IIDI

Manfaatkan Pekarangan Jadi Sentra Ekonomi

HARI Perempuan Internasional di Sumatera Utara tanggal 8 Maret lalu ditandai juga dengan seminar tentang berbagai kasus yang mendera perempuan dengan berbagai topik antara lain, Kekerasan Dalam Rumah Tangga (KDRT), HIV/AIDS, maupun incest. Dilaksananakan Jaringan aktivis pendukung gerakan perempuan Sumatera Utara (Jarak), Perkumpulan Sada Ahmo dan Koalisi Perempuan Indonesia, di Asean Hotel Medan. Hadir sejumlah anggota DPRDSU antara lain, Nurhasanah S.Sos (kanan), Ristiawati sejumlah LSM Perempuan dan anak serta aktivis perempuan.

tiap tanggal 8 Maret sangat erat kaitannya dengan kisah para pekerja migran dunia. Pada tahun 1911 di bulan maret, 146 pekerja perempuan tewas dalam kebakaran di pabrik Triangle Shirtwaist di New York, mereka adalah para pekerja migrant yang tidak dilindungi oleh sistem keselamatan dan kesehatan kerja. Tragedi ini menarik perhatian publik yang akhirnya mendorong perubahan kebijakan perburuhan di USA. Sejak saat itu, 8 Maret disepakati sebagai Hari Perempuan Internasional (International Women’s Day) yang dirayakan setiap tahunnya di seluruh dunia. Bahkan di beberapa Negara 8 Maret dijadikan hari libur resmi. Tuntutan perlindungan perempuan berkembang bukan hanya di bidang pekerja, tetapi hak untuk memilih, tidak didiskriminasi untuk menduduki jabatan publik, aktif dalam dunia politik dan bebas mengemukakan pendapat. Meski 100 tahun telah berlalu sejak HPI dirayakan pertama kali, situasi perlindungan HAM perempuan di Indonesia tidak banyak mengalami perubahan. Alih-alih melindungi perempuan, justru banyak kebijakan dan pernyataan yang dikeluarkan justru melemahkan perlindungan perempuan, buruh perempuan dan TKW di luar negeri. Dikatakan Restaria, LBH Jakarta mencatat berbagai pelanggaran hak perempuan dari tahun ke tahun. Bahkan

UNTUK meningkatkan pendapatan dan perekonomian keluarga, kader PKK Desa Galang Suka, Kec.Galang memanfaatkan areal halaman/ pekarangan rumah dengan menanam berbagai tanaman perkebunan serta memproduksi sejumlah kerajinan tangan. Antusias para kader dilakukan setelah desa tersebut ditetapkan menjadi pilot proyek sentra ekonomi binaan PKK Deliserdang. Selain membuat berbagai kerajinan tangan serta memahami manfaat halaman atau pekarangan rumah sebagai salah satu sentra ekonomi keluarga, para kader PKK Desa Galang Suka memanfatkan halaman atau pekarangan rumahnya untuk menanam berbagai tanaman. “Bahkan, ada kader yang memanfaatkan halaman rumahnya untuk lahan pembibitan pohon kelapa sawit, pohon karet dan tanaman produktif lainnya,” jelas Camat Galang H Hadisyam Hamzah, baru-baru ini. Sedangkan, bagi warga yang tidak memiliki halaman yang cukup luas, diberikan pelatihan bordir, sulam dan home industri lainnya seperti pembuatan keripik, peyek, opak dan aneka ragam kue. Program yang telah dicanangkan Ketua TP PKK Deliserdang Ny Hj Anita Amri Tambunan dan menetapkan Desa Galang Suka sebagai pilot proyek sentra ekonomi merupakan gagasan yang harus di syukuri warga karena hasilnya mampu menambah perekonomian keluarga. Karenanya, pemanfaatkan pekarangan sebagai sebagai salah satu sentra ekonomi merupakan suatu gagasan yang dapat memberi income bagi keluarga yang muaranya juga dapat mengentaskan kemiskinan. (a06)

Cabang Medan, Ny Iskandar Hasibuan bersama Seksi Kesra Ny Linda Gontar Alamsyah Siregar,dari 118 anak yang diperiksa kondisi kesehatan matanya, ada 6 anak yang mengalami masalah. Dari pendataan itu, akhirnya pihak IIDI memberikan kacamata gratis kepada siswa. “Dari ratusan anak yang diperiksa matanya oleh tim dokter, ternyata ada yang mengalami masalah dan memerlukan kacamata. Pihak IIDI memberikan kacamata kepada para siswa, agar mereka tidk mengalami kendala dalam proses

belajar di sekolahnya. Kami merasa bahagia bisa turut meringankan beban orang tua siswa dengan pemberian kacamata itu, agar anakanak sebagai generasi muda bangsa ini tidak menemui kendala dalam proses belajarnya di sekolah maupun di rumah karena sudah dibantu dengan kacamata untuk membaca,”kata Linda. Hal lain yang disampaikan Linda bahwa tanggal 16 Maret mendatang dilaksanakannnya ceramah tentang pencegahan dan penanggulangan bahaya narkoba, HIV/AIDS,

merokok dan dampak negatif physiologis pada anak akibat teknologi informasi bagi siswa SMP dan SMA serta warga masyarakat. Kegiatan juga bekerjasama dengan FK USU melalui seksi pendidikan. “Program sosialisasi dan pembinaan bagi masyarakat di Kelurahan Ladang Bambu Medan Tuntungan ini sebagian dari program IIDI, semoga kami bisa berbuat lagi untuk masyarakat dalam cakupan yang lebih luas,” kata Ny Iskandar bersama wakilnya Dr Ny Rahayu Khairul Yoel, kemarin. * Anum Saskia


Ny Iskandar Hasibuan menyerahkan kacamata untuk siswa kepada kepala sekolah.


WASPADA Minggu 13 Maret 2011


Langit Berduka

Puisi Puisi Karya: Ayu Harahap



ANDIEN gak habis pikir kenapa Langit tak kunjung menghubunginya. Padahal Sabtu kemarin sepulang dari sekolah mereka sudah janjian akan bertemu, Minggu sore ini. Penantian Andien terasa semakin lama, karena kegelisahan yang mulai merajai sisi hatinya. “Tidak biasanya Langit begini, biasanya dia pasti sms kalau ada apa-apa. Kenapa dia melupakan janjinya sendiri ya?” Tak sadar Andien bergumam di dekat Mama yang sedang asyik menonton FTV. Mendengar keluhan Andien, sejenak mata Mama memandang ke arah remaja enam belas tahun itu. Dari tadi Mama memang memperhatikan putri ke duanya itu terlihat gelisah. Masuk kamar, keluar lagi, lihat jam… terus melirik ke luar… “Kamu sedang menunggu seseorang, Ndien? Memangnya kalian mau kemana? Mama bertanya dengan nada menyelidik. Dia memandangi dandanan Andien yang tampak tak biasa. Sore itu puterinya terlihat cantik sekali, atasan gaun berwarna ungu muda dengan padanan rok kembang-kembang ungu. “Iya Ma, Andien lagi nungguin Langit. Kami janjian sore ini mau ke Mal Ma…rencananya mau membeli kado buat Mamanya. Hari Senin besok, Mamanya Langit berulang tahun. Jadi Langit minta tolong Andien untuk pilihkan hadiah buat Mamanya. Tapi sekarang udah hampir jam lima, kok Langit gak datang-datang ya…Sms juga enggak…” “Kenapa gak kamu aja yang coba hubungi…siapa tahu dia lupa, atau mendadak ada sesuatu.. ”Mama memberi masukan. “Tapi..Ma..Andien kan sungkan…ntar dikirain gak sabaran. Lagian kan Langit yang ngajak kemarin…” Andien mencoba bertahan. “Lho..kan gak ada salahnya kamu mencoba menghubungi..Dien…kan

maksudnya baik, apakah dia terlupa dengan janjinya… atau jangan-jangan hp nya hilang…lagi…” Kemudian Andien mencoba saran Mamanya… dia memijit nomor hp Langit… Sejenak dahinya berkerut ternyata hpnya mati… Andien jadi penasaran. Diliriknya kembali Mama, yang ternyata masih menatapnya juga… “Udah hubungi ke rumahnya aja..siapa tahu ada di rumah…” “Iya deh…coba telfon ke rumahnya aja…”Andien mengikuti anjuran Mamanya lagi dan beranjak ke meja telfon. Perlahan dia memijit, kemudian terdengar nada sambung di seberang sana. Lama Andien menanti hingga nada sambung terhenti sendiri, tak ada yang mengangkat di seberang sana. Berarti rumahnya Langit sedang kosong…duga Andien. Pada ke mana ya, mereka… padahal di rumahnya kan ada Mbok Nah dan Mbak Surti yang bantuin Mamanya beres-beres rumah. Ah..coba lagi aja… Andien kembali memijit nomor telfon rumah Langit… dan hasilnya sama…tak ada yang mengangkat… Rasa penasaran semakin merajai hatinya. Ada apa denganmu Langit? Andien sejenak termenung…dia memegangi hp…tiba-tiba hp nya bernyanyi…Sejenak senyum tersungging di bibirnya… .tapi itu Cuma sejenak… karena saat matanya menatap layar blackberry nya, tercantum nama Galih di sana…. Hm….ternyata bukanlah orang yang dinantinya… Dengan berat hati Andien menerima juga panggilan dari Galih…

Sebutir ragu dalam nanar hati Menguji celah rasa sendu keikhlasan Aral menjarak sepi layarkan gelisah Pada pucuk lembar kehidupan

bersinar wajahmu bagai cahaya selembut kasihmu bagai sutra bagai bintang yang terus bersinar cintamu tak pernah pudar engkaulah pelipur laraku engkaulah bintang di hatiku air wudhu yang selalu membasahi wajahmu hiasan indah di duniaku ibu... engkau bagai matahari yang terus menyinariku lelahmu adalah semangatku engkau lampu penerangan cintamu penuh ketulusan

“Halo Lih….”sahut Andien seolah tak bertenaga. Dia benar-benar sudah kehilangan semangat..karena kecewa menunggu Langit yang tak kunjung terlihat batang hidungnya. “Ndien…..kamu udah dengar kabar belum?”Galih yang juga teman sekelasnya langsung aja nyerocos tanpa basa basi. Lalu Galih melanjutkan pembicaraannya…”Barusan aku mendapat sms dari Erika adiknya Langit, Mama mereka anfal lagi….dan sekarang lagi kritis di Permata Ibu….” “Apa??? Benarkah kabar yang kau terima itu? Pantesan aku gak bisa-bisa menghubungi Langit…ya udah aku langsung ke rumah sakit aja….kita ketemua di sana ya Lih…. temani aku…. “Andien spontan mengajak Galih untuk menjenguk Mamanya Langit. Bergegas Andien menyambar tasnya sambil

pamit ke Mamanya. “Ma…ternyata Mamanya Langit anfal dan sekarang keadaannya sedang kritis di rumah sakit. Andien pergi dulu ya Ma…” Ucap Andien terburu-buru sambil berjalan ke luar rumah. Bibir Andien terlihat komatkamit, dia memanjatkan doa pada yang Maha Kuasa…. “Ya Allah kuatkanlah Mama Langit …semoga dia bisa melewati masa kritisnya….” Tapi belum lagi Andien memanggil becak di depan rumahnya…tiba-tiba hpnya kembali bernyanyi…. Andien menatap tajam ke layar hpnya…ah ternyata Langit…. Secepat kilat bibir Andien langsung menyapa, “Halo Langit….” “Ndien….tadi siang Mama anfal …. Dan barusan …Mama sudah berpulang…. “ Suara Langit terdengar parau dan terbatabata seperti menahan tangis..lalu suaranya menghilang, ternyata sudah

terputus sebelum Andien sempat menjawab. “Ya Allah…..?? Kenapa begitu cepat Kau ambil Mamanya Langit….kasihan mereka, baru tiga bulan yang lalu Papanya meninggal karena kecelakaan….kenapa sekarang Mamanya juga Kau panggil…??” Andien berlari masuk kembali ke dalam rumah….Mama yang masih berdiri mematung tampak bingung melihat Andien kembali membuka pagar. Mata Andien basah oleh airmata…Andien langsung memeluk Mamanya. Tangisnya meledak tanpa bisa dibendungnya… “Mamaaaaa…Mamanya langit berpulang Ma…..Padahal besok beliau berulang tahun….Kasihan banget mereka Ma….Begitu berat cobaan yang mereka terima….baru tiga bulan lalu Papanya pergi…sekarang Mamanya juga….”ucap Andien pilu.

selama ini. Saat kembali dari mengantar bakso aku menangkap ekor matanya mencuri pandang ke arahku, tipis dan nyaris sekejab. Tapi curi pandangnya itu buat jantungku seolah berhenti, seperti ada sebuah jarum menyucuk menyetop jalan darahku sesaat. Bagaikan gemuruh menggelegar berdebar kencang di dadaku, tanpa sengaja tangan kiriku menyenggol tempat sendok garpu di atas meja, untung dengan cekatan tangan kananku menangkap menyelamatkan tempat sendok itu agar tidak jatuh. Ah… andai terjatuh ke lantai semen dan menimbulkan suara gaduh…? Betapa malunya aku?

merepotkan ibunya maka anak gadisnya tak ikut membantu. Semua rencana rayuan yang telah kusiapkan hancur berantakan. Rabu malam awan gelap angin dingin semakin kencang sepertinya akan turun hujan. Sebenarnya perutku tidak lapar tapi kerinduan akan gadis penjual bakso membawaku melangkah menuju warung bakso. Aku memesan bakso di antara ramainya orang, tak kupedulikan suasana yang tidak nyaman yang penting aku dapat melihat wajah manis gadis penjual bakso. Malam ini aku menemukan gadis itu sibuk membuat bakso bersama ibunya, sebagai pengantar bakso ada seorang pemuda yang wajahnya mirip dengan gadis itu, dengan badan lebih tinggi rambut gondrong hampir kebahu, wajahnya cukup ganteng seperti bintang sinetron, mungkin beliau abang kandung gadis itu?


rambutku yang gondrong. Bulan muncul setengah di antara langit biru yang cerah beberapa bintang bersinar indah. Badanku yang gerah mendorongku keluar rumah. Dihembus angin malam aku menyusuri jalan, seperti biasa tujuanku ngumpul bersama teman duduk di pinggir simpang jalan. Di tengah jalan aku berobah pikiran…, ada rasa penasaran ingin tahu penyebab banyaknya pengunjung di warung bakso yang baru? Apakah rasa bakso yang enak atau ada hal lain menjadi daya tariknyanya? Pengunjung warung tidak banyak, aku mengambil duduk membelakangi sepasang anak muda, sepertinya mereka pacaran. Beberapa saat kemudian seorang ibu separuh baya datang menanyakan pesananku, ada sisa kecantikan dari wajah ibu tersebut. Tak lama kemudian seorang gadis berjalan

Kepadamu yang telah lama berlalu Izinkan aku tetap merindu sebab tak ku tau cara menyimpan kenang di jantungku yang masih berselimut angan meski terkadang hati kian lelah menanti dan tak dapat ku usir segala sepi namun menunggu adalah jenuh paling teduh ketika mengeja wajahmu yang hadir dengan tiba


Nada Sukri Pane

SEBENARNYA posisi warung itu tidak strategis tidak di simpang jalan tidak di daerah keramaian. Keberadaan warung itu juga tidak begitu megah, dengan dinding seperempat terbuat dari papan bekas, beberapa tiang dari batang kayu beroti sisa, beratapkan rumbia warung itu berdiri beberapa meter di depan rumah di sisi jalan. Ber ita warung baru hangat di antara muda mudi warga kampungku. Saat melintas aku melihat pembelinya ramai dari hari ke hari. Para muda mudi di kampungku seperti tumpah, apalagi Rabu malam dan Sabtu malam kursi warung kekurangan, calon pembeli terpaksa menunggu antri pada bangku panjang yang disediakan di depan warung. Selasa malam itu angin malam berhembus sepoi mempermainkan ujung

Perjuangan Hidup

Karya: Ervina Aisyah Lubis

Gadis Penjual Bakso Cerpen

Karya: Ardiani

Menyimpan Kenang

anggun mengantar semangkok bakso kepadaku, senyum tipis menghiasi wajah cantik manisnya disempurnakan dengan gerakan lembut saat meletakkan mangkok bakso di mejaku, ketika dia berbalik ujung mataku sempat melihat wajahnya dari samping. Ampun.. manisnya tak berhenti…! Saat mengantar bakso kepada pembeli yang baru datang di sampingku aku mencuri pandang lagi akan wajah manis gadis pelayan bakso itu. Badannya seimbang dengan ukuran pinggul agak besar, kulit kuning air terang halus bersih, wajahnya bulat bulat telur agak lebar… ampun… manis bagai madu. Rambut sebahu kasar hitam berkilat dipermainkan cahaya lampu, senyumnya sangat tipis nyaris sekejab namun dapat mendebarkan dada. Duh… manisnya tak ketulungan… wajah manis ini menjawab rasa penasaranku

Sabtu malam aku coba lagi ke warung bakso, tapi aku balik badan ketika melihat pembeli yang sangat ramai. Dengan suasana ramai seperti itu aku tak puas menikmati wajah manis gadis penjual bakso atau sebaliknya, gadis itu tak sempat menikmati wajah tampanku. Ya…wajahku lumayan tampan. Kata ibu wajahku lebih tampan dari ayah. Dengan tubuh tinggi dan kulit putih aku mirip Sanjay Dutt bintang film India, demikian kata nenek setahun yang lalu. Selasa malam awan berselimut kabut gelap, bintang tak terlihat menemani bulan yang muncul malu-malu. Dengan rasa kerinduan akan gadis penjual bakso aku menuju warung bakso sambil membayangkan senyumnya yang tipis, rencananya malam ini senyum itu kubalas mesra. Rencananya malam ini aku akan berkenalan, menanyakan sekolahnya, menanyakan keluarganya, mengajaknya janji bertemu. Ya… aku akan merayunya mengeluarkan racun-racun asmara meluluhkan hatinya menjadikannya pacarku…, bahkan akan kujadikan dia istriku, kelak..! Ketika aku masuk ada dua anak muda sedang menikmati bakso sambil bercerita. Tak lama kemudian bakso yang kupesan diantarkan ibunya, sambil menikmati bakso mataku mencari gadis penjual bakso. Sial…sampai selesai makan aku hanya dilayani ibu penjual bakso, mungkin karena pembeli sedikit tak sampai

*** Sekarang aku sudah mendapat jawaban atas semua penyebab warung baru ini sangat ramai pembeli. Yang pertama karena wajah cantik manis dan pinggul besar anak gadis warung bakso ini. Dengan senyum tipisnya dan jalannya yang anggun menciptakan magnet daya tarik buat semua pemuda anak kampungku. Kalau boleh jujur… hanya anak muda yang kurang sehat saja yang tidak tertarik dengan gadis cantik manis anak penjual bakso itu. Yang kedua, adalah wajah abang gadis itu yang sangat tampan untuk ukuran anak kampungku, maaf… paling saingannya aku…!, yang lainnya tingal di belakang. Dengan tampang gantengnya dan murah senyum maka semua anak gadis di kampungku demam kasmaran berharap semoga dapat menjadi kekasihnya. Dengan segunung harapan para gadis kampungku berduyunduyun pasang aksi buat menarik perhatian pemuda itu. Yang ketiga…, sapa dan canda ibu pemilik warung yang cukup menggoda melempar guyon sehat bersahabat, tawa manis ibu separuh baya itu cukup menarik hati, perhatiannya akan kebersihan warungnya menjadi nilaia tambah pelaris

Ini Untuk Mimpi Itu, Ayah I Aku berjalan gontai tak tentu arah Menelusuri jejak kebisuan Dalam perasaan berkecamuk di dada Senyum pahit pun sulit ku rekahkan Aku berlari sambil memercikkan keharuan Ku sambut pelukan hangat ayah

Ini Untuk Mimpi Itu, Ayah II Akhir-akhir ini kesunyian selalu menggelayuti Akh... Kau tidak sendirian Begitu katanya jika aku mengucapkan kata sunyi Sambil tersenyum manja ku benamkan rasa penat ke rangkaian tubuhnya Ini untuk mimpi itu ayah sambutku Rasa bangga itu... Sinari trus untuk ananda Jangan terus kau hentikan celotehan dan gumammu Ayah, Ini untuk mimpi itu Doakan ananda selalu Hangatmu , harummu , titipkan selalu bersamaku

Setelah beberapa kali makan bakso belum pernah aku melihat gadis penjual bakso atau abangnya bercerita kepada pembeli, paling hanya senyum dan senyum. Apakah tak ada yang mereka kenal atau tak ada yang menyapa mereka? Nyaris seperti orang bisu?! Dengan ibunya yang sibuk membuat bakso mereka juga bicara satusatu. Semuanya tertata sepi segar dan rapi. Bagaikan ada yang tersembunyi atau sengaja dikondisikan demikian. Bagaikan pedagang perofesional para pembeli diberlakukan seimbang tanpa ada yang diistimewakan, suasana ini menciptakan aura semua pembeli punya harapan. Pernah suatu malam pemuda kampung sebelah yang duduk di sebelah mejaku menggoda gadis penjual bakso dengan pertanyaan, tapi ekor matanya seolah meminta persetujuanku sebelum memberikan jawaban. Seakan takut aku marah dia hanya tersenyum tak menjawab dan berlalu. Kenapa ekor matanya meminta persetujuanku? Aku bukan pacarnya atau suaminya? Aku mengenalnya hannya sebatas penjual dan pembeli. Seingatku aku belum pernah bercerita padanya atau mungkin dia naksir denganku….? Dadaku berdebar kencang malam itu. Sepanjang jalan pulang aku tersenyum membayangkan tatapan matanya seolah meminta persetujuanku. Ada sebuah harapan kepastian akan menjadi kekasihnya….! Malam itu aku sulit tidur, bayangan gadis penjual bakso bermain-main dalam pikiranku, debar asmara berkejaran di antara relung hatiku. Senyum manisnya, rambut hitamnya anggun jalannya tunduk malunya jemari lembutnya berulang bergantian membuatku tersenyum sendiri. Ada kenikmatan membayangkan semua itu. Aku berhayal menggandeng tangannya di hadapan teman-

Aku pagi yang tertumpah Pada sajadah rindu mentari Merambat dari balik selimut mimpi Yang menghijau, menghitam dan menghilang Tenggelam pada sinar surya Penantian singkat yang merubah kelam malam Kesunyian jadi pilar kebahagian camar pada pucuk cempaka Karya: Deni Prayogi

Karya: Nanda Risanti


Sajadah Rindu Mentari

Kelambu Penderitaan

ibu... engkau wanita hebat suka – duka bukan halanganmu pengorbananmu sangat berarti kasih sayangmu tak akan terganti slalu hangat dalam tubuhku

warung bakso tersebut. Tutur katanya yang lembut membuat para pembeli merasa akrab seolah diperlakukan seperti anak sendiri. Walaupun rasa baksonya biasa saja tapi ketiga nilai tambah itu cukup menciptakan promosi tersendiri buat larisnya warung tersebut.

Mengarungi lambaian teduh ombak Senja musim semi yang mendesahkan kerinduan burung camar pada sangkar kesabaran Bentangan jarak tuk merengkuh rindu Telah tertekuk kedamaian nurani

Berpapah pada dinding kemakmuran Buat diri terlena dengan ketenangan Tidur di atas bantal nan empuk Beralaskan kasur harum Buat raga tergeletak pulas pada mimpi indah Tapi, mengapa? Semua itu terjadi di atas ranjang penderitaan rakyat Apa mereka tidak sadar? Apa mereka tidak berpikir? Ah... Mungkin mereka lupa akan tugas Tidak apalah, Takdir yang berkata Apakah tertinggal dosa dalam raga?

Kepada Saudaraku Kini dunia terjangkit virus kebohongan Demam dengan pembalakan liar Hingga rambut bumi rontok Dan hampir tak bernyawa Tapi, entah mengapa? Mereka enggan menyadari itu. Mereka lebih bahagia Lihat dunia murka Saudaraku, aku hanya berpesan: “ Kehidupan kita adalah kehidupan semesta, kematian kita adalah kematian semesta. Maka, jadikanlah sejarahmu indah dan bermakna, yang kelak akan mengingat tingkah dan kelakuan baikmu di masa depan.”

ku, ada kebangaan dan keangkuhan atas keberhasilanku merebut hatinya, ada kesombongan atas wajahku yang paling tampan di kampungku, ada rindu yang menggebu. *** Malam itu aku beserta keluarga datang ke rumah mereka, warung bakso tutup karena hajatan malam pernikahanku. Sanak saudaranya dengan suka cita menyambut kedatangan kami. Tepak pengiring diterimakan oleh pihak mempelai wanita, diusung dengan tepak penyambut tamu.Tak lama kemudian gadis penjual bakso keluar dari kamar diapit dua orang ibu muda. Gaun pernikahan melayu yang dikenakan malam itu berwarna kuning emas sangat serasi dengan bentuk tubuhnya . Bagaikan putri raja yang turun dari kayangan kecantikannya malam itu menghiasi seluruh ruangan, memukau semua mata. Dengan ekor mataku kulihat gadis itu duduk diapit dayang-dayang di sudut ruangan tertunduk malu saat menatap wajahku. Tak lama kemudian aku dipersilakan maju ke depan menghadap Ayah gadis itu berjabat tangan di hadapan Tuan Kadi buat mencatatkan pernikahan. Saat tanganku dihentakkan oleh tangan ayahnya agar menerima pernikahan anaknya….. aku terbangun dari mimpi indah malam itu…. Mimpi akan dinikahkan dengan gadis penjual bakso. Dengan tersenyum malu… aku menarik bantal guling untuk melanjutkan tidurku. *** Kemarin sepupuku dari kota dating. Lelaki bernama Toni itu anak pakcikku yang selalu tidur di rumahku setiap libur sekolah, sebaliknya aku juga terkadang demikian. Usia kami tak jauh beda, kalau kami berjalan orang bilang seperti kembar, ketampanan kami selalu jadi perhatian gadis kampungku. Rencananya malam ini aku akan membawanya makan bakso, sengaja tak kuberitahukan betapa manisnya gadis penjual bakso, aku ingin melihat reaksinya ketika melihat gadis itu. Sial… mungkin karena pembeli tidak begitu ramai

malam ini gadis penjual bakso tidak turut serta membantu ibunya berjualan. Selasa malam bintang bertaburan di atas langit yang cerah, bulan sabit tersenyum indah menyapa seluruh alam. Tak sabar rasanya ingin menunjukan gadis pujaan hatiku kepadanya aku mengajak kembali sepupuku makan bakso, ada rasa kebanggaan memperlihatkan kecantikan gadis yang akan kujadikan pacarku. Alhamdulilah… .gadis itu turut membantu ibunya malam ini, diam-diam kulihat reaksi sepupuku saat bakso dihantarkan gadis itu kemeja kami. Seakan diistimewakan, gadis itu mengambilkan kertas elap tangan dari meja di sudut ruangan buat kami. Seperti biasa ekor mataku melirik setiap gerak gadis yang telah mencuri hatiku itu, gadis yang pernah terbawa dalam mimpiku. Tapi aku tak melihat reaksi yang luar biasa dari sepupuku, bahkan sepertinya dia jemu tak mau berlama-lama. Sepanjang perjalanan pulang dari makan bakso aku penasaran akan sikap sepupuku itu. Tidak biasanya demikian. Biasanya ketika melihat cewek cantik dia pasti memberikan komentar atau merayunya untuk dijadikan pacar, tapi malam ini dia tak bergeming sedikitpun. Apakah gadis itu tidak begitu cantik di matanya? Atau… dia telah punya pacar yang membuatnya setia tak bisa pindah kelain hati….? Dengan ringan kutanyakan pendapatnya tentang gadis penjual bakso. “Gimana Ton… Cantik gadis penjual bakso tadi..?” “Cantik. Kau naksir…?!” “Apa enggak boleh aku naksir…?” “Boleh….. Nanti, setelah dia janda…!!” “A p a m a k s u d m u Ton…?!” “Lelaki yang berambut gondrong itu suaminya…!!” “Haaa…!” “Mereka itu korban pergaulan bebas.... terpaksa pernikahan dini…!!” “Kamu kog tau Ton…!?” “Gadis itu tetanggaku di Kota..!”



WASPADA Minggu, 13 Maret 2011

Al Azhar Medan Gelar Lomba Mewarnai Dan Melukis UNTUK membangun semangat kemandirian dan sportivitas antar muridTK dan SD, sebanyak ratusan siswa SD di Kota Medan mengikuti lomba mewarnai di Perguruan Al Azhar Medan dalam rangka Grand Opening Swimming Poll 2011 di gedung internasional sekolah tersebut, Sabtu (12/3). Ketua Pelaksana Muhammad Dhirar didampingi Drs. Agustono, MA kepada wartawan mengatakan, sebuah lembaga tidak hanya semata-mata mendidikparasiswanyadalambidang ilmu pengetahuan saja, tapi berupaya mengembangkan kepribadiansetiappesertadidiknya.Salah satu caranya dengan mengajar-

kan moral dan etika sebagai kegiatan ekstrakurikuler dalam proses belajar mengajar di lembaga tersebut. Nah, tentunya sebagai lembaga pendidikan yang bernuansa Islam, Perguruan Al Azhar Medan telah memperkenalkan berbagai kegiatan ajar yang menjurus kepada konsep pengembangan diri itu, seperti menyelenggarakan kegiatan lomba mewarnai dan melukis tingkat SD ini yang bermuara kepada kemampauan siswa agar trampil. “Hal ini kita lakukan untuk membangun semangat kemandirian dan sportivitas antar siswa guna menciptakan wadah bagi para siswa untuk menunjukan

kemampuan dalam bidang ekstrakurikuler dan intrakurikuler,” katanya. Sementara itu, Pembina Yayasan Pendidikan Hajjah Rachmah Nasution H. Abdul Manan Muis menyambut baik atas terselenggaranya perlombaan seperti ini. Dalam rangka menciptakan murid yang berbakat dan kreatif dengan harapan dapat meningkatkan kreativitas anak yang mampu bekerja untuk menghasilkan sesuatu dengan usaha mereka sendiri. “Kepada tim pelaksana di lain kesempatan juga diharapkan dapat meningkatkan lagi dari yang telah terlaksana seperti sekarang ini,” katanya. (m43)

Bayi menghabiskan hampir waktu terjaganya untuk menendang, melompat, atau mengayunkan lengannya. Bagi orang dewasa, aktivitas ini terlihat seperti gerakan biasa saja, padahal hal itu penting untuk menyadari bahwa bayi tak selalu“cuma bergerak”atau“cuma main-main”.Setiap tindakan dan gerakan bayi penting untuk perkembangan bayi dalam halhal tertentu. Pergerakan tubuh membantu membentuk jalinan sel saraf dan sambungan pada otak ke seluruh tubuh, mulai dari bayi hingga de-wasanya. Berikut adalah gerakangerakan yang penting untuk bayi: 1. Ayun-ayun bayi saat dipeluk Saat si bayi menangis, kebanyakan orangtua secara intuitif akan menggendong sambil mengayunkan si bayi untuk menenangkannya. Anda tahu bahwa gerakan ini kemungkinan bisa menenangkan bayi. Namun, tahukah Anda bahwa gerakan ini juga bisa membantu perkembangan sistem vestibular (sistem gerak dan keseimbangan) anak, sekaligus memberinya ketenangan lewat sentuh, sensasi, serta menenangkan anak. Namun, pergerakan dan sensasi ini juga memicu perkembangan awal otak anak dan per-siapan pertumbuhan visualnya. Perhatikan ayunannya juga, jangan terlalu kuat karena si anak bisa mual. 2. Berguling Pergerakan pertama bayi sifatnya refleksif atau tidak disengaja. Berguling adalah gerakan yang diupayakan dan Anda bisa membantu anak berlatih berguling dengan dorongan sedikit. Saat bayi telentang, duduk di dekat kepalanya, sambil menggeng-gam mainan di atas kepalanya. Saat Anda sudah mendapatkan perhatian si anak, gerakkan perlahan mainan tersebut ke salah satu sisi tubuh si bayi sambil memberinya dorongan untuk menggapai mainan itu. Jika si bayi berguling, berikan mainan itu padanya. Anda bisa ulangi

mainan itu di lain waktu. 3. Tum-pukk an um-pukkan Permainan tumpuk, Anda du-duk, bayi berbaring di depan Anda, kakinya disampirkan di kedua paha atas Anda, sambil Anda berinteraksi dengannya, mengimitasi gerakan, saling sentuh, dan tepuk tangan ritmis, bisa memberi kesempatan bayi melihat, merasakan sentuh, serta mendengar suara Anda. 4. “M en ang “Men enyyeber eberang ang”” Bayangkan tubuh bayi memiliki satu garis lurus dari atas tubuh ke bawah, yang membedakan kiri dan kanan bagian tubuhnya. Saat ia

pahanya. Jangan lepaskan pandangan Anda darinya. Ajak ia untuk bermain dengan air tersebut, bermain percik air akan membantunya melatih koordinasi tangan dan mata, serta melatih perut bagian atasnya. 6. Latihan berdiri Membuat anak-anak belajar jalan atau berdiri terlalu cepat bukanlah ide yang bagus. Bayi akan mendapati kemampuan ini saat ia sudah merasa cukup mampu, tetapi mereka memang butuh bantuan dan kesempatan. Sebelum si bayi mendapati ia sudah siap untuk belajar berdiri atau berjalan, pastikan ia punya kesempatan untuk mencoba belajar berdiri sambil berpegangan pada bendabenda kokoh, seperti sofa atau meja yang kokoh. Jika Anda melihat ia mencoba berdiri sambil ber-pegangan dengan benda-benda yang berba-haya dan tidak kokoh, bantulah ia berdiri dan letakkan ia pada lokasi yang lebih aman. Jangan lupa untuk perhatikan dia, begitu Anda bantu ia berdiri, ada kemungkinan ia butuh bantuan untuk duduk kembali. 7. Latihan berjalan Pada waktunya bayi akan belajar berjalan menggunakan bantuan furnitur. Saat ia berjalan tanpa bantuan, bayi akan menikmati menarik, mendorong, atau membawa obyek tertentu.Tak hanya aktivitas ini memberi latihan motorik anak, tetapi juga membantu pemahaman sebabakibat pada anak. 8. Bergerak Bayi perlu bergerak. Sulit untuk memahami apa dan mengapa alasan dari masingmasing gerakan. Namun, gerakan dibutuhkan oleh bayi untuk melatih motorik dan perkembangan otaknya. Berikan waktu, ruang, dan kesempatan untuk bayi bergerak.


Salah seorang peserta, M. Azam Zamakhsyari, siswa kelas 1 SD 1 Al Azhar tampak dengan tekun mewarnai lembaran gambarnya dalam perlombaan mewarnai di Perguruan Al Azhar Medan, Sabtu (12/3).

Gebyar Bakat Seni Anak 8 Aktivitas Membantu Perkembangan Otak Anak Di SD Muhammadiyah 18 Medan

berbaring, coba iming-imingi ia benda yang ia sukai, awali dari bagian depan tubuhnya, lalu pelan, arahkan benda itu ke bagian yang berlawanan dengan tangan yang mencoba menggapai, kalau ia mengulurkan kedua tangannya, tahan salah satu tangannya. Dengan begini ia akan melatih sarafsaraf yang berseberangan antara otak kiri dan kanan. Nan-tinya, saat bayi mulai merangkak, letakkan benda atau mainan berwarna terang di atasnya supaya ia berusaha menggapai. Lakukan permainan ini selama ia menikmati permainan dengan tertawa. 5. Main air Saat bayi sudah bisa duduk tanpa dibantu, coba letakkan ia duduk di sebuah ember besar berisi air hangat yang tingginya hanya mencapai

Hamzah **Hamzah

DALAM upaya mengembangkan bakat dan minat anak didik dalam bidang seni, SD Muhammadiyah 18 Medan mempagelarkan Gebyar Bakat dan Seni Anak 2011 di kompleks Perguruan tersebut, Sabtu lalu. Pagelaran yang digagas sebagai ajang unjuk kemampuan siswa dalam bidang seni budaya Islam dan kegiatan ekstrakurikuler ini menggelar berbagai perlombaan, yakni mewarnai dan melukis, pakaian adat, busana muslim, tari kreasi daerah, hafal ayat-ayat pendek dan foto genik. Menurut Kepala SD Muhammadiyah 18 Syamsul Hidayat, SPd, gebyar bakat dan seni ini digelar diperuntukkan untuk mengasah kreativitas anak sebagai calon penerus di masa depan bangsa. Maksudnya adalah untuk memberi aspek edukatif kepada anak akan arti pentingnya lingkungan hidup yang hijau, asri, dan sehat bagi kehidupan mereka melalui ketrampilan melukis dan mewarnai. “Aktifitas yang mengedepankan aspek imajinasi, kepekaan rasa, originalitas ide serta kemampuan skill yang dapat diikuti oleh siswa Sekolah Dasar (untuk lomba melukis) dan siswa Taman Kanakkanak serta Paly Group (lomba mewarnai). Di samping memotivasi siswa untuk meningkatkan kemampuan, melatih mental siswa dalam berkompetisi, menjalin ukuwah antar sesama siswa dan memiliki mental untuk siap kalah dan menang,” katanya lagi. Hal yang paling pokok, sebut Syamsul, mengembangkan potensi bakat anak supaya mengembangkan seni budaya keislaman dan kebangsaan. (m43)

Mengisi Kotak


Salah satu peserta ketika bergaya di atas panggung saat mengikuti lomba busana muslim di SD Muhammadiyah 18, pekan lalu.

Adik-adik, Redaksi memuat tuntunan yang merupakan ajaran-ajaran Rasulullah, untuk diterapkan dalam kehidupan kita sehari-hari. Semoga kita menjadi muslim yang lebih baik.

Al-Qur’an Dan Hadist Panduan Hidup Muslimin RASULULLAH SAW bersabda,”Kutinggalkan untuk kamu dua pusaka. Tidaklah kamu akan sesat selama-lamanya selagi kamu berpegang kepada keduanya, yaitu Al-Qur’an dan Hadist.” menjauhi Al-Qur’an dan hadist.

Maksudnya : AL-Qur’an dan hadist adalah panduan hidup bagi kaum Muslimin, di mana saja mereka berada. Orang yang selalu mengikuti ajaran yang terdapat di dalam keduanya akan selamat buat selama-lamanya. Oleh karena itu, janganlah sekali-kali

Kupon Seri

**m31/Darul Nu’man

U Tempel DiAmplop

Sayembara Mewarnai Berhadiah Hadiah I : Rp75.000 + Hadiah II : Rp50.000 + Hadiah III : Rp25.000 + Untuk harapan I s/d mendapatkan bingkisan dan sertifikat.

sertifikat sertifikat sertifikat III akan

Syarat-syarat peserta 1. Peserta bebas menggunakan alat pewarna apa saja. 2. Peserta terbatas hingga kelas VI SD, menyantumkan nama, alamat yang jelas 3. Sudah sampai di meja redaksi selamat-lambatnya tanggal 31 Maret 2011 Nama Sekolah Alamat


: .............................................................................. : .............................................................................. : ..............................................................................

Coba lihat cowboy ini dik. Ada 8 perbedaannya, ditandai dengan pinsilmu yang mana saja perbedaannya itu ya.

WASPADA Minggu 13 Maret 2011


SESUKA HATI: Berebut penumpang dan berhenti sesuka hati sudah biasa dilakukan sopir angkot.

Waspada/Surya Efendi



SENGAJA DILANGGAR: Tanda larangan untuk berhenti serta menaikkan dan menurunkan penumpang sengaja dilanggar.

Lalu Lintas Ala Angkot Medan BUKAN rahasia umum lagi, kalau angkot (angkutan kota) identik dengan kesemrawutan lalu lintas, supir yang ugal-ugalan, serta ketidaknyamanan di dalam angkot itu sendiri.

DITENGAH JALAN: Angkot menaikkan penumpang di tengah- tengah jalan

BERHENTI DI LAJUR KIRI JALAN TERUS: Angkot menumpuk dan sengaja berhenti dijalur kiri jalan terus.

Waspada/Surya Efendi

Akibat kesemrautan tersebut, angkot menjadi salah satu penyebab terjadinya kemacetan di jalan raya. Sedangkan akibat dari supir yang ugal-ugalan itu, angkot bisa membahayakan pengendara lainnya. Bahkan sering juga terjadi kecopetan pada penumpang didalam angkot itu sendiri. Inilah lalu lintas ala angkot di Medan. Kalimat diatas itu sudah terlanjur melekat pada angkot di Medan. Memang, sebagai angkutan kota, biaya atau ongkosnya relatif murah meriah. Tapi image buruk yang sudah melekat itu susah untuk diperbaiki. Jangan pernah berharap ada pelayanan yang baik ketika menaiki angkot, sampai di tempat tujuan dengan selamat saja sudah lebih dari cukup. “Kalau menurunkan atau menaikkan penumpang, angkot sukasukanya saja berhenti bahkan tidak mengasih tanda-tanda atau lampu tangan, akibatnya pengendara lain yang dibelakang sering kaget karena angkot berhenti tiba-tiba, dan sering kejadian pengendara belakang menabrak bagian belakang angkot,karena itu tadi,” jelas Faisal, 27, warga Jl. Flamboyan/Pasar Melati Medan, kemarin. Faisalmengakuipernahmengalamipengalamanyangpahitdengan angkot. Pria ini pernah terjatuh dari sepeda motornya karena harus mengerem (memberhentikan) laju sepeda motornya dengan spontan, akibat supir angkot yang berada didepannya mengerem mendadak. “Karena takut ketabrak, aku juga ngerem mendadak.” Menurutnya, para supir mungkin hanya patuh pada ramburambu lalu lintas atau disiplin berlalu lintas jika ada polisi atau Dinas Perhubungan yang jaga dijalanan. “Kalau melihat tingkah laku supir

ini, sepertinya UU nomor 22 tahun 2009 tentang Lalu Lintas dan Angkutan jalan tidak diperdulikan para supir.” Dia berharap, para supir hendaknya lebih mengutamakan keselamatan penumpang dan pengendara lainnya serta memberikan kenyamanan, seandainya kalau angot seperti itu mungkin penumpang angkot menjadi bertambah. “Memang supir angkot tidak semuanya seperti itu, lagipula angkot di Medan inikan banyak kali, mau tak mau mereka kejar setoran tanpa pedulikan penumpang dan pengendara lain,.” Kejar Setoran Sementara itu, koordinator Kesper (Keluarga Besar Supir dan Pemilik Kendaraan) Sumut Israel Situmeang sangat tidak setuju jika angkot dikatakan salah satu penyebab kesemrautan lalu lintas. Menurutnya, kesemrautawan lalu lintas dikarenakan parkir berlapis di jalan-jalan raya. “Cemana pula dengan betor, dan parkir yang semraut?Saya tidak setuju kalau angkotdibilang penyebab kemacetan,” ujarnya. Dia juga menjelaskan, supir yang ugal-ugalan di jalan raya penyebabnya adalah berlebihnya plafon/unit trayek yang dikeluarkan Pemko Medan dalam hal ini pelaksana teknisnya adalah Dishub Medan. Idealnya, lanjut Israel, plafon/unit trayek yakni 60 unit/ trayek. Namun, yang ada saat ini mencapai 180 unit/trayek. “Bahkan ada yang mencapai 200 plafon.” Israel meminta warga pengguna jasa angkot agar tidak menyalahi para supir angkot, karena penyebab para supir ugal-ugalan karena ingin kejar setoran serta banyaknya plafon yang dikeluarkan pemerintah. “Jangan salahi pelaku jasanya, tetapi pemerintah yang memberikan plafon itu berlebihan,” tegasnya. � Mursal AI

Waspada/Surya Efendi

Waspada/Surya Efendi

MENGGANGGU: Aksi angkot berhenti sembarangan menggangu pengendara sepedamotor dan mobil pribadi.

CURI KESEMPATAN: Angkot dan sepedamotor curi kesempatan menerobos lampu merah.


TEROBOS LAMPU MERAH: Angkot nekat menerobos lampu merah.




Konsultasi Teknologi Informasi Diasuh oleh Network And Open System Community

From : 085763xxxxxx Salam NOS, saya Arif di Tembung, aku punya masalah sama komp dan modem speedyku. Saat sudah tersambung, dan muncul pesan yang bacaannya “connected” tapi, ketika saya buka internet, tidak bisa. Mohon solusi dan jawabannya NOS. terima kasih. Jawab: Hai Arif, pada modem speedy, biasanya terdapat beberapa lampu indikator pada modem speedy, lampu-lampu tersebut adalah untuk menunjukkan power listrik, koneksi adsl, konektivitas internet, koneksi lan, dan koneksi wlan. Setiap jenis modem bisa berbeda jenis pengucapannya, kadang untuk koneksi lan bisa disebut sebagai LAN atau Ethernet, dan koneksi internet bisa disebut Internet atau Data. Periksalah lampu indikator yang terdapat pada modem anda, sebagai contoh, apabila anda menggunakan kabel UTP untuk koneksi komputer anda ke mo-

Minggu 13 Maret 2011

Bantuin Aku, Dong?! BUAT yang punya problem, khusus remaja atau pelajar tapi susah buat dipecahkan, seperti masalah sekolah, pacar, ortu yang suka ngomel atau teman yang nyebelin, jangan bingung dulu. Tim Remaja Waspada dan Mbak Fifi yang nama lengkapnya Fidia Rizki, S.Psi, psikolog lulusan Universitas Medan Area akan mencoba membantu kamu mencari jalan solusinya. Silahkan kirim pertanyaan melalui SMS ke

From : 085297xxxxxx Hai NOS, apakah setiap beli laptop memang dalam keadaan kosong (tidak diinstall OS Windows). Bagaimana pula mengetahui kalau OS yang diinstall adalah asli. Thanks Jawab : Tidak semua laptop selalu dalam keadaan kosong saat dibeli, ada juga laptop yang sudah diinstall sistem operasi baik windows atau linux atau sistem operasi lainnya dan merupakan satu paket didalam laptop tersebut. Untuk mengetahui apakah laptop memang dijual dalam keadaan kosong atau sudah dibundel dengan sistem operasi, kamu dapat melihatnya dari situs resmi laptop tersebut, biasanya pada situs resmi akan disebutkan apakah laptop dilengkapi dengan sistem operasi atau tidak. Biasanya juga, laptop yang dilepas dalam keadaan kosong tanpa OS harganya lebih murah dibandingkan laptop yang dilepas dengan menggunakan OS. Sedangkan untuk mengetahui keaslian windows dapat dilakukan dengan menggunakan software seperti Microsoft diagnostic Key atau langsung melakukan update ke situs Microsoft sehingga mereka bisa mengecek keaslian windows yang kamu gunakan, semoga dapat membantu. Terima kasih.


No 082165600868,

Jawaban akan dibalas melalui Harian Waspada, jadi dimohon sabar menunggu.

Tanya: Lisa – Hp 081254302xxx Mbak aku punya sahabat dekat.. saya sering jalan bareng ..sampai suatu hari saya pulang telat ke rumah gara-gara nemenin dia jumpa pacarnya dan akhirnya saya dimarahin sama ortu. Mbak aku bingung, aku sering diomelin mama gara-gara sahabatku. Aku sayang dia dan enggak enak nolak ajakan dia, tapi aku juga enggak mau terus dimarahin sama mama. Jadi gimana donk mbak Fifi yang baik? Tanya: Moly – Hp 085745397xxx Assalamualaikum, Mbak Fifi, aku lagi bingung nii.. aku punya teman dekat. Kami berteman udah cukup lama. Masalahnya kini aku mulai terganggu dengan dia.. abis dia suka maksain kemauannya dan aku merasa engga enak buat menolaknya. Tapi kalau diikutin terus aku jadi makan ati… please help me.. dem speedy, dan tidak ada kerusakan dikabel atau port UTP, maka lampu indikator LAN pasti menyala, begitu pula apabila anda menggunakan Wireless sebagai media penghubung, maka lampu WLAN pasti menyala. Sedangkan untuk mengecek koneksi jaringan internet, silahkan cek lampu indikator ADSL dan Internet anda. Apabila lampu ADSL anda menyala namun internet anda tidak menyala, atau lampu ADSL anda menyala, namun blinking, maka sebaiknya hubungi provider speedy anda, dan minta agar mereka mereset port ADSL anda, agar jaringan anda kembali normal. Semoga dapat membantu, terima kasih. From : 085761xxxxxx Hy NOS ne iyan di Medan, aku punya laptop ACER ASPIRE 5500, windows dilaptop aku windows 2003, yang mau aku tanya bisa gak diganti windows xp/seven? Tolong dijawab ya NOS. Jawab : Hai Iyan, sistem operasi untuk laptop acer aspire 5500 dapat diganti dari windows server 2003 menjadi windows xp, akan tetapi tidak dapat diganti menjadi windows seven karena tidak

PEMBERITAHUAN : Website NOS Community sudah dapat diakses dari internet pada alamat, saat ini fasilitas yang disediakan hanya forum untuk sharing ilmu pengetahuan dan tanya jawab.Website dan repository artikel segera menyusul. Segera daftarkan diri anda sekarang pada website noscommunity dan mari bersama-sama majukan IT Indonesia. Kirimkan permasalahan komputer dan jaringan yang anda kelola ke atau SMS ke nomor 081370311355. SMS dan email yang anda kirim akan kami jawab sesuai giliran masuk hanya pada SKH Minggu Waspada.

ada dukungan driver dari Acer untuk sistem operasi windows 7 pada laptop jenis aspire 5500. Sebelum mengganti sistem operasi laptop kamu, pastikan semua data sudah disimpan dan kamu sudah memiliki semua driver hardware untuk sistem operasi windows xp. Apabila kamu belum memiliki driverdriver tersebut, kamu dapat mendownloadnya dari http://, pilih Indonesia, dan pilih drivers and download. Pilih jenis gadget kamu dan download drivernya. Setelah driver selesai didownload, kamu sudah bisa mengganti sistem operasi laptop kamu. Semoga dapat membantu dan selamat mencoba, terima kasih. From : 087869xxxxxx Pagi NOS, namaku Sayuti Nor di Medan, saya ada beberapa pertanyaan, 1. Bagaimana menginstall office 2007, tapi office 2003 yang sudah ada tidak terhapus. Ini sudah tiga kali saya coba pada tiga komputer, namun office 2003 tetap terhapus. 2. Ketika saya lagi asik main komputer tiba2x langsung mati. Thanks Jawab : Hai Sayuti, sebenarnya apabila kamu sudah menginstall office 2007, kamu tidak perlu lagi menggunakan office 2003 karena semua fitur di 2003 sudah tercover di 2007. Memang pada saat kamu menginstall 2007, secara otomatis office 2003 akan terhapus karena office 2007 akan mereplace office 2003 kamu dan menggunakan semua sistem file office 2003 untuk diintegrasikan dengan office 2007. Sedangkan untuk masalah komputer yang tiba-tiba mati, coba periksa suhu CPU kamu, kemungkinan komputer kamu mati karena processor terlalu panas. Semoga

dapat membantu, terima kasih. From : 083199xxxxxx Hay NOS, aku Ardi di Medan, aku mau nanya ni kenapa ya laptopku setelah diinstall ulang windows XP wifinya tidak ada, padahal sebelumnya ada, terima kasih NOS. Jawab : Hai Ardi, apakah kamu sudah menginstall driver untuk wifi kamu? Biasanya hal tersebut terjadi karena OS kamu belum mampu membaca hardware wireless card kamu. Install driver yang kompatibel untuk sistem operasi kamu, dan restart komputer kamu. Setelah restart, wifi kamu akan terbaca oleh OS kamu. Semoga dapat membantu. Terima kasih. From : 085658xxxxxx Aslm NOS, saya Nadya di Medan, NOS saya mau tanyak ni. Kenapa kalau pake windows7 prosesnya lama kali?? Makasih ya NOS.mohon dibalas ya NOS secepatnya. Jawab : Wslm Nadya, ada beberapa hal yang bisa menyebabkan windows 7 kamu berjalan lambat di komputer kamu. Pertama, ada kemungkinan spesifikasi komputer kamu sebenarnya tidak sanggup untuk menggunakan windows 7, biasanya, untuk menggunakan windows 7 minimal kamu harus menggunakan processor dual core dan RAM minimal 1GB agar windows 7 dapat berjalan normal. Kedua, bisa saja windows 7 kamu sudah terserang virus sehingga prosesnya menjadi lambat. Ketiga, bisa juga karena windows 7 kamu perlu diupdate karena sudah tidak kompatibel dengan perangkat keras yang kamu miliki. Terima kasih.

Jawab: Dear Lisa dan Moly yang baik.. Waalaikumsalam. Mbak salut ngeliat kebaikan dan pengorbanan kalian.. tapi menolong sahabat jangan sampai ngorbanin perasaan dan jadi dimarahin mama donk. Gini Lisa dan Moly.. dalam bersahabat kamu perlu tahu apakah pengorbananmu sebanding nilainya dimata sahabatmu jadi engga berat sebelah. Jangan gara-gara nemenin dia kamu jadi sering dimarahi ortu sementara dia bisa pergi sendiri tanpa kamu, atau berusaha ngikutin kemauannya sementara kamu merasa terpaksa ngelakuinnya. Kalau kamu tidak bisa nemenin atau nuruti kemauannya sebaiknya kamu perlu berterus terang, karena kunci persahabatan agar awet dan langgeng adalah keterbukaan. Nah supaya kamu tidak merasa enak hati.. kamu dapat menunjukkan kepedulian dengan menelpon dan mengirim sms disaat kamu tidak bisa nemenin dia. Oke Lisa dan Moly.. Gpp ngomong secara terbuka disaat kamu keberatan dan smoga persahabatanmu awet tanpa mengurangi rasa kepedulianmu, salam. Tanya: Deasy – Hp 08523654xxx Assalamualaikum.. Mbak Fifi yang maniezt.. aku pengen menghibur teman yang lagi patah hati. Jawab: Waalaikumsalam, Dear Deasy Mbak senang ngelihat kepedulianmu.. indahnya..kalau setiap teman punya sahabat yang care seperti mu.. Orang yang lagi patah hati memang butuh teman buat ngedengerin curhatannya.. jadi kamu cukup nunjukin empatimu dan dengarkan enggak usah kasi nasihat, karena yang ia butuhkan support dan mengerti apa yang ia rasakan. Kalau doi suka marah saat kamu ngulik atau nyebut nama mantannya, wajarlah namanya

Konsultasi Remaja

lagi patah hati tapi katakan kamu tidak bermaksud membuka cerita lamanya dan meminta maaf. Nah Deasy.. ajak dia kembali memulai aktivitas baru agar dia merasa terhibur dan cepat menguasai perasaannya. Salam smoga sukses selalu. Tanya: Willa – Hp 081367896xxx Assalamualaikum…Mbak pa khabar kenalin aku Willa. Mbak aku punya masalah, dulu ada cowok yang naksir tapi aku tolak. Dan sekarang aku suka padanya tapi dia koq cuek banget, padahal kata teman-teman sebenarnya sih dia masih suka sama aku. Jadi gimana sebaiknya ya mbak sikapku padanya? Jawab: . Waalaikumsalam, Dear Willa Kamu perlu memahami perasaanmu..apakah memang benar-benar suka atau karena merasa kehilangan seseorang yang biasanya memperhatikanmu, secara dulu adik pernah menolaknya. Jadi pastikan dulu perasaanmu jangan hanya merasa seperti kehilangan fans. Kalau memang suka kamu dapat menunjukkan sinyal balik bahwa kamu suka padanya. Ajak ketemuan.. dan memulai pertemanan baik dulu jadi jangan buruburu ngungkapin perasaan. Take it slow..cukup utarakan kebingungan atas sikapnya yang cuek dan katakan kamu senang atas perhatiannya selama ini.. dan tidak bermaksud benar-benar menolaknya kamu hanya ingin memastikan perasaanmu padanya. Jadi engga usah buru-buru jadian.. yang penting memperbaiki intensitas komunikasi menjadi lebih baik. Seiring berjalannya waktu .. semuanya akan berjalan sendiri. Salam. Tanya: Rudi – Hp 081354763xxx Assalamualaikum, mbak Fifi yang baik.. bantuin donk, aku punya pacar tapi dia cemburuan banget. Aku pengen dia ngertiin kalo aku juga butuh teman cewek sebagai sahabat. Apa yang musti saya lakukan supaya dia mengerti? Terimakasih Jawab: waalaikumsalam, Helo Rudi Tahukah adik, orang posesif karena dia engga nyaman dengan dirinya sendiri.. bisa jadi karena dia takut kehilanganmu dan merasa engga yakin dengan kelayakan cintanya padamu. Jadi dia hanya perlu diberi pengertian agar dia tahu kamu memang menyayangi dia dan berharap diapun menyayangimu. Ajarkan dia menyayangi seseorang dengan memberi rasa percaya dan kebebasan tanpa perlu merasa dikhianati. Nah mulai dari dirimu dulu.. dengan ngenalin siapa teman-teman cewekmu dan melibatkan dia tujuannya agar rasa percaya dalam dirinya tumbuh dan berkembang dan tidak lagi merasa khawatir saat kamu punya teman yang lain. Salam.

Konsultasi Sumber Daya Manusia Diasuh oleh Thoga Sitorus

Rekomendasi Karena Kesalahan Selamat pagi, Pak Thoga Sitorus. Saya Ilham Z. di Pematang Siantar, menanyakan apakah ada sanksi bagi pimpinan perusahaan yang memberikan rekomendasi kepada karyawan tanpa bernomor surat, yaitu karyawan melakukan kesalahan dan mengundurkan diri (karena sakit) dan pernah ditawarkan jabatan lain tapi karyawan tersebut tidak bersedia karena merasa tidak betah lagi. Kemudian perusahaan telah mengeluarkan Surat Peringatan III (SP 3) karena karyawan pernah melakukan kesalahan. Apakah dapat diberikan rekomendasi kepada karyawan yang melakukan kesalahan. Jawab: Selamat pagi, Sdr Ilham. Tentang pimpinan perusahaan mengeluarkan surat rekomendasi tanpa nomor surat mungkin suatu kelalaian maka dapat diulang kembali dengan mencantumkan nomor surat. Karena yang menjadi pokok masalah apakah karyawan melakukan kesalahan sesuai dengan Undang-undang Ketenagakerjaan No. 13 tahun 2003 (UUK) Pasal 158

tentang PHK karena melakukan kesalahan berat, dan itupun karyawan dapat di PHK apabila sudah ada putusan Pengadilan Hubungan Industrial/ Mahkamah Agung yang berkekuatan tetap. Kemudian pemberian SP harus berdasarkan apa kesalahan yang dilakukan karyawan (lihat UUK Pasal 161) harus berdasarkan SP I, SP II dan SP III, kecuali melakukan kesalahan berat. Apabila karyawan mengundurkan diri karena melakukan kesalahan, maka karyawan harus membuat pernyataan di atas materai secara sadar tanpa ada paksaan mengakui kesalahannya atau mengundurkan diri atas kemauan sendiri sesuai Pasal 162 UUK yaitu mendapat penggantian hak (Pasal 156 ayat 4) dan dapat uang pisah yang besarnya diatur dalam Perjanjian Kerja (PK), Peraturan Perusahaan (PP), atau Perjanjian Kerja Bersama (PKB). Kalau karena sakit sehingga tidak dapat melakukan pekerjaan, biaya pengobatan ditanggung oleh perusahaan/PT. Jamsostek dan upah tetap dibayar sesuai dengan UUK Pasal 93 ayat (3), bila sakit berkepanjangan. Sesungguhnya ketentuan-ketentuan di atas harus diatur dalam PP atau

PKB perusahaan dan terhadap permasalahanpermasalahan yang dihadapi yang menyangkut syarat-syarat kerja maupun hak dan kewajiban mengacu kepada PP atau PKB perusahaan. Maka sesuai dengan pertanyaan dan penjelasan di atas, mana sebenarnya yang menjadi inti permasalahan. Kalau memang karyawan melakukan kesalahan dan terbukti kesalahannya (kesalahan berat) maka tidak dapat diberikan rekomendasi. Tetapi di luar kesalahan berat, dapat diberikan rekomendasi sebagai bukti pernah bekerja di perusahaan yang bersangkutan. Sesuai dengan pertanyaan Sdr telah menyurati PT. AAL Tbk di Jakarta yaitu Presiden Direktur Bapak W.W. untuk memberikan solusinya namun belum ada balasan. Apabila permasalahan Sdr tidak mendapat tanggapan atau jawaban/tidak ada penyelesaian maka Sdr dapat mengadukan permasalahannya ke kantor Disnaker/kepolisian setempat untuk ditangani sesuai dengan kewenangannya sebagaimana tertera dalam UU No. 13 tahun 2003 tentang Ketenagakerjaan Pasal 182.

Masalah Mutasi Pekerja Selamat pagi, Pak Sitorus. Nama saya M. Siagian, bekerja di sebuah perusahaan di Deli Serdang mau menyampaikan pertanyaan kepada Bapak dalam Konsultasi Sumber Daya Manusia yang dimuat setiap hari Minggu di Surat Kabar Waspada. Pertanyaan saya tentang mutasi pekerja/ karyawan yang dilakukan oleh pengusaha, bagaimana sebenarnya ketentuannya dan apa tujuannya karena di perusahaan kami sering dilakukan mutasi yang kami kurang mengerti maksudnya. Mohon penjelasan Bapak dan saya ucapkan terima kasih. Jawab: Selamat pagi, Sdr Siagian. Saya akan jelaskan tentang mutasi atau pemindahan pekerja yang dilakukan pengusaha di dalam perusahaan adalah sesuatu yang wajar dalam rangka penyegaran/ perbaikan kondisi kerja. Hanya bila perusahaan ingin melakukan mutasi, sebaiknya diberitahu terlebih dahulu kepada si pekerja alasan mutasi atau kepada Serikat Pekerja/ Serikat Buruh sebagai mitra kerja pengusaha di perusahaan. Adapun maksud

pengusaha memutasikan pekerja tujuannya adalah baik hanya saja sering ditafsirkan oleh pekerja sebagai hukuman atau ada unsur suka tidak suka sehingga pekerja menolak mutasi yang dilakukan terhadap dirinya. Untuk itu perlu Saudara ketahui apa alasan sebenarnya dilakukan mutasi, antara lain : 1. Untuk meniadakan rasa bosan dan kejenuhan pekerja yang secara terus- menerus bekerja pada satu tempat/ bagian saja. Jadi di sini mutasi adalah dalam rangka refreshing/penyegaran. 2. Untuk menjadikan pekerja bisa dan terampil dalam hal menangani beberapa macam tugas pekerjaan, sehingga dapat diandalkan sebagai pekerja yang serba bisa dan serba guna. Selanjutnya 3. Mutasi dalam jabatan yang sama

dikarenakan pada tempat pekerjaannya yang terdahulu hasilnya kurang meningkat dengan harapan bahwa dengan dilakukannya mutasi ini produk akan lebih meningkat. 4. Pemindahan dari suatu bagian dalam perusahaan ke bagian lain yang diperkirakan cocok bagi pekerja yang bersangkutan, sehingga di bagian yang baru diharapkan ia akan bekerja lebih bergairah. 5. Dengan demikian untuk menjamin kepercayaan kepada pihak pekerja bahwa mutasi bukan merupakan hukuman atau akan diberhentikan karena kekurangcakapannya dalam menangani tugas/ kewajibannya.

Dari gambaran di atas, jelaslah bahwa maksud dilaksanakannya mutasi atau pemindahan yang dilakukan oleh pengusaha dalam lingkungan perusahaan adalah baik yaitu agar pekerja tidak mengalami kejenuhan, pekerja dapat bekerja pada pekerjaan dan kedudukannya yang cocok, dapat bekerja lebih kreatif dan produktif dan memberikan kesempatan bagi pekerja untuk promosi jabatan. Untuk tidak menimbulkan prasangka yang tidak baik dari pekerja dan tidak menjadi perselisihan maka maksud dan tujuan mutasi tersebut

Bagi para pembaca yang ingin menanyakan seputar tentang ketenagakerjaan dapat mengirimkan pertanyaan melalui, HP:0811632554

sebaiknya dimuat secara rinci dalam Peraturan Perusahaan atau Perjanjian Kerja Bersama(PKB) dan dibagikan kepada para pekerja atau ditempel di papan pengumuman perusahaan untuk dapat dibaca oleh para pekerja. Demikianlah pencerahan yang dapat saya sampaikan dengan harapan dapat menjadi jelas bagi Saudara dan tidak menimbulkan prasangkaprasangka yang tidak baik, tentunya bila mutasi dilakukan dengan maksud baik untuk lebih meningkatkan produktivitas demi kesejahteraan para pekerja dan kemajuan perusahaan.

Kupon Konsultasi

Kesehatan Apa Yang Sering Dikeluhkan Lansia Jika Tidurnya Terganggu ?


WASPADA Minggu 13 Maret 2011

TIDUR merupakan fenomena alamiah yang mendasar karena merupakan suatu kebutuhan tubuh untuk mengistirahatkan dan memperbaiki fungsi sel-sel dan organorgan tubuh. Dari segi psikologik, tidur adalah fase relaksasi (istirahat) yang paling dalam dan pada fase ini semua ide termasuk ide yang tak masuk akal dapat muncul dan ketegangan pikiran dapat berkurang setelah bangun tidur. Berbagai penelitian melaporkan bahwa keluhan-keluhan dari para lanjut usia (lansia) sehubungan dengan gangguan tidur dapat berupa menggunakan waktu ditempat tidur yang lebih lama dibandingkan dengan orang dewasa, sering terbangun pada malam hari, semakin panjangnya waktu yang diperlukan untuk dapat tertidur (sleep latency), sebentar-sebentar terbangun dari tidur (tidur tidak nyenyak), terbangun pada dini hari, tidur disertai dengan henti nafas sejenak, mimpi buruk, gelisah, berjalan sewaktu sedang tidur, tidur hanya sebentar pada siang hari, terbangun pada siang hari tanpa rasa segar dan mengalami kelelahan, gangguan berpikir, aktivitas fisik yang berkurang atau bertambah lambat, perasaan lesu serta malas dan lain-lain. Oleh karena gangguan tidur pada lansia demikian banyaknya ragam maka hanya beberapa hal akan dibahas di dalam tulisan ini. Manfaat Tidur Setiap manusia dewasa yang sehat mengalami tidur malam hari sekitar 6-8 jam. Pada lansia, umumnya kebutuhan tidur akan berkurang, yaitu lama tidur malam hari sekitar 5 jam dianggap normal. Terbangun karena mau buang air kecil kemudian langsung tertidur lagimasihdianggapsuatukeadaannormal. Tidurmerupakankeadaan hilangnya kesadaran secara normal dan periodik. Dengan tidur maka akan dapat diperoleh kesempatan untuk beristirahat dan memulihkan kondisi tubuh baik secara fisik maupun mental. Tidur dapat dianggap sebagai suatu perlindungan bagi tubuh untuk menghindari pengaruh-pengaruh yang merugikan kesehatan akibat kurang tidur. Pada saat tidur berlangsung, aktivitas susunan saraf tepi yang bernama saraf parasimpatik meningkat yang menyebabkan denyut jantung melambat, meningkatnya aktivitas saluran cerna sehingga pengumpulan enersi dan pemulihan tenaga dari dalam tubuh di-

percepat dan akan memberikan kesegaran jasmani dan rohani. Jika tidur menjadi sulit, mata sulit terpejam atau pikiran terus melayang-layang, sering mimpi buruk, atau jika terbangun tengah malam tidak bisa tertidur lagi maka hal ini perlu diwaspadai, mungkin ada gangguan fisik atau jiwa. Pola Tidur Secara umum, proses tidur normal diawali dengan tahap mengantuk, yaitu didapatinya hubungan antara kesadaran dan lingkungannya menjadi berkurang. Pada saat ini, rangsanganrangsangan dari luar masih dapat diterima tubuh dengan mudah yang membuat terbangun atau sadar kembali. Jika proses tidur berlanjut terus maka kesadaran semakin menurun dan terjadi tahap tidur ayam, yang rangsangan inderawi sedikit masih dapat diterima, dan akhirnya proses tidur memasuki tahap tidur nyenyak. Dengan penemuan alat canggih telah berhasil menemukan adanya 2 macam pola tidur, yaitu : 1. Pola tidur biasa (non REM/Rapid eye movement) : yang berlangsung kurang lebih 1 jam, dan pada tahap ini biasanya orang masih dapat mendengarkan suara-suara disekitarnya, sehingga masih mudah terbangun dari tidurnya. Pada keadaan ini sebahagian besar organ-organ tubuh secara berangsur-angsur menjadi kurang aktif, pernafasan teratur, kecepatan denyut jantung berkurang, otototot mulai rileks, mata dan muka diam tanpa gerak. 2. Pola tidur paradoksal (REM) : yang berlangsung selama kurang lebih 20 menit, terjadi gerakan-gerakan mata secara cepat (REM), pernafasan naik turun, otot mengalami pengendoran (relaksasi) seluruhnya, yang bermanfaat untuk pemulihan tenaga dan menghilangkan rasa lelah. Pada tahap ini juga sering timbul mimpimimpi, mengigau, atau bahkan mendengkur. Gangguan Tidur Beberapa jenis gangguan tidur pada lansia dapat berupa : 1. Gangguan tidur karena menghadapi situasi tiba-tiba yang penuh stres, misalnya perawatan di rumah sakit, pembedahan, pensiun, kehilangan atau peristiwa-pertistiwa kehidupan lainnya. 2. Gangguan tidur berupa henti nafas sejenak karena sumbatan (obstructive sleep apnea) yaitu terhantinya bernafas selama beberapa detik karena relaksasi otot sekitar tenggorokan atau mulut, dengan gejala sering terbangun untuk berkemih, tidur mengorok, sakit kepala pada pagi hari, ngantuk sekali dan sering tertidur pada siang

Amankah Mencium Hewan Peliharaan? Bagi pecinta binatang rasa sayang bisa ditunjukkan dengan berbagai cara, salah satunya adalah menciumi hewan peliharaannya. Tapi amankah mencium binatang peliharaan? Ada banyak mitos yang beredar mengenai keamanan mencium hewan peliharaan. Beberapa beranggapan bahwa mulut hewanlebihbersihdibandingmanusia sedangkan yang lain beranggapan sebaliknya. “Beberapa jenis bakteri yang ada di mulut kucing atau anjing adalah jenis bakteri yang sama seperti pada manusia. Tapi jika tidak dirawat dengan benar bisa jadi kesehatan hewan peliharaan lebih kotor dibanding manusia,” ujar Dr Paul Maza, wakil direktur pusat kesehatan di College ofVeterinary Medicine Cornell University, seperti dikutip dari Foxnews, Sabtu (12/3). Dr Maza menuturkan jika pemilikmemperhatikankebersihan oral dari hewan peliharaannya seperti rajin menyikat gigi dan membersihkan mulut hewan,

Upaya Membantu Tidur Upaya mengatasi gangguan tidur pada lansia sebaiknya terlebih dahulu menanggulangi penyebabnya. Penggunaan obat penenang/ obat tidur hanyalah bersifat sementara dan sebaiknya dihindari untuk memberikannya secara berlarut-larut karena lebih mudah terjadi efek sampingnya pada lansia. Beberapa upaya yang dapat dilakukan adalah : 1. Hindari sedapat mungkin hal-hal yang dapat mengganggu tidur dari lingkungan sekitarnya seperti kebisingan, cahaya lampu yang terang di kamar tidur, suhu kamar yang tidak nyaman, pakaian tidur yang sempit, minum alkohol, dan kopi. 2. Jika belum dapat tertidur, lakukan pekerjaan ringan seperti membaca atau mencatat ide-ide yang timbul, sehingga rasa mengantuk akan datang. 3. Rasa lapar dapat mengganggu tidur, karena itu minuman ringan seperti susu hangat dapat membantu untuk tertidur. 4. Hindari berpikir secara menjelimat selama beberapa jam sebelum tidur, bacalah novel ringan atau menonton televisi secara santai, jangan menyelesaikan pekerjaan kantor atau mendiskusikan keuangan keluarga dengan pasangan hidup anda. 5. Hindari penggunaan kamar tidur untuk bekerja atau menonton televisi, dan belajarlah mensosialisasikan kamar tersebut untuk tidur. 6. Hindari tidur sejenak pada siang hari yang dapat mengganggu kenyamanan tidur pada malam hari. 7. Gerak badan ringan yang teratur dapat membantu tidur lebih nyenyak. 8. Biasakan mengatur waktu yang cocok untuk memulai tidur sehingga tubuh akan terbiasa dengan waktu tidur yang teratur, serta tidurlah dalam posisi yang terasa nyaman .(dr.Pirma Siburian Sp PD, K Ger, spesialis penyakit dalam dan penyakit lansia, dokter pada klinik lansia Klinik Spesialis Bunda dan RS Permata Bunda Medan).

Kasus gangguan kesehatan jiwa di Indonesia terus menunjukkanpeningkatan.Jumlahmasyarakatyangmengalamigangguan kesehatan jiwa seperti stres, depresi, cemas berlebihan, ketakutan, hingga kasus parah shizoprenia mencapai angka 20-30 persen. Dari jumlah di atas, 2-3 persen mengalami gangguan jiwa kronis kegilaan dan schizofrenia. Meningkatnya pasien gangguan kesehatan jiwa ini karena dipicu oleh masalah ekonomi, stres sosial, stres kerja, trauma bencana, korban kejahatan. Sayangnya masalah gangguan kesehatan jiwa belum menjadi prioritas kesehatan yang dibuat pemerintah. “Diperkirakan orang-orang yang mengalami gangguan kejiwaan ringan hingga berat jumlahnya 30 persen, lebih besar daripada sekedar angka 2 persen hingga 3 persen dalam data statistic. Padahal bila salah satu anggota keluarga ada yang mengalami gangguan kesehatan jiwa berat maka praktis seluruh sistem kehidupan keluarga terganggu. Seperti dicontohkan terhadap kasus yang dialami seorang ibu yang sebut saja bernama Nyonya A berusia 65 tahun. Ny A divonis menderita dementia (pikun) disertai gangguan perilaku dan sudah beberapa kali tinggal di rumah sakit. Ny A tinggal bersama putra sulung, menantu, dan tiga orang cucu dengan status sosial ekonmi yang cukup baik. Beban yang dialami Ny A ternyata juga menjadi beban berat bagikeluarganya.Sampai-sampaiputranya(dalamsuatukonsultasi di salah satu biro psikolpgi) mengungkapkan keinginannya untuk memindahkan sang ibu ke panti jompo. “Daripada kami sekeluarga ambruk bersama,” tutur sang anak. Tidak mudah memang untuk bisa mendeteksi gangguan kesehatan jiwa, karena banyak masyarakat yang belum terlalu peduli dengan masalah ini. Bahkan di beberapa negara di Eropa, sebagian besar orang harus melewati waktu 5 sampai 10 tahun hingga akhirnya gangguan kesehatan jiwa tersebut terdiagnosa dengan tepat. Untuk bisa membantu proses penyembuhan penderita gangguan kesehatan jiwa dibutuhkan kombinasi dari terapi medis, toleransi serta dukungan yang besar dari keluarga dan orang sekitarnya terhadap pasien. Namun, seringkali stigma buruk dari masyarakat terhadap orang dengan gangguan kesehatan jiwa membuat pengobatan tersebut terhambat. Sampai saat ini kesehatan jiwa masih menjadi prioritas bawah dan tidak termasuk dalam bagian utama praktik, kebijakan dan agenda kesehatan, sehingga banyak orang yang sulit mendapatkan pelayanan kesehatan untuk jiwa. Karena kurangnya pelayanan kesehatan jiwa membuat orang yang memiliki gangguan kesehatan jiwa tidak mendapatkan pengobatanyangtepat.Sehinggabanyakterjadikasuspemasungan, penelantaran, gelandangan psikotik, perilaku kekerasan, penyalahgunaan obat-obatan dan kriminalitas. Untuk dapat memperbaiki masalah ini diminta kepada pemerintahagarrumahsakitjiwadigantimenjadifasilitasrehabilitasi psikososial. Pemerintah juga perlu menyediakan konsultasi di tiap puskesmas dimana terdapat poli konsultasi, sehingga orang tidak merasa sungkan untuk berobat. Di puskesmas dengan fasilitas tersebut dapat dimanfaatkan kegiatan rutin berupa pertemuan atau perkumpulan antara pasien dengan keluarga untuk menjelaskan masalah dan apa saja yang dubutuhkan oleh pasien. Sehingga pasien lebih merasa dihargai dan tidak mendapatkan perbedaan yang berarti dengan masyarakat lainnya. Serta dilakukan pula kunjungan ke rumah sebagai pendekatan langsung untuk mengontrol pengobatan dan kondisi dari pasien itu sendiri. Masalah gangguan kesehatan jiwa bisa dideteksi oleh diri sendiri. Misalnya, jika mengalami sedih yang berlebihan yang membuat sulit untuk konsentrasi dan menurunkan kualitas hidup, sebaiknya segera dikonsultasikan agar tak keterusan menjadi gangguan kesehatan jiwa. *Lastri Nastiti S.Psi

Tips : Memilih Asuransi Kesehatan maka bisa jadi mulut anjing atau kucing lebih bersih dari mulut manusia. “Jadi selama hewan tersebut terpeliharadenganbaikkebesihan dan kesehatan mulut serta badannya, maka aman-aman saja bagi pemilik untuk mencium hewan peliharaan,” ungkapnya. Beberapa penyakit memang bisa ditularkan dari hewan peliharaan kepada manusia seperti toksoplasmosis atau bartonella. Tapi hal ini sangat jarang terjadi dan biasanya ditularkan melalui

kotoran binatang yang tertelan. Meski begitu bagi beberapa orang yang memiliki sistem kekebalan tubuh rendah, memiliki penyakitHIVataupenyakitlainyang bisa menurunkan kekebalan tubuh serta orang yang sudah tua, sebaiknya tidak terlalu sering mencium hewan peliharaan. Hal ini karena daya tahan tubuhnyasudahmenurunsehingga lebihrentanterinfeksibakteriatau kuman. “Selain itu bayi yang sedang sakit juga sebaiknya tidak terlalu

sering berdekatan dengan hewan peliharaan,” ujar Dr Maza. Untuk itu jika ingin aman setiap kali mencium hewan peliharaan, maka sikatlah mulut hewan dengan alat khusus dan membilasnya dengan air, jangan membiarkan hewan peliharaan mengonsumsi makanan sisa di dapur atau tempat sampah, membersihkan tempat makannya secara teratur serta menjaga kebersihan tubuh dan kandangnya. (det)

PDUI Sumatera Utara Bertekad Tingkatkan Pelayanan Kesehatan Di Indonesia Akhir-akhir ini dunia kesehatan mendapat banyak sorotan dari berbagai elemen masyarakat dan media massa mengenai beberapa hal yang bersifat mendasar. Dugaan adanya sikap kurang komunikatif dan professinal dari tenaga medis, prosedur pelayanan dalam penanganan pasien di rumah sakit yang dianggap lamban, adanya dampak komplikasi dari penyakit yang ditangani, serta dugaan adanya malpraktik yang dilakukan oleh seorang dokter, tentu telah menggugah rasa tanggung jawab moral dari segenap tenaga profesinal kesehatan terutama para dokter khususnya dokter umum. Sejak bertahun-tahun yang lalu dokter umum di Indonesia masihdihadapkanpadapersoalan rendahnya tingkat kesejahteraan. Banyaknya dokter umum yang sulit berpraktek karena terganjal ujian kompetensi, jasa medik yang tidak layak bagi dokter jaga di rumah sakit atau di klinik sampai batasan jam praktek yang melebihi batas kewajaran (24 jam). Hal ini tentunya juga menjadi permasalahan yang hanya bisa diselesaikan dengan kontribusi dari semua pihak terutama

hari. 3. Gangguan tidur dengan gerakan anggota gerak secara periodik: gangguan tidur ditandai dengan gerakan berulang-ulang dari anggota gerak sewaktu tidur pada lengan dan tungkai, yang terjadi sekitar 20-40 detik, dapat terjadi dengan atau tanpa penderita terbangun. Gejalanya dapat berupa sering terbangun malam hari, merasa letih pada otot-otot pada anggota gerak pada siang hari dan gelisah pada malam hari, 3. Gangguan tidur dengan kegelisahan tungkai : hal ini terjadi sewaktu menjelang tidur, yaitu seolah-olah ada rasa tidak nyaman seperti ada yang merayap atau kesemutan pada tungkai bawah. Akibatnya, penderita sulit untuk tertidur dan sewaktu tidur mudah terbangun. 5. Gangguan tidur yang berhubungan dengan kondisi medik: :berbagai gangguan tidur karena penyakit jantung, diabetes melitus, saluran cerna, penyakit yang menimbulkan nyeri, obat-obatan dan lain-lain. 6. Gangguan tidur yang berhubungan dengan kelainan jiwa misalnya akibat cemas dan depresi. Keadaan cemas biasanya tanpa sebab yang jelas, rasa kuatir berlebihan, rasa takut yang tak masuk akal, yang dapat menyebabkan penderita berjalan mondar mandir, gelisah terus menerus, jantung berdebar-debar, perut mulas dan lain-lain. Penderita depresi biasanya terbangun lebih cepat dari yang biasanya, tidak berdaya, tidak berpengharapan dan sedih, tidak punya tenaga, merasa letih dan tidak punya rasa percaya diri, menarik diri dari pergaulan masyarakat, bingung, tidak tahu keberadaannya (disorientasi), biasanya ada riwayat kehilangan sesuatu yang berharga atau bermakna di dalam hidupnya. 7. Gangguan tidur karena kepikunan (dementia) : seringkali menyusahkan orang serumahnya karena berkeliaran tengah malam, pergi ke dapur mencari makanan atau membongkar lemari.

30 Persen Masyarakat Indonesia Alami Gangguan Kesehatan Jiwa

pemerintah. Di sisi lain dengan rendahnya tingkat kesejahteraan tersebut, tentu dapat mempengaruhi kualitas pelayanan yang diberikan yang pada akhirnya dokter umum menjadi kehilangan kepercayaan masyarakat. Hal ini dapat terlihat dengan sikap masyarakat yang lebih memilih langsung berobat ke dokter spesialis tanpa indikasi rujukan dari dokter umum. Belum lagi maraknya pasien yang berobat ke luar negeri semakin menyudutkan kalangan dokter terutama dokter umum Indonesia sebagai tenaga kesehatan yang professional. Permasalahan diatas tentu membutuhkan solusi terbaiknya, karena selama bertahun-tahun pula, dokter umum belum memiliki wadah yang mampu untuk menyuarakan aspirasi mereka. Namun sejak tahun 2009, dokter umum telah memiliki sebuah organisasi untuk mempersatukan dan memperjuangkan aspirasinya.Wadah tersebut adalah Perhimpunan Dokter Umum Indonesia (PDUI). Berdirinyaorganisasitersebut disambut secara antusias oleh seluruh dokter umum yang ada

di Indonesia. Kenyataan ini juga terjadi di Sumatera Utara dengan dideklarasikannya serta dilantiknya pengurus PDUI cabang Sumatera Utara pada tanggal 6 maret 2010 yang diketuai oleh Dr Almaycano Ginting M.Kes dengan Sekretaris Umum Dr Suci Rahmat oleh Presidium Nasional PDUI Dr Abraham Andi PP M.Kes Dalam kurun waktu setahun pertama ini PDUI Cabang SumateraUtaralebihmenekankanaktivitasnya pada konsolidasi kepengurusan dan pemenuhan kebutuhan dasar organisasi. PDUI Cabang Sumatera Utara telah memiliki kantor tetap yang bertempat di Jalan Jemadi No. 7 Medan. Adanya sekretariat ini sangat pentinguntukmenunjangkinerja administrasi dan rutinitas organisasi. Dalam setahun ini, ada beberapa kegiatan yang telah diselenggarakandiantaranyaseminarDM Update pada bulan Maret 2010 yang bertujuan untuk meningkatkan kompetensi dokter umum dalam menangani kasuskasus diabetes dalam praktik sehari-hari. Selain itu banyak kegiatan ilmiah lainnya diselenggarakan

melalui kerjasama antara PDUI cabang Sumatera Utara dengan berbagai organisasi seperti Indonesian Pain Society, Ikatan Farmakologi Indonesia (IKAFI), MER-C dan PT.Jamsostek. Masih dalam rangka pelaksanaan program kerja, PDUI cabang Sumatera Utara maka telah melaksanakan workshop P2KB untuk dokter umum sebagai panduan dalam melakukan re-sertifikasi dan re-registrasi. Setahun berlalu PDUI Sumatera Utara melalui momentum peringatan hari ulang tahun yang pertama, menyelenggarakan silaturahmi dengan berbagai organisasi profesi di bidang kesehatansepertiIDI,perhimpunan dokterspesialisdankalanganakademis. Peringatan ini diselenggarakan secara sederhana dengan menyantuni anak yatim piatu. SetahunPDUISumateraUtara bekerja tentu masih banyak tugas dan tanggung jawab yang menanti. Melalui media ini kami mengajakseluruhelemenmasyarakat Indonesia untuk terus meningkatkan derajat kesehatan dan bertekad menjadi bagian dalam perbaikan dan peningkatan pelayanan kesehatan di Indonesia. *dr Noor Aziziah

ASURANSI KESEHATAN merupakan kebutuhan asuransi yang paling utama sebelum kita memiliki program asuransi dan investasi lainnya. Karena kesehatan adalah modal dasar kita untuk melakukan berbagai aktivitas kehidupan ini. Tingginya polusi dan pola hidup yang semakin tidak teratur dengan kebutuhan olahraga dan istirahat yang tidak cukup termasuk juga pola makan yang kini semakin instan, semua itu semakin meningkatkan resiko terhadap kesehatan. Jadi, peluang seseorang untuk sakit sangatlah tinggi. Sementara biaya kesehatan atau pengobatan kini semakin mahal khususnya biaya rumah sakit dan obat-obatan. Pada umumnya produk kesehatan terdiri atas asuransi kesehatan dan santunan kesehatan. Kedua produk tersebut memiliki perbedaan yang sangat mendasar. Perlu diingat bahwa jika diri kita atau ada anggota keluarga kita yang sakit dan harus dirawat di rumah sakit baru kita

merasakan pentingnya memiliki asuransi kesehatan. Karena saat sakit apalagi sakitnya parah, selain badan harus menderita, kantung pun ikut sengsara. Hal terpenting adalah sebelum menentukan produk asuransi kesehatan apa dan dari perusahaan asuransi mana. Berikut beberapa tips yang bisa kita gunakan sebagai pertimbangan: 1.Tentukan manfaat perlindungan apa saja yang kita butuhkan. Sebagai contoh memberikan manfaat rawat inap dan penyakit kritis karena inilah yang menyebabkan kita mengeluarkan sejumlah besar uang karena jangka waktunya sulit diperkirakan. 2.Cari informasi produk-produk asuransi sesuai kebutuhan. 3.Tanyakan kepada agen secara detail tentang produk tersebut secara menyeluruh sampai detail perhitungan alokasi dana yang kita bayarkan untuk apa saja. 4.Mintalah dibuatkan ilus-

trasi manfaat produk asuransi kesehatan, premi yang harus dibayarkan dengan pengalokasian premi yang dibayarkan itu kemana saja. 5.Pelajari isi ilustrasi di rumah dengan santai dan seksama. 6.Tentukan produk asuransi setelah semuanya benar-benar kita pahami. 7.Setelah menentukan dan memutuskan membeli suatu produk asuransi kesehatan, kita akan menerima polis asuransi yang berisi perjanjian yang mengikat antara nasabah dan perusahaan asuransi. Proses kalim merupakan momen penting pembuktian janji asuransi pada tertanggung. Di sinilah hal yang paling utama akan menjadi fokus customer (tertanggung), agen pendamping maupun perusahaan. Dalam hal ini mempertemukan hak dan kewajiban (tertanggung) dengan hak dan kewajiban perusahaan (penanggung). Bila semua syarat dan ketentuan klain telah terpenuhi sesuai polis

asuransi kesehatan, maka tidak satupun pihak asuransi yang dapat menolah klain atau tidak membayarkan manfaat perlindungannya. Semua itu dijelaskan secara detail dalam buku polis dan setiap polis asuransi memiliki jaminan kepastian hukum dalam NKRI. Hal penting lagi bahwa memiliki asuransi kesehatan bukan berarti menyelesaikan seluruh masalah terhadap resiko finansial kesehatan kita. Karena asuransi kesehatan hanya melindungi tertanggung terhadap resiko kesehatan yang mungkin akan terjadi di masa yang akan datang, bukan resiko yang sudah pasti dan telah terjadi. Berdasarkan pengalaman penulis agar jangan menggunakan seluruh budget kesehatan kita untuk membeli polis asuransi kesehatan. Sisihkan 25 persen sebagai cadangan untuk menutupi biaya-biaya yang disebut tabungan. Sehingga disarankan untukmenentukanasuransikesehatan yangjugamencakupjiwadantabungan. *Syamira Lubis

5 Manfaat Membaca Buku untuk Kesehatan Kebanyakan orang begitu sibuk dengan kehidupannya sehingga tidak cukup waktu untuk membaca buku, orang lebih senang menonton film, televisi atau bermain komputer. Padahal membaca tidak hanya memperkaya wawasan tetapi juga bermanfaat untuk kesehatan. Rajin membaca dapat membuat orang kaya akan wawasan dan informasi. Selain itu, membaca untuk bermanfaat untuk otak dan kesehatan. Setidaknya ada 5 manfaat membaca untuk kesehatan, seperti dilansir Lifemojo, Sabtu (12/3/2011), yaitu: 1. Melatih otak Salah satu keuntungan membaca buku adalah sebagai latihan otak dan pikiran. Membaca dapat membantu menjaga otak agar selalu menjalankan fungsinya secara sempurna. Saat membaca, otak dituntut unutk berpikir lebih sehingga dapat membuat orang semakin cerdas. Tapi untuk latihan otak ini, membaca buku harus dilakukan secara rutin. 2. Meringankan stres Stres adalah faktor risiko dari beberapa penyakit berbahaya. keindahan bahasa dalam tulisan dapat memiliki kemampuan untuk menenangkan dan mengurangi stres, terutama membaca buku fiksi sebelum tidur. Cara ini dianggap bagu untuk mengatasi stres. 3. Menjauhkan risiko penyakit Alzheimer Membaca benar-benar dapat langsung meningkatkan daya ikat otak. Ketika membaca, otak akan dirangsang dan stimulasi (rangsangan) secara teratur dapat membantu mencegah gangguan pada otak termasuk penyakit Alzheimer. Penelitiantelahmenunjukkanbahwalatihanotaksepertimembaca buku atau majalah, bermain teka-teki silang, Sudoku, dan lain-lain dapat menunda atau mencegah kehilangan memori. Menurut para peneliti, kegiatan ini merangsang sel-sel otak dapat terhubung dan

tumbuh. 4. Mengembangkan pola tidur yang sehat BilaAndaterbiasamembacabukusebelumtidur,makaitubertindak sebagai alarm bagi tubuh dan mengirimkan sinyal bahwa sudah waktunya tidur. Ini akan membantu Anda mendapatkan tidur nyenyak dan bangun segar di pagi hari. 5. Meningkatkan konsentrasi Orang yang suka membaca akan memiliki otak yang lebih konsentrasi dan fokus. Karena fokus ini, pembaca akan memiliki kemampuan untuk memiliki perhatian penuh dan praktis dalam kehidupan. Ini juga mengembangkan keterampilan objektivitas dan pengambilan keputusan. Jadi jangan hanya menghabiskan waktu berjam-jam untuk menonton televisi atau bermain game komputer, tetapi juga luangkan waktu untuk membaca buku. Kebiasaan baik itu tidak hanya akan menyegarkan pikiran tetapi juga memberi manfaat untuk kesehatan dan kehidupan.(det)



WASPADA Minggu 13 Maret 2011

Gaun Abstrak KEPALA Dinas Pendidikan Kota Medan Drs. H. Hasan Basri, MM didampingi Pimpinan Perguruan Methodist 2 Pdt Paulus Subyanto, STh saat meninjau salah satu institusi pendidikan yang ikut dalam Methodist Education Expo 2011, Jumat (11/3).

TAHUN ini adalah saat yang tepat untuk bergaya dengan terusan motif abstrak yang membuat kita serasa berada di zaman Mama kita remaja. Sesekali ingin tampil dengan gaun vintage, boleh-boleh saja. **Neneng KZ/AP


Methodist Education Expo 2011

Ajang Siswa Bersaing Dalam Ilmu Sains LOMBA sains plus antar pelajar SMA se Sumut dan pameran pendidikan merupakan ajang mempertemukan siswa dari berbagai kabupaten/kota di Sumut agar bisa bersaing dalam lomba sains atau melihat berbagai perguruan tinggi (PT) di dalam maupun di luar negeri. Demkian Kadis Pendidikan Kota Medan Drs. H. Hasan Basri, MM ketika membuka Education Expo 2011 yang digelar SMA Methodist 2 Medan, Jumat-Sabtu (11-12/3). “Jadi ini iklim yang sangat bagus sekali, sebuah upaya yang harus kita dorong untuk melihat perkembangan PT dalam negeri maupun luar negeri dalam upaya mendekatkan anak-anak keduniapendidikan,”kataHasanBasri. DijelaskanHasan,melaluikegiatan ini kita harapkan ke depan semangat berprestasi siswa, jadi perlu kita dorong dan motivasi. Untuk membangun apa yang dinamakan iklim kompetisi maka akan lahirlah kompetensi dan prestasi. Karenakompetensiituharusdidukung dengan kompetisi, agar bisa menjadi dorongan bagi mereka untuk bisa berprestasi baik. Paramaternya dalam prestasi, siswa harus memiliki kepercayaan, karakter IT, prestasi, integritas, mandiri (PRIMA), jadi kita harus membangunnya bersama-sama tidak bisa sendiri, jadi kita perlu pengusaha, sekolah dan orangtua siswa serta masyarakat yang peduli dengan pendidikan. Menyangkutpameranpendidikan,

Hasan berpesan, kepada institusi yang ikut dalam Education Expo ini kiranya bisa memberikan ruang untuk memamerkanberbagaikeunggulan,jadikami mengimbau jangan ada institusi yang ilegaldanmemberikaninfotidakbenar. “Siswa boleh memilih dan selektif, karena masa depan anda tergantung di tangan anda. Jadi jangan salah memilih perguruan tinggi,” katanya. Kepada panitia, ke depan harus penyusunnyasoal-soalharusdianalisis, berdasarkan standar soal yang disesuikandenganbadanstandarnasional. “Jadi sebelum diujikan, kalau perlu kita analisis dahulu baru kemudian kita ujikan. Agar soal-soal yang diujikan ada konektivitasnya dengan soal-soal yang akan disajikan dengan ujian nasional. Pimpinan Perguruan Methodist 2PdtPaulusSubyanto,SThdalamsambutannya mengaku kagum atas semangat peserta yang begitu antusias mengikuti lomba sains plus ini meskipun pekan depan masing-masing sekolahakanmelaksanakanujianakhir sekolah (UAS). Lebih lanjut dijelaskan Paulus, kegiatan ini sudah menjadi ciri khas dan sumbangsih SMA Methodist 2 Medan bagi pendidikan, khususnya di Sumatera Utara. Melalui kegiatan ini kita harapkan mampu meningkatkan kecerdasan bangsa dan kesadaran ilmiah, sehingga siswa mampu mengekspresikan rasa keingintahuan dan meningkatkan kreativitas sistematika berpikir serta nalarnya dalam bertanding dengan siswa lainnya dan mempererat hubungan sesama siswa, guru dan sekolah. Sementara itu Ketua Lembaga


AKTRAKSI tarian daerah yang ditampilkan siswa SMA Methodist 2 saat pembukaan Methodist Education Expo 2011 di sekolahnya, Jumat (11/3). Olimpiade Pendidikan Indoensia (LOPI) Donald Tambunan mengatakan, lomba sains ini merupakan wacana untuk mencari bibit-bibit berprestasi untuk nantinya diikutsertakan dalam olimpiade sains tingkat kota, daerah dan nasional nantinya. “Jadi ini merupakan barometer siswa untuk bisa nantinya tampil dalam ajang bergengsi tersebut,” katanya KetuaPelaksanaDrsBobS.Saragih, MSi, Sekretaris J. Manurung, STh menjelaskan, jumlah peserta yang ikut dalam lomba sains ini berjumlah 1.078 siswa yang diikuti 19 kabupaten/kota se Sumut di antaranya, P. Siantar, Tan-

jungbalai,T.Tinggi, Deliserdang,Tanah Karo, Simalungun, Asahan, Labuhanbatu, Tapanuli Selatan, Dairi, Tobasa, Madina, Kisaran, Samosir, Sergai, Sidikalang, Rantauprapat dan Medan. “Untuk bidang lomba yang akan digelar, yakni, biologi, fisika, matematika, kimia B. Inggris dan Ekonomi Akuntansi. Selain itu juga28 institusi perguruan tinggi dalam dan luar negeri meramaikan pameran pendidikan internasional pada Methodist 2 Education Expo 2011 di antaranya Singapore, Malaysia, Australia, Inggris dan perguruan tinggi lokal serta nasional,” jelas Bob Saragih. ** m43

Dua Siswa SMP Darussalam Juara Spelling Contest DUA siswa SMP Darussalam Stevani Al Hasyim Hasibuan, kelas VIII dan Fahara Liddini Hanifah kelas VII berhasil meraih juara II dan I pada lomba Spelling Contest di Shandy Putra Telkom, belum lama ini. Demikian Kepala SMP Muhammadiyah Ariadi, AEF. SPd didampingi PKS III Kesiswaan Alfadri, SPd kepada wartawan, Senin (7/3) mengatakan, kami sangat bersyukur kepada Allah SWT atas prestasi yang diraih peserta didik, yang selanjutnya kita harapkan ini bisa menjadi modal mereka untuk masa-masa mendatang. Kepada peserta didik yang telah berprestasi, tutur Ariadi lagi, kiranya agar terus termotivasi untuk berprestasi baik di akademik maupun ekskul. Sementara kepada peserta didik lainnya agar terus berpacu seperti temanteman yang sudah berhasil. Menanggapikeberhasilansiswaitu,PKSIIIKesiswaanAlPadrimenjelaskan, secara kontiniu pihak sekolah melakukan pembinaan secara intensif kepada siswa yang berprestasi, sebagai wadah untuk memberikan kesempatan mereka untuk dapat mengekspresikan pengetahuan dan keterampilananya dalam bidang akademik dan non akademik. Sementara itu, Liddini dan Stevani, ketika dimintai komentarnya mengaku tidak percaya bisa meraih juara pada event tingkat Sumut dan NAD ini meningat persaingan yang cukup ketat. Tapi begitupun, mereka merasa bangga tas prestasi yang mereka raih dalam perlombaan ini. **m43

karya tulis siswa untuk dijadikan dokumentasi khusus, jika memungkinkan akan dilaksanakan penjajakan terhadap penerbit buku agar karya siswa itu bisa dirilis untuk dipasarkan. Demikian antara lain disampaikan Kepala MTsN 2 Dra Nursalimi MAg, Jumat lalu. “Selaku kepala sekolah, tentu saja saya memberikan apresiasi

Waspada/Anum Saskia

FINA Mardiana memamerkan karya novelnya bersama guru di sekolahnya Nita Ariani.

Yuk, Tetap Senyum Usai Patah Hati GIRLS, hampir setiap orang yang telah mengenal cinta merasakan sakit dan sedihnya patah hati. Tapi enggak zamannya lagi menangisi kesedihan karena ditinggal pacar secara lama. Karena hidup kita harus terus berlanjut, jadi buat apa lama-lama memikirkan si dia yang sudah pergi.

Fokus ke pelajaran Sebenarnya putus cinta bisa jadi hal positif. Kita jadi punya waktu lebih untuk melakukan aktivitas yang selama ini ditinggalkan. Kita bisa main sepeda, hangout sama teman, atau jalan sama kakak dan mama. Salah satu yang penting, kita juga bisa lebih focus ke pelajaran.

Tetap berteman Biar tidak terlalu lama merasakan sakit, yuk jalin hubungan pertemanan dengan mantan. Meski hubungan kita sebagai pacar sudah berakhir, engak ada salahnya kita tetap menjadi teman, bukan malah musuhan. Memang, sih kita enggak bisa langsung temenan sama si dia. Kita pasti butuh waktu untuk melewati rasa sakit. Tapi, kalau kita sudah ikhlas, kita pasti bisa berteman sama mantan. Biar bagaimanapun, kalau dulu kita bisa pacaran sama dia, berarti pasti ada sifat yang kita sukai, kan?

Lebih kreatif Kita harus bisa membuktikan, putus cinta bisa menjadi ajang buat membuktikan prestasi. Cukup lah seharian menangisi kepergian si dia. Sambut esok pagi dengan beraktivitas positif, seperti menulis puisi, cerpen atau menulis bait-bait lagu. Cara ini terbukti ampuh dan menjadi terapi yang bagus untuk mengobati sakit hati. Liburan dengan keluarga Pergi liburan selalu berhasil mengembalikan mood atau semangat kita agar bagus kembali. Setelah putus, kita jadi bisa pergi

bareng keluarga dan bercengkrama bersama, hal ini mungkin sangat jarang kita lakukan saat masih berpacaran. Berlibur bareng keluarga pasti ampuh mengalihkan perhatian kita dari pikiran sedih dan suntuk. Cari yang baru Putus pacaran memang bikin sakit hati. Tapi enggak berarti kita harus sedih berkepanjangan? Masih banyak cowok lain yang enggak kalah oke dari mantan. Kita enggak salah kok kalau ingin mencari kebahagiaan yang baru. Toh hanya kita yang tahu bagaimana bikin hidup kita lebih bahagia. Asal jangan jadikan gebetan baru sebagai pelampiasan saja. Belajar mencintai lagi Biarpun sakit, tapi dari putus pacaranlah kita bisa tahu cowok seperti apa sih yang cocok buat kita. Jadi, nanti kalau si cowok yang lebih oke datang, kita udah siap untuk menerima dan belajar mencintai lagi. **m31

Peringatan Maulid Di SMA Dharmawangsa Waspada/Dede

Liddini dan Stevani foto bersama usai menerima hadiah lomba Spelling contest di SMk Shandy Putra Telkom, belum lama ini.

Apresiasi Bagi Siswa Penulis Novel MADRASAH Tsanawiyah Negeri (MTsN 2) Jalan Pratun Medan, memberikan apresiasi kepada para siswa yang gemar menulis. Caranya dengan memberi kesempatan kepada penulisnya untuk memamerkan tulisannya di perpustakaan sekolah. Ke depan, pihak sekolah berencana membukukan semua


yang tinggi terhadap siswa yang mempunyai hasil karya. Utamanya buat siswa bernama Fina Mardiana Nasution yang membuat karya novel berjudul Sahabat terbaik Fia adalah karya Fina yang pertama. Karyanya itu sudah bisa dibaca para siswa karena dibukukan dan diletakkan di perpustakaan,”kata Nursalimi. Sempat Khawatir Meski awalnya merasa kuatir karyanya ditolak orang lain, tapi akhirnya Fina sang penulis novel ini memberanikan diri untuk melahirkan karyanya itu dan membukukannya. Ternyata apa yang dia khawatirkan tidak terbukti sama sekali. Sebab, teman dekat, bahkan temannya di kelas memberikan dukungan penuh padanya untuk menyelesaikan tulisan novelnya itu. “Keraguan dan rasa khawatir saya ternyata tidak beralasan, karena kepala sekolah, guru dan sahabat serta orang tua akhirnya memberikan dukungan hingga novel sebanyak 118 halaman folio ini bisa selesai. Saya memerlukan waktu dua bulan untuk bisa menamatkan cerita yang saya kemas dari cerita fiksi bertemakan anak pelajar. Alhamdulillah, orang tua saya juga sudah memberikan

angin segar untuk karya ini, katanya akan membicarakannya dengan pihak penerbit. Saya bahagia sekali, apalagi pihak sekolah memberi kesempatan pada saya untuk memajang novel ini di perpustakaan sekolah,”kata Fina datar. Apa sebenarnya cita-cita Fina, hingga dia begitu tertarik dengan dunia sastra bahkan menyempatkan diri menulis karya novel ? “Saya ingin jadi dokter. Tapi menulis memang hobi saya sejak kecil. Karena itu saya gemar membaca apa saja yang bisa menjadi inspirasi dalam menulis. Waktu kecil saya punya buku cerita yag selalu menjadi teman sebelum tidur. Setelah lulus SD, saya pilih baca novel yang ceritanya pada skala remaja dan sedikit buku tentang dongeng. Dari rajin membaca itu, saya terobsesi membuat naskah cerita yang saya simpulkan tulisan ini adalah sebuah novel. Alhamduillah begitu selesai langsung saya bukukan. Kalau dijadikan novel dan bisa dipasarkan, saya merasa lebih bahagia lagi,”kata puteri pasangan Lutfi Maulana Nasution dan Sri Kencana yang tinggal di Jalan Danau Singkarak Medan ini. Anum Saskia

Teladani Kepemimpinan Rasulullah PERINGATAN maulid Nabi Muhammad SAW di SMA Dharmawangsa, Sabtu (12/3) berjalan meriah dan khidmat. Hal itu ditandai dengan tampilnya berbagai penampilan seni dan lomba siswa, seperti lagu-lagu Islami, puisi, Nasyidn, MTQ, dan lomba cerdas cermat. Al Ustadz Syech Tengku Abdul Rahman Umar, BA yang hadir dalam peringatan tersebut dalam tausyiahnya mengharapkan kepada siswa agar meneladani kepemimpinan Rasulullah SAW, baik itu dari perilaku, berbicara sopan santun, apalagi cara berpakaiannya terutama kaum putri. “Saat ini kita sangat miris sekali melihat cara berpakaian para remaja putri, meskipun mereka memakai jilbab tapi tetap saja membuka aurat atau memakai pakaian ketat, sehingga terlihat lekuk tubuh. Dengan cara berpakaian yang tidak sopan bahkan memancing syahwat, hal ini bisa menimbulkan hal-hal negatif bagi remaja putri,” katanya. Sementara Kepala SMA Dharmawangsa Drs. Sutrisno mengatakan, memperingati lahirnya Nabi Muhammad SAW ini bertujuan untuk supaya kembali mengingat akan sejarah perjuangan beliau. Sekaligus mensyiarkan Islam di kalangan remaja dan pelajar-pelajar yang saat ini tidak lagi mengenal

Rasulnya. Untuk itu, Sutrisno mengajak siswa bersama-sama melanjutkan perjuangan Nabi Muhammad SAW untuk mensyiarkan Islam dengan cara menjaga ibadah, merubah sikap, perilaku dan disiplin. “Banyak dari kita yang mengikuti peringatan tersebut bisa mengambil maknanya, sebagian menganggap hanya sebatas peringatan hari kelahiran seorang insan yang paling mulia bagi umat Islam, dan pengulangan dari cerita sejarah Rasul. Untuk itu jangan peringatan kelahiran Rasulullah ini dijadikan seremonial, tapi merupakan

wujud nyata untuk memupuk rasa cinta kepada-NYA,” katanya. Ketua Panitia Drs. Purwanto didampingi Drs. Karyaman Sinaga menjelaskan, melalui peringatan maulid ini diharapkan dapat memberikan perubahan perilaku kepada siswa dan guru. Seperti cara berpakaian Islami, berkasih sayang, saling menolong dan membantu untuk keselamatan dunia dan akhirat. Hadir dalam peringatan maulid itu, Ketua Yayasan diwakili H. Muzzakir, SE, Kepala SMA Dharmawangsa Drs. Sutrisno, Wakasek Drs. Ahmad Syamsuri Matondang, dewan guru dan siswa. ** m43


AKSI salah satu grup musik perwakilan siswa kelas XI SMA Dharmawangsa saat menyemarakkan Maulid Nabi di sekolahnya, Sabtu (12/3).

WASPADA Minggu 13 Maret 2011

Drs Mahmud Rangkuti


RAJIN melakukan komunikasi pada pesera didik sebelum kegiatan belajar mengajar berlangsung di sekolah, adalah program yang selalu dilaksanakan oleh Kepala SMPN 7 Medan di Jalan Adam Malik ini. Baginya membangun komunikasi terhadap peserta didik termasuk sarana silaturahmi serta sebuah peluang agar siswa tidak terlalu kaku menghadapi kepala sekolahnya. “Sebelum mulai belajar, atau kebetulan siswa yang datang terlambat, saya langsung bertanya. Mengapa terlambat, di mana rumah, apa kegiatan

sebelum kesekolah? Kalau alasan mereka karena rumahnya jauh, lantas saya katakan mengapa tidak sekolah di dekat rumah saja agar tidak terlambat. Mendengar hal itu, siswa tadi menangis dan berjanji tidak akan terlambat lagi. Sayapun lega, karena saya melihat mereka membuktikan ucapannya. Tetapi sebagai pimpinan, sayapun harus menjadi contoh, karena itu saya harus datang ke sekolah lebih awal, agar sayapun dicontoh para siswa dan guru di sekolah ini,”kata Mahmud Rangkuti kemarin sembari menyebutkan meski masih beberapa bulan menjabat kepala sekolah di SMPN 7 ini, ia sudah merasa sangat dekat dengan para siswa dan seluruh staf pengajar di sekolah itu. Selain komunikasi dan memberikan contoh di lingkunga sekolah, Mahmud mengaku memberikan motivasi dan dukungan pada siswa yang akan mengikuti Ujian Nasional. Pihak sekolah, kata dia,sudahmemberikanberbagaibimbingankepada siswa sesuai mata pelajaran yang akan diujikan. Selain try out, para siswa diberi kesempatan menelaah soal-soal ujian yang telah lewat dengan program pengulangan materi ujian disampaikan guru bidang studi masing-masing. “Persiapan untuk UN sudah cukup mantap, diharapkan dalam pelaksanaannya tidak ada masalah,”katanya yang menyebutkan jumlah siswa yang ikut UN tahun ini mencapai 289 siswa. Saat ini mereka sedang mengikuti kegiatan Ujian Sekolah, nantinya hasil ujian sekolah ini akan disampaikan kepada dinas pendidikan, karena syarat kelulusan termasuk hasil ujian sekolah,”ujarnya. *Anum Saskia

aja pekarangan belakang atau teras menjadi lokasi pesta kebun yang cantik. Biar lebih terasa suasana kebun, minta katering yang menangani pestamu membuatkan menu makanan yang sesuai tema. Jangan lupa kue ulang tahunmu juga berornamen buah dan sayuran. 2. Pesta Kolam Renang Mau pestamu terasa santai? Bikin pesta di tepi kolam renang. Biar makin meriah, tambahin aja permainan seru. Ajak teman-teman dekatmu buat merancang permainan buat ngisi acara pestamu. Jangan lupa, siapin baju cadangan buat jaga-jaga bajumu basah kena air. Cocoknya, pesta ini diadain siang atau sore hari, jadi tamu-tamu kamu gak kedinginan dan masuk angin. 3. Cosplay Seru banget kalau ultahmu dihadiri karakter Manga/anime Jepang beken! Apalagi kalau kamu dan teman-temanmu penggemar anime. Siapin fotografer buat mengabadikan momen seru ini. 4. Blast From The Past Nggak ada salahnya nyobain pesta ala dekade ‘70 atau ‘80-an. Suasananya bakal lebih oke kalau diiringi dengan iringan musik yang beken di jaman itu. Baju-baju gaya tempo doeloe bikin kita serasa hidup di zaman Mama dan Papa. **m31

paikan Kepala SMKN 1 Medan Dra Asli Sembiring MM,kegiatan sosialisasi ini bertujuan untuk memberikan pemahaman kepada siswa bagaimana seharusnya memposisikan diri di jalan raya saat menggunakan kenderaan mereka. Diharapkan, dengan pengetahuan ini para siswa akan lebih disiplin dan memahami bagaimana berkendara yang baik, hal ini memberikan dampak pada keselamatan mereka juga. Selain itu sebagai bukti kepada masyarakat bahwa para pelajar yang menggunakan kenderaan tidak akan menjadi ugal-ugalan. “Kegiatan ini sangat positif, diharapkan para peserta bisa memahami sikap dan prilaku mereka dalam berkendaraan dan yang paling utama patuh pada peraturan rambu lalu lintas, sehingga mereka selamat diperjalanan,” kata Asli Sembiring. Dia juga menyebutkan bersamaan dengan kegiatan ini,dilaksanakan juga kegiatan

perlombaan. Dengan pakaian seragam sekolah, puluhan bahkan seratusan remaja putra dan putri secara bergantian mulai dari tingkat Pendidikan anak usia dini (Paud) , SD, SMP duduk bersama di atas tikar sambil di depan mereka tersedia meja kecil dengan beberapa lembar kertas dan peralatan tulis lainnya sebagai fasilitas mendukung perlobaan melukis dan mewarnai. “Ini merupakan tahap awal kami dari Yayasan Komunis 17 Agustus Indonesia yang berpusat di Tembung, Sumatera Utara,” kata Husni Hamid Lubis, SE sebagai ketua pelaksana acara Gerakan Peduli Pendidikan dan Kesehatan Deli Serdang usai acara pembukaan oleh Ketua YP-17 Agustus Indonesia Sukadi Kagan. Husni Hamid Lubis sendiri mengaku selain lomba menggambar dan mewarnai tetapi acara bakti sosial itu dirangkai acara sunat massal dan pengobatan gratis serta memberikan

bantuan kepada kaum dhuafa. Husni yang didampingi Sekretaris panitia Halil, SE dan Ketua Penggerak Pendidikan dan Sosial Masyarakat Rahmad Hidayat menyebutkan bahwa kegiatan gelar pendidikan dan kesehatan itu sebagai kelanjutan dari gerakan peduli Kamtimbmas sebelumnya. Sementara tujuan digelar acarapedulipendidikandankesehatan itu, sebagai upaya memotivasiminatanak-anakdalamberkarya serta memberikan perhatian khusus kepada kaum dhuafa di daerah pedesaan yang selama ini sering disebut hanya diperuntukkan bagi orang kota. Dia juga sangat berterima kasihkepadaKepalaDinasPendidikan Sumatera Utara Drs.Syaiful Syafri, MM yang turut mendukung acara tersebut. Begitu Husni mengakuacarayangdimeriahkan hiburan keyboard dengan menampilkan penyanyi-penyanyi popular di desa itu hanya bertumpu pada kekuatan dana sen-

diridaripengurusYayasanKomunitas 17 Agustus Indonesia yang berpusat di Sumatera Utara. “Kami tidak ada mengajukan proposal untuk acara peduli tahap awal ini,” kata Husni. Begitupun dia tidak menutup peluang bagi kalangan masyarakat seperti pengusaha atau pejabat pemerintah yang ingin membantu acara selanjutnya yang akan dilaksana-kan di berbagai kabupaten dan Kota se Sumut, dan yang kedua sesudah Bandar Klippah dijad-walkan berlangsung di kota Binjai secara bergilir. Menurut Husni, kita perlu mempedulikan anak-anak remaja usia sekolah dalam bentuk memberi kesempatan menampilkan bakat karya seni mereka. “Yang tidak kalah pen-tingnya adalahturutdiperlombakanpembacaan teks Proklamasi dan Undang-Udang Dasar 1945,” kata Husni yang mengaku saat ini kondisi kurangnya perhatian terhadap sejarah bangsa kita ini.

Malah isi kedua teks itu , menurut pandangan pengurus YK-17 Agustus Indonesia itu, banyak tertinggal dan banyak terlupakan, termasuk oleh kaum remaja sebagai generasi pewaris atau penerus tongkat estafet kepim-pinan bangsa. Husni juga membenarkan bahwa kegiatan ini dilakukan di pedesaan bukan dikarenakan tidakpunyabiayatetapimengingat sejarah perjuangan bangsa kita yang juga berjuang dari desa. Jadi kegiatan sosial seperti ini, selainanak-anakdesayangberada di desa tertinggal atau apalah namanya,termasukdarikalangan orangtuaberekonomilemah,bisa mendapatkan kesempatan langsung menerimanya. “Kami harap panitia dari Kosmunitas 17 Agustus Indonesia tidak berhenti sampai di sini melaksanakan acara lomba ini tetapi terus berkelanjutan,” kata Fadila yang disertai sejumlah rekanrekan yang ikut lomba. *Aidi Yursal

Sekolah Islam Di Medan Bertaraf Internasional

Berkendara Perlu Pengetahuan Juga Lho PELAJAR SMKN 1 Medan mendapatkan pengetahuan tentang cara berkendara yang aman serta kewajiban mengenakan berbagai perangkat berkenderaan. Kegiatan sosialisasi berkendara ini berlangsung Sabtu kemarin di sekolah tersebut dengan mendatangkan nara sumber W Sitorus dari Satlantas Medan. Dalam paparannya, Sitorus menyebutkan para pengendara harus mempunya perlengkapan antara lain kelengkapan surat-surat kenderaan serta kelengkapan perangkat kenderaan lainnya. Diingatkan pula mengenakan pengaman seperti helm, jaket dan sarung tangan. “Berbagai perangkat yang harus digunakan oleh pengendara termasuk juga pendukung keselamatan mereka di jalan raya,” kata Sitorus yang menambahkan pandai menggunakan kenderaan tanpa paham aturan dan keamanannya, bisa memberikan dampak buruk. Hal yang sama disam-

KAUM remaja yang berdomisili di daerah pedesaan, khususnya di Desa Bandar Klippah, Kecamatan Tembung, Kabupaten Deliserdang yang selama ini merasaterkucilkankarenakesempatan dalam mengukur kebolehandalambidangsenisertamendapatkanpengetahuaninformasi terknologi sering lebih banyak diperuntukkan untuk kaum remaja yang tinggal di perkotaan, namun pada Kamis, 10 Maret itu mulai hilang dan kembali bergairah. Acara peduli Pendidikan dan Kesehatan yang digelarYayasan Peduli 17 Agustus di lapangan Garuda Putra, Bandar Klippah itu merupakan lembaran baru bagi anak-anak remaja, khususnyamerekapadausiadini,karena berkumpul bersama-sama untuk mengikuti lomba melukis, lomba mewarnai serta dilatih menggunakan peralatan computersehinggapengetahuanyang mereka peroleh di sekolah formal selama ini siap diuji dalam suatu

Pembina YPSA Resmikan PSB

Menggelar Pesta Tips M enggelar P esta eru U ltah Yang SSer er u DI usia remaja seperti kita menggelar pesta ultah menjadi satu impian, apalagi pesta ulang tahun di usia tujuh belas. Bagaimana agar pesta ultahmu selalu diingat terus? Kuncinya ya bikin pesta yang unik dan nggak biasa. Caranya ? Banyak kok alternatif tema pesta ultah seru yang bisa kamu cobain.Yang penting bikin persiapan yang matang biar pesta ultahmu gak terlupakan. Sebelum menentukan tema, ada baiknya untuk mengikuti beberapa langkah singkat agar pestamu bisa sukses, antara lain: ·Bentuktimpanitiakecilbuatnyiapinpestamu, soalnya pesta bertema perlu persiapan yang lebih matangdankitabutuhtenagadanbantuantemanteman yang memang siap untuk bekerja. · Cari info sebanyak-banyaknya tentang tema yang kamu pilih. Jangan sampai kamu sendiri malah salah kostum. Ini penting banget, biar pestamu tetap menjadi kenangan teman-teman yang diundang. · Pastiin kamu mencantumkan dress code pestamu di undangan. Mentaati peraturan seperti gaun pesta adalah salah satu kewajiban bagi para undangan, jadi jangan lupa menuliskannya di undangan. 1. Pesta Kebun Nggak harus beneran diadain di kebun. Sulap

Remaja B9 Kepedulian Komunitas 17 Agustus Indonesia Memotivasi Pendidikan Remaja Pedesaan

bazar dan tampilan pentas seni para siswa yang menampilkan berbagai tari kreasi daerah dan modern. Program ini, sekaligus menghilangkan rasa jenuh siswa kelas akhir yang baru saja usai mengikuti ujian praktik dan menyongsong program ujian tiori tanggal 15 Maret mendatang. “Kebetulan kegiatan sosialisasi aman berkenderaan bagi para siswa dimulai sejak pagi hari. Mumpung semua siswa berkumpul, maka siswa yang lain tidak mau ketinggalan untuk unjuk kebolehan dengan kegiatan pentas seni dan menampil-kan karya kreativitasnya yang dituangkan dalam program bazar. Disini ada program keahlian pemasaran, jadi mereka mendominasi kegiatan bazar. Sekalian praktik pemasaran juga. Alhamdulillah kegiatan berjalan lancar, lebih dari seribu siswa ambil bagian dalam kegiatan ini,” ucapnya. *Anum Saskia

SEBAGAI sekolah Islam bertaraf internasional di Medan, YP. Shafiyyatul Amaliyyah terus berupayameningkatkanberbagai fasilitas dan melakukan berbagai terobosan-terobosan baru dalam bidang pendidikan, baik itu bekerjasama dengan Cambragde dalam kurikulum begitu juga mengirimkan siswa intuk mengikuti event-event berkelas di dunia. PembinaYPSA Drs H Sofyan Raz, Ak. MM ketika meresmikan (launching) penerimaan siswa baru (PSB) untuk TP 2011-2012 di Front Office sekolah itu, Selasa (8/3). Hadir dalam acara itu Ketua UmumYPSA Umi Hj Rahmawaty Sofyan Raz, Ketua Harian Hj Nunuk P,Kepala Humas Drs Amrizal, seluruh kepala sekolah, sejumlah guru dan siswa. Dijelaskan Sofyan Raz, persaingandibidangpendidikansaat ini, khususnya di Medan membuatYPSA harus tetap konsisten. Sehingga, tahan dari berbagai tantangan dan cobaan yang menerpanya. Hal ini tidak mudah, karena tantangan dan cobaan itu sangatdirasakanYPSAbelakangan ini sehingga kita terus meningkatkan sistem dan kualitas pendidikan di YPSA. “Apalagi, secara sarana dan prasarana serta fasilitas di sekolah yang bertaraf internasional ini terpenuhi. Bahkan, banyak siswa YPSA yang dikirim ke mancanegarauntukmenimbailmupengetahuandanpengalaman,”katanya. Menurutnya,YPSA merupakan sekolah Islam di Medan bertaraf internasional yang secara terus-menerus meningkatkan kualitas pendidikan, termasuk seluruh guru dan karyawannya harus benar-benar berkualitas untuk bisa menjadi sekolah go internasional. Pada kesempatan itu, Sofyan Raz meminta kepada seluruh panitia PSB TP 2011-2012 harus dapat memberikan pelayanan


Ketua Umum YPSA Hj Rahmawaty menggunting pita sebagai tanda dimulainya PSB di sekolah tersebut, Selasa (8/3). terbaik kepada masyarakat yang anak-anaknya ingin bersekolah diYPSA,sepertidilakukansekolahsekolah di mancanegara. “Karena itu, setiap calon siswa dan orangtua yang berurusan dengan YPSA dalam PSB harus dilayani dengan sebaik-baiknya. Berikan pelayanan terbaik, agar merekabenar-benarnyamandan menjadikanYPSAsebagairumahnyasendiridengantetapmenjaga kebersihan dan keamanannya,” ujarnya. Ketua PSB Azhar Fauzi, SAg dalam laporannya mengatakan, PSB YPSA TP 2011-2012 sudah dimulaisejak7Maretdenganberbagai persiapan dengan terencana, terarah, bertahap, realistis,


Tim futsal SMP Muhammadiyah 1 usai menerima tropy foto bersama di Raja Futsal belum lama ini.

Ekskul Futsal SMP Muh 1 Ukir Prestasi

Waspada/Anum Saskia

UJI KEMAMPUAN : Seorang siswa yang sedang diuji menggunakan kenderaan sepeda motor yang dilihat langsung oleh kepala sekolah di antara siswa lainnya. Mahir berkendara perlu diimbangi dengan berbagai kelengkapan kenderaanya.

EKSKULfutsalSMPMuhammadiyah1Medanberhasilmenuai prestasi gemilang. Tim yang digawangi pelatih M. Latif Siregar berhasil meraih juara I dan II pada turnamen futsal antar SMP Muhammadiyah se Kota Medan di Raja Futsal, pekan lalu. Menurut Kepala SMP Muhammadiyah 1 Paiman, SPd didampingi pelatih M. Latif Siregar kepada wartawan mengatakan, Alhamdulillah dua tim SMP Muhammadiyah berhasil meraih juara I dan II, ini membuktikan pembinaan yang kita lakukan di sekolah sudah cukup baik. “Apalagi selama ini kita berupaya terus memfasilitasi keinginan dan bakat siswa dalam bidang olahraga, seperti futsal ini kita memberikan latihan kepada siswa setiap Kamis dan Sabtu. Begitu juga dengan ekskul Tapak Suci Putra Muhammadiyah, yang lebih dulu memberikan hasil yang maksimal di tingkat lokal maupun provinsi dan nasional. Di jelaskan Paiman, pada turnamen kemarin kita menurunkan tim I Rifai Ujung (kipper), M. Iqbal (back), Jihan (back), Dandi (penyerang) dan Mari (penyerang). Sedangkan tim II Firmansyah (kipper), Agung Anugrah (back), Supriadi (back), Bima Sakti (penyerang), Tri Julianto (Penyerang) dan Dandi, kelas VIII C berhasil menjadi top scor. “Ke depan kita harapkan siswa yang berhasil meraih juara ini bisa menjadi motivator siswa yang lain untuk bersaing dalam berbagaibidangprestasibaikituakademik,maupunnonakademik,” sebut Paiman. ** m43

serius dan berkesinambungan dengan didukung oleh tim kerja yang profesional.

Acara itu ditandai pengguntingan pita oleh Umi Hj Rahmawaty Sofyan Raz serta penekanan

tombol tentang perkembangan YPSA melalui audio visual dilakukan Buya H Sofyan Raz. * m43

Mahasiswa Politeknik LP3I Medan Study Tour Ke Tiga Negara BELAJAR sambil jalan-jalan merupakan suatu kegiatan yang paling menyenangkan, selain menambahwawasan,pengalamandanpengetahuan, kegiatan study tour juga dapat mempelajari kehidupan dan aktivitas usaha masyarakat di suatu daerah maupun negara lain, sebagai penyesuaian dari mata kuliah yang ada di kampus. Olehkarenaitu,mahasiswaPoliteknikLP3IMedan melaksanakan study tour ke tiga negara di Asean yaitu Singapura, Malaysia dan Thailand, serta melakukan study banding ke salah satu perguruan tinggi di Kuala Lumpur, Malaysia, Metropolitan University College, untuk menambah wawasan dan pengetahuan sekaligus liburan ke negara lain. \Rombongan mahasiswa yang mengikuti study tour tersebut sebanyak 32 orang terdiri dari 20 dari Politeknik LP3I Kampus Glugur By Pass, 2 orang dari Kampus Sisingamangaraja dan 10 orang dari Kampus Gajah Mada. Kegiatan tersebut akan berlangsung selama 6 hari (10-15 Maret 2011). “Kegiatan ini lebih banyak sebagai liburan dan menambah wawasan mahasiswa, supaya apa yang dipelajari selama ini di kampus seperti perdagangan internasional dan perkembangan teknologi di negara lain tidak hanya sekadar bayangan saja, tetapi di sini mahasiswa bisa melihat secara langsung, sehingga termotivasi untuk membangun Indonesia khususnya Medan seperti negara-negara luar,” kata Pembina Politeknik LP3I Medan Ir. H. Fadya Harry Satwiko saat berada di Bandara Polonia Medan, Kamis (10/3) sebelum bertolak menuju Penang, Malaysia. Kepala Kampus Politeknik LP3I Glugur By Pass

Surya Hendra Putra menyebutkan, study tour ini dilaksanakan selama 6 hari lima malam yang diawali ke Penang Malaysia-Hadyai ThailandKuala Lumpur Malaysia-Metropolitan University College-Johor-Singapura kemudian kembali lagi ke Kuala Lumpur-Thailand dan kemudian ke Penang baru balik ke Medan. Surya menyebutkan, kegiatan study tour dan study banding tersebut merupakan kegiatan tahunan yang dilaksanakan Politeknik LP3I Medan baik study tour di Indonesia maupun negara tetangga Malaysia. Namun untuk tahun ini study tour dilakukan di tiga negara yaitu Malaysia, Thailand dan Singapura. “Tujuanuntukmembukawawasanmahasiswa tentang bagaimana perguruan tinggi dan mahasiswa di negara lain itu seperti apa dan sistem pendidikannya serta kurikulumnya seperti apa,” jelas Surya yang didampingiWakil Kepala Kampus Gajah Mada Asri Sanusi. Sementara itu, Direktur Politeknik LP3I Medan yangdiwakiliWakilDirekturIIHandriAgusSukendro mengharapkan, kegiatan ini benar-benar dimanfaatkan oleh mahasiswa untuk menambah pengetahuan, pengalaman dan wawasan agar mahasiswa dapat mengetahui negara lain dan bagaimana memahami negara luar tersebut. Tommy Hardianto salah seorang mahasiswa, mengaku senang dapat mengikuti study tour dan study banding tersebut ke negara lain, karena hal ini akan dapat menambah wawasan dan pengetahuannya tentang negara yang akan dikunjungi tersebut, terutama yang berkaitan dengan mata kuliah yang diambilnya. **m41


Rombongan Mahasiswa Politeknik LP3I Medan foto bersama sebelum bertolak menuju Penang Malaysia untuk melakukan study tour ke tiga negara, saat berada di Bandara Polonia Medan, Kamis (10/3).



WASPADA Minggu 13 Maret 2011

Seni Budaya Ono Niha Tetap Lestari

Waspada/Bothaniman Jaya Telaumbanua

Salah satu atraksi tari tradisional yang ditampilkan pada Festival Seni Budaya Tradisonal Nias yang digelar di Lapangan Merdeka Gunungsitoli pada 79 Maret lalu.

Komunitas Sastra Di Sumut

Mobilisasi Karya Dan Massa Tanpa Ide Baru Oleh: Yulhasni PERTANYAAN paling mengganggu saya sejak tumbuhnya komunitas sastra di Sumatera Utara, khususnya Kota Medan, adalah untuk apa semua itu dibuat? Seberapa pentingkah komunitas bagi proses kreatif dan pertumbuhan kesusasteraan di daerah ini? Apakah komunitas mampu menciptakan satu genre baru dalam khazanah sastra Indonesia sebagai bagian ‘proklamasi kreatifitas baru’ dari sastrawan Sumatera Utara? Jangan-jangan, ini hanya bentuk kegagapan kita merespon kecenderungan lahirnya silaturahim sastrawan secara nasional. Bukankahpertumbuhankomunitas itu hanya berpusat di Taman Budaya Sumatera Utara (TBSU) yang lama kelamaan jadi semacam tempat pembenaran untuk klaim diri sebagai sastrawan? Saya tidak sedang membuat peta-peta kelompok kemudian menilainya dengan membagi berdasarkan kualitas pencapaian karya.Tulisan ini hanya mencoba melihat secara sederhana apakah komunitas diperlukan dalam pertumbuhan sastra di Sumatera Utara. Saya juga tidak mendefenisikan komunitas dalam terminologi kelompok atau grup sebagaimana munculnya Komunitas Sastra Indonesia (KSI) di Indonesia.Pengertiankomunitaslebih diarahkan kepada sekumpulan orang yang meminati dan berkecimpung dalam bidang sastra. Sejarah sastra di Indonesia telah mencatat berbagai fenomena kelompok dalam proses penciptaan karya sastra. Ajib Rosidi (1986) misalnya telah membagi periodesasi sastra Indonesia dalam berbagai angkatan kepengarangan serta genre sastra. Selanjutnya Korrie Layun Rampan menyempurnakan periode tersebut dalam buku Angkatan 2000 sebagai sebuah jawaban atas tidak hadirnya buku yang mencatatproseskreatifsastrawan 90-an ke atas. Hal ini setidaknya memberikangambarankepadakitabahwa telah ada peta kepengarangan di tanah air dalam kurun waktu yang berbeda dan tentu saja dalam konteks kualitas penciptaan yang berbeda pula. Dalam perjalanannnya kemudian, kurun waktu 90-an, muncul sebuah fenomena baru dalam khazanah sastra di Indonesiayaknikosakata‘’komunitas’’. Iwan Gunadi mencatat, kelompok-kelompok yang secara

sukarela didirikan oleh penggiat dan pengayom sastra atas inisiatif sendiri, yang ditujukan bukan terutama untuk mencari untung (nirlaba),melainkanuntuktujuantujuan lain yang sesuai dengan minat dan perhatian kelompok atau untuk kepentingan umum. Sekitar 15 hingga 25 tahun terakhir, di negeri ini memang tumbuhbegitubanyakkomunitas sastra.Termasuk berbagai komunitas sastra yang mencoba menghancurkan eksklusivitas sebutan “sastrawan” dan mengangkat karya-karya atau pelakupelaku sastra yang dianggap marginal.Kalaukitapakaiperumpamaan klise, fenomena tersebut bak cendawan di musim hujan. Pada bagian lain, Iwan Gunadi menulis, kalau wilayahnya diperluas sampai seluruh Indonesiadenganrentangwaktusama (1997), jumlahnya bisa ratusan atau bahkan lebih. Apalagi jika rentang waktunya diperpanjang melebihi tahun tersebut. Melani Budianta, dosen Fakultas Sastra Universitas Indonesia, misalnya, pada diskusi Mencermati Sastra Subkultur Kita yang diselenggarakan Yayasan Obor Indonesia di Jakarta, 31 Mei 2001, memperkirakan bahwa pada saat itu, jumlah komunitas sastra di Indonesia lebih dari 200 dan 75 di antaranya berada di Jakarta. Jumlah tersebut pun belum termasuk komunitas sastra yang dibentuk di kampus-kampus perguruan tinggi. Maraknya pertumbuhan komunitas sastra di tanah air akhirnyasampaijugakeSumatera Utara. Komunitas sastra tumbuh seperti jamur di musim hujan. Kelompokpenciptadanpenikmat sastra ini lebih banyak beraktifitas di TBSU. Menariknya, beberapa di antaranya anggota dan penggagas kelompok ini berasal dari Univeritas Negeri Medan (Unimed). Ini tercatat dalam postingan M Raudah Jambak dalam http://omongomongsastra-, 7 Desember 2010. Juga muncul gerakan kreatifitas yang digawangi Win RG (dosen FKIP UMSU) dalam komunitas Forum Lingkar Pena (FLP) Sumut dan komunitas Win’s Sharing Club. Fenomena ini tentu saja memperlihatkan adanya pergeseran kreatifitas pada masyarakat kampus, yakni ‘unjuk gigi’ nya Unimed dalam percaturan sastra di Sumatera Utara. Jika ingin dikatakan,era90-ansampai2000an merupakan masa kebangkitan pencipta sastra dari Unimed. Apresiasi positif tentu layak diberikan kepada mereka yang secarakonsistensampaisekarang terus melakukan aktifitas dengan kelompok masing-masing. Barangkali fenomena munculnya kelompok seperti ini memperlihatkan kecenderungan bahwa kreatifitas sastra harus dimulai dari proses ‘silaturahim’ antarsesama pencipta sastra.

dan gagasan baru proses penciptaan sastra di Indonesia. Gerakan Beno Siang Pamungkas, Sosiawan Leak, dan Kusprihyanto Namma dalam Revitalisasi Sastra Pedalaman dari Solo (Jateng) hanya pemberontakan atas hegemoni pusat (Jakarta). Gerakan ini memang sempat ‘mengganggu’ tidur panjang sastrawan Jakarta meski kemudianmenghilangbegitusaja. Hirukpikuksastrajugadiramaikan dengan ‘pertempuran tanpa ujung’ antara komunitas Utan Kayu dengan kelompok Saut Situmorang yang mengusung sastra boemipura dalam Jurnal Boemiputra di kurun waktu 2007. Saut Situmorang lewat makalah Politik Kanonisasi Sastra yang disampaikannya pada Kongres Cerpen Indonesia V di Banjarmasin, Kalimantan Selatan, 2628 Oktober 2007 terang-terangan menyerang komunitas Utan Kayu yang ia anggap sebagai mitos baru setelah era emas Majalah Horison dan Taman Ismail Marzuki mulai ditinggalkan. Beberapa fakta tersebut tentu sajaperludipikirkanolehpencipta

sastra di daerah ini terutama oleh mereka yang rajin berkelompok tersebut. Kebangkitan sastra di Sumatera Utara haruslah dimaknai dengan melihat bentuk dan gagasan yang baru, bukan sekadar munculnya sastrawan baru yang tidak membawa genre baru. Meski Syarifuddin Lubis melihat bahwa Era 2010 sebagai tahun kebangkitan sastrawan Sumatera Utara, namun itu tidak lebih sebagai bentuk apresiasi atas lahirnya sejumlah karya dari daerah ini yang kemudian menyemarakkan peta kesusasteraan di tanah air. Tulisan itu tidak melihat adanyagerakanbarudalamgenre sastra Indonesia. Hanya sebatas pemaparan singkat dan mendata ulang sejumlah pengarang dari Sumatera Utara yang merambah pusat (Jakarta). Berkomunitas atas nama apapun tentu sesuatu yang baik. Berkelompok untuk mencipta juga tak perlu disalahkan. Hanya saja, saya agak sedikit menaruh harapan besar agar komunitas sastradidaerahinimampumembuat ide dan gagasan yang baru untuk sebuah genre sastra yang baru pula.Tanpa ide dan gagasan baru itulah yang saya maksud sebagai kecenderungan yang kelirudalamgerakan‘berkelompok’ para pencipta sastra di daerah ini. Saya justru mengkuatirkan, munculnyafenomenaberkelompok tersebut akhirnya terjebak dalam bentuk mobilisasi massa dan mobilisasi karya. Artinya, ukuran keberhasilan akhirnya hanya diukur dalam sederetan orang yang berjubel dalam setiap aktifitas kelompok dan sejumlah karya yang dihasilkan dari sebuah proses penciptaan. Mobilisasi massa dan karya di sisi yang lain juga akan memantik persaingan tidak sehat dalam berkarya. Ukuran kualitas kemudian menjadi kabur. Tidak ada sebuah institusi yang independen untuk mengukur derajat kualitas pencapaian karya dari masing-masing komunitas. Aroma tidak sehat ini tentu saja dapat memundurkanawalkebangkitan sastra di daerah ini. Kehadiran komunitassejatinyaadalahuntuk mencari gagasan baru bukan persainganbaru.Apakahkitatidak menyadari bahwa diam-diam telah terjadi disharmoni di antara sastrawanyangberkelompokdan berkomunitas di Sumatera Utara yang ‘berkantor’ di TBSU? Penulis adalah Dosen Bahasa danSastraIndonesiaFKIPUMSU

memiliki jaringan kuat sesama etnis Tionghoa yang menguasai perekonomian. Ketua PSMTI Kota Medan Halim Loe yang memaparkan sejarah dan keberadaan 23 cabang PSMTI di Indonesia termasuk di Medan meyebutkan, etnis Tionghoa juga memiliki andil dalam membangun Indonesia sejak dahulu. Tokoh muda etnis Tionghoa Medan ini mengakui, walau perannya tidak terlalu besar,namunmemilikikontribusi yang tak bisa dilepaskan dari sejarah berdirinya Negara Kesatuan Republik Indonesia. “Etnis Tinghoa sama dengan etnis lainnya di Indonesia, ingin berperan dalam segala bidang pembangunan. Kita lahir, besar dan meninggal di Indonesia. Jadi sudah suatu kewajiban membangun Indonesia,” katanya yang menyatakan siap bermitra dan berperan aktif membangun Medan menuju Kota Metropolitan. Direktur MCM, Destanul

Aulia SKM, MBA MEC didampingi Ketua Penyelenggara Hendy Ong menyatakan, MCM hadir dengan upaya mensinergikan potensi yang ada termasuk etnis -etnis yang ada di Medan. MCM, katanya, didirikan oleh kelompok muda Medan dari berbagai etnis dan dalam kegiatannya selalu berasosiasi dengan IndoNEXT FoundationdiWashingtonDCUSA. MCM juga merupakan kelompok independen dan terlepas dari intrik politik dengan misi keterbukaan, transparansi, jaringan kerja dan persahabatan dalam mewujudkanvisinya“MedanKota Dunia Segala Ada Apa Pun Bisa”. Kedepan,lanjutDestanulAulia, pihaknya akan bersinergi dengan berbagaipihakdenganmenggelar kegiatan pencarian ikon yang bisa menjadikebanggaanKotaMedan menuju kota metropolitan dan menggelarpemilihanMedanCity Angel dari setiap etnis yang ada di kota ini. *Sugiarto

poksepertiinitidakharusmemiliki struktur organisasi yang jelas. Sayamemandangbahwajika ada lebih dari satu orang melakukan aktivitas rutin bersama dengan minat yang sama yaitu “sastra” maka dapat dikatakan itulahkomunitassastra.Walaupun Afrizal Malna pernah juga mendirikan komunitas yang anggotanya dia sendiri, yaitu “Komunitas Sepatu Biru.” Mungkin ada baiknya kita melihat fenomena gerakan sastra di Indonesia sebagai sebuah catatan penting untuk melihat sejauh mana peran ‘komunitas’ dalam melahirkan ide dan gagasan baru. Setelah Sutardji Coulzoum Bachri muncul dengan fenomena baru penciptaan sastra di Indonesia, praktis hiruk pikuk sastra kemudian hilang. Mungkin gerakan Remy Silado dkk dalam ‘puisi mbeling’ dan sastraabsurd(gelap)AfrizalMalna adalah catatan akhir dalam ide

Kebangkitan sastra di Sumut haruslah dimaknai dengan melihat bentuk dan gagasan yang baru, bukan sekadar munculnya sastrawan baru tanpa membawa genre baru

Meski demikian, tidak serta merta kecenderungan ini disikapi dengan luar biasa karena mereka yang ‘tidak percaya’ kepada kelompok akhirnya memilih jalur independendanberkaryasendiri. Di sisi lain, tentu saja harus kita usik kesadaran kelompok ini untuktidakhanyasekadarberkarya akan tetapi mampukah komunitas tersebut menghasilkan sesuatu yang ‘baru’ sebagai wujud kreatifitas? Secara lebih ekstrem lagi, apakah lahirnya komunitas seperti ini tidak lebih dari wujud keinginan berkreasi akibat tidak adanyaprosespolitikdarikampus tempat mereka menempa ilmu? Bukankah kelompok kesusasteraansebenarnyadilahirkanuntuk sebuahproseskelahiranyangbaru dari genre sastra itu sendiri? Nanang Suryadi menulis jika kita tengok dari perjalanan sastra Indonesia baik yang tercatat maupun yang tidak sebenarnya komunitas-komunitas sastra ini sudah berkembang sejak dahulu, walupun mungkin tidak secara resmi menggunakan kata-kata “komunitas.” Dikatakannya, sebuah komunitas sastra, kelom-

Medan Kota Peradaban Dunia Dihuni Etnis Tionghoa 600 Tahun Lalu KOTA Medan, Sumatera Utara,merupakankotayangunik, segalanya ada, apa pun bisa. Bahkan Medan dijuluki Kota Dunia karena semua etnis suku, agama ada di Medan. Sayang, Kota Medan ternyata tidak memilikimuseumwarisansejarah sebagaimana kota-kota besar di dunia. Padahal, Medan merupakan kota sejarah dunia, di mana peradaban dunia ada di kota ini sejak ratusan tahun lalu. Hal itu terungkap dalam dialog terbatas “Medan Chinese Uniqueness From Phuket to Medan City with Friendly Smile” yang digelar di Uspell Mesra Library Prof Dr Usman Pelly, Komplek Griya Unimed Jalan Pelajar Timur Medan, Selasa (8/3) lalu. Dialog yang digelar Medan City Merdeka (MCM) dengan menampilkan pembicara Ketua PSMTI Kota Medan, Halim Loe, SE dan Chontida Auikool (Pang) dari Thailand, telah mengungkapkan bahwa Kota Medan

pernah dihuni masyarakat etnis Tionghoa (China) sekitar 600 tahun lalu. Dalam dialog terbatas tersebut, turut dihadiri belasan pakar dari berbagai disiplin ilmu, di antaranya Dr Ichwan Azhari, Prof Dr Usman Pelly, Dr Budi Agustono, Ketua DPRD Medan Drs H Amiruddin dan Walikota Medan diwakili Asisten III, Drs H Mursadad. Dr Ichwan Azhari mengatakan, dalam peradaban itu ditemukan “Kota China” di Marelan dengan peninggalan barangbarang sejarah yang saat ini menjadi kajian dan penelitian. Tapi Pemko Medan dan DPRD Medan belum serius bahkan kurang peduli melestarikan warisan sejarah peradaban masyarakat Medan dan dunia itu. Selain itu, Medan juga tak memiliki ikon seperti kota-kota besar di dunia. Ketiadaan ikon itu karena Pemko tak memiliki arah yang jelas dalam membawa

warna/ciri khas Kota Medan. Bahkan, Prof Usman Pelly menyebutkan, keunikan lainnya adalah orang Tionghoa di Medan tidakmudahmasukdalamstruktur sosialbudayamasyarakatyangada di Medan. Hal itu disebabkan di Medantidakadaetnisyangdominan. Etnis dominan itu dilihat dari mayoritas jumlah penduduk, ekonomi dan budayanya kuat. “Sedangkan di Phuket Thailandlingkungansosialbudayanya homogen sehingga etnis Tionghoa di sana menjadi satu budaya masyarakat setempat, tidak seperti di Medan,” ujar Usman Pelly seraya mengatakan orang Tionghoa di mana pun sama, tak ada bedanya, yang membedakan masyarakat setempat. Chontida Auikool (Pang) dari Thailand yang merupakan Uspell Mesra LibraryVolunteer menyatakan, etnis Tionghoa di Phuket banyak seperti di Medan dan kini disapa dengan sebutan Baba. Di Medan,diamelihatetnisTionghoa

KIAN derasnya arus globalisasi yang didorong oleh kemajuan teknologi komunikasi dan informasi, sering menimbulkan pengaruh negatif terhadap seni budaya tradisonal suatu daerah seperti semakin memudarnya penghargaan pada nilai-nilai budaya itu sendiri. Namun tidak demikian dengan seni budaya tradisional Nias, hingga saat ini bisa dikatakan hampir seluruh masyarakat di Kepulauan Nias masih menghargai, memelihara dan melestarikan seni budaya tradisional yang menjadi ciri khas dan kebanggan Ono Niha yang berada di pulau paling barat Sumatera tersebut. Di daerah kepulauan ini, melestarikan dan memelihara keberadaan seni budaya tradisonal di tengah-tengah masyarakat Ono Niha bukan hanya menjadi tanggungjawab dari tokoh-tokoh adat, pemerhati seni budaya, tetapi justru pemerintah daerah mengambil inisiatif untuk tampilpaling depan dalam memprogramkan danmenganggarkandalamAnggaranPendapatan dan Belanja Daerah setiap tahunnya guna melestarikan,memeilihara,danmengembangkan seni budaya tradisional serta objek-objek wisata lainnya yang menjadi peninggalan nenek moyangmasyarakat Ono Niha. Dahulu, sebelum pemekaran daerah otonom baru di Kepulauan Nias, salah satu upaya Pemerintah Daerah Kabupaten Nias saat itu dalam melestarikan dan memelihara seni budaya tradisional Ono Niha dengan menggelar suatu pesta rakyat yang cukup dikenal dengan Pesta Ya’ahowu. Masing-masingkecamatanpadaPestaYa’ahowu tersebut menampilkan atraksi musik dan tari tradisonal dengan menggunakan alat music tradisional yang selalu digunakan nenek moyang Ono Niha. Selain itu, masing-masing kecamatan juga menampilkan atraksi seni budaya tradisional berupa pelaksanaan adat istiadat serta yang selalu dilaksanakan dalam suatu pesta adat maupun perkawinan. Beberapa tahun terakhir ini, Nias secara beruntun ditimpa musibah bencana tsunami dan gempa mengakibatkan pemerintah daerah memfokuskan kegiatan dalam melakukan rehabilitasi dan rekonstruksi wilayah Kepulauan Nias. Namun demikian, pemerintah setempat padatahun2006kembalimenghidupkankegiatan seni budaya tradisional Ono Niha. Bersama Lembaga Budaya Nias bekerjasama dengan BRR melaksanakan suatu kegiatan yang diberi nama Musyawarah Adat Fondrako yang dilanjutkan

pada tahun 2007 mengadakan Pagelaran Pesta Ya’ahowu yang diikuti 34 kecamatan. Pada tahun ini, Pemerintah Kabupaten Nias melalui Dinas Kebudayaan, Pariwisata, Pemuda dan Olahraga kembali menggelar kegiatan yang diberi nama Festival Seni BudayaTradisional Nias yang digelar dari 7 sampai 9 Maret 2011 bertempat di Lapangan Merdeka Gunungsitoli. Festival Seni Budaya Tradisional Nias ini bertujuan untuk melestarikan kebudayaan dan seni tradisional Nias pasca pemekaran wilayah dengan tema Niasku Mekar, Budayku Lestari dan Berkembang. Festival tahun ini diikuti 9 kecamatan se Kabupaten Nias memperlombakan masingmasing Tari Tradisonal, Musik Tradisonal dan Vokal Solo Lagu Daerah Nias. Tari Tradisonal andalan masing-masing kecamatan berupa Tari Tuwu, Maena Baluse, Folaya Famadogo Omo, Tari Moyo, Folaya ba Zimate, Maena Fona, Boli Hae ba Gowasa, Hiwo dan Famanari Ni’owalu. Jenis Lomba Musik Tradisional Nias berupa Aramba, Gondra, Faritia, Fondrahi, Koko, Sigu, Doli-Doli,Tutuhao,Tarumbu dan Surune dengan membawakanlagudaerahNias.Sedangkanuntuk jenislombaVokalSolo,pesertadarimasing-masing kecamatan membawakan lagu daerah Nias seperti lagu Asondru, Ina Solomasi, Hulo Omasi’o, TanoWa’asokhi, Bowo Sebua, Sibolowua, Ngenu Dodo Zogai Gito, towi-Towi, U’o’o’o Sa’ato dan lagu Boi Aoso. Kadis Kebudayaan, Pariwisata, Pemuda dan Olahraga Kabupaten Nias,Drs Baziduhu Zebua padapelaksanaankegiatantersebutmenyebutkan pelaksanaan Festival Seni Budaya Tradisional Nias merupakan realisasi dari kebijakan Pemerintah Kabupaten Nias untuk menggali, melestarikan seni budaya tradisional di daerah itu yang telah dijadikan Peraturan Daerah Kabupaten Nias pada tahun 2008. PantauanpenulisselamapegelaranFestivalSeni BudayaTradisional Nias tersebut, ratusan hingga ribuan masyarakat Nias berbondong-bondong menyaksikanpelaksanaanfestivalituyangberlangsung pagihinggamalamhari.Yanglebihmembanggakan lagi, para peserta festival dari masing-masing kecamatan lebih banyak kalangan remaja. Penulis dapat menyimpulkan bahwa seni budayatradisionalOnoNihaternyatamasihbegitu lestari dan melekat di hati masyarakatnya walaupun di era globalisasi ini budaya dari luar terus berkembang seiring perkembangan zaman. * Bothaniman Jaya Telaumbanua

Omong-omong Sastra Di Binjai

Dari Komunitas Hingga Gelar Sastrawan Oleh: Yosi Abdian Tindaon KEDIAMAN yang asri milik salah satu sastrawan Sumut, Saripuddin Lubis di Binjai, ternyata tak menjamin sebuah diskusi akan berlangsung dingin dan sejuk. Diskusi mengenai komunitas sastra mungkin tak akan ada habisnya. Pembicara, bahkanmasing-masingpesertamemilikipendapat yang berbeda soal topik pembicaraan. Setidaknya hal itu akan terlihat pada “Omongomong Sastra” yang diadakan pada Minggu, 6 Maret 2011 lalu. “Omong-omong Sastra” merupakan salah satu kegiatan yang dilaksanakan para sastrawan Medan (Sumatera Utara).Wadah diskusiantarparasastrawaninisudahberlangsung sejak 35 tahun yang lampau. Acara diskusi ini berlangsung secara periodik (tergantung waktu dan kesempatan) dari rumah ke rumah. Sejumlah sastrawan tampak hadir pada diskusi kali ini seperti; Damiri Mahmud, D. Rivai Harahap, Sulaiman Sambas, M. Raudah Jambak, Hasan Al Banna, Nasib TS, Norman Tamin, Idris Siregar, M. Yunus Rangkuti, Herni Fauziah serta beberapa penulis muda lainnya. Diskusi berlangsung sekitar 4 jam dan dimeriahkan juga dengan pertunjukan musikalisasi puisi yang dibawakan dengan sangat apik oleh siswa SMAN 2 Binjai. Afrion ditunjuk forum sebagai pemandu dua pembicara:Yulhasni(pengamatsastra)danWahyu Wiji Astusti (penulis dan penggiat komunitas). Yulhasni menyodorkan tema komunitas sastra di Sumut. Selanjutnya, Wahyu Wiji Ayu banyak menyinggung topik sastra kontemporer. Kedua pembicara menyampaikan pemikirannya dengan apik meskipun lebih banyak membaca makalahnya hingga lembar terakhir. Diskusi yang berkembang selanjutnya lebih dititikberatkan pada masalah komunitas sastra. Ya,Yulhasni lewat makalahnya mengurai satu kenyataan yang kemudian dianggap sebagai masalah. Komunitas sastra belakangan memang tengah berkembang dengan pesat di Sumut, terutama di beberapa kampus yang memiliki beberapa komunitas sekaligus. Beliau merasakan fakta bahwa komunitas sastra yang tersebar di Medan belakangan ini hanyalah sebagai wujud perayaan penciptaan karya dan berkumpulnya penulis sastra tanpa melakukan perubahan besar demi kemajuan ranah sastra Medan. Bagi Yulhasni, suatu kelompok kesusatraan sebenarnyadilahirkanuntuksebuahkelahiranbaru bagi genre sastra itu sendiri. Beliau bernasihat kritis betapasebaiknyakomunitassastraharusmemiliki ideologidanmenciptasesuaiideologiyangdiusung. Dan perlunya komunitas-komunitas melakukan penolakan hegemoni yang tidak sesuai. Sebagaisalahsatupesertadiskusi,DaniSukma A.S berpendapat lain. Dia menuduh pembicara melupakan hal yang paling mendasar tentang alasanseseorangmemilihmasukkedalamsebuah komunitas sastra. Tentu ingin mengetahui bagaimana cara menulis sastra yang baik dan bagaimana agar dapat mengembangkan kemampuan menulisnya. Pembentukansebuahkomunitaspenuliskampus adalahjugasebuahupayapembuktianbahwaseorang sarjana mampu menulis serta bersastra dan tidak hanya bergelut dengan bidang akademisi semata. Bayangkan, bagaimana ketika kemudian penulis pemula disodori dengan ideologi? Damiri Mahmud lain pula. Dia menyatakan bahwa inovasi pada ranah sastra tidak harus melalui gebrakan dan penemuan genre baru. Melainkan yang lebih penting adalah bagaimana seorang sastrawan dapat terus menulis dan memberikanpencerahanbagisemuaorangtanpa harus terpatok pada genre penciptaan dan akhirnya melakukan kemunafikan. Sementara itu, Wahyu dalam makalahnya menjelaskan ihwal puisi kontemporer yang belakangan marak dibicarakan dan ditulis oleh beberapa penyair muda. Secara pribadi Wahyu menjunjung tinggi kebebasan dalam menulis dan berekspresi. Meskipun begitu, banyak penulis muda lainnya masih merasa bahwa puisi konvensional lebih indah karena mudah dimengerti dan sederhana hingga pesan yang terkandung akan dapat ditangkap oleh pembaca. Dalam Komunitas Penulis Anak Kampus (KOMPAK) yang diketuainya,Wahyu menggiring anggotanya untuk terlebih dahulu menekuni proses penciptaan puisi konvensional.

Hakikatnya, kedua topik yang dibahas pada “Omong-omong Sastra” berkaitan erat. Pembahasan ‘kemeriahan’ komunitas sastra di Medan diharapkan melahirkan sebuah gebrakan baru atau bahkan genre baru dalam ranah kesusastraaan yang akhir-akhir ini dianggap monoton. Ulasan Wahyu tentang sastra kontemporer juga terkait langsung dalam kesemarakan kesastraan itu sendiri. Sastra kontemporer (dalam konteks kebaruan ideologi) itulah yang mungkin ditagih Yulhasni dari pena para penulis yang berkhidmat di komunitas-komunitas sastra di Medan yang berpusat diTaman Budaya Sumatera Utara (TBSU). Kebebasan pada hakikatnya adalah milik semua orang. Juga milik setiap penulis, baik dari segi penyampain maupun dari segi isi. Besar harapan, kiranya para sastrawan tidak terlena akan kebebasan yang dimilikinya. Sehingga tidak semata-mata memamerkan keahlian dan kekreatifan yang luar biasa sehingga tak jarang sebuah puisi sama sekali tidak dapat diinterpretasi dengan mudah oleh para pembaca. Hal ini dapat dengan mudah terlihat. Bahkan para mahasiswa Jurusan Sastra akan mengalami kesulitan untuk memaknainya. Lantas bagaimana dengan para pembaca awam lainnya? Dan benarkah sudah tersedia banyak sastrawan yang mampu menjelaskan dengan benar akan makna yang sebenarnya dari puisi-puisi yang menyimpang tersebut? Pada akhirnya tidak dapat dielakkan bahwa puisi-puisi kontemporer dengan permainan bahasa serta tipografi sedemikian rupa, terkadang justru menimbulkan kebingungan dan tentu saja akan ditinggalkan masyarakat.Yang lebih diperlukan bangsa kita pada saat ini adalah karya sastra yang sederhana, komunikatif, mudah dicerna dan tentu saja mengandung pesan-pesan pencerahan.Dengandemikianjugadapatmenumbuh kembangkan minat mengapresiasi sastra oleh masyarakat luas. Di mana ada kemauan, di situ ada jalan.Tentu saja kehadiran komunitas-komunitas penulis di Medan layaknya disambut baik, sebab dari komunitas-komunitas itulah diharapkan melahirkan para sastrawan yang berkarakter. Ideologi yang diharapkan tumbuh di setiap komunitas bisa saja makin kokoh seiring berjalannya waktu dan proses kreativitas anggota komunitas. Pun demikian, tidaklah sebuah komunitas diharuskan memiliki sebuah ideologi dalam menulis atau berkarya,karenajustruakanmembatasiperjalanan hasil sastra. Namun, tidak seharusnya komunitas menjadi tempat bergantung para penulis sehingga akan membunuh kemandirian penulis itu sendiri. Kelak penulis yang sangat bergantung pada komunitasnyaakanrikuhketikaharusterjunsendiri tanpa bantuan komunitas. Belenggu komunitas juga kian rapat karena pada akhirnya tak jarang penulis kurang bersosialisasi dan merasa eksklusif dengan komunitasnya. Seolah tak membutuhkan dunia lain di luar komunitas. Komunitas agaknya bukan sarana pembaptisanbagicalonsastrawan.Sepertihalnyapenyataan ekstremYulhasni yang mengatakan bahwaTBSU juga menjelma sebagai arena baptis seseorang menjadi sastrawan. Begitupun, kedua pemikiran demikian di atas tetap bisa didebat. Terkhusus pernyataan Yulhasni yang dituding beberapa peserta diskusi berlebihan. Betapa tidak? Banyak orang yang berkunjung ke TBSU untuk masuk ke proses pembelajaran aneka seni, terutama sastra. Namun, dangkal juga jika kemudian pernyataan Yulhasni ditelan begitu saja. Manalah ada asaptanpaapi?Yulhasnitakmungkinberpendapat sedemikian rupa tanpa bukti-bukti dan kenyataan yang ditemui di lapangan sebab beliau juga termasuk orang yang sering “singgah” di TBSU. Apakah memang terdapat banyak orang yang mengakui diri sebagai sastrawan setelah sering berkunjung dan berdiskusi ke TBSU? Boleh jadi! Segelintir orang yang terganggu pernyataan kontroversial tersebut setidaknya haruslah bertanya pada diri sendiri. Selanjutnya mencoba memberikan penyanggahan dengan menelurkan karya-karya nyata dan tidak hanya berlalu lalang di TBSU semata. *Penulis adalah mahasiswa Jurusan Bahasa dan Sastra Indonesia di FBS Unimed


WASPADA Minggu 13 Maret 2011


Jembatan Pulau Pinang yang menawan.

Wisata Di Pulau Penang PULAU Pinang atau Penang di Malaysia, tentu tidak asing lagi bagi warga Sumatera Utara. Kawasan ini sepertinya menjadi tempat pelancongan terdekat bagi warga Sumut yang ingin menikmati liburan ke negara tetangga. Memang, pulau ini menjanjikan kesenangan bagi orang yang bertandang ke sana. Pusat perbelanjaan, pusat jajanan/makanan, pusat industri sampai kawasan wisata lokal yang harus menggunakan Ringgit ataupun gratisan ada di pulau ini. Sebenarnya, Pulau Pinang adalah negara bagian Malaysia yang terkecil kedua, setelah Perlis. Namun dari segi kepadatan penduduk, menduduki urutan pertama. Negeri ini juga memiliki persentase penduduk muslim dan Melayu yang terendah di Malaysia. Jika bertandang ke sana, banyak hal yang bisa dilihat, utamanya bangunan kunonya. Kota utama di

Pulau Pinang adalah George Town, Balik Pulau, Butterworth, Prai, Air Itam, Gelugor, Batu Feringghi, Bayan Lepas, Seberang Jaya, Bukit Mertajam, Kepala Batas, Jawi, Bertam, Pantai Acheh, Teluk Kumbar, Bayan Baru, Jelutong dan Nibong Tebal. Tempat ini selalu menjadi pembicaraan para pengmudi taxi, jika Anda menggunakan jasa mereka. Umumnya, sopir taxi atau agen perjalanan di sana, sangat paham dengan seluk beluk kota itu. Apalagi kawasan wisata dan nama-nama gegung yang berdiri megah sampai yang akan ambruk, mereka bisa menceritakannya. Dengan cara itu, semua pendatang yang menggunakan jasa taxi atau travel agen bisa memilih tempat yang ingin dikunjungi dan bisa memastikan apakah uang yang dibawa memadai untuk perjalanan. Bulan Februari lalu, penulis bertandang ke negeri seberang. Dari stasiun bus asal Kuala Lumpur, langsung mengendarai taxi menuju Butterworth. Sepanjang perjalanan

Berpose dekat pohon meriam yang penuh dengan bunga di batang pohon serta terasa wangi menjadi pilihan pengunjung.

menuju kawasan itu, supir taxi menceritakan bagaimana kehebatan jembatan terpanjang Pulau Pinang. Dari jenis bangunan sampai kontruksi bangunan jembatan dia hafal betul. Bahkan kenderaan pertama yang melintas di jembatan itu disebutnya kenderaan buatan Malaysia, yakni Proton. Jembatan Penang (Jambatan Pulau Pinang dalam bahasa Melayu) adalah sebuah jembatan tol dua jalur yang menghubungkan Bayan Lepas di pulau Penang dan Seberang Prai di daratan Malaysia. Jembatan ini juga berhubungan dengan Jalan Lintas Utara-Selatan di Prai dan Jalan Tol Jelutong di Bayan Lepas. Jembatan ini diresmikan 14 September 1985. Panjang keseluruhan jembatan ini sekitar 13,5 km, sehingga tercatat salah satu jembatan terpanjang di Asia Tenggara dan merupakan sebuah landmark nasional. Sebelum 1985, transportasi antara pulau Penang dan daratan hanya dilayani oleh feri antara Butterworth dan George Town. Dari jembatan, nampak berbagai pemandangan yang fantastis. Utamanya pada malam hari, gedunggedung yang tak jauh dari kawasan laut, dihiasi dengan aneka lampu, sehingga memberikan daya tarik sendiri. Ada juga kapal pesiar pribadi yang terapung-apung dinikmati dua atau tiga orang saja di atasnya sambil menikmati suasana malam. Penang Botanical Garden Bagi yang ingin melepas lelah setelah berjalan-jalan di kesibukan dan keramaian kota di Pulau Pinang, mampirlah sejenak ke Penang Botanical Garden. Tempat yang penuh dengan bunga dan satwa liar di antaranya kera dan aneka jenis burung yang bebas berkeliaran, ada juga sebuah pohon meriam asal Amerika Selatan yang sangat unik, karena bunganya berada di batang pohon dan sangat wangi. Sepanjang perjalanan dengan menggunakan bus angkutan khusus, pengunjung bisa melihat asyiknya para juru foto mengabadikan kera dengan berbagai gaya maupun para model dan calon pengantin yang sedang pemotretan ala pra wedding. Konon, taman ini diprakarsai oleh para pejabat Inggris masa lalu yang sangat cinta pada kebun bunga, sehingga lokasi yang berada di kaki bukit ini mereka jadikan sebuah taman. Sehingga, orang Inggeris bernama Charles Curtis, menjadi orang yang merancang berdirinya kawasan taman ini sejak tahun 1884. Awalnya taman tersebut ditujukan untuk pembibitan tanaman Hortikultura yang dikirim ahlinya

dari Kew Gardens di Inggris dengan harapan penanaman tanaman di Penang untuk masa depan. Tapi akhirnya, berbagai tanaman dan pohon ditanam di tempat ini dan langsung memberikan informasi bagi setiap pendatang. Banyak yang suka berjalan kaki untuk bisa menelusuri taman hutan buatan ini dengan berbagai lintas dan rintangan alam di dalamnya. Jalan terjal dan bertangga-tangga serta sedikit lembab, menjadi pilihan bagi mereka yang hobi menjelajah hutan. Tapi bagi yang enggan berjalan kaki, kenderaan semacam bus pengangkut massal atau lebih mirip odong-odong bisa membawa Anda berkeliling. Sambil menikmati perjalanan itu, ada segerombol monyet yang berloncatan kesana kemari sambil bergaya. Biasanya hewan-hewan ini menunggu diberi makanan oleh pengunjung.Tapi jangan terlalu dekat dengan kerakera ini, karena ada yang sedikit galak dan mau mengejar pendatang yang membuat kita kaget.

Taman Wisata Botanical Garden.

Rumah Batik Dan Kopi Perjalanan lain yang bisa dinikmati di inti kota adalah mengunjungi rumah batik dan rumah kopi serta teh. Di rumah batik, pembuatan bahan dasar batik dengan mengandalkan cetakan diterakan di halaman depan toko tersebut. Dengan begitu, setiap orang yang ingin melihat proses pembuatannya bisa langsung melihat. Para turis dari berbagai negara nampak penuh semangat melihat proses pembuatan batikbatik ini. Di galery yang disiapkan khusus untuk pengunjung, aneka kreasi batik bercorak pilihan dengan harga bervariasi cukup banyak. Jika hanya berniat untuk membawa pulang sovenir batik, pengunjung juga bisa mendapatkan harga yang murah antara 5 s/d 15 Ringgit. Bagi yang suka minum kopi atau teh, tak jauh dari kawasan ini ada juga toko penjualan kopi. Kopi ini sangat banyak digemari pelancong, apalagi sebelumnya disediakan minuman kopi dengan berbagai rasa.

Tentunya, mereka yang gemar kopi bisa membedakan cita rasa kopi pilihannya. Pengolahan biji kopi secara alami memberikan cita rasa yang enak. Begitu kata para pelayan toko

di sana, sembari mengatakan bahwa kopi ini menjadi salah satu pilihan oleh-oleh pendatang ke Pulau Pinang. Naskah dan foto : Anum Saskia

Wisatawan memotret seekor monyet di kawasan Botanical Garden.



WASPADA Minggu 13 Maret 2011

Belasungkawa Untuk Jepang GEMPA bumi berkekuatan 8,9 Skala Richter (SR) disusul gelombang pasang tsunami di kawasan Utara Jepang, Jumat (11/3), spontan menyita perhatian dunia. Publik dunia langsung menyatakan belasungkawa dan ikut merasakan kepedihan yang dialami korban bencana alam di Negeri Sakura tersebut. Sejumlah bintang Hollywood menyampaikan keprihatinan dan doa bagi warga Jepang yang menjadi korban tsunami paling mengerikan di kawasan pantai timur Pulau Honshu, Jepang. Tsunami itu dipicu oleh gempa bumi berkekuatan 8,9 SR di kedalaman 10 kilometer. Pernyataan simpati itu mereka sampaikan lewat microblogging Twitter dan situs jejaring sosial lainnya. Sosialita Paris Hilton, Kim Kardashian, aktor komedian Ben Stiller, peraih Grammy Awards Taylor Swift, hingga Katy Perry menyampaikan keprihatinan atas bencana yang terjadi. Bahkan, Katy Perry memanjatkan doa kepada pengikutnya (followers) agar tabah dan sabar menghadapi bencana yang datang. Penyataan keprihatinan yang sama juga disampaikan sejumlah artis di Indonesia yakni Agnes Monica, Wulan Guritno, Vidi Aldiano dan Sophia Latjuba. “Semua orang, karyawan dari rekaman, pekerja jasa pariwisata, anggota band dan penari, jangan bekerja hari ini,” tulis penyanyi terkenal Jepang, Ayumi Hamasaki dalam bahasa kanji di akun twitter-nya, Jumat 11 Maret 2011. Ayumi mengucapkan terima kasih kepada masyarakat dunia yang sudah menunjukkan perhatiannya atas gempa dan tsunami yang melanda warga Jepang. Kantor berita Associated Press melaporkan, gempa mulai terasa pada pukul 14:46 waktu setempat. Sekitar 30 menit kemudian, terjadi gempa susulan berkekuatan 7,4 SR dan gelombang pasang tsunami. Tsunami yang melanda Jepang juga pernah terjadi pada 3 Maret 1933 yang dipicu gempa berkekuatan mencapai 8,3 SR, yang berpusat di Sanriku, Pulau Honshu. Lebih dari 3.000 jiwa menjadi korban dalam bencana tersebut.(k/vvn/m25)



Agnes Monica

Wulan Guritno


Kristen Stewart Dievakuasi


Gelombang pasang tsunami yang menghantam daerah pesisir Jepang. Diperkirakan ribuan orang tewas akibat bencana alam tersebut.


SEJUMLAH artis dan kru film Twilight terpaksa dievakuasi, setelah sirene tanda peringatan tsunami berbunyi di lokasi syuting mereka di Vancouver, Kanada. Gempa bumi 8,9 Skala Ritcher dan gelombang tsunami setinggi 23 kaki yang menghantam Jepang, ternyata mengirim peringatan tanda bahaya hingga ke seberang Samudera Pasifik, tempat berlangsungnya proyek pembuatan film ‘The Twilight Saga: Breaking Dawn.’ Seluruh bintang dan kru film tersebut, termasuk pemeran utama Kristen Stewart (foto) dan Taylor Lautner yang sedang menjalani proses pengambilan gambar, akhirnya dievakuasi keluar dari lokasi syuting. Sebagaimana dilansir showbizpy, Sabtu (12/3), seluruhnya dalam kondisi sehat, meski beberapa di antaranya masih cemas karena sirene peringatan tsunami yang tiba-tiba berbunyi. Gempa bumi dan sejumlah gempa susulan di Jepang telah mengirim peringatan bahaya tsunami ke lebih dari 50 negara di kawasan Pasifik.(vvn/m25)

Justin Bieber Dilarang Keluar Hotel


Pengawal pribadi Justin Bieber berusaha melindungi penyanyi fenomenal itu dari serbuan penggemarnya.

PENYANYI fenomenal Justin Bieber memang sedang menjadi idola remaja di seluruh dunia. Di Inggris, antusias Anak Baru Gede (ABG) terhadap bintang asal Kanada itu tidak terbendung lagi. Ribuan pelajar di dampingi orangtua mereka berkumpul di halaman Hard Days Night Hotel, Liverpool, Inggris, Kamis (10/3) waktu setempat. Mereka berharap bisa bertemu dengan sang idola. Para remaja yang ngotot bertemu Bieber itu, sempat terlibat saling dorong dan histeris begitu mengetahui idola mereka sedang berada di hotel tersebut. Khawatir terjadi sesuatu, pihak manajemen memutuskan untuk tidak membawa Bieber menemui para penggemarnya di luar hotel atau menunjukkan dirinya meski dari balkon. Kabarnya, polisi sempat mengancam akan memberikan sanksi kepada Bieber dan manajemennya jika kedapatan mendekati area balkon hotel. Hal ini dilakukan untuk menghindari hal-hal yang tak diinginkan. Di dalam hotel, Bieber menyambut penggemarnya dengan mengirimkan pesan lewat akun Twitter. ”Sepertinya ada ribuan orang di luar sana. Aku cinta kalian tapi aku ingin tidur. Tolong jangan berteriak ya,” ujar Bieber.

Narkoba Hantui Kehidupan Selebritis PENANGKAPAN mantan penyanyi cilik Iyut Bing Slamet atas kepemilikan narkoba jenis sabu menambah panjang daftar selebriti yang terjerumus ke dalam lembah kelam narkoba. Iyut resmi ditetapkan sebagai tersangka setelah dinyatakan positif menggunakan narkoba dan pemilik 0,4 gram sabu. Iyut resmi ditetapkan sebagai tersangka setelah mengetahui hasil tes urin. Iyut ditangkap Satuan Narkoba Mabes Polri di Mangga Besar, Jakarta Barat, Selasa (8/3). “Sudah positif dan resmi ditahan,” ujar AKBP Unggul selaku Kepala Unit IV yang mendampingi Iyut saat pindah ke ruang tahanan sementara di gedung BNN, Sat Narkoba Bareskrim Polri, Cawang, Jakarta Timur, Kamis (10/3). Iyut Bing Slamet sudah dua bulan menjadi incaran petugas Sat Narkoba, Mabes Polri, sebagai pengguna narkoba. Penangkapan Iyut Bing Slamet tidak lama berselang setelah penangkapan Yoyok. Drummer grup musik Padi itu ditangkap Tim Satuan Narkoba Mabes Polri di apartemen miliknya, di Apartemen Sudirman Park, Tower B, Tanahabang, Minggu (27/ 2) sekitar pukul 02:00. Dari penangkapan itu diperoleh barang bukti berupa 0,2 gram sabu dan sebuah alat hisap, bong. Fenomena pemakaian narkoba jenis sabu di kalangan artis memang bukanlah fenomena baru di kalangan artis dan selebritis. Sebut saja musisi seperti Sammy Kerispatih, Rivaldo, Imam S Arifin hingga artis senior Roy Marten pun terganjal kasus kepemilikan narkoba jenis sabu tersebut. Sammy ‘Kerispatih’ alias Hendra Samuel Simorangkir digerebek di kamar kosnya. Dia kedapatan menggunakan serta memiliki 0,5 gram sabu. Hakim menjatuhkan vonis satu tahun penjara

pada 2 Februari 2010. Pada 20 Juli 2010, Vivaldi Surya Permana alias Rivaldo kembali ditangkap untuk kedua kali dalam kasus narkoba di Jln. S Parman, Jakarta, dengan barang bukti 50 gram sabu. Sebelumnya, penyanyi dangdut senior, Imam S Arifin, kembali ditangkap polisi di Jln Pangeran Jayakarta, Sawah Besar, Jakarta Pusat pada 24 Maret 2010. Sebelumnya, Imam S Arifin pernah ditangkap di pelataran parkir Hotel Pardede, Jln Juanda, Medan pada tahun 2008 karena memiliki 1,6 gram sabu. Pada 13 November 2007 Roy Marten kembali ditangkap di Hotel Novotel Surabaya bersama temannya. Polisi menemukan satu gram dan satu ons sabu-sabu. Hakim menjatuhkan vonis tiga tahun penjara. Publik mungkin bertanya-tanya mengapa para artis lekat dan lebih memilih narkoba jenis sabu untuk dikonsumsi mereka. Sabu murni yang berbentuk seperti kristal putih, merupakan golongan obat stimulan jenis metamphetamine. Sabu digunakan untuk mendapatkan efek psikologis sebagai hasil kerja obat ini di berbagai sistem neuro-transmitter di otak, termasuk dopamin dan serotonin. “Penggunaan sabu dapat menimbulkan efek meningkatnya kepercayaan diri, harga diri, dan peningkatan libido,” jelas Dr. Andri, SpKJ selaku psikiater klinik Psikosomatik RS Omni. Efek pemakaian narkoba jenis sabu dapat membuat pemakainya percaya diri luar biasa. Dengan demikian, pada beberapa orang yang memakai sabu tersebut membuatnya terjaga dan tetap konsentrasi.(inc/tv)

Keriuhan para penggemar Bieber sempat membuat polisi dan pengelola hotel kewalahan. Pasalnya, mereka berusaha masuk ke dalam hotel dan saling dorong untuk bertemu dengan Bieber. Bahkan, polisi menutup Jalan North John karena dipenuhi massa penggemar Bieber yang ingin bertemu denganya. Kedatangan Bieber ke Inggris merupakan bagian dari tur dunianya bertajuk My World. Selain di kawasan Eropa, Bieber juga dijadwalkan akan bertandang ke Jakarta, Indonesia. Konser Bieber di Sentul, Bogor pada 23 April 2011, dinilai lebih sulit dibanding menggelar konser artis lainnya. Sebab, lima promotor yang menangani konser Justin Bieber sempat salah paham dengan Creative Artist Agency (ACC), manajemen yang mewakili Bieber. Masalah itu meliputi presale tiket hingga hubungan dengan sponsor. Namun masalahnya telah terselesaikan dengan kesepakatan lima promotor Asia Sport Development (ASD), Berlian Entertainment, Marygops, Multivision dan Mahkota. “Kami deal dengan manajemen Justin Bieber sudah cukup lama. Seperti penjualan tiket mereka sudah menentukan kapan, lalu promosinya juga demikian,” ujar Muhamad Reza Abdulah, Executive Vice President ASD.(k/inc/m25)

Wajah Julia Roberts Jadi Tato NAMA besar aktris Hollywood Julia Roberts di dunia akting tak diragukan lagi. Dia dinilai sangat profesional dan berprestasi dalam karir sehingga tidak sedikit publik yang mengidolakannya. Kebanyakan penggemar cukup puas jika foto diri Julia Roberts yang telah ditandatangani artis tersebut. Tapi penggemar Julia Roberts yang satu ini mempunyai cara memuja yang unik. Pria ini melakukan hal yang menurutnya lebih personal, untuk membuktikan kecintaannya kepada bintang ‘Pretty Woman’ itu. Dia membuat 82 tato dengan bentuk wajah Julia Roberts di tubuh dan lengannya. Penggemar fanatik itu bernama Miljenko Parserisas Bukovic, penjual surat kabar asal Valparaiso, Chile. Bukovic menghabiskan waktu sepuluh tahun untuk mengabadikan Julia Roberts di tubuhnya dalam bentuk 82 tato itu. Semua itu menghabiskan biaya 1.300 poundsterling. Ke-82 tato Julia Roberts di tubuh Bukovic menggambarkan berbagai adegan yang pernah dilakoni Roberts di film-filmnya.(inc/vvn)

Syahrini: Semoga Tidak Terjadi Pada Saya


MARAKNYA penggunaan narkoba di kalangan selebritis membuat penyanyi Syahrini (foto) merinding. “Aku turut prihatin kalau hal itu terjadi pada rekan-rekan yang lain,” kata mantan rekan duet Anang Hermansyah itu, ditemui di Jakarta, Kamis (10/3) malam. Indikasi masih banyaknya artis terlibat narkoba telah disampaikan pejabat di jajaran kepolisian. Setidaknya masih ada 12 TO (target operasi) termasuk di antaranya dari kalangan artis. Melihat kondisi ini, Syahrini sangat menyayangkannya. Terlebih jika si artis justru sangat dinanti karyanya oleh masyarakat dan penggemarnya. “Sayang sekali kalau menghilang apalagi masih muda dan multitalenta,” katanya. Menanggapi hal tersebut, Syahrini hanya bisa berdoa semoga kejadian ini tak berlaku kepada dia dan keluarganya. “Naudzubillah ya, semoga ini tidak terjadi pada diriku dan keluargaku. Semoga permasalahan ini akan segera terselesaikan. Aku enggak terlalu mau banyak berkomentar. Pokoknya doa yang terbaik saja, ya, supaya masalah siapa pun yang kena terhadap sama-sama pekerja seni akan segera terselesaikan,” harapnya.(k)

Waspada, Minggu 13 Maret 2011  

Waspada, Minggu 13 Maret 2011

Read more
Read more
Similar to
Popular now
Just for you