Page 1

OKI Dukung Kuota Haji JEDDAH, Arab Saudi (Waspada): Organisasi Kerjasama Islam (OKI) yang beranggota 56 negara telah menyatakan dukungannya pada keputusan Arab Saudi untuk mengurangi jumlah jamaah haji sampai 20 persen. Pengurangan itu karena ada renovasi di Masjidil Haram dan penting untuk menjamin keselamatan dan keamanan para tamu Allah,kata Sekjen OKI Ekmeleddin Ihsanoglu kemarin. (an/m10)

WASPADA Demi Kebenaran Dan Keadilan

www.waspadamedan.com

KAMIS, Kliwon, 27 Juni 2013/18 Sya’ban 1434 H

No: 24266 Tahun Ke-67

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

Terbit 20 Halaman (A1-12, B1-8)

Harga Eceran: Rp2.500,-

Indonesia Tidak Takut JAKARTA (Antara): Presiden Susilo Bambang Yudhoyono (SBY) mengatakan, apa yang dilakukan Indonesia mempercepat penanggulangan asap, dengan mengirimkan Satgas sama sekali tidak diperintah oleh negara lain, atau takut dengan negara lain.

“Tidak ada yang berhak meminta Indonesia sebagai negara berdaulat, dan menyuruh-nyuruh Presiden. Ini semua keputusan Presiden sendiri untuk saudara-saudara kita di Riau dan juga tetangga-tetangga kita,” tegas Presiden SBY dalam

Mobil BPBD G. Sitoli Ambil Korban 1 Tewas 10 Luka

Ronaldo: Saya Suka Indonesia

GUNUNGSITOLI (Waspada): Mobil dinas Badan Penanggulangan Bencana Daerah (BPBD) Kota Gunungsitoli BK 9051 YY, dikemudikan Ariston Lombu, Rabu (26/6) siang, menabrak dua rumah yang dijadikan warung makan dan sejumlah pengendara kereta di Simpang Meriam Jl. Diponegoro, Gunung Sitoli. Dalam peristiwa itu, satu orang tewas, sepuluh orang lainnya menderita luka-luka. Korban tewas, pegawai tata usaha SMPN 1 Gunungsitoli bernama Faigisokhi Harefa alias Ama Jeli, 50, yang saat kejadian sedang makan di kedai milik Kamidin Sikumbang. Selain menewaskan

Faigisokhi Harefa, sopir bersama tiga penumpang mobil dinas tersebut serta enam orang warga luka-luka dan dirawat di rumah sakit. Sejumlah saksi mata kepada Waspada di lokasi kejadian menyebutkan, pada saat itu mobil Kijang Innova yang dikemudikan Ariston Lombu melaju kencang dari arah Jl. Karet menuju Simpang Meriam Jl. Diponegoro. Saat hendak membelok ke arah kiri, diduga sopir tidak dapat mengendalikan kendaraannya dan menghantam sejumlah pengendara kereta serta dua rumah yang dijadikan warung makan. Lanjut ke hal A2 kol. 6

DENPASAR (Antara): Pemain sepakbola terkemuka dunia, Cristiano Ronaldo memenuhi janjinya menghadiri “Bali Save Mangrove, Save Earth (BSMSE)”, di Taman Hutan Raya Ngurah Rai, Tanjung Benoa, Bali, Rabu (26/6) siang. Ronaldo yang ditunjuk sebagai Duta Forum Peduli Mangrove (FPM) Indonesia pada kesempatan itu juga mendampingi Presiden Susilo Bambang Yudhoyono (SBY) dan Ibu Negara Hj. Ani Yudhoyono untuk menanam pohon mangrove di Taman Hutan Raya Ngurah Rai.

Lanjut ke hal A2 kol. 6

konferensi pers di Lanud Halim Perdanakusuma, Jakarta, Rabu (26/6) sore. Menurut presiden, bencana asap akibat kebakaran hutan di Kepulauan Riau yang juga dirasakan warga Singapura dan Malaysia bukanlah kesengajaan.

Namun demikian, pemerintah Indonesia bertanggung jawab dan akan berusaha keras menghentikan kebakaran lahan dan asap. “Memang kondisi alam yang terjadi saat ini (bencana asap-red) adalah yang terburuk,

tetapi, yang terjadi sekarang ini bukan kesengajaan. Tidak ada niat Indonesia menyusahkan tetangga-tetangganya,” kata Presiden. Presiden menegaskan, pemerintah Indonesia berupaya terus untuk menghentikan

Waspada/Bothaniman Jaya Telaumbanua

MOBIL dinas Kepala BPBD Kota Gunungsitoli usai terjadinya tabrakan di Simpang Meriang Jl. Diponegoro Gunungsitoli, Rabu (26/6).

Al Bayan

Keseimbangan

ini. Kita semua ingin menjalin kerjasama dan kemitraan yang sebaik-baik-nya,” ujar Presiden. Tidak berlebihan Mengenai permintaan maafnya pada Singapura dan

Lanjut ke hal A2 kol. 3

Pengumuman PSB 70 Persen Lancar Besok Seleksi Bina Lingkungan Tertulis MEDAN (Waspada) : Pengumuman Penerimaan Siswa Baru (PSB) sistem 70 persen dengan penjaringan nilai berdasarkan Surat Keterangan Hasil Ujian Nasional (SKHUN), Rabu (26/6) berjalan lancar. Sejumlah peserta sekolah negeri mulai SMP, SMA dan SMK di Medan terlihat tertib. Sedangkan siswa tidak lolos seleksi SKHUN, bisa mengikuti ujian seleksi bina lingkungan tertulis dengan membawa nomor pendaftaran PSB yang dimiliki guna menjaring 30 persen, besok (Jumat-Red) dimulai pukul 08:00 di tempat siswa mendaftarkan diri. Antara

RONALDO TANAM BAKAU: Presiden Susilo Bambang Yudhoyono bersama Ibu Ani Yudhoyono dan pesohor sepak bola dunia, Christiano Ronaldo (kiri) mengacungkan jempol saat menanam bakau di Taman Hutan Raya Ngurah Rai, Tanjung Benoa, Nusa Dua, Bali, Rabu (26/6).

Wagubsu Minta Awasi KPK: Penggeledahan Penyaluran BLSM BI Sangat Berguna MEDAN (Waspada): Untuk memperlancar proses penyaluran Bantuan Langsung Sementara (BLSM) bagi rakyat miskin, Wagubsu T Erry Nuradi melakukan sosialisasi kepada kepala daerah kabupaten/kota dan pimpinan SKPD untuk diteruskan ke tingkat desa dan kelurahan. Sosialisasi digelar di Gedung Binagraha Jl. Diponogoro

kebakaran ladang dan asap, dan Indonesia akan bertanggung jawab, dan akan melakukan yang terbaik. “Kami tidak melempar tanggung jawab, terus bekerja. Ini tanggung jawab kita, jangan kirim signal keliru atas apa yang Indonesia lakukan saat

Medan, Rabu(26/6), dihadiri Kadis Pendidikan M Zein, Staf Ahli Gubsu Arsyad Lubis, Kabag Pembinaan Kehidupan Beragama Biro Binsos H Sudarto SH, sejumlah Asisten, Kepala Bappeda, Kadis Sosial, Kepala Bagian Kesra dari kabupaten/ kota se Sumatera Utara. Wagubsu menjelaskan,

Lanjut ke hal A2 kol. 1

Lumpuh Dan Miskin Tak Tersentuh BLSM

Oleh Muhammad Arif Fadhillah Lubis, SHI, MSI SETELAH Nabi Muhammad SAW mempersaudarakan Salman Al-Farisi dan Abu Darda’, maka Salman mengunjungi Abu Darda’. Salman melihat Ummu Darda’ berpenampilan lusuh. Berkatalah Salman, “Bagaimana keadaanmu?” Ummu Darda’ menjawab, “Saudaramu (Abu Darda’) tidak punya kebutuhan apa pun terhadap dunia.” Lalu Abu Darda’ menghidangkan makanan untuk Salman, “Makanlah, aku sedang berpuasa.” Jawab Salman, “Aku tidak akan makan kecuali jika engkau makan.” Abu Darda’ pun makan. Di waktu malam, bangunlah Abu Darda’ melaksanakan shalat Tahajud. Salman mengatakan kepadanya, “Saudaraku! Tidurlah.” Maka, Abu Darda’ pun tidur kembali. Kemudian, ketika malam semakin larut, Abu Darda’ bangun kembali. Lalu, Salman kembali mengatakan, “Tidurlah.” Menghormati tamunya Abu Darda’ tidur kembali.

Lanjut ke hal A2 kol. 3 Waspada/Rasudin Sihotang

PAK Adeng duduk di kursi roda.

JAKARTA (Antara): Komisi Pemberantasan Korupsi mengklaim bahwa penggeledahan di sejumlah ruangan Bank Indonesia terkait kasus korupsi fasilitas pendanaan jangka pendek (FPJP) dan penetapan Bank Century sebagai bank gagal berdampak sistemik berguna untuk penyidikan kasus tersebut. “Hasil penggeledahan ini sangat berguna bagi kualitas

proses penyidikan yang tengah berlangsung untuk mengungkap lebih utuh kasus Century,” kata Wakil Ketua Bambang Widjojanto melalui pesan singkatnya di Jakarta, Rabu (26/6). Pada Senin (25/6) KPK menggeledah sejumlah ruangan di Bank Indonesia antara lain ruangan Bidang Pengawasan

Lanjut ke hal A2 kol. 1

MANCHESTER (Waspada): Ada yang aneh di Museum Manchester, Inggris. Patung Mesir bernama NebSenu setinggi 25 sentimeter, koleksi museum tersebut selama 80 tahun ini bisa bergerak sendiri. Dan, ini disaksikan staf museum melalui video yang memperlihatkan patung-patung kuno yang dijaganya seolah bernyawa. Neb-Senu yang diperkirakan sudah ada sejak 1800 Sebelum Masehi ditemukan di kuburan mumi dengan sebuah catatan bertuliskan “roti, bir, dan daging”. Selama beberapa bulan terakhir, kurator museum menyadari, patung ini menghadap ke arah yang salah.

Lanjut ke hal A2 kol. 7

PATUNG Neb- Senu difoto dari arah depan dan berputar sendiri ke belakang.

Lanjut ke hal A2 kol. 1 net

Lanjut ke hal A2 kol. 3

PM Julia Gillard Terguling CANBERRA, Australia (AP): PM Australia Julia Gillard terguling sebagai pemimpin Partai Buruh Rabu (26/6) oleh pendahulunya Kevin Rudd, dalam satu pemungutan suara yang dilakukan oleh para anggota parlemen partai dengan harapan untuk menghindari satu kekalahan besar dalam pemilihan mendatang. Pemungutan suara itu dilakukan tiga tahun dua hari setelah Gillard menggulingkan Rudd dalam satu pemungutan suara yang serupa untuk menjadi wanita pertama jadi PM Australia. Pemungutan suara Rabu itu menjadikan Rudd sebagai pemimpin partai, namun

Patung Mesir Berputar Sendiri Di Museum Inggris

SYAHREN alias Pak Adeng, barangkali satu dari ribuan orang fakir miskin Kota Ta n j u n g b a l a i yang seharusnya menerima kompensasi kenaikan harga Bahan Bakar Minyak (BBM). Pria berusia 52 tahun, warga Lingk. IV, Kel. Tanjungbalai Kota IV, Kec. Tanjungbalai Utara, itu sejak sepuluh tahun

Pantauan Waspada kemarin, meski jadwal pengumuman dimulai pukul 15:00, namun sejak pukul 13:00, calon siswa bersama orang tua mereka sudah memadati sekolah yang mereka inginkan . Di SMAN 1, sistem penerimaan dengan SKHUN nilai tertinggi 43,1 dan yang paling rendah nilainya 38,55. Jumlah siswa yang ditampung berdasarkan nilai ini sebanyak 374 siswa. Sedangkan di SMAN 2 Medan, nilai tertinggi mencapai 42,15 dan nilai terendah 38,25. Sedangkan siswa yang

dia belum jadi PM dan kemungkinan tidak akan dapat jabatan tersebut jika para anggota parlemen partai meninggalkan koalisi berkuasa Partai Buruh.

Lanjut ke hal A2 kol. 7

Baca Besok Pengumuman Kenaikan Kelas Santri Ar-Raudlatul Hasanah TA 2012-2013

Ada-ada Saja Lelang Rumah Di Pinggir Jurang GARA-gara longsor, rumah mewah dengan empat kamar tidur mengalami penurunan harga drastis dari Rp 6 miliar menjadi Rp 375 juta. Rumah itu terletak di samping sebuah rumah yang kini telah runtuh

Lanjut ke hal A2 kol. 2

Serampang - Tidak takut, cuma cuak? - He...he...he...


Hujan Di Sumut Kurangi Titik Api MEDAN (Waspada): Titik api kebakaran lahan di beberapa daerah di Sumatera Utara berkurang akibat curah hujan Rabu (26/6) pagi dan sore. Selain di Riau, sudah terdeteksi adanya titik api di beberapa wilayah di Sumut, seperti Labuhanbatu, Paluta (Padang Lawas Utara), Tapsel dan Madina. Dari 174 titik api yang terdeteksi di Sumatera (data 25 Juni 2013), Lanjut ke hal A2 kol 6

WASPADA

Puting Beliung Rusak 8 Rumah Di Lhoksukon

Demi Kebenaran Dan Keadilan

LHOKSUKON (Waspada) : Angin puting beliung yang didahului hujan dan petir merusak delapan rumah di Desa Cot U Sibak, Kec. Lhoksukon, Rabu (26/6) sekitar pukul 03:00. Tidak ada korban jiwa dalam kejadian itu, namun empat rumah di antaranya rata dengan tanah dan salah seorang pemilik rumah, Zulfadli, 33, luka-luka di kepala

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) KAMIS, Legi, 27 Juni 2013/18 Sya’ban 1434 H

z zNo: 24265 * Tahun Ke-67

Lanjut ke hal A2 kol 6

Terbit 20 Halaman

Maaf Soal Asap Pada Singapura

Presiden: Indonesia Tidak Takut JAKARTA (Antara): Presiden Susilo Bambang Yudhoyono (SBY) mengatakan, apa yang dilakukan Indonesia mempercepat penanggulangan asap, dengan mengirimkan Satgas sama sekali tidak diperintah oleh negara lain, atau takut dengan negara lain.

“Tidak ada yang berhak meminta Indonesia sebagai negara berdaulat, dan menyuruh-nyuruh Presiden. Ini semua keputusan Presiden sendiri untuk saudara-saudara kita di Riau dan juga tetangga-

tetangga kita,” tegas Presiden SBY dalam konferensi pers di Lanud Halim Perdanakusuma, Jakarta, Rabu (26/6) sore. Menurut presiden, bencana asap akibat kebakaran hutan di Kepulauan Riau yang

juga dirasakan warga Singapura dan Malaysia bukanlah kesengajaan. Namun demikian, pemerintah Indonesia bertanggung jawab dan akan berusaha keras menghentikan kebakaran lahan dan asap.

Pengumuman PSB 70% Lancar Besok Seleksi Bina Lingkungan Tertulis M E D A N ( Wa s p a d a ) : Pengumuman Penerimaan Siswa Baru (PSB) sistem 70 persen dengan penjaringan nilai berdasarkan Surat Keterangan Hasil Ujian Nasional (SKHUN), Rabu (26/6) berjalan lancer. Sejumlah peserta sekolah negeri mulai SMP,SMA dan SMK di Medan terlihat tertib. Sedangkan siswa tidak lolos seleksi SKHUN, bisa mengikuti ujian seleksi bina lingkungan tertulis dengan membawa nomor pendaftaran PSB yang dimiliki guna menjaring

30 persen, besok (Jumat-Red) dimulai pukul 08 di tempat siswa mendaftarkan diri. Pantauan Waspada kemarin, meski jadwal pengumuman dimulai pukul 15 WIB, namun sejak pukul 13 WIB, calon siswa bersama orang tua mereka sudah memadati sekolah yang mereka inginkan. Di SMAN 1, sistem penerimaan dengan SKHUN nilai tertinggi 43,1 dan yang paling rendah nilainya 38,55. Jumlah siswa yang ditampung Lanjut ke hal A2 kol 3

Pemko Medan Gelar Pasar Murah Di 151 Titik MEDAN (Waspada): Guna mengendalikan harga kebutuhan pokok pasca kenaikan harga BBM dan menjelang bulan suci Ramadhan, Pemko Medan menyiapkan anggaran Rp4 miliar lebih untuk menggelar pasar murah di 151 titik lokasi. Demikian dikatakan Plt Wali Kota Medan Dzulmi Eldin kepada Waspada,Rabu (26/6). “Pasar murah ini rencananya kita buka pada 1 Juli, bertepatan hari jadi ke-423 Kota Medan,” kata Eldin. Menurut Eldin, pasar murah itu merupakan program

rutin Pemko Medan yang digelar untuk membantu masyarakat dalam menyambut datangnya hari besar keagamaan. “Kebetulan menjelang datangnya bulan suci Ramadhan, pemerintah menaikkan harga BBM dan berimbas dengan naiknya harga bahan kebutuhan pokok. Jadi kita berharap pasar murah dapat meringankan warga untuk membeli bahan kebutuhan pokok. Sebab, bahan kebutuhan yang dijual di pasar murah Lanjut ke hal A2 kol 3

Antara

PRESIDEN Susilo Bambang Yudhoyono (tengah) bersama Ibu Ani Yudhoyono (kanan) dan pesohor sepak bola dunia, Christiano Ronaldo (kiri) mengacungkan jempol saat menanam bakau di Taman Hutan Raya Ngurah Rai, Tanjung Benoa, Nusa Dua, Bali, Rabu (26/6).

ganya,” kata presiden. Presiden menegaskan, pemerintah Indonesia berupaya terus untuk menghentikan kebakaran ladang dan asap, dan Indonesia akan bertanggung jawab, dan akan melaku-

Ronaldo: Saya Suka Indonesia

Mobil Dinas BPBD G. Sitoli Ambil Korban 1 Tewas 10 Terluka

BALI (Waspada): Bintang Real Madrid Cristiano Ronaldo mengaku sangat menikmati kunjungannya di Indonesia. Saat diminta memberi kata sambutan oleh panitia, Ronaldo sempat malu-malu dan minta didampingi oleh penerjemahnya. Dalam sambutannya, Ronaldo yang hari itu secara resmi didaulat oleh pemerintah sebagai duta Mangrove Indonesia menyatakan senang berada di Indonesia. “Saya senang sekali datang ke Indonesia,” ujar Cristiano Ronaldo di Nusa Dua Bali, Rabu (26/6) yang diterjemahkan oleh Lanjut ke hal A2 kol 5

Penderita Sakit Jiwa Mengamuk, 2 Orang Tewas, 3 Kritis LHOKSUKON (Waspada): Satu keluarga, terdiri dari ibu, anak dan cucu, serta seorang tetangga dibantai dengan sebilah pedang di Desa Arongan, Kec. Lhoksukon, Aceh Utara, Rabu (26/6) pagi. Dua orang tewas di tempat dan tiga lainnya kritis. Sementara pelaku

yang juga keluarga korban, diduga sakit jiwa diamankan di Mapolres Aceh Utara di Lhoksukon. Korban meninggal, Juarah, 40, ibu rumah tangga dan anaknya Maizar, 22. Mereka menderita luka bacok di kepala dan leher. Korban kritis,

Maimunah, 60, ibu kandung Juarah, Zalzahbari alias Dek Gam, 20, putra kandung Juarah dan Nurjannah, 60, tetangga Maimunah. Setelah kejadian, kelima korban dibawa ke Puskesmas Lhoksukon. Korban kritis, dirujuk ke RSU Cut Meutia

Aceh Utara di Buket Rata, Lhokseumawe. Infor masi dihimpun Waspada, tersangka pelaku Mun alias Nyak Di, 28, anak kandung Maimunah. “Dia memang sakit jiwa. Lanjut ke hal A2 kol 1

GUNUNGSITOLI (Waspada): Mobil dinas Badan Penanggulangan Bencana Daerah (BPBD) Kota Gunungsitoli BK 9051 YY, dikemudikan Ariston Lombu, Rabu (26/6) siang, menabrak dua rumah yang dijadikan warung makan dan sejumlah pengendara kereta di Simpang Meriam Jl. Diponegoro, Gunung Sitoli. Dalam peristiwa itu, satu orang tewas, sepuluh orang lainnya menderita luka-luka. Korban tewas, pegawai tata usaha SMPN 1 Gunung-

Keseimbangan Oleh: Muhammad Arif Fadhillah Lubis,SHI,MSI

Waspada/ist

LOODS Pasar Sihepeng yang roboh akibat diterpa angin kencang, Selasa (25/6) sekira pukul 20.00.

Angin Kencang Rubuhkan Loods Pasar Sihepeng Madina PANYABUNGAN (Waspada): Angin kencang yang melanda sebagian wilayah Kab. Mandailing Natal (Madina), Selasa (25/6) malam, merubuhkan tiga jalur loods di Pasar Sehepeng Kec. Siabu. Informasi Waspada peroleh, malam itu angin kencang disertai hujan deras mengguyur wilayah Mandailing Julu Lanjut ke hal A2 kol 5

SYAHREN alias Pak Adeng, barangkali satu dari ribuan orang fakir miskin Kota Tanjungbalai yang seharusnya menerima kompensasi kenaikan harga Bahan Bakar Minyak (BBM). Pria berusia 52 tahun, warga Lingk. IV, Kel. Tanjungbalai Kota IV, Kec. Tanjungbalai Utara, itu sejak sepuluh tahun lalu menderita lumpuh dan sehari-harinya dihabiskan duduk di atas kursi roda yang dibeli dari swadaya masyarakat. Untuk menyambung hidup, Adeng mengharapkan uluran tangan dan belas kasihan dari temantemannya. “Terkadang sampai dua hari saya tidak makan, itu

kalau tidak ada teman-teman yang datang memberi makan,” ujar Adeng. Adeng saat ini tinggal di sebuah gubuk berukuran 2 x

kan yang terbaik. “Kami tidak melempar tanggung jawab, terus bekerja. Ini tanggung jawab kita, jangan kirim signal keliru atas apa yang Indonesia Lanjut ke hal A2 kol 6

sitoli bernama Faigisokhi Harefa alias Ama Jeli, 50, yang saat kejadian sedang makan di kedai milik Kamidin Sikumbang. Selain menewaskan Faigisokhi Harefa, sopir bersama tiga penumpang mobil dinas tersebut serta enam orang warga luka-luka dan dirawat di rumah sakit. Sejumlah saksi mata kepada Waspada di lokasi kejadian menyebutkan, pada saat itu satu mobil Kijang Innova yang Lanjut ke hal A2 kol 5

Rumah Anggota DPRD Sergai Dilempar Bom Molotov PERBAUNGAN (Waspada): Rumah anggota DPRD Kab. Serdang Bedagai, H.Syahlan Siregar ST yang berlokasi di Jl.Teratai, No.9A, Lingk.Juani, Kel.Simpang Tiga Pekan, Kec.Perbaungan, dilempar bom molotov oleh orang tak dikenal (OTK), Rabu (26/6), dini hari.Tidak ada korban jiwa dalam peristiwa itu karena dua bom molotov yang dilempar OTK tidak mengenai sasaran. Korban yang juga ketua Fraksi PAN DPRD Sergai ketika ditemui Waspada di gedung DPRD Sergai di Jl.Negara, Desa

Syahren Yang Lumpuh Dan Miskin, Tak Tersentuh BLSM

Al Bayan

SETELAH Nabi Muhammad SAW mempersaudarakan Salman Al-Farisi dan Abu Darda’, maka Salman mengunjungi Abu Darda’. Salman melihat Ummu Darda’ berpenampilan lusuh. Berkatalah Salman, “Bagaimana keadaanmu?” Ummu Darda’ menjawab, “Saudaramu (Abu Darda’) tidak punya kebutuhan apa pun terhadap dunia.” Lalu Abu Darda’ menghidangkan makanan untuk Salman, “Makanlah, aku sedang berpuasa.” Jawab Salman, “Aku tidak akan makan kecuali jika engkau makan.” Abu Darda’ pun makan. Di waktu malam, bangunlah Abu Darda’ melaksanakan shalat Tahajud. Salman mengatakan kepadanya, “Saudaraku! Tidurlah.” Maka, Abu Darda’ pun tidur kembali. Kemudian, ketika malam semakin larut, Abu Darda’ bangun kembali. Lalu, Salman kembali mengatakan, “Tidurlah.” Menghormati tamunya Abu Darda’ tidur kembali. Lanjut ke hal A2 kol 2

“Memang kondisi alam yang terjadi saat ini (bencana asap-red) adalah yang terburuk, tetapi, yang terjadi sekarang ini bukan kesengajaan. Tidak ada niat Indonesia menyusahkan tetangga-tetang-

3 meter berdinding tepas sumbangan dari masyarakat. Bangunan itu ternyata Lanjut ke hal A2 kol 1

Firdaus, Kec.Sei Rampah menuturkan malam itu dia bersama putranya M.Sando,17, tertidur sekira pukul 01:30, di ruang tamu. “Sekitar pukul 04:00, kami Lanjut ke hal A2 kol 3

Baca Besok

Pengumuman Kenaikan Kelas Santri Ar-Raudlatul Hasanah TA 2012-2013

Ada-ada Saja

Lelang Rumah Di Pinggir Jurang

GARA-gara longsor, rumah mewah dengan empat kamar tidur ini mengalami penurunan harga drastis dari Rp 6 miliar menjadi Rp 375 juta. Rumah itu terletak di samping sebuah rumah yang kini telah runtuh separuh

Lanjut ke hal A2 kol 5

Serampang - Siapa takut...! - He.... he....he.... PAK Adeng duduk di kursi roda.

Waspada/Rasudin Sihotang


Berita Utama

A2

WASPADA Kamis 27 Juni 2013

Warga Aek Bilah Kekurangan Ustadz

Waspada/Musyawir

PETUGAS Puskesmas Lhoksukon mengevakuasi korban pembantaian pria yang diduga sakit jiwa ke dalam ambulans untuk dirujuk ke Rumah Sakit Cut Meutia, Rabu (26/6).

Penderita Sakit Jiwa ....

Dia baru pulang dari rumah sakit jiwa di Banda Aceh, Selasa (25/6) malam. Tiba-tiba, tadi pagi, sekitar pukul 10:00, ia mengamuk dan mengejar kami dengan pedang,” kata M Ali, 25, keluarga korban, di Puskesmas Lhoksukon. Ali menambahkan, amukan pelaku baru mereda setelah salah seorang warga memukulnya dari jarak jauh dengan balok kayu panjang. Setelah itu, pelaku lemas, lalu diikat oleh warga dan diserahkan ke polisi. Informasi lain dihimpun Waspada, tersangka mengamuk gara-gara mi instan yang lambat dimasak ibunya Maimunah. Sepulang dari Banda Aceh, Rabu (25/6) malam, dia terlihat mondar-mandir di Desa Arongan, sembari menyandang pedang, seperti pendekar. Malam itu dia tidur di meunasah atau surau desa. Paginya, sekitar pukul 09:30, tersangka pulang ke rumah sambil membawa sebungkus mi siap saji. Dia meminta ibunya memasak mi tersebut. Namun, karena banyak kesibukan, mie itu baru dimasak oleh Maimunah, sekitar pukul 10:00. Hal ini membuat tersangka marah. Dia tiba-tiba menghunus pedangnya dan langsung membacok bagian belakang leher ibunya, yang ketika itu sedang memasak mi untuknya. Korban tersungkur. Tapi, kemudian keluar rumah sambil berteriak minta tolong. Mendengar teriakan korban, kakak kandung tersangka Juarah, yang rumahnya terpaut sekitar 15 meter dari rumah Maimunah, datang menolong. Namun Juarah ikut dibacok hingga meninggal di

Syahren Yang ....

belum sepenuhnya selesai karena ketiadaan biaya. Atap sengnya masih kurang beberapa lembar lagi dan jika hujan, kediamannya itu akan basah. Di dalam ‘gubuknya ‘ itu semua fasilitas yang seharusnya terpisah ternyata digabung menjadi satu seperti tempat tidur, lemari, kamar mandi, dapur, dan toilet. Tidak ada sekat ataupun pemisah. Semuanya berpadu. Kepada Waspada, Adeng yang mengaku tak mau jadi pengemis ini tidak terlalu mu-

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. c8(M)+, Gd8. 2. BxG+, Be8. 3. BxB+, Rh7. 4. Bh8+mat. (Jika 1. ...., Gh7. 2. KxG+, g7xK. 3. Bxf7+mat). Jawaban TTS: TTS Topik

Olahraga

Jawaban Sudoku: 7 9 6 5 4 2 1 8 3

5 1 4 8 3 6 2 7 9

2 8 3 9 7 1 4 6 5

1 6 2 7 8 9 5 3 4

3 7 5 6 1 4 8 9 2

9 4 8 2 5 3 6 1 7

4 2 7 3 6 8 9 5 1

8 3 9 1 2 5 7 4 6

6 5 1 4 9 7 3 2 8

tempat. Begitu pula Maizar, anak Juarah, yang menyusul ibunya beberapa saat kemudian. Setelah itu, tersangka kabur meninggalkan korban. Saat melewati lorong rumahnya, sambil lari, tersangka membacok kepala Zalzabahri, adik Maizar. Lalu, di ujung lorong bertemu Nurjannah, tetangganya. Nurjanah menanyakan kepada tersangka, apa yang terjadi. Namun, bukannya mendapat jawaban, Nurjannah ikut dibacok hingga luka robek di kepala. Ketika itu masyarakat mulai ramai dan berusaha mengepung pelaku. Namun, masyarakat tak berani mendekat, karena pelaku mengayun-ayunkan pedangnya sambil mengancam warga yang berani mendekat. Beruntung, seorang warga desa setempat, Faidan, 40, memukul tersangka dengan balok kayu panjang, lalu menamparnya hingga tersungkur. Saat itulah, tersangka dilumpuhkan dan diserahkan ke polisi dengan tangan diikat. Kapolres Aceh Utara AKBP Gatot Sujono melalui Kapolsek Lhoksukon AKP Razali, mengatakan, untuk memastikan tersangka sakit jiwa atau tidak, polisi akan meminta keterangan ahli dari Rumah Sakit Jiwa (RSJ) Banda Aceh. Menurut Kapolres, pihaknya masih menyelidiki dari mana pedang itu berasal. Yang jelas, menurut pihak keluarga, pelaku melarikan diri dari rumah sakit jiwa Banda Aceh. Kabarnya dia sudah lama lari dari rumah sakit tersebut dan selama ini berkeliaran di Banda Aceh. ‘’ Namun karena pakaiannya bersih, orang di sana tidak tahu dia sakit jiwa,” katanya. (b19) luk-muluk dalam berharap. Dia hanya memohon agar diberikan pinjaman modal untuk membuka usaha berjualan kecil-kecilan. Sebab, sejak dahulu dia lebih suka berniaga. “ Tak satupun bantuan pemerintah dirasakan. Cuma beras madani dari Wali Kota sajalah, itu pun baru beberapa kali. Kalau bisa pula memohon, sudilah saya diberi modal demi menyambung hidup saya,” kata Adeng. Lurah Tanjungbalai Kota IV, Nurmiah SE yang dikonfirmasi Waspada mengatakan, ada ratusan warganya tidak memperoleh kompensasi BBM. Padahal, rata-rata mereka masuk dalam golongan miskin dan sangat merasakan dampak dari kenaikan harga BBM tersebut. “Memang Pak Adeng tidak memperoleh BLSM, tapi kan data bukan dari kami, itu dari statistik, merekalah yang mengajukan data ke pusat. Kalau kami yang buat data, pasti Pak Adeng masuk dalam daftar,” tutur Nurmiah. (a32)

Al Bayan ....

Memasuki akhir malam, Salman bangun, berkata kepada Abu Darda’, “Bangunlah sekarang.” Mereka pun shalat tahajud berdua. Selesai shalat, Salman berkata, “Sesungguhnya Tuhanmu mempunyai hak atasmu yang harus engkau tunaikan. Dirimu punya hak atasmu yang harus engkau penuhi, dan keluargamu punya hak atasmu yang harus engkau tunaikan. Tunaikanlah hak masing-masing kepada setiap pemiliknya secara seimbang.” Merasa kurang yakin dengan masukan saudaranya, keesokan hari Abu Darda’ mendatangi Rasulullah SAW menuturkan yang terjadi. Berkatalah Rasulullah SAW, “Abu Darda’, Salman memang benar.” Kisah ini dari hadis diriwayatkan Imam Bukhari. Berdasarkan hadis tersebut, nyatalah Islam menghendaki keseimbangan urusan keduniaan dan keakhiratan, masalah ibadah dan kemasyarakatan. Tirulah perilaku Rasulullah SAW dalam kesehariannya. Sang Muhammad SAW meneladankan kepada kita keseimbangan dalam kehidupan antara dunia dan akhirat.

P.SIDIMPUAN (Waspada): Masyarakat Kec. Aek Bilah, Kab. Tapanuli Selatan, yang mayoritas beragama Islam, sangat kekurangan dan butuh penambahan ustadz. Para orangtua khawatir , anak-anak mereka terpengaruh kemajuan zaman. “Kami kesulitan mendapatkan gur u agama atau ustadz yang bisa membimbing dan mengarahkan kami sesuai ajaran Islam. Kami sangat

takut generasi muda daerah ini makin terpengaruh kemajuan zaman,” kata Camat Aek Bilah, Haris Ritonga SH kepada Waspada di Padangsidimpuan, Rabu (26/6). Dari 7.879 jiwa warga di kecamatan itu, 95 persen beragama Islam. Tetapi hingga saat ini keberadaan ustadz atau ulama masih menjadi kendala bagi 12 desa yang ada di ujung utara Kab. Tapsel tersebut. Diakuinya, ada beberapa

ulama atau ustdaz yang terus ‘berjihad’ mengembangkan syiar Islam di Aek Bilah. Namun, bila dibandingkan dengan penduduk , jumlah ustadz tersebut sangat tidak sebanding.Apalagi Majelis Ulama Indonesia (MUI) setempat tidak maksimal dalam melakukan syiar Islam. Camat Aek Bilah berharap pengurus MUI kecamatan yang baru terbentuk dapat mengatasi permasalahan ini. (a27)

Pengumuman PSB ....

antaranya jurusan akuntansi memiliki daya tampung 105 siswa dengan nilai tertinggi 97,95 dan terendah 85,60. Jurusan Administrasi perkantoran juga memiliki daya tampung 105 siswa dengan nilai tertinggi 97,95 dan terendah 85,60. Untuk jurusan pemasaran daya tampungnya 75 siswa, peringkat pertama nilainya 91,00 dan terendah 37,00. Terakhir jurusan Urusan Perjalanan Wisata (UPW) daya tampungnya 48 siswa dimana nilai tertinggi 95,35 dan terendah 76,45. Sistem penilaian di SMK berbeda, kalau di SMA nilai UN mur ni ditambahkan dengan 4 untuk pendaftar dari kota Medan sedangkan pendaftar dari luar Kota Medan tidak mendapatkan nilai sama sekali. Sedangkan penilaian di SMK sedikit rumit yakni untuk nilai UN bahasa Inggris dikalikan 4, nilai Matematika dikali 3, bahasa indonesia dikali 2 dan IPA dikalikan 1. Setelah dikalikan nilai seluruhnya di total dan di urutkan berdasarkan nilainya untuk menentukan siapa tertinggi. “Nilai saya tidak mencukupi dari standar nilai yang ditentukan,”kata Ayu calon siswa yang memilih program keahlian administrasi perkantoran. Dia mengaku ingin ikut seleksi bina lingkungan yang akan menjaring calon siswa 30 persen lagi. Suasana di SMPN 2 Me-

dan dan SMPN 3 Medan saat pengumuman PSB untuk 70 persen lancar. Di SMPN 2 Medan, ada 173 siswa yang lolos dan nilai tertinggi 32,75 dan terendah 30,25. Demikian juga di SMPN 3 Medan, nilai tertinggi 28,65 dan terendah 25,30. “ Besok yang berminat ujian seleksi bina lingkungan tertulis untuk menjaring 30 persen, bisa langsung ujian tanpa mendaftar asalkan membawa nomor pendaftaran awal . Itu hak calon siswa,” kata Kepala Sekolah Nurhalimah Sibuea MPd. Sementara di SMPN 16 Medan, nilai tertinggi 31,65 dengan jumlah siswa 149. Bagi siswa yang ingin ikut seleksi bina lingkungan untuk 30 persen, bisa mendaftarkan diri atau ikut langsung ujian pada Jumat (28/ 6). Demikian Irmawati Kepala SMPN 16 Medan. (m37)

berdasarkan nilai ini sebanyak 374 siswa. Sedangkan di SMAN 2 Medan, nilai tertinggi mencapai 42,15 dan nilai terendah 38,25. Sedangkan siswa yang ditampung untuk kouta 30 persen ini sebanyak 216 orang. Sedangkan nilai tertinggi di SMAN 3 yakni 42,30, dan terendah 38,60. Wakil Kepala Sekolah SMA 3 Emir menyebutkan tahun ajaran kali ini sekolahnya memiliki daya tampung berjumlah 418, namun ada siswa yang tinggal kelas sebanyak 19 siswa jadi kursi yang tersedia untuk siswa baru tahun ini berjumlah 399. “ Yang diterima melalui jalur SKHUN berjumlah 279 atau 70 persen dari sisa sisa kursi untuk siswa baru, untuk jalur bina lingkungan (tes tertulis) sebanyak 120 atau 30 persen dari kursi yang tersisa,” kata Emir kemarin. Sebelumnya, Kepala sekolah SMAN 5, Drs Haris Simamora menyatakan, peringkat pertama yang lulus di sekolah yang dipimpinnya yakni 41,65 sedangkan yang paling rendah 36,20. “Bagi yang tidak lulus melalui jalur SKHUN masih memiliki kesempatan untuk mengikuti seleksi tertulis atau bina lingkungan,” jelasnya. Sementara itu, di SMKN 1 menerima siswa baru melalui jalur SKHUN berjumlah 333 yang dibagi ke 4 jurusan, di

Pemko Medan ....

stansi terkait juga akan mengawasi pasokan bahan kebutuhan pokok sehingga para pedagang tidak sesukanya menaikkan harga. Sedangkan, Ramadhan Fair 2013, kata Eldin, akan digelar di tiga lokasi berbeda yaitu Taman Sri Deli, Martubung dan Lapangan Cadika Pramuka Medan Johor. Khusus untuk kuliner, E ldin mengaku lebih memprioritaskan pelaku UMKM. (m50)

Rumah Anggota ....

terbangun karena alarm mobil yang diparkir di teras tiba-tiba berbunyi. Anak saya mendengar suara lemparan serta suara sepeda motor melintas dan berhenti di depan rumah. Ia pun membangunkan saya,” ujar H.Syahlan, yang juga Bendahara DPD PAN Sergai. Setelah itu Syahlan berusaha mematikan alarm mobil dari dalam rumah dan melarang putranya keluar. “Paginya sekira pukul 07:00, saat istri saya menyapu halaman, ia melihat serpihan botol kaca salah satu minuman suplemen.Setelah diperiksa, ia menemukan satu botol berisi minyak tanah dengan sumbu sobekan handuk bekas dibakar. Setelah saya diteliti ternyata salah satunya mengenai tiang teras dan pecah mengakibatkan alarm mobil berbunyi,” papar Syahlan. Kasus itu, menurut Syahlan, sudah dilaporkan ke Kepling, diteruskan ke Bhabinkantibmas Kel. Simpang Tiga Pekan, Aiptu.Piter Barasa. Tujuh personel Polsek Perbaungan dipimpin Kanit

Reskrim, Ipda.Ilham S.Sos mendatangi rumah korban dan melakukan olah tempat kejadian perkara, selanjutnya mengamankan barang bukti bom molotov. Menurut Syahlan, hingga saat ini belum mengetahui motif pelemparan itu. Selama terjun ke dunia politik maupun dagang, ia dan keluarganya merasa tidak punya musuh atau pun masalah, terlebih dengan masyarakat sekitar. Kapolsek Perbaungan, AKP.Maruluddin didampingi Kanit Reskrim, Iptu Ilham ketika dikonfirmasi Waspada, membenarkan peristiwa tersebut. Pihaknya telah melakukan olah TKP serta menyita barang bukti dua bom molotov yang belum terbakar.’’ Tetapi korban belum resmi melapor, ‘’terangnya. Catatan Waspada, kasus pelemparan bom molotov di rumah anggota DPRD di Deliserdang, sudah kali terjadi. Beberapa tahun lalu, OTK melemparkan bom molotov ke rumah anggota DPRD Sergai MY Basrun. Namun, tidak ada korban jiwa. (c03)

Rujuk jugalah Firman Allah SWT surah Al-Qashash ayat ke-77 berikut ini, “Dan carilah pada apa yang telah dianugerahkan Allah kepadamu (kebahagiaan) negeri akhirat, dan janganlah kamu melupakan bagianmu dari (kenikmatan) duniawi dan berbuat baiklah (kepada orang lain) sebagaimana Allah telah berbuat baik kepadamu, dan janganlah kamu berbuat kerusakan di (muka) bumi. Sesungguhnya Allah tidak menyukai orang-orang yang berbuat kerusakan.” Dalam tafsirnya, Ibnu Katsir memberikan penjelasan: “Pergunakanlah karunia yang telah Allah berikan kepadamu berupa harta dan kenikmatan yang berlimpah ini, untuk menaati Rabb-mu dan mendekatkan diri kepada-Nya dengan berbagai bentuk ketaatan. Dengan itu, kamu memeroleh balasan di dunia dan pahala di akhirat. Firman A l l a h “ Ja n g a n l a h k a m u melupakan bagianmu dari kenikmatan duniawi”, yaitu dari apa-apa yang dibolehkan Allah berupa makanan, minuman, pakaian, tempat tinggal dan pernikahan. Sesungguhnya Allah mempunyai hak atas dirimu. Jiwa ragamu juga

mempunyai hak atas dirimu. Keluargamu juga mempunyai hak atas dirimu. Tamumu juga mempunyai hak atas dirimu. Maka berikanlah tiap-tiap hak kepada pemilikinya.” Sang Rasul SAW kerap mengingatkan umatnya mengedepankan keseimbangan dan tidak berlebihan. Hadis yang diriwayatkan Imam Bukhari, “Sederhanalah dalam beramal, mendekatlah pada kesempurnaan, pergunakanlah waktu pagi dan sore serta sedikit dari waktu malam. Bersahajalah, niscaya kalian akan sampai tujuan.” Hadis lain yang diriwayatkan Imam Muslim, “Binasalah orang-orang yang berlebih-lebihan.” Nyatalah berdasarkan Islam merupakan agama yang mengedepankan keseimbangan baik dalam ucapan maupun perbuatan. Islam tidak menghendaki pemeluknya terlalu asyik beribadah individual dengan menafikan ibadah sosial. Islam tidak me ng i ng inkan umatnya hidup individualistik dengan hanya mengejar urusan akhirat saja atau hanya mengejar kehidupan dunia saja. Islam adalah agama yang seimbang.

telah kita subsidi sehingga harganya jauh lebih murah dari pasaran,” ungkapnya. Eldin mengatakan, penyaluran beras miskin (Raskin) untuk tahun ini dilakukan 15 kali, biasanya hanya 12 kali dalam setahun. Eldin merencanakan, penyaluran Raskin menjelang Idul Fitri dilakukan 2 kali, sehingga dapat membantu masyarakat. Kemudian, lanjutnya, in-

Angin Kencang ....

khususnya Kotanopan, setelah beberapa minggu dilanda panas terik. “Hujan deras dan angin kencang datang tiba-tiba. Bahkan di daerah kami sempat mati lampu beberapa menit,” kata seorang warga di Kotanopan. ‘’Angin kencang merubuhkan tiga jalur loods di Pasar Sihepeng, ‘’ kata Camat Siabu Edi Sahlan yang dihubungi melalui selularnya.Namun, tidak ada korban jiwa dalam peristiwa tersebut. Pemkab Madina melalui Dinas Perindag, Koperasi, UKM dan Pasar sudah turun meninjau loods yang rusak. Sementara itu, Kepala Dinas Perindang, Koperasi, UKM dan Pasar, Lis Mulyadi Nasution yang dikonfirmasi, Rabu (26/6) membenarkan loods Pasar Sihepeng rubuh akibat diterpa angin kencang. “Kami berupaya bagaimana loods yang runtuh bisa diperbaiki kembali,” katanya. (a28)

Ronaldo: ....

penerjemahnya di atas panggung. Ucapan Ronaldo tersebut langsung disambut tepuk tangan meriah dari ratusan peserta kegiatan menanam mangrove bersama ini. Dalam kesempatan ini Ronaldo juga mengucapkan terima kasih kepada Presiden SBY yang sudah menyambutnya dengan baik. (m09/kc)

Mobil Dinas ....

dikemudikan Ariston Lombu melaju kencang dari arah Jl. Karet menuju Simpang Meriam Jl. Diponegoro. Saat hendak membelok ke arah kiri, diduga sopir tidak dapat mengendalikan kendaraannya dan menghantam sejumlah pengendara kereta serta dua rumah yang dijadikan warung makan. Sepuluh orang lainnya yang luka-luka yakni Amir Syarif Tanjung, Ama Putri, Yusman Polem, Kamidin Sikumbang, Irwandi Selayang, sopir Ariston Lombu, istri Aris-

Ada-ada Saja ....

akibat longsor ke ke dasar jurang. Rumah yang dilengkapi perabot serba mewah serta taman indah dengan pemandangan menghadap laut ini terletak di kompleks perumahan Tor Cottage di Devon, Inggris. Namun, dua longsoran yang terjadi belum lama ini membuat rumah itu berada tepat di bibir jurang. Pemiliknya membeli rumah itu seharga £400,000 dan kini telah telah pindah, tapi sebuah per usahaan spesialis kini tengah berusaha melelang rumah itu dengan harga £25,000. “Bukan tak mungkin seorang pembeli yang lihai bisa mendapat keuntungan dari investasi ini jika alam mau berbaik hati kepada mereka,” kata juru lelang Graham Penny seperti dilansir The Mirror, Rabu (26/6). Graham berharap rumah itu tetap berdiri tegak di pinggir jurang itu hingga bulan depan saat lelang berakhir. Siapa pun yang menjadi pembelinya dilarang bermalam di rumah ini – dan harus bisa membuktikan bahwa tempat itu benar-benar aman jika ingin menempatinya secara permanen. (mr/rzl)

Waspada/Musyawir

WARGA melihat salah satu rumah yang rubuh akibat puting beliung di Desa Cot U Sibak, Lhoksukon, Rabu (26/6).

Puting Beliung ....

beliung. “Kejadiannya sangat cepat. Tidak sampai sepuluh menit. Saat itu, listrik padam. Kami sudah terjaga semua karena suara petir sangat kuat. Tak lama setelah mati lampu, tibatiba terdengar suara angin kencang dan rumah kami langsung rubuh,” kata Nursiah, 35, istri Zulfadli, di lokasi kejadian. Nursiah menambahkan, saat rumahnya rubuh, dia dan keluarga berada dalam rumah, di Dusun Cot Asan, Desa U Sibak. Namun hanya suaminya yang luka-luka di kepala akibat terkena reruntuhan rumah. Sementara dia dan dua anaknya, tidak luka-luka. Kepala Dusun Cot Asan,

Abdus Salam, di tempat sama menyebutkan, pihak desa sudah melaporkan peristiwa itu ke kantor Camat Lhoksukon. Dia berharap Pemkab Aceh Utara membantu para korban dengan memberikan biaya rehab atau membangun rumah baru. Kadis Sosial Aceh Utara, Jailani, yang dihubungi terpisah mengatakan, pihaknya akan membangun tenda darurat di lokasi kejadian, sebagai tempat penginapan sementara. “Kita juga akan menyalurkan bantuan masa panik, berupa makanan dan kain sarung. Sedangkan menyangkut rumah bantuan, nanti kita koordinasi dulu dengan bupati,” kata Jailani. (b19)

Presiden: Indonesia ....

memperjuangkan wilayah itu sampai kapan pun. Tidak ada kompromi tentang kedaulatan dan keutuhan wilayah kita,” tegas SBY. Demikian pula halnya terkait dengan perlindungan kepada Tenaga Kerja Indonesia (TKI), Presiden SBY menegaskan, ia akan terus berjuang dan berdiplomasi agar TKI di Malaysia dilindungi dan diberikan hak-hak, dan tidak ada kekerasan terhadap WNI di Malaysia. Presiden SBY menegaskan, ia ingin agar hubungan antar-negara terjaga dengan baik, apalagi antar-tetangga dan dalam kelompok ASEAN harus terjaga dengan baik, dengan semangat persaudaraan, dan saling hormatmenghormati. Presiden menyesalkan pemberitaan media internasional, terutama di Singapura, yang dinilainya banyak terasa berlebihan sehingga imej Indonesia sangat buruk di mata masyarakat dunia. Ia lantas menunjuk contoh, seolah-olah sejak 1997, Indonesia dianggap terus mencemari udara Singa-

pura. “Saya yakin Indonesia dan Singapura dapat benefit dalam kerjasama ekonomi dan bisnis. Tentu menyakitkan kalau Indonesia dianggap hanya menimbulkan masalah bagi tetangga-tetangganya,” sindir SBY. Presiden menyayangkan pemberitaan seperti itu justru pada saat kita sangat serius menanggulangi masalah bencana asap ini. “Tahun 2013 ini sangat berbeda. Suhu panas, angin panas, disamping faktor manusia. Ada beberapa tahun yang hampir tidak ada,” ungkap SBY. Terkait dengan Singapura ini, Presiden SBY mengemukakan, bahwa Indonesia akan terus berjuang untuk menyelesaikan perjanjian ekstradisi. “Banyak aset kita dilarikan ke Singapura waktu krisis. Kita akan terus berjuang, mendapatkan hak-hak asasi rakyat Indonesia,” kata Presiden. Ia menegaskan, Indonesia ingin bekerjasama yang jujur dengan Singapura, termasuk dalam mengindari terjadinya illegal trading.

Hujan Di Sumut ....

api yang terpantau satelit NOA di kawasan Sumut sebanyak 50 titik api, di kawasan Sumatera 436 titik api. Mega Sirait, kepala Seksi Bidang Data dan Informasi BMKG Wilayah I stasiun Meteorologi Bandara Polonia, membenarkan hal itu ‘’Adanya hujan yang turun di beberapa wilayah di Sumut memungkinkan berkurangnya titik-titik panas yang terdapat di daerah ini. Hujan yang terjadi cukup merata di wilayah Sumut bagian utara,’’ katanya. Sedangkan, kabut yang menyelimuti wilayah Medan Rabu pagi, akibat cakupan awan yang cukup tebal dan terjadinya hujan di wilayah kita.’’ Bukan kabut karena asap,’’ katanya. Namun, imbuhnya, tidak menutup kemungkinan untuk ke depannya terdapat kabut a s a p d i Me d a n . D a n , i n i tergantung adanya aktivitas pembakaran lahan atau hutan di sekitar Medan. Sirait mengatakan, asap yang bersumber dari Riau belum sampai ke Medan hingga saat ini karena pergerakan

angin di wilayah Sumut maupun Riau umumnya bertiup dari barat. Sehingga pergerakan asap dari Riau menuju arah timur sesuai pergerakan angin dari barat ke timur. Penerbangan Terganggu Sementara itu, akibat hujan yang terjadi Rabu sejak pukul 06:00 hingga pukul 10:00, sejumlah penerbangan terganggu berangkat pada rute Medan tujuan Singapura dan Kuala Lumpur. Misalnya penerbangan Silk Air MI-233 dan Mandala Tiger RI-862, terlambat bertolak ke Singapura masingmasing antara 50 menit hingga 1 jam. Mandala Tiger yang biasanya take off dari Bandara Polonia Medan pukul 08:00 menjadi pukul 09:00, dan Silk Air dari pukul 08:20 menjadi pukul 09:10. Sedangkan penerbangan MAS MH-861 juga mengalami keterlambatan berangkat ke Kuala Lumpur lebih kurang 30 menit dari jadwal pukul 09:20. Namun, pesawat rute dalam negeri tidak mengalami gangguan. (m32)

akibat tertimpa reruntuhan rumah. Dia terpaksa menjalani perawatan medis di Puskesmas Lhoksukon. Informasi dihimpun Waspada, keempat rumah yang rata dengan tanah, masingmasing milik Zulfadli, Azmi, 45, Zulkifli, 40, dan milik Abdul Muthaleb, 50. Keempat rumah tersebut terbuat dari kayu dan para korban kini menumpang tinggal di rumah saudara di desa yang sama. Sedangkan empat rumah yang rusak ringan dan berat, masing-masing milik Aminah, 51, Halimah, 40, Zubir, 35, dan Syahbuddin, 40. Rumah korban rata-rata kehilangan atap karena diterbangkan putting lakukan saat ini. Kita semua ingin menjalin kerjasama dan kemitraan yang sebaik-baiknya,” ujar Presiden. Tidak berlebihan Mengenai permintaan maafnya pada Singapura dan Malaysia, Presiden SBY menjelaskan kepekatan asap yang berasal dari kebakaran hutan tidak saja mengganggu warga di Riau, tetapi juga mengganggu kesehatan warga kedua negara itu, bahkan di Singapura penerbangan sampai ditutup. Atas alasan inilah, menurut Presiden, tidak berlebihan jika Indonesia meminta maaf. Menurut Presiden SBY, hubungan Indonesia dengan Malaysia maupun Singapura secara umum sejauh ini baik dan harus dijaga. Namun kalau dibawa ke isu-isu lain yang menyangkut kedaulatan negara, integritas wilayah, dll), jelas Presiden, tidak ada kompromi. “Hubungan kita dengan Malaysia, secara umum baik dan harus dijaga. Tapi kalau dikaitkan dengan Ambalat, kita akan terus 18 titik di antaranya terdapat di Sumut. Sehari sebelumnya, titik ton Lombu dan dua anaknya yang menumpang mobil. Sebelumnya, mobil yang dikemudikan Ariston Lombu sempat menabrak dua orang pengendara sepeda motor di Jl. Karet. Ariston Lombu diduga berusaha kabur, sehingga memacu kendaraannya dengan kecepatan tinggi. Namun, mengalami kecelakaan di Simpang Meriam. Petugas Laka Lantas Polres Nias yang turun ke tempat kejadian perkara segera mengevakuasi para korban ke rumah sakit. Sedangkan mobil dinas dan lima kereta diamankan ke Mapolres Nias untuk pengusutan. Menurut sumber, mobil dinas Kepala BPBD Kota Gunungsitoli tersebut salah satu dari 39 unit mobil dinas di Pemko Gunungsitoli yang hingga saat ini belum memiliki surat-surat kendaraan resmi dan dalam proses audit BPKP, karena pengadaannya terindikasi korupsi. (a25)


Berita Utama

A2 Hujan Di Sumut Kurangi Titik Api MEDAN (Waspada): Titik api kebakaran lahan di beberapa daerah di Sumatera Utara, berkurang akibat curah hujan Rabu (26/6). Selain di Riau, sudah terdeteksi adanya titik api di beberapa wilayah di Sumut, seperti Labuhanbatu, Paluta (Padang Lawas Utara), Tapsel dan Madina. Dari 174 titik api yang terdeteksi di Sumatera (data 25 Juni 2013), 18 titik di antaranya terdapat di Sumut. Sehari sebelumnya, titik api yang terpantau satelit NOA di kawasan Sumut sebanyak 50 titik api, di kawasan Sumatera 436 titik api. Mega Sirait, kepala Seksi Bidang Data dan Informasi BMKG Wilayah I stasiun Meteorologi Bandara Polonia, membenarkan hal itu ‘’ Adanya hujan yang turun di beberapa wilayah di Sumut memungkinkan berkurangnya titik-titik panas yang terdapat di daerah ini. Hujan yang terjadi cukup merata di wilayah Sumut bagian utara,’’ katanya. Ganggu Penerbangan Sementara itu, akibat hujan yang terjadi Rabu sejak pukul 06:00 hingga pukul 10:00, sejumlah penerbangan terganggu berangkat pada rute Medan tujuan Singapura dan Kuala Lumpur. Misalnya penerbangan Silk Air MI-233 dan Mandala Tiger RI-862, terlambat bertolak ke Singapura masing-masing antara 50 menit hingga 1 jam. Mandala Tiger yang biasanya take off dari Bandara Polonia Medan pukul 08:00 menjadi pukul 09:00, dan Silk Air dari pukul 08:20 menjadi pukul 09:10. Sedangkan penerbangan MAS MH-861 juga mengalami keterlambatan berangkat ke Kuala Lumpur lebih kurang 30 menit dari jadwal pukul 09:20. Namun, pesawat rute dalam negeri tidak mengalami gangguan. (m32)

Pemko Medan Gelar Pasar Murah Di 151 Titik MEDAN (Waspada): Guna mengendalikan harga kebutuhan pokok pasca kenaikan harga BBM dan menjelang bulan suci Ramadhan, Pemko Medan menyiapkan anggaran Rp4 miliar lebih untuk menggelar pasar murah di 151 titik lokasi. Demikian dikatakan Plt Wali Kota Medan Dzulmi Eldin kepada Waspada,Rabu (26/6). “Pasar murah ini rencananya kita buka pada 1 Juli, bertepatan hari jadi ke-423 Kota Medan,” kata Eldin. Menurut Eldin, pasar murah itu merupakan program rutin Pemko Medan yang digelar untuk membantu masyarakat dalam menyambut datangnya hari besar keagamaan. “Kebetulan menjelang datangnya bulan suci Ramadhan, pemerintah menaikkan harga BBM dan berimbas dengan naiknya harga bahan kebutuhan pokok. Jadi kita berharap pasar murah dapat meringankan warga untuk membeli bahan kebutuhan pokok. Sebab, bahan kebutuhan yang dijual di pasar murah telah kita subsidi sehingga harganya jauh lebih murah dari pasaran,” ungkapnya. Eldin mengatakan, penyaluran beras miskin (Raskin) tahun ini dilakukan 15 kali, biasanya hanya 12 kali dalam setahun. (m50)

KPK: Penggeledahan ... Moneter dan Bidang Perbankan. “Penggeledahan dilakukan lebih dari 20 jam, setelah briefing selesai pukul 07:30 WIB di KPK, tim berangkat dan mulai bekerja ke BI pukul 09:00 WIB dan baru selesai hari ini, Rabu dinihari sekitar pukul 05:30 WIB,” ungkap Bambang. Pada hari Rabu, KPK juga memeriksa Direktur Eksekutif Departemen Riset Ekonomi dan Kebijakan Moneter (DKM) BI Dody Budi Waluyo untuk tersangka Budi Mulya. Dalam kasus ini, KPK sudah memeriksa mantan ketua Komite Stabilitas Sistem Keuangan (KSSK), Sri Mulyani Indrawati di Washington DC Amerika Serikat pada 30 April dan 1 Mei, Kepala Perwakilan BI di Amerika Serikat di Washington Wimboh Santoso serta mantan staf kedeputian BI Galoeh AnditaWidorini di Australia. KPK juga sudah memeriksa sejumlah pejabat BI seperti Deputi Gubernur BI Halim Alamsyah yang pernah menjabat sebagai Direktur Direktorat Penelitian dan Pengaturan Perbankan (DPNP) BI pada 2008, Kepala Kantor BI di Amerika Serikat Wimboh Santoso yang pada 2008 menjabat sebagai Kepala Biro Stabilitas Sistem Keuangan BI serta memeriksa Deputi Gubernur BI Halim Alamsyah yang sebelumnya menjabat sebagai direktur bidang Pengawasan BI.

Wagubsu Minta Awasi ... kebijakan pemerintah mengurangi subsidi BBM dikarenakan meningkatnya defisit anggaran APBN. Terkait dampak tersebut ,pemerintah memberikan konpensasi berupa BLSM bagi warga miskin di seluruh Indonesia. Di Sumatera Utara ada 746.220 kepala rumahtangga penerima BLSM. T Erry menegaskan, pemberian BLSM harus tepat sasaran. Untuk itu diinstruksikan kepada seluruh kepala daerah berikut kepala SKPD hingga camat dan kepala desa agar ikut mengawasi penyaluran tersebut. “Secara teknis memang pemerintah menyalurkan Kartu Perlindungan Sosial KPS melalui kantor pos di seluruh Indonesia, namun mengingat banyaknya warga miskin yang jauh dari kantor pos, diharapkan aparat desa turut membantu,” katanya. (m36/m28)

Patung Mesir Berputar Sendiri ... Aneh, karena siapapun tak memiliki akses ke lemari penyimpanannya. Lalu petugas museum membuat sebuah video untuk mengamati patung ini. Yang mereka lihat, patung itu berputar sendiri tanpa ada yang menyentuhnya. “Saya menyadari patung ini berputar. Ini aneh karena hanya saya yang memiliki kunci untuk ke patung terseJawaban Problem Catur, but,” kata Campbell Price, kurator Museum Manchester, TTS Dan Sudoku seperti dikutip dari News, Rabu (26/6). Dari Halaman Sport. “Saya memperbaiki letaknya, tapi dia berubah Jawaban Problem Catur: posisi lagi. Di video pun akhirnya terlihat, patung ini ber1. c8(M)+, Gd8. gerak memutar sendiri,” tambahnya. 2. BxG+, Be8. Mesir Kuno percaya bila sebuah mumi hancur, maka 3. BxB+, Rh7. patung yang menjaganya akan menjadi media bagi roh 4. Bh8+mat. (Jika mumi tersebut. Pihak museum menduga itulah yang ter1. ...., Gh7. jadi pada patung tersebut. Namun, para ahli menga2. KxG+, g7xK. takan patung tersebut ber3. Bxf7+mat). putar karena langkah kaki pengunjung museum. Benarkah?.(m11/okz)

Jawaban TTS:

TTS Topik

Olahraga

Jawaban Sudoku: 7 9 6 5 4 2 1 8 3

5 1 4 8 3 6 2 7 9

2 8 3 9 7 1 4 6 5

1 6 2 7 8 9 5 3 4

3 7 5 6 1 4 8 9 2

9 4 8 2 5 3 6 1 7

4 2 7 3 6 8 9 5 1

8 3 9 1 2 5 7 4 6

6 5 1 4 9 7 3 2 8

Ada-ada Saja ... separuh akibat longsor ke dasar jurang. Rumah yang dilengkapi perabot serba mewah serta taman indah dengan pemandangan menghadap laut ini terletak di kompleks perumahan Tor Cottage di Devon, Inggris. Namun, dua longsoran yang terjadi belum lama ini membuat rumah itu berada tepat di bibir jurang. Pemiliknya membeli rumah itu seharga £400,000 dan kini telah telah pindah, tapi sebuah perusahaan spesialis kini tengah berusaha melelang rumah itu dengan harga £25,000. “Bukan tak mungkin seorang pembeli yang lihai bisa mendapat keuntungan dari investasi ini jika alam mau berbaik hati kepada mereka,” kata juru lelang Graham Penny seperti dilansir The Mirror, Rabu (26/6). Graham berharap rumah itu tetap berdiri tegak di pinggir jurang itu hingga bulan depan saat lelang berakhir. Siapa pun yang menjadi pembelinya dilarang bermalam di rumah ini – dan harus bisa membuktikan bahwa tempat itu benar-benar aman jika ingin menempatinya secara permanen. (mr/rzl)

WASPADA Kamis 27 Juni 2013

Penderita Sakit Jiwa Mengamuk, Dua Orang Tewas Dan Tiga Kritis LHOKSUKON ( Waspada): Satu keluarga, terdiri dari ibu, anak dan cucu, serta seorang tetangga dibantai dengan sebilah pedang di Desa Arongan, Kec. Lhoksukon, Aceh Utara, Rabu (26/6) pagi. Dua orang tewas di tempat dan tiga lainnya kritis. Sementara pelaku yang juga keluarga korban, diduga sakit jiwa diamankan di Mapolres Aceh Utara di Lhoksukon. Korban meninggal, Juarah, 40, ibu rumah tangga dan anaknya Maizar, 22. Mereka menderita luka bacok di kepala dan leher. Korban kritis, Maimunah, 60, ibu kandung Juarah, Zalzahbari alias Dek Gam, 20, putra kandung Juarah dan Nurjannah, 60, tetangga Maimunah. Setelah kejadian, kelima korban dibawa ke Puskesmas Lhoksukon. Korban kritis, dirujuk ke RSU Cut Meutia Aceh Utara di Buket Rata, Lhokseumawe. Informasi dihimpun Waspada, tersangka pelaku Mun alias Nyak Di, 28, anak kandung Maimunah. “Dia memang sakit jiwa. Dia baru pulang dari rumah sakit jiwa di Banda Aceh, Selasa (25/6) malam. Tiba-tiba, tadi pagi, sekitar pukul 10:00, ia mengamuk dan mengejar kami dengan pedang,” kata M Ali, 25, keluarga korban, di Puskesmas Lhoksukon. Ali menambahkan, amukan pelaku baru mereda setelah salah seorang warga memukulnya dari jarak jauh dengan balok kayu panjang. Setelah itu, pelaku lemas, lalu di-

ikat oleh warga dan diserahkan ke polisi. Informasi lain dihimpun Waspada, tersangka mengamuk gara-gara mi instan yang lambat dimasak ibunya Maimunah. Sepulang dari Banda Aceh, Rabu (25/6) malam, dia terlihat mondar-mandir di Desa Arongan, sembari menyandang pedang, seperti pendekar. Malam itu dia tidur di meunasah atau surau desa. Paginya, sekitar pukul 09:30, tersangka pulang ke rumah sambil membawa sebungkus mi siap saji. Dia meminta ibunya memasak mi tersebut. Namun, karena banyak kesibukan, mie itu baru dimasak oleh Maimunah, sekitar pukul 10:00. Hal ini membuat tersangka marah. Dia tiba-tiba menghunus pedangnya dan langsung membacok bagian belakang leher ibunya, yang ketika itu sedang memasak mi untuknya. Korban tersungkur. Tapi, kemudian keluar rumah sambil berteriak minta tolong. Mendengar teriakan korban, kakak kandung tersangka Juarah, yang rumahnya terpaut sekitar 15 meter dari rumah Maimunah, datang menolong. Namun Juarah ikut dibacok hingga meninggal di tempat. Begitu pula Maizar, anak Juarah, yang menyusul ibunya beberapa saat kemudian. Setelah itu, tersangka kabur meninggalkan korban. Saat melewati lorong rumahnya, sambil lari, tersangka

membacok kepala Zalzabahri, adik Maizar. Lalu, di ujung lorong bertemu Nurjannah, tetangganya. Nurjanah menanyakan kepada tersangka, apa yang terjadi. Namun, bukannya mendapat jawaban, Nurjannah ikut dibacok hingga luka robek di kepala. Ketika itu masyarakat mulai ramai dan berusaha mengepung pelaku. Namun, masyarakat tak berani mendekat, karena pelaku mengayunayunkan pedangnya sambil mengancam warga yang berani mendekat. Beruntung, seorang warga desa setempat, Faidan, 40, memukul tersangka dengan balok kayu panjang, lalu menamparnya hingga tersungkur. Saat itulah, terrsangka dilumpuhkan dan diserahkan ke polisi dengan tangan diikat. Kapolres Aceh Utara AKBP Gatot Sujono melalui Kapolsek Lhoksukon AKP Razali, mengatakan, untuk memastikan tersangka sakit jiwa atau tidak, polisi akan meminta keterangan ahli dari Rumah Sakit Jiwa (RSJ) Banda Aceh. Menurut Kapolres, pihaknya masih menyelidiki dari mana pedang itu berasal. Yang jelas, menurut pihak keluarga, pelaku melarikan diri dari rumah sakit jiwa Banda Aceh. Kabarnya dia sudah lama lari dari rumah sakit tersebut dan selama ini berkeliaran di Banda Aceh. ‘’ Namun karena pakaiannya bersih, orang di sana tidak tahu dia sakit jiwa,” katanya. (b19)

Pengumuman PSB ...

menerima siswa baru melalui jalur SKHUN berjumlah 333 yang dibagi 4 jurusan, di antaranya jurusan akuntansi memiliki daya tampung 105 siswa dengan nilai tertinggi 97,95 dan terendah 85,60. Jurusan Administrasi perkantoran juga memiliki daya tampung 105 siswa dengan nilai tertinggi 97,95 dan terendah 85,60. Untuk jurusan pemasaran daya tampungnya 75 siswa, peringkat pertama nilainya 91,00 dan terendah 37,00. Terakhir jurusan Urusan Perjalanan Wisata (UPW) daya tampungnya 48 siswa dimana nilai tertinggi 95,35 dan terendah 76,45. Sistem penilaian di SMK berbeda, kalau di SMA nilai UN murni ditambahkan dengan 4 untuk pendaftar dari kota Medan sedangkan pendaftar dari luar Kota Medan tidak mendapatkan nilai sama sekali. Sedangkan penilaian di SMK sedikit rumit yakni untuk nilai UN bahasa Inggris dikalikan 4, nilai Matematika dikali 3, bahasa indonesia dikali 2 dan IPA dikalikan 1. Setelah dikalikan nilai seluruhnya di total dan di urutkan berdasarkan nilainya untuk menentukan siapa tertinggi.

“ Nilai saya tidak mencukupi dari standar nilai yang ditentukan,”kata Ayu calon siswa yang memilih program keahlian administrasi perkantoran. Dia mengaku ingin ikut seleksi bina lingkungan yang akan menjaring calon siswa 30 persen lagi. Suasana di SMPN 2 Medan dan SMPN 3 Medan saat pengumuman PSB untuk 70 persen lancar. Di SMPN 2 Medan, ada 173 siswa yang lolos dan nilai tertinggi 32,75 dan terendah 30,25. Demikian juga di SMPN 3 Medan, nilai tertinggi 28,65 dan terendah 25,30. “ Besok yang berminat ujian seleksi bina lingkungan tertulis untuk menjaring 30 persen, bisa langsung ujian tanpa mendaftar asalkan membawa nomor pendaftaran awal . Itu hak calon siswa,” kata Kepala Sekolah Nurhalimah Sibuea MPd. Sementara di SMPN 16 Medan, nilai tertinggi 31,65 dengan jumlah siswa 149. Bagi siswa yang ingin ikut seleksi bina lingkungan untuk 30 persen, bisa mendaftarkan diri atau ikut langsung ujian pada Jumat (28/ 6). Demikian Irmawati Kepala SMPN 16 Medan.(m37)

ta,” tegas SBY. Demikian pula halnya terkait dengan perlindungan kepada Tenaga Kerja Indonesia (TKI), Presiden SBY menegaskan, ia akan terus berjuang dan berdiplomasi agar TKI di Malaysia dilindungi dan diberikan hak-hak, dan tidak ada kekerasan terhadap WNI di Malaysia. Presiden SBY menegaskan, ia ingin agar hubungan antarnegara terjaga dengan baik, apalagi antar-tetangga dan dalam kelompok ASEAN harus terjaga dengan baik, dengan semangat persaudaraan, dan saling hormat-menghormati. Presiden menyesalkan pemberitaan media internasional, terutama di Singapura, yang dinilainya banyak terasa berlebihan sehingga imej Indonesia sangat buruk di mata masyarakat dunia. Ia lantas menunjuk contoh, seolah-olah sejak 1997, Indonesia dianggap terus mencemari udara Singapura. “Saya yakin Indonesia dan Singapura dapat benefit dalam

kerjasama ekonomi dan bisnis. Tentu menyakitkan kalau Indonesia dianggap hanya menimbulkan masalah bagi tetanggatetangganya,” sindir SBY. Presiden menyayangkan pemberitaan seperti itu justru pada saat kita sangat serius menanggulangi masalah bencana asap ini. “Tahun 2013 ini sangat berbeda. Suhu panas, angin panas, disamping faktor manusia. Ada beberapa tahun yang hampir tidak ada,” ungkap SBY. Terkait dengan Singapura ini, Presiden SBY mengemukakan bahwa Indonesia akan terus berjuang untuk menyelesaikan perjanjian ekstradisi. “Banyak aset kita dilarikan ke Singapura waktu krisis. Kita akan terus berjuang, mendapatkan hakhak asasi rakyat Indonesia,” kata Presiden. Ia menegaskan, Indonesia ingin bekerjasama yang jujur dengan Singapura, termasuk dalam mengindari terjadinya illegal trading .

ditampung untuk kuota 30 persen ini sebanyak 216 orang. Sedangkan nilai tertinggi di SMAN 3 yakni 42,30 dan terendah 38,60. Wakil Kepala Sekolah SMA 3 Emir menyebutkan tahun ajaran kali ini sekolahnya memiliki daya tampung berjumlah 418, namun ada siswa yang tinggal kelas sebanyak 19 siswa jadi kursi yang tersedia untuk siswa baru tahun ini berjumlah 399 siswa. “ Yang diterima melalui jalur SKHUN berjumlah 279 atau 70 persen dari sisa kursi untuk siswa baru, untuk jalur bina lingkungan (tes tertulis) sebanyak 120 atau 30 persen dari kursi yang tersisa,” kata Emir. Sebelumnya, Kepala sekolah SMAN 5, Drs Haris Simamora menyatakan, peringkat pertama yang lulus di sekolah yang dipimpinnya yakni 41,65 sedangkan yang paling rendah 36,20. “ Bagi yang tidak lulus melalui jalur SKHUN masih memiliki kesempatan untuk mengikuti seleksi tertulis atau bina lingkungan,” jelasnya. Sementara itu, di SMKN 1

Indonesia Tidak Takut ... Malaysia, Presiden SBY menjelaskan kepekatan asap yang berasal dari kebakaran hutan tidak saja mengganggu warga di Riau, tetapi juga mengganggu kesehatan warga kedua negara itu, bahkan di Singapura penerbangan sampai ditutup. Atas alasan inilah, menurut Presiden, tidak berlebihan jika Indonesia meminta maaf. Menurut Presiden SBY, hubungan Indonesia dengan Malaysia maupun Singapura secara umum sejauh ini baik dan harus dijaga. Namun kalau dibawa ke isu-isu lain yang menyangkut kedaulatan negara, integritas wilayah, dll, jelas Presiden, tidak ada kompromi. “Hubungan kita dengan Malaysia, secara umum baik dan harus dijaga. Tapi kalau dikaitkan dengan Ambalat, kita akan terus memperjuangkan wilayah itu sampai kapan pun. Tidak ada kompromi tentang kedaulatan dan keutuhan wilayah ki-

Al Bayan ... Memasuki akhir malam, Salman bangun, berkata kepada Abu Darda’, “Bangunlah sekarang.” Mereka pun shalat tahajud berdua. Selesai shalat, Salman berkata, “Sesungguhnya Tuhanmu mempunyai hak atasmu yang harus engkau tunaikan. Dirimu punya hak atasmu yang harus engkau penuhi, dan keluargamu punya hak atasmu yang harus engkau tunaikan. Tunaikanlah hak masing-masing kepada setiap pemiliknya secara seimbang.” Merasa kurang yakin dengan masukan saudaranya, keesokan hari Abu Darda’ mendatangi Rasulullah SAW menuturkan yang terjadi. Berkatalah Rasulullah SAW, “Abu Darda’, Salman memang benar.” Kisah ini dari hadis diriwayatkan Imam Bukhari. Berdasarkan hadis tersebut, nyatalah Islam menghendaki keseimbangan urusan keduniaan dan keakhiratan, masalah ibadah dan kemasyarakatan. Tirulah perilaku Rasulullah SAW dalam kesehariannya. Sang Muhammad SAW meneladankan kepada kita keseimbangan dalam kehidupan antara dunia dan akhirat. Rujuk jugalah Firman Allah SWT surah AlQashash ayat ke-77 berikut ini, “Dan carilah pada apa yang telah dianugerahkan Allah kepadamu (kebahagiaan) negeri akhirat, dan janganlah kamu melupakan bagianmu dari (kenikmatan) duniawi dan berbuat baiklah (kepada orang lain) sebagaimana Allah telah berbuat baik kepadamu, dan janganlah kamu berbuat kerusakan di (muka) bumi. Sesungguhnya Allah tidak menyukai orang-orang yang berbuat kerusakan.”

Dalam tafsirnya, Ibnu Katsir memberikan penjelasan: “Pergunakanlah karunia yang telah Allah berikan kepadamu berupa harta dan kenikmatan yang berlimpah ini, untuk menaati Rabb-mu dan mendekatkan diri kepada-Nya dengan berbagai bentuk ketaatan. Dengan itu, kamu memeroleh balasan di dunia dan pahala di akhirat. Firman Allah “Janganlah kamu melupakan bagianmu dari kenikmatan duniawi”, yaitu dari apa-apa yang dibolehkan Allah berupa makanan, minuman, pakaian, tempat tinggal dan pernikahan. Sesungguhnya Allah mempunyai hak atas dirimu. Jiwa ragamu juga mempunyai hak atas dirimu. Keluargamu juga mempunyai hak atas dirimu. Tamumu juga mempunyai hak atas dirimu. Maka berikanlah tiap-tiap hak kepada pemilikinya.” Sang Rasul SAW kerap mengingatkan umatnya mengedepankan keseimbangan dan tidak berlebihan. Hadis yang diriwayatkan Imam Bukhari, “Sederhanalah dalam beramal, mendekatlah pada kesempurnaan, pergunakanlah waktu pagi dan sore serta sedikit dari waktu malam. Bersahajalah, niscaya kalian akan sampai tujuan.” Hadis lain yang diriwayatkan Imam Muslim, “Binasalah orangorang yang berlebih-lebihan.” Nyatalah berdasarkan Islam merupakan agama yang mengedepankan keseimbangan baik dalam ucapan maupun perbuatan. Islam tidak menghendaki pemeluknya terlalu asyik beribadah individual dengan menafikan ibadah sosial. Islam tidak menginginkan umatnya hidup individualistik dengan hanya mengejar urusan akhirat saja atau hanya mengejar kehidupan dunia saja. Islam adalah agama yang seimbang.

Waspada/Musyawir

PETUGAS Puskesmas Lhoksukon mengevakuasi korban pembantaian pria yang diduga sakit jiwa ke dalam ambulans untuk dirujuk ke Rumah Sakit Cut Meutia, Rabu (26/6).

Rumah Anggota DPRD Sergai Dilempar Bom Molotov PERBAUNGAN (Waspada): Rumah anggota DPRD Kab. Serdang Bedagai, H.Syahlan Siregar ST yang berlokasi di Jl.Teratai, No.9A, Lingk.Juani, Kel.Simpang Tiga Pekan, Kec. Perbaungan, dilempar bom molotov oleh orang tak dikenal (OTK), Rabu (26/6), dini hari. Tidak ada korban jiwa dalam peristiwa itu karena dua bom molotov yang dilempar OTK tidak mengenai sasaran. Korban yang juga ketua Fraksi PAN DPRD Sergai ketika ditemui Waspada di gedung DPRD Sergai di Jl.Negara, Desa Firdaus, Kec.Sei Rampah menuturkan malam itu dia bersa-

Mobil BPBD ... Sepuluh orang lainnya yang luka-luka yakni Amir Syarif Tanjung, Ama Putri,Yusman Polem, Kamidin Sikumbang, Irwandi Selayang,sopirAristonLombu,istri Ariston Lombu dan dua anaknya yang menumpang mobil. Sebelumnya, mobil yang dikemudikan Ariston Lombu sempat menabrak dua orang pengendara sepeda motor di Jl. Karet. Ariston Lombu diduga berusaha kabur, sehingga memacu kendaraannya dengan kecepatan tinggi. Namun, mengalami kecelakaan di Simpang Meriam. Petugas Laka Lantas Polres Nias yang turun ke tempat kejadian perkara segera mengevakuasi para korban ke rumah sakit. Sedangkan mobil dinas dan lima kereta diamankan ke Mapolres Nias untuk pengusutan. (a25)

Ronaldo: Saya Suka ... Dalam sambutannya Ronaldo menyampaikan terima kasih kepada Presiden SBY dan Ibu Negara Hj. Ani Yudhoyono yang telah memberinya kesempatan hadir di Bali untuk menjadi Duta Forum Peduli Mangrove Indonesia. “Ini merupakan suatu kehormatan untuk datang kembali ke Indonesia. Saya suka sekali datang ke Indonesia dan peran saya di Bali pada hari ini dapat memberikan dorongan kepada inisiatif menyelamatkan hutan bakau,” kata pemain sepakbola termahal di dunia itu. Sementara Presiden Susilo Bambang Yudhoyono mengajak semua pihak yang menginginkan tanah air ini tetap indah, sehat dan lingkungannya baik untuk merawat hutan kita, termasuk hutan bakau atau mangrove kita. “Tanah air kita luas. Hutan kita luas. Sekitar 130 juta hektare. Hutan bakau sekitar 3,7 juta hektare. Mari kita jaga, mari kita rawat, mari kita tanam kemudian pelihara supaya subur dan kembali lingkungan Indonesia baik,” ajak Presiden SBY. Kepala Negara memuji semangat masyarakat Bali dalam memelihara dan menghijaukan lingkungan. “Luar biasa Bali. Saya bangga. Saya ingin seluruh Indonesia semangatnya sama merawat dan menjaga dan hutan kita membikin lingkungan kita baik, sehat dan indah,” tutur Kepala Negara. Ia mengajak semua pihak memberikan contoh dan menjadikan contoh untuk menjaga kelestarian lingkungan kita. “Hari ini dan mengajak semuanya untuk menanam mangrove bersama-sama kita Christiano Ronaldo dan lainnya,” kata Presiden SBY.

ma putranya M.Sando,17, tertidur sekira pukul 01:30, di ruang tamu. “Sekitar pukul 04:00, kami terbangun karena alarm mobil yang diparkir di teras tiba-tiba berbunyi.Anak saya mendengar suara lemparan serta suara sepeda motor melintas dan berhenti di depan rumah. Ia pun membangunkan saya,” ujar H.Syahlan, yang juga Bendahara DPD PAN Sergai. Setelah itu Syahlan berusaha mematikan alarm mobil dari dalam rumah dan melarang putranya keluar. “Paginya sekira pukul 07:00, saat istri saya menyapu halaman, ia melihat serpihan botol kaca salah satu minuman suplemen.Setelah diperiksa, ia menemukan satu botol berisi minyak tanah dengan sumbu sobekan handuk bekas dibakar. Setelah saya diteliti ternyata salah satunya mengenai tiang teras dan pecah mengakibatkan alarm mobil berbunyi,” papar Syahlan. Kasus itu, menurut Syahlan, sudah dilaporkan ke Kepling, diteruskan ke Bhabinkantibmas Kel. Simpang Tiga Pekan, Aiptu. Piter Barasa.

Tujuh personel Polsek Perbaungan dipimpin Kanit Reskrim, Ipda.Ilham S.Sos mendatangi rumah korban dan melakukan olah tempat kejadian perkara, selanjutnya mengamankan barang bukti bom molotov. Menurut Syahlan, hingga saat ini belum mengetahui motif pelemparan itu. Selama terjun ke dunia politik maupun dagang, ia dan keluarganya merasa tidak punya musuh atau pun masalah, terlebih dengan masyarakat sekitar. Kapolsek Perbaungan, AKP.Maruluddin didampingi Kanit Reskrim, Iptu Ilham ketika dikonfirmasi Waspada, membenarkan peristiwa tersebut. Pihaknya telah melakukan olah TKP serta menyita barang bukti dua bom molotov yang belum terbakar.’’ Tetapi korban belum resmi melapor, ‘’terangnya. Catatan Waspada, kasus pelemparan bom molotov di rumah anggota DPRD di Deliserdang, sudah dua kali terjadi. Beberapa tahun lalu, OTK melemparkan bom molotov ke rumah anggota DPRD Sergai MY Basrun. Namun, tidak ada korban jiwa. (c03)

PM Julia Gillard ... Pejabat partai Chris Hayes mengatakan Gillard kalah 57 suara lawan 45. Rudd tampaknya akan menunjukkan bahwa dia dapat mengomandokan mayoritas anggota parlemen dari partai tersebut di depan Gubernur Jenderal Quentin Bryce untuk menjamin dia dapat jadi PM Kamis. Jika dia tidak dapat, pemimpin oposisi Tony Abbott dapat diminta untuk membentuk satu pemerintahan atau pemilihan dapat dipercepat dari September ke Agustus. Buruh menguasai 71 kursi di Dewan Perwakilan Rakyat yang beranggota 150 kursi, koalisi Abbott menguasai 72 kursi dan sisanya 7 kursi diduduki oleh para independen atau Partai Hijau. Australia harus berbesar hati kembali menyambut Kevin Rudd untuk menjadi perdana menteri baru mereka. Pasalnya, Rudd berhasil menggulingkan Gillard dalam pemungutan suara di rapat kaukus Partai Buruh. Menurut BBC, rapat kaukus Partai Buruh hari ini menghasilkan 57 suara dukungan untuk Rudd, sementara Gillard mendapatkan 45 suara. Dengan ini Rudd kembali memimpin Partai Buruh, sekaligus menggantikan Gillard memimpin Australia sebagai perdana menteri. Kemenangan Rudd kali ini sekaligus menjadi ajang balas dendam setelah dia digulingkan Gillard pada tahun 2010 lalu. Saat itu, Gillard yang menjabat sebagai Wakil PM menantang Rudd untuk melakukan pemilihan di tubuh partai untuk menentukan pemimpin berikutnya. Gillard sendiri yang mengajukan digelarnya voting dan kali ini Rudd mengiyakan. (bbc/m10)

Lumpuh Dan Miskin, Tak ... lalu menderita lumpuh dan sehari-harinya dihabiskan duduk di atas kursi roda yang dibeli dari swadaya masyarakat. Untuk menyambung hidup, Adeng mengharapkan uluran tangan dan belas kasihan dari teman-temannya. “Terkadang sampai dua hari saya tidak makan, itu kalau tidak ada teman-teman yang datang memberi makan,” ujar Adeng. Adeng saat ini tinggal di sebuah gubuk berukuran 2 x 3 meter berdinding tepas sumbangan dari masyarakat. Bangunan itu ternyata belum sepenuhnya selesai karena ketiadaan biaya. Atap sengnya masih kurang beberapa lembar lagi dan jika hujan, kediamannya itu akan basah. Di dalam ‘gubuknya ‘ itu semua fasilitas yang seharusnya terpisah ternyata digabung menjadi satu seperti tempat tidur, lemari, kamar mandi, dapur, dan toilet. Tidak ada sekat ataupun pemisah.Semuanya berpadu. Kepada Waspada, Adeng yang mengaku tak mau jadi pengemis ini tidak terlalu muluk-muluk dalam berharap. Dia hanya memohon agar diberikan pinjaman modal untuk membuka usaha berjualan kecil-kecilan. Sebab, sejak dahulu dia lebih suka berniaga. “ Tak satupun bantuan pemerintah dirasakan. Cuma beras madani dari Wali Kota sajalah, itu pun baru beberapa kali. Kalau bisa pula memohon, sudilah saya diberi modal demi menyambung hidup saya,” kata Adeng. Lurah Tanjungbalai Kota IV, Nurmiah SE yang dikonfirmasi Waspada mengatakan, ada ratusan warganya tidak memperoleh kompensasi BBM. Padahal, rata-rata mereka masuk dalam golongan miskin dan sangat merasakan dampak dari kenaikan harga BBM tersebut. “Memang Pak Adeng tidak memperoleh BLSM, tapi kan data bukan dari kami, itu dari statistik, merekalah yang mengajukan data ke pusat. Kalau kami yang buat data, pasti Pak Adeng masuk dalam daftar,” tutur Nurmiah. (a32)


Medan Metropolitan A3 Pecandu Narkoba Akan Lakukan Kejahatan WASPADA Kamis 27 Juni 2013

Peringati HANI 2013, Polisi Bagikan Bunga MEDAN (Waspada): Setiap pecandu narkoba, memiliki kecenderungan melakukan tindak kejahatan seperti pencurian, perampokan dan penjambretan. Lalu hasil kejahatan ini dijual dan uangnya digunakan untuk menyokong kecanduannya pada sabu-sabu.

Iskandar Silaturahmi Dengan Masyarakat Asal Langsa MEDAN (Waspada): Calon Legislatif (Caleg) DPR RI dari Partai Nasional Demokrat (Nasdem) Iskandar, ST menyempatkan diri bersilaturahmi dengan sejumlah masyarakat asal Langsa yang ada di Sumut dalam suatu acara di Jln. Medan-Binjai km 12, barubaru ini. Iskandar ST mengatakan, kehadirannya pada acara tersebut untuk bersilaturahmi dengan masyarakat Desa Purwodadi khususnya para sesepuh dan orangtua dari Kota Langsa yang juga hadir di acara ini. “Ternyata para tamu yang hadir disini semuanya merupakan sahabat kedua orangtua saya. Apalagi saya merupakan putra dari Kota Langsa. Saya ucapkan terimakasih karena diberi kesempatan untuk hadir ditengah-tengah Perkumpulan Masyarakat Langsa,” ujarnya. Iskandar yang maju menjadi caleg untuk DPR RI mengharapkan doa dan dukungan dari masyarakat Desa Purwodadi dan Perkumpulan Masyarakat Langsa. “Untuk Dapil yang sama dengan saya, ada empat orang etnis Tionghoa. Tapi, saya satu-satunya etnis Tionghoa berasal dari Kota Langsa. Saya bergabung di Partai Nasdem yang dipimpin Bapak Surya Paloh untuk membawa gerakan perubahan dengan tujuan mengembalikan rasa kebangsaan, nasionalisme tanpa membeda-bedakan suku, agama dan warna kulit. Diharapkan kita bisa bersatu untuk bersama-sama membangun bangsa Indonesia ke arah yang lebih baik lagi,”ujarnya.(m25/rel)

Awalnya, mereka mencuri uang dan barang berharga milik orangtua atau saudaranya. Jika tidak ada lagi uang atau barang berharga milik orangtuanya, maka pecandu narkoba ini akan mencuri atau merampok barang berharga milik orang lain,” Demikian dikatakan Kasat Reserse Narkoba Polresta Medan Kompol Dony Alexander kepada Waspada,disela-sela kampanye Hari Anti Narkotika Internasional (HANI) di persimpangan Jln. S. Parman – Jln. Gajah Mada – Jln. Zainul Arifin, Rabu (26/6). Dari beberapa kasus yang ditangani polisi, lanjut Dony, sejumlah pecandu narkoba berpotensi melakukan tindak kejahatan lebih berat dan menempatkan mereka ke dalam kondisi yang sangat berbahaya. Karena itu, Polresta Medan melalui Sat Reserse Narkoba terus berupaya melakukan tindakan edukatif kepada para remaja dengan memberikan informasi tentang bahaya penyalahgunaan narkoba. “Dengan memanfaatkan momentum Hari Anti Narkotika Internasional (HANI) yang jatuh pada 26 Juni, Sat Reserse Narkoba Polresta Medan mengajak semua pihak untuk bekerjasama dan sama-sama bekerja untuk menanggulangi bahaya penyalahgunaan narkoba di Kota

Medan,” ujar Dony. Sosialisasi dan kampanye tentang bahaya penyalahgunaan narkoba ini dilakukan dengan cara membagi-bagikan bunga dan brosur kepada pengguna jalan yang melintas di persimpangan Jln. S. Parman – Jln. Gajah Mada – Jln. Zainul Arifin. “Para remaja harus menyadari tentang bahaya penyalahgunaan narkoba. Sebab, penyalahgunaan narkoba bisa merusak masa depan generasi bangsa Indonesia,” ujar Kompol Dony didampingi Kasat Intelkam Kompol Faisal Napitupulu, Kasat Lantas Kompol M. Budi Hendrawan. Dony mencontohkan tentang dampak penggunaan narkoba jenis sabu. Si pengguna sabu akan terlihat tidak mau diam dan selalu banyak bicara, berkeringat secara berlebihan, nafsu makan berkurang dan badannya semakin kurus. Dony berharap dengan adanya sosialisasi tentang bahaya penyalahgunaan narkoba ini, warga Medan bisa melakukan antisipasi dengan cara tidak mendekati narkoba apalagi mencobanya. Sementara itu, seorang pengendara sepedamotor yang mendapat brosur dan bunga menyambut baik kampanye anti narkotika yang dilaksana-kan Sat Res Narkoba Polresta

Waspada/Rudi Arman

KASAT Reserse Narkoba Polresta Medan Kompol Dony Alexander saat memberikan bunga dan brosur kepada pengendara mobil ketika melakukan kampanye Hari Anti Narkotika Internasional di Jln. S. Parman Medan, Rabu (26/6) sore. Medan. “Diharapkan dengan adanya sosialiasi ini, warga Medan bisa menjauhi narkoba. Hidup sehat tanpa narkoba bisa menjadi cerminan warga Kota Medan. Selain itu, polisi diharapkan tetap melakukan pemberantasan narkoba terutama di tempat hiburan malam dan lokasi yang dianggap rawan peredaran narkoba,” jelas Dodi.(m39)

Terkait Tanah 106 Ha Di Desa Helvetia

Waspada/ist

CALEG DPR RI dari Partai Nasdem Iskandar,ST foto bersama dengan sejumlah masyarakat asal Langsa yang ada di Sumut.

RIMA Peringati Isra Dan Mikraj MEDAN (Waspada): Memperingati Isra dan Mikraj Nabi Muhammad SAW 1434 H, Remaja Islam Masjid Ar Ridho (RIMA) Helvetia Timur, menggelar berbagai perlombaan untuk kelompok anak-anak usia 6-12 tahun, Sabtu (22/6). Jenis kegiatan yang diperlombakan yakni adzan, busana muslim, hafal surat pendek dan pidato. Ketua STM Ar Ridho H. Margono mengatakan, dengan aktif bergaul di lingkungan remaja masjid, maka para generasi muda dapat terhindar dari kenakalan dan bahaya narkoba. Sementara Sekretaris Lurah Helvetia Timur memberikan apresiasi kepada RIMA yang menyelenggarakan peringatan Isra Mikraj kali ini. Acara pembukaan dihadiri tokoh masyarakat Helvetia Timur antara lain M Syafei Lubis, Amrin Nasution selaku Ketua BKM Ar Ridho, Caleg No. 9 dari PAN Dapil Sumut 7 Lukman Hakim Lubis, Caleg No. 1 dari GerindraDapil 3 Kota Medan Hidayat Tanjung. Sementara puncak peringatan Isra dan Mikraj Nabi Muhammad SAW 1434 H digelar pada Minggu (23/6), pukul 21:00 di Jln. Pembangunan No.128 Helvetia Timur Medan . Amrin Nasution mengajak pengurus dan anggota RIMA agar senantiasa melakukan kegiatan positif sehingga terhindar dari kenakalan remaja dan bahaya narkoba. Lurah Helvetia Timur Andry Febriansyah memohon dukungan masyarakat untuk memajukan daerahnya sehingga lebih baik lagi. Dia berharap peringatan Isra dan Mikraj ini mendapat berkah dari Allah SWT. Ustadz Sudirman Jailani dalam tausyiahnya mengatakan, tujuan memperingati Isra Mikraj adalah untuk menegakkan shalat lima waktu sehari semalam. Karena itu diharapkan agar pengurus dan anggota RIMA berperan aktif memakmurkan masjid.(cwan)

Waspada/Ist

KETUA STM Ar Ridho H. Margono bersama Lurah Helvetia Timur Andry Febriansyah ketika memukul bedug pada peringatan Isra dan Mikraj Nabi Muhammad SAW 1434 H di Masjid Ar Ridho, Helvetia Timur, Minggu (23/6) malam.

Kuasa Hukum Masyarakat Klarifikasi Laporan Mafia Tanah Ke KPK MEDAN (Waspada): Kuasa hukum masyarakat pemilik tanah seluas 106 ha di Pasar IV, Desa Helvetia, Kec. Labuhan Deli, Deliserdang, menyampaikan klarifikasi adanya laporan PB Al Washliyah tentang mafia tanah seluas 32 ha ke KPK. “Klarifikasi itu diterima Sutanto Arso Birowo sebagai penerima laporan pengaduan masyarakat di KPK, Senin (24/ 6),” kata Fachruddin Rifai SH, MHum, didampingi Suhardi SH, Muhammad Riau SHR, SH, kepada wartawan di Medan, Rabu (26/6). Dijelaskannya, dalam pertemuan tersebut, telah diklarifikasi bahwa berdasarkan putusan PN Lubuk Pakam yang telah berkekuatan hukum tetap ternyata PB Al Washliyah tidak mempunyai tanah di Pasar IV, Desa Helvetia, Kec. Labuhan Deli, Deliserdang.Yang ada adalah tanah perjuangan orangtua para ahli waris yang sejak dahulu telah memperjuangkan tanah tersebut, yang pada tahun 1970 an tanah itu telah dirampas PTP IX yang sekarang menjadi PTPN-II. Menurut Fachruddin, pada tahun 2004 ada dua perusahaan yang memanfaatkan PB Al Washliyah yaitu Suwan Citron dan PT Asia Citra Roba Lestari dan Sugiono selaku pihak PT Asia Citra Alam Semesta membeli tanah seluas 32 ha dari PTPNII yang merupakan bagian dari tanah 106 ha yang merupakan perjuangan dari masyarakat. Akibat pengalihan tersebut pada tahun 2006 terjadilah perkara antara masyarakat dengan PTPN-II dan PB Al Washliyah dikenal dengan putusan nomor 15/Pdt.G/2006/PN-LP jo Nomor: 173/PDT/2007/PT-Mdn jo. Nomor: 2461 K/PDT/2007 jo. Nomor: 701 PK/PDT/2009 dimana 65 orang masyarakat menyatakan sah selaku pemilik

Waspada/Ist

KUASA hukum masyarakat pemilik tanah seluas 106 ha di Pasar IV, Desa Helvetia, Fachruddin Rifai SH, MHum, Suhardi SH, Muhammad Riau SHR, SH, menyampaikan klarifikasi ke KPK diterima Sutanto Arso Birowo. atas tanah seluas 106 ha dan menyatakan Akte Penyerahan Hak Atas Tanah Dengan Ganti Rugi antara PTPN-II dengan PB Al Washliyah nomor: 29 tanggal 27 September 2004 batal demi hukum, tidak sah dan tidak mempunyai kekuatan mengikat dengan segala akibat hukumnya. Kata dia, terhadap akte antara PTPN-II dan PB Al Washliyah No. 29 tanggal 27 September 2004 tersebut terdapat indikasi di dalamnya unsur memberikan keterangan tidak benar/ palsu, sehingga perbuatan tersebut dapat diklasifikasikan sebagai tindak pidana melanggar pasal 266 ayat 1 KUHPidana. Tindakan PB Al Washliyah mempergunaan Akte Penyerahan Hak Atas Tanah Dengan Ganti Rugi No. 29 tanggal 27 September 2004 sebagai dasar mengalihkan tanah tersebut kepada Suwan Citron dari PT Asia Citra Rona Lestari dan Sugiono dari PT Asia Citra Alam Semesta dapat diklasifikasikan sebagai tindak pidana melang-

gar pasal 266 ayat 2 KUHPidana sebagaimana tertuang dalam Surat Kepala Divisi Pembinaan Hukum Mabes Polri tanggal 30 April 2009 Nomor: B/312/IV/ 2008/Divbinkum. “Setelah selesai perkara perdata, tahun 2009 PB Al Washliyah membuat laporan pidana terhadap masyarakat yang sudah dinyatakan sebagai pemilik tanah dengan tuduhan membuat dan mempergunakan surat palsu di dalam Surat Keterangan Pernyataan Ahli Waris yang akhirnya pada tahun 2011 dinyatakan masyarakat sebagai terdakwa dinyatakan bebas dan tidak terbukti bersalah membuat dan mempergunakan surat palsu tersebut,” tutur Fachruddin. Dari laporan/pengaduan tersebut di persidangan terungkap, bahwa PB Al Washliyah telah mengalihkan hak atas tanah tersebut kepada Suwan Citron dan Sugiono yang diperbuat dihadapan notaries Go Uton Utomo SH, MKn. “Namun tidak sampai disitu saja, tahun 2010 PB Al Washliyah mengajukan gugatan perlawanan yang kedua kalinya dimana tahun 2011 PN Lubuk Pakam telah memutuskan perkara tersebut dengan putusan menolak perlawanan pelawan PB Al Washliyah,” ujarnya. Kemudian, tahun 2012 PB Al Washliyah kembali mengajukan gugatan yang ke tiga kalinya dengan alas hak yang berbeda, dimana PB Al Washliyah tidak lagi mempergunakan dasar Akte Penyerahan Hak Atas Tanah Dengan Ganti Rugi Nomor: 29 tanggal 27 September 2004 melainkan seolah-olah PB Al Washliyah telah membeli tanah yang sama dari masyarakat dan perkara ini juga telah diputus PN Lubuk Pakam dengan putusan menolak gugatan PB. Al Washliyah. Fachruddin mengatakan, seharusnya dalam permasalahan hukum ini harus diselesaikan secara hukum dan jangan dipolitisir ke isu SARA dan masalah ini harus diletakkan secara profesional. “Jadi yang dipermasalahan PB Al Washliyah ini bukan aset umat Islam,” katanya. (m39)

Kapoldasu Lantik Kapolres Batubara MEDAN (Waspada): Kapoldasu Irjen Syarief Gunawan melantik AKBP Japerson Paringotan Sinaga menjadi Pejabat Sementara (Pjs) Kapolres Batubara, Rabu (26/6), di Aula Kamtibmas Polda Sumut. Kapolda mengatakan, disebabkan masih persiapan, maka Polres Batubara belum memiliki markas komando (Mako), sehingga untuk sementara menggunakan bangunan eks kantor KPUD Batubara.“Pemkab Batubara meminjam pakai sampai terealisasinya Mako Polres Ba-

tubara,” kata Kapolda. Semua personel yang dipimpin AKBP Japerson merupakan penepatan personel yang baru. Sehingga semuanya akan dimulai dari awal termasuk bidang administrasi yang diperlukan untuk mengoperasikan satuan Polres. “Di sini mereka akan berhadapan dengan minimnya sarana hukum dalam menjalankan tugas,” ujarnya. Di Batubara, menurut Kapolda, ada beberapa catatan yang perlu menjadi perhatian. Yakni konflik nelayan, konflik

lahan perkebunan, penyelundupan narkoba, judi, warung remang-remang dan tindakan masyarakat yang main hakim sendiri. “Untuk sementara, itu menjadi perhatian khusus bagi Kapolres Batubara,” ucapnya. Pjs Kapolres Batubara AKBP Japerson Paringotan Sinaga mengatakan, sebagai langkah awal akan mengatur anggota sesuai dengan tupoksinya. “Ada 340 personel kita di sana. Untuk sementara operasinya mengacu kepada Polres Asahan,” kata dia. (m27)

Mahasiswa UISU Bawa Pesan Penghijauan MEDAN (Waspada): Lima mahasiswa Fakultas Sastra Universitas Islam Sumatera Utara (FS UISU) Kampus Al-Munawwarah yang baru kembali dari kunjungannya ke Chengdu University, China, membawa pesan untuk Pemko Medan. Pesan itu agar Pemko terus melakukan penghijauan. “Setelah berinteraksi dengan masyarakat, mengenal budaya dan kehidupan dan melihat kebersihan Kota China, kami berharap Kota Medan juga bisa menegakkan budaya bersih,” kata Fitriani dan Evo Larasati, dua dari lima mahasiswa program pertukaran mahasiswa di Chengdu University China, kepada wartawan, di kampus Al Munawwarah Jln. SM Raja Medan, Rabu (26/6). Selain Evo dan Fitri, tiga rekan mereka yakni Ramadani Irawan, Putra Purnama, dan M Gusnaldi Putra mewakili Sumatera Utara mempelajari kebudayaan dan Bahasa Mandarin di Chengdu University, China, sejak 21 Mei hingga 20 Juni 2013. Selama empat minggu di Chengdu, mereka belajar budaya, kehidupan lingkungan Chengdu, sekaligus untuk memantapkan bahasa Mandarin yang merupakan salah satu mata kuliah di FS UISU. Lima utusan Sumut yang memperkuat program Sister City (Kota Kembar) Medan-Chengdu ini mengimbau Pemko Medan

untuk terus menggalakkan program penghijauan. Menurut mereka, selain penghijauan, membiasakan membuang sampah pada tempatnya juga perlu dibudayakan kepada masyarakat Kota Medan. Sehubungan itu, Pemko Medan harus menyediakan tempat sampah dan memisahkannya sebagai tempat sampah organik dan non-organik. “Di sana kami melihat kotanya tertatabaikdanbersih.Pengemispun tidak terlihat di sana,” ujar Evo. Kedatangan lima mahasiswa UISU ini disambut Rektor UISU Prof Ir H Zulkarnain Lubis MS, PhD, Pembantu Rektor (PR) I UISU Dr Srie Faizah Lisnasari MSi, PR II Hj Habsah Lubis SH, MH, Dekan Fakultas Sastra Prof Dr Effendi Barus MA, dan Kepala Biro Humas dan Kerjasama H Onan Siregar MSi. Rektor UISU Prof Zulkarnain Lubis menyatakan bersyukur atas kembalinya lima mahasiswa UISU tersebut ke Indonesia. Dia menyampaikan terimakasih dan penghargaan kepada pemerintah China khususnya Pemerintah Kota Chengdu melalui Konjen RRC di Medan, yang mendukung terlaksananya program kerjasama UISU dengan Chengdu University. “Terima kasih kami ucapkan karena mahasiswa kami diterima dengan baik oleh masyarakat Chengdu. Kami pun berharap kerjasama UISU de-

ngan Chengdu University akan berkelanjutan, karena UISU berencanamembukaprogramstudi Bahasa Mandarin,” sebutnya. Kata Rektor, pengiriman mahasiswa UISU ke Kota Chengdu dalam rangka realisasi MoU UISU-Chengdu University dalam bingkai Sister City (Kota Kembar)Medan-Chengdu.UISU terlibatdalamprogramKotaKembarkhususnyadalambidangpendidikan kesehatan, budaya dan sastra.“Melalui kerjasama antara UISU-Chengdu ini menumbuhkan citra UISU yang lebih baik lagi di mata masyarakat,” tuturnya. Rektor meminta peserta program pertukaran mahasiswa ke Chengdu University itu agar membuat laporan berupa tulisan berisi pengalaman mereka selama berada disana. Laporan tertulistersebut,nantinyadiserahkan kepada Pemko Medan, Konjen RRC di Medan, dan dibagikan kepada teman-teman mereka di FS UISU sebagai motivasi. Selain itu rektor juga meminta mereka memuat tulisan itu di media. Permintaan rektor senada dengan Wakil Konjen RRC di Medan Zhang Kaibin saat menerima audiensi UISU menjelang keberangkatan sebulan lalu. Dia juga mengharapkan agar mahasiswa sepulang dari Chengdu membuat tulisan tentang kisah-kisah mereka saat berinteraksi dengan masyarakat Chengdu untuk selanjutnya dipublikasikan lewat media. (m49)


Medan Metropolitan

A4 Tersangka Penyelundupan 1.415 Botol Miras Bertambah

BELAWAN (Waspada): Setelah menahan tersangka PS alias Golap, bakal calon legislatif (Bacaleg) DPRD Kota Medan daerah pemilihan (Dapil) V, Bea Cukai (BC) mengincar dua tersangka lain yang diduga terlibat dalam penyelundupan 1.415 botol miras yang ditangkap dari KIM III, baru-baru ini. Kepastian mengenai nama kedua tersangka baru itu, belum dijelaskan BC dengan alasan agar tersangka tidak melarikan diri. Namun, walau telah dua kali dipanggil tersangka belum hadir ke ruangan penyidik DJBC Kanwil I Sumut di Belawan. “Sepengetahuan saya peyidik telah dua kali mengirimkan surat panggilan untuk kedua tersangka. Namun sampai sekarang belum hadir,” kata Kasi Penindakan Kanwil I BC Sumut Ogi Feriadla tanpa bersedia menyebutkan nama kedua tersangka dimaksud, Selasa (25/6). Menurut dia, penambahan kedua tersangka itu berdasarkan keterangan PS alias Golap, dan jika hingga batas waktu ditentukan kedua tersangka tidak menghadiri panggilan maka akan dilakukan upaya panggilan paksa. Terpisah, Kasi Intel Kejaksaan Negeri (Kejari) Belawan Novan SH mengatakan, pihaknya telah menerima sutar pertanda dimulainya penyelidikan (SPDP) kasus penyeludukan 1.415 botol miras asal luar negeri itu. Disinggung tentang adanya penambahan tersangka, Novan mengatakan belum tahu. “Kita baru terima SPDP dan kita sedang menunggu bagaimana hasil pemeriksaan BC,” katanya, Rabu (26/6). Sebelumnya, seorang bacaleg DapilV PS alias Golap ditetapkan sebagai tersangka oleh BC karena diduga terlibat kasus penyelundupan 33 jenis minuman keras beralkohol 40 persen yang ditangkap BC dari KIM III. Selanjutnya, tersangka yang sebelumnya juga telah pernah diduga terlibat penyelundupan gula impor beberapa tahun lalu dan ditahan di rumah tahanan negara (rutan) Labuhan Deli. (h03)

Tagih Utang Kritis Ditikam MEDAN (Waspada): Putra, 31, warga Jln. Luku V Gang Seleng, Kel. Kwala Bekala, Medan Johor, kritis akibat ditikam oleh tersangka I, 25, Minggu (23/6) malam. Korban menderita luka tikaman sebanyak tiga liang di bagian pinggang dan betis kanan. Korban dalam laporan pengaduannya di Polsek Delitua, Rabu (26/5) menyebutkan, akibat luka tikaman itu, dirinya dirawat dua hari di rumah sakit. Menurut dia, peristiwa itu terjadi berawal dari tersangka I yang bertindak kasar kepada istri korban karena tidak senang utangnya ditagih. Mendengar istrinya dikasari, korban mendatangi tersangka yang berada di rumahnya tak jauh dari kediaman korban. Ketika bertemu, korban bertanya kepada tersangka mengapa bertindak kasar pada istrinya, namun I tidak senang sehingga terjadi perkelahian. Karena terdesak, tersangka mengambil pisau dari rumahnya dan menikam korban sebanyak tiga liang di bagian pinggang dan betis. Usai menikam korban, tersangka I melarikan diri. Kapolsek Delitua Kompol Bakhtiar Marpaung melalui Kanit Reskrim Iptu Martualesi Sitepu ketika dikonfirmasi membenarkan laporan pengaduan korban. “Kita segera mengejar pelaku penikaman itu,” tuturnya.(m40)

Golkar Nilai BLSM Jadi Ajang Politik MEDAN (Waspada): Fraksi Partai Golongan Karya (Golkar) DPRD Kota Medan menilai penyaluran Bantuan Langsung Sementara Masyarakat (BLSM) kepada masyarakat miskin hanya menjadi ajang politik ataupun pencitraan penguasa dari kalangan partai politik (Parpol). “Yang jelas itu bukan uang partai. Itu uang negara yang ditampung dalam Anggaran Pendapatan Belanja Negara Perubahan (APBN-P) tahun anggaran 2013,” kata penasehat FPG DPRD Kota Medan H Sabar Syamsurya Sitepu didampingi Ketua FPG Ferdinand Lumbantobing SE, Selasa (25/6), menyikapi banyaknya pengaduan warga miskin yang masuk ke FPG terkait penyaluran BLSM yang tidak tepat sasaran itu. Sabar mempertanyakan keakurasian data penerima BLSM tersebut. Sebab, masih banyak warga yang seharusnya berhak menerima bantuan tersebut, justru tidak mendapatkannya. “Data BPS yang menjadi acuan penyaluran BLSM itu tidak akurat, mereka mengambil data simpel-simpel saja. Akibatnya, masih banyak yang tidak menerima,” kata Wakil Ketua DPRD Kota Medan ini. Kondisi seperti itu, sebut dia, rentan terjadi keributan bahkan perpecahan di tengah-tengah masyarakat. “Lihat saja sekarang di lapangan, banyak kepala lingkungan (Kepling) dikejar-kejar warganya mempertanyakan hal itu,” tuturnya. Pada prinsipnya, sambung Sabar, pihaknya mendukung BLSM tersebut dan bila perlu ditambah. Namun, warga yang menerima bantuan tersebut haruslah orang yang benar-benar layak. Sementara itu, Ferdinand Lumbantobing menuturkan, seharusnya dalam pendataan warga miskin melibatkan kepala lingkungan. Sebab, Kepling yang lebih mengetahui kondisi warga di wilayah masing-masing. Selama ini, kata dia, para kepling tersebut tidak dilibatkan dalam melakukan pendataan warga, sehingga data yang ada tidak sinkron dengan kondisi yang terjadi di lapangan. “Coba suruh para kepling itu yang mendata dan dikasih honornya, saya yakin data akan semakin akurat,” ujar anggota Komisi A ini. Menurut Ferdinand, FPG siap menampung pengaduan ataupun keluhan masyarakat yang tidak menerima penyaluran bantuan tersebut. “Kita siap menerimanya. Buktinya, di Kelurahan Sei Sikambing B saja ada beberapa warga yang mengeluh karena tidak mendapatkan bantuan itu. Dan itu kita bantu seperti warga yang menerima BLSM,” sebutnya. (m30)

WASPADA Kamis 27 Juni 2013

Pemko Medan Plin Plan Legalitas Hukum Lapak Pedagang Buku Tidak Jelas MEDAN (Waspada): Pemko Medan terkesan plin plan dalam menyikapi masalah pedagang buku di Lapangan Merdeka. Buktinya, para pedagang buku tersebut hendak dipindahkan ke lokasi yang tidak jelas legalitas hukumnya.

di Bandung. Suratnya sudah kita siapkan dan menunggu tandatangan Plt Wali Kota. Setelah itu surat segera kita kirim dan kita berkoordinasi terkait hak pakai Pemko Medan atas aset PT KAI itu. Karena untuk legalitas itu harus ada persetujuan dari Direktur Utama di Bandung,” kata Asisten Ekbang Qamarul Fattah kepada Waspada,Rabu (26/6). Qamarul menyebutkan, Pemko Medan belum dapat memastikan berapa lama batas waktu hak guna pakai yang akan diberikan PT KAI kepada Pemko Medan. “Tentunya kita menginginkan hak pakai yang diberikan dalam waktu lama. Artinya, sepanjang tidak ada pembangunan yang lebih besar, maka lahan itu tetap digunakan oleh pedagang buku. Secara perlahan akan kita cari solusi yang lebih permanen untuk pedagang

buku. Kita juga ingin mencari tempat yang representatif untuk pedagang buku,” ucapnya. Hingga saat ini, lanjut Qamarul, Pemko Medan masih menunggu keputusan Direksi PT KAI terkait hak guna pakai lahan di Jln. Pegadaian. “Saat ini, Pemko masih menunggu surat dari PT KAI. Tapi persetujuan hak guna pakai itu secara lisan sudah ada. Dalam hal ini, PT KAI telah memberikan hak guna pakai dengan biaya sewa gratis selama satu tahun. Tapi memang persetujuan itu sesuai dengan tuntutan pedagang, kita mintasecaratertulis.Artinyaharus ada penyerahan hak pakai dari PT KAI ke Pemko,” ujar Qamarul. Qamarul berharap agar pedagang dapat pindah ke Jln. Pegadaian Medan. “Kita harapkan dalam proses ini secara prinsip hak guna pakai itu secara lisan

sudah disetujui oleh direksi, cuma ‘hitam di atas putihnya’ saja yang belum ada. Artinya, sambil itu berjalan kita berharap agar pedagang cepat pindah ke Jln. Pegadaian, karena sekarang sebagian pedagang juga sudah bersedia pindah,” terangnya. Ditanya jika pedagang menolak pindah dan menunggu keluarnya legalitas hak guna pakai dari PT KAI secara tertulis, Qamarul mengatakan, Pemko Medan sebenarnya tidak ingin melakukan upaya paksa. “Kita tidak ingin melakukan upaya paksa. Kami harapkan agar pedagang dapat segera pindah. Tuntutan pedagang sudah kita

Khairul Basyar Jadi Ketua DPP Himas

MEDAN (Waspada): Turut melakukan pengeroyokan atau terlibat dalam pembunuhan delapan nelayan Myanmar di Rumah Detensi Imigrasi (Rudenim) Belawan, tiga anak Rohingya KH, 16, MY, 15, dan MH, 16, dituntut masing-masing dua tahun penjara. Tuntutan yang disampaikan oleh JPU dalam sidang tertutup di ruang Cakra VII, Pengadilan Negeri (PN) Medan, Rabu (26/ 6) menyatakan, ketiga terdakwa dikenakan 3 pasal yaitu Pasal 338, 170, dan 351 KUHPidana dimana terlibat didalam pembunuhan. Usai persidangan, Khairil

Hingga saat ini, legalitas hukum atas hak pakai lahan di Jln. Pegadaian Medan dari PT KAI kepada Pemerintah Kota (Pemko) Medan masih belum jelas. Pemko Medan masih berencana mengirim surat ke Direksi PT KAI di Bandung agar legalitas itu dapat diberikan, sehingga pedagang buku di Lapangan Merdeka bersedia pindah ke kios yang baru. “Kita segera mengirimkan surat ke Direktur Utama PT KAI

MEDAN (Waspada): HT Khairul Basyar SSos, MSP, terpilih menjadi Ketua Dewan Pimpinan Pusat Himpunan Masyarakat Aceh Serantau (DPP Himas) periode 2013-2018 dalam Mubes I Himas tahun 2013, di Hotel Syariah Grand Jamee, Medan, Sabtu (22/6). Khairul Basyar yang sebelumnya menjabat Ketua DPD Himas Kota Medan ini terpilih secara aklamasi, setelah salah satu kandidat lainnya Iskandar Saady tidak bersedia dipilih menjadi Ketua DPP Himas. Selanjutnya, Ketua DPP Himas terpilih selaku ketua merangkap anggota formatur di-

bantu empat anggota formatur yakni Saifuddin AW SH, SE, MH, H Hasbi Jalil, Drs H Djuwaini HS, dan H Ramli, diberi waktu satu setengah bulan untuk menyusun komposisi kepengurusan DPP Himas 2013-2018. Selain memilih Ketua DPP Himas periode lima tahun ke depan, peserta mubes juga memutuskan Ketua DPP Himas periode sebelumnya, Tar M Samalanga menjadi Ketua Majelis Permusyawaratan Raya (MPR) DPP Himas 2013-2018. Mubes yang dihadiri DPP, DPD dan DPC Himas juga memutuskan perubahan sejumlah pasal dalam AD/ART Himas. Pa-

sal yang ditambah antara lain tentang Majelis Permusyarawatan Raya (MPR). MPR adalah majelis tinggi yang mempunyai wewenang mengangkat dan memberhentikan personalia yang berhalangan tetap sekaligus melantik/mengukuhkan DPP Himas. Personalia MPR lima orang sebanyak-banyaknya sembilan orang dalam jumlah ganjil terdiri atas satu orang ketua, satu orang wakil ketua dan selebihnya anggota. MPR dipilih melalui forum rapat paripurna mubes. Syarat-syarat menjadi anggota MPR antara lain, tokoh masyarakatyangmemahamidan peduli terhadap Himas.(m30)

Yayasan Indah Medan Khitan 240 Anak Kurang Mampu MEDAN (Waspada): Sebanyak 240 anak kurang mampu mengikuti khitanan massal yang diadakan Yayasan Indah Medan, meliputi Akademi Farmasi (Akfar), Akademi Kebidanan(Akbid)danAkademiKeperawatan (Akper), Minggu (23/6). Kegiatan sosial ini merupakan program rutin tahunan yang diselenggarakan Yayasan Indah sebagai wujud dari komitmennya untuk membantu masyarakat miskin. KetuaYayasan Indah H. Abdul Haris Sy Hasibuan, SE

mengatakan, pihaknya sudah rutin mengadakan khitanan massal setiap libur sekolah dan selalu mendapat dukungan dari berbagai pihak. Adapun anakanak yang mengikuti khitanan massal ini berasal dari keluarga tidak mampu yang ada di wilayah lingkungan kampus dan sekitarnya. “Kami berharap melalui kegiatan ini dapat meningkatkan tali silaturahmi antara Yayasan Indah Medan dengan masyarakat sekitar kampus. Kegiatan ini juga bertujuan meringankan

Waspada/Ist

SALAH seorang anak sedang dikhitan tim dokter di halaman KampusYayasan Indah Jln. Jaya II No.24/Saudara Ujung, Simpang Limun, Medan.

beban para keluarga yang tidak mampu untuk mengkhitankan anak-anak mereka,” jelas Abdul Haris kepada wartawan. Abdul Haris menambahkan, dari tahun ke tahun animo masyarakat untuk mengikutsertakan anak-anaknya dalam khitanan massal terus bertambah. Para peserta selain memperoleh peralatan ibadah seperti sarung, baju koko dan peci, juga diberikan uang saku. Menjawab pertanyaan wartawan, Abdul Haris mengatakan, khitanan massal ini juga akan dilaksanakan pada 30 Juni 2013 di Radio Indah Suara (RIS 103.2 FM) Perbaungan bekerjasama dengan Akademi Kesehatan Yayasan Indah Medan. “Hingga saat ini peserta yang mendaftar jadi peserta khitanan sekitar 300 orang,” tambahnya. Sementara itu, Murniati, 54, mengungkapkan rasa gembiranya karena anaknya sudah dikhitan. Sebagai orangtua, dia mengaku sedih karena putranya sudah berusia 12 tahun, tapi belum dikhitan akibat ketiadaan biaya. Kegiatan khitanan massal ini dihadiri para direktur, direktris Akper, Akfar dan Akbid beserta para tenaga dosenYayasan Indah Medan. (h02)

tindak lanjuti. Masalahnya, itu kan harus disetujui Direksi PT KAI di Bandung,” jelasnya. Di tempat terpisah, Ketua Asosiasi Pedagang Buku Lapangan Merdeka (Aspeblam) Donald Sitorus menegaskan, jika legalitas hukum tidak juga diselesaikan oleh Pemko Medan, maka pedagang yang sudah pindah ke Jln. Pegadaian juga akan kembali lagi ke Lapangan Merdeka. “Kalau legalitas tidak juga keluar, kami akan kembali lagi,” tegas Donald. Menurut Donald, Asisten Ekbang Pemko Medan hanya berbohong dan semua janjinya palsu. “Kami minta kinerjanya

dievaluasi. Dari awal memang sudah terlihat tidak ada keseriusan Pemko Medan untuk menangani kasus pedagang. Kita bukan tidak mau pindah, tapi harus ada aturan. Apalagi Pemko Medan sudah menjanjikan pertemuan pada minggu ini,” ujar Donald. Donald menegaskan, jika Pemko membuat pertemuan dalam minggu ini, seharusnya tidak hanya dengan pedagang, tapi juga melibatkan DPRD Medan dan PT KAI. “Pertemuan yang dibuat Pemko nanti juga harus melibatkan DPRD dan PT KAI sehingga bisa sinkron dan jelas,” tegas Donald.(m50)

Terdakwa Pembunuhan Warga Myanmar Dituntut Dua Tahun Anwar Hasibuan, salah seorang kuasa hukum para terdakwa mengatakan, JPU menuntut ke tiga kliennya itu dengan pasal 170 ayat 2 KUH Pidana mengenai pengeroyokan. Khairil Anwar dari Tim Pembela Muslim ini mengatakan, dalam amar tuntutannya, JPU menyebutkan hal yang memberatkan perbuatan terdakwa mengakibatkan matinya seseorang, kemudian perbuatan terdakwa meresahkan masyarakat dan para terdakwa tidak mengaku perbuatannya. Sementara hal yang meringankan, terdakwa masih anak-anak. Menurut dia, menyikapi

tuntutan JPU tersebut, kuasa hukum para terdakwa akan mengajukan pledoi atau pembelaan yang akan dibacakan pada sidang selanjutnya hari Senin mendatang. Diketahui, ketiga anak Rohingya didakwa terlibat bersama 14 orang pengungsi Rohingya dewasa lainnya dalam kasus pengeroyokan hingga tewas 8 warga Myanmar di Rudenim Belawan beberapa waktu lalu. Pengeroyokan dipicu akibat pelecehan yang dilakukan warga Myanmar terhadap suku Rohingya di dalam rumah pengungsian itu. (m38)

PFI Pecahkan Rekor Pameran 7.000 Foto MEDAN (Waspada): Pewarta Foto Indonesia (PFI) Medan akan memecahkan rekor dengan menampilkan 7.000 hasil karya fotografi dari seluruh pewarta foto di Indonesia dalam event bertajuk “Nusantara Photo Fest 2013”, yang berlangsung Kamis (27/6) mulai pukul 14.00 wib, hingga Sabtu (29/6) mendatang, di Taman Sri Deli Jln. Masjid Raya, Medan. Ketua Panitia, Said Harahap menjelaskan, acara pameran 7.000 foto ini bertujuan untuk membangkitkan kembali kejayaan dunia fotografi di Kota Medan, sekaligus memperkenalkan Kota Medan kepada daerah lain, bahkan negara lain melalui fotografi. “Seluruh foto adalah karya pewarta foto seluruh Indonesia yang tergabung dalam PFI ditambah foto-foto dari komunitas fotografi di Sumut,” jelas Said, didampingi sekretaris panitia Arifin Al Alamudi, Divisi Acara Edy Purnomo, Surya Efendi dan beberapa panitia lainnya. Menurut Said, kegiatan ini dirancang untuk mengakomodir hasil karya terbaik pewarta foto juga sebagai perangsang pelaku foto tanah air dalam menggali khasanah budaya bangsa melalui karya foto nusantara. Panitia Divisi Acara Edy Purnomo menambahkan, acara pembukaan akan diisi pagelaran budaya multietnis, flashmob dan hunting foto bareng 1.000 fotografer. “Kami mengundang

seluruh pecinta fotografi untuk bergabung dalam acara hunting foto bareng ini,” ujar Edy Purnomo. “Di hari kedua pelaksanaan acara akan diramaikan dengan kegiatan donor darah dan pengobatan gratis. Ada juga Photo Clinic setiap hari yang akan dibimbing fotografer-fotografer nasional. “Sejak dibentuknya PFI Medan, kader-kader yang terus aktif berkarya menghasilkan pu-

luhan masterpiece rekam jejak peristiwa khususnya di Sumut, mencoba membuka diri terhadap khalayak ramai untuk berbagi skill dan pengalaman di lapangan dalam suatu kegiatan pameran akbar ini,” tambah Said. Berbagai pihak turut mendukung acara ini, diantaranya Pemko Medan, Dinas Pariwisata Kota Medan, Dinas Kominfo Kota Medan, PT XL Axiata, serta sejumlah media cetak di Kota Medan.(m46)

Waspada/Surya Efendi

PERSIAPAN PAMERAN FOTO: Panitia sedang mempersiapkan pameran “Nusantara Photo Festival 2013”, di Taman Sri Deli Medan, Rabu (26/6).

Ilmu Perpustakaan Jadi Pengembangan Ilmu Terdahulu MEDAN (Waspada): Perpustakaan memang sudah tidak asing lagi bagi masyarakat. Namun tidak banyak yang tahu tentang program studi Ilmu Perpustakaan. Program studi ini ada di Fakultas Komunikasi dan Ilmu Perpustakaan Universitas Sari Mutiara (USM) Indonesia. llmu Perpustakaan adalah ilmu yang universal dan multidisipliner. Karena itu, Ilmu Perpustakaan bisa dijadikan pengembangan ilmu-ilmu yang terlebih dahulu ada, tanpa harus kehilangan inti dari Ilmu Perpustakaan itu sendiri yaitu, pengadaan, pengelolaan, pelayanan, penemuan kembali dan penyebaran informasi serta pengembangan perpustakaan. Dalam UU No. 12 tahun 2012 tentang Pendidikan Tinggi, Ilmu Perpustakaan masuk dalam rumpun ilmu terapan. Ilmu terapan merupakan rumpun ilmu pengetahuan dan teknologi yang mengkaji dan mendalami aplikasi ilmu bagi kehidupan manusia. Ilmu Perpustakaan menjadikan Perpustakaan sebagai objek kajiannya. Mulai dari kegiatan teknis Perpustakaan, manajemen Perpustakaan dan aplikasi Teknologi Informasi di Perpustakaan. Dalam hal ini, Perpustakaan tidak sekadar gudang buku, tetapi dijadikan pusat informasi. Sebab, Perpustakaan

sangat erat kaitannya dengan teknologi informasi dan komunikasi. “Untuk mencapai hal tersebut, Prodi Ilmu Perpustakaan USM Indonesia memiliki visi, Menjadi program studi unggulan dalam bidang Ilmu Perpustakaan dan menghasilkan lulusan yang berkompetensi tinggi di Indonesia,” kata Rektor USM Indonesia DR. Dra. Ivan Elisabeth Purba, MKes kepada Waspada di kampus perguruan tinggi itu Jln. Kapten Muslim Medan, Rabu (26/6). Visi tersebut tertuang dalam misi yaitu: Pertama, Mengelola dan mengembangkan studi Perpustakaan dan informasi secara optimal. Kedua, Meningkatkan mutu keilmuan dan keprofesian sumberdaya manusia di bidang kepustakawanan dan studi informasi dengan kemampuan mengambil manfaat dari teknologi informasi dan komunikasi. Ketiga, Menumbuhkan dan mengembangkan pengalaman meneliti dalam bidang studi Perpustakaan dan informasi, serta menyebarluaskan hasilnya melalui publikasi dan pertemuan ilmiah. Menurut Ivan, Ilmu Perpustakaan tidak semata-mata mempelajari pengelolaan buku. Mahasiswa dibentuk menjadi seorang yang mampu menge-

lola informasi, baik informasi cetak maupun non-cetak dengan memanfaatkan teknologi informasi dan komunikasi. Ilmu Perpustakaan bertujuan mempersiapkan tenaga ahli Perpustakaan dan informasi yang siap memenuhi tuntutan dunia kerja serta mampu bertindak sebagai manajer dalam mengelola Perpustakaan, pusat informasi, pusat dokumentasi dengan konsep manajemen modern. Karena itu, banyak yang dipelajari di Ilmu Perpustakaan baik bersifat teknis maupun pengembangan Ilmu Perpustakaan. Kurikulum para program studi ini selalu uptodate sesuai dengan perkembangan teknologi informasi dan komunikasi. Dengan demikian, mahasiswa Prodi Ilmu Perpustakaan USM Indonesia memiliki kompetensi lulusan sebagai berikut: 1. Mampu mengelola Perpustakaan berstandar nasional dan internasional 2. Mampu mengorganisir sumber informasi tercetak dan elektronik 3. Mampu menerapkan Ilmu Perpustakaan untuk mengelola Perpustakaan digital 4. Mampu mengelola bahan pustaka menggunakan teknologi informasi dan komunikasi 5. Mampu mengelola rekod dan arsip secara profesional

6. Mampu menganalisis kebutuhan informasi masyarakat untuk pengembangan koleksi Perpustakaan 7. Mampu melakukan penelusuran online (e-journal, ebooks, e-news, database online) 8. Mampu berkomunikasi dengan sesama pustakawan nasional dan internasional 9. Mampu mengaplikasikan pendidikan agama dalam tugas dan kehidupan sehari-hari 10. Mampu meningkatkan nasionalisme yang tinggi dalam pelaksanaan profesi pustakawan Dengan keberadaan Prodi Ilmu Perpustakaan, lanjut Ivan, USM Indonesia bertekad menghasilkan sarjana Ilmu Perpustakaan yang kompeten dan professional. Lulusan ini mampu melakukan kegiatan manajerial dan memberikan solusi terhadap atas persoalan kepustakaan dan informasi di masyarakat, pemerintah dan dunia usaha. Lulusan Ilmu Perpustakaan mampu melaksanakan penelitian ilmiah guna menyesuaikan keilmuan Perpustakaan dengan kemajuan teknologi informasi dan komunikasi. “Yang paling penting, lulusan Ilmu Perpustakaan akan mendorong masyarakat untuk melek informasi (information literacy) guna mencapai belajar sepanjang hayat (long life education) melalui program pengabdian masyara-

kat,” ujar Ivan. Guna mendukung pencapaian visi dan misi tersebut, USM Indonesia memiliki fasilitas pendukung proses belajar mengajar yang representatif. Bahkan, USM Indonesia telah memiliki Perpustakaan Universitas yang modern dan telah meraih predikat juara 1 untuk kategori perpustakaan PTS terbaik tingkat Provinsi Sumatera Utara. Perpustakaan ini akan menjadi Perpustakaan pendidikan dan riset bagi Prodi Ilmu Perpustakaan USM Indonesia. “Untuk mendukung tujuan penyelenggaraan Prodi Ilmu Perpustakaan, USM Indonesia menyediakan sarana Laboratorium Komputer (multimedia), Laboratorium Bibliografik dan pelestarian bahan pustaka. Metode pengajaran dilakukan dengan kuliah tatap muka, seminar, kuliah lapangan, praktikum, studi banding dan praktik kerja lapangan,” jelas Ivan. Bantu pemerintah Ivan menambahkan, keberadaan USM Indonesia guna membantu pemerintah dalam rangka meningkatkan Angka Partisipasi Kasar (APK) Nasional. Lebih dari itu, USM Indonesia bertekad menghasilkan lulusan yang berkualitas dan profesional di bidangnya. Saat ini, USM Indonesia memiliki tujuh fakultas terdiri dari

Fakultas Ilmu Kesehatan dengan program studi Kesehatan Masyarakat (S1), Keperawatan (S1), Ners (Profesi), Keperawatan (D3), Kebidanan (D3), Analis Kesehatan (D3) dan Teknik Elektro Medik (D3). Fakultas Matematika dan IPA dengan program studi Kimia (S1), Farmasi (S1) serta Analisa Farmasi dan Makanan (D3). Fakultas Ilmu Komputer dengan program studi Sistem Informasi

(S1). Fakultas Psikologi dengan program studi Psikologi (S1). Fakultas Ekonomi dengan program studi Akuntansi (S1) dan Manajemen (S1). Kemudian, Fakultas Ilmu Komunikasi dan Perpustakaan dengan program studi Ilmu Komunikasi (S1) dan Ilmu Perpustakaan (S1). Fakultas Hukum dengan program studi Ilmu Hukum (S1). USM Indonesia juga memiliki Program Pasca

Sarjana dengan program studi Kesehatan Masyarakat (S2). “USM Indonesia memberi kesempatan seluas-luasnya kepada masyarakat yang kurang mampu untuk dapat mengikuti program beasiswa baik dari Yayasan maupun yang diberikan pemerintah melalui Kopertis Wilayah I, serta dari mitra kerja dan lembaga lain yang ada melalui persyaratan tertentu,” demikian Ivan.(m25)

dok USM

DUA mahasiswi USM Indonesia meninggalkan kampus perguruan tinggi tersebut di Jln. Kapten Muslim Medan, usai mengikuti perkuliahan, baru-baru ini.


Medan Metropolitan

WASPADA Kamis 27 Juni 2013

A5

KPK Dapat Apresiasi Negara Asia-Pasifik

Wapada/Surya Efendi

CEGAH GRATIFIKASI: Juru Bicara KPK Johan Budi (tengah) bersama Direktur Pembinaan Jaringan Kerja Antar Komisi dan Instansi Komisi Pemberantasan Korupsi (KPK) Sujanarko (kiri) dan Wakil Ketua Bambang Widjojanto (kanan) melakukan jumpa pers usai pertemuan APEC Third Senior Officials Meeting (SOM) III And Related Meetings di Medan, Rabu (26/6). Pertemuan tersebut membahas tentang peningkatan komitmen kalangan swasta dalam pencegahan gratifikasi.

Jadwal Penerbangan Di Bandara Polonia No. Penerbangan Ke Flight

Pukul

Tiba Dari

Flight

GARUDA INDONESIA 1 Jakarta GA-181 2 Jakarta GA-183 3 Jakarta GA-185 4 Jakarta GA-187 5 Jakarta GA-189 6 Jakarta GA-191 7 Jakarta GA-193 8 Jakarta GA-147 9 Jakarta GA-195 10 Banda Aceh GA-142 11 Banda Aceh GA-14.6 12 Banda Aceh GA-278 13 Pekanbaru GA-276 14 Batam GA-272 15 Palembang GA-266 16 Batam GA-270 17 Padang GA-262 18 Penang GA-802 19 Penang GA-804

05.20 08.45 10.30 11.55 13.55 15.55 17.55 18.45 19.55 09.45 14.50 06.10 09.55 13.20 06.00 10.40 14.50 06.05 13.55

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Banda Aceh Banda Aceh Banda Aceh Pekanbaru Batam Palembang Batam Padang Penang Penang

GA-180 GA-182 GA-184 GA-186 GA-146 GA-188 GA-190 GA-192 GA-196 GA-143 GA-147 GA-279 GA-277 GA-273 GA-267 GA-271 GA-263 GA-803 GA-805

08.00 09.45 11.10 13.20 14.20 15.10 17.10 19.10 22.00 13.10 17.55 08.45 12.40 19.45 09.55 14.05 20.50 08.30 16.25

CITILINK 1 Jakarta 2 Jakarta 3 Jakarta 4 Batam 5 Batam

QG-831 QG-833 QG-835 QG-880 QG-882

8.40 18.50 20.05 10.00 14.20

Jakarta Jakarta Jakarta Batam Batam

QG-830 QG-832 QG-834 QG -881 QG-883

08.05 09.05 09.35 13.15 17.55

AIR ASIA 1 Kuala Lumpur 2 Kuala Lumpur 3 Kuala Lumpur 4 Kuala Lumpur 5 Penang 6 Penang 7 Kuala Lumpur 8 Baangkook 9 Bandung 10 Surabaya 11 Bandung 12 Banda Aceh 13 Pekanbaru

QZ-8050 QZ- 8054 AK- 1351 AK-1355 QZ-8072 AK-5837 AK-1357 QZ-8084 QZ-7987 QZ-7611 QZ-7981 QZ-8022 QZ-8028

06.05 11.20 08.00 17.25 10.40 18.30 21.25 17.00 08.25 11.35 17.10 11.00 07.00

Kuala Lumpur Kuala Lumpur Kuala Lumpur Kuala Lumpur Penang Penang Kuala Lumpur Bangkok (2,4,6) Bandung Surabaya Bandung Banda Aceh Pekanbaru

QZ-8051 QZ-8055 AK-1350 AK-1354 QZ-8073 AK-5836 AK-1356 QZ-8085 QZ-7986 QZ-7610 QZ-7980 QZ-8023 QZ-8029

08.30 10.55 07.35 17.00 16.30 18.15 21.05 29.55 05.35 11.10 19.55 13.20 10.30

LION AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Jakarta 5 Jakarta 6 Jakarta 7 Jakarta 8. Jakarta 9 Jakarta 10 Jakarta 11 Jakarta 12 Jakarta 13 Jakarta 14 Penang 15 Penang 16 Jakarta 17 Jakarta 18 Jakarta 19 Jakarta 20 Jakarta 21 Surabaya 22 Surabaya 23 Banda Aceh 24 Jakarta

JT- 211 JT- 381 JT- 397 JT- 207 JT- 301 JT- 395 JT- 303 JT- 215 JT-201 JT- 387 JT-399 JT-383 JT-385 JT-1282 JT-1288 JT-205 JT-203 JT-219 JT-309 JT-209 JT-0970 JT-972 JT-396 JT-305

0545 06.45 07.50 08.40 10.00 11.00 11.50 12.25 12.50 13.50 15.20 15.50 17.00 08.05 13.35 2010 18.00 20.40 19.10 21.00 07.00 12.55 12.15 18.30

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Penang Penang Jakarta Jakarta Jakarta Jakarta Jakarta Surabaya Surabaya Banda Aceh Jakarta

JT-380 JT-300 JT-394 JT-302 JT-214 JT-200 JT-204 JT-398 JT-382 JT-384 JT-202 JT-212 JT-396 JT-1283 JT-1289 JT-206 JT-208 JT-386 JT-308 JT-218 JT-971 JT-973 JT-397 JT-210

08.20 09.20 10.20 11.10 11.40 12.10 13.10 14.40 15.10 16.20 17.20 17.50 19.45 10.25 15.55 9.20 18.25. 21.05 22.20 23.20 12.15 16.00 07.05 07.20

MALAYSIA 1 Kuala Lumpur 2 Kuala Lumpur

MH-861 MH-865

09.40 15.45

Kuala Lumpur Kuala Lumpur

MH-860 MH-864

08.50 15.00

SILK AIR 1 Singapura 2 Singapura

MI-233 MI-237

08.40 20.35

Singapura Singapura

MI-232 MI-238

07.50 19.50

VALUAIR 1 Singapura (2.4,7) VF-282 2 Singapura (1,3,6) VF-284 3 Singapura (Jumat)VF-282

10.35 18.30 09.45

Singapura (2.4.7) VF-281 Singapura (1,3,6) VF-283 Singapura (Jumat)VF-281

09.55 17.40 09.05

SRIWIJAYA AIR 1 Jakarta 2 Jakarta 3 Batam 4 Pekanbaru 5 Pekanbaru 6 Banda Aceh 7 Penang 8 Padang

SJ-015 SJ-011 SJ-035 SJ-043 SJ-041 SJ-010 SJ-102 SJ-021

13.25 15.55 16.50 10.20 17.20 12.50 07.20 16.00

Jakarta Jakarta Batam Pekanbaru Pekanbaru Banda Aceh Penang Padang

SJ-010 SJ-016 SJ-034 SJ-042 SJ-040 SJ-011 SJ-103 SJ-020

11.00 16.20 14.55 11.50 15.45 14.20 09.50 14.10

FIRE FLY 1 Subang 2 Penang 3. Penang

FY -3413 FY- 3403 FY- 3407

14.35 10.55 18.20

Subang Penang Penang

FY-3412 FY-3402 FY-3406

14.05 10.35 17.55

07.30 11.45 18.50

Singapura Jakarta Jakarta

RI-862 RI-093 RI-097

08.00 12.00 19.30

MANDALA AIRLINE 1 Jakarta RI-092 2 Singapura RI-861 3. Jakarta RI-096

Pukul

Jadwal Perjalanan Kereta Api No KA

Nama KA

Kelas

Dari

Tujuan

Berangkat

U.28 Sri Bilah Eks/Bisnis Medan RantauPrapat U30 Sri Bilah Eks/Bisnis Medan Rantau Prapat U.32 Sri Bilah Eks/Bisnis Medan Rantau Prapat U.34 Sri Bilah Eks/Bisnis Medan Rantau Prapat U.27 Sri Bilah Eks/Bisnis Rantau Prapat Medan U.29 Sri Bilah Eks/Bisnis Rantau Prapat Medan U.31 Sri Bilah Eks/Bisnis Rantau Prapat Medan U.33 Sri Bilah Eks/Bisnis Rantau Prapat Medan U35 Sri Lelawangsa Ekonomi Tebing Tinggi Medan U36 Sri Lelawangsa Ekonomi Medan Tebing Tinggi U37 Sireks Ekonomi Siantar Medan U38 Sireks Ekonomi Medan Siantar U.39 Putri Deli Ekonomi Tanjung Balai Medan U.40 Putri Deli Ekonomi Medan Tanjung Balai U.41 Putri Deli Ekonomi Tanjung Balai Medan U.42 Putri Deli Ekonomi Medan Tanjung Balai U.43 Putri Deli Ekonomi Tanjung Balai Medan U.44 Putri Deli Ekonomi Medan Tanjung Balai U45 Sri Lelawangsa Ekonomi Binjai Medan U46 Sri Lelawangsa Ekonomi Medan Binjai U47 Sri Lelawangsa Ekonomi Binjai Medan U48 Sri Lelawangsa Ekonomi Medan Binjai U49 Sri Lelawangsa Ekonomi Binjai Medan U50 Sri Lelawangsa Ekonomi Medan Binjai U51 Sri Lelawangsa Ekonomi Binjai Medan U52 Sri Lelawangsa Ekonomi Medan Binjai U53 Sri Lelawangsa Ekonomi Binjai Medan U54 Sri Lelawangsa Ekonomi Medan Binjai U55 Sri Lelawangsa Ekonomi Binjai Medan U56 Sri Lelawangsa Ekonom Binjai Medan U57 Sri Lelawangsa Ekonomi Medan Binjai U58 SriLelawangsa Ekonomi Binjai Medan U59 Sri Lelawangsa Ekonomi Medan Binjai Reservasi Tiket KA Medan (061-4248666)

08.17 10.47 15.46 22.50 08.45 15.20 17.10 23.55 05.36 18.17 06.25 14.27 07.55 06.57 13.20 13.12 19.00 16.57 05.45 05.00. 07.15 06.30 09.15 08.30 11.35 10.00 14.30 12.30 16.15 17.45 17.00 21.30 20.10

Datang

13.57 16.00 21.16 03.52 14.04 20.43 22.11 05.09 07.53 20.38 10.22 18.15 12.52 11.28 17.55 17.36 23.20 21.35 06.14 05.29 07.44 06.59 09.44 08.59 12.04 10.29 14.59 12.59 16.44 18.14 17.29 21.59 20.39

MEDAN (Waspada): Komisi Pemberantasan Korupsi (KPK) mendapat apresiasi dari negara-negara Asia-Pasifik atas kinerjanya dalam pemberantasan korupsi di negara ini. Selain itu, banyak negara lain belajar tentang kinerja KPK memberantas korupsi di Indonesia. “Ini merupakan suatu prestasi yang membanggakan bagi kami menjadi lembaga yang gencar memberantas korupsi di negara ini,” kata Wakil Ketua KPK Bambang Widjajanto dalam acara Senior Officials Meetings III APEC 2013, di Hotel Grand Santika Medan, Rabu (26/6). Untuk meningkatkan upaya pemberantasan korupsi di Indonesia, KPK terus melakukan perbaikan sistem dan metode untuk mengungkap kasus korupsi. Salah satunya dengan mengirimkan para penyidik KPK ke Chili untuk bertukar ilmu serta berbagi pengalaman. Kata Bambang, KPK akan membuat suatu kesepakatan dengan para pengusaha yang tergabung dalam Working Group dengan 21 member antar negara Asia-Pasifik, karena pengusaha swasta lebih berpeluang besar dalam praktik penyuapan dan korupsi. Namun, dalam petemuan kali ini hanya

dihadiri 17 member saja. “Pengusaha swasta lebih rentan melakukan praktik penyuapan dan korupsi. Maka dari itu, KPK akan segera mengundang para direktur perusahaan agar membuat sebuah komitmen untuk tidak malakukan praktik penyuapan dan korupsi,” ujarnya. Menurut dia, karena selama ini belum ada undang-undang yang mengatur dan mengawasi para pengusaha swasta. Sedangkan negara lain seperti Singapura dan Amerika telah menerapkan undang-undang tentang pengawasan bagi pengusaha dalam praktik bisnis yang digelutinya. “Negara kita telah tertinggal dalam pembentukan undang-undang yang mengatur aktivitas pengusaha dalam menjalankan bisnisnya,” sebutnya. Dalam kesempatan itu, Bambang menyampaikan ucapan terimakasih karena Kota Medan adalah salah satu kota terbaik dalam penyelenggaraan APEC 2013, dengan memberikan pelayanan serta kenyamanan sehingga sejauh ini kegiatan Senior Officials Meetings III APEC 2013 berjalan baik. (cay)

Polsek Medan Timur Tangkap Pengedar Narkoba Dan Curanmor MEDAN (Waspada): Selama empat hari, petugas Reskrim Polsek Medan Timur dipimpin Kanit Reskrim Iptu Jama K Purba SH, MH, meringkus empat pengedar narkoba dan empat pencuri sepedamotor plus penjambret dari beberapa lokasi terpisah. Dari para tersangka, di-sita barang bukti 5 unit sepedamotor, uang Rp490 ribu, kartu kredit, 2,5 gram sabu-sabu, dan ganja. Informasi yang diperoleh di kepolisian, Rabu (26/6), ke delapan tersangka masing-masing berinisial AS ,19, warga Jln. Bustaman, Pasar IX, Desa Bandarkhalipah, Kec. Percut Seituan,

BMP, 25, warga Jln. Letda Sujono Gang Boyan, Kec. Medan Tembung, MI, 24, warga Jln. Makmur Gang Taqwa, Kec. Medan Tembung, MHL, 42, warga Jln. Karya Bakti, Kec. Medan Tembung. RS, 29, warga Jln. Gaharu Blok C, Kel. Gaharu, Kec. Medan Timur, Sh, 27, warga Jln. Benteng Hulu Gang Amal, Kec. Medan Tembung, MN, 46, warga Jln. Darul Amin, Desa Medan Estate, Kec. Percut Seituan, dan S, 45, warga Kotamatsum, Kec. Medan Kota. Kapolsek Medan Timur AKP Efianto didampingi Kanit Reskrim Iptu Jama K Purba menjelaskan, tersangka AS ditangkap, Selasa (25/6), beberapa hari setelah mencuri sepedamotor milik Jalaludin Sibarani, 29, di depan warnet Dying Jln. Prof HM

Yamin. Tersangka BMP dan MI ditangkap di kawasan Jln. Prof HM Yamin, Senin (24/6), setelah beberapa hari menjambret tas milik korban Abdiana Manurung, 31, warga Jln. Pancing, Kec. Medan Tembung. Sedangkan tersangka MHL ditangkap petugas saat membawa kabur sepedamotor milik korban di Jln. Pasar III, Kel. Tegalrejo, Kec. Medan Perjuangan. Dari tersangka disita sepedamotor Vario BK 6925 ACZ sebagai barang bukti. Selain itu, pengedar sabusabu berinisial RS ditangkap, Senin (24/6) sekira pukul 21:00, saat mengendarai sepedamotor Supra X BK 3952 FR di Jln. Gaharu. Dia menyimpan 0,98 gram

sabu-sabu, 1 pipet plastik dan 10 plastik kecil di jok bawah tempat duduk sepedamotornya. Tersangka S dan MN, keduanya pengedar ganja, ditangkap di Jln. Thamrin Medan, karena mengantongi 1,3 gram daun ganja kering. Sementara tersangka S ditangkap saat mengkonsumsi sabu-sabu di rumahnya kawasan Kotamatsum III, Kec. Medan Kota. Dari tersangka disita barang bukti 0,22 gram sabu-sabu. Menurut AKP Efianto, pihaknya terus melaksanakan patroli di beberapa lokasi rawan penjambretan dan curanmor. “Untuk mencegah tindak kriminalitas jalanan (street-crime), personel Reskrim melakukan

Waspada/Andi Aria Tirtayasa

KAPOLSEK Medan Timur AKP Efianto didampingi Kanit Reskrim Iptu Jama K Purba memperlihatkan barang bukti bungkusan plastik berisi sabu-sabu, satu lembar kartu ATM dan barang bukti lainnya, Rabu (26/6).

Petugas LP Ditangkap Kasus Sabu

Polisi Selidiki Keterlibatan Orang Dalam MEDAN (Waspada): Petugas Direktorat Reserse Narkoba Polda Sumut menyelidiki keterlibatan orang dalam Lembaga Pemasyarakatan (LP) Tanjung Gusta setelah penangkapan S, 43, petugas LP dewasa atas kepemilikan 10 gram sabu-sabu, kemarin. “Kemungkinan ada orang dalam lainnya yang terlibat dalam kasus tersebut, tetapi masih diselidiki,” kata Direktur Dit Res Narkoba Poldasu Kombes Pol. Toga H Panjaitan, ditanya kasus tersebut, Rabu (26/6). Dia mengatakan, peredaran

narkoba di dalam LP bukan hal baru karena beberapakali penangkapan pernah dilakukan bekerjasama dengan petugas Depkumham. Karena itu, wilayah itu tetap dalam pengawasan. Namun, Toga belum mau menjelaskan siapa orang dalam LP Tanjung Gusta yang dicurigai terlibat, atau bahkan pengedar narkoba di dalam LP. Dia juga belum mau membeberkan darimana asal 10 gram sabusabu yang diamankan dari tersangka S, dan akan diserahkan kepada siapa barang tersebut.

“Masih dalam pengembangan, nanti setelah pengungkapan kasus itu akan disampaikan,” ujarnya. Diberitakan kemarin, petugas Dit Res Narkoba Poldasu menangkap S, petugas LP dewasa Tanjung Gusta atas kepemilikan 10 gram sabu-sabu, Senin (24/6). Dia ditangkap di halaman LP, namun membantah narkoba itu miliknya. Pada pemeriksaan di Dit Res Narkoba, S mengatakan sabusabu itu merupakan barang titipan orang untuk diserahkan kepada penghuni LP. Namun

penyidik tidak mempercayai begitu saja keterangan tersangka. “Dia bisa saja beralasan itu bukan barangnya, tetapi yang jelas barang tersebut ada padanya saat penangkapan,” ujar Toga menyebutkan alasan itu sudah sering di dengarnya dari para bandar dan pengedar. Saat ini, S masih diperiksa intensif. Dari keterangannya diharapkan dapat membongkar jaringan peredaran narkoba dalam LP Tanjung Gusta, juga mengungkap siapa saja yang menjadi kurir, agen, dan bandar barang haram tersebut.(m27)

IDI Cabang Medan Akan Gelar Muscab MEDAN (Waspada): Ikatan Dokter Indonesia (IDI) Cabang Medan akan menggelar Musyawarah Cabang (Muscab) di Hotel Garuda Plaza Medan, Minggu (30/6). Ketua Bidang Organisasi IDI Cabang Medan dr. Rushakim, SpOG mengatakan, tujuan Muscab V itu adalah penyampaian laporan pencapaian organisasi IDI Cab. Medan periode 20102013 dan memilih Ketua IDI Cab. Medan periode 2013-2016. “Acara itu dirangkai dengan

simposium tentang peran IDI dalam memperjuangkan nasib dokter dan peningkatan pelayanan kesehatan,” katanya didampingi Sekretaris Panitia dr. Ery Suhaymi SH, di kantor IDI Cab. Medan, Rabu (26/6). Dijelaskannya, saat ini lebih 3.000 dokter terdaftar dalam anggota IDI. Hal ini menjadi tanggungjawab IDI untuk melakukan pembinaan sesuai UU Kedokteran. “Kita mengundang semuanya agar hadir dengan membawa kartu anggota yang

masih berlaku dan akan diregistrasi,” ujar Rushakim. Dia menjelaskan, syarat untuk menjadi Ketua IDI Medan yakni memiliki riwayat perilaku yang baik, berdedikasi, pernah jadi pengurus dan mempunyai waktu untuk mengelola IDI. “Kita juga mengajukan agar memiliki izin dari instansi tempatnya bekerja karena mengurus IDI harus mempunyai waktu yang cukup,” tambahnya. Pelaksanaan Muscab IDI akan dihadiri Ketua Umum

Pengurus Besar IDI dr. Zaenal Abidin, MKes yang akan menyampaikan informasi mengenai peran IDI. Dia berharap, Ketua IDI yang baru nantinya dapat meningkatkan peran IDI dan memperjuangkan nasib anggota yang masih banyak terkendala dengan peraturan baru. “Bagi peserta yang hadir mendapatkan 6 SKP, moderator 2 SKP, Panitia 1 SKP dan Pembicara 8 SKP,” demikian Rushakim. (h02)

Dalang Pembunuhan Bidan Diserahkan Ke Kejaksaan MEDAN (Waspada): Polresta Medan menyerahkan tersangka I br P diduga dalang pelaku pembunuhan bidan Puskesmas Teladan Nurmala Dewi Tinambunan ke Kejaksaan Negeri Lubukpakam bersama barang bukti. “Tadi sekitar pukul 08:00 yang bersangkutan yang merupakan dalang perencanaan pembunuhan bidan Nurmala Dewi Tinambunan diserahkan ke Kejari Lubukpakam,” kata

Kasat Reskrim Kompol M Yoris Marzuki melalui Kanit Jahtanras AKP Antoni Simamora, Rabu (26/6). Menurut dia, sebelumnya tujuh tersangka lainnya sudah diserahkan ke Jaksa. “Memang untuk dalang pelakunya, belakangan kita serahkan ke pihak kejaksaan karena mengingat keselamatannya sendiri,” ujarnya. Penyerahan tersangka I br P ke Kejari Lubukpakam akan didampingi tiga pengacaranya.

Pengacara tersangka ada yang dari Jakarta, Batam, dan Medan. “Ada kemungkinan tersangka I br P ini akan didampingi tiga pengacaranya. Ya kita lah yang menyerahkan langsung bukan pihak Kejari Lubukpakam yang menjemputnya kemari (Polresta Medan),” tutur Antoni. Sebelumnya bidan Puskesmas Teladan Nurmala Dewi Tinambunan tewas diterjang peluru oleh pembunuh bayaran di depan rumahnya di Jln. Perta-

hanan, Lorong Indah, Dusun V, Patumbak, Deliserdang, Kamis (7/2) sekira pukul 14:00. Pembunuhan tersebut bermotif dendam antara bidan Nurmala Dewi Tinambunan dengan dalang pelaku I br P. Nurmala Dewi Tinambunan juga diketahui menjalin hubungan asmara dengan Berton Silaban yang merupakan kekasih I br P. Kasus pembunuhan ini juga melibatkan dua anggota Polri. (m39)

patroli rutin dan hunting di kawasan rawan jambret seperti di Jln. Perintis Kemerdekaan, Jln. Madong Lubis, Jln. Sei Kera. dan Jln. Sentosa Baru simpang Jln. Perintis Kemerdekaan,” tuturnya. Kata dia, dibawah kendali Kanit Reskrim yang baru akan berupaya menekan angka kejahatan sekaligus menangkap para pelaku curanmor, jambret, dan narkoba.

Efianto mengimbau kaum wanita dan ibu-ibu rumahtangga agar tidak memakai perhiasan yang mencolok dan membawa tas saat mengendarai sepedamotor. “Kepada pengguna kendaraan roda dua terutama kaum wanita diimbau untuk memasukkan barang bawaannya ke dalam bagasi (jok sepeda motor) dan bila memarkirkan kendaraan diupayakan memakai kunci ganda,” sebutnya. (h04)

Pencuri Uang Gaji Polisi Diancam Satu Tahun Penjara MEDAN (Waspada): Terdakwa Muliadi, warga Palembang, dan Yasa, warga Delitua, yang mencuri uang gaji polisi Rp6 juta terancam hukuman satu tahun penjara dalam persidangan di ruang Tirta I Pengadilan Negeri (PN) Medan, Selasa (24/6). Sidang lanjutan dengan agenda mendengarkan keterangan saksi tersebut, pencurian yang dilakukan kedua terdakwa pada Rabu 20 Maret 2013 lalu. “Waktu itu kami baru saja mengambil uang gaji di bank. Pas kami makan di warung nasi yang ada di Brayan, teman saya melihat kedua terdakwa ini mencongkel mobil sedan yang kami bawa,” kata saksi polisi Indra ketika dihadirkan oleh Jaksa Penuntut Umum (JPU) J Naibaho. Melihat mobilnya dicongkel, saksi bersama temannya mengejar terdakwa. “Pada saat itu salah satu terdakwa mencoba melarikan diri. Uangnya sudah sempat diambil mereka,” ujar Indra. Kata saksi, ketika kedua terdakwa naik sepedamotor, langsung ditendangnya. “Mereka terjatuh dan nyaris dihakimi massa,” sebutnya. Kedua saksi langsung membawa kedua terdakwa ke kantor Polres Belawan. Usai mendengarkan keterangan saksi, kedua terdakwa yang dimintai tanggapannya membenarkan hal tersebut. “Awalnya memang kami ikuti dari depan Bank Mandiri pak hakim. Kami melihat bapak-bapak ini keluar dari bank membawa plastik berisi uang,” ujar terdakwa Muliadi. Mereka berencana untuk mencuri uang tersebut. “Kami menggunakan kunci T untuk mencongkel mobil itu,” tuturnya sembari mengaku menyesali perbuatannya. JPU J.Naibaho menjerat kedua terdakwa atas percobaan pencurian Pasal 53 Jo Pasal 362 KUHPidana. “Ancamannya satu tahun,” kata jaksa. (m38)

Raffles Institute Ciptakan Lulusan Taraf Internasional MEDAN (Waspada): Saat ini mutu pendidikan di Indonesia khususnya Sumatera Utara, masih berdaya saing rendah untuk menghadapi era global. Raffles Institute of Higher Education berkomitmen menciptakan lulusan desainer muda dan business leader yang kreatif dan potensial pada program setara D3 (Advanced Diploma) yang berdaya saing taraf internasional. “Selain kurikulum dengan standar internasional, pengajar di Raffles merupakan profesional yang berpengalaman dan mempunyai kualitas internasional. Salah satunya Luna, dosen Fashion design Raffles Institute of Higher Education Medan,” kata Education Consultant Raffles Institute of Higher Education Medan Reza kepada wartawan di Kompleks Centre Point Jln. Timor Medan, Minggu (23/6). Kata dia, perkuliahan Raffles Institute of Higher Education Medan menggunakan bahasa Inggris yang merupakan bahasa standar internasional. Menurutnya, keberadaan Raffles Institute of Higher Education di Medan, merupakan salah satu daerah pilihan yang strategis untuk memberikan mutu pendidikan tinggi berkualitas internasional dengan biaya yang lebih terjangkau, tanpa harus jauh ke luar negeri. “Di luar negari jelas coast yang dikeluarkan sangat besar. Dengan kehadiran Raffles Institute of Higher Education di Medan, coast yang dikeluarkan untuk mendapatkan mutu pendidikan yang sama, tidak perlu lagi ke luar negeri,” sebutnya. Perkuliahan untuk termin bulan Juli, jurusan Fashion Design akan dimulai tanggal 8 Juli 2013. Bagi para calon mahasiswa yang tertarik dan ingin menjadi profesional yang berpengalaman dan mempunyai kualitas internasional bidang desainer dan business leader, Raffles Institute of Higher Education membuka pendaftaran sampai 19 Juli 2013. “Pendaftaran mahasiswa baru diadakan empat kali setahun, yaitu Januari, April, Juli, dan Oktober. Syaratnya harus tamat SMA atau lulus IGCSE “O” Level, dengan usia minimal 16 tahun,” tuturnya.(cwan)

Bina Santri Wisuda 23 Lulusan TK Alquran MEDAN (Waspada): Perguruan Bina Santri Kota Medan kembali mewisuda 23 lulusan TK Alquran. Anak-anak saleh yang dibentuk Bina Santri itu rata-rata telah menunjukkan kemampuannya pandai membaca Alquran. “Mereka sudah mulai bisa baca Alquran,” kata Ketua Yayasan Perguruan Bina Santri Drs H Sotar Nasution MHB. didampingi Kepala TK Bina Santri Hj Latifah Hanum Batubara di Medan, Minggu (23/6). Sotar menyebutkan, selain wisuda santri angkatan ke 3 dan kegiatan syukuran 3 tahun Bina Santri, juga diselenggarakan Isra Mikraj sekaligus pembukaan Sanggar Aerobik Salon Ladies Santri. Sotar terlihat cukup puas melepas para santrinya, karena dia optimis santri-santri tersebut telah mampu melanjutkan ke jenjang masuk SD/MI. “Kalau saja para santri ini masuk ke SD/MI yang tak memiliki kualitas yang memadai, maka santri-santri Bina Santri nantinya akan merasakan seperti mengulangkaji, sehingga bisa saja menimbulkan kejenuhan,” ujarnya. Menurut dia, santri-santri itu telah memiliki kelebihan baik di bidang membaca Alquran, seni drum band, menulis dan membaca huruf latin, dan berhitung. Sementara itu, Ustazd Zulfahmi Hutasuhud SPdi, dalam ceramah Isra Mikraj dan menyambut bulan suci Ramadhan menharapkan para orangtua untuk senantiasa membimbing anakanaknya ke jalan Tuhan. Anak-anak sejak dini harus dididik untuk pandai membaca Alquran, dan juga diajari shalat sehingga kelak mereka tumbuh menjadi anak saleh. (m26)


A6 1 CM 2 CM

WASPADA

Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000

BURSA

AUTOMOTIVE Informasi Pembaca

Bursa Automotive

AC BR CL ND DB

: : : : :

Air Condition Ban Radial Central Lock Nippon Denso Double Blower

PS PW RT VR EW

: Power Stearing : Power Window : Radio Tape : Velg Racing :Electric Window

GRAND MAX PU...DP 11 JT-AN/ANGS. 86 RIBU D A I H A T S U XENIA....DP 28 JT-AN/ANGS. 2,1 jT-AN B A R U TERIOS.....DP 32 JT-AN/ANGS 3,2JT-AN

TERMURAH

Hub: INDAH 0852 9777 8255

DAIHATSU LUXIO M M/T Thn 2009. Hitam, Bk Mdn. Rp 95 Jt. Hub : 0852 7538 3218 “DAIHATSU BAGI HADIAH” GRAN Max PICK UP 1.3 DP 11 jt’an Angs 2 jt’ an Gran Max Minibus 1.3D Dp 23 jt’an Angs 2 jt’an Luxio D Dp 27jt’an Angs 3 jt’an Xenia 1.0 D Dp 27jt’an Angs 3 jt’an Terior Ts’Xtra Dp 32 jt’an Angs 3 jt’an Hubungi : Erwin HP 081263154132 ASTRA INT’L DAIHATSU PAKET Hemat 100% Baru. Hub : 0852 7747 2542 DAIHATSU ROCKY Thn 93. Warna Hitam, Bk Medan, 4x4. Hub 0853 7234 4929 DAIHATSU XENIA Li VVTI, 1,0 Thn 2008. W. Hitam, Ac, Tape, P. Window, P. Steering, Lengkap, Tinggal Pakai, Pemakai. Hub : 0813 7618 8118. Harga : 108 Jt/Damai

5 CM 6 CM

Rp. 65.000 Rp. 78.000

DAIHATSU TARUNA CSX Thn 2000. Asli Mdn, mulus, siap pakai. Harga 78 Jt. Hub : 0812 650 8819 DAIHATSU ESPASS Th 97, 1600 cc, Bk Asli Medan, Pajak Panjang, Siap pakai. Harga 34 Jt. Hub : 0812 6542 2876 (TP) KEJUTAN KEMILAU JUNI HONDA BERHADIAH!!

- Brio Dp 20 Jtan - Jazz Dp 40 Jtan - CRV Dp 80 Jtan Hub Langsung 0853 7288 8469

ISUZU PANTHER Hi-Grade. W. Biru Malam. Thn 1995, Pjk Panjang, Satu Tahun, Siap Pakai. Hp : 0821 6080 2009 ISUZU PANTHER New Royale Thn 99, Bk Asli Medan, W. biru, Lkp, Tp, Ac Dbl, Pw, Ps, Vr, Br, Jok Kulit, Mbl Sehat, Terawat & Mulus skl, Siap pakai. Hrg 75 Jt. (Jual Cepat/BU ). Hub : 0853 6082 8533

M I T S U B I S H I KUDA GLS 2000. Hitam, Asli Medan, Siap Pakai, Mobil Jarang pakai, Nomor Cantik Bk 9 ZW, Mulus. Harga 83 Jt/.Nego. Hub : 0812 6568 818 / 77305875

7 CM 8 CM

Rp. 91.000 Rp. 104.000

NISSAN MARCH 1,5 M/T. Thn 2011. Silver, Bk Mdn, Irit BBM. Rp 118 Jt. Hub : 91327433

NISSAN PROMO 100% BARU

9 CM Rp. 126.000 10 CM Rp. 140.000 DIJUAL

Satu Unit Mobil Suzuki Katana Thn 88. Mulus, Jl Sido Dame Ujung No. 267 Compleks Pemda-Krakatau Medan.

MARCH..............DP 23 JT-AN GRAND LIVINA...DP 29 JT-AN EVALIA................DP 34 JT-AN JUKE....................DP 50 JT-AN XTRAIL.................DP 57 JT-AN SERENA...............DP 85 JT-AN NAVARA & ELGRAND CASH

TOYOTA AVANZA Type G 1,3 Thn 2010. W. Hitam, Ac Doble, Sehat, Sgt Mulus, Original, jarang Pakai. Harga 143 Jt/Damai. Hub : 0853 6182 2458. NB : Pemakai

Hub: BINTANG 061-770666 / 0813 9737 4840

TOYOTA KIJANG SUPER COMMANDO SHORT Th 95, Sgt Orisinil Spt Baru, Vr, Br, RTP, Ac Dingin, Wrn Biru, Lampu Grand Extra, Hrg 56 Jt Nego, Hub : 0823 6156 7527

OPEL BLAZER LT INJECTION Yg Irit Minyak Th 97, Orisinil Mulus, Mesin Sehat, Ac Dingin, Hrg 45 Jt Nego. Hub : 0813 9789 9711

TOYOTA HIACE Pick Up Bensin Th 1976. Sgt Orisinil, Antik, Mesin dan body Sehat Sekali, Siap Pakai, A/N Sendiri, Hrg 30 Jt Nego. Hub : 0823 6432 0052

PROTON SAGA 1,3 M/T Thn 2009. Hijau Met, Bk Mdn, Pajak STNK Baru, Irit BBm, Rp 80 Jt. Hub : 0812 6594 2789

AVANZA VELOZ ETIOS YARUS RUSH INNOVA FORTUNER Proses Cepat & Serba MANTAB Hub, Hery Mutia 0852 6297 5555 TOYOTA KIJANG KRISTA 2000. Solar, Warna Silver, Asli Medan, BPKB 1 Nama dari Baru, Nomor Cantik. Bk 128 Rc, Sdh Model 2004, Mobil Jarang Pakai. Harga 118 Jt/ Nego. Hub 0812 6568 818 / 77305875

SUZUKI BARU

CARRY PU, DP 13 JT-AN/ANGS. 2,6JT-AN MEGA CARRY..DP 20 JT-AN/ANGS. 2,8JT-AN ERTIGA...DP 33 JT-AN/ANGS. 3,9 JT-AN

Hub : 0852 6111 7724

SUZUKI KARIMUN OVER KREDIT Th 2003, Warna Hitam Orisinil, Sudah Bayar 17x Sisa 19x2.499.000, Balik Dp 35 Jt Nego. Hub : 0823 6452 5302, Full Sound Pake TV

MITSUBISHI KUDA Grandia Diesel Thn 2003. Asli Mdn, Mulus, Siap pakai. Harga 109 Jt. Hub : 0812 650 8819

SUZUKI ESCUDO Nomet Thn 1997, W. Bri Mika, Mobil Cantik, Luar Dalam. Hp : 0821 6080 2009

SUZUKI CARRY FUTURA MB, GRV, Ac Dobel, Biru, 2002, Asli Mdn. Bisa Kredit. Dp 8 Jt. Hub : 0813 7051 4600 / 77805265

SUZUKI APV 2007, Type GL, Ac Dobel Blower, Hitam, Mulus Sekali. DP Ringan. Hub : 0811 615 365, 0813 7051 4600

Carry Pick-Up

DP 14 Jutaan atau Angsuran 2 Jutaan

Proses Mudah dan Cepat Bisa Tukar Tambah

TOYOTA PROMO 100 % BARU READY STOK

DIJUAL TOYOTA KIJANG Grand Extra Th 93 Long 1500 cc. Bk Hidup, Lengkap, Siap pakai, H 64 Jt. Hp. 0852 9634 5884

DIJUAL

-TOYOTA KIJANG JANTAN 1987. 6 Speed. Lampu Grand, Ac Dingin, Tape, Velg Racing, Ban SR. Hrg 37.7 Jt. - TOYOTA KIJANG Commando 5 Speed. Lampu Grand, Ac, Tape, Velg 17, Br, Hrg Nego. Hub : 0812 6219 9300 TOYOTA AVANZA TYPE G Thn 2011. W. Silver, Bk Medan, Pajak Panjang. Mulus Sekali, BU. 0821 6717 6723, (061) 77967599 TOYOTA AVANZA G Th 2006 VVTI. Warna Biru Met, Cat Dan Mesin Mulus, Siap pakai. Hrg Nego. Hp 0811 652 506

KREDIT VIA:

Hubungi Dealer

SUZUKI

ADA JADI MOBIL

JL. JEND. G. SUBROTO 18-20-22 Depan Air Mancur Petisah Tel. 4522619 - 4146757 MEDAN

TOYOTA KIJANG KAPSUL LGX Th 2000. Solar, Bk Medan, Warna Silver Met, Mobil Dalam Keadaan mulus, Siap Pakai. Hrg Nego. Ada TV. Hrg Nego. Hp. 0852 7650 6242 TOYOTA KIJANG GREEN Th 1994. Bk Medan, Warna Abu - Abu Met, Cat dan Mesin Mulus. Siap Pakai. Harga Nego. Hp. 0821 6021 0957

TOYOTA KIJANG SUPER KF 40 Short Th’ 94. Wrn Biru, Bensin, Mobil Kaleng - Kaleng. a/n Sendiri, Rp 59 Jt. Jl. SM. Raja No. 200.0815 3373 3688/ 7851402 TOYOTA INNOVA G Bensin Th’08. Wrn Silver Met, Full Soundsystem, Pajak Panjang, Power, Tv, Kompit. 1 Tangan dr Baru. Rp 173 Jt. Depan Kampus UISU No. 200. 0821 6767 7000 / 7851402 TIMOR SOACE. W. Biru Mika. Thn 1997, Bk Medan, Satu Tangan, Dari Baru. Hp : 0821 6080 2009

BURSA

GENSET DIJUAL 1 Unit Genset Silent. Mesin Deutz. Kapasitas 150 KVA. Lokasi Banda Aceh (RRI). Baru nyala 1 jam. Peminat serius Hub. Bpk Deddy : 0881 1003 900

MINI & EFEKTIF IKLANKAN PRODUK ANDA

11 CM Rp. 165.000 12 CM Rp. 180.000

Kamis, 27 Juni 2013

FAX.4561347 Info Iklan Hub. 0821 60 126688

HARGA BELUM TERMASUK PPN 10%

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

MULTAZAM - UMROH

BUTUH DANA

MANASIK HAJI 2013 HAJI PLUS / KHUSUS

PINJAMAN DANA RAMADHAN

Spesialis Surat Rumah dan BPKB. Proses 5 Jam Cair, Tanpa Usaha, 3 Juta - 1 Milyar. Jaminan, SHM, SK Camat, HGB. BPKB Mobil, Spd. Mtr, Truk, Mobil kredit. Dan Bantu Pelunasan BPKB. Hub. Family Finance. 0813 7044 6668 - 0813 7044 6633

* UMROH AWAL RAMADHAN 9 H (10 JULI) * UMROH AWAL RAMADHAN 13 H (10 & 12 JULI) * UMROH AKHIR RAMADHAN 14 H (26 JULI) MANASIK HAJI MULTAZAM SETIAP HR SABTU : 14.00 - 16.00 WIB HR MINGGU : 09.00 - 11.00 WIB

BURSA

PENDIDIKAN

SEGERA DAFTARKAN KE KANTOR PUSAT

MULTAZAM

SEKOLAH TINGGI ILMU KESEHATAN

JL. TITI PAPAN / PERTAHANAN NO. 10 SEI KAMBING D MEDAN

(STIKes) FLORA MEDAN

TELP. 061-4576116 FAX 061-4512319 HP. 0813.6137.2321 - 0812.6495.8456

IZIN MENDIKNAS RI No. 14/D/O/2009 Tanggal 2 Maret 2009

TELAH TERAKREDITASI BAN - PT

Menerima Mahasiswa/i Baru T.A 2013/2014 PROGRAM STUDI:

S-1 Keperawatan Angkatan V DIII Keperawatan Angkatan XXI DIII Kebidananan Angkatan XII Pendaftaran mulai bulan April s/d Agustus 2013 Informasi dan Pendaftaran

Kampus STIKes Flora Medan: Jl. Rajawali No.24 Medan Telp. 8454407, 8454408, 8454409 Hp. 0812 650 6377 website: www.stikesflora-medan.ac.id KURSUS CEPAT MURAH LPK PAULINE

DAFTAR LANGSUNG BELAJAR WAKTU BEBAS Ms Word+Excel Rp 125(2minggu) Design Grafis Rp 500rb(1 bulan) Acad/3DMax Rp 300rb(10hari) Corel Draw/Photoshop Rp 100rb(2 minggu) TOEFL Rp 150rb JL. SEI BATANGHARI 170 Medan Telp 8442158

BURSA

LOWONGAN

DICARI

GURU BHS. INGGRIS. Hub. SITUATIONAL EC. Jl. KL. Yos Sudarso No 21 K (Depan Pajak Glugur Kota). (Jam 15.00 - 16.00 WIB) LOWONGAN KERJA

Lembaga Perguruan Sri Langkat Tanjung Pura membutuhkan tenaga pendidik untuk mengajar di SMP, SMA dan SMK Sri Langkat Tahun Ajaran 2012/2013. Tenaga Pendidik yang dibutuhkan : - Kimia - Fisika - Matematika - Sosiologi - Geografi - Bahasa Indonesia - KKPI/TIK - Produktif Multimedia - Produktif TKJ - Produktif Otomotif - Produktif Adm. Perkantoran - Penjaskes - Sejarah - Seni Budaya Bagi Anda berminat segera kirimkan berkas lamaran dan CV Anda Ke : LEMBAGA PERGURUAN SRI LANGKAT Jl. MADRASAH No. 7 TANJUNG PURA KAB.LANGKAT 20853

LOWONGAN KERJA DIBUTUHKAN Beberapa Orang Staf : 1.Pengajar B. Inggris (sesuai jurusan) 2.Pengajar Matematika (sesuai jurusan) 3.Administras (Sarjana/SMU/sederajat) Hub : Lembaga Pend. Bahasa Plus Matematika PROSPECT LEARNING CENTRE JL. Mandala By. Pass No. 108-E Telp.(061) 7354994 JL. Pasar VII No. 32 Telp. (061) 738 3025 (Lamaran Diterima paling lambat1 minggu setelah iklan ini terbit)

BURSA

FOTO COPY

AKADEMI KEBIDANAN SEHATI MEDAN MENERIMA MAHASISWA BARU TAHUN AKADEMIK 2013 / 2014 ANGKATAN VIII � JALUR KHUSUS � JALUR UMUM

A K R E D I TA S I BA N - P T

IZIN DEPKES MEDAN NO. 440.446.1/8609/IV/2006, IZIN DEPKES RI NO. HK.03.2.4.1.03138, IZIN MENDIKNAS NO. 2791/D/T/2008 SYARAT PENDAFTARAN :

WNI, TAMATAN SMA/SMU (IPA & IPS) MADRASAH ALIYAH (MA), SMK, SMEA, SPK, DAN SEMUA JURUSAN, D1 KEBIDANAN, D3 KEPERAWATAN

UJIAN SELEKSI :

GEL. I: BULAN JULI 2013 GEL. II: BULAN AGUSTUS 2013 GEL. III: BULAN SEPTEMBER 2013

Untuk Informasi dapat Menghubungi:

HP. 0852 6181 5907 - 0852 6181 5807

PRESTASI: AKBID SEHATI BERHASIL MERAIH JUARA PERTAMA LOMBA CERDAS CERMAT DALAM RANGKA HUT IKATAN BIDAN INDONESIA (IBI) KE 62 SE SUMATERA UTARA BERTEMPAT DI POLTEKKES KEMENKES RI TGL. 14 S/D 15 JUNI 2013 KLINIK TERAPY/ ALAT VITAL

MAK EROT YANG TERUJI DAN TERBUKTI

(Untuk reumatik & asam urat)

Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041

Dengan H. TEJA SAEFUL Cucu Asli Mak Erot Bersama Ust. M. OTONG

Bila anda ingin perkasa ingat jangan sampai salah masuk, carilah yang benar-benar pewaris ilmu mak Erot sejati, karena keahlian H. Teja Saeful sudah tidak diragukan lagi dalam menangani keluhan seputar alat vital bahkan pengobatan H. Teja Saeful sudah terkenal di seluruh Indoneisa dan kota-kota besar di Indonesia, sudah ribuan pasien tertolong dipengobatan Mak Erot ini yang aman tanpa efek samping, bahkan dimanca negara sekalipun pengobatan Mak Erot SUDAH TIDAK DIRAGUKAN LAGI KEBERHASILANNYA, INGAT untuk kaum pria jangan sampai anda terhina kaum wanita karena kondisi alat vital yang kurang sempurna KHUSUS WANITA: KHUSUS PRIA: - Ingin punya keturunan - Ejakulasi dini - Memperkencang & - Impotensi memperbesar payudara - Memperpanjang “Alvit” - Keras dan tahan lama, dll - Memperbesar “Alvit” DIJAMIN 100% KONSULTASI UMUM: HANYA TEMPAT - Buka aura KAMI KLINIK - Cari jodoh MAK EROT - Pelaris - Mencari orang hilang JL. LAKSANA NO. 55 J MASUK DARI JL. AMALIUN YUKI SIMPANG RAYA MEDAN (PRAKTEK TETAP) HP: 0812 4038 333 - www.terapialatvitalmakerot.com

BURSA

G R : Garasi LB : Luas Bangunan KM : Kamar Mandi LT : Luas Tanah KP : Kamar Pembantu RM : Ruang Makan KT : Kamar Tidur RT : Ruang Tamu SHM: Sertifikat Hak Milik

RUKO

DIJUAL

/

DISEWAKAN.

4,2 x 30 M. Jl. W. Iskandar No : 285 Panyabungan Mandailing Natal. Harga Rp 600 Juta. Sewa Rp 30 Jt/Th. 2 (Dua) Thn Rp 50,-Juta. Dua Lantai Keramik. Telp, Tersedia Air PAM, Listrik 900 WAT. Hp 0812 6312 3368. Hp 0821 6026 2419 DIJUAL CEPAT Rumah Dan Tanah Ukr 15x30M Jl. Abdul Rukun Komp. Satelit Graha/BTN (SAMPING KTR DPR) Kp. Baru. Kwala Simpang - Aceh Tamiang. Hp 0823 6886 0437

RUMAH DIJUAL LT. 295M2(23,55 x 12,65)/12,4), LB. 170 M2, SHM, 4 KT, RT, RM, R. Shalat, 2 KM, Garasi, PAM, PLN, Lt. Keramik, Skllg Pagar B. Bata/ Besi. Harga Rp 950 Jt/ Nego. Di Jl. Amaliun Gg. Amal Bakti No. 7 Medan. Telp (061) 7361092

DIKONTRAKKAN

RumahDi Perumahan Bumi Asri Medan. 3 KT, 2 KM. Hub 0877 3901 0875 LANGSA

Dijual Ruko Langsa Jalan Iskandar Muda 2 1/2 Tingkat 6x25 Meter. Siap Huni, Hak Milik. Peminat Serius Hub : 081-160-2432 (Boleh Perantara Dapat Komisi)

TANAH DIJUAL

Sebidang Tanah dan Bangunan diatasnya U 30m x 30m. Terdiri dari 3 bangunan. Bangunan utama permanen u 10m x 20 m. Jl. H. Iwan Matsum Rantau Prapat (Belakang Kantor Bupati). Harga Nego. Hub : 0812 6333 5688

Hub: (061) 7365429 - 7362887

BURSA

KESEHATAN

PROPERTY

Informasi Pembaca Bursa Property

Dpt Diperoleh di Sumatera - Aceh

BAKTERI SEDOT LEMAK

Turun 15 KG - 2 Gratis 1. 0813 3207 7899 KUSUK LULUR TERAPHY

MBAK ALIN BISA DIPANGGIL 0813 7739 9508

ANDA BUTUH

ALAT BANTU DENGAR ? HUB.

MELTRA HEARING AID JL. KEDIRI NO. 36 MEDAN TELP. 451.6161

SERVICE

AC

AC

ELEKTRONIK CUCI + B. PASANG

Kulkas, M. Cuci, Dispenser H u b . M a j u Te k n i k - 061.7030 118 - 0813 6244 4913

REPARASI AC, KULKAS, MESIN CUCI

Kompor Gas, Dispenser H & C TV, M. Pompa Air Sanyo, Genset Hub. SURYA TEKNIK SERVICE

Telp.

061-7725 4947 - 0813 7589 8757 Siap Ketempat

SERVICE VISTA

SERVICE : Cuci Ac+ Freon dan Bongkar Pasang Ac, Kulkas, Dispenser, Bergaransi. Hub : 0823 6611 3966

BURSA

PERABOT

TERCECER

TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 7653.2188

TERCECER

SPRING BED DIJUAL MURAH

STUK. BK 8823 Bd. No uji : MDN 09943-C. A/N : PT. Sumber Baru Asli. Alamat : Jl. Stasiun Kereta Api. Merk : Mitsubishi

TERCECER

STUK. BK 8227 BR. No uji : MDN 12162 B. A/N : Djonii. Alamat : Jl. Madong Lubis No. 19 B Medan. Merk : Mitsubishi

Spring Bed 6 kaki 2 lapis Rp. 1.150.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun

Hub Telp. (061) 661.8116 - (061) 661.6802 - 7653.2188

BURSA

ALAT MUSIK DIJUAL 2nd : BMB 55(c), Daj7 II, (c). Dar 500, 800, 1000, Spk BMB 8,10,12, Ramsa 8, yamaha 12, Power Channel 1000, 2000, 3000, 4000, w, EQ Elesis Digital, Dod 60, 30 ch, Terima Visa 0%. Jl Indragiri 25 dkt Asia Hotel Wayat. 061-7345487

BURSA

ELEKTRONIK


Agenda

WASPADA Kamis 27 Juni 2013

07:00 Dahsyat 09:00 Sinema Pagi 11:00 Intens 12:00 Seputar Indonesia Siang 12:30 Si Doel Anak Sekolahan (Rr) 14:30 Kabar Kabari 15:00 Silet 15:30 Putri Bidadari (Rr) 16:30 Seputar Indonesia 17:00 Pernikahan Dini 18:00 Jodohku 19:00 Berkah 20:00 Layar Drama Indonesia : Tukangbubur Naik Haji The Series22:15 Mega Sinema

CATATAN

07:00 SL Inbox 09:00 Halo Selebriti 10:00 SCTV FTV 11.00 Liputan 6 Terkini 12:00 SL Liputan 6 Siang 12:30 SCTV FTV Siang 14:30 SL Eat Bulaga Indonesia 16:30 SL Liputan 6 Petang 17:00 Heart Series 2 18:15 Pesantren & Rock n Roll Season 3 19:30 Love in Paris Season 2 21:00 Ustad Fotocopy 22.00 Liputan 6 Terkini 22:30 SCTV FTV Utama

07:00 Upin & Ipin Dkk 07:30 Pose 08:00 Layar Unggulan 09:30 Kisah Unggulan 11:00 Di Antara Kita 11:30 Lintas Siang 12:00 Layar Kemilau 13:30 I Drama 15:00 Top Pop 16:00 Lintas Petang 16:30 Tuntas 17:00 Animasi Spesial 18:00 Bola Bolu 19:00 Tendangan Si Madun Season 3 20:30 Raden Kian Santang 22:00 Hidayah 00:00 Premier Highlights

07:30 Perempuan Hebat 08:00 Seleb @ Seleb 09:00 KLIK! 10:00 Ngobrol Asik 11:00 New Friends 11:30 Topik Siang 12:00 Seputar Obrolan Selebriti 13:00 Bulepotan 13:30 Chhota Bheem Aka Bima Sakti 14:00 Panda Fanfare Aka Kungfu Panda 14:30 Duckula 15:00 Tom & Jerry 15:30 Curious George 16:00 Mr. Bean 16:30 Topik Petang 17:00 Suka-Suka Nizam 18:00 Pesbukers 19:30 RT Sukowi 20:30 Mel’s Update 21:30 Sinema Spesial 23:30 Cakrawala

07:00 KISS Pagi 08:00 Sinema Tv Spesial 10:00 Pagi Pagi Bagi Bagi 11:30 Patroli 12:00 Sinema Pintu Taubat Siang 14:00 HOT KISS 15:00 Fokus 15:30 Penolong Misterius 16:00 Drama Asia (Korea): Faith @ The Great Doctor 17:00 Drama Asia (Korea): Fashion King 18:00 Drama Seri Indonesia: Setulus Kasih Ibu 19:00 Sinema Indonesia 21:00 Drama Seri Keluarga: Brama Kumbara 23:00 Sinema Unggulan

07:05 Bedah Editorial Media Indonesia 08:05 8 Eleven Show 09.05 8 Eleven Show 11:05 Sisi Berita 11:30 Metro Siang 13:05 Wideshot 17:05 Metro Hari Ini 18:05 Prime Time News 20:05 Suara Anda 21:05 Top News 21:30 Economic Challenges 22:30 Sentilan Sentilun 23:05 Politika 23:30 Metro Sports

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

A7 07:30 New Ranking 1 08:30 Spektakuler 10:00 Wisata Kuliner 10:30 Reportase Siang 11:00 Insert 12:00 Bioskop Indonesia 14:00 Sketsa 15:15 Show Imah 16:30 Reportase Sore 17:00 Insert Investigasi 18:00 Ethnic Runaway 19:00 Oh Ternyata 20:00 Bioskop TRANSTV Spesial 22:00 Bioskop TransTV 00:00 Harta Tahta Wanita 00:30 Reportase Malam

07:00 Live News Apa Kabar Indonesia Pagi 09:00 EnsikloTIVI 09:30 Live News Kabar Pasar Pagi 10:00 Coffee Break 11:30 Live News Kabar Siang 13:30 Ruang Kita 14:30 Live News Kabar Pasar 15:00 Divisi Utama Liga Indonesia 2012 - 2013 17:30 Live News Kabar Petang 19:30 Kabar Utama 21:30 Live News Kabar Malam 22:30 Menyingkap Tabir 23:00 Kabar Arena 23:30 Live News Kabar Hari Ini

07:30 The Penguins Of Madagascar 08:00 Auto B Good 08:30 Sketsa Tawa 09:30 Hot Spot 10:00 Obsesi 11:00 Buletin Indonesia Siang 12:00 Serasi 13:00 Dimas dan Raka 14:00 100% Ampuh 15:30 Fokus Selebriti 16:00 Arjuna 16:30 Si Kriwil Jadi 2 17:30 Spongebob Squarepants 18:30 Night at The Museum 21:00 Konser Semangat Bersama Bank BJB 23:30 Initial D

07:30 Selebrita Pagi 08:00 Makan Besar 08:30 Gak Nyangka 09:00 Ups Salah 09:30 Spotlite 10:30 Warna 11:30 Redaksi Siang 12:00 Selebrita Siang 12:30 Si Bolang 13:00 Laptop Si Unyil 13:30 Dunia Binatang 14:00 Brownies 14:30 Tau Gak Sih 15:00 Fish N Chef 15:30 Jejak Petualang 16:00 Redaksi Sore 16:30 Indonesiaku 17:00 Orang Pinggiran 18:00 Hitam Putih 19:00 On The Spot 20:00 Opera Van Java 22:00 Opera Van Java 23:30 Jam Malam **m31/G

SepenggalKisahKecintaan Ronaldo Pada Mangrove Diam-diam Cristiano Ronaldo punya kekasih baru, yang tidak bisa dia ajak ke berbagai pertandingan sepakbola ataupun pestapesta. Sang kekasih barunya adalah tanaman bakau alias mangrove.

Jim Carrey/nndb.com

Jim Carrey Mundur Dari Kick-Ass 2 Komedian Jim Carrey mundur dari proyek terbarunya, KickAss 2. Melalui akun Twitter @JimCarrey, ia mengumumkan pengunduran dirinya beberapa jam yang lalu. “Saya syuting Kickass sebulan sebelum peristiwa Sandy Hook dan dengan segenap nurani, saya tidak dapat mendukung tingkat kekerasannya,” kata Carrey, seperti dikutip dari laman BBC. “Saya minta maaf untuk orang lain yang terlibat dalam film ini. Saya tidak malu, tapi kejadian baru-baru ini mengubah hati saya,” tambahnya. Carrey terkenal dengan sikapnya mendukung kontrol terhadap penggunaan senjata tajam. Bulan Desember tahun lalu, 20 siswa dan enam staf Sekolah Dasar Sandy Hook di Connecticut, Amerika Serikat, tewas ditembak Adam Lanza yang baru berusia 20 tahun. Dalam film karya Jeff Wadlow tersebut, Carrey berperan sebagai Kolonel Stars and Stripes, pemimpin sekumpulan superhero. Mark Millar, pembuat sekaligus produser eksekutif film tersebut, mengatakan dirinya heran dengan keputusan Carrey dan meminta sang aktor untuk mempertimbangkan kembali. “Seperti yang kalian tahu, Jim adalah pendukung kontrol senjata dan saya menghormati pandangannya. Tetapi, saya heran dengan pengumuman mendadaknya,” tulis Millar dalam forum di situs resmi miliknya. Ia menambahkan meski akan ada ceceran darah dalam filmnya nanti, film itu tidak akan membuat penikmat yang telah mengikuti dari film pertama terkejut. Ia pun menyatakan, sama seperti Jim Carrey, ia juga ngeri dengan kekerasan. “Pada akhirnya, itu keputusannya. Tapi saya masih belum bisa mengerti dengan gagasan kekerasan dalam fiksi berakibat pada kekerasan di kehidupan nyata, seperti Harry Potter melontarkan mantra lalu ada banyak penyihir di dunia. Jim, saya suka kau dan berharap kau mempertimbangkan poin-poin di atas,” tutupnya. Universal Pictures selaku studio belum memberikan komentarnya terhadap keputusan Jim Carrey tersebut.(ant)

Adalah Menteri Kehutanan, Zulkifli Hasan, mengungkap kekasih baru CR7 itu, di Tanjung Benoa, Bali, Rabu. CR7 alias Ronaldo menjadi bintang penanaman dan pelestarian bakau, dipimpin Presiden Susilo Yudhoyono, dan disesaki masyarakat pesisir setempat. Laiknya kawasan pesisir alias maritim, Kepala Staf TNI AL, Laksamana TNI Marsetio, juga hadir, selain koleganya, Kepala Staf TNI AU, Marsekal TNI IB Putu Dunia. Jika mengurut waktu kembali pada 2005, maka kita akan maklum mengapa CR7 jatuh cinta pada bakau. Selepas bencana alam tsunami Aceh, dunia dikejutkan dengan temuan bocah Aceh yang selamat, sempat terapung-apung di batang kelapa. Martunis, bocah kelas 3 SD selamat dari terjangan gelombang tsunami raksasa itu setelah terombang-ambing selama 19 hari sampai akhirnya tersangkut di kerapatan hutan bakau setempat. Sebetulnya, kisah Martunis ini bukan hal cukup aneh dalam musibah-musibah seperti itu. Yang menyentuh hati CR7 saat itu menyaksikan berbagai laporan media massa internasional adalah bahwa Martunis memakai kaus Tim Nasional Portugal bernomor 7 dan bertuliskan nama Ronaldo di punggungnya, saat dia ditemukan dan diselamatkan. Artinya: Martunis fans Ronaldo, dan bocah Aceh itu mengerti alias paham kiprah Ronaldo selama itu. “Dari sana Ronaldo dekat dengan Martunis dan mangrove,” kata Hasan.

Novita Dewi bersama fans-nya diabadikan di Cafe ET-45 Rabu (26/6) siang

Novita Dewi Kebanjiran Job

Cristiano Ronaldo/footballwood.com Mangrove atau bakau dalam dian memanggil Martunis yang bahasa Indonesia, telah menye- kini sudah remaja dan gemar lamatkan nyawa seorang Indo- bermain sepak bola. “Ini dia nesia. Martunis. Ayo ke depan salaman Saat datang ke Aceh, tidak dengan Bapak Presiden dan Rolama setelah Martunis ditemu- naldo,” katanya. Martunis pun kan dan diselamatkan, Ronaldo maju dan menyalami Yudhomenyempatkan menemui dia yono dan Ronaldo. di Aceh dan memberinya beaDalam sambutan singkatsiswa untuk sekolah. “Martunis nya, CR7 berkata, “Terima kasih dulu dikasih handphone oleh kepada Presiden SBY. Saya seRonaldo, tapi handphone-nya nang datang ke Indonesia. Sehilang,” tutur Hasan. moga acara saya di Bali ini dapat Di mana Martunis saat ini? meningkatkan pesan penyelaDi sela acara itu, Hasan kemu- matan mangrove.”(ant)

Sukses menggapai prestasi di ajang X Faktor Indonesia, membawa berkah tersendiri buat Novita Dewi. Walaupun hanya menyandang juara kedua, namun job manggung beruntun diperolehnya bahkan dalam waktu dekat album kompilasi bersama finalis lainnya bakal dirilis. Ditemui di Cafe ET-45 Jalan Mangkubumi Medan Rabu (26/ 6), siang, Novita Dewi datang bersama managernya sebelum konser di salah tempat hang out anak muda kota ini, dia banyak bercerita seputaran karirnya termasuk pertemuannya dengan Alex Rudiart juga finalis X Faktor sekarang menjadi pacarnya. Novita mengaku, perubahan paling mendasar dirasakannya setelah menjadi finalis X Faktor adalah namanya makin dikenal masyarakat, juga tanggungjawabnya semakin besar. “Aku harus bertanggungjawab kepada penggemarku dan ini tentu beban sangat berat harus aku pikul setelah menjadi runner up X Faktor Indonesia”, ujarnya membuka pembicaraan dengan media. Putri Jack Marpaung ini mengaku, walaupun sekarang dia sudah meraih predikat bintang, tetap tidak pernah terpikirkan untuk meninggalkan lagu-lagu

Bila Arumi Kaget Duluan

HelenaBonham Ibu Peri

MENGERAHKAN segenap kemampuan akting di film terbarunya Kerasukan, Arumi Bachsin, antara lain berharap mampu mengagetkan sekaligus memberi hiburan kepada kaula muda penikmat horor layar lebar. Namun, harapan Dara cantik berdarah campuran Palembang – Bengkulu – Jerman – Belanda kelahiran Jakarta, 19 Februari 1994 ini sempat tertunda lantaran film besutan Sutradara wanita Chiska Doppert – pada 27 April silam mendadak ditarik produser BIC Pictures dari jaringan bioskop 21 walau baru dua hari diputar. “Niatnya mau menghibur sambil mengagetkan penggemar film horor, saya malah kaget duluan. Pasalnya, sudah janjian nonton film Kerasukan pada pemutaran hari ketiga de-ngan banyak teman-teman, eh filmnya mendadak ditarik dari peredaran oleh Pak Firman Bintang – Produser BIC Pictures,” papar Arumi Bachsin kepada Waspada pada jumpa pers kepastian pemutaran film Kerasukan di Gedung Pusat Perfilman Usmar Ismail Jl Rasuna Said Kuningan, Jakarta Selatan baru-baru ini. Seperti diketahui, kendati baru diputar dua hari dan mampu mendulang penonton sekitar 18 ribuan, produser BIC menghentikan pemutaran film Kerasukan, Pemicunya, ketika itu pihak jaringan Cinema 21 lebih menganakemaskan film import Iron Man 3 dengan memberi 400 layar sementara film

Aktris Helena Bonham Carter berperan sebagai ibu peri dalam film liveaction Cinderella. Dia akan beradu akting dengan Lily James (Cinderella) dan Cate Blanchett (ibu tiri), ungkap The Hollywood Reporter. Sumber mengatakan bahwa ibu peri memegang peran lebih besar daripada versi animasi Disney yang tayang pada 1950. Ibu peri ini akan menyamar menjadi pengemis tua terus memperhatikan Cinderella sebelum akhirnya mengungkapkan identitas sebenarnya. Richard Madden berperan sebagai pangeran, sementara Sophie McShera dan Holliday Grainger menjadi dua saudara Cinderella yang jahat. Pengambilan gambar film disutradarai Kenneth Branagh diperkirakan dimulai di London pada musim gugur ini. Bonham Carter juga akan memainkan peran Elizabeth Taylor dalam drama Burton and Taylor serta muncul di film layar lebar The Lone Ranger.(ant)

nasional hanya dapat jatah 77 layar. Untungnya, setelah melakukan negosiasi dan adanya rencana perbaikan sistim tata edar serta pembagian porsi film asing dan nasional yang lebih adil, film Kerasukan kembali diputar mulai 27 Juni 2013. “Alhamdulillah, setelah dua bulan ditarik – film Kerasukan bisa diputar kembali di Cinema

Arumi Bachsin 21 seluruh Indonesia mulai Kamis (27/6). Rasanya lega dan plong, karena di film horor keempat yang dibintingani ini saya mengerahkan segenap kemampuan akting, Maklum, bisa jadi film ini merupakan film terakhir diputar di bioskop sebelum melepas lajang dan terbang ke Amerika ikut suami,” tambah Arumi . * (AgusT)

Helena Bonham Carter/ fanpop.com

Batak dan tetap bersedia membawakan lagu-lagu Batak dan harus lebih memperkaya budaya Batak. “Karena orang Batak yang bikin aku besar seperti sekarang ini, ujarnya. Cuma saja setelah menjadi bagian X Faktor, Novita sekarang bernaung dibawah managemen Sony Music. Dia harus mengikuti persyaratan yang berlaku di managementnya termasuk dalam merilis album. “Kalau Sony Musik meminta aku membuat album lagu-lagu Batak kenapa tidak, karena semua tergantung mereka”, katanya. Menyinggung mengenai ajang pencarian bakat seperti X Faktor, diakuinya sangat membantu buat penyanyi pemula. Walaupun banyak imej bahwa ajang pencarian bakat hanya melahirkan penyanyi-penyanyi karbitan, namun ia melihat semua tergantung kepada manusianya juga. “Judika yang lahir dari Indonesian Idol sampai sekarang mampu bertahan”, ujarnya serius. Karena itu, Novita tidak ingin namanya tenggelam setelah masuk ajang X Faktor. Sebisa mungkin dia terus berkarya ditopang bakatnya sebagai penyanyi juga dirinya mampu menciptakan lagu. “Aku bersyukur punya talen-

ta di bidang seni, yang tak bisa lepas dari turunan orang tuaku”, katanya sembari menyatakan dia tidak terbebani nama besar Jack Marpaung sang ayah dikenal sebagai legenda penyanyi lagu-lagu Batak. Tentang Alex Rudiart sekarang menjadi pacar seriusnya, diakuinya sudah mendapat restu orang tua kedua belah pihak. Cuma saja kapan mereka melangkah ke pelaminan, Novita belum mau berkomentar, karena fokusnya sekarang masih di karirnya sebagai penyanyi. Disinggung mengenai tawaran main sinetron, Novita menyatakan, sudah ada tawaran di sinetron maupun layar lebar, Namun dia belum mau menerimanya, karena lebih suka nyanyi. “Sementara ini belum lah, masih fokus nyanyi”, tandasnya. Sebelum ikut X Faktor Indonesia, Novita Dewi dikenal sebagai penyanyi lebih sering membawakan lagu-lagu Batak dengan nama Dewi Marpaung. Dia pun sudah memiliki tiga album lagu-lagu Batak. Terakhir sebelum ikut ajang X Faktor, Novita masih sempat meluncurkan album “Boru Nauli” yang tak disangka mendapat sambutan hangat bersamaan dia ikut ajang X Faktor Indonesia.(m19)

George Lucas dan Mellody Hobson/people.com

Sutradara George Lucas Nikahi Pacar Lama Para sutradara terkenal, penggemar dan bahkan Darth Vader (tokoh dalam film Star Wars) memberi ucapan selamat kepada pencipta StarWars George Lucas Selasa atas pernikahannya dengan teman perempuan yang dipacari sejak lama, Mellody Hobson, di rumah pertanian Skywalker miliknya, di California. Pendiri media Huffington Post, Arianna Huffington mengikuti acara pernikahan Sabtu, memajang di Twitter, foto Lucas mengenakan dasi dan bunga putih dan pengantin perempuannya dalam kerudung putih, lapor Reuters. Pembuat film dengan pandangan ke depan, StarWars menikahi ketua Ariel Investment di hadapan sekelompok orang-orang dekatnya, tulis Huffington di bagian berita dan gosip. Ia mengatakan pernikahan kedua Lucas dipimpin wartawan AS, Bill Moyers dihadiri sejawat serta keluarga mempelai termasuk kolega perfilman, sutradara Steven Spielberg dan Francis Ford Coppola. Van Morrison terbang untuk tampil dalam pesta pernikahan tersebut. Tamu-tamu lainnya adalah sutradara Ron Howard, juga mencatat pada Twitter untuk memberi ucapan kepada pasangan itu. Ucapan serupa diberikan pula sejumlah rekan mempelai. Lucas,69 sebelumnya pernah menikah dengan editor film Marcia Grifin dan memiliki tiga anak angkat. Putranya, Jeff, menjadi saksi nikah sementara dua putrinya Katie dan Amanda menjadi pengiring pengantin perempuan, tulis Huffington. Ini adalah pernikahan pertama bagi Hobson berumur 44 tahun. (ant)


Nusantara

A8

WASPADA Kamis 27 Juni 2013

Korban Kebakaran Lahan Bertambah PEKANBARU (Aantara): Korban meninggal dunia akibat kebakaran lahan di Provinsi Riau bertambah menjadi dua orang, setelah Dulsani Purba yang menjalani perawatan sejak sepekan lalu, pada Selasa (25/6) petang juga meninggal dunia.

Antara

HARI ANTI NARKOTIKA SEDUNIA: Sejumlah personil Korem 072 bersama elemen masyarakat dan komunitas yang ada di Yogyakarta melakukan aksi damai dalam memperingati Hari Anti Narkotika Sedunia di Jl. Malioboro, Yogyakarta, Rabu (26/6). Kegiatan tersebut bertujuan untuk mengkampanyekan tentang bahaya narkoba kepada masyarakat.

Dulsani Purba yang seorang petani kelapa sawit asal Kecamatan Mandau, Kabupaten Bengkalis, jiwanya tidak tertolong meski telah menjalani perawatan di rumah sakit Awal Bros Pekanbaru karena kondisinya yang kritis. Dulsani meninggal dunia sekitar pukul 18:30, menurut anak kandung Dulsani, Johan Purba, saat dihubungi dari Pekanbaru, Rabu (26/6). Istri Dulsani, Laniem, telah

56 Imigran Asal Timur Tengah Diamankan JAKARTA (Waspada): Dirpolair Polda Metro Jaya amankan 56 imigran asal Timur Tengah di perairan Pulau Laki, Kepulauan Seribu, DKI Jakarta, Rabu (26/6). Penangkapan imigran asal Iran, Irak dan Pakistan itu terdiri dari 41 laki-laki, 9 perempuan serta 6 anak-anak, berawal ketika kapal patroli Polisi Satpolair Tangerang melakukan patroli di Perairan Muara Mauk, sebelah barat Perairan Pulau

Laki, sekitar jam 12:00. Kecurigaan dengan kapal motor Kian Santang yang melintas dengan tujuan Pulau Cristmas, Australia dilanjutkan dengan pemeriksaan hingga akhirnya didapatilah sejumlah imigran di dalam kapal yang bisa dikatakan kapal tradisional. Dirpolair Polda Metro Jaya Kombes Pol Makhruzi Rahman mengatakan, pasca penangkapan ke 56 imigran gelap langsung dibawa ke Markas

Ditpolair untuk dilakukan pemeriksaan. “Mereka berasal berbagai negara seperti Iran, Irak dan Pakistan,” kata Makhruzi di Markas Dirpolair Polda Mtero Jaya, Tanjung Priok, Jakarta, Rabu(26/6). Menurut Makhruzi, rombongan imigran gelap itu berangkat dari Teluk Jakarta. “Tujuannya akan menuju sebuah pulau untuk bertemu agen. Sedianya rombongan

Asupan Kalsium Di Indonesia Masih Rendah JAKARTA (Waspada): Kalsium tidak sekedar menyehatkan tulang. Lebih dari itu kalsium sangat penting bagi pencegahan berbagai penyakit seperti penyakit jantung, hipertensi, lambung bahkan depresi. “Itu karena kalsium merupakan major mineral alias mineral yang dibutuhkan dalam jumlah besar, supaya tubuh tetap sehat dan tidak mudah terserang penyakit,” kata ahli gizi dari Fakultas Kedokteran Universitas Atmajaya, Nani Djaja, SpGK, dalam seminar kesehatan tulang yang diadakan Pfizer Indonesia, di Jakarta, Rabu (26/6). Sayangnya, asupan kalsium orang Indonesia rata-rata hanya 30 persen per hari. Padahal, World Health Organization (WHO) merekomendasikan standar kebutuhan kalsium per hari sebesar 800-1000 mg per hari untuk orang usia 15-65 tahun. Bahkan untuk ibu hamil dan orang lanjut usia, kebutuhannya meningkat menjadi 1300 mg. Menurut Nanny, beberapa hal menyebabkan asupan gizi manusia Indonesia sangat rendah. Pertama adalah rendahnya konsumsi susu akibat ma-

halnya harga susu. Dari belasan negara ASEAN, konsumsi susu di Indonesia tidak sampai 12 persen. Sementara negaranegara lain seperti Malaysia, Singapura bahkan Thailand sudah di atas 20 persen. Selain itu, pola makan masyarakat Indonesia juga masih mengkhawatirkan. Kurang konsumsi sayur, buah dan kacang-kacang yang ditengarai banyak mengandung vitamin D dan magnesium masih banyak dijumpai di banyak keluarga Indonesia. Vitamin D dan magnesium sangat dibutuhkan tubuh agar penyerapan kalsium lebih baik.Tanpa vitamin D, daya serap tubuh terhadap kalsium yang dikonsumsi hanya 10-15 persen saja. “Jadi semakin baik asupan vitamin D dan zat besi atau magnesium kita, semakin baik tingkat pemenuhan kalsium dalam tubuh,” imbuh Nanny. Selain yang berkaitan dengan daya beli dan konsumsi makanan, masyarakat Indonesia juga enggan bermandi matahari pagi. Padahal, matahari adalah salah satu sumber vitamin D. “Matahari pagi adalah sumber vitamin D alami yang sangat

berlimpah di Indonesia. Sebaiknya itu dimanfaatkan,” tukas Nanny. Lebih jauh dikatakan Nanny, defisiensi atau kekurangan kalsium dapat berakibat tidak hanya pada kerapuhan tulang atau osteoporosis, melainkan juga membuat gigi mudah rusak, kram otot, hipertensi, penurunan daya pikir dan juga depresi. Bahkan hasil penelitian terkahir menunjukkan, ada hubungan langsung antara kekurangan kalsium dengan hipertensi. Efek terburuknya adalah seseorang lebih mudah terkena serangan jantung dan stroke. Itu sebabnya, lanjut Nanny, sejak usia 30-an tahun, di mana kualitas tulang dan daya tahan tubuh dalam diri manusia semakin menurun, sebaiknya asupan kalsium, vitamin D dan zat besi ditingkatkan. “Tapi sejak dalam kandungan, ibu hamil harus sudah mengonsumsi kalsium minimal 1300 mg per hari. Kualitas manusia Indonesia sangat bergantung pada asupan gizi sejak dalam kandungan,” tegas Nanny. (dianw)

Presiden DMDI Akan Hadiri Jambore Entrepreneur Di Medan MEDAN (Waspada) : Presiden Dunia Melayu Dunia Islam (DMDI) Datok Seri HM Ali Rustam akan menghadiri Jambore Entrepreneur (kewirausahaan) Remaja Masjid se-Asean di Medan, Kamis (27/6). Jambore entrepreneur itu akan memperebutkan piala bergilir Ir HM Hatta Rajasa, piala tetap Gubernur Sumatera Utara H Gatot Pujonugroho, Presiden DMDI dan piala tetap H Oesman Sapta yang akan diadakan pada 27-30 Juni di Aula Martabe Sumut. Dato Seri HM. Ali Rustam menjawab wartawan di VIP room Bandara Polonia Medan setiba dari Kuala Lumpur, Rabu (26/8) menyatakan, menaruh harapan banyak program Jambore Entrepreneur. Dia berharap akan mendapat dukungan semua pihak. Jambore tersebut, kata Menteri Besar Malaka itu salah satu upaya mempererat silaturrahmi antara negara termasuk Indonesia dan Malaysia. Pihaknya menaruh harapan, setidaknya kaum muslimin harus bermanfaat kepada orang banyak apalagi menjelang bulan suci Ramadhan, dari pada membicarakan asap-asap yang bertebaran di kawasan Malaysia dan Indonesia. Dia juga akan mendukung penuh pemberdayaan anakanak yatim terutama dalam bulan suci Ramadhan baik di kampung-kampung binaan DMDI maupun kampung tsunami. “Kita akan borong kain-kain sarung dari Medan untuk mem-

Waspada/Abdullah Dadeh

PRESIDEN DMDI Datok Seri HM. Ali Rustam bersalaman saat mendarat di Bandara Polonia Medan dari Kuala Lumpur, Rabu (26/6) sore. bagi-bagi kepada kaum muslimin di Malaysia agar dapat melaksanakan ibadah Ramadhan dengan sempurna,” kata Datuk Seri yang pada kesempatan itu didampingi Konjen Malaysia Abdul Rozein, Konsul Muda Nor Azhar Rajis, Ketua DMDI Said Aldi Al Idrus dan pejabat lainnya. Ketua Panitia Ahmad Efendi menyebutkan, dari rombongan Presiden DMDI yang akan tiba di Medan puluhan pejabat dan wirausaha asal Malaysia. “Jadi seluruh rombongan akan mengikuti jambore entrepreneur selama tiga hari. Harapan kita agar semua pemuda khususnya remaja masjid untuk mensukseskan kegiatan itu,” kata Ahmad Efendi. Said Aldi Al Idrus yang juga

Ketua Umum Remaja Masjid Pecinta Alam (Rempala) Indonesia pada kesempatan itu menyatakan jambore entrepreneur yang diadakan salah satunya guna meningkatkan hubungan atau silaturrahim yang lebih baik. Dia mengharapkan, dengan adanya kegiatan itu perlu adanya networking pemuda khususnya Rempala dalam menghadapi Economic Asean Community 2015. Di bagian lain, Said Aldi juga menyampaikan terima kasih kepada Gubsu H Gatot Pujo Nugroho yang telah mendukung terlaksananya kegiatan jambore entrepreneur ini se-Asean di Medan ini dan semua biaya murni dari DMDI dan remaja masjid pecinta alam. (m32)

imigran itu akan melanjutkan ke Autralia untuk mendapatkan suaka. Belum sampai pulau mereka keburu tertangkap,” kata Makhruzi. Dari puluhan imigran yang diamankan lanjut Mahkruzi, ada beberapa orang yang kondisi kesehatannya terganggu. “Beberapa kondisinya luka. Ada yang patah tulang dan menggunakan kursi roda,” terang Mahkruzi. Selain imigran gelap, polisi juga mengamankan tiga nahkoda kapal yakni Asnawi, 50, Kaharudin, 29 dan Darwis, 45. “Mereka sudah ditetapkan menjadi tersangka karena me-

langgar UU No. 06 tahun 2011 tentang Keimigrasian. Ancaman hukumannya maksimal 15 tahun penjara atau denda maksimal Rp1,5 miliar,” kata Mahkruzi. Salah seorang imigran bernama Umah, 26, asal Irak dengan bahasa Inggris mengatakan, rombongannya akan menuju Australia untuk mencari suaka. Alasan mencari suaka karena di negara asalnya tidak aman dan nekat menyeberangi lautan untuk mencari kehidupan lebih baik. “Saya ingin juga seperti kalian (Indonesia) hidup aman dan tenang,” katanya.(j02)

2 Siswa SPN Jambi Tewas JAKARTA (Waspada): Dua siswa Sekolah Polisi Negara (SPN) Polda Jambi tewas, 17 instruktur diperiksa intensif. Pemeriksaan terhadap 17 pelatih yang terlibat langsung dalam pelatihan terhadap 2 siswa yang tewas saat menjalani pendidikan dan latihan ketangkasan lapangan yakni Hottua Halomoan Tampubolon ditemukan tewas pada Minggu (23/6) dan Ferry Wahyudi meninggal dunia saat mengikuti latihan pendidikan pada Jumat (22/6). “Propam Polda Jambi sekarang ini sedang memeriksa 17 anggota (pelatih) SPN yang melatih para siswa didik saat peristiwa itu terjadi. Kapolda Jambi Brigjen Pol Hari Satria sedang mengevaluasi sistim pembelajaran di sana,” kata Kabag Pensat Polri Kombes Rana S. Permana di Mabes Polri Rabu (26/6). Dari hasil otopsi jasad kedua siswa kata Rana, tidak ditemukan tanda-tanda kekerasan. ”Diduga mengalami kegagalan fungsi organ vital karena suhu di Jambi saat ini sedang panas terik. Jadi kematian akibat suhu tinggi. Bukan sebab lainnya,” terang Rana. Sebelumnya siswa Halomoan sempat hilang sebelum ditemukan tewas. Saat itu dia menjalani latihan ketangkasan fisik lari cross country sejauh 6 km di lokasi SPN. Selain dua orang itu, pihak Polda Jambi mengakui sebelas orang siswa SPN masih menjalani perawatan di sejumlah rumah sakit di Kota Jambi.(j02)

lebih dulu meninggal. Dulsani dan Laniem terjebak di tengah kebakaran lahan saat keduanya hendak menyelamatkan buah sawit di kebunnya di Kecamatan Tanah Putih, Kabupaten Rokan Hilir, pada 18 Juni lalu. Suami-isteri yang tinggal di Jalan Sakobatik Kecamatan Mandau, Kabupaten Bengkalis ini dikebumikan berdampingan. “Ayah dikuburkan disamping makam ibu saya di Desa Tebing Tinggi Kabupaten Deliserdang, Sumatera Utara,” kata Johan,19. Johan mengatakan, dokter RS Awal Bros menyatakan kondisi ayahnya sudah tidak bisa diselamatkan lagi. Dulsani mengalami luka bakar tingkat tiga di kedua kaki, telapak tangan dan bokongnya. Selain itu Dulsani juga menghirup terlalu banyak asap

sehingga mengganggu sarafnya dan membuatnya terus dalam kondisi koma. Dia mengatakan, pihak keluarga kini masih meninggalkan hutang biaya perawatan mendiang Dulsani. “Kami masih berunding mengenai biayanya dengan pihak rumah sakit,” kata Johan yang enggan menyebut jumlah hutang mereka di RS Awal Bros. Dia mengatakan, hingga kini belum ada bantuan sepeser pun dari pemerintah daerah untuk meringankan kesulitan keluarganya. Padahal, harta keluarganya berupa lahan kelapa sawit seluas dua hektare juga sudah musnah akibat kebakaran lahan. Awalnya Dulsani sempat dibawa ke Rumah Sakit Pemerintah di RSUD Arifin Achmad.

Namun saat dibawa ke sana tidak tersedia ruangan ICU, sehingga keluarga terpaksa membawanya ke rumah sakit swasta di Awal Bros Pekanbaru. Menkokesra Agung Laksono saat kunjungannya ke Pekanbaru meninjau kebakaran lahan pada Jumat (21/6) mengatakan, Pemerintah Provinsi Riau harus membantu korban kebakaran lahan dan hutan melalui dinas kesehatan. Menurut Agung, baik korban luka ringan dan luka parah, akibat kebakaran lahan harus dibantu oleh pemerintah. “Hanya satu anggota DPRD Riau yang menjenguk ayah saya dan memberi bantuan secara pribadi. Tapi setelah itu tidak ada lagi, dari pemerintah daerah juga belum ada,” kata Johan.

Kemenhub Ingin Setiap Bandara Terapkan Prinsip Ramah Lingkungan JAKARTA (Waspada): Kementerian Perhubungan (Kemenhub) menginginkan setiap Bandara di Indonesia menerapkan sistem eco-airport atau bandara yang menerapkan prinsip-prinsip ramah lingkungan berkelanjutan. “Karena Indonesia termasuk negara yang punya inisiatif menyangkut sisi lingkungan berkelanjutan,” kata Direktur Jenderal (Dirjen) Perhubungan Udara Kemenhub, Herry Bhakti di Jakarta, (26/6), dalam konferensi pers International Green Aviation Conference 2013 yang akan di adakan di Nusa Dua, Bali tanggal 2-3 juli. Menurutnya, Pemerintah telah menyatakan komitmennya untuk menurunkan tingkat emisi karbondioksida (CO2) seperti yang dinginkan dunia internasional. Karena itu Indonesia telah terpilih sebagai pengamat dalam kelompok kerja International Civil Aviation Organization (ICAO) yang membahas tentang konsep

lingkungan di dunia penerbangan secara global. “Ke depan kami akan menuju kepada eco-airport atau smart airport. Di Eropa saat ini telah di ujicoba pada pesawat komersial yaitu satu tanki di isi avtur dan satunya lagi di isi bio fuel. Ujicoba di Eropa ini sudah berjalan enam bulan,” terang Harry. Direktur Operasi Garuda Indonesia Novijanto Herupraptomo menyatakan, saat ini Indonesia masih mencari energi baru terbarukan sebagai bahan bakar pesawat. Sekarang ini pesawat masih menggunakan avtur sebagai bahan bakarnya yang berasal dari fosil dan tidak terbarukan. Sementara pesawat Garuda saja mengkonsumsi lebih dari 1 miliar juta avtur per tahun. “Dilihat dari historikal Garuda sejak tahun 2000-2013, jumlah avtur yang kami konsumsi berkisar antara 700 juta liter sampai 1,2 miliar liter per tahun,” katanya.

Menurut Novijanto, pihaknya berencana menggunakan bio fuel atau bio avtur sebagai bahan bakar. “Tapi sampai saat ini, aviation bio fuel belum diproduksi massal untuk pasar penerbangan. Tapi kita tetap akan lakukan ujicoba dengan bio fuel pada tahun 2016,” ujarnya. Garuda mentargetkan penggunaan bio fuel hingga dua persen pada 2016 - 2018. Penggunaan bahan bakar terbarukan itu ditargetkan meningkat menjadi tiga persen dalam kurun 2010 - 2020. “Untuk penggunaan 1% bio fuel setara dengan sepuluh juta liter bahan bakar untuk pesawat,” jelas Heru. Menurut Novijanto, satu persen atau sepuluh juta liter bio fuel yang digunakan sudah cukup untuk mensubstitusi konsumsi avtur. Dia pun berharap akan ada produsen bio fuel di Indonesia. “Dengan catatan, harganya kompetitif dan unsur kimianya sama dengan avtur,” paparnya.(J03)

Rektor IAIN Sumut Bertemu Wantimpres MEDAN (Waspada): Untuk mendapat dukungan yang luas IAIN-SU menjadi Universitas Islam Negeri (UIN), Rektor IAIN SU Prof. DR. Nur Ahmad Fadhil Lubis melakukan berbagai pendekatan dan lobi-lobi termasuk dengan Dewan Pertimbangan Presiden khusus dalam bidang agama DR. K. H. Makruf Amin yang juga Ketua Harian MUI Pusat beberapa waktu lalu. Dalam pertemuan tersebut Nur Ahmad Fadhil Lubis mengajukan berbagai argumentasi peralihan IAIN SU menjadi UIN seperti pertimbangan kelembagaan dan perluasan pengembangan. Dengan menjadi UIN maka program studi akan diperluas tidak seperti selama ini yang hanya berkisar empat fakultas yakni Dakwah, Syariah, Tarbiyah dan Ushuluddin. Nanti akan ada Fakultas Hukum, Ekonomi, Teknik, Pertanian, Fisipol, Komunikasi dan lainnyanya termasuk kedokteran dalam jangka panjang. Alasan lainnya, lanjut rektor yang alumni UCLA Amerika ini, dengan berdirinya UIN akan terhapus dikhotomi ilmu, sehingga tidak ada lagi istilah ilmu umum dan ilmu agama karena memang semua ilmu bersumber dari Tuhan. Dalam kesempatan ini juga disampaikan, terjadi progres yang cepat, karena kini sudah diadakan penandatangan MoU dengan Islamic Development Bank dan secara kelembagaan telah terjadi perubahan nomenklatur fakultas seperti Fakultas Dakwah berubah menjadi Fakultas Dakwah dan Komunikasi, Fakultas Syariah menjadi Fakultas Syariah dan Ekonomi Islam. Mudah-mudahan rencana besar ini tidak menghadapi ganjalan teknis dan non teknis seperti pergantian kepemimpinan. Demikian harapan Wantimpres dan sekaligus berjanji akan memberikan dukungan sepenuhnya bagi pengembangan IAIN Sumatera Utara.(m26)

Dua Anggota DPR PAW Dilantik JAKARTA (Waspada): Ketua DPR RI Marzuki Alie melantik dua orang anggota DPR RI baru dari Fraksi Partai Demokrat sebagai bagian dari proses pergantian antar waktu (PAW). Kedua anggota DPR baru itu adalah Iman Tjahya Abdullah dan Nuki Sutarno. Tjahya adalah anggota DPR pengganti Taufiq Effendy, mantan Wakil Ketua Komisi II DPR RI yang berhenti menjadi anggota Fraksi Partai Demokrat, karena pindah partai ke Partai Gerindra. Taufiq adalah juga mantan Menteri Pendayagunaan Aparatur Negara. Sementara Nuki Sutarno menggantikan mantan anggota Komisi V dari Fraksi Partai Demokrat, Achmad Syafi’i. “Proses pergantian antarwaktu ini sesuai dengan UU yang berlaku,” ujar Ketua DPRRI Marzuki Alie saat mengambil sumpah kedua anggota DPR hasil PAW itu di Gedung DPR RI, Jakarta, Rabu (26/6). Marzuki berharap agar kedua anggota DPR yang baru bisa terlibat dalam pelaksanaan tugas dan fungsi DPR di bidang legislasi, budgetting dan pengawasan. “Saudara wajib menuruti apa yang dikatakan dalam sumpah jabatan,” ujar Marzuki Alie.(aya)

Waspada/Muhammad Zeinizen

PARA ahli waris Anwar Karim berfoto bersama Rektor USU Prof. Dr. dr. Syahril Pasaribu, DTM&H, M.Sc(CTM), Sp.A(K) usai peresmian dan serahterima gedung perkuliahan di Fakultas Ekonomi USU, Rabu (25/6).

24 Ribu Alumni FE USU Tersebar Di Nusantara Gedung Anwar Karim Building FE USU Diresmikan MEDAN (Waspada): Dekan Fakultas Ekonomi USU Prof Azhar Maksum menyatakan, sebagai salah satu dari 14 fakultas yang ada di lingkungan USU, FE USU sudah berdiri sejak 1961 dan telah melahirkan hampir 24.000 orang alumni dan tersebar di seluruh nusantara. Hal itu disampaikannya saat peresmian dan penyerahterimaan Gedung kuliah Fakultas Ekonomi (FE) Universitas Sumatera Utara , Anwar Karim Building, Rabu (25/6). Peresmian dan penyerahterimaan bangunan tiga lantai bantuan dari PT Musim Mas itu dilakukan oleh putra Anwar Karim, Bahtiar Karim yang juga pimpinan PT Musim Mas kepada Rektor USU Prof. Dr. dr. Syahril Pasaribu, DTM&H, M.Sc(CTM), Sp.A(K) di Fakultas Ekonomi USU. Hadir dalam kesempatan selain jajaran pimpinan PT Musim Mas di antaranya HRD Musim Mas Uniarti, alumni FE USU yang juga pimpinan Yayasan Syafiatul Amaliah Sofyan Raz, PR III USU Raja Bongsu Hutagalung, PR IV Prof Ningrum Natasya Sirait, PRV IrYusuf Husni, jajaran dekan dan pembantu Dekan se USU, Kahumas USU Bisru Hafi, mewakili Pangdam I/BB, mewakili Kapoldasu, Kapolrestabes AKBP Nico Alfinta, Kapolsekta Medan Baru Kompol Calvinj Simanjuntak (sedang dipro-

mosikan menjabat Kasat Reskrim Polrestabes Medan, serta undangan lainnya. Saat ini, menurut Azhar Maksum para alumni tersebut sudah menyebar ke berbagai institusi pemerintahan maupun swasta dan tidak terkecuali di PT Musim Mas.“Saat ini Fakultas Ekonomi (FE USU) mengasuh sekitar 6.000 orang mahasiswa yang tengah mengikuti pendidikan di jenjang Diploma 3 dan Strata 1 dibeberapa departemen atau program studi yang diasuh oleh 104 dosen,’’urai Azhar Maksum. Namun diakuinya, jika dibandingkan dengan berbagai Fakultas Ekonomi dari PTN yang tergabung dalam PT BHMN, pihaknya mengakui fasilitas di FE USU termasuk sarana gedung dan kelengkapannya masih tertinggal. Oleh karenanya Azhar Maksum menyampaikan terimakasih atas kepedulian keluarga besar Anwar Karim yang diwakili putranya Bahtiar Karim dan PT Musim Mas yang telah berkenan untuk membantu sarana di FE USU ini. Selain itu, Azhar Maksum juga mengungkapkan, dalam mengatasi kekurangmampuan daya listrik, pihak Musim Mas juga telah menyumbangkan satu unit mesin genset dengan kapasitas 100 KVA yang digunakan untuk mengantisipasi aliran listrik yang selalu padam. FE USU, urai Azhar Mak-

sum berjanji akan memelihara, merawat dan menggunakan gedung ini seoptimal mungkin untuk kepentingan proses belajar mengajar dan berharap berbagai kekurangan fasilitas lainnya diharapkan dapat dibantu oleh PT Musim Mas. Rektor USU Prof. Dr. dr. Syahril Pasaribu, DTM&H, M.Sc(CTM), Sp.A(K) dalam sambutannya menyampaikan rasa terimakasihnya kepada PT Musim Mas khususnya ahli waris Anwar Karim, Bahtiar Karim yang sudah memberikan sumbangan gedung serbaguna yang menurut rektor nantinya akan dipakai sebagai sarana belajar mengajar. Rektor mengakui jika kepedulian perusahaan refineri terbesar kedua di Indonesia mau memberikan bantuan bukan hanya gedung, namun juga mesin genset. Seraya tidak lupa berterimakasih kepada Sofyan Raz, yang sudah menjembatani komunikasi dengan keluarga besar Musim Mas. Pihak Musim Mas yang diwakili salah satu unsur pimpinan antara lain menyatakan, bantuan ini merupakan salah satu bentuk kepedulian perusahan yang beroperasi di Sumut terhadap dunia pendidikan di Sumut. Pihak Musim Mas berharap ke depan, agar gedung ini benar-benar dapat dimanfaatkan terutama bagi kemajuan FE dan USU. (m49/m14)


WASPADA Kamis, 27 Juni 2013

Luar Negeri

A9

Bom Yang Ditargetkan Hakim Terkenal Di Karachi, Empat Tewas KARACHI, Pakistan (Antara/AFP): Satu serangan bom yang menargetkan seorang hakim senior Karachi pada Rabu (26/6), menewaskan sedikitnya empat orang di jalan yang sibuk pada pagi di ibu kota bisnis Pakistan, kata para pejabat. Bom meledak saat Maqbool Baqir, seorang hakim senior di pengadilan tinggi provinsi selatan Sindh, di mana Karachi adalah kota utama, melaju melewati dengan pengawal keamanannya di Jalan Burns. “Setidaknya empat orang tewas dalam serangan di Jalan Burns dan beberapa orang lainnya terluka,” kata pejabat polisi Salman Syed kepada AFP. Baqir dilarikan ke rumah sakit dengan luka kritis dan sopirnya tewas, kata polisi. “Kita tidak bisa memberikan jumlah pasti korban terluka saat ini.Tetapi saya bisa mengkonfirmasikan bahwa Hakim Maqbool Baqir menderita luka parah,” kata Syed. Polisi mengatakan Baqir adalah target. “Pada saat ini kami tidak dapat menentukan apakah itu adalah serangan bunuh diri atau bom tanaman,” kata pejabat senior polisi Ameer Sheikh kepada AFP. Baqir memiliki reputasi untuk kejujuran dan juga menjabat sebagai hakim di pengadilan khusus anti-terorisme yang dibentuk di Pakistan untuk menjatuhkan hukuman cepat untuk teroris. Karachi, satu kota berpenduduk 18 juta orang, menyumbang 42 persen dari PDB Pakistan namun penuh dengan pembunuhan dan penculikan serta telah diganggu selama bertahun-tahun oleh kekerasan etnis, sektarian dan politik.

Menlu Thai Hadiri Pertemuan Menlu ASEAN Di Brunei BANGKOK, Thailand (Antara/Xinhua-OANA): Departemen Luar Negeri Thailand akan menghadiri Pertemuan Menteri-Menteri Luar Negeri Perhimpunan Bangsa Bangsa Asia Tenggara (AMM) ke-46 di Bandar Seri Begawan, Brunei Darussalam, 29 Juni-2 Juli, menurut situs Kementerian Luar Negeri Thailand. Selain AMM, Konferensi Pasca-Menteri antara ASEAN dan Mitra Dialog, Pertemuan Menteri Luar Negeri ASEAN ke14 Plus Tiga Menteri Luar Negeri, Pertemuan KTT Menteri Luar Negeri Asia Timur ketiga dan Forum Regional ASEAN ke20 juga akan diselenggarakan. Selain menghadiri Pertemuan Menteri Luar Negeri ASEAN (AMM) ke46 Surapong Tovichakchaikul, wakil perdana menteri dan menteri luar negeri Thailand akan menghadiri pertemuan kerangka kerja sub-regional.

1.300 Orang Ditangkap Dalam Operasi Anti-Narkoba Mekong

Xinjiang Rusuh, 27 Orang Tewas BEIJING, China (Reuters): Sekelompok orang bersenjatakan pisau menyerang kantor polisi dan gedung pemerintah setempat di Xinjiang, China, menyebabkan 27 orang tewas dalam bentrok dengan polisi, kata kantor berita Xinhua Rabu (26/6). Kerusuhan di kawasan itu, kediaman minoritas Muslim Uighur, merupakan yang paling mematikan sejak Juli 2009, ketika hampir 200 orang tewas dalam kerusuhan yang membenturkan etnis Uighur dengan etnis China di Urumqi, ibukota Xinjiang. Xinhua mengatakan kerusuhan Rabu meletus pukul 06:00 pagi. Pagi di kota Lukqun, sekitar 200 km di tenggara Urumqi. Sekelompok orang menyerang kantor polisi Lukqun, gedung pemerintah setempat dan satu bangunan lain, menikam beberapa orang dan membakar beberapa kenderaan polisi, kata pejabat Partai Komunis seperti dikutip Xinhua. Sembilan polisi dan petugas penjaga serta delapan warga sipil tewas sebelum polisi menembak mati 10 penyerang, kata Xinhua. Alasan serangan tersebut belum diketahui. Banyak etnis Uighur, Muslim yang menggunakan bahasaTurki, geram terhadap apa yang mereka sebut pembatasan yang diberlakukan pemerintah China terhadap kebudayaan, bahasa dan agama mereka.China mengatakan, pihaknya memberikan kebebasan yang luas bagi Uighur dan menuduh etnis Uighur menyulut separatisme.(m23)

16 Tewas Dan 33 Cedera Dalam Serangan Bom Di Irak BAGHDAD, Irak (Antara/Xinhua-OANA): Sedikitnya 16 orang tewas dan 33 orang lagi cedera dalam rangkaian pengboman paling akhir di Irak, kata polisi. Satu bom pinggir jalan meledak di dekat lapangan sepakbola di Baquba, ibukota Provinsi Diyala di Irak Timur, menewaskan delapan orang dan melukai 18 orang lagi, kata satu sumber polisi yang tak ingin disebutkan jatidirinya kepada Xinhua Selasa. Sumbertersebutjugamengatakansatubomrakitanmeledakkan satubusminidiDaerahZafaraniyahdiBaghdadSelatan,menewaskan empat orang dan melukai 15 orang lagi. Sementara itu, di Provinsi Nineveh di Irak Barat-daya, satu serangan bom terhadap patroli Angkatan Darat Irak menewaskan empat prajurit, ia menambahkan sebagaimana dilaporkan oleh Xinhua Rabu (26/6) pagi. Sebelum serangan paling akhir itu, satu serangan terjadi di kota Tuz-Khurmato ketika dua pembom bunuh diri menewaskan 10 orang dan melukai sebanyak 50 orang lagi selama pawai masyarakat minoritas, Turmenistan, di kota tersebut, sekitar 200 km di sebelah utara Baghdad, kata satu sumber polisi setempat. Selain itu, tiga peziarah Syiah Iran tewas dan 15 orang lagi cedera ketika satu bom pinggir jalan meledakkan bus mereka dalam perjalanan mereka dari Baghdad ke Kota Suci Syiah Karbala di jalan raya utama di dekat Iskandriyah, sekitar 50 kilometer di sebelah selatan Baghdad. Pemboman pada Selasa terjadi di tengah kerusuhan yang berkecamuk dan peningkatan ketegangan sektarian, yang mencapai titik tertinggi sejak tentara AS ditarik dari negeri itu pada akhir 2011.

8 Ditangkap, Bahrain Gagalkan Rencana Pembobolan Penjara MANAMA, Bahrain (Antara/Xinhua-OANA): Delapan pria bersenjata ditangkap selama satu operasi oleh polisi Bahrain untuk menggagalkan upaya mereka guna membobol pusat penahanan, kata Kementerian Dalam Negeri Bahrain,. Kementerian tersebut menyatakan kedelapan tersangka itu ditangkap pada 21-22 Juni karena keterlibatan mereka dalam serangan tersebut, dan polisi sedang memburu seorang tersangka lain —yang kini buron. “Dua Senapan Kalashnikov, 143 peluru Kalashnikov, lima magazin yang terisi dan satu senjata api disita dari orang yang ditangkap,” katanya. Kementerian itu menambahkan penyelidik mendapati pria bersenjata tersebut telah menerima dukungan keuangan dan pelatihan dari kelompok di Iran, Lebanon dan Irak dalam serangan mereka terhadap pusat penahanan tersebut, kata Xinhua Selasa (25/6). Selain itu, “penyelidikan telah mengungkapkan para tersangka adalah anggota jaringan teror yang dikenal sebagai ‘Tentara Al Imam’ yang sebelumnya mengincar tempat penting di Bahrain”, katanya.

Nouri Bousahmein Jadi Pemimpin Sementara Libya TRIPOLI, Libya (Antara/AFP): Anggota parlemen dari kelompok independen, Nouri Bousahmein, terpilih menjadi ketua Kongres Gerakan Nasional (GNC) dan membuatnya menjadi pemimpin sementara Libya. Bousahmein merupakan orang pertama dari kelompok minoritas Berber yang memegang posisi senior di negara itu. Dia menggantikan Mohammed Megaryef, yang mengundurkan diri setelah satu undang-undang yang disahkan melarang mereka yang pernah berdinas di bawah diktator yang digulingkan Moammar Khadafi memegang jabatan politik. Bousahmein dipilih oleh majelis dalam pemungutan suara kedua setelah memimpin pada pemilihan babak pertama yang diikuti oleh sembilan kandidat. Dia memperoleh 96 dari 184 suara, unggul atas Al-Sherif al-Wafi, dari kelompok independen juga yang meraih 80 suara. Berdasarkan peraturan GNC, lembaga eksekutif dan legislatif tertinggi di Libya, mayoritas sederhana diperlukan untuk pemilihan presidennya. Dua partai utama di negara itu, Partai Keadilan dan Konstruksi (PJC) dukungan Ikhwanul Muslimin, dan Aliansi Pasukan Nasional yang liberal tidak mengajukan calon. Pada awal sidang Selasa, PJC menyerukan pemungutan suara ditunda hingga satu komisi terbentuk untuk melaksanakan undangundang baru itu tapi ditolak olehWakil Presiden GNC Jomaa Atiga. Setelah pemungutan suara itu, Atiga memulai pertemuan hingga Selasa petang. Bousahmein adalah lulusan Fakultas Hukum Universitas Benghazi dan bekerja di kompleks kimia Abu Kamash dari 1978 hingga 2000.Dia terpilih untuk menjadi anggota GNC dari kampung halamannya Zuwara dan menjadi rapporteur majelis itu. Etnis Berber berjumlah sekitar 10 persen dari populasi Libya. Mereka hidup menderita di bawah rezim Qaddafi dan terus merasa termarjinalkan di bawah rezim baru.Mereka hidup di pegunungan sebelah barat ibu kota itu atau seperti orang-orang Tuareg, di gurun di bagian selatan Libya.

The Associated Press

PARA PETUGAS kepolisian Pakistan berkumpul di lokasi satu ledakan bom di Karachi, Pakistan, Rabu (26/6). Satu bom yang ditujukan pada seorang hakim senior di Karachi, kota di selatan Pakistan, telah mencederainya dan menewaskan beberapa petugas keamanan Rabu, kata seorang pejabat senior pemerintah.

Menlu Ekuador Ricardo Patino:

Keputusan Mengenai Snowden Dapat Makan Waktu Bulanan KUALA LUMPUR, Malaysia (AP/Antara News): Menteri Luar Negeri Ekuador mengatakan Rabu (26/6) pemerintahnya dapat membutuhkan waktu berbulan-bulan untuk memutuskan apakah memberikan suaka kepada buronan pembocor data Badan Keamanan Nasional AS (NSA) Edward Snowden. Menlu Ricardo Patino membandingkan kasus Snowden dengan yang dialami pendiri WikiLeaks Julian Assange, yang telah diberi suaka di Kedutaanbesar Ekuador di London. “Keputusan untuk Asange membutuhkan waktu dua bulan, jadi janganharapkankamiakanmembuat satu keputusan secepatnya saat ini,” kata Patino dalam satu temu pers saat berkunjung ke ibukota Malaysia, Kuala Lumpur.

Ketika ditanya apakah Ekuador akan memberikan perlindungan kepada Snowden pada saat dia mempertimbangkan permohonan suakanya, Patino mengatakan melalui penerjemahnya bahwa jika Snowden “pergi ke Kedubes, kemudian dia akan membuat satu keputusan.” Patino menolak untuk mengatakan apa kriteria yang digunakan Ekuador untuk mengeluarkan keputusannya, namun dia menambahkan bahwa pemerintahnya akan ‘mempertimbangkan semua risiko,’ termasuk kemungkinan tindakan itu akan merusak perdagangan dengan AS dan perekonomian negaranya. Berada di bandara transit Presiden RusiaVladimir Putin mengungkapkan bahwa pembocorintelejenASEdwardSnowden masih berada di kawasan transit bandara Moskow, menolak se-

ruan bagi ektradisinya ke AS. Dalam campur tangan pertamanya atas pengejaran Snowden yang menarik perhatian dunia, Putin melukiskan mantan kontraktor intelejen itu sebagai‘orang bebas’ yang kedatangannya di Rusia ‘sepenuhnya tak diharapkan’ otoritas Rusia. Pemberitahuan dramatis itu mengakhiri dua hari misteri di manakeberadaanSnowdenyang membocorkan program pemantauanmasifASkepadamediadan sekarang dicari oleh penguasa AS. “Benar bahwa Tuan Snowden datang ke Moskow,” kata Putin dalam jumpa pers ketika mengunjungi Finlandia Selasa (25/6). “Bagi kami, ini sama sakali tak diharapkan.” “Dia tiba sebagai penumpang transit dan tidak memerlukan visa atau dokumen lainnya. Diabolehmembelitiketdanpergi kemana saja dia suka. Dia tidak

Perang Saudara Di Syria Telah Menelan Korban 100.000 Jiwa BEIRUT, Lebanon (AP/ Antara/AFP): Lebih dari 100.000 orang tewas di Syria sejak meletusnya pemberontakan di negara itu Maret 2011, kata Observatorium Syria untuk Hak Azasi Manusia Rabu (26/6). Observatorium itu mengatakan jumlah korban tewas kini 100.191 orang, dengan setidaktidaknya 36.661 warga, termasuk lebih dari 3.000 wanita dan lebih dari 5.000 anak-anak berusia di bawah 16 tahun. Kelompok yang mengandalkaninformasinyadarijaringan aktivis, dokter dan pengacara di lapanganseluruhSyriaitumengatakan 18.072 petempur pemberontak tewas. Di pihak pemerintah, kelompok itu melaporkan setidaknya 25.407 tentara, 17.311 milisi propemerintah dan 169 anggota milisi Hizbullah Lebanon

yang berperang membantu tentara Syria tewas. Kelompok itu mencatat 2.571 orang yang tidak dikenal tewas dalam pertempuran di seluruh negara yang porakporanda itu sampai 24 Juni. Angka itu adalah satu manifestasi tingkat aksi kekerasan yang melanda negara itu, yang dihantam perang saudara dimulai dengan demonstrasi yang menuntut penggantian pemerintah. Pemerintah Suriah menanggapi dengan keras unjuk-unjuk rasa itu, dimulai dengan tindakani kekerasan berdarah yang melanda seluruh negara itu dan menimbulkan kecemasan timbulnya kekacauan di kawasan itu. Singkirkan teroris Angkatan bersenjata Syria melanjutkan operasinya melawan kelompok-kelompok teroris bersenjata di Homs dan pe-

desaan serta menyingkirkan sejumlah teroris. Satu sumber militer mengatakankepadawartawanSANA bahwa tentara sepenuhnya mengendalikan lapangan gas al-Sha’er di pedesaan Palmyra dan membunuh para teroris di daerah. Tentara menewaskan sejumlah teroris di wilayah al-Qarabees, al-Khaldyehdanal-Qusourdikota Homs. Unit militer juga mengejar kelompok teroris bersenjata di daerah perdesaan al-Wa’er, Kiseen, Talbeseh, Deir busuk, Eyon Hassein,al-GhantodanBeitHajjo di Homs dan kerugian besar ditimbulkan pada teroris. Tentara menghancurkan gudang senjata teroris di Lattakia. Sebuah unit angkatan bersenjata menghancurkangudangamunisi di pedesaan Lattakia dan membunuh sejumlah teroris. (m10)

The Associated Press

MELIHAT KORBAN BANJIR. Warga India berdiri di dekat satu gerbang bandara yang ditempeli beberapa pengumuman khusus dan gambar-gambar dari orang yang hilang di Jollygrant, di negara bagian Uttarakhand, India, Rabu (26/6). Para prajurit paramiliter Rabu menemukan lagi 20 mayat dari satu kaki bukit di utara India di mana satu helikopter yang membantu usaha penyelamatan korban banjir jatuh saat melakukan misi penyelamatan orang-orang yang terkucil akibat banjir, demikian menurut kepala AU India.

melintasi perbatasan negara, sebagai penumpang transit dia masih di ruang transit,” kata Putin. Snowden dijadwalkan menumpang pesawat satu penerbangan ke Kuba Senin dan dia dilaporkan sedang mencari suaka di Ekuador. Tetapi dia tidak pernah melakukannya dan Putin sepertinya membenarkan bahwaorangyangdicariitumasih belum memiliki rencana perjalanannya kemana. “Tuan Snowden orang bebas, segera memilih tujuan akhirnya, lebih baik untuk kami dan untuk dirinya,” kata Putin. AS sebelumnya mendesak Moskow untuk menggunakan segalacarauntukmengusirSnowden, yang dilaporkan tiba bandara Sheremetyevo Moskow dari Hongkong Minggu. Namun Putin menyatakan bahwa Rusia hanya mengekstradisi warga asing ke negara-negara yang memiliki perjanjian ekstradisiformal.“Kamitakpunya perjanjian sejenis itu dengan AS,” kata dia, menyebut tuduhan-tuduhan AS bahwa Rusia melanggar undang-undang ‘tak masuk akal dan sampah.’ Ketika berbicara di Jeddah, MenteriLuarNegeriASJohnKerry menyeru Rusia ‘tenang’ dan menyerahkan Snowden, dengan menyatakan Washington tidak mencari-cari‘konfrontasi.’ Menlu Rusia Sergei Lavrov membantah sebelumnya Selasa pagi bahwa Moskow‘terlibat’dalamrencanarencanaperjalananmantanteknisi Lembaga Keamanan Nasional (NSA) itu yang berusia 30 tahun. Perselisihan tersebut berisiko mempertajam ketegangan antaraWashington dan Moskow serta Beijing pada saat mereka berusaha mengatasi perbedaanperbedaan untuk mengakhiri konflik di Suriah. Peraturan transit di laman bandara Sheremetyevo menyebutkanbahwawarganegaraasing dapat tetap di bandara hingga 24 jam tanpa visa Rusia dan harus memiliki tiket untuk tujuan mereka selanjutnya. Namun tak ada pejabat Rusia yang bersedia memberikan penjelasan atas hal ini dalam kasus Snowden. AS: Punya dasar usir Snowden Gedung Putih Selasa bersikeras bahwa Rusia memiliki dasar hukum yang jelas untuk mengusir buronan pembocor Edward Snowden, setelah Presiden Vladimir Putin sebelumnya menolak tuntutan AS. “Sementara kita tidak memiliki perjanjian ekstradisi dengan Rusia, ada dasar hukum yang jelas untuk mengusir Mr Snowden,” kata Jurubicara Keamanan Nasional Caitlin Hayden kepada AFP. Hayden mengatakan bahwa Snowden, saat ini berada di fasilitas transit di bandara Moskow, bisa diusir atas dasar dokumen perjalanan dan penundaan tuduhan terhadap dirinya. “Oleh karena itu, kami meminta pemerintah Rusia untuk mengambil tindakanuntukmengusirMrSnowden tanpa penundaan dan untuk membangun kerja sama penegakan hukum kita yang kuat, terutama sejak pemboman Marathon Boston,” katanya. (m10)

BEIJING, China (Antara/Xinhua-OANA): Polisi dari China, Laos, Myanmar dan Thailand telah menangkap 1.300 tersangka dan menyita 3,9 ton obat-obatan selama kampanye anti-narkoba dua bulan yang dimulai April, kata Kementerian Keamanan Umum Selasa (25/6). Polisi menyita 29 senjata api, 797 peluru, dan 78,7 ton bahan kimia yang digunakan untuk memproduksi narkoba selama kampanye, menurut Kementerian. Polisi juga menyelesaikan 1.037 kasus terkait narkoba dalam kampanye, kata kementerian itu. Dikatakan sering terjadinya kejahatan narkoba di Sungai Mekong telah efektif diatasi. Kampanye bersama melawan perdagangan narkoba, berjudul“Safe River,” dilaksanakan dari 20 April - 20 Juni. Sungai Mekong, yang mengalir melalui China, Laos, Myanmar, Thailand, Kamboja dan Vietnam, meru-pakan rute perdagangan utama di Asia Tenggara.

Israel Tunjuk Dubes Wanita Untuk Negara Islam TEL AVIV, Israel (Waspada): Carmela Shamir telah ditunjuk sebagai Dutabesar Israel untuk Uzbekistan. Shamir menjadi diplomat perempuan pertama dari Negeri Yahudi yang berdinas di negara Islam. Jurubicara Kementerian Luar Negeri Israel Yigal Palmor mengatakan, tidak ada alasan khusus bagi Israel untuk mengirim seorang kepala perwakilan diplomatik perempuan ke negara Islam. Shamir merupakan salah seorang diplomat terbaik yang sudah dinominasikan di posisi itu. Dalam menjalankan tugasnya di Taskent, Uzbekistan, Sharmir akan didampingi oleh wakilnya yang juga merupakan diplomat perempuan, Hagit Mualem. Selama berdinas di Kementerian Luar Negeri Shamir juga menduduki posisi-posisi penting, perempuan itu sempat menjabat sebagai direktur riset kebijakan luar negeri. Saat ini, Shamir menggantikan posisi Dr Hillel Newman yang menjadi Dubes Israel di Uzbekistan pada 2008. Penunjukkan Shamir juga sudah disetujui oleh Pemerintah Uzbekistan. Shamir akan segera menunjukkan surat kepercayaannya pada Presiden Islam Karimov yang sudah menguasai Uzbekistan sejak Uni Soviet runtuh di 1990. “Ada 12 perempuan yang memimpin misi Israel di luar negeri dan beberapa duta besar perempuan akan memulai tugasnya di luar negeri, secepat mungkin,” ujar salah seorang pajabat Kemlu Israel Yossi Regev, seperti dikutip Ynet, Rabu (26/6). Seperti diketahui, Uzbekistan merupakan salah satu negara Asia Tengah yang didominasi warga Muslim. Lima persen warga di negara bekas Uni Soviet itu menganut agama Kristen Orthodoks Rusia.

Myanmar Larang Majalah Time YANGON, Myanmar (AP): Pemerintah Myanmar melarang majalah Time edisi pekan ini yang menurunkan berita utama soal pendeta Buddha bernama Wirathu. Televisi pemerintah mengumumkan bahwa keputusan ini diambil untuk mencegah munculnya kembalinya kerusuhan SARA di negara tersebut. “Kami melarang majalah Time edisi 1 Juli untuk dicetak dan dijual (di Myanmar) agar tidak terjadi lagi kerusuhan ras dan agama. Kami juga melarang edisi tersebut dalam bentuk foto kopi,” kata Ye Htut, juru bicara pemerintah kepada kantor berita AFP. Komite khusus di Kementerian Dalam Negeri yang dibentuk untuk mengatasi kerusahan SARA mengatakan laporan Time bisa mengganggu upaya pemerintah mewujudkan rasa saling percaya di antara anggota komunitas Muslim dan Buddha. Sampul Time menampilkan foto Wirathu dengan judul berita The Face of Buddhist Terror atau wajah teror Buddha. “Kami melarang majalah Time agar tidak terjadi lagi kerusuhan ras dan agama.” Desakan boikot orang Islam Wirathu dikenal sebagai pemimpin gerakan biksu radikal yang mengatakan bahwa kelompok minoritas Muslim mengancam kemurnian ras dan keamanan nasional Myanmar. Dia mendesak pembatasan perkawinan antara warga Muslim dan Buddha dan juga menyerukan boikot bisnis yang dijalankan orang-orang Islam. Wirathu sendiri menegaskan bahwa dirinya adalah orang yang suka damai, meski di laporan Time dia dikutip mengatakan “saatnya sekarang untuk bergerak dan membangkitkan amarah”. Kantor presiden mengatakan tulisan di majalah Time mencoreng citra agama Buddha. Hampir 250 orang tewas dan ribuan lainnya mengungsi, sebagian besar warga Muslim, akibat kerusuhan agama dalam setahun terakhir. Dalam kerusuhan itu, warga Buddha memasuki desadesa, membakar rumah dan masjid, menurut kantor berita The Associated Press.(m10)

Pertemuan Keluarga Bahas Mandela Berlangsung Panas PRETORIA, Afrika Selatan (Waspada): Mantan Presiden Afrika Selatan Nelson Mandela masih dalam kondisi kritis dan terus dirawat di rumah sakit di Pretoria. Pertemuan keluarga yang membahas kondisi Mandela dikabarkan berlangsung panas. Mandela dirawat di rumah sakit karena menderita gangguan pada paru-paru, jantung dan ginjalnya. Dokter yang merawatnya mengatakan, kondisinya tidak berubah sejak dirawat awal bulan ini. Tetapi di kediaman Mandela, anggota keluarganya berkumpul dalam suasana suram. Napilisi Mandela mengatakan, dirinya datang untuk membahas “masalah penting” mengenai pahlawan anti-apartheid itu, demikian dilaporkan Rabu (26/6). Menurut beberapa sumber, pertemuan yang diadakan di Qunu itu berlangsung panas. Tidak dijelaskan apa yang sebenarnya terjadi dalam pertemuan keluarga ini. Di Rumah Sakit Pretoria, Mandela yang kini berusia 94 tahun terus berjuang untuk nyawanya. Mandela terus ditemani oleh sang istri, Graca Machel. Kondisi Mandela yang sakit kemungkinan besar membuat pertemuannya dengan Presiden AS Barack Obama batal. Pihak Gedung Putih menyatakan, Obama belum tentu akan menjenguk mantan Presiden Mandela dalam kunjungannya itu. Obama pernah bertemu dengan Mandela pada 2005. Namun, saat itu Obama belum terpilih sebagai Presiden AS. Sebelum Mandela jatuh sakit, banyak pihak menganggap akan terjadi pertemuan bersejarah antara Obama dan Mandela. Peristiwa itu mempertemukan presiden kulit hitam pertama Afsel dengan presiden kulit hitam pertama AS. (ok)


Sport

A10

WASPADA Kamis 27 Juni 2013

Strategi Azzurri FORTALEZA, Brazil (Waspada): Absennya striker andalan Mario Balotelli, memaksa allenatore Cesare Prandelli kerja keras meracik strategi terbaik Italia untuk menghadapi Spanyol pada semifinal Piala Konfederasi 2013. Apalagi, bek Ignazio Abate pun harus absen karena belum pulih dari cedera bahu. Menurut laporan La Gazetta dello Sport, Rabu (26/6), Gli Azzurri terpaksa akan menggunakan formasi 1-3-4-2-1. Sistem pertahanan tiga bek ini sempat diterapkan Gli Azzurri ketika menahan 1-1 El Matador pada laga penyisihan grup Euro 2012. Posisi di depan kiper sekaligus kapten Gianluigi Buffon, didominasi trio bek Juventus Andrea Barzagli, Leonardo Bonucci dan Giorgio Chiellini. Posisi wingback akan ditempati Emanuele Giaccherini danChristianMaggio.Linitengah kembali dimotori Daniele De Rossi (AS Roma) dan Andrea Pirlo (Juventus), yang masingmasing sudah kembali dari

akumulasi kartu dan cedera. Alberto Gilardino menjadi striker tunggal, didukung dua gelandang serang Antonio Candreva dan Claudio Marchisio dalam laga di Fortaleza, yang turut ditayangkan langsung tvOne dinihari nanti mulai pkl 02:00 WIB. “Kehilangan Balotelli merupakan kerugian. Kami semua tahu seberapa kuat Balotelli dan dia juga ingin membalaskan dendamnya kepada Spanyol,” jelas Marchisio melalui Football Italia. “Namun gol Gilardino akan berbicara untuknya (Balo). Dia (Gilardino) pemenang Piala Dunia dan saya yakin dia akan melakukannya dengan baik,” tegas gelandang andalan Super Juve itu.

Marchisio juga mengaku, Azzurri masih mencari komposisi terbaik untuk bisa mematikan Xavi Hernandez dan Andres Iniesta, yang menjadi motor serangan La Furia Roja. “Mereka merupakan yang terbaik di posisinya,” pujinya. “Kami tahu kekuatan Spanyol tergantung pada kemampuan mereka menjaga bola, itulah yang dalam beberapa hari terakhir kami upayakan untuk mengatasinya,” katanya menambahkan. Italia telah mengadakan sesi latihan secara tertutup bagi fotografer dan media hanya dalam waktu 15 menit, guna menjaga kerahasiaan strategi andalan Prandelli untuk menjajal pasukan Vicente Del Bosque. Menilik performa Fernando Torres cs sepanjang tujuh tahun belakangan, terutama di penyisihan grup Piala Konfederasi, Prandelli merasa, skuadnya akan sangat kesulitan untuk mengimbangi permainan tiki taka La Roja.

Supaya tidak terlalu tegang, Prandelli malah berseloroh mengatakan, Italia bakal membawa bola sendiri supaya tak perlu repot-repot merebutnya dari kaki anak asuh Del Bosque. “Untuk mengalahkan Spanyol kita harus membawa bola lainnya dan bermain dengan dua bola di lapangan,” canda mantan pelatih AC Parma dan Fiorentina tersebut. “Sangat sulit mengambil bola dari mereka. Yang jelas Spanyol tim kuat dan sangat sulit mengalahkan mereka,” ujarnya lagi kepada Soccerway. Untungnya setelah menjalani masa istirahat selama beberapa hari, playmaker Pirlo menunjukkan tanda-tanda siap dimainkan di Fortaleza. PIrlo terlihat fit di sesi latihan kemarin dan dokter tim Italia Enrico Castellacci yakin dia punya peluang besar untuk melawan Matador. (m15/vvn/ldgs/fi/sw)

Prioritas Casillas GELANDANG Daniele De Rossi (kanan) latihan mengatasi beban badan di Fortaleza, Brazil, Rabu (26/6). -AP-

Ramos Gemas Isu Pesta Seks Pique Cs FORTALEZA (Waspada): Bek Sergio Ramos gemas dengan tuduhan miring media Brazil tentang penyebab beberapa pemain Spanyol kemalingan pekan lalu di Recife. Isu Gerard Pique cs melakukan pesta seks melalui permainan stik poker, menurut kekasih Elisabeth Reyes (foto) itu, sungguh telah mencoreng nama baik skuad El Matador di Piala Konfederasi 2013. Karena dampaknya bisa merusak konsentrasi tempur La Furia Roja menghadapi semifinal lawan Italia dinihari WIB nanti di Fortaleza, Ramos pun mendesak Federasi Sepakbola Dunia (FIFA) mengusut tuntas penyebar isu miring tersebut. “Kami berharap FIFA menindak para pembohong itu. Membuat-buat kisah seperti ini sebuah tindakan serius,” tegas bek serba bisa Real Madrid tersebut. “Kami berharap hukum bisa menempatkan mereka pada tempatnya (penjara),” tambah Ramos, seperti dilansir Super Sport, Rabu (26/6). Sebelumnya, beberapa pemain Spanyol dikabarkan menjadi korban pencurian di hotel tempat mereka menginap.

fabwags.com

Ramos sangat gemas, sebab pelaku pencurian itu disebutkan lima wanita panggilan Brazil yang diundang berpesta semalam suntuk di kamar para pemain. Banyak yang menduga, tuduhan ini merupakan salah satu siasat media Negeri Samba untuk mengusik fokus pasukan Vicente Del Bosque. Pasalnya, tuan rumah Brazil dan Spanyol sebagai juara Piala Dunia 2010 serta Piala Eropa 2008 dan 2012, paling difavoritkan untuk bertemu pada final

Piala Konfederasi 2013. “Saya tidak tahu apakah itu strategi dari mereka, tapi tim nasional tidak akan goyah oleh cerita tidak penting seperti itu. Dan Brazil telah menyambut kami dengan baik,” tepis Ramos. La Roja akan reuni final Euro 2012 melawan Gli Azzurri, duel itu nantinya akan dipimpin wasit Howard Webb. Wasit plontos asal Inggris ini terakhir kali memimpin laga Spanyol pada final Piala Dunia 2010, saat skuad Del Bosque menang 1-0 atas Belanda lewat gol tunggal Andres Iniesta. (m15/vvn/ss/fifa)

FORTALEZA (Waspada): Entrenador Vicente del Bosque menjadikan Iker Casillas sebagai prioritas starter di bawah mistar Spanyol, saat menjajal Italia pada semifinal Piala Konfederasi 2013 dinihari WIB nanti di Fortaleza, Brazil. “Anda bisa lihat statistik yang ada, Casillas sudah bermain lebih dari 140 laga untuk Spanyol. Saya rasa Pepe baru bermain 27 kali,” jelas Del Bosque melalui AS, yang dikutip Rabu (26/6). “Semua kiper kami sesungguhnya sangat bagus, namun Casillas merupakan kiper nomor satu,” tambah mantan pelatih Real Madrid tersebut. Padahal sebelumnya di tiga laga babak penyisihan Grup B, Del Bosque sudah membagi rata jam tanding Casillas, Pepe Reina dan Victor Valdes. Casillas mentas melawan Uruguay, Reina menghadapi Tahiti, Valdes versus Nigeria. “Jika Anda benar-benar ingin tahu siapa yang kemungkinan besar bermain, saya memilih Casillas.Tapi saya tegaskan, ketiganya merupakan kiper hebat dan semuanya bisa saja dimainkan,” dalih Del Bosque. Untuk lapangan tengah, La Furia Roja kembali mengandalkan gelandang Xavi Hernandez sebagai motor permainan. Xavi merupakan otak sukses El Matador menggasak Gli Azzurri 4-0 pada final Euro 2012 lalu di Polandia-Ukraina. “Xavi pemimpin kami di atas lapangan, pemain yang me-

Ronaldo-Irina Pamer Mesra DENPASAR (Waspada): Cristiano Ronaldo dan kekasihnya Irina Shayk, menyempatkan diri pamer kemesraan sebelum terbang ke Indonesia untuk kampanye hutan bakau Bali. Keduanya memang ibaratkan berbulan badu, sejak La Liga Primera berakhir bulan lalu dan Real Madris selaku klub pemilik Ronaldo, belum melakukan pemusatan latihan untuk menyambut musim kompetisi 2013-2014. Ronaldo dan Irina terus mengunjungi tempat-tempat terindah di dunia. Keduanya seakan ingin menunjukkan hubungan asmara mereka sangat mesra dan hot, kendati Ronaldo sempat dilanda rumor perselingkuhan dengan seorang model seksi Brazil,

Andressa Urach. Sebagaimana dikutip dari The Sun, Rabu (26/6), pasangan superstar sepakbola dan super model itu setidaknya telah menikmati liburan di Miami, Amerika Serikat. Setelah itu mereka terbang ke New York. Di kota Big Apple, superstar Portugal berumur 28 tahun itu kembali pamer kemesraan dengan kekasih seksinya yang berusia 27 tahun. Keduanya foto di salah satu jalanan yang terkenal di New York dengan pakaian yang cukup merangsang. Mereka juga tak lupa mengunggah foto mesranya saat berada di jet pribadi melalui akun facebook (foto), sebelum bertolak ke Indonesia. Ronaldo kini sedang berada di Bali untuk kampanye penanaman hutan

facebook

bakau. Mantan winger Manchester United dan Sporting Lisbon itu baru diangkat sebagai duta mangrove oleh Yayasan Artha Graha Perduli. Kampanye bakau Ronaldo juga diikuti Presiden RI Susilo Bambang Yudhoyono

Malaga Pensiunkan 22 MADRID (Antara/AFP): Pemilik Malaga Sheikh Ab-

AP

dullan bin Nasser Al-Thani, sekali lagi kembali memancing kontroversi melalui akun twitter miliknya. Pasalnya, Al-Thani mengklaim bahwa dirinya akan memensiunkan nomor punggung 22 yang dikenakan gelandang serang Isco (foto) sepanjang musim lalu. “Nomor punggung 22

tidak akan tersedia untuk pemain lain manapun di Malaga CF sebagai penghormatan terhadap Isco,” tulis Al-Thani, seperti dikutip Rabu (26/6). Bintang muda Spanyol berusia 21 tahun itu diyakini akan menyelesaikan urusan

dan Ibu Ani Yudhoyono di Taman Hutan Raya (Tahura) Telaga Waja Benoa, Bali. “Saya senang datang ke Indonesia. Saya berharap bisa memberi dorongan untuk menyelamatkan hutan bakau di Indonesia terutama di Bali,”

tutur Ronaldo. Irina tidak tampak menemani sang kekasih, cewek cantik Rusia itu disebutkan istirahat penuh di kamar hotelnya untuk kemudian menikmati keindahan alam Pulau Dewata. (m15/vvn/sun)

ngelola tim dari dalam dan mendikte permainan. Tentu saja saya akan berbicara dengan dia,” beber Del Bosque. Karena laga ini ibaratkan reuni final Euro 2012, striker Fernando Torres mengaku, duel bakal berjalan sangat sulit, sebab Italia juga mengemban misi balas dendam. “Final Brazil kontra Spanyol, nanti dulu karena kami akan berpikir untuk Italia. Mari kita selalu menjaga langkah demi langkah dan tidak membuat

kesalahan yang sama,” tegas Torres dalam Football Italia. “Pertarungan antara Brazil kontra Spanyol adalah laga yang dinanti-nantikan orang, tetapi kami harus menghargai Uruguay dan Italia yang juga bermain bagus,” lanjut striker Chelsea tersebut. Italia asuhan allenatore Cesare Prandelli, menurut Torres, bisa saja akan memainkan sebuah pertandingan yang membuat La Roja banyak melakukan banyak kesalahan.

“Tahun lalu adalah referensi, kami tahu apa yang harus kami lakukan. Namun sebuah tim dengan sekumpulan pemain hebat akan membuat mereka (Italia) berbahaya,” ramal mantan bomber Atletico Madrid dan Liverpool itu. “Jika mereka (Italia) telah terluka pada tahun lalu, mereka akan menjadi sangat berbahaya. Ketika mereka harus bersaing mereka akan bersaing,” pungkas Torres. (m15/goal/as/fi)

Ancelotti Incar Cannavaro MADRID (Waspada): Entrenador anyar Carlo Ancelloti (foto kiri) mengincar Fabio Cannavaro (foto kanan) sebagai calon asistennya di Real Madrid. Menurut agen Cannavaro, Enrico Edele, Rabu (26/6), kliennya dalam posisi sangat strategis untuk mendukung kinerja sekaligus mempercepat proses adaptasi Ancelotti di Santiago Bernabeu. Pasalnya, mantan bek andal dan kapten Italia pemenang Piala Dunia 2006 itu pernah tiga musim membela Madrid. Cannavaro juga mantan bek muda andalan Ancelotti saat membesut AC Parma pada era 1990-an. “Sudah ada perbicangan telepon. Saya tidak mengetahui keputusan yang diambilnya,” jelas Edele kepada Radio Kiss Kiss. “Tapi, Cannavaro memang ingin menjadi pelatih dan mendapat pengalaman dari pelatih karismatik yang tahu bagaimana menangani tim besar,” ujarnya lagi. Ancelotti sendiri sudah dihadirkan El Real secara resmi kepada media kemarin siang di Bernabeu. Pelatih asal Italia berusia 54 tahun itu diboyong dari Paris Saint-Germain, yang juga telah mengangkat Laurent Blanc sebagai pelatih baru musim mendatang. Mantan bos Juventus, AC Milan dan Chelsea itu, menjadi pilihan utama Presiden Real Florentino Perez untuk menggantikan Jose Mourinho. Dia hadir dengan CV mengesankan, pernah menjuarai Eropa, Italia, Inggris dan Prancis. Bersama Don Carlo, El Real akan menjalani

realmadrid.com

Sebelum Kampanye Bakau

KIPER Spanyol Iker Casillas (kiri) berlatih serius disaksikan pelapisnya Victor Valdes di Fortaleza, Brazil, Rabu (26/6) pagi WIB. -AP-

pengalaman baru setelah dalam setahun terakhir di bawah Mourinho penuh gejolak dan ternyata gagal memenangkan trofi utama. Rekam jejak Ancelotti di Liga Champions kunci utama untuk menarik Perez, yang ingin memenangkan Piala Eropa ke-10 sebagai tujuan utama. Kedatangan Ancelotti itu juga cenderung sebagai sinyal awal pergerakan besar Madrid di bursa transfer. Sejauh ini Los Blancos hanya menggunakan haknya membeli kembali pemain Spanyol U21 Dani Carvajal dari Bayer Leverkusen serta meminjam Casemiro dari Sao Paulo. Pembelian Isco dari Malaga dengan harga 30 juta euro (39 juta dolar AS) juga diharapkan selesai minggu ini. Real juga dikaitkan dengan kepindahan Gareth Bale dari Tottenham Hotspur dan Luis Suarez dari Liverpool. (m15/rkk/afp/rtr)

Mignolet Tak Gentar Saingi Reina kepindahannya ke Real Madrid akhir pekan ini. Fulus yang diterima Malaga untuk biaya transfer pemain bernama lengkap Francisco Roman Alarcon Suar e z i t u disebut-sebut sekitar 30 juta euro. Al-Thani berencana untuk menghormati sang pemain, meski faktanya Isco baru bergabung dengan klub Andalusia itu dua tahun silam dari Valencia. Pebisnis Qatar itu juga menghiasi halaman-halaman depan surat kabar atas komentar-komentarnya di twitter, April lalu. Ketika itu dia mengklaim bahwa tersingkirnya Malaga di tangan Borussia Dortmund pada perempatfinal Liga Champions, disebabkan karena rasisme yang merupakan bagian dari UEFA.

LONDON (Waspada): Simon Mignolet (foto) menegaskan, tak gentar bersaing dengan Pepe Reina untuk memperebutkan posisi sebagai kiper utama Liverpool. “Kompetisi itu sesuatu hal yang baik,” klaim mantan penjaga gawang Sunderland itu dalam situs resmi Liverpool, Rabu (26/6). “Saya selalu bersaing di manapun saya berada. Di Belgia dengan tim nasional, di Sunderland dengan Craig Gordon dan Keiren Westwood yang merupakan kiper internasional,” jelas Mignolet. The Reds secara resmi telah mengikat Mignolet dengan kontrak berdurasi lima tahun. Sedangkan Reina yang kini membela Spanyol di Piala Konfederasi 2013 Brazil, menegaskan belum mau mandah dari An-

field. “Sekarang, situasinya sama dengan Pepe dan Brad Jones. Itu hal bagus, menjadi kompetitif dan berlatih sekuat tenaga, sehingga memberikan yang terbaik buatmu,” papar Mignolet. “Pepe merupakan kiper berpengalaman yang telah membuktikan banyak hal sepanjang tahun. Ke depan saya ingin bekerjasama dia, sama dengan yang akan saya lakukan dengan Brad dan pelatih kiper,” tambah pria kelahiran 6 Maret 1988 tersebut. Mignolet juga mengaku, sudah tidak sabar untuk berada di bawah mistar gawang Si Merah sekaligus ingin menciptakan clean sheet. “Saya tidak pernah gugup. Saya percaya diri dengan kemampuan yang saya miliki,” tekadnya. Sebelumnya, Reina sendiri

mengaku siap bersaing dengan Mignolet. “Saya menerima dia (Mignolet) dengan senang hati. Setiap tim pasti punya persaingan di dalam skuadnya,” tutur mantan kiper Real Madrid itu. “Saya menyambut itu dengan positif. Saat ini saya sangat senang berada di Liverpool. Saya juga merasa nyaman, kedatangan Mignolet tidak mengubah apa pun,” optimisme Reina. Mignolet datang dari Sunderland dengan nilai transfer sembilan juta pound (13,9 juta dolar). Kiper Belgia itu menjadi pemain keempat yang dikontrak The Reds di bursa transfer musim panas ini, setelah bek Kolo Toure (Manchester City), Luis Alberto (Sevilla) dan Iago Aspas (Celta Vigo). Manajer Brendan Rodgers menginginkan tambahan kekuatan setelah mengalami mu-

sim lalu berakhir sangat mengecewakan. Merah tanpa piala, berada di urutan ketujuh Liga Premier dan gagal ke kompetisi Eropa. Mignolet lebih 100 kali mengawal gawang Sunderland, sejak pindah dari klub St. Truiden (Belgia) pada Juni 2010 dengan nilai dua juta pound. “Saya gembira setelah kami berhasil mengontrak salah satu penjaga gawang terbaik di kompetisi liga. Simon gabung dengan klub tempat dia akan memiliki kesempatan untuk menunjukkan kemahirannya serta mengembangkan bakatnya,” beber Rodgers. Belanja Rodgers bahkan belum selesai, karena dia masih menginginkan bek andal Sporting Lisbon, Tiago Ilori, yang baru berusia 20 tahun. Juga gelandang 24 tahun Henrikh Mkhitar-

Reuters

yan dari klub raksasa Ukrainia, Shakhtar Donetsk. (m15/okz/sky/rtr)


Sport

WASPADA Kamis 27 Juni 2013

A11

Menpora Minta PSSI Tegas JAKARTA (Waspada): Menteri Pemuda dan Olahraga (Menpora), Roy Suryo, meminta PSSI dan PT Liga Indonesia selaku pengelola kompetisi Indonesian Super League (ISL) untuk tegas terhadap setiap tindakan anarkis yang terjadi. Penyataan Menpora disampaikan seusai melakukan pertemuan dengan pengurus Persib Bandung terkait insiden perusakan bus pemain yang dilakukan oknum suporter Persija

Jakarta beberapa waktu lalu. Pertemuan dilakukan di Kantor Kementrian Pemuda dan Olahraga, Senayan, Jakarta, Rabu (26/6), Roy menggelar pertemuan dengan beberapa

pengurus Persib, di antaranya Manajer Persib Umuh Muhtar, Risha Adi Wijaya (Direktur PT PBB), Muhammad Farhan (Direktur Marketing dan Promosi Persib) serta Kuswara (Komisiaris PT PBB). “Pertemuan dengan Persib untuk mengumpulkan datadata terkait kejadian pada Sabtu (22/6) lalu. Kami hanya ingin membantu, bukan untuk intervensi,” kata Roy kepada wartawan.

“Kami ingin mengumpulkan data sebanyak mungkin untuk memberi masukan kepada PSSI dan aparat kepolisian. Data ini juga untuk evaluasi mendalam khususnya kepada aparat keamanan yang menangani insiden tersebut,,” lanjut Roy. Masih kata Roy, insiden penyerangan bus pemain Persib tidak seharusnya terjadi. Pasalnya, laga melawan Persija Jakarta yang tadinya akan dimainkan di Stadion Utama Gelora

Persidi Tertunda, PSDS Kandas KISARAN (Waspada): Persidi Idi masih harus menunda kepastian lolos tidaknya dari fase Grup I Divisi I Liga Amatir Indonesia XVIII, setelah ditahan Aceh Utara FC 1-1 di Stadion Mutiara Kisaran, Asahan, Rabu (26/6). Laga lainnya, Persal Aceh Selatan menang telak 3-0 atas PSDS Deliserdang melalui dua gol Andre Kurniawan dan satu gol Febri Yulianto. Harapan PSDS berarti kandas untuk mendampingi Bintang Utara. Sedangkan Persidi masih akan menunggu hasil pertan-

dingan Kamis (27/6) ini. Aceh Utara FC bermain dengan target lolos degradasi, langsung unggul 1-0 pada menit kedua melalui gol Muhammad Basir. Tertinggal satu gol, Persidi langsung meningkatkan serangan. Malapetaka bagi Aceh Utara terjadi pada paruh babak pertama saat Muhammad Basir mendapat kartu merah akibat akumulasi dua kartu kuning. Unggul jumlah pemain, Persidi menguasai permainan. Namun hingga turun minum, skor 1-0 untuk Aceh Utara FC

tetap bertahan. Babak kedua, Persidi terus mendominasi serangan, hingga akhirnya menyamakan skor lewat gol pemain pengganti, Mujiburrahman. Keberuntungan kembali menghinggapi Persidi ketika Agusmadi dikeluarkan wasit. Alhasil, Aceh Utama pun hanya tampil dengan sembilan pemain, tetapi keunggulan jumlah pemain tidak mampu dimanfaatkan Persidi. Hingga pertandingan berakhir, skor bertahan 1-1. Kamis (27/6) ini, PSTS Tan-

jungbalai menghadapi PS Pidie Jaya dan tuan rumah PS Bintang Jaya Asahan melawan Aceh Utara FC. Di Grup II, PSSA Asahan gagal lolos grup setelah tuan rumah PS Siak bermain imbang 1-1 atas PS Kwarta di Stadion Kampung Rempak, Siak, Rabu (26/6). Hasil lainnya, Medan United menang 1-0 atas PSTeluk Kuantan. Dengan begitu, maka PS Siak dan PS Kwarta melaju ke babak berikutnya setelah tampil sebagai juara dan runner-up

UTI Pro Sumut Kirim 60 Atlet

Waspada/Dedi Riono

KONTINGEN taekwondoin UTI Pro Sumut diabadikan bersama di Bandara Polonia Medan, jelang keberangkatan menuju Yogyakarta, Rabu (26/6) pagi. bet medali emas di ajang internasional itu. Dia tidak memungkiri persaingan sangat ketat, tetapi dengan materi dan persiapan maksimal para atlet, Bobby optimis Sumut berprestasi. “Kami mohon dukungan doa masyarakat Sumut dan semoga dukungan akan mengalir

Waspada/Sapriadi

PECATUR Asahan, Safarius Dian Samosir dan Gideon Siagian, bersama Ketua Percasi Syahril Samrao dan Ketua KONI Asahan Nurkarim Nehe saat akan berangkat ke Medan, Rabu (26/6).

di Yogyakarta. Kita tahu banyak perantau asal Sumut yang bermukim ataupun yang berse-

Klasemen Sementara Grup I Bintang Jaya Persidi Persal PSTS Pidie Jaya Aceh Utara PSDS

5 6 6 5 5 5 6

4 3 2 2 1 1 1

1 1 1 1 2 2 2

0 2 3 2 2 2 3

9-3 11-7 10-9 4-6 6-7 4-8 4-8

13 10 7 7 5 5 5

Klasemen Akhir Grup II PS Siak PS Kwarta PSSA Asahan Medan United Bungo Tebo Teluk Kuantan Poslab

6 6 6 6 6 6 6

5 4 4 2 1 0 0

1 2 1 1 2 2 1

0 0 1 3 3 4 5

9-4 15-7 16-6 7-7 4-9 5-13 2-12

16 14 13 7 5 2 1

Grup II. Sedangkan Poslab Labuhanbatu terdegradasi ke Divisi II musim depan. (a31/a15)

Waspada/ist

SEJUMLAH poster dan baju PSMS bernomor 25 digantung di pagar kediaman Indra Sakti Harahap, Rabu (26/6).

Pemain PSMS Datangi Rumah Indra MEDAN (Waspada): Tidak memperoleh gaji, belasan pemain, ofisial dan managemen PSMS PT Liga Indonesia mendatangi rumah Indra Sakti Harahap yang terletak di Jalan Sering Medan Tembung, Rabu (26/6). Mereka datang dengan memasang poster di pintu gerbang masuk rumah Ketua Umum PSMS PT Liga Indonesia itu, salah satunya bertuliskan permintaan gaji segera dibayar. Selain

kolah di sini,” ucap Bobby mengaku siap member bonus bagi taekwondoin berprestasi. (m42)

Semifinal Suguhkan Laga Ulangan Piala Wali Kota Binjai BINJAI (Waspada): Binjai Putra berhasil menundukkan Tandem Putra 3-0 dalam pertandingan babak enam besar turnamen sepakbola Piala Wali Kota Binjai di Stadion Binjai, Rabu (26/6). Atas kemenangan itu, Binjai Putra pun tampil sebagai juara Grup D untuk melaju ke semifinal. Tiket babak empat besar juga diraih Bintang Muda yang mengalahkan Tunas Jati 1-0. Dengan begitu, laga semifinal pada Jumat (28/6) besok, merupakan partai ulangan penyisihan Grup A antara Binjai Putra dan Tunas Jati. Demikian halnya dengan semifinal kedua pada Sabtu (29/ 6), akan mempertemukan Bintang Muda dan Tandem Putra. Laga kedua tim juga menjadi partai ulangan, mengingat keduanya sudah bertemu di fase penyisihan. Manajer Tim Binjai Putra, Awang dan Ucok Etek Jaya, mengaku tak ingin menganggap enteng Tunas Jati yang sudah dikalahkan 2-0 dalam laga penyisihan sebelumnya. Di fase grup, Tandem Putra pun menang 2-0 atas Bintang Mudas. (a04)

MEDAN (Waspada): Sebanyak 64 tim SSB berasal dari sejumlah kabupaten/kota di Sumut bersaing dalam festival sepakbola Bintang Johor Cup III di Lapangan Kelapa Kuning, Jl STM Ujung Medan, mulai Rabu (26/6). “Festival ini ajang meningkatkan pembinaan, khususnya membentuk mental pemain usia dini yang kuat dan selalu siap berkompetisi,” ujar Wakil Ketua PS Bintang Johor, H Irsal Fikri SSos, saat membuka resmi turnamen. Ditambahkan, festival tersebut mendapat sambutan positif dan dukungan penuh Pembina SSB Bintang Johor, Drs H Asrul Azwar MM yang juga menjabat Manajer Timnas U-23 dalam

persiapan SEA Games 2013 di Myamar. “Festival sepakbola Bintang Johor Cup sudah digelar sebanyak tiga kali. Ini menjadi bukti SSB Bintang Johor sangat mendukung peningkatan pembinaan pemain usia dini lewat kompetisi yang rutin, mengingat pembinaan tidak cukup dengan latihan saja, tapi dibutuhkan kompetisi untuk menguji mental,” pungkas Irsal. Ketua Panpel, Effendi Harahap, melaporkan 64 tim yang bersaing dibagi dalam tiga kategori pertandingan, yakni U-11, U-12, dan U-13. Babak penyisihan sampai perempatfinal digelar hingga Sabtu (22/6), sedangan semifinal dan final berlangsung Minggu (30/6).

Asahan, Safarius Dian Samosir dan Gideon Siagian, turut memperkuat tim Sumut dalam kejuaraan tingkat nasional di Asrama Haji Pondok Gede Jakarta, 27 Juni-7 Juli 2013. Ketua Percasi Asahan, Syahril Samrao, mengatakan pihaknya merasa terhormat dengan kepercayaan yang diberikan Percasi Sumatera Utara kepada kedua atlet tersebut mengikuti kejuaraan berlevel nasional. “Kita bangga dengan atlet binaan Asahan bisa melaju bertanding di pentas nasional. Semoga keduanya mampu memberikan prestasi terbaik dan mendapatkan gelar Master Percasi (MP),” jelas Samrao, Selasa (25/6) malam. Dian dan Gideon merupakan bagian dari kontingen catur Sumut yang totalnya berjumlah 15 orang. Kejuaraan itu akan diikuti ratusan peserta dari seluruh Provinsi di Indonesia. Ketua Umum KONI Asahan, Nurkarim Nehe SE MSP, berharap kedua pecatur Asahan mampu meraih prestasi terbaik bagi daerah. (a15)

TANJUNGBALAI (Waspada): PS Tanjungbalai old crack binaan Rolel Harahap mengagendakan pertandingan ujicoba ke Malaysia dan Thailand. Nantinya, Zulkifli Lubis cs akan melakoni laga menghadapi Port Rangers FC dan Shongkla FC, Sabtu (29/6). “Kita rencana bertolak menuju Malaysia pada Jumat (28/ 6) besok melalui Pelabuhan Teluknibung Kota Tanjungbalai,” kata Sekretaris Tim, Hermanto Harahap, didampingi pelatih Syaifuddin YS alias Udin Putih, Rabu (26/6). Dia memaparkan, selain mempererat tali silaturahim, laga ujicoba ke Malaysia dan Thailand juga merupakan persiapan turnamen di Kota Tanjungbalai yang akan menghadirkan tim Negeri Jiran dan tim dalam negeri, September mendatang. “Rencananya kita akan undang Pro Duta ataupun Semen Padang dan klub peserta Divisi Utama asal Malaysia. Kegiatan ini akan dijadikan agenda rutin setiap tahunnya,” kata Hermanto menambahkan kegiatan tersebut sekaligus mempromosikan pariwisata, seni, dan budaya Kota Tanjungbalai. (a14)

Problem Catur

TTS TOPIK

Jawaban di halaman A2. 8

7

6

5

4

3

2

1 A

B

C

D

E

F

G

H

Waspada/Dedi Riono

WAKIL Ketua PS Bintang Johor, H Irsal Fikri SSos, menyerahkan bola kepada wasit sebagai tanda dimulainya festival sepakbola Bintang Johor Cup III, Rabu (26/6). Dalam laga pembuka kategori U-11, SSB Andespa Patumbak menang atas tuan Bintang Johor 3-0. Tiga gol Andespa di-

cetak Dito, Robbi, dan Renal. Di laga lain, SSB Mandiri mencukur SSB Hendra 4-0 melalui dua gol Yoyok dan Dedi. (m42)

Ardiles Soccer Cup Bidik Medan JAKARTA (Waspada): Dalam waktu dekat kompetisi sepakbola bergengsi untuk usia muda kembali akan digelar di Kota Medan. Hal tersebut menyusul rencana Ardiles Soccer Cup U-12 digelar di ibu kota Sumatera Utara ini. Ketua Bangkit Sport selaku penggagas event tersebut, Andre Prajitno, mengatakan pihaknya akan menggelar kejuaraan bagi usia muda tersebut di Kota Medan, setelah menggelarnya di Jakarta.

“Kami masih membicarakan dengan pihak penyelenggara di sana (Kota Medan). Prinsipnya, kami akan menggelar di Kota Medan, seperti halnya di kota-kota lain yang sudah dijalani,” kata Prajitno kepada Waspada, Rabu (26/6). Ditambahkan, untuk penyelenggaraan di Jakarta, setidaknya 25 SSB memastikan ikut ambil bagian dalam kegiatan yang direncanakan berlangsung pada 29-30 Juni nanti. Sebelumnya Ardiles Soccer Cup ini juga

peserta yang mendaftar sudah mencapai 25 SSB. “Setiap tim hanya berhak mendaftarkan 15 pemain. Format pertandingannya sendiri akan dilakukan di lapangan berukuran 50x45 meter dengan format pemain tujuh lawan tujuh dalam waktu pertandingan 2x15 menit,” ujar Taufik. Panitia tidak akan menyediakan hadiah uang. Tapi dalam bentuk lain, yakni sepasang sepatu Ardiles yang merupakan sponsor utama. (yuslan)

digelar di Semarang, Gresik, Surabaya, dan Malang. “Kegiatan ini kita lakukan untuk membantu PSSI melakukan pembinaan pemain usia dini. Karena prestasi tidak akan diraih bila pembinaan di tingkat usia dininya memble,” urai Andre, salah satu pejabat Ardiles. Dalam event kali ini, Bangkit Sport bekerjasama Asosiasi Sekolah Sepakbola Indonesia (ASSBI) sebagai pelaksana di lapangan. Ketua ASSBI, Taufik Jursal Effendi, mengatakan

IMI Sumut Dukung Program Poldasu

PS Tanjungbalai Old Crack Duet Pecatur Asahan Perkuat Sumut Jajal Malaysia Dan Thailand KISARAN (Waspada): Dua pecatur binaan Pengcab Percasi

Putih melangkah, mematikan lawannya empat langkah.

Sakti sekaligus menanyakan kejelasan gaji. Pasalnya, hingga kompetisi selesai, seluruh pemain, pelatih, dan unsur manajemen belum juga menerima gaji. “Kami rasa perlu mempertanyakannya langsung masalah ini, karena terkait penandatanganan kontrak pada November lalu, Indra Sakti tidak pernah bertemu. Kalaupun terjadi komunikasi, itu hanya lewat telepon saja,” ungkapnya. (m33)

itu, unjuk rasa juga ditandai penggantungan baju PSMS. Aksi ini mendapat perhatian warga yang melintas di daerah tersebut. Sesekali para pemain berteriak agar gaji mereka segara dibayar, karena punya keluarga yang harus mereka hidupi dan dukung kebutuhannya sehari-hari. Sekretaris Tim PSMS PT LI, Fityan Hamdi, mengatakan kedatangan mereka untuk berjumpa langsung dengan Indra

64 Tim Ikut Bintang Johor Cup III

International Best Of The Best MEDAN (Waspada): Universal Taekwondo Indonesia Profesional (UTI Pro) Sumatera Utara mengirim 60 taekwondoin dalam mengikuti turnamen internasional terbuka bertajuk Best of The Best di GOR Amongrogo Yogyakarta, 28-30 Juni nanti. Keberangkatan 60 atlet tersebut dilepas resmi Ketua Umum Pengprov UTI Pro Sumut, Nelson Simatupang, di Bandara Polonia Medan, Rabu (26/6). Nelson berpesan kepada seluruh atlet agar menjaga nama baik daerah dalam kejuaraan yang akan diikuti 26 negara itu. “Persaingan dalam kejuaraan ini sangat ketat untuk bisa meraih prestasi. Dibutuhkan perjuangan maksimal seluruh atlet agar memenangkan setiap pertandingandanmembawapulang medali bagi Sumut,” ujar Nelson. Manajer Tim, Bobby Octavianus Zulkarnaen, mengaku optimis Sumut mampu menya-

Bung Karno digelar secara tertutup alias tanpa penonton. “Tapi saat meninggalkan hotel menuju stadion, rombongan Persib dapat teror dari sekelompok orang yang diduga suporter tim lawan. Padahal, pertandingan yang akan dilakukan tanpa penonton,” ucap Roy menambahkan pihaknya meminta PSSI dan PT LI bertindak lebih tegas jika kejadian serupa terulang. (yuslan)

Waspada/Armansyah Th

SEKRETARIS IMI Sumut Drs H Zulhifzi Lubis menyerahkan bibit pohon trambesi kepada Kapolda Sumut Irjen Pol Drs Syarief Gunawan.

STABAT (Waspada): Pengprov Ikatan Motor Indonesia (IMI) Sumatera Utara pimpinan Ijeck siap mendukung sepenuhnya seluruh program yang dilaksanakan Poldasu, salah satunya “Sejuta Pohon” berupa penghijauanSekolahPolisiNegara(SPN) Hinai, Kabupaten Langkat. Dalam kesempatan itu, Ijeck yang diwakili Sekretaris Drs H Zulhifzi Lubis (Opunk Ladon) menuturkan, pihaknya akan terus mendukung dengan menyiapkan seluruh bibit berbagai jenis pohon untuk penghijauan, guna mendukung program Poldasu yang kini dipimpin Irjen Pol Drs Syarief Gunawan. “Pengprov IMI Sumut, sebagai mitra kerja Poldasu, akan tetap mendukung seluruh program mereka. Tidak hanya

OLAHRAGA

penghijauan kegiatan sosial yang berkenaan dengan masyarakat tetap akan kita dukung,” sebut Opunk. Kapoldasu mengatakan, pihaknya sangat berterimakasih atas perhatian Pemkab Langkat serta seluruh mitra kerja Poldasu, salah satunya Pengprov IMI Sumut yang menyatakan siap mendukung Poldasu seperti dengan penghijauan di wilayah SPN Hinai yang juga tempat pendidikan kepolisian baru selain SPN Sampali. Bupati Langkat, H Ngogesa Sitepu, dalam sambutannya menyatakan bersama seluruh dinas yang di jajaran Pemkab Langkat siap pula merapikan ataupun memperindah SPN Hinai yang telah rampung 80 persen proses pembangunannya. (m47)

Sudoku MENDATAR

1. Gerak badan untuk menguatkan dan menyehatkan tubuh. 5. Olahraga (Inggris). 7. Sikap bersedia mengakui keunggulan (kekuatan) lawan; Kesportifan. 11. Seri (Inggris). 12. Liga (Inggris, jamak). 14. Kode negara Jepang dari Komite Olimpiade Internasional (IOC). 15. Bunyi dering kalau dipukul (dalam pertandingan tinju). 16. Ruang besar (di sekolah dsb) untuk kegiatan olahraga dsb. 18. Angka (di belakang jersey pemain). 19. Singkatan olahraga. 20. Kode negara Kuwait dari IOC. 22. Undian dengan uang logam. 23. Kode negara Indonesia dari FIFA. 24. Satuan ukuran panjang (untuk lomba lari dsb). 26. Alat pelepas panah. 27. Kesebelasan. 28. Over Time. 30. Perbuatan; Tindakan; Olahraga. 31. Air tempat lomba boat, yacht dsb. 33. Gerakan berguling ke depan. 34. Klub sepak bola Italia yang dijuluki Ducali. 35. Sebutan lain Barcelona, klub sepak bola Spanyol.

MENURUN

2. Klub sepak bola Inggris yang jerseynya ada tulisan Emirates. 3. Ibukota Brazil, tuan rumah Piala Konfederasi 2013 dan Piala Dunia 2014. 4. Petinju legendaris AS. 5. Babak (dalam bulu tangkis, tenis). 6. Olahraga raket dengan jaring setinggi kira-kira satu meter. 8. Pertandingan diikuti beberapa regu. 9. Stadion balap sepeda. 10. Olahraga menggunakan pedang. 11. Lepaskan peluru (olahraganya Perbakin). 13. England Premier League. 17. Negara berkota Melbourne, tempat turnamen tenis internasional. 19. Lawan in. 21. Olahraga bertempur/bela diri China. 22. Pelatih (Inggris populer, selain coach) 25. Air beku, lapangan Ice Skating. 26. Adu kecepatan. 27. Penjaga gawang. 29. Technical Knock Out. 30. Perkumpulan (olah raga). 32. Kelompok; Regu.

Isi dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di kotak 3x3 bergaris tebal. Tingkat kesulitan: sulit (****), bisa diselesaikan dalam waktu tak sampai 15 menit. Jawabannya di halaman A2 kolom 1.

9

4

5 6 1 2 9

2 8 6

7

6

7

9 5

9

3 8

4

2

2

6

1 5 1

8 9 1 1 7 7

2 ****204


Sport A12 Sharapova Lengkapi Drama Wimbledon WASPADA

Kamis 27 Juni 2013

LONDON (Waspada): Babak kedua Wimbledon 2013 ditandai serangkaian kejutan dan cedera yang menyebabkan beberapa unggulan mundur dari All England Club, Rabu (26/6). Salah satunya adalah kekalahan Maria Sharapova (foto). Tampil di babak kedua, mantan juara Wimbledon dan unggulan ketiga asal Rusia itu dibuat tak berdaya oleh petenis kualifikasi bernama Michelle Larcher De Brito. Kendati berperingkat 131 dunia, De Brito mampu mengimbangi bahkan mengungguli Sharapova. Si cantik nan jangkung pun tak kuasa meladeni De Brito yang tampil nyaris tanpa cela. Sebaliknya, Sharapova justru kesulitan menemukan irama permainan sejak awal. Bahkan, mantan ratu tenis itu pun sempat mendapat perawatan medis di pertengahan set kedua setelah terpeleset di dekat baseline. Alhasil, Sharapova harus mengubur impian gelar keduanya diWimbledon menyusul kekalahan 6-3, 6-4. Tersingkirnya Sharapova melengkapi kejutan di babak kedua. Sebelumnya, unggulan kedua Victoria Azarenka (Belarus) juga memberi

kemenangan kepada lawannya. Menang di babak pertama dengan memaksakan rasa sakit di lutut, Azarenka akhirnya memutuskan mundur. Petenis Italia, Flavia Pennetta, pun mendapat kemenangan tanpa mengeluarkan keringat. Duel antara dua petenis cantik, Ana Ivanovic (Serbia) dan Eugenie Bouchard (Kanada), juga berakhir di luar prediksi. Ivanovic harus rela menyerah di tangan petenis berusia 19 tahun itu yang menang 6-3, 6-3. Belum lagi Caroline Wozniacki (Denmark) ikut tersisih akibat takluk dari Petra Cetkovska (Repubik Ceko). Kemenangan turut dipetik Monica Puig (Puerto Riko), Alize Cornet (Prancis), dan Carla Suarez Navarro (Spanyol). Bila Puig menang atas Silvia Soler Espinosa (Spanyol) 6-2, 5-7, 6-4, Cornet menyingkirkan Hsieh Su-Wei (China Taipei) 6-3, 6-2,

maka Navarro menumbangkan Mirjana Lucic-Baroni (Kroasia) 1-6, 6-3, 6-3. Kejayaan Steve Darcis yang sukses mengalahkan Rafael Nadal di babak pertama pun berubah menjadi kekecewaan. Pasalnya, petenis Belgia itu terpaksa mengundurkan diri akibat cedera bahu. “Harus mundur setelah mencapai kemenangan brilian atas Nadal?! Benar-benar keputusan tersulit yang pernah saya ambil!!!” tulis Darcis di akun twitter miliknya. Ironisnya, Darcis baru saja mencatat salah satu kemenangan bersejarah di pentasWimbledon kala mengakhiri langkah Nadal dalam straight set. Darcis mengaku rasa nyeri pada bahunya itu dirasakan pada pertengahan set pertama dalam duel kontra Nadal. Karenanya, Darcis kesulitan tidur karena bahunya benar-benar terasa nyeri. Dengan demikian, Darcis memberi tiket babak ketiga secara gratis kepada petenis Polandia, Lukasz Kubot. Selain Darcis, John Isner (AS), Marin Cilic (Kroasia), dan Radek Stepanek (Rep Ceko) juga mundur. (m33/rtr)

AP

Hamilton Ungkap Hasrat Terpendam LONDON (Waspada): Lewis Hamilton mengungkapkan dirinya memiliki hasrat untuk menjadi pebalap Ferrari. Driver asal Inggris ini beralasan bahwa semua pebalap pasti ingin bergabung dengan tim Kuda Jingkrak tersebut. Memulai karier di Formula One (F1) pada 2007 bersama McLaren, Hamilton sukses meraih gelar juara dunianya pada 2008. Kemudian, Hamilton memutuskan hengkang ke Mercedes musim ini. Ternyata, pria berusia 28 tahun ini menyimpan keinginan bergabung dengan Ferrari yang dinilainya sebagai tim hebat dan prestisius. Meski begitu, dirinya tetap merasa nyaman bersama Mercedes saat ini. “Saat ini saya tidak melihat berada di tempat lain, karena merasa bahagia di tim sekarang. Tapi, apa yang saya dapat katakan adalah karier balap, karting, dan semuanya, Ferrari selalu menjadi salah satu tim top dan menjadi impian tersendiri bagi pebalap manapun untuk membela tim tersebut,” kata Hamilton, Rabu (26/6). “Jadi bagi siapa saja yang mendapatkan kesempatan tersebut, tak peduli di mana atau mobil apa yang Anda kemudikan, Anda akan melihat sebuah Ferrari dan berpikir itu hal yang keren. Tapi seperti yang saya bilang, saat ini saya amat senang di sini dan berharap Mercedes mempertahankan saya lebih lama,” sambungnya. (m33/auto)

motogp

Lorenzo Termotivasi Hatrik ASSEN, Belanda (Waspada): Kemenangan MotoGP Italia dan Catalunya semakin membangkitkan kepercayaan diri Jorge Lorenzo (foto). Pebalap Yamaha itu juga mengaku kian ‘lapar’ akan kemenangan dan siap membidik seri Assen di Belanda, akhir pekan ini. Berkat kemenangan beruntun tersebut, rider Spanyol tersebut semakin memperkecil selisih poin dari Dani Pedrosa sebagai rivalnya yang masih berada di puncak klasemen sementara dengan 123 poin. Dengan hanya selisih tujuh poin, Lorenzo pun siap mencari kemenangan dan memperuncing persaingan ketat dengan andalan Repsol Honda tersebut, seperti pada musimmusim sebelumnya. “Saya sangat senang usai menang di Mugello dan Catalunya, dua kemenangan penting untuk saya dan juga tim Yamaha,” ujar Lorenzo, Rabu (26/6).

“Kami berada dalam kondisi yang amat bagus di dua balapan terakhir itu dan saya merasa lebih kuat dari sebelumnya dan amat ‘lapar’ untuk menang,” sambungnya. Jawara dunia MotoGP 2012 ini pun mengaku bahwa Sirkuit Assen yang memiliki lintasan sepanjang 2,822 mil itu adalah favoritnya. Karena itu, Lorenzo mengaku tak sabar untuk mengaspal di lintasan tersebut. “Saya sangat termotivasi untuk balapan di Assen dan akan berusaha menang ketiga kali berturut-turut,” tambah Lorenzo yang menganggap Indonesia sebagai rumah keduanya itu. Lorenzo dan Yamaha juga tidak terlalu terganggu dengan pengalaman buruk musim lalu. Saat itu, Lorenzo gagal naik podium lantaran terjatuh di lap awal akibat bertabrakan dengan Alvaro Bautista. (m33/mgp)

Pasang Iklan f1live

PEBALAP Mercedes Lewis Hamilton (kiri) mengaku tertarik untuk membela panji Ferrari.

Pedrosa Fokus Klasemen ASSEN, Belanda (Waspada): Dani Pedrosa (foto) berharap meraih kemenangan pada balapan MotoGP Belanda, akhir pekan nanti. Hal itu didasari keinginan pebalap Repsol Honda tersebut mempertahankan posisinya di puncak klasemen. Saat ini, Pedrosa berada di puncak dengan raihan 123 poin atau unggul tujuh angka dari Jorge Lorenzo di posisi runnerup. Sebab itu, pria asal Spanyol ini berharap bisa naik podium

motogp

di Sirkuit Assen nanti. Terlebih, Pedrosa memiliki catatan baik di lintasan sepanjang 2,822 mil tersebut dengan meraih kemenangan pertamanya di balap grand prix kelas 125cc pada 2002 silam. Ia juga berharap cuaca bisa bersahabat pada balapan nanti. “Setelah balapan bagus di Catalunya dan 20 poin penting, saya masih memimpin kejuaraan dan amat menantikan Assen,” kata Pedrosa, Rabu (26/6).

“Saya memenangi balapan pertama di sana dan punya kenangan yang amat spesial. Cuaca bisa berat, jadi saya harap bisa mendapatkan waktu menguji lintasan dalam kondisi kering,” sambungnya. Runner-up MotoGP musim lalu tersebut menilai pemilihan ban bisa menjadi salah satu kunci kemenangan di Assen. Ini mengingat sirkuit tersebut memiliki beberapa tikungan yang cukup berat. (m33/mgp)

Telp. 4528431 HP. 081370328259 Email:

iklan_waspada@yahoo.co.id


Sumatera Utara

WASPADA Kamis 27 Juni 2013

Kota

Zhuhur ‘Ashar

Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

12:30 12:43 12:31 12:38 12:37 12:34 12:30 12:26 12:33 12:32

15:57 16:10 15:57 16:05 16:04 16:00 15:57 15:53 16:00 15:59

Magrib 18:40 18:57 18:41 18:51 18:50 18:41 18:40 18:36 18:43 18:45

‘Isya

Imsak

Shubuh Syuruq

Kota

19:55 20:12 19:56 20:06 20:05 19:55 19:55 19:50 19:58 20:00

04:46 04:55 04:46 04:50 04:51 04:54 04:47 04:43 04:49 04:46

04:56 05:05 04:56 05:00 05:01 05:04 04:57 04:53 04:59 04:56

L.Seumawe 12:36 L. Pakam 12:29 Sei Rampah12:28 Meulaboh 12:40 P.Sidimpuan12:27 P. Siantar 12:28 Balige 12:28 R. Prapat 12:25 Sabang 12:43 Pandan 12:29

06:17 06:27 06:18 06:22 06:23 06:26 06:19 06:15 06:21 06:19

Zhuhur ‘Ashar 16:03 15:56 15:55 16:07 15:54 15:55 15:55 15:51 16:10 15:56

B1

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

Zhuhur ‘Ashar

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

Zhuhur

‘Ashar

Magrib

‘Isya

Imsak

Shubuh Syuruq

18:49 18:40 18:39 18:51 18:34 18:38 18:37 18:33 18:58 18:37

20:05 19:54 19:54 20:06 19:49 19:52 19:51 19:48 20:13 19:51

04:48 04:45 04:44 04:55 04:47 04:45 04:46 04:44 04:54 04:49

04:58 04:55 04:54 05:05 04:57 04:55 04:56 04:54 05:04 04:59

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:29 12:31 12:41 12:33 12:30 12:37 12:25 12:36 12:29 12:28

18:37 18:40 18:54 18:42 18:41 18:49 18:35 18:46 18:37 18:38

19:51 19:55 20:10 19:56 19:56 20:04 19:50 20:01 19:51 19:53

04:49 04:48 04:53 04:52 04:46 04:51 04:42 04:52 04:48 04:44

04:59 04:58 05:03 05:02 04:56 05:01 04:52 05:02 04:58 04:54

Panyabungan Teluk Dalam Salak Limapuluh Parapat GunungTua Sibuhuan Lhoksukon D.Sanggul Kotapinang AekKanopan

12:26 12:33 12:31 12:27 12:29 12:26 12:26 12:35 12:29 12:24 12:26

15:52 15:59 15:58 15:53 15:55 15:52 15:52 16:02 15:56 15:50 15:52

18:32 18:38 18:40 18:37 18:38 18:33 18:32 18:48 18:38 18:32 18:35

19:46 19:53 19:55 19:52 19:52 19:47 19:46 20:04 19:52 19:46 19:49

04:47 04:55 04:49 04:43 04:46 04:46 04:46 04:48 04:48 04:43 04:44

04:57 05:05 04:59 04:53 04:56 04:56 04:56 04:58 04:58 04:53 04:54

06:21 06:17 06:16 06:26 06:19 06:17 06:18 06:15 06:27 06:20

15:56 15:57 16:08 16:00 15:57 16:04 15:52 16:02 15:55 15:55

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

06:20 06:20 06:25 06:23 06:18 06:23 06:14 06:24 06:19 06:16

06:19 06:26 06:21 06:15 06:18 06:17 06:18 06:20 06:19 06:15 06:15

44 Pejabat Dan Staf Kejari Binjai Periksa Urine BINJAI (Waspada):Tim Rumah Sakit Umum Daerah (RSUD) dr. Djoelham dipimpin Direktur dr. T. Amri Fadly melakukan pemeriksaan urine 44 pejabat dan staf Kejaksaan Negeri (Kejari) Binjai, Rabu (26/6), di aula kejari Binjai, Jalan T. Amir Hamzah. Kepala Kejari Binjai Wilmar Ambarita mengemukakan, tes urine PNS di Kejari Binjai guna cek and rechek penggunaan narkoba di jajaran Kejari. “Saya yakin staf Kejari Binjai bersih, namun perlu dilakukan tes urine agar memperoleh hasil objektif,” ujarnya. Wilmar Ambarita menjelaskan, staf Kejari yang juga menangani perkara narkoba diharapkan tidak ada yang terlibat narkoWaspada/Riswan Rika

KA. KEJARI Binjai Wilmar Ambarita bersama Direktur RSU dr. Djoleham Binjai, dr. T. Amri Fadly sebelum melakukan tes urine di Kejari Binjai.

Tersenggol Di Tontonan Keyboard, Siswa SMU Tewas Dibacok STABAT (Waspada): Dedi Sanjaya, 17, warga Desa Sawit Hulu Kec. Sawit Seberang Kab. Langkat tewas dibacok OTK saat hiburan keyboard berlangsung di Desa Sei Litur Kec. Padangtualang, Rabu (26/6) dinihari. Berbagai keterangan dihimpun, setelah menonton hiburan organ tunggal tersebut waktu dinihari korban bermaksud pulang. Saat menuju sepedamotor yang diparkir, entah bagaimana korban tersenggol salah seorang pemuda tak dikenalnya. Meski telah minta maaf dan mengaku tidak sengaja, namun pelakutetapmemanggilkawan-kawannyayanglangsungmengeroyok korban. Bahkan salah seorang di antaranya membacok punggung korban dengan senjata tajam mengakibatkan pelajar kelas II SMU itujatuhbersimbahdarah.Kemudiankawananpelakukabursementara korban dilarikan warga ke Klinik Keluarga tak jauh dari lokasi. Namun naas, beberapa saat dirawat nyawa korban tidak tertolong. Keluarga korban Safruddin ketika ditemui di RSU Tanjungpura untuk visum, berharap polisi segera menangkap pelaku. “Hanya gara-gara tersenggol mereka tega membunuh keluarga saya,” katanya. Sementara itu secara terpisah Kasat Reskrim Polres Langkat AKP Rosyid Hartanto menegaskan, pihaknya masih memburu para pelaku.(a03)

ba. Sehingga tidak menimbulkan imej negatif di masyarakat. “Sebagaiaparatpemerintahharus memberikan tauladan kepada masyarakat. Masalah narkoba sangat merusak generasi muda, dan perlu ditangani serius,” tegas Kajari. Sementara Direktur RSUD dr. Djoelham Binjai, dr. T. Amri Fadlysangatmeresponkerjasama Kejari Binjai dalam pemeriksaan urinestafnya.“Bertepatandengan

PLN Pemerataan Arus Jaringan Gebyar Bersih Penyulang Lubukpakam-Perbaungan LUBUKPAKAM (Waspada): Pihak PLN Area Lubukpakam melakukan pemerataan arus jaringan dalam rangka Gebyar Bersih Penyulang di sepanjang jalanLubukpakam-SimpangTiga, Perbaungan, Selasa (25/6). Pantauan Waspada, jajaran

petugas PLN dikomandoi Aswad dan R. Purba memulai pekerjaan dari titik Simpang Tiga Perbaungan, depan rumah makan Simpang Tiga Kota Perbaungan. Saatdihampiri,Purbaselakuketua pelaksana mengaku pihaknya sedang melakukan pemerataan

Pengendara Sepedamotor Tewas Ditabrak Truk BINJAI (Waspada): Tety Arfina Ginting, 32, penduduk Langkat pengendara sepedamotor Mio BK 6427 PAL, Rabu (26/6) sekitar pukul 13.30 siang tewas ditabrak truk BL 2648 MB dikemudikan M, 35, warga Aceh di Jalan TA Hamzah Kelurahan Jati Utomo, Kec. Binjai Utara. Masyarakat yang mengetahui kejadian itu memberitahu pihak Polantas Polres Binjai. Petugas Sat Lantas Polres Binjai dipimpin Aiptu Ramadhan lalu membawa korban ke RSU dr. Djoelham Binjai guna visum. Keterangan diperoleh, korban menuju arah Binjai dari Stabat. Tiba tiba di Jalan TA Hamzah sepedamotornya terjatuh ke badan jalan. Sementara dari arah belakang meluncur truk dikendarai M yang langsung menabrak korban hingga tewas di tempat kejadian.(a05)

Ditangkap Saat Hendak Transaksi Ganja TEBINGTINGGI (Waspada): Tersangka pengedar ganja, EL, warga Jalan Dr. Hamka, Kampung Bicara, Kel. Durian, Kec. Bajenis, Tebingtinggi diringkus aparat Sat. Narkoba PolresTebingtinggi Ketika hendak transaksi ganja di Jalan Pulau Irian, Ling. III, Kel. Bandar Sono, Kec. Padang Hulu, Tebingtinggi. Berdasarkan informasi, rencana tersangka yang tercium petugas, langsung diciduk saat menunggu pembeli. Dua petugas Sat Narkoba Polres Tebingtinggi mengintai di sekitar lokasi. Tersangka duduk di sepedamotornya dan lngsung ditangkap. Saat digeledah, dari jaketnya ditemukan sebungkus plastik warna hitam berisi 25 amp ganja dibungkus kertas coklat. Bersama barang bukti, tersangka digelandang ke PolresTebingtinggi guna penyelidikan lebih lanjut. Tersangka mengaku 25 amp ganja tersebut mau diberikanya kepada seseorang yang sering disuruhnya menjadi kurir. “Saya lagi menunggu kurir, ternyata polisi yang datang,” ucap tersangka yang mengaku bekerja sebagai pedagang keliling. “Tersangka dijerat dengan pasal 114 ayat (1) Subs pasal 111 ayat (1) UU RI No. 35 Tahun 2009,” kata Kapolres Tebingtinggi melalui Kasubbag Humas, AKP Ngemat Surbakti saat dikonfirmasi wartawan, kemarin.(a11)

Melukis, Memupuk Nilai Estetika Anak Sejak Dini TEBINGTINGGI (Waspada): Melukis yang diajarkan kepada anak sejak dini, akan mampu memupuk nilai-nilai estetika dalam diri seorang anak. Jika si anak telah dewasa, nantinya nilai estetika itu akan menjadikannya sosok yang menyukai keindahan dan keteraturan dalam hidup. Selain akan berpengaruh pada lingkungan, berupa kecintaan terhadap suasana yang teratur dan tertata rapi. Kadis Pendidikan Kota Tebingtinggi diwakili Kabid Pendidikan danPengajaranDrs.JonnerSitinjak, mengatakanhalitu,saatmembuka kegiatan ‘Lomba Kreatifitas Melukis Siswa TK,’ se-Kota Tebingtinggi di anjungan Sri Mersing, lapangan Merdeka. Dikatakan, tugas guru maupun tutor sangat penting dalam meletakkan dasar-dasar estetika sebagai pemberi pemahaman kepada anak secara benar. “Lomba melukis ini salahsatu media penting, agar anak memiliki jiwa estetika dalam dirinya,” terang J. Sitinjak. Lomba Melukis TK/PAUD, dari laporan Kasi Dikdas Sugiarto, SPd,diikutipesertaPAUD,TKdanRaduhatulAthfalse-KotaTebingtinggi. Total siswa yang ikut mencapai 88 orang, terdiri siswa PAUD 30 orang, TK/RA 15 orang dan SD/MI 50 orang. “Dalam perlombaan ini setiap sekolah diwakili satu putra dan satu putri,” terang dia. Dilaporkan, tujuan kegiatan ini untuk mengembangkan bakat, kreatifitas dan imajinasi anak untuk memiliki keterampilan, bersifat mandiri dan berakhlak mulia. Kegiatan ini dilaksanakan setiap tahun dan menjadi program Dinas Pendidikan. (a09)

peringatan Hari Narkoba Internasional, Rabu hari ini, tim RSUD dr. Djoelham Binjai melakukan tes urine. Ka. Kejari BinjaiWilmar Ambarita juga turut di tes,” jelas dr. T. Amri Fadly yang langsung memimpintimRSUdr.Djoelham Binjai, di Kejari Binjai. dr. Amri mengemukakan, sejalan dengan peringatan hari Narkoba Internasional di Kota Binjai yang dilaksanakan di GOR, Jalan Jambi dengan thema, “Aksi global untuk mewujudkan masyarakat sehat tanpa narkoba”, ternyata pihak Kejari memberi contohdantauladandenganmembersihkan internalnya. “Contoh yang diberikan Kejari Binjai, sangatpositif,”tegasdr.Amri.(a04)

Waspada/Rizaldi Anwar

PIHAK PLN Area Lubukpakam sedang melakukan pemerataan arus jaringan di Simpang Tiga Kota Perbaungan, Serdang Bedagai.

jaringan di titik Simpang Tiga. “Untuk sementara pemadaman bergilir terjadi di berbagai kawasan, di antaranya Perbaungan,RambungSialangdanBeringin sekitarnya,” sebut Purba didampingi Aswad, Asman Pelayanan PLN Area Lubukpakam. Menurut Aswad, kegiatan itu salah satu upaya meningkatkan pelayanan kepada masyarakat mengingatpembangkitlistrikPLN sudah tak memadai. “Jadi Gebyar Bersih Penyulang merupakan gerakan pembersihan jaringan dari gangguan dahan pohon dan kawatdisepanjangLubukpakamPerbaungan,” sebutnya sambil menambahkan, semua itu atas perintahKepalaPLNAreaLubukpakam Albert Tampubolon. Menurut Aswad dalam gerakan itu pihaknya melibatkan tiga rayon, yakni PLN Rayon Lubukpakam, Galang dan Perbaungan. “Ini juga prioritas pihak kami dalam pelayanan prima kepada masyarakat untuk menyambut bulan suci Ramadhan dan Hari Raya Idul Fitri,” jelasnya sembari memohon maaf jika selama ini pihaknya memadamkan arus listrik tanpa memberitahu karena gangguan jaringan tersebut. Sementara menurut Rianto, petugas PLN Rayon Galang, satu saja ranting menyentuh jaringan arus listrik, itu sudah menyedot arus sekira 50 amper.(m16)

Peringatan Hari Anak Di DS Meriah Bunda PAUD Ajak Didik Anak Berakhlak Mulia LUBUKPAKAM (Waspada): Peringatan Hari Anak Nasional (HAN) Tahun 2013 tingkat Kab. Deliserdang berlangsung meriah. Kegiatan ini didukung pemerintah, dunia usaha, masyarakat, keluarga dan orangtua dalam membangun karakter anak melalui pemenuhanhak-hakdan perlindungan anak, dibukaWakil Bupati Deliserdang H Zainuddin Mars di Lapangan Alun-alun Pemkab Deliserdang di Lubukpakam, Senin (24/6). Kegiatandigelarmelaluistand pameran diprakarsai sejumlah Satuan Kerja Perangkat Daerah (SKPD) terkait, dirangkai penyerahan 500 akte kelahiran, pelayanan kesehatan, penyerahan 3.000 batang bibit pohon mangga untuk tanaman keluarga serta penyerahan hadiah berbagai perlombaan. Pembukaannya ditandai

pelepasan puluhan burung merpati serta pelepasan balonWabup H Zainuddin Mars diikuti Ketua DPRD Deliserdang Hj Fatmawati Takrim, unsur Muspida, Bunda PAUD Ny. Hj Anita Amri Tambunan yang juga Ketua TP PKK Deliserdang, Ketua GOPTKI Ny. Hj Asdiana Zainuddin, Ketua GOW Ny. Sri Rahmawati Barus, Plt Kaban KB dan PP Dra Hj RabiatulAdawiyahLubisMPdselaku KetuaPanrasertasejumlahpimpinanSKPDdanundanganlainnya. Di hadapan ribuan anakanak, ditampilkan berbagai aksi kreativitas anak berupa penampilan sendratari anak kreatif bersama Bunda PAUD Ny. Hj Anita Amri Tambunan. Penampilan tari cawan etnis Tapanuli dari siswa SMKN 1 Lubukpakam memukau penonton dan penampilan pembawa acara berbahasa Inggris oleh Rowena dan Gio-

briciola. Pertunjukan mendongeng, temu wicara tiga murid SD Pelita Kasih Tanjungmorawa dengan Wabup H Zainuddin Mars, Kapolres AKBP Dicky Patrianegara dan Bunda PAUD Ny. Hj Anita AmriTambunan berkaitan dengan cita-cita mereka sebagai generasi penerus calon pemimpin bangsa. Bunda PAUD Ny. Hj Anita AmriTambunan di sela-sela puncak peringatan Hari Anak Nasional mengajak seluruh guru maupun orangtua untuk terus mendorong pendidikan anak dengan cara menyeimbangkan ilmu pengetahuan dan pengenalan alam disertai kegiatan bermain sehingga ke depan kita menghasilkan anak-anak berkarakter yang diharapkan kelak menjadi generasi yang berkualitas, andal dan berakhlak mulia. (a06)

Waspada/HM Husni Siregar

WABUP Deliserdang H Zainuddin Mars bersama Ketua TP PKK Ny. Hj Anita Amri Tambunan dan anak-anak melepasan puluhan burung merpati tanda peringatan Hari Anak di Kab. Deliserdang.

Waspada/Ibnu Kasir

H. NGOGESA, calon bupati incumbent menerima dukungan tertulis dari DPD Pengajian Al Hidayah Langkat dalam acara Tabligh Akbar di alun-alun Tengku Amir Hamzah di Stabat.

Tabligh Akbar Al Hidayah se Kab. Langkat, Meriah:

Ngogesa, Kaji Diri Dengan Berzikir STABAT (Waspada): Zikir dan tabligh akbar dari waktu ke waktu yang dilakukan berbagai kalangan masyarakat diharap mampu memberi bekas positif dalam memperbaiki dan menguatkan keyakinan, bahwa seluruh hidup berada dalam tatapan dan genggaman Allah SWT. “Diperlukan kaji diri dengan berzikir, agar kitasemuaselamatduniadanakhirat,”kataBupati Langkat H. Ngogesa Sitepu, SH pada Tabligh AkbardiselenggarakanDPDPengajianAlHidayah se Kab. Langkat yang berlangsung meriah, di alun-alun Tengku Amir Hamzah Stabat, Selasa (25/6). Terkait menyambut bulan suci Ramadhan, Bupati H. Ngogesa mengajak para jamaah yang didominasi kaum ibu tersebut untuk meningkatkan kualitas ibadah dan kepedulian sesama. Sebelumnya Penasehat Pengajian AlHidayah, Hj. Nuraida Ngogesa menyampaikan terimakasih kepada seluruh jamaah yang hadir

khususnya Al Hidayah, organisasi pengajian terbesar di Sumut binaan Partai Golkar. Menurutnya, jamaah pengajian terdiri dari kaum ibu ini telahmemberi sumbangsihyangmewarnaidaerah Langkat dengan visi relijiusnya, dan ini tentu akan ditingkatkan lagi pada tahun-tahun mendatang. Sementara Ketua DPD Pengajian Al Hidayah LangkatHj.FadhilahNasutiondidampingisegenap unsur pengurus mengemukakan, sebagai organisasi yang dibesarkan Partai Golkar, wajarlah segenap jamaah mendukung Ketua DPD Partai Golkar Langkat H. Ngogesa, untuk melanjutkan kepemimpinannya di Langkat periode 2014-2019 sebagai calon bupati incumbent. “Kita semua mendukung sepenuh hati,” katanya disambut tepuk meriah jamaah yang hadir. Selain zikir dipandu Majelis Al-Firdaus Pangkalanbrandan itu, acara yang dihadiri ribuan jamaah Al-Hidayah se Kab. Langkat itu juga diisi tausyiah oleh Ustadz HM. Daud Sagita Putra.(a01)

Batubara Ke Depan Jauh Lebih Baik Sementara Al-ustadz Khairuddin BA dalam MASJIDLAMA, Batubara (Waspada): Bupati Batubara meyakini daerah kepemimpinannya tausyiahnya menekankan kepada umat untuk kedepanlebihbaik,sehubungandilaksanakannya mengerjakan sholat lima waktu dan menjauhi pembangunan Pelabuhan Global Hub segala larangan Allah SWT, agar terlepas dari api Internasional KualaTanjung dijadwalkan dimulai neraka. Ketua Panitia Israk Mikraj, Indra Gunawan awal 2014. “Ini tak terlepas dari perjuangan yang didu- Hasibuan menyatakan terima kasih atas bantuan kungdenganpotensidaerahyangdimiliki,sehingga semua pihak yang mendukung sehingga pembangunan raksasa tersebut dapat tergeser terlaksananya kegiatan siar Islam tersebut. Turut memberi sambutan Buya Ridwan Amin, ke Batubara ,” kata Bupati H. OK Arya Zulkarnain, SH, MM pada peringatan Israk Mikraj Nabi Besar Kades Masjid Lama, Mirwan Azuar. Hadir Camat Muhammad SAW dilaksanakan remaja Desa Talawi, Luthfi, S.Sos beserta kalangan masyarakat termasuk nelayan. Dalam kesempatan itu bupati Masjid Lama, Kec. Talawi, baru-baru ini. Pembangunan tersebut, katanya, membuka menyerahkan bantuan kepada para remaja.(a13) peluang berdirinya kawasan industri di daerah pesisir sebagaimana Master Plan Percepatan Perluasan Pembangunan Ekonomi Indonesia (MP3EI) Tahun 2011-2025. Agar anak daerah tidak ketinggalan dan menjadi penonton,upayapeningkatan SDMmelaluipendiriansekolah logistik diharap dapat menjawab kekhawatiran terhadap perkembangan ilmu pengetahuan dan teknologi ke depan. OK mengaku pembangunansetahapdemisetahaptelah dilakukan yang harus disyukuridandimanfaatkansebaikbaiknya. Termasuk Program Waspada/Iwan Has Keluarga Harapan (PKH) kini BUPATI Batubara H. OK Arya Zulkarnain, SH, MM yang juga sudah dapat dinikmati Cabup perseorangan periode 2013-2018 di tengah-tengah masyarakat masyarakat. pada suatu acara.

Kepengurusan Himpaudi T.Tinggi ‘Dikudeta’ TEBINGTINGGI (Waspada): Dinas Pendidikan dan Tim Penggerak PKK Kota Tebingtinggi dituding melakukan‘kudeta’ atas kepengurusan Himpunan Pendidik dan Kependidikan Anak Usia Dini Indonesia (Himpaudi). ‘Kudeta’ itu dilakukan melalui musyawarah derah luar biasa (Musdalub) yang dilakukan di gedung Hj. Sawiyah Nasution, Jumat (21/6). Musdalub mendapat perlawanan dari pengurus sah, namun tetap dilaksanakan. Daripantauan,Musdalubitu,dihadiriseluruh pengelola PAUD se kota Tebingtinggi, pengurus PKK serta Kadis Pendidikan Drs.H.Pardamean Siregar, MAP, tanpa dihadiri pengurus Himpaudi Sumut. Dalam rapat berlangsung sekira satu jam, terpilih secara aklamasi Wakil Ketua PKK Hj. Aisyah Siregar yang juga istri mantan Wali Kota Ir.H.Abdul Hafiz Hasibuan. Dalam Musdalub itu, Ketua Himpaudi periode 2012-2016 Dra. Suriani, S.Pd.I sempat memprotes jalannya musyawarah. Ketua yang merasa‘dikudeta’menudingMusdalubmelanggar AD/ART. Suriani meminta agar Musdalub dilaksanakansesuaiperaturanorganisasi.Namun, usai melakukan protes, Kadis Pendidikan Drs. H. Pardamean Siregar, MAP, maju ke mimbar. Menurut Pardamean Siregar, Musdalub ini dilakukan atas dukungan seluruh PAUD yang ada, sembari meminta angkat tangan pengelola yang setuju Musdalub. Selain itu, dengan suara keras Kadisdik, mengatakan, tanpa keberadaan Himpaudi, pendidikan di Kota Tebingtinggi bisa jalan terus. “Terserah mau ikut Dinas atau

Himpaudi,” tegas Pardamean Siregar. Usai Musdalub, Ketua Himpaudi Suriani, mengatakan kekecewaannya atas sikap Disdik dan PKK. “Masih ada pejabat bermental seperti ituyangsewenang-wenangdengankekuasaannya,” keluh dia. Diterangkan, sejak awal digerakkannya usaha Musdalub ini, Seksi PAUD/PLS meminta agar pengelola PAUD mengajukan mosi tidak percaya. Bahkan,upayaitudilakukandenganmemanipulasi tandatangan,hinggaancamantidakdiberibantuan. “Ya macam mana lagi, mereka pasrah sajalah,” keluh Suriani. Namun, Ketua Terpilih Himpaudi Hj. Aisyah Siregar, mengatakan Musdalub dilaksanakan, karena adanya desakan dari pengelola PAUD. Menurut dia, ada dua alasan dilaksanakannya Musdalub, yakni kepengurusan lama tidak bisa mengelola organisasi dengan baik. Kemudian, dalam mengelola organisasi pengurus yang lama bersikap tidak transparan. “Saya sebenarnya tidak mau jadi ketua, tapi karena semua mendesak, saya mau bilang apa,” ujar Hj. Aisyah Siregar. Kepengurusan Himpaudi Kota Tebingtinggi periode2012-2016telahdiSKkanHimpaudiSumut berdasarkan surat No.106/SK/PW Himpaudi/ SU/VI/2012 tanggal 18 Juni 2012 ditandatangani Ketua dr. Hj. Netty Harnita, Sp.THT.KL dan Sekretaris Dra. Hj. Yulheni, M.Pd. Namun, sejak mendapat SK pengesahan, ujar Wakil Ketua Himpaudi Harirayani, SE, kepengurusan ini tidak dilantik, karena dihalangi Kadis Pendidikan Kota Tebingtinggi. (a09)


Sumatera Utara

B2 WASPADA

Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu Lusia Damayanti (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: H. Halim Hasan. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Zulkifli Harahap. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Promosi: Edward Thahir (Koordinator). Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Sinur Manik (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi). Wartawan Kota Medan: Umum: H. Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Hj. Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa, Avli Yarman. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Arianda Tanjung, Dio Utama. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebingtinggi: Muhammad Idris, Abdul Khalik. Pematangsiantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Tarutung: Parlindungan Hutasoit. Sibolga/Tapanuli Tengah: Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan/Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies, H. Rusli Ismail, Arman Konadi. Aceh Besar: Iskandarsyah. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanafiah. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar, Dedek Juliadi. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Jasvira Sautisa. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan WASPADA dilengkapi dengan kartu pers. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada yang mengaku wartawan WASPADA tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: redaksi@waspadamedan.com KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 13.000,-, berwarna Rp. 36.000,Halaman depan: hitam-putih Rp. 39.000,-, berwarna Rp. 108.000,Ukuran kolom: 40,5 mm. E-mail Iklan: iklan@waspadamedan.com Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Seminar Internasional Pendidikan Peduli Anak TANJUNGBALAI (Waspada): Konseling Islami merupakan upaya pengukuhan citra diri peserta didik sebagai manusia muslim. Dalam pendidikan di sekolah, tujuan jangka panjangnya agar peserta mampu mencapai perkembangan optimal sesuai dengan potensi yang dimiliki. Hal itu dikatakan Guru besar Fakultas Tarbiyah IAIN Sumut dan visiting Professor Academy of Islamic Studies University of Malaya Kuala Lumpur, Prof Dr Saiful Akhyar Lubis,MA pada seminar internasional pendidikan peduli anak yang diselenggarakan Disdik Kota Tanjungbalai di aula rumah dinas Wali Kota Rabu (26/6). Selain Saiful, seminar itu menghadirkan narasumber dari Malaysia, yaitu pensyarah kanan di jabatan Alquran dan al Hadist Akademi Pengajian Islam Universiti Dr Faisal Ahmad Shah, dosen University Malaya Asyraf Isyraqi Bin Jamil, Ph.D serta staf pengajar USU Dr Wiwik Sulistyaningsih. Seminar dipandu staf Politeknik Tanjungbalai M Fazrin Pane dan staf Disdik Tanjungbalai Andika. Dikatakan Saiful, kendati tergolong fenomena baru, konseling Islami ini sebenarnya sama tuanya dengan kegiatan dakwah di tengah-tengah masyarakat. Ini tidak lain karena konseling hakikatnya merupakan bagian penting dari kegiatan beragama itu sendiri, sebagaimana tergambar dalam berbagai terminologi keagamaan Islam. Kadisdik Kota Tanjungbalai, Drs.H.Hamlet Sinambela,MPd di sela kegiatan mengatakan, seminar mengenai anak selalu menjadi penting karena anak merupakan tunas-tunas harapan bangsa. (a14)

WASPADA Kamis 27 Juni 2013

Pengusaha Angkutan Sudah Naikkan Ongkos TANJUNGBALAI (Waspada): Sejumlah pengusaha angkutan di Kota Tanjungbalai telah menaikkan harga ongkos secara sepihak, meski belum ada ketetapan besaran tarif pasca kenaikan harga BBM. Kenaikan tersebut berkisar dari 20 hingga 100 persen, mulai 23 Juni 2013 lalu. Akibatnya, banyak penumpang mengeluh karena belum ada pengumuman secara resmi dari menteri terkait soal kenaikan ongkos angkutan. Untuk Angkutan Kota Dalam Provinsi (AKDP) Tanjungbalai Pematangsiantar, tarifnya dinaikkan dari Rp20 ribu menjadi Rp25 ribu. Sedangkan line Tanjungbalai-Medan,jugameningkat dari Rp25 ribu menjadi Rp30 ribu rupiah. “Tarif yang baru ini perintah dari direksi, sebagai anak buah, kami harus melaksanakannya, lagian kan memang harus dinaikkan,” ujar Gultom, 34, agen PO Sepadan di terminal Kota Tanjungbalai, Selasa (25/6).

Sementara, untuk angkutan dalam kota sendiri kenaikan cukup signfikan dari Rp2 ribu menjadi Rp4 ribu per line. Kenaikan tersebut memberatkan para penumpang karena dinilai terlalu tinggi dari harga awalnya. “Boleh naiklah, tapi jangan sampaiseratuspersensepertiini,” ungkap Selly, mahasiswa salah satu universitas swasta di Asahan. Menurutnya,parapengusahaharus sabar menunggu pengumuman dari pemerintah menyangkutkenaikantarifangkutan.Selain angkutan darat, angkutan air seperti ferry penyeberangan, kargo,danlainnyajugamengalami kenaikan. Untuk ferry tujuan Sungaiberombang, Panipahan, dan Leidong, sudah naik sejak beberapa hari lalu.

Kepala Kantor Dinas Perhubungan melalui Kasi ASDP Abdul Murad dan staf Belman Siahaan mengatakan, belum ada mengumumkan besaran kenaikan tarif angkutan. Kendati demikian, Menteri Perhubungan EE Mangindaan telah memberi gambaran bahwa kenaikan tarif minimal 15 persen dan maksimal 20 persen. “Persentase kenaikan ini belum resmi, kita juga masih menunggu dari Provsu,” kata Siahaan. Halsenadajugadiungkapkan Plt Kepala Kantor Kesyahbandaran dan Otoritas Pelabuhan Tanjungbalai Asahan (KSOPTBA) Juliansyah. Sebagai perpanjangan tangan dari Kementerian Perhubungan di Kota Tanjungbalai, pihaknya juga belum menerima besaran kenaikan tarif angkutan. “Belum, belum ada kenaikan. Meski kenyataan di lapangan telah naik, itu bukan dari kita tapi inisiatif pengusaha,” pungkas Juliansyah. (a32)

Ilmu Tanpa Iman, Lahir Pribadi Jahat TANJUNGBALAI (Waspada): Dalamrangkamenyambutbulan suci Ramadhan, Rohani Islam (Rohis) SMK Negeri 1 Kota Tanjungbalai mengadakan sejumlah kegiatan keagamaan seperti lomba hafalan Surat alWaqi’ah dan acara peringatan Israk dan Mikraj, Rabu (26/6). Kegiatan dilaksanakan di lapangan SMKN 1 Tanjungbalai Jl. Sei Agul, Kel. Seiraja, Kec. Seitualang Raso, Kota Tanjungbalai. Sebagai penceramah, panitia mengundang Al-Ustadz DR H Azhar Sitompul MA yang didatangkan dari Kota Medan. Ust. Azhar Sitompul dalam tausyiahnya berpesan kepada para siswa/i SMKN 1 Kota Tanjungbalaibahwaadaduahalyang harus dimiliki jika ingin sukses. Kedua hal itu juga bisa merubah kondisi bangsa Indonesia menjadi lebih baik. “Apakah itu, yakni Iman dan Ilmu. Kenapa harus keduanya, sebab bila berilmu saja tanpa punya iman yang kuat, justru akan melahirkan pribadi yang jahat,” kata Ustadz kelahiran Sungaikepayang, Kab. Asahan ini. Wakil Kepala SMK Negeri 1

Waspada/Rasudin Sihotang

LETDA Laut Kaeronnaki, Al-Ustadz DR.H.Azhar Sitompul, MA, Hj.Nurul Asyiah, Hendrik (Ketua OSIS), Amirullah Marpaung, dan Khoiruddin, S.PdI, MM pose bersama. Kota Tanjungbalai Khoiruddin, S.PdI, MM dalam sambutannya memberi apresiasi atas kinerja anak-anak Rohis. Lewat organisasi seperti Rohislah, kata Khairuddin, para siswa bisa lebih memahami arti sebuah tanggung jawab, kebersamaan dan kerjasama yang merupakan ranah pendidikan karakter tuntutan kurikulum dewasa ini. Ketua Umum Rohis SMKN

1 Kota Tanjungbalai Amirullah Marpaung didampingi Ketua Panitia M. Reza Fahmi Hasibuan mengatakan, pengumuman dan penyerahan hadiah perlombaan dilaksanakan Kamis (27/6). Hadir dalam kegiatan itu Letda Laut Kaeronnaki (Dan Satma Lanal Tanjungbalai-Asahan), dan Hj. Nurul Asyiah, Pengawas PAI pada Kantor Kemenag Kota Tanjungbalai. (a32)

Banyak Warga Tak Terima Kartu Perlindungan Sosial LABUHANRUKU (Waspada): Banyak warga miskin di delapan Lingkungan Kelurahan Labuhanruku Talawi Batubara yang layak menerima Bantuan LangsungSementaraMasyarakat (BLSM) tak mendapat panggilan menerima Kartu Perlindungan Sosialyangdiberikanpihakkantor Pos setempat, Rabu (26/6). Berdasarkan keterangan Moran, 73 (foto), warga LingkunganIIILabuhanruku,diamerasa kecewa tak mendapat BLSM sedangkantahunsebelumnyadia mendapatbantuanBLTdiberikan pemerintah tersebut. “Aku heran ada warga yang punya saham di boat penangkap ikan dapat, ada juga warga yang punya kebun sawit dapat BLSM,” jelas Moran pengrajin atap nipah.

Lebihfatallagi,seorangwarga yang punya mobil berjualan sayuranbisakebagianBLSM,juga beberapaKeplingdapat.Jaditidak diketahui pasti siapa yang bertanggungjawab melakukan kesalahan mendata orang-orang miskin sebenarnya. Termasuk dirugikan, Salmah di Kp.Jawa

seorang janda dengan tiga anak dan seorang diantaranya masih duduk dibangku SMA, juga tidak dapat Kartu Perlindungan Sosial sebagai syarat mendapatkan BLSM, raskin, PKH. Kepling VII Ismail mengaku terus terang dapat KPS, tetapi dia bersama istrinya berniat akan memberikan uang BLSM kepada orang miskin di lingkungannya. Nani, Kepling III Labuhanruku, mengaku tidak menerima BLSM, dan beberapa warga miskin ternyata juga tidak dapat, sedangkan ada warganya yang punya mobil berdagang sayuran ke Siantar bisa pula dapat BLSM. “Yang menjadi sasaran kami, didatangi warga. Padahal kami tidak pernah ikut mendata warga miskin,” tegas Nani. (a12)

Upacara HLH Di Labusel Diselimuti Kabut KOTAPINANG (Waspada): Upacara peringatan Hari Lingkungan Hidup (HLH) Sedunia 2013 tingkat Kabupaten Labusel yang digelar di lapangan PTPN3 Kebun Sisumut, Rabu (26/6) pagi diselimuti kabut asap. Seluruh peserta tetap khidmat melaksanakan upacara meski tanpa menggunakan masker. Upacara yang dipimpin oleh Plt. Sekda Kab. Labusel Zulkifli itudiikutiolehparaasistenPemkab Labusel, pejabat SKPD Pemkab Labusel, Unsur Muspida dan Muspika, para pelajar, dan beberapa lembaga kemasyarakatan lainnya yang ada di Labusel. Meskipunapelitudiselimutikabut asap, namun tidak satupun peserta upacara yang menggunakan masker. Pada kegiatan yang dilaksanakan Badan Lingkungan Hidup (BLH)PemkabLabuselitu,dilakukanpenanaman500pohonpelindungyaknimangga,rambutan,dan durian yang penanamannya dimulaidarilapanganPTPN3Kebun Sisumut.SelainPemkab,kegiatan inijugadidukungsejumlahpihak, sepertiPTPN3KebunSisumutyang ikutmenyumbangkanbibitpohon untuk ditanam. “Penanamanpohoninibertujuanuntukmemperbaikiekosistem lingkungandanmengurangipolusi udara,” kata Kepala BLH Pemkab Labusel, Kholil Jubri Harahap. Dalamkesempatanitu,Sekda

berharap agar kegiatan ini bukan hanya sekedar formalitas belaka namun dapat dilakukan dengan memulai hal-hal kecil seperti membuang sampah pada tempatnya. Zulkiflijugaberharap, kegiatan penanaman pohon dapat dilaksanakan secara berkelanjutanolehsetiapgenerasi. Upacara itu juga diisi dengan

pemberian piagam penghargaan PemkabLabuselkepadasejumlah perusahaan yang telah mengikuti Program Penilaian Peringkat Kinerja Perusahaan (Proper), yakni PT. Sumber Tani Agung (STA), PT. PP Lonsum Sei Rumbia Estate, PTPN 3 PKS Aek Torop, PTPN 3 PKS Torgamba, dan PTPN 3 PKS Sei Beruhur. (c18)

Waspada/Iwan Has

KOBARAN api menjilat bangunan ruko di Jalan Rakyat Tanjungtiram yang dikenal padat dengan penduduk berada dipusat kota kecamatan tersebut.

Tiga Ruko Terbakar Di T. Tiram TG TIRAM (Waspada): Tiga unit ruko hangus terbakar di Jalan Rakyat, Kec. Tanjungtiram, Kab. Batubara, Selasa (25/6) sekira pukul 23.00. Ketiga ruko yang hangsus terbakar tersebut diketahui miliki Devi Sikumbang, H. Yudo dan Ismet. Peristiwa tersebut tidak sampai menimbulkan korban jiwa. Namun kerugian material diderita korban mencapai ratusan juta rupiah. Asal api penyebab kebakaran sejauh ini belum dapat diketahui apakah bersumber dari kompor gas atau arus pendek listrik. Dan kasusnya sudah ditangani Polsek Labuhanruku. Bupati Batubara H OK Arya Zulkarnain, SH, MM pada dinihari berkesempatan turun ke lokasi dan merasa prihatin atas musibah dialami dan selalu bersabar atas cobaan dihadapi Keterangan Waspada peroleh di lokasi kejadian menyebutkan, awalnya warga sekitar dikejutkan munculnya asap tebal disertai kobaran api dari salah satu rumah toko menjual jam. Kobaran api dengan cepat melalap perabotan rumah beserta barang jualan di dalam ruko yang sudah ditutup tersebut. Warga melihat kobaran api berusaha untuk membantu mendobrak pintu ruko untuk memadamkan.Namunapidengancepatmenjilat kebagian atas bangunan dan merembes memba-

kar ruko yang menjual sepatu/slop dan pakaian yang bersebelahan. Petugas pemadam kebakaran begitu mendapat informasi kejadian tersebut langsung turun ke lokasi dibantu dua mobil kebakaran dari Asahan dan Inalum. Lurah Tanjungtiram Yusri dikonfirmasi Waspada seputar hal itu tidak memberikan jawaban. Camat Tanjungtiram Nasir Yuhanan, Rabu (26/6) membenarkan peristiwa kebakaran tersebut. Sedangkan kerugian material mencapai ratusan juta rupiah. Cabup Bantu Pasangan Cabup/Wabup Bupati Batubara Zahir dan Suriono memberikan bantuan kepada tiga korban kebakaran di Tanjungtiram, dan dua korban di Kuala Tanjung, Rabu (26/6). “Kami turut berduka cita atas musibah kebakaran menimpa para korban. Untuk itu sebagai tanda ikut berduka kami memberikan bantuan sekedarnya,jangandinilaiharganya,”sebutSuriono, ST MSi saat menyerahkan bantuan di Jl. Rakyat. Menurut keterangan, untuk tiga korban di Tanjungtiram, dan dua korban kebakaran lainnya diKualaTanjungdiberikanbantuanmasing-masing beras 1 goni, mi instan 2 kotak, gula pasir, minyak makan serta 1 kodi seng. (a13/a12)

Tari Tradisional Warnai Pelantikan Dewan Kesenian RANTAUPRAPAT( Waspada): Bupati LabuhanbatuDrHTigorPanusunanSiregarSpPD melantikpengurusDewanKesenianLabuhanbatu periode 2012-2017 di Gedung Kesenian Rantauprapat,Selasa(25/6).Pelantikanitudiwarnai dengan pagelaran tari tradisional, tari kontemporer, pantonim, pembacaan puisi, vocal group dan penampilan penyanyi cilik Ivan Roy Simanjuntak. Acara yang berlangsung meriah itu dihadiri oleh Wakil Bupati Suhari Pane SIP, Plt Sekdakab H Ali Usman Harahap SH, para Asisten Setdakab, para kepala SKPD, tokoh budaya, tokoh masyarakat, dan ratusan pelaku seni yang memenuhi Gedung Nasional tersebut. Bupati Dr H Tigor Panusunan Siregar SpPD dalam sambutan arahan dan bimbingannya mengatakan, seni itu adalah produk manusia, teknologi juga produksi manusia. Oleh sebab itu kedua-

duanya saling mengisi dan membutuhkan. Tigor menegaskan, yang paling ditakutkan seorangpemimpinadalahkemiskinan,kebodohan, tidak beradab. Kalau ini sudah terjadi pada suatu bangsa maka bangsa itu akan hancur. Supaya mereka tidak bodoh maka kita paksa mereka untuk sekolah. Pendidikanlah yang mampu menghapus kebodohan, kemiskinan Kata Tigor, dewan kesenian hadir untuk mengawal seni budaya lokal agar tetap terjaga dan tidak punah. Dewan kesenian, tambahnya, harus mampu mempertahankan dan membawa budaya lokal menjadi diminati generasi muda. Ketua Dewan Kesenian, Drs H Said Adlin mengucapkan terima kasih kepada Bupati dan Wakil Bupati Labuhanbatu serta Kadis Pemuda Olah Raga, Pariwisata dan Kebudayaan yang telah memberikan dukungan kepada Dewan Kesenian Daerah Labuhanbatu. (c07)

Unjukrasa Minta Tindaklanjut Proses Hukum TANJUNGBALAI (Waspada): Sejumlah mahasiswa berunjukrasa ke Kantor Kejaksaan Negeri (Kejari) Kota Tanjungbalai meminta agar Kepala Dinas Pertanian dan Peternakan kota setempat diproses hukum, Rabu (26/6). “Bukan rahasia lagi banyaknya dugaan penyimpangan di dinas ini, mulai dari pembentukankelompokyang diseleksitimtujuh.Kemudian, pengadaan sapi yang memprihatinkan hingga pembangunan kandang yang tidak tuntas,”tulismahasiswadalam selebarannya. Hari ini, kata mahasiswa, Waspada/Rasudin Sihotang dalam bentuk aksi jalanan, KASI Intel Kejari Tanjungbalai Hendra (kanan) disaksikan mereka terpanggil untuk melaporkan dugaan penyimpa- Kasat Intel Polres AKP Simatupang (tengah) menerima laporan dari mahasiswa. ngan tersebut kepada Kejari Kota Tanjungbalai dengan harapan untuk ditin- mengelola dan memberikan solusi terhadap daklanjuti. Bila terbukti, maka para pelakunya pertanian dan peternakan di kota itu. Kepala Kejari Kota Tanjungbalai melalui Kasi harusdiprosessecarahukum,danmasyarakatmemIntel,Hendra,dihadapanmahasiswamengatakan, percayakan hal itu kepada Kejari Tanjungbalai. Selain meminta agar ditangkap, mahasiswa akan menindaklanjuti laporan tersebut. Jaksa, kata juga menuntutWali Kota Tanjungbalai mencopot Hendra,akanmempelajariterlebihdahulukemudian kepala dinas yang dilaporkan tersebut. Sebab, melakukantelaah,mengumpulkandatadanmeminmahasiswa menilai kadis dimaksud tak mampu ta keterangan dari sejumlah orang. (a32)

Bupati L. Batu Ucapkan Selamat dr H Alwi Ikut Pilkada Palas

Waspada/Deni Syafrizal Daulay

PLT Sekda Labusel, Zulkifli melakukan penanaman pohon rambutan secara simbolis pada upacara peringatan Hari Lingkungan Hidup Sedunia 2013 tingkat Kab. Labusel di lapangan PTPN 3 Kebun Sisumut.

PANGKATAN(Waspada): Penglepasan dr H Alwi Mujahid Hasibuan MKes untuk mengikuti pertarungan pemilihan Bupati Padanglawas (Palas) mewarnai peringatan Bulan Bhakti Gotong Royong Masyarakat (BBGRM) dan Hari Kesatuan Gerak (HKG) PKK di lapangan bola kaki Desa Tebingtinggi, Kec. Pangkatan, Selasa (25/6). Pada kesempatan itu Bupati Labuhanbatu dr H Tigor Panusunan Siregar SpPD memberikan ucapan selamat kepada dr Alwi yang telah lolos verifikasi sebagai calon bupati indipenden oleh KPUD Palas. “Sebagai mantan staf saya, saya mengucapkan selamat berjuang. Sebagai dokter anda harus selalu siap melakukan perubahan di daerah anda terpilih atau tidak”, ujar Tigor. Tigor mengungkapkan, negara ini berdiri atas perjuangan para dokter yang ingin melakukan

perubahan pada masa itu karena karakter seorang dokter adalah senantiasa menginginkan perubahan ke arah yang lebih baik. “Dr Wahidin dan dr Sutomo merupakan dua dokter yang berjuang keras melakukan perubahan dengan melawanpenjajahanpadamasanya”,ungkapTigor. Terkait pelaksanaan peringatan HKG PKK, Tigor mengungkapkan, bahwa PKK merupakan bagian dari dirinya dalam melaksanakan tugas. Ketua Umum TP PKK Pusat, Ny Hj Vita Gamawan Fauzi dalam sambutan tertulisnya yang dibacakan Ketua TP PKK Labuhanbatu dr Hj Fitra Laila TP Siregar SpTHT menandaskan, HKG PKK Ke-41 Tahun 2013, tidak sekedar untuk menciptakan kemeriahan sesaat. Akan tetapi lebih memberikan makna dan ungkapan rasa syukur, atas berbagai kiprah dan karya nyata Gerakan PKK selama ini. (c07)


Sumatera Utara

WASPADA Kamis 27 Juni 2013

B3

Diselimuti Kabut Asap, Warga Paluta Pakai Masker GUNUNGTUA (Waspada): Dua hari terakhir, wilayah Kota Gunungtua, Kec. Padangbolak, Kab. Padanglawas Utara (Paluta) diselimuti kabut asap kiriman. Diduga hasil kebakaran lahan dan hutan, sehingga kondisi kabut asap yang tebal menyebabkan jarak pandang terganggu. Sejumlah warga pakai masker.

Satpol PP Madina Razia Hotel Menjelang Ramadhan Satu Pasangan Bukan Muhrim Diamankan PANYABUNGAN (Waspada): Menjelang bulan suci Ramadhan, Sat Pol PP Madina melakukan razia wilayah Pantai Barat tepatnya di Kec. Natal, baru-baru ini. Satu pasangan yang bukan muhrim diamankan dari salah satu hotel. Demikian disampaikan Kakan Sat Pol PP Madina, Hendra SSTP kepada Waspada, Selasa (25/6) di kantornya. Katanya, menjelang bulan Ramadhan ini razia PSK di tempat-tempat diduga lokalisasi akan terus di lakukan, sehingga umat Islam bisa beribadah dengan baik dan khusuk. Katanya, razia tersebut selain rutin dilakukan jelang bulan puasa juga karena banyaknya laporan masyarakat terkait maraknya tempat lokalisasi di wilayah Pantai Barat. Razia bekerjasama dengan Polres Madina dan Polisi Meliter. Namun pelaksanaan razia di tempat yang di duga dijadikan lokalisasi tutup semua diduga informasi bocor, hanya belasan minuman berakohol diamankan serta satu pasangan yang berada di hotel. “Kita akan memberikan surat peryataan kepada pasangan yang berhasil di jaring agar tidak mengulangi perbuatanya, dan razia akan rutin di lakukan untuk menimalisir tempat-tempat yang di duga di jadikan tempat maksiat,” katanya. Kakan Satpol PP Madina sangat mengharapkan peran serta masyarakat, tokoh agama dalam pemberantasan penyakit masyarakat khususnya dunia prostitusi di Madina. (c14)

Himpak Gelar ‘Pepalum Nteddoh’ MEDAN (Waspada): Dewan Pimpinan Pusat Himpunan Masyarakat Pakpak (DPP Himpak) akan menggelar‘pepalum nteddoh’ atau temu kangen, di pelataran Mess Pemkab Pakpak Bharat, Jalan Ngumban Surbakti Medan, Sabtu (29/6). Hal itu diungkapkan Ketua Umum DPP Himpak Drs H Citra Efendi Capah, MSP didamping Sekretaris Jenderal (Sekjen) Drs Lister Berutu, MA, usai menerima laporan persiapan panitia yang diketuai Mulia Banurea, MSi, di sekretariat DPP Himpak Jalan Karya Jaya No 46 Komplek JBBC Medan Johor, Sabtu (22/6). Citra menjelaskan, pepalum nteddoh ini bertujuan menghimpun masyarakat Pakpak yang ada di Kota Medan. Kemudian mempertunjukkan kekayaan budaya Pakpak melalui kesenian tradisional dan modern. “Kegiatan budaya ini juga untuk meningkatkan kebersamaan dan solidaritas sesama warga Pakpak yang hidup di tengah masyarakat Kota Medan yang heterogen, sekaligus jadi wahana saling tukar informasi,” kata Citra Efendi Capah. Dalam kesempatan itu, Ketua Panitia Mulia Banurea MSi didampingin Sekretaris Drs Rafuddin Berutu dan Bendahara Warni Banurea menjelaskan, acara akan dimulai pembukaan oleh Syahril Maha dan Heppi Berutu, kemudian upacara nasional dipandu Erlin br Lingga. Selanjutnya, acara merkata genderang sisibah oleh Sanggar Nantampuk Emas. (m26)

Mendagri Diminta Tunjuk Plt Bupati Madina PANYABUNGAN (Waspada): Menteri Dalam Negeri (Mendagri) Gamawan Fauzi diminta untuk segera menunjuk dan mengangkat pelaksana tugas (Plt) Bupati Madina untuk menggantikan Bupati Hidayat Batubara. “Mendagri Gamawan Fauzi harus segera menonaktifkan Bupati HidayatBatubarayangsaatinimenjalanimasapenahanandiKPKuntuk pemeriksaan atas dugaan penerimaan hadiah untuk proyek Bantuan Dana Bawahan,” ujar Ketua Konsorsium Mahasiswa Tapanuli Bagian Selatan (Tabagsel) Adi Nasution di Panyabungan, Rabu (26/6). Dikatakan, sebelum adanya Plt Bupati Madina, biaya kerja para SKPD Pemkab Madina akan sangat tinggi karena harus hilir mudik ke Jakarta untuk penandatanganan surat-surat. Adi menambahkan, kasus yang menimpa Bupati Madina Hidayat Batubara tidak jauh beda dengan Gubernur Riau Rusli Zainal yang tersangkut masalah korupsi dan tengah ditahan KPK. “Dalam kasus itu Mendagri Gamawan Fauzi menunjuk Wakil Gubernur Riau Mambang Mit sebagai Plt Gubernur Riau sehingga roda pemerintahan tidak terganggu,” jelasnya. (a26)

Waspada/Ist

KETUA DPRD Langkat H. Rudi Hartono Bangun, SE, M.AP menyapa sejumlah orangtua lanjut usia pada Peringatan Hari Keluarga XX 2013 Kab. Langkat.

Ketua DPRD Langkat:

KB Wujudkan Generasi Unggul LANGKAT (Waspada): Ketua DPRD Langkat H. Rudi Hartono Bangun, SE, M.AP, mengajak masyarakat Kab. Langkat untuk menyukseskan program Keluarga Berencana (KB) untuk menjadikan generasi mendatang sebagai generasi yang unggul dan bermutu. Ajakan itu disampaikanya pada Peringatan Hari Keluarga XX 2013 Kab. Langkat di halaman Kantor Badan Keluarga Berencana dan Pemberdayaan Perempuan (KB dan PP) Kabupaten Langkat, Selasa (25/6). Hadir para tokoh dan pemimpin wanita Kab. Langkat, sejumlah pimpinan SKPD, Ketua MUI Langkat, Ketua TP PKK Kab. Langkat, dan Bupati Langkat diwakili PLH Setdakab Langkat Dr. H. Indra Salahuddin, .M, Kes. Menurut Rudi Hartono Bangun, hingga saat ini Indonesia menempatiurutankeempatnegaradenganjumlahpendudukterbesar di dunia. Jumlah penduduk yang besar itu bisa menjadi modal pembangunanjikamerekadalamkondisisehatjasmanidanrohanimya, mempunyai pendidikan, keterampilan, dan ahlak yang baik. Namun juga bisa menjadi beban jika mereka lemah. Menurut Rudi Hartono Bangun, di sinilah pentingnya digalakkannya kembali program Keluarga Berencana yang sempat agak melemah dikampanyekan beberapa waktu. Para petugas lapangan KB harus terus mengingatkan pasangan usia subur untuk dapat mengatur dan merencanakan kehamilan mereka. Kepala Badan KB dan PP Kabupaten Langkat, Drs. H. Darwan Hasrimy,MM,dalamsambutanyamengatakan,Kab. Langkat termasuk daerah yang berhasil dalam program KB, lebih baik dari rata-rata provinsi Sumatera Utara. Sedangkan Ketua TP-PKK Kabupaten Langkat, Ny. Hj. Nuraida Ngogesa Sitepu menekankan pentingnya kesadaran untuk memperbaiki kualitas kehidupan. Salahsatu caranya dengan mensukseskan program KB. Namun kemajuan itu haruslah berdasarkan norma-norma agama dan budaya Indonesia. Bupati Langkat, yang diwakili oleh PLH Sekdakab Langkat, Dr. H. Indra Salahuddin, M. Kes, menyatakan keluarga kecil yang bahagia dan sejahtera merupakan target program KB. (ihn)

Pantauan Waspada, kabut asap terjadi sejak dua hari ini diduga dampak asap dari Riau, dimana hampir seluruh wilayah Paluta khususnya di Gunungtua. Meskipuntidakmengganggu penglihatan tapi diselimuti asap, namunpalingparahterjadiSelasa (25/6) sekira pukul 15.45 hingga malam. Akibat kabut asap tersebut, sejumlah masyarakat, terutama pengendara motor di

Gunungtua, banyak mengeluhkan kondisi mata mereka yang pedih, termasuk nafas mereka yang sesak, sehingga terpaksa menggunakan masker untuk menutup hidung. “Kabut asap yang menyelimuti Paluta ini terjadi karena dekatnya Paluta dengan Riau secarageografissehinggamemungkinkan asap ini sampai ke Paluta ditambah daerah ini selama dua minggu terakhir dilanda angin

kencang dan musim kemarau,” ujar warga Lingkungan VI Paranginan, Tajuddin Hasibuan kepada Waspada. Kondisi ini, lanjutnya, menyebabkancahayamataharitidak seperti biasanya, sehingga membuat suasana redup seperti sore hari. Meskipun cahaya matahari tidak terik, namun suhu udara di wilayah Kota Gunungtua khususnya dan beberapa kecamatan di Paluta terasa panas. (a35)

Puting Beliung Landa Dairi, Puluhan Rumah Porak Poranda SIDIKALANG (Waspada): Puluhan atap rumah porak poranda di Desa Berampu, Kec. Berampu serta di Desa Lae Parira, Kec. Lae Parira, Kab. Dairi, akibat dilanda hujan es serta terjangan angin puting beliung. Peristiwa ini terjadi, Selasa (25/6) sekira pukul 18:00 , di saat daerah itu dilanda hujan lebat. Informasi diperoleh Waspada, Rabu (26/6), tidak ada korban jiwa dalam peristiwa itu, tetapi empat warga dikabarkan

mengalami luka-luka. Akibat peristiwa itu kerugian ditaksir mencapai ratusan juta. Kepala Badan Penanggulangan Bencana Daerah (BPBD), Maruli Barasa ST, dihunungi membenarkanperistiwatersebut. Jumlah rumah warga yang mengalami kerusakan khususnya di bagian atap mencapai lebih 20 rumah di Desa Beramapu. Tetapi karena kejadian ini terjadi dua kecamatan, tim terus melakukan pendataan jumlah

rumah yang rusak akibat hujan es dan angin puting beliung itu. “Kami masih tetap berkoordinasi dengan kepala desa maupun camat setempat untuk mendapatkan data sebenarnya,” ujarnya. Ditambahkan, selain merusakrumahpenduduk,peristiwa hujan es tersebut juga merusak tanamanpadimasyarakatdiDesa Berampu yang sudah siap panen, luasnya belum dapat kita pastikan. (a20)

Ongkos Angkutan P.Sidimpuan-Madina Naik Rp5 Ribu P. SIDIMPUAN (Waspada): Seiring dengan pemerintah yang menaikkan harga Bahan Bakar Minyak (BBM), para sopir angkutan umum jenis L300 jurusan PadangsidimpuanMandailing Natal (Madina) juga menaikkan ongkos Rp5.000 per daerah tujuan atau trayek. Isa Nasution, sopir angkutan CV Madina Utama, yang ditemui di Terminal Palopat, Kec. Sidimpuan Tenggara, Selasa (25/6), menyebut kenaikan ongkos untuk sewa umum Rp5 ribu, se-

dangkan untuk anak sekolah dikenakan kenaikan Rp3 ribu. Dikatakan, tarif atau ongkos angkutan jenis L300 untuk sewa umum dari Padangsidimpuan menuju berbagai daerah di Madina saat ini adalah, tujuan Panyabungan dari Rp15 ribu menjadi Rp20 ribu. Kotanopan dari Rp20 ribu menjadi Rp25 ribu,tujuanSikapasdariRp70ribu jadi Rp75 ribu. Sedangkan tarif ongkos untuk anak sekolah, dari Padangsimpuan ke Panyabungan dari

Rp12 ribu jadi Rp15 ribu. Ke Kotanopan jadi Rp20 ribu dan ke Sikapas menjadi Rp70 ribu. Informasi diperoleh di stasiunbussepanjangJalanImam Bonjol, Kel. Padangmatinggi, hingga kini belum ada kenaikan ongkos. Karena pihak perusahaan masih menunggu keputusan Organda Sumatera Utara. Menurutinformasi,kenaikan ongkos bus mungkin akan terjadi pada pertengahan bulan Ramadhan atau menjelang Idul Fitri. (a27)

Listrik Padam Saat Maghrib SIBOLGA(Waspada):Sejumlah warga Muslim yang akan dan sedang melaksanakan ibadah Shalat Maghrib, Selasa (25/6), merasa terganggu. Pasalnya, tanpa diduga dan tak ada cuaca buruk, lampu listrik PLN mendadak padam, mulai dari kawasan Kel. Aek Manis Kec. Sibolga Selatan umumnya serta Kel. Sarudik dan Kecamatan Sarudik Tapteng dan sekitarnya. “Kita sangat menyesalkan PLN yang melakukan pemadaman mendadak saat kita sedang melaksanakan Shalat Maghrib. Karena dis aat kita sedang konsentrasi beribadah, tiba-tiba saja listrik padam. Padahal, sebelumnyakalauadapemadamanlistrik, biasanyapihakPLNmemberikan pemberitahuan terlebih dulu,” keluh Raden, 52, salahseorang

wargaKel.AekManis,Kec.Sibolga Selatan, Rabu (26/6). Hal senada dikeluhkan ibu rumah tangga yang saat itu juga mengaku sedang melaksanakan ibadah Shalat Maghrib. “Kalau pada siang hari ada pemadaman listrik,kitamasihbisamemaklumi. Namun saat menjelang malam, persisnya saat kita Shalat Magrib, tentunya kita sangat kesal. Karena saatitukitasedangmelaksanakan Shalat Magrib,” ujar Aswati, 43, salahseorang ibu rumah tangga wargakelurahanSarudikTapteng.. Informasi yang dihimpun Waspada , sebagian Kota Sibolga dan sebagian Kab. Tapanuli Tengah,Selasa(25/6),mulaisekira pukul 18.30, mendadak listrik padam hingga sekira pukul 21.30. Akibatnya, sejumlah kawasan gelap gulita dan sejumlah warga

Muslimterganggumelaksanakan ibadah Shalat Maghrib. Anggota DPRD Kota Sibolga Jansul Perdana Pasaribu SAg, juga sangat menyesalkan padamnya listrik saat Maghrib. Wakil rakyat dari Partai Keadilan Sejahtera ini malah meminta PLN tidak memadamkan aliran listrik saat bulan suci Ramadhan. Kepala PLN Wilayah Sibolga yang dikonfirmasi melalui Sekretaris/Humas A Tanjung Rabu (26/6) meminta Waspada untuk menanyakan langsung kepada Manajer Rayon Sibolga BHutagalung.Namunsayangnya, ketika beberapa kali Manajer PLN RayonSibolgayangdicaridiruang kerjanya belum berhasil ditemui. Teleponselulernyadihubungijuga tidak dijawab. (cpol)

Warga Banjar Dapat Bantuan Makanan Sehat Balita PEMATANGSIANTAR (Waspada): Warga, Pos Pelayanan Terpadu (Posyandu) dan Pusat Kesehatan Masyarakat Pembantu (Pustu) Kel. Banjar, Kec. Siantar Barat, Kota Pematangsiantar, mendapat bantuan makanan sehat bayi di bawah lima tahun (balita), peralatan Posyandu dan Pustu dari Pertamina Terminal BBM Pematangsiantar. “Ini wujud kepedulian terhadap warga di sekitar operasional perusahaan yang turut membantu membuat kondusif keamanan hingga operasional perusahaan lancar,” sebut Operation Head Pertamina Terminal BBM Pematangsiantar Suwardi didampingi Camat Siantar Barat L. Pardamean Manurung, Lurah Banjar Adenan, Kepala Pustu Banjar Dr. Chandra I Tarigan, Ny. Suwardi dan lainnya saat penyerahan bantuan corporate social responsibility (CSR) Pertamina Terminal BBM bidang kesehatan berupapemberdayaanPosyandu danPustutahun2013diaulakantor Kelurahan Banjar, Rabu (26/6). Suwardi menyebutkan,

bantuan makanan sehat balita itu diberikan 100 paket kepada ibu-ibu yang memiliki balita, timbangan badan lima unit, peralatan mencek darah dan kolesterol sembilan kotak, peralatan perlengkapan Pustu berupa televisi, receiver dan parabolasatuunitditerimaKepala Pustusertakelengkapanbajukaos tim Posyandu 35 potong, kursi plastik10unitdanduamejaplastik untuk Posyandu. “Kami membantu warga dengan lebih dulu bertanya apa yang mereka perlukan, karena memberikan barang tanpa bertanya lebih dulu apa yang dibutuhkan, bisa menjadi mubazir. Kami mengharapkan barang yang diberikan bisa bermanfaat bagi warga, Posyandu dan Pustu. Nilai seluruh bantuan Rp35 juta,” sebut Suwardi. Suwardi menambahkan penyerahanbantuanitusekaligus mendukung program penilaian peringkat kinerja perusahaan (Proper) dalam pengelolaan lingkungan hidup, dimana Terminal BBM Pematangsiantar

sudah dua tahun Proper Hijau. “Proper ada beberapa peringkat dan paling bawah hitam dan berikutnya,merah,biru,hijaudan gold. Terminal BBM Pematangsiantar tahun 2013 direncanakan mendapat Proper Gold.” Menurut Suwardi, perusahaanharusselalumengupayakan pengelolaanlingkungan,minimal lingkungan tempat kerja, apakah ada pencemaran air, udara dan pengrusakan lingkungan serta ditambah tertib administrasi pelaporan lingkungan hidup. Camat Siantar Barat atas nama warga mengucapkan terimakasih kepada Pertamina Terminal BBM Pematangsiantar atas bantuan yang diberikan dan mengharapkan bantuan dapat diberikan tiap tahun. Kepala Pustu Banjar mengharapkan, terutama kepada para ibu yang mempunyai balita, agar jangansungkan-sungkanmemeriksakan balita mereka secara rutinkePosyandudanPustuserta berterimakasih atas bantuan Pertamina Terminal BBM Pematangsiantar. (a30)

Waspada/Edoard Sinaga

BANTUAN Pertamina Terminal BBM Pematangsiantar diserahkan Operation Head Suwardi (dua dari kiri) kepada ibu-ibu yang mempunyai balita saat penyerahan bantuan CSR bidang kesehatan di aula kantor Kelurahan Banjar, Kecamatan Siantar Barat.

Waspada/ Rap.Negara Siregar

KEPALA Sub Seksi Penindakan dan Penyidikan Bea dan Cukai P.Siantar, Martogi Silaen, (kiri) dan petugas operasi Rama Budi Permana (kanan) sedang memperlihatkan hasil tangkapannya, di kantor Bea dan Cukai Pematangsiantar.

‘Mainkan’ Pita Cukai, 847 Bungkus Rokok Disita PEMATANGSIANTAR (Waspada): Dalam masa empat hari pelaksanaan operasi penertiban cukai di tiga daerah, tim operasional Bea dan Cukai Pematangsiantar di bawah kordinasi Kepala Sub Seksi Penindakan dan Penyidikan Kantor Bea dan Cukai kelas I-B Pratama Pematangsiantar, Martogi Silaen, berhasil menyita 847 bungkus rokok produksi dari perusahaan rokok di Pulau Jawa. Menurut Martogi Silaen, saat melakukan pendataanatashasiltangkapannyaitudikantornya dijalanSisingamangarajaPematangsiantarkepada Waspada, Rabu (26/6) siang mengatakan, rokok yang disita dari kedai dan warung-warung itu berada di tiga daerah di wilayah kerjanya, yaitu Kab. Simalungun, Tanah Karo dan Kab. Dairi. Rokok-rokok yang disita itu terdiri dari delapan mereka rokok yang rata-rata rokok tersebut selama ini laku dijual di daerah-daerah luar perkotaan.Dan rokok-rokok tersebut pada bungkusnya jelas tertulis di produksi perusahaan rokok di Pulau Jawa, seperti dari Kudus, Pasuruan dan Sidoarjo. Perusahaan produksi rokok tersebut diketahui telah melakukan pemalsuan pita cukai,yaitu dengan cara menempelkan pita cukai yang tidak

sesuai dengan isi di dalam bungkus rokok. Contohnya, pada pita cukai yang ditempelkan tertulis isi 12 batang rokok namun kenyataannya rokok tersebut di dalam bungkus berisi 16 batang. Dan dari hasil perhitungan yang dilakukan tim operassional yang terdiri dari Muhammad Husen Rambe, Rama Budi Permana,Zupan Sinaga dan Eko Priandi itu, akibat perbuatan pihak peru sahaan rokok tersebut , negara mengalami kerugian mencapai Rp 10 juta lebih. MartogiSilaenmenyebutkan,pihaknyamasih terus melakukan operasi sekaligus memantau kegiatan penyaluran rokok pengguna pita cukai yang tidak sesuai dengan isinya itu ke daerah pemasarannya. “Petugas kami sudah mengantongi data-data tentang armada yang digunakan pihak distribusi serta kapan-kapan saja mereka melakukan kegiatannya.Mudah-mudahan petugas kami dilapangan dapat menangkap tangan para pelaku kejahatan pita cukai itu,” kata Silaen. Sebelumnya kantor Bea dan Cukai Kelas I-B PratamaPematangsiantarberhasilmenangkapdan menyita 2.821 bungkus rokok pengguna pita cukai tidaksesuaiisidan218minumanbotolmengandung etil alkohol berbagai merek. (crap/c16)

Bupati Palas Salurkan Bantuan Ongkos Haji TPHD SIBUHUAN (Waspada): Bupati Padanglawas (Palas) H Ali Sutan Harahap (TSO) melalui Plt. Sekretaris Daerah Drs H Irfan Soaduon Hasibuan menyalurkan bantuan ongkos naik haji kepada dua orang tim petugas pembimbing haji daerah (TPHD) tahun 2013. Penyerahan batuan ongkos haji TPHD Palas itu dilaksanakan di ruang kerja Sekda, sekretariat Bupati Palas di Sibuhuan, Rabu (26/6). Kedua TPHD tersebut yakni H Abdul Wahid Harahap dari Desa Sangkilon, Kec Lubuk Barumun dan Abdul Wahid Siregar dari Kemenag Palas. Penyerahan bantuan tersebut juga disaksikan Kepala Seksi Haji Kantor Kementerian Agama Padanglawas H.IskanNur danBendaharaSekretariat Kantor Bupati Zainuddin Hasibuan MM. Dalam pengarahannya, Bupati mengharap-

kan TPHD nantinya dapat bertugas dengan prima baik dari segi administrasi maupun pelayanan terhadap jamaah calon haji Padanglawas mulai daripemberangkatanhinggapemulangan,karena jamaah haji merupakan duta daerah sekaligus duta bangsa Indonesia. Kedua TPHD Palas tersebut mengatakan, mereka akan melaksanakan tugas seoptimal mungkin,sehinggajamaahcalhajasalPadanglawas dapat dengan sempurna melaksanakan manasik haji, sehat wal afiat dan memperoleh haji mabrur. KepalaSeksiHajiiKantorKementerianAgama Padanglawas,H.IskanNur mengatakanuntuktahun ini jamaah calon haji yang sudah melunasi ongkos haji303calonhaji,namunkarenaadanyapemotongan kuotajumlahhajiIndonesia,makajumlah jamaah haji Palas belum bisa dipastikan. (a34)

Tarif Angdes Di Simalungun Naik 20 Persen SIMALUNGUN (Waspada): Tarif angkutan pedesaan (Angdes), mobil penumpang umum dan bus umum di Simalungun naik 20 persen sesuai ketetapan maksimal Dishub Provinsi Sumatera Utara. “Kenaikan efektif berlaku mulai Jumat depan, tetapi kami masih mentolerir jika ada yang sudah menaikkan tarif asal tidak melebihi ketetapan 20 persen. Jika ketahuan akan kami tindak,” ujar Kadishubkominfo Mixnon Andreas Simamora. Pemerintah Kabupaten (Pemkab) Simalungun melalui Dinas Perhubungan Komunikasi dan Informatika (Dushubkominfo) menggelar rapat kenaikan tarif angkutan desa (angdes) dengan stakeholder, Selasa (25/6), di ruang Harungguan kantor bupati di Pamatang Raya. Rapat dipimpin Sekretaris Daerah Drs Gidion Purba MSi mewakili Bupati didampingi Asisten Ekonomi dan Pembangunan Johanes Gurning, Kadishubkominfo Mixnon Andreas Simamora, anggota DPRD Agus Sofyan Siregar dan Dody

H Lukman, Kabag Ren Polres Simalungun Kompol Ramli Sirait, Ketua Organda Simalungun Timbul jaya Sibarani dihadiri Kepala Jasa Raharja PematangsiantarWDamanik,7direksiperusahaan angkutan dan para camat. Ketua Organda Simalungun, Timbul Jaya Sibarani, menyampaikan kepada stakeholder mematuhi kesepakatan dan berharap Pemkab memperbaikijalanrusakuntukmengurangibeban operasional angkutan. “ Saat ini sekitar 40 persen angkutan tidak melayani penumpang karena beban bertambah sedangkan ongkos belum naik. Ada penambahan biaya Rp60 ribu untuk 30 liter bensin sehari,” katanya. Sekda mengapresiasi pihak angkutan yang tidak memaksakan menaikkan tarif dengan tinggi dan lebih menyesuaikan dengan pendapatan masyarakat.“ Naik wajar, tetapi kalau terlalu tinggi menjadi beban masyarakat. Ternyata sopir dan pengusaha angkutan memiliki pengertian kepada masyarakat,” ujar Purba. (a29)

Dandim: Penyelenggara Pilkada Dairi Harus Netral SIDIKALANG (Waspada): Dandim 0206 Dairi Letkol. Inf.Drs.Syawal Fahmi Tambunan,MM mewanti-wanti agar menjadikan perbedaan menjadi pemersatu. “Jika itu dapat kita laksanakan di pemilukada nanti,makapestademokrasitersebuatakanaman, damai dan sukses,” ujarnya saat rapat pleno penetapan daftar pemilih sementara (DPS) pada pemilihan kepala daerah (Pilkada) di gedung KPU Dairi, kemarin. Disebutkannya, polisi dan TNI tidak memihak siapapun,dansiapapunnantiyangterpilihmenjadi bupati dan wakilnya, itulah pimpinan kita semua. Diharapkan kepada semua penyelenggara pemilu agar netral dalam melaksanakan semua tahapan pilkada. “Perbedaan yang memang ada di masyarakat mari kita jadikan jadi pemersatu,” tegasnya. Ketua KPU Dairi Ferianto Sitohang menjelaskan, jumlah pemilih sementara hingga saat ini mencapai 207.678 orang dan masih diberi kesempatankepadawargaDairiuntukmendaftarkandiri menjadi pemilih hingga 17 Juli 2013, dengan langsung mendaftar ke PPK membawa KTP dan KK. Ferianto juga mengajak seluruh masyarakat memeriksa nama di DPS di kantor pemerintahan, apakah ada terdaftar atau tidak, sehingga ketika Pemilukada dilaksanakan tidak lagi terjadi persoalan. Peran serta masyarakat sangat diharapkan untuk mensukseskan Pilkada Dairi. Ditegaskan, masyarakat yang boleh memilih nantinya adalah pemilih yang namanya sudah terdaftar di Daftar Pemilih Tetap (DPT) pada pelaksanaan pilkada,walaupun masyarakat tidak mendapatkan formulir C6 yaitu surat undangan memilih, asalkan terdaftar di DPT tetap bisa mem-

berikan hak suara dengan menunjukkan KTP. Kajari Sidikalang Pendi Sijabat,SH.MH juga mengajak masyarakat Dairi dalam menjalani tahapan pemilukada harus mengacu pada peraturan pemilukada dan Bhineka Tunggal Ika,walau berbeda pilihan nantinya, diharapkan seluruh penyelenggara pemilu dan masyarakat saling menjaga keamanan dalam pelaksanaan tahapan pemilukada terlebih saat pelaksanaan pemilukada 10 Oktober 2013. Kapolres Dairi,Enggar Pareanom dalam arahannya mengajak seluruh penyelenggara pemilukada agar bekerja sesuai dengan prosedur dan fungsi masing-masing. Sikap netral menjadi acuan setiap penyelenggara pemilu. Sementara polisi dan TNI adalah bertanggungjawab dalam keamanan pilkada. “Mari kita tetap saling berkoordinasi untuk memberi rasa aman bagi masyarakat dalam melaksanakan tahapan pemilukada,” ajak Enggar. MewakiliBupatiDairi,AsistenI,RewinSilaban mengajak PPK bekerja keras mendata warga sehingga nantinya saat pemilukada dilaksanakan tidak terjadi konflik yang merugikan calon kepala daerah dan wakilnya. Bila DPT bermasalah, dikatakan Rewin, akan berakibat hasil pemilukada bermasalah, karenanya PPK harus bekerja ekstrakeras, tegasnya. Sedangkan Ketua Panwas Kab Dairi Hotmanita Capah dikesempatan itu juga menerangkan, pengawasanpemilukadasiapdilaksanakanseluruh panwas, jika laporan pengaduan tertulis dari masyarakat pelanggaran pilkada, maka segera ditindak lanjuti sesuai mekanisme. “Panwas tetap bersikap netral dalam Pilkada,” ujarnya. (ckm)


Opini

B4 TAJUK RENCANA

Kekuatan Persuasi

Minim Prestasi Sarat Masalah

K

abar menggembirakan datang dari PT Liga Indonesia (PT LI) yang berjanji membantu 11 pemain PSMS Medan karena berbulan-bulan tidak gajian. PT LI melalui CEO-nya Djoko Driyono menawarkan cara pelunasan gaji 11 pemain PSMS melalui dana subsidi. Konon PT LI mau mengucurkan dana Rp 200 juta langsung ke pemain yang berunjuk rasa ke kantor PSSI Pusat pekan lalu. Berarti, sudah ada solusi dari PT LI sehingga pengurus PSMS wajib berterima kasih. Jangaan sampai mempersulit penyalurannya. Hemat kita, lebih baik kalau uang tersebut langsung diberikan kepada para pemain. Sebab, kalau lewat tangan pengurus PSMS bisa-bisa tidak sampai atau dipotong lagi sehingga permasalahan tidak dibayarnya gaji pemain ini menjadi semakin berlarut-larut. Permasalahan pemain tidak dibayar gajinya oleh pengurus klub seperti halnya PSMS bukan yang pertama. Banyak klub lain yang gagal mengelola klubnya sehingga berdampak pada pendanaan. Kas kosong, utang menumpuk. Artinya, klub atau tim itu tidak mampu berprestasi, penontonnya minim, dan sponsor menjadi tidak berminat, akhirnya kesulitan membiayai klub/ tim, termasuk gaji pemain tertunda-tunda pembayarannya. Lain halnya dengan klub-klub elite, sudah punya nama besar. Mereka bisa hidup mewah karena di bawah naungan perusahaan atau tanggung jawab pengusaha ternama, sehingga pembayaran gaji dan hak-hak pemain berjalan aman-aman saja (lancar). Sebenarnya, PSMS juga punya nama besar. Baru pertama kali ini manajemen PSMS tidak mampu membayar gaji pemain sampai 10 bulan. Hal ini jelas kesalahan fatal dari pengurus. Sehingga sewajarnya kalau pengurus dituntut mundur dari jabatannya, begitu pula dengan manajer tim dll. Selaku pengurus Intisari merekalah yang bertanggung jawab terkait urusan pemain, termasuk pembayaran gaji, kebutuhan tim lainnya saat latihan, PSMS bukan lagi the dan bertanding dll. Masalah tersebut menjadi urusan killer tapi perserikatan manajemen klub khususnya ketua umum dan manajer tim. sarat masalah dan sedih Namun begitu kita prihatin dengan ucapan Driyono selaku CEO PT Liga Indonesia tak mampu bayar gaji Djoko yang menganggap masalah gaji pemain PSMS pemain yang belum dibayarkan selama 10 bulan merupakan hal biasa. Seharusnya hal itu merupakan ‘’aib’’ dunia sepakbola Indonesia, termasuk kesalahan pengurus PSSI, PT LI, dan pengurus klub-klub. Kalau mereka tidak mampu lebih baik mengundurkan diri. Jangan memaksakan diri menjadi pengurus, namun mengabaikan hak-hak pemain. Pengurus PSSI, PSMS dan PT Liga Indonesia tidak bisa lepas tanggung jawab atas masalah yang mendera para pemain PSMS dan sejumlah klub lainnya yang mengalami hal sama. Selain tidak dibayarnya gaji para pemain PSMS kita juga prihatin dengan terjadinya jual-beli pertandingan. Para pemain PSMS mengaku diminta kalah melawan klub-klub lainnya, atau hasil pertandingan diminta berakhir seri. Pastilah permintaan itu sama dengan suap menyuap dan terkait dengan judi, sehingga kasusnya tidak boleh didiamkan begitu saja. Semua pihak wajib mendesak dilakukan pengusutan dan menindak siapa pun yang bersalah (terlibat). Kasus suap pernah melanda Ayam Kinantan di tahun 1980an melibatkan belasan pemain ketika mengikuti turnamen. Masa itu pengurus PSSI Pusat diwakili Acub Zainal bersama Amran YS selaku tokoh sepakbola Sumut yang sukses membawa PSMS dua kali juara perserikatan menindaklanjuti dugaan kasus suap-menyuap di dalam tim PSMS. Hasilnya, pihak berwajib sukses membongkar kasus suap dalam tim PSMS. Tidak hanya mengintrogasi para pemain dan pihak-pihak yang terlibat, termasuk cukong suapnya ditangkap. Kasusnya bergulir hingga pengadilan dan semua yang terlibat dihukum sesuai tingkat kesalahannya. Sumut selama ini dikenal sebagai gudangnya pemain sepakbola. Khususnya nama besar PSMS menjadi jaminan pertandingan bakal berjalan seru dan menarik sehingga tidak sulit mendatangkan penonton ke stadion, baik kandang maupun tandang. Sayangnya, kehebatan PSMS sejak tahun 1950an hingga tahun 1980an, secara pelan tapi pasti mengalami penurunan, sehingga PSMS tidak mampu lagi bercokol dalam kompetisi bergengsi. Beberapa kali mengalami degradasi alias turun kelas. Hal ini membuat minat penonton berkurang. Kalau jumlah penonton minim maka sponsor berkurang, sehingga pendapatan PSMS semakin minim. Masih untung beberapa tahun lalu, Walikota Medan mendanai PSMS lewat APBD sehingga masalah pembiayaan PSMS tidak menimbulkan masalah. Setelah muncul larangan menggunakan dana APBD, pembinaan tim PSMS tertatih-tatih. Dalam internal PSMS terjadi intrik-intrik sehingga menimbulkan dualisme kepengurusan. Satu PSMS di bawah komando Benny Sihotang, satu lagi PSMS di bawah pimpinan Indra Sakti. Keduanya tidak mampu menjalankan tugasnya dengan baik sehingga nasib PSMS semakin menyedihkan. Minim prestasi, sarat masalah, jauh dari profesional.+

Foliopini

Dedi Sahputra dedisahputra@yahoo.com

Pembujuk Telefon yang berdering itu mengabarkan cerita tentang kegundahan. Seketika hatiku diliputi drama. Bulu-bulu roma pun tiba-tiba berdiri. Getaran halusnya terasa di sekujur badan tanpa kecuali. Orang menyebutnya merinding. Entah sudah berapa kali saya merasakan bulu roma berdiri seperti ini. Setiap berada dalam kondisi cemas, takut, bulu-bulu itu akan berdiri serentak. Tapi kali ini saya baru sempat memerhatika mereka. Kenapa namanya bulu roma, kenapa bukan “bulu medan” yang lebih dekat misalnya, “bulu tanjungmorawa” yang bernuansa alam, atau “bulu padangbulan” yang lebih terdengar eksotik. Soal nama ini biarlah para ahli bahasa nanti yang menerangkannya.Tapi kalau bulu roma itu tumbuh di hampir setiap hamparan tubuhku, itu benar adanya. Mereka bersusunsusun dengan kerapihan yang menakjubkan. Jika kulit tubuh adalah kebun sawit, maka ia adalah koloni dengan keteraturan tak tertandingi. Dia tumbuh di tempat yang semestinya tumbuh dan tak tumbuhditempatyangsemestinya tak tumbuh. Di masingmasing tempatnya terhampar, ukuranmerekarelatifpresisisatu samalain.Antarasatubuluroma dengan yang lain punya tinggi dan ketebalan yang sama dan sebangun. Coba perhatikan bulu roma di tangan, mereka punya ukuran yang“sebaya” dengan arah kecondongan tumbuh seirama, membentuk guratan meliuk-liuk. Ketika berdiri, bulu-bulu ini melakukannya secara serentak kolosal.Seolahadainstruksitaktisagarmereka melakukannya—yang ditaati dengan kepatuhan mengagumkan. Perintah itu seperti dirijen dalam suatu harmoni yang memerintahkan hanya bulu roma saja yang berdiri, dan bulu yang lain harus tetap pada tempatnya. Tak terbayangkan kalau ketika engkau takut, semua bulu di tubuhmu ikut berdiri; rambut, alis, ketiak, kumis, dan jambangmu. *** Vincent melompat ke dalam taksi Max danmemaksanyamembawaketempatorang yang akan dihabisi satu-persatu. Tapi Max akhirnyabertindakjugaketikaVincenthendak membunuh Annie, perempuan yang diidolakannya. Vincent adalah pembunuh bayaran yang mendapat order membunuh lima orang sekaligus dalam satu malam. Vincent tentu orang yang berdarah dingin. Dia benar-benar dingin, dengan kemampuan membunuh

secara taktis dan efektif. Saya menyukai akting Tom Cruise yang memerankan Vincent dalam film berjudul Collateralini.Tapibukanresensifilmyanghendak saya tulis, cuma pilihan judul film ini. Dalam duniaperbankanistilahcollateraladalahjaminan yang mungkin bisa disita apabila ternyata calon pelanggan tidak bisa memenuhi kewajibannya. Tapi nama asli collateral ini dinisbahkan dalam bidang kedokteran. Dia adalah sirkulasi sampinganuntukkebutuhandarurat.Wujudnya adalahpipa-pipapembuluhrambutkapileryang pada dasarnya menguncup, diam di tempatnya. Collateral ini baru akan bekerja ketika aliran darah di pembuluh arteri terhalang secara gradual. Ketika ini terjadi maka collateral segera tumbuh mengembang di atas dan di bawah penyumbatan, yang akhirnya bertemu dan bersambung—yang dengannya, darah bisa mengalir hingga meskipun arteri-mu tertutup, engkau akan tetap merasa sehat. Mandatnya adalah menjadi cadangan.Tapi lagi-lagi mandat itudijalankandengankepatuhan tiada tara. Dia mungkin tak akan pernah bekerja sepanjang jantungmu dalam keadaan sehat. Dicollateralinisayamenemukan keteraturan dan kepatuhan setara teraturnya alam semesta. Kesetiaanbumi,bulan,matahari yang berada pada orbitnya dengan kepatuhan pada mandatnya. *** Kalau LR.Sauvage yang menjelaskan proses collateral tak dapat menutupi kekagumannya padaorganyangsatuini—betapatidak,collateral ini bekerja dengan sangat taktis dan otomatis. Dia seperti jari-hari tangan yang saling menggenggamsatusamalain—makasayajugakagum pada keajaiban bulu-bulu roma ini. Tidakcumapadabulu,sayajugakagumpada hidung yang posisi lubangnya di bawah, pada mata yang jumlahnya cuma dua, pada tangan dan kaki yang memiliki siku di tengahnya, dan pada segala yang melekat di dalam kemanusiaanku. Semuanya adalah keajaiban yang entah karena bagaimana berkumpul jadi satu membentuk satu entitas yang disebut manusia. Tapi khalayak, sebagai kumpulan dari manusia-manusia,kataBlumer,adalah stubborn (kepala batu). Artinya mereka tidak mudah dipengaruhi, tidak gampang diingatkan, sulit untuk dibujuk. Dan untuk inilah sebenarnya segalakeajaibanitumenyatudalamdirimanusia yang keras kepala itu: untuk terus menerus membujuk dan mengingatkan.(Vol.424,27/6/ 2013)

Kolom foliopini dapat juga diakses melalui http://epaper.waspadamedan.com

WASPADA Kamis 27 Juni 2013

Oleh M.Ridwan Lubis Manakala para calon wakil rakyat tidak memiliki kemampuan persuasi, dan hanya mengandalkan kekuatan finansial maka keberadaan bangsa kita akan semakin jauh tertinggal...

D

alam beberapa waktu ke depan masyarakat akan menyaksikan calon-calon yang akan mewakili suara aspirasi mereka saling memperebutkan dukungan masyarakat. Karena itu, sejak sekarang para calon akan memulai perjalanan panjang memersuasi rakyat di daerah pemilihannya agar menjatuhkan pilihannya kepada mereka. Untuk meraih dukungan masyarakat mereka akan berusaha sekuat mungkin meraih dukungan opini. Proses tersebut disebut dengan persuasi. Persuasi adalah proses yang mengubah atau membentuk kembali sikap, keyakinan, opini, atau perilaku terhadap hasil yang telah ditentukan secara sukarela. Atas dasar itu, dengan menerapkan maximum influence secara tepat maka seorang calon wakil rakyat—bukan saja untuk menginginkan opini dari masyarakat calon pemilihnya—hal yang sama dengan apa yang diinginkannya, tetapi juga bersemangat melakukan apa yang diinginkan oleh seorang wakil. Karena itu, dalam teknik melakukan persuasi terdapat tiga unsur penting yaitu pengaruh. Artinya siapa dan bagaimana diri Anda sebagai pribadi akan memengaruhi pesan yang akan disampaikan. Unsur kedua adalah kekuatan untuk meningkatkan kemampuan Anda untuk membujuk dan mempengaruhi. Dan kekuatan itu terdiri dari wawasan pengetahuan, otoritas atau menggunakan tekanan dalam melakukan persuasi. Tentunya tekanan itu tidak melanggar ketentuan norma agama, hukum dan budaya. Unsur ketiga adalah motivasi yaitu kemampuan mendorong orang lain bertindak sesuai saran dan gagasan yang ditawarkan. Dilihat dari segi hubungan personal maka persuasi adalah bagian dari komunikasi—apabila dilihat dari pekerjaan yang berkaitan dengan kejiwaaan maka persuasi dapat dilihat sebagai bagian dari psikologi (Kurt W. Mortensen, Maximum Influence, 2004:14-15).

Kenapa persuasi perlu dibicarakan? Sejak sekarang sampai tahun 2014 yang akan datang, kita akan menyaksikan berbagai perhelatan politik secara nasional. Sebagai warga masyarakat yang disebut konstituen tentulah mengharapkan adanya perbaikan menuju kemajuan pembangunan bangsa khususnya dalam bidang politik. Dalam melakukan rekayasa kehidupan berpolitik itu maka unsur pokoknya terletak pada aktor-aktor politik yang secara sukarela menyediakan dirinya mewakili aspirasi rakyat. Demikian juga rakyat hendaknya secara sadar memberikan suaranya kepada sosok yang memang memiliki kapasitas memadai untuk memikul kepercayaan sebagai wakil rakyat. Atas dasar itu maka tentulah ada dua pihak yang saling memiliki kepentingan yaitu figur yang akan menjadi calon dan masyarakat yang memiliki hak untuk memilih. Seorang figur yang rela memikul beban berat dunia akhirat yang akan memerjuangkan aspirasi rakyat hendaklah tidak terjadi perilaku yang tega mempermainkan kepercayaan yang diberikan rakyat. Sebagai seorang yang beragama tentulah semua mempercayai bahwa kehidupan ini tidak hanya akan berakhir di dunia yang fana tetapi dituntut pertanggunganjawab di hari kemudian— seberapa kuat mereka memperjuangkan harapan rakyat. Sebagai wakil rakyat, tentulah masyarakat pemilih wajar apabila menumpukan harapan kepada wakil yang mereka pilih baik secara sadar maupun pilihan bawah sadar. Atas dasar itu, maka hendaknya para figur yang akan tampil sebagai calon memiliki pandangan bahwa yang mereka tawarkan adalah idealisme dan kesungguhan untuk memperjuangkn idealisme itu. Kita merasa prihatin dengan komentar sebagian calon yang akan tampil dengan terlebih dahulu menghitung-hitung biaya pencalonan yang jumlahnya sangat fantastis bagi orang masyarakat bawah. Tentulah

akal sehat akan mengatakan betapa sulitnya mengembalikan modal tersebut apabila hanya mengandalkan pemasukan dari pendapatan riil-nya secara prorsional sebagai wakil rakyat. Namun, sekedar idealisme seorang calon juga tidak cukup. Masyarakat sebagai pemilih juga hendaknya memiliki kecerdasan baru yaitu melihat ukuran pilihan terhadap calon tidak bersandarkan kepada bekal pundipundi yang dimiliki seorang calon tetapi dari kesungguhan membantu memperjuangkan idealisme pembangunan masa depan bangsa termasuk daerah. Dengan tidak mendorong para calon wakil rakyat berpikir menebar pundi-pundi maka harapan akan tampilnya tokoh berkualitas sebagai wakil rakyat akan menjadi kenyataan. Tetapi sebaliknya, manakala para calon wakil rakyat tidak memiliki kemampuan persuasi akibat dari kurangnya pengaruh, kekuatan dan motivasi, dan hanya mengandalkan kekuatan finansial saja maka keberadaan bangsa kita akan semakin jauh

tertinggal dari kemajuan yang diraih oleh bangsa-bangsa lain khususnya di seputar Asia Tenggara. Demikian juga masyarakat yang memberikan ukuran keterpilihan pada seorang calon tergantung dari pundi-pundinya maka hal itu juga akan semakin menjauhkan kita dari perpolitikan yang sehat. Dengan persuasi maka seorang calon yang menawarkan gagasan yang benar dengan cara yang benar dan untuk meraih tujuan yang benar. Acuan kebenaran itu bertitiktolak dari nilai yang terkait di dalam agama dan budaya. Bisa saja secara yuridis formal sebuah tindakan dipandang tidak melanggar hukum positif tetapi akal budi manusia dapat menimbang antara yang benar dan salah serta antara yang baik dan buruk. Demikianlah dibangun teknik persuasi, di satu sisi ia adalah bagian dari ilmu, seni dan keterampilan, di sisi lain ia penuh dengan muatan-muatan moral. Penulis adalah Guru Besar UIN Syarif Hidayatullah Jakarta.

Perhitungan Kerugian Negara BPKP Oleh Irfan Mangkunegara Jika standar tidak dilaksanakan, maka kesahihan angka kerugian negara sebagai hasil audit investigatif yang disajikan BPKP dapat diragukan dan berpotensi rawan gugatan.

A

khir-akhir ini marak kasus kriminalisasi yang dilakukan Kejaksaan Agung kepada beberapa korporasi di Indonesia. Kasus kriminalisasi yang menyita khalayak publik adalah kasus dugaan korupsi senilai Rp1,3 trilyun yang dilakukan oleh Indosat Mega Media (IM2) dan kasus dugaan korupsi senilai kurang lebih USD9,9 juta oleh PT. Chevron Pacific Indonesia. Benang merah yang mengaitkan kedua kasus tersebut adalah perhitungan kerugian negara oleh Badan Pengawas Keuangan dan Pembangunan (BPKP) atas permintaan Kejaksaan Agung. Pada setiap sidang, pengacara kedua kasus tersebut selalu menggunakan argumentasi bahwa perhitungan kerugian negara oleh BPKP adalah tidak sah menurut hukum. Perhitungan kerugian negara sepenuhnya menjadi wewenang dari Badan Pemeriksa Keuangan (BPK) berdasarkan UU Nomor 15 tahun 2004 pasal 10 ayat (1) tentang BPK yang berbunyi, “BPK menilai dan/atau menetapkan jumlah kerugian negara yang diakibatkan oleh perbuatan melawan hukum baik sengaja maupun lalai yang dilakukan oleh bendahara, pengelola BUMN/BUMD, dan lembaga atau badan lain yang menyelenggarakan pengelolaan keuangan negara”. Argumentasi tersebut di atas memang dapat digunakan, namun Hakim/Mahkamah Agung selaku pihak yang memutuskan perkara, dapat menggunakan hasil perhitungan kerugian negara oleh BPKP. Hal ini didasarkan pada Rumusan Hasil Diskusi Komisi IA bidang Pidana Umum dan Pidana Khusus pada Rapat Kerja Nasional Mahkamah Agung RI tanggal 9 Oktober 2009 di Palembang, yang menyatakan, “Badan Pemeriksa Keuangan adalah auditor negara. Penghitungan kerugian negara dapat dilakukan oleh Badan Pemeriksa Keuangan (BPK) atau Badan Pengawas Keuangan dan Pembangunan (BPKP) atau Jaksa selaku penyidik.” Namun, baru-baru ini kuasa hukum mantan direktur utama IM2 dan Indosat memenangkan gugatan kepada BPKP atas Laporan Hasil Audit Perhitungan Kerugian Keuangan Negara atas Perkara Dugaan Tindak Pidana Korupsi nomor SR-1024/D6/01/ 2012 tanggal 9 November 2012. Pengadilan Tata Usaha Negara menyatakan menunda pelaksanaan keputusan BPKP tersebut. Dalam salah satu pertimbangannya, Majelis Hakim me-

nyatakan dasar audit penghitungan BPKP tidak valid karena dari sisi Kejaksaan saja. Pertanyaan yang mungkin timbul selanjutnya adalah bagaimana dasar audit yang dilakukan BPKP dapat dianggap valid? Dalam melaksanakan tugasnya seorang auditor pemerintah harus mengacu pada standar yang telah ditetapkan. BPKP selaku Aparat Pengawas Internal Pemerintah (APIP) harus mengacu pada Peraturan Menteri Negara Pendayagunaan Aparatur Negara Nomor PER/5/M.PAN/03/ 2008 tentang Standar Audit Pengawas Intern Pemerintah. Standar tersebut meliputi standar audit kinerja dan audit dengan tujuan tertentu (termasuk investigasi). Untuk menghitung kerugian negara dalam kerjasamanya dengan kejaksaan, BPKP harus melakukan audit investigasi yang sasarannya menurut standar adalah terungkapnya kasus penyimpangan yang berindikasi dapat menimbulkan terjadinya kerugian keuangan negara/daerah. Perlu diketahui, kerugian negara/ daerah tidak hanya bisa diketahui saat pelaksanaan audit investigasi melainkan juga saat dilakukan audit laporan keuangan dan kinerja. Oleh karenanya audit investigasi tidak hanya menghitung kerugian negara/daerah yang menjadi dampak, tetapi juga modus operandi, sebab dan serta pihak yang bertanggungjawab/terlibat atas timbulnya kerugian negara/daerah tersebut. Standar pelaksanaan audit investigasi, menyatakan hal-hal antara lain sebagai berikut : Pertama, dalam setiap penugasan audit investigatif, auditor investigatif harus menyusun rencana audit. Rencana audit tersebut harus dievaluasi, dan bila perlu, disempurnakan selama proses audit investigatif berlangsung sesuai dengan perkembangan hasil audit investigatif di lapangan. Rencana audit yang disusun berdasarkan informasi yang diterima harus dianalisis dan dievaluasi terlebih dahulu. Hasil analisis tersebut berupa kesimpulan apakah audit investigatif jadi dilaksanakan, meneruskan ke pejabat berwenang maupun tidak perlu dilaksanakan. Jika kesimpulannya adalah melaksanakan audit investigatif, maka APIP harus menentukan rencana tindakan yang antara lain mengidentifikasi kemungkinan pelanggaran hukum dan memahami unsur-unsur terkait dengan pembuktian atau standar. Kedua, dalam membuat rencana

audit, auditor harus menetapkan sasaran, ruang lingkup, dan alokasi sumber daya. Sasaran audit investigatif adalah terungkapnya kasus penyimpangan yang berindikasi merugikan keuangan negara/daerah. Ruang lingkup audit investigatif adalah pengungkapan fakta dan proses kejadian, sebab dan dampak penyimpangan dan pihak-pihak yang terlibat atau bertanggungjawab. Sedangkan alokasi sumber daya ditujukan untuk memperoleh hasil audit secara maksimal. Ketiga, auditor investigatif harus mengumpulkan bukti audit yang cukup, kompeten dan relevan. Dalam audit investigatif, bukti audit harus diperoleh dengan tidak menggunakan metode sampling, melainkan harus secara keseluruhan populasi. Pengumpulan bukti harus dilakukan dengan teknik-teknik tertentu antara lain wawancara kepada pengadu, saksi, korban, dan pelaku; reviu catatan; pengumpulan bukti forensik; pengintaian dan pemantauan; serta penggunaan teknologi komputer. Bukti audit disebut kompeten jika bukti tersebut sah dan dapat diandalkan untuk menjamin kesesuaian dengan faktanya. Bukti yang sah adalah bukti yang memenuhi persyaratan hukum dan peraturan perundang-undangan. Bukti audit disebut relevan jika bukti tersebut secara logis mendukung atau menguatkan pendapat atau argumen yang berhubungan dengan tujuan dan kesimpulan audit. Pengumpulan bukti harus dilakukan dengan teknik-teknik tertentu antara lain wawancara kepada pengadu, saksi, korban, dan pelaku; reviu catatan; pengumpulan bukti forensik; pengintaian dan pemantauan; serta penggunaan teknologi komputer. Keempat, auditor investigatif harus menguji bukti audit yang dikumpulkan. Bukti diuji dengan memerhatikan urutan proses kejadian (sequences) dan kerangka waktu kejadian (time frame) yang dijabarkan dalam bentuk bagan arus kejadian (flow chart) atau narasi. Teknik-teknik yang dapat digunakan untuk menguji bukti antara lain inspeksi, observasi, wawancara, konfirmasi, analisis, pembandingan, rekonsiliasi dan penelusuran kembali. Kelima, auditor investigatif harus meminta tanggapan/pendapat terhadap hasil audit investigatif. Tanggapan/ pendapat tersebut harus dikemukakan pada saat melakukan pembicaraan akhir dengan auditi. Salah satu cara yang paling efektif untuk memastikan bahwa suatu laporan hasil audit investigatif dipandang adil, lengkap, dan objektif adalah adanya reviu dan tanggapan dari pejabat yang bertanggung jawab. Sehingga dapat diperoleh suatu laporan yang tidak hanya mengemukakan kesimpulan auditor investigatif saja, melainkan memuat pula pendapat pejabat yang bertanggung jawab tersebut.

Audit investigatif akan adil, lengkap dan objektif jika dilaksanakan sesuai standar seperti yang telah penulis contohkan di atas. Jika standar di atas tidak dilaksanakan, maka kesahihan angka kerugian negara sebagai hasil audit investigatif yang disajikan BPKP dapat diragukan dan berpotensi rawan gugatan. Padahal, angka kerugian negara adalah salah satu faktor penting dalam menentukan kasus tindak pidana korupsi. Karenanya perhitungan kerugian negara melalui audit investigasi harus sesuai standar. Perhitungan kerugian negara/daerah dapat dilakukan oleh BPKP atau bahkan jaksa, walaupun tidak sesuai dengan peraturan perundang-undangan. Hal tersebut menunjukkan dukungan dari para pengadil di Indonesia terhadap pemberantasan korupsi. Namun, angka perhitungan kerugian negara tersebut haruslah meyakinkan hakim. Keyakinan hakim atas angka kerugian negara/daerah tersebut dapat ditingkatkan apabila angka tersebut valid dan angka yang valid adalah hasil dari audit yang memenuhi standar. Penulis adalah Auditor BPK RI Perwakilan Sumatera Utara.

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di Media manapun.Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * PM Singapura terima maaf SBY - Sama tetangga memang harus baik, he...he...he * Soft opening KNIA tetap 25 Juli - Tinggal menghitung hari * Medan gelap hingga 10 hari ke depan - Sudah bisalah stok lilin

oel

D Wak


Ekonomi & Bisnis

WASPADA Kamis, 27 Juni 2013

B5

Sumut Usul Pengembangan Wirausaha Muda Lintas Batas MEDAN (Waspada): Pemprovsu bersama swasta dan perguruan tinggi memberikan usulan pada pertemuan Human Resource Development Working Gruop (HRD WG) Public-Private Partnership (PPP) Pilot Forum SOM III APEC, di Hotel Aryaduta Medan, Rabu (26/6).

Waspada/Zainal Abidin

Ketua kelompok tani tambak Blang Mangat, Azhar memperlihatkan beberapa udang yang berhasil dibudidaya dengan sistem ramah lingkungan, Rabu (26/6)

Nelayan Lhokseumawe Berhasil Budidaya Udang Kualitas Ekspor LHOKSEUMAWE (Waspada): Di tengah kegagalan pembudiyaan udang windu akibat Monodon BaculonVirus (MBV), petani tambak Kecamatan Blang Mangat, Pemko Lhokseumawe berhasil memanen udang berkualitas ekspor. Pembudidayaan sistem Better Manajement Practices (BMP), dilakukan dengan pembatasan pemakaian pestisida dan penaburan benih serentah, Rabu (26/6). Ketua kelompok petani tambah Blang Mangat,

Azhar kepada Waspada, menjelaskan sistem BMP berhasil menekan serangan MBV. “Kami sering gagal karena serangan virus. Tetapi dengan membatasi penggunaan pestisida, dapat mengurangi serangan penyakit,” ungkap Azhar. Sekarang petani setempat hanya menggunakan pestisida dosis rendah. Selain itu, penaburan benur windu juga dilakukan serentak, sehingga resiko gagal akibat virus juga dapat ditekan.

Petani Blang Mangat telah membentuk kelompok budidaya windu ramah lingkungan. Sebanyak 71 petani mengelola seluas 150 hektare lahan tambak. Mereka berasal dari Desa Tunong, Teungoh, Baloi, Menasah Masjid dan warga dari Desa Ule Blang Mane. Namun, sejumlah petani gagal panen akibat tambah mereka mengalami banjir. Azhar juga mengatakan,

petani belajar budidaya ramah lingkungan dari program WWF (World Wildlife Fund-red). Awal April lalu, tambahnya, WWF mengajarkan pembudidayaan windu agar memiliki nilai jual ke luar negeri. Ditanya, dengan membatasi penggunaan pestisida. Asisten program dari WWF, Said Rahmad mengakui, udang yang dibudidaya ramah lingkungan memiliki nilai jual ke luar negeri.(b15)

Standar BBM Rencana

Daging Sapi Kemasan Pemerintah Jenis Ron 90 Rp70.000 Per Kg JAKARTA (Antara): PT Rajawali Nusantara Indonesia (RNI) meluncurkan produk daging sapi kemasan dengan harga Rp70.000 per kg. Penetapan harga sebesar itu bisa dilakukan karena PT RNI melakukan usaha sendiri dari hulu. Direktur Utama PT RNI Ismed Hasan Putro, mengatakan itu saat peresmian peluncuran merek produk daging sapi kemasan ‘Raja Daging’ di Gedung RNI, Jakarta, Rabu (26/6). Disebutkan bahwa peluncuran produk itu sebagai komitmen memenuhi kebutuhan daging berkualitas dan sehat dengan harga kompetitif kepada masyarakat luas. Menurut Ismed, pihaknya menetapkan harga Rp70.000 per kg dengan tujuan agar lebih kompetitif. Itu bisa dilakukan karena RNI melakukan usaha sendiri dari hulu atau peternakan sapi, memprosesnya menjadi produk ritel, hingga menjualnya kepada masyarakat. “Harga bisa lebih murah karena RNI mampu memotong mata rantai bisnis daging sapi, termasuk distribusinya,” katanya. Ismed, mengaku bahwa komitmen RNI untuk menyediakan daging sapi murah di masyarakat jangan diragukan. Karena sejak 12 Juli 2012 RNI telah mengembangkan peternakan sapi. Peternakan sapi RNI dikembangkan dengan pola terintegrasi melalui Program Sapi Tebu (Sate), Program Sawit Sapi (Sasa), Program Sapi The, Program Petani Mitra Binaan (Plasma), Program Kemitraan, dan Program Sarjana Masuk Desa (SMD). “Tidak hanya penggemukan (fattering) dan pembibitan (breeding), RNI juga akan mengembangkan pemotongan dan teknologi makanan,” ujar Ismed. RNI optimistis sebanyak 222.000 ekor sapi per tahun dapat dicapai, sejalan dengan pola kerja sama dengan para peternak, sehingga mempercepat jumlah produksi serta dampak kesejahteraan lainnya.

Daftar Harga Bahan Pokok Di Medan, Selasa (25/6) Beras KKB Beras Jongkong IR64 Gula Pasir Minyak Goreng Curah Kuning Minyak Goreng Bimoli 1000 ml Terigu Segi Tiga Biru Terigu Cakra Kembar Terigu Kunci Daging Sapi Murni Daging Ayam Broiler Daging Ayam Kampung Telur Ayam Broiler Telur Ayam Kampung Garam Bata (250 gr) Garam Halus Cabai Merah Cabai Rawit Cabai Hijau Bawang Merah Bawang Putih Tomat Kol Kentang Ikan Asin Teri Ikan Kembung Kacang Hijau Kacang Tanah Kacang Kedelai Minyak Tanah

: Rp9.800 per kg : Rp8.900 per kg : Rp13.000 per kg : Rp10.000 per kg : Rp12.000 per btl : Rp7.500 per kg : Rp7.500 per kg : Rp7.000 per kg : Rp85.000 per kg : Rp26.000 per kg : Rp55.000 per kg : Rp1.100 per butir : Rp1.500 per butir : Rp4.000 per btg : Rp4.000 per kg : Rp45.000 per kg : Rp20.000 per kg : Rp20.000 per kg : Rp32.000 per kg : Rp16.000 per kg : Rp7.000 per kg : Rp4.000 per kg : Rp8.000 per kg : Rp80.000 per kg : Rp32.000 per kg : Rp12.500 per kg : Rp20.000 per kg : Rp8.000 per kg : Rp9.000 per liter (m41)

Harga Emas LM Lokal (99,99%)

443.000

Emas (99,5%)

340.000

Emas Perhiasan (70%)

328.000

Emas Putih (75%)

350.000

Suasa

221.000 (m41)

JAKARTA (Waspada): Pemerintah Indonesia berencana melakukan standar isasi penggunaan bahan bakar minyak (BMM) dengan jenis Ron 90 di tanah air. Saat ini, BBM jenis premium di Indonesia masih menggunakan Ron 88. Direktur Jenderal Minyak dan Gas Bumi (Dirjen Migas) Kementrian ESDM Edy Hermantoro, Rabu (26/6), mengatakan wacana melaukan standarisasi itu sebenarnya sudah akan dijalankan. Namun akan dilihat dari faktor utamanya, yakni kilang minyak. Katanya, saat ini sebagian besar kilang di desain untuk Ron 88. Kalau mau menggunakan Ron 90 harus diubah sedikit desainnya. ‘’Kuncinya paling mendekati itu bukan masalah harga tapi masalah teknologi,” kata Edy saat ditemui di Sari Kuring, Jakarta. Edy, menjelaskan saat ini di luar negeri untuk penggunaan BBM sudah masuk dalam standar Euro III dan IV. “Kita saat ini baru masuk ke Euro II. Kalau masuk Euro III, ya masuk Ron 90. Kalau itu, berarti harus ada upgrading,” jelas Edy. Menurut Edy, sebenarnya ESDM sudah mengeluarkan standarisasi penggunaan Ron 90. Namun Pertamina selaku perusahaan Migas milik negara

harus menghitung seberapa besar anggaran yang diperlukan. “Tapi kan kita cek juga kilangnya cukup enggak. Keuangannya gimana?. Jangan cek di sini saja. Cek juga di Kementerian Keuangan,” tutur Edy. Kilang batal Edy Hermantoro, juga memperkirakan rencana pembangunan kilang minyak di Indonesia yang bekerja sama dengan investor Kuwait Petroleum Corporation (KPC) dan Saudi Aramco akan sulit terealisasi, alias batal dilaksanakan. Karena sampai saat ini belum ada kesepakatan antara pemerintah Indonesia dengan kedua perusahaan tersebut terkait permintaan insentif kilang. “Aramco sama Kuwait minta tax holiday, bebas bea masuk ada 10 item. Kementerian Keuangan (Kemenkeu) agak berat memberikannya. Belum bisa dibilang batal. Tapi kita berat buat kasih itu, “ungkap Edy Hermantoro. Dia menambahkan, untuk mengatasi permintaan kedua perusahaan tersebut, seharusnya Pertamina sebagai unit bisnis Migas harus melakukan tender bagi seluruh perusahaan di dunia yang ingin membangun kilang di Indonesia, dengan tawaran insentif yang sudah dibakukan oleh pemerintah.

Yakni peningkatan dan pengembangan wirausaha muda dan tenaga kerja lintas batas melalui North Sumatera Action Plan. Kepala Pusat Penelitian Kebijakan dan Pengembangan di Kementerian Pendidikan dan Kebudayaan (Kemendikbud) Bambang Indriyanto, selaku Co Chair (Wakil Ketua) HRD WG Kelompok Kerja Pengembangan SDM (HRD WG) APEC 2013 di Medan mengatakan, North Sumatera Action Plan ini ingin mempromosikan ekonomi secara berkelanjutan di kalangan 21 ekonomi anggota APEC melalui peningkatan kualitas wirausaha muda. “Pemerintah Sumut mengambil momentum ini sebagai bagian dari skenario pengembangan ekonomi yang ada di Sumut. Karena ini forumnya APEC maka dinamakan The North Sumatera Action Plan yang merupakan pengembangan penjabaran lebih lanjut dari Moscow Inisiatif. Intinya pertumbuhan berkelanjutan berdasarkan kerjasama antara pihak swasta dan pemerintah,” ujarnya. Gubernur Sumut H Gatot Pujo Nuroho sendiri dalam pidato pembukaannya, telah menyatakan Sumut akan menciptkan 6.000 wirausaha muda. Ini yang menjadi titik tolak North Sumatera Action Plan Youth Entrepreneurship. Kemudian Apindo mengusulkan Productivity, Creativity,Village Project dimana tempat para wirausaha muda bermain. “Saya menskenariokan, titik tolaknya menciptakan wirausahawan muda. Ini ternyata berkaitan dengan upaya China untuk mengembangkan job creative bagi wirausaha muda. Ketika itu menjadi titik tolak, ada beberapa skenario yang akan dikembangkan,” ujarnya. Skenario tersebut di antaranya, ketika mengembangkan wirausaha muda, tidak terlepas dari sistem pendidikan yang ada. Terutama yang sangat dekat dengan pengembangan wirausaha muda adalah Sekolah Menengah Kejuruan (SMK). Kedepan akan melihat kemungkinan-kemungkinan mereorientasi program-pogram dan metode pembelajaran di SMK agar lulusan itu tidak mencari kerja, tetapi berupaya menciptakan lapangan kerja. “Ma ka n ya ka mi a ka n melakukan bagaimana melihat kemungkinan untuk pemetaanpemetaan bersama Apindo melihat perkembangan industri dan bisnis di Sumut untuk memfasilitasi. Sekali lagi yang namanya Productivity, Creativ-

Inovasi Teknologi Dukung Kebangkitan Brand Nasional MEDAN (Waspada): Kebangkitan Brand-brand lokal Indonesia dalam peta persaingan dunia usaha di Indonesia perlu didukung inovasi teknologi yang tepat. Hal ini disampaikan Gidion Suranta Barus-Vice President VAS Commerce Lintasarta dalam kegiatan ICT Knowledge for Jurnalist Senin (24/6). Cloud Computing dianggap sebagai teknologi yang mampu membuat Infomation Communication Telecomunication (ICT) menjadi lebih rasional terhadap bisnis, karena dapat mendukung inovasi bisnis tanpa menggunakan biaya yang besar, meminimalkan resiko dan mendukung kelincahan bisnis. Menurutnya, ditengah semakin menariknya pasar Indonesia dengan jumlah kelas menengah lebih dari 131 juta jiwa, invasi pelaku bisnis asing semakin marak di dalam negeri. Apakah pemain lokal memiliki kesempatan ikut menjadi raja di negeri sendiri?. Menilik pada buku Market Your Way to Growt: 8 Ways to Win karangan Philip Kotler, terdapat beberapa cara meningkatkan pertumbuhan bisnis antara lain meningkatkan market share, membuat basis pelang-

gan yang loyal, mengembangkan brand tangguh, inovasi produk & layanan serta bermitra dengan berbagai pihak untuk pengembangan bisnis. Gidion menambahkan, kata kunci sukses dalam meningkatkan pertumbuhan bisnis adalah kecepatan dan flexibilitas. Persaingan yang ketat membuat perusahaan harus cepat mengambil keputusan bisnis, kapan produk baru harus diluncurkan, diimprove atau bahkan ditarik dari pasar, flexibilitas menyangkut kepada adaptasi perusahaan terhadap perubahan bisnis terjadi dalam pasar. “Untuk mendukung pertumbuhan bisnis yang cepat & flexible, maka paradigma IT sudah harus bergeser dari IT sebagai Cost Center, menjadi IT sebagai Strategic Business Partner”, ujar Gidion. Penelitian dilakukan Lintasarta dan mitra menyatakan bahwa dengan implementasi Cloud Computing, 50 persen perusahaan menyatakan dapat mengurangi biaya operasional, 20 persen menyatakan flexible dalam menghadapi perubahan bisnis yang cepat, 20 persen menyatakan lebih berfokus pada core business tidak hanya

IT, 10 persen perusahaan menyatakan dapat mengubah Capex (investasi) menjadi Opex (biaya sewa). Disebutkannya, di tahun 2014, 90 persen korporasi akan mengizinkan penggunaan personal device oleh karyawan sebagai akses dalam bekerja melalui teknologi Cloud Computing dikenal dengan BYOD (Bring Your Own Device). Ditanya mengenai sektor industri apa sudah mengimplementasikan Lintasarta Cloud Service, Gidion menjelaskan beberapa perusahaan finance, manufaktur dan trading sudah mengimplementasikan Lintasarta Cloud Service. Beberapa alasan perusahaan tersebut implementasi Cloud adalah mendukung pengembangan bisnis melalui ICT, solusi Business Continuity Plan dan pembaharuan dari hardware. Lintasarta Cloud Service memiliki tagline ‘SAFE’ yaitu Secure, Affordable, Flexible dan Excellent. Tingkat security layanan Lintasarta Cloud Service dapat diandalkan, hal ini terbukti dengan diperolehnya sertifikasi ISO 9001:2008 untuk jaminan mutu layanan ISO 27001:2005 dan Cloud Security Alliance. (m19)

Waspada/Sugiarto

Kepala Pusat Penelitian Kebijakan dan Pengembangan di Kemendikbud Bambang Indriyanto didampingi Ketua Apindo Sumut yang juga anggota DPD RI Parlindungan Purba dan Asisten II Bidang Ekonomi Pemprovs Sabrina, saat memberikan keterangan pers usai melakukan diskusi HRD WG APEC 2013 di Hotel Aryaduta Medan, Rabu (26/6). ity, Village Project ini akan dijadikan model dalam skala relatif kecil terutama di Sumut,” jelasnya. Selain itu juga dimungkinkan untuk membuka akademi komunitas yang merupakan suatu program perguruan tinggi yang secara langsung menyediakan kejuruan terampil seperti di kejuruan SMK. “Kami akan berbicara untuk melihat kemungkinan bagaimana melengkapi akademi komunitas ini. Kita sudah berbicara dengan salah satu anggota Asosiasi Perguruan Tinggi Swasta Indonesia (Aptisi) Sumut seperti Universitas Sari Mutiara maupun Universitas Sumatera Utara. Akademi komunitas ini, respon terhadap action plan yang diupayakan segera menjadi bagian skenario North Sumatera Action Plan,” paparnya. Mengenai dukungan para delegasi 21 economic negaranegara APEC terhadap usulan Pemprovsu tersebut, Bambang menyebutkan, beberapa negara seperti Rusia, Chili, Kanada, Australia sangat menyambut baik North Sumatera Action Plan ini untuk diterapkan di negara mereka. “Ini merupakan suatu langkah awal. Bahkan saya sudah menyatakan, kalau mereka welcome. Kami akan segera mengkonseptualisasikan menjadi action plan dan kami akan presentasikan pada SOM

di Vietnam pada Oktober 2014. Kita akan menyajikan The North Sumatera Action Plan progresnya seperti apa?” kata Bambang. Sesuai Visi-Misi Gubsu Asisten II Bidang Ekonomi Pemprovsu Sabrina mengatakan, melalui HRDWG APEC ini, Pemprovsu akan melakukan pengenalan apa sebenarnya yang dibutuhkan di masa depan untuk mengembangkan usahausaha terutama wirausaha muda. Ini akan sangat sesuai dengan visi-misi Gubsu terpilih yang akan menciptakan wirausahawan muda. “Nah, ini harus didukung dengan sumber daya manusia yang handal. Ini akan diadopsi dalam APEC ini supaya masuk dan diharapkan nanti bahwa sebagian dari action plan yang kita usulkan kemudian, bisa dibiayai dengan beberapa negara atau barangkali dari APEC sendiri,” ujar Sabrina. Menurutnya, North Sumatera Action Plan ini untuk mendidik sumber daya manusia. Makanya leading sektornya dalam HRD WG APEC adalah dari Kementerian Pendidikan dan Kebudayaan dan Kementerian Tenagakerja dan Transmigrasi. “Jadi bagaimana kita mempersiapkan dan kedepannya kita mau mendidik atau menciptakan wirausaha-wirausaha yang baik. Dan juga

mengkualifikasi tenaga-tenaga kerja kita yang cocok di internasional supaya memiliki pengakuan atau mempunyai lisensi internasionalnya,” ujarnya. Ketua Apindo Sumut Parlindungan Purba menambahkan, apa yang disebut North Sumatera Action Plan tersebut bukan hanya SDM saja, tetapi juga peluang-peluang ekonomi lainnya supaya ekonomi itu bisa didapatkan. “Tanpa SDM yang handal, kita akan kalah bersaing. Kita tidak akan mendapatan kue ekonomi tersebut,” ujarnya anggota DPD RI ini. Parlindungan menyebutkan, melalui usulan tersebut akan dilakukan pengembangan dalam menciptakan lapangan pekerjaan di Sumut dan Indonesia. Selain itu, dengan adanya kerjasama universitas dan adanya Productivity, Creativity, Village Project telah dilakukan hubungan bilateral antara Indonesia dan Korea Selatan. “Nanti kita akan melakukan rapat pada 12 Juli apa saja yang akan dibicarakan. Pokoknya harus melihat kondisi Indonesia, apa yang menguntungkan Indonesia dan apa yang bisa kita harapkan di dalam APEC yang menyangkut 21 negara ini. Bilateral dengan Korsel sudah deal dan kita juga akan berusaha bekerjasama dengan negaranegara lain,” ujarnya. (m41)

UMKM Penting Dalam Perekonomian Kota Medan MEDAN (Waspada): Usaha Mikro Kecil dan Menengah (UMKM) penting kedudukannya dalam perekonomian Kota Medan. Peran UMKM juga sangat dominan, terutama dalam penyerapan angkatan kerja. Di samping itu UMKM sangat besar peranannya untuk menjadi perisai ekonomi agar tidak masuk pada jurang krisis berkepanjangan. Berdasarkan data Badan Pusat Statistik (BPS), proporsi jumlah pengusaha mikro, kecil dan menengah di Kota Medan mencapai 99 persen dari total pengusaha yang ada. “Hal ini menunjukkan besarnya ketimpangan produktifitas antara usaha besar dan UMKM. Kondisi ini memerlukan perkuatan dari berbagai pihak secara sinergis terhadap UMKM,” kata Plt Wali Kota Medan Dzulmi Eldin, Selasa (25/6). PltWali Kota Medan Dzulmi Eldin, mengatakan itu dalam acara Field Trip (kunjungan lapangan) peserta Policy Partnership on Food Security (PPFS) Plenary 2 Senior Official Meeting (SOM) III Asia Pasific Economic Coorporation (APEC) tahun

2013 di kawasan Rumah Pangan Lestari Jln. Petunia Raya Kel. Namo Gajah, Medan Tuntungan. Eldin, menjelaskan sampai tahun 2012, jumlah UMKM di Kota Medan mencapai 222.133 pelaku usaha dengan jenis usaha perdagangan jasa, industri kerajinan dan aneka usaha. Mengingat potensi besar yang ada pada UMKM, Pemko Medan menetapkan peningkatan kedudukan, fungsi dan peranan UMKM dalam perekonomian kota, sebagai salah satu agenda prioritas pembangunan. Sementara itu, Fiield Trip (kunjungan lapangan) merupakan salah satu rangkaian kegiatan yang dilakukan delegasi SOM III APEC tahun 2013. Kunjungan yang mereka lakukan di kawasan Rumah Pangan milik Badan Ketahanan Pangan Kota Medan terkait pengembangan UMKM. Terutama yang bergerak di bidang penganekaragaman pangan dan ketahanan pangan. Adapun peserta PPFS Plenary 2 SOM III APEC tahun 2013 yang melakukan Field Trip ke Rumah Pangan diantaranya H Teramura (Jepang), R Washimori (Jepang), Bae Jong Hyuk

(Korea), ChoiYoon Chul (Korea), Kazuko Takabatake (Jepang), WongWen Chey (Malaysia), Cao Ying Jua (China), Chandra H (Indonesia), Ridha Putri (Indonesia) Thanawat Sirikul (thailand), Mei Rochjay (Indonesia), Kirill Antyukin (Rusia), Zhou Ziyi (China), Dea Merriless (Australia), Julio Chan (Peru), Yusof Othman (Malaysia), Han Ji Zhi (Cina) dan Siriwat Suwannasyi (Thailand). Dalam peninjauan di Rumah Pangan, mereka melihat aneka tanaman pangan, termasuk memanen kol. Selain itu para peserta juga melihat pembenihan dan pembibitan aneka sayur yang ada di lokasi. Kemudian para peserta melewati jembatan yang diberi nama Jembatan APEC untuk melihat pembibitan ikan air tawar. Sebelumnya, peserta juga melihat dan memanen tanaman di tempat pembenihan di kawasan Ladang Bambu. Umumnya para peserta mengaku tertarik dengan penganekaragaman pangan dan ketahanan yang ada di tempat tersebut. Mereka berharap agar lokasi itu dapat dikembangkan lagi. (m50)

Investor Ramai Beli Saham IHSG Naik 3,82 Persen JAKARTA (Waspada): Laju Indeks Harga Saham Gabungan (IHSG) terus melaju sepanjang peradagangan Rabu (26/6). Investor nampaknya tak mau kehilangan kesempatan. Mereka membeli saham-saham yang sempat terkoreksi pada beberapa hari kemarin. IHSG pada penutupan Rabu sore naik 168,86 poin atau 3,82 persen ke 4.587,73. Indeks LQ45 naik 4,98 persen ke 755,46, indeks IDX30 menguat 5,20 persen ke 384,52, dan Jakarta Islamic Indeks (JII) melaju 5,73 persen ke 616,89. Saham-saham di Asia juga bergerak positif, dengan indeks Hang Seng naik 482,83 poin atau

2,43 persen ke 20.338,55, indeks Straits Time melaju 18,15 poin atau 0,58 persen ke 3.107,96. Sementara indeks Nikkei turun 135,33 poin atau 1,04 persen ke 12.834,33. E-Trading Securities, dalam risetnya mengatakan IHSG yang sudah melemah terbatas, nampaknya telah masuk pada area oversold. Hal ini terlihat dari indikator stochasticnya. Sebanyak 223 menguat, 72 melemah, dan 86 saham bergerak stagnan. Pada Rabu siang, IHSG ditutup dengan transaksi sebesar Rp7,319 triliun dari 5,371 juta lembar saham diperdagangkan. Selain itu, investor asing mencatat aksi jual sebesar Rp81,389

miliar. Sektor-sektor penopang IHSG masih menguat, dengan sektor industri dasar naik 5,74 persen, sektor aneka industri menguat 4,38 persen, sektor manufaktur menguat 5,35 persen, sedangkan sektor perkebunan melonjak 4,38 persen. Adapun saham-saham yang masuk dalam jajaran top gainers, antara lain saham PT HM Putra Sampoerna Tbk (HMSP) naik 3,65 persen ke Rp85.000, saham PT Indocement Tunggal Prakasa Tbk (INTP) naik 9,72 persen ke Rp23.700, dan saham PT Unilver Indonesia Tbk (UNVR) naik 7,69 persen ke Rp28.000.(okz)


Aceh

B6 IAIN Ar-Raniry Terima 3.500 Mahasiswa Baru

8 Ruang Rata Dengan Tanah

Polres Simeulue Donor Darah Waspada/Zamzamy Surya

BANGUNAN SDN Suak Berambang, Kec. Lembah Sabil, Abdya, ludes dilalap api akibat arus pendek. Foto direkam, Rabu (26/6)

Demo PLTA, Polisi Lepaskan Gas Air Mata TAKENGEN (Waspada) : Belum jelasnya penyelesaian ganti rugi dampak banjir yang diduga akibat pembangunan regulating wair (tanggul) PLTA Pesangan di Aceh Tengah berbuntut panjang.

Waspada/M Rapyan

DARI kiri ke kanan ; Direktur RSUD Simeulue Yusmardi, Kasat Intel Polres Simeulue Ipda Erizal, Kabag Ren Polres Simeulue AKP Armia dan Kasat Shabara Polres Simeulue Iptu Salmidin. Foto direkam, Rabu (26/6).

Pemkab Abdya Salurkan Bantuan Anak Yatim BLANGPIDIE (Waspada) : Pemerintah Kabupaten Aceh Barat Daya melalui Dinas Sosial, Tenaga Kerja dan Transmigrasi setempat menyantuni sebanyak 2.398 anak yatim sekaligus pemberian bantuan bagi penyandang cacat dihadiri Forum Komunikasi Pimpinan Kabupaten (Forpimka) Abdya, puluhan anak yatim serta penyandang cacat diberikan Bupati Abdya Jufri Hasanuddin di halaman pendopo bupati, Sabtu (22/6). Kepala Dinsonakertrans Abdya, Jasman menyebutkan, bantuan yang diperuntukkan bagi anak yatim yang berumur 0-15 tahun bersumber dana dari APBK pada plot anggaran Dinsonakertrans Abdya. “Setiap anak akan mendapatkan bantuan Rp100 ribu,” ujar Jasman. Selain menyantuni anak yatim, lanjut Jasman, pihaknya juga menyalurkan 50 unit kursi roda, 100 pasang tongkat ketiak, 5 unit alat bantu pendengaran dan satu unit komputer khusus untuk penyandang cacat. Bupati Abdya Jufri Hasanuddin menegaskan, santunan dan bantuan yang diperuntukkan bagi anak yatim dan penyandangn cacat harus segera sampai ke tangan yang berhak menerima. (b08)

‘Raja’ Juarai Lomba Ayam Ketawa BANDA ACEH (Waspada): ‘Raja’ terpilih sebagai Juara I Kelas Latber Kuta Radja dalam Lomba Ayam Ketawa yang digelar Federasi Perlindungan Flora dan Fauna Aceh (FP2FA) di de Helsinki Coffee Banda Aceh, Minggu (23/6). Dalam perlombaan itu, ayam jantan milik MZ Arifin dari klub Kuta Radja Banda Aceh, mengumpulkan nilai 900 poin. Sementara Juara II ditempati ayam ketawa milik T Rizal Fahlevi (Kuta Radja), Juara III diraih ayam ketawa milik Halim Panjaitan dari Klub Kossa Banda Aceh. Sedangkan Juara Harapan I untuk kelas yang sama, ditempati ayam ketawa milik Imam (Kuta Radja), Juara Harapan II diraih ayam ketawa milik Ilham Ibrahim (Kapas Aceh Utara) dan Juara III diraih ayam ketawa nilik Ko Afuk (Kossa Klub Banda Aceh). Untuk Kelas Exclusive atau Kelas Besas, Juara I Grand Champion diraih Topek, ayam ketawa dari Kossa Klub Banda Aceh, Juara II ditempati ayam ketawa milik Ko Afuk dan Juara III ditempati ‘Brewok’, ayam ketawa milik T. Arief Munandar dari Klub Kuta Radja, Banda Aceh. (b05)

Lebih dari seratus massa merupakan korban banjir yang berdomisili di seputar danau kembali mengadakan aksi. Mereka berupaya mendobrak dan berencana membongkar paksa tanggul yang saat ini masih dalam proses pembangunan, Rabu (26/6) sore. Massa yang merasa ‘dizhalami’ karena telah berulang upaya ganti rugi molor, mulai bertindak anarkis. Mereka mulai merusak pagar seng di sekitar tanggul dan berupaya memasuki area tanggul. Namun puluhan petugas polisi yang siaga mulai mengamankan aksi warga. Tembakan gas air mata kemudian dilepas petugas. Satu orang warga terluka di bagian tangan kiri karena tersayat seng. “Aksi ini merupakan puncak kekecewaan kami terhadap

pengelola PLTA yang belum memberikan kompensasi ganti rugi banjir. Padahal perjanjian telah 3 kali dibuat dan disepakati antara pihak kami dengan PLTA ,” jelas Tomi Nova Gayo, koordinator aksi massa di lokasi kejadian. Untuk menuntut kejelasan persoalan ganti rugi ini, pihaknya juga sebelumnya melakukan orasi di kantor PLTA Bius, Silih Nara (sekitar 20 km dari arah pusat Kota Takengen). Massa menjumpai pimpinan penanggungjawab PLTA Pesangan. “Meski kami (massa) telah melakukan audiensi dengan pimpinan PLTA saat di Bius, namun belum ada kesepakatan dan solusi yang jelas. Dari itu, aksi ini kembali berlanjut dengan jumlah massa lebih besar ke Tanggul PLTA di Jembatan Bale,” katanya. “Kami juga tidak akan pulang dari lokasi ini sebelum ada upaya ganti rugi yang telah berulang kali dijanjikan PLTA,” jelas Tomi. Oktavianus Duha, Manager PLTA Pesangan mengatakan, pihaknya pada dasarnya tidak berniat mengingkari kesepaka-

tan yang sebelumnya telah dimediasi Pemda Aceh Tengah. “Perlu kami luruskan, persoalan kompensasi imbas banjir ini masih dalam proses upaya ganti rugi seperti yang telah disepakati bersama. Namun, realisasinya harus berdasarkan hukum yang jelas. Sehingga proses legalitas ganti rugi bisa dilakukan,” paparnya. Lainnya, yang jadi pertanyaan pihak kami, lanjut dia, di saat upaya proses kompensasi sedang dijalankan, warga kemudian menuntut, mengadukan dan melaporkan persoalan ini ke pihak Pengadilan Negeri Takengen. “Artinya, persoalan ini bukan lagi diselesaikan secara musyawarah, namun sudah ke ranah hukum. Jadi apakah kompensasi ganti rugi ini nantinya akan kami lakukan? Tentu hal itu harus melalui hasil keputusan pengadilan,” katanya. Sementara terkait seorang korban luka yang dirujuk ke RSU Data Beru Takengen, Hardi Yanis, pimpinan RSU menyebutkan, pihaknya telah menangani pasien luka tersebut. (cb09/b32/b33)

Waspada/Gito Rolies

PEGAWAI Kejaksaan Tinggi Aceh sedang melakukan donor darah di kantor Kejati Aceh

LEMBAH SABIL (Wasapada) : Bangunan Sekolah Dasar Negeri (SDN) Suak Berambang, Kec. Lembah Sabil, Abdya, Rabu (26/6) dini hari rata dengan tanah akibat dilalap api. Sebanyak delapan unit ruang belajar beserta mobilernya hangus termasuk sejumlah buku pelajaran. Awi ,30, warga setempat mengatakan, api berasal dari bangunan belakang sekolah itu, tiba-tiba makin membesar dengan spontan dia berteriak seraya menggedor pintu rumah warga yang berdekatan dengan lokasi. “Api cukup besar, beruntung tak ada angin sehingga api tidak merembes ke rumah warga lain yang berdekatan dan mendengar suara teriakan saya, warga pun berdatangan membantu memadamkan,” ungkapnya. Buyong, warga lain menyayangkan terlambatnya bantuan mobil pemadam kebakaran. Menurutnya, mobil pemadam baru tiba di lokasi satu jam kemudian. Selain dibantu dua unit mobil Damkar, warga juga bergotong royong dengan menggunakan timba pengangkut air yang diambil dari rumah dan masjid terdekat. “Mobil Damkar jauh dari Blangpidie ke Lembah Sabil, butuh waktu 30 menit, bayangkan saja repotnya kami dalam memadamkan api,” kata Buyong. Kepala SDN Suak Berambang yang kini jadi SDN 1 Ladang Tuha 1, Thamren ketika dijumpai di lokasi, Rabu (26/6) mengatakan, akibat keja-

dian itu enam unit ruang belajar siswa dan dua ruang pusat kegiatan guru (PKG) serta sejumlah mobiler hangus terbakar, termasuk beberapa buku paket pelajaran siswa. “Kita sudah membuat laporan insiden kebakaran ini, sambil menunggu realisasi pembangunan kembali, kemungkinan kita akan mencari bangunan sementara untuk proses belajar-mengajar,” ujarnya. Meskip bangunan ini sudah hancur, akan tetapi proses penerimaan siswa baru tetap berlangsung, dengan memanfaatkan bangunan yang tersisa. Untuk kegiatan pesantren kilat dalam bulan suci Ramadhan, pihaknya akan menggunakan masjid terdekat. Dia berharap pemda segera membangun kembali demi kelancaran pendidikan, apalagi sekolah ini merupakan tertua di daerah ini. Kadis Pendidikan Abdya Yusnaidi menuturkan akan berupaya cepat mengatasi proses pembangunan kembali. “Kita akan mengupayakan pembangunan kembali guna menanggulangi proses belajar sekaligus menyediakan bangunan sementara,” tuturnya. Kepala Badan Penanggulangan Bencana Daerah (BPBD) Abdya Jusbar mengakui mobil pemadam di dinasnya terlambat datang, mengingat lokasi jarah tempuh antara BlangpidieLembah Sabil menghabiskan waktu sekitar 30 menit. (b30/cb05)

Pertemuan KIP Sarat Adu Argumen SUBULUSSALAM (Waspada) : Pertemuan Komisi Independen Pemilihan (KIP) Subulussalam yang menghadirkan Ketua KIP dan Asisten I Setdaprov Aceh, Wali Kota dan Ketua DPRK bersama anggota, Kadis PPKKD, Kepala Bappeda Kota Subulussalam di Sekretariat KIP, Rabu (26/6) sarat adu argumen. Pasalnya, acara yang dipimpin Ketua KIP Syarkawi Nur diawali pandangan singkat tentang Pilkada oleh Ketua KIP Aceh dan Asisten I Setdaprov, wali kota dan Ketua DPRK, dilanjutkan pendapat sejumlah anggota DPRK, yakni Ansari Idrus Sambo, Syaripuddin Padang, Jamasa Cibro, Netap Ginting dan Bahtiar Hs secara marathon. Usai Bahtiar berbicara, corong dikuasai Ketua KIP, Syarkawi, di mana saat yang sama beberapa anggota DPRK seperti Wakil Ketua Siti Ansari Bancin, Ansari Idrus Sambo, Mukmin dan Dedi ingin menyampaikan pendapat. Pertemuan berakhir sekira pukul 12:40 setelah KIP berjanji secepatnya memberikan solusi terkait persoalan Pilkada Subulussalam. Saat akan menutup pertemuan, masih terjadi adu pendapat antara Dedi dengan Syarkawi, membuat pertemuan sedikit tegang. Dari hasil pertemuan itu, soal Pilkada Subulussalam terkesan belum ditemukan kesimpulan, antara digelar Oktober 2013 atau ditunda

hingga 2015. Legislatif dan eksekutif masih beda pandangan soal anggaran, meski diakui telah diparipurnakan akhir Desember 2012. Bahkan surat pemberitahuan DPRK kepada KIP tentang berakhirnya masa jabatanWali Kota dan Wakil Wali Kota Subulussalam yang ditandatangani dua pimpinan DPRK dan beberapa anggota dikecam Netap Ginting, anggota DPRK setempat. “Surat yang ditandatangani dua pimpinan DPRK itu tak ubah seperti proposal kelompok tani,” kata Netap. Sebelumnya, Pianti mempertanyakan KIP tentang agenda pertemuan. Soal Pilkada, menurut Pianti, pihaknya belum menyurati KIP tentang berakhirnya masa jabatan kepala daerah setempat. “Lembaga DPRK sampai saat ini belum mengeluarkan surat pemberitahuan tentang berakhirnya masa jabatan Wali Kota dan Wakil Wali Kota Subulussalam,” tutur Pianti seraya menambahkan, daerah ini masih berutang sebesar Rp13,5 miliar dan harus dilunasi pada 2013. Wali Kota Subulussalam Merah Sakti berharap Pilkada bisa digelar pada 2013 ini karena anggaran sudah ada, daerah aman dan tidak sedang dalam bencana. (b28)

Wagub Batal Buka TTG Di Gayo TAKENGEN ( Waspada): Wakil Gubernur Aceh Muzakir Manaf batal hadir ke Gayo, Aceh Tengah untuk membuka secara resmi Gelar Teknologi Tepat Guna (TTG) VIII 2013. Sementara pagelaran ini sendiri diikuti 33 kabupaten/kota se-Aceh berlangsung di Lapangan Musara Alun Takengen. Tidak hadirnya pejabat teras ini menjadi pertanyaan sebagian masyarakat. Pasalnya, isu kedatangan Wagub Aceh sebelumnya telah mulai beredar di kalangan warga, dijadwalkan hadir ke Aceh Tengah membuka resmi acara TTG tersebut. Sementara menggantikan

Gubernur/Wagub Aceh untuk membuka acara TTG ini diwakilkan kepada Asisten II administrasi pembangunan pemerintah Aceh T Said Mustafa. “Kenapa gubernur/Wagub tidak hadir membuka TTG ini. Padahal sejak terpilihnya pasangan ‘Zikir’ sebagai pemimpin di Aceh ini belum pernah berdialog langsung dengan masyarakat Gayo. Ini suatu bukti bahwa pemerintah Aceh tidak berniat menjalin komunikasi yang baik dengan masyarakat Gayo wilyah ALA,” kata Zamzam Mubarak, Dewan Pengurus Rakyat (DPR) ALA, Rabu (26/6) di Takengen.

Menurutnya, tidak hadirnya kedua pejabat teras di Aceh ini membuktikan ada dugaan mereka ‘takut’ serta belum dewasa dalam menghadapi perkembangan politik. Hal ini karena sebelumnya masyarakat di sana kerap meminta pemekaran Aceh Leuser Antara (ALA). T Said Mustafa, Asisten II Pemerintah Aceh menyangkut batalnya kunjungan Wagub membuka resmi TTG menyebutkan, saat ini kondisi beliau kurang sehat pasca sekembalinya dari Kota Subulussalam. Sementara acara pembukaan Gelar TTG ini sendiri dibuka T Said Mustafa. (cb09/b33/b32)

Waspada/Khairul Boangmanalu

SUASANA pertemuan di Sekretariat KIP Subulussalam, Rabu (26/6)

PNPM Perkotaan Evaluasi Program BANDA ACEH (Waspada): Untuk mengevaluasi keberhasilan program PNPM mandiri perkotaan dalam implementasi kemitraan dalam pengentasan kemiskinan di Aceh, PNPM perkotaan melaksanakan lokakarya review PNPM mandiri perkotaan yang dilaksanakan di Kantor Bappeda Kota Banda Aceh, Rabu (26/6). Konsultan Manajemen Wilayah (KMW) PNPM Mandiri perkotaan Saifulsyah mengatakan, kegiatan tersebut merupakan kegiatan tahunan untuk mereview program yang telah dilaksanakan dan tujuannya untuk perbaikan ke depan apabila masih terdapat kekurangan. Untuk program selanjutnya, PNPM perko-

taan akan membuat program penguatan gender serta memperkuat peran lembaga masyarakat. “Kami berharap pemerintah kota Banda Aceh bisa menunjuk salah satu SKPK untuk membina lembaga yang sudah terbentuk,” terangnya. Asisten tiga Kota Banda Aceh T Bukhari mengatakan, kehadiran PNPM Perkotaan di Kota Banda Aceh terbukti mampu meningkatkan perekonomian masyarakat,” tegasnya. PNPM Mandiri Perkotaan yang sudah masuk di Kota Banda Aceh telah membawa berbagai inspirasi, motivasi, ide dan gagasan baru dalam pelaksanaan program yang membangun semangat pemberdayaan masyarakat. (cb01)

534 Calon Mahasiswa Jalur SNMPTN Gugur

Pegawai Kejati Aceh Donor Darah BANDA ACEH (Waspada): Kejaksaan Tinggi Aceh menggelar donor darah dalam rangka memperingati Hari Bhakti Adhyaksa ke-53, Senin (24/6), di kantor Kejati Aceh diikutieluruh pegawai Kejaksaan Tinggi Aceh. Kepala Kejaksaan Tinggi Aceh melalui Kasipenkum Amir Hamzah mengatakan, kegiatan donor darah untuk membantu Palang Merah Indonesia (PMI) mendapatkan darah dari masyarakat menjelang Ramadhan 1434 Hijriah karena pada bulan itu pasokan darah biasanya berkurang. Lebih lanjut ia mengatakan, kegiatan donor darah ini merupakanrangkaiankegiatanHariBhaktiAdhyaksake-53,selainkegiatan Pekan Olahraga (POR).“Masyarakat umum juga bisa mendonorkan darahnya jika ingin meramaikan kegiatan ini,” katanya. Darah yang terkumpul dalam kesempatan itu sebagian besar memiliki golongan O, A dan B. Dalam kegiatan itu, Kajati Aceh TM Syahrizal dan Wakil Kepala Kejaksaan Tinggi Aceh Hermut Achmadi turut menyumbangkan darahnya. (cb01

Rabu 27 Juni 2013

Bangunan SDN Terbakar

BANDA ACEH (Waspada): Institut Agama Islam Negeri ArRaniry akan menerima 3.500 mahasiswa baru. Sedangkan yang mengikuti Seleksi Penerimaan Mahasiswa Baru Perguruan Tinggi Agama Islam Negeri (SPMB-PTAIN) tahun ini berjumlah 4.362 orang. Ketua Pelaksana SPMB-PTAIN IAIN Ar-Raniry Amirul Hadi menyebutkan, SPMB-PTAIN nasional ini yang ketiga kalinya diikuti IAIN Ar-Raniry Banda Aceh. “Tahun 2013 ini total jumlah yang diterima sebanyak 3.500 mahasiswa baru dari berbagai jalur,” kata Amirul, Rabu (26/6). Kata dia, dari hasil tes SPMB-PTAIN ini, IAIN Ar-Raniry akan menerima 2.000 mahasiswa dengan nilai rata-rata di atas enam. Dari jalur undangan dan JPA 600 orang dan jalur PMB mandiri IAIN Ar-Raniry lebih kurang 1.000 orang. “Tapi ini belum angka pasti,” papar dia. Ditanya ujian tulis SPMB-PTAIN dalam dua hari ini, hanya tiga atau empat persen peserta yang tidak mengikuti di hari kedua, mungkin karena sakit atau berhalangan. (b07)

SINABANG (Waspada) : Menyambut HUT ke-67 Bhayangkara, Polres Simeulue melakukan kegiatan social berupa donor darah, Rabu (26/6) di Mapolres Simeulue. Kegiatan itu diikuti seluruh anggota Polres dan Polsek se Kabupaten Simeulue. Kapolres Simeulue melalui Kasat Intel Ipda Erizal yang juga ketua panitia kegiatan mengatakan, donor darah dilaksanakan dalam memeriahkan peringatan HUT Bhayangkara ditargetkan mendapatkan 50 kantong darah. Direktur RSUD Kabupaten Simeulue Yusmardi mengatakan bahwa kegiatan ini berlangsung atas kerjasama Polres Simeulue, RSUD Kabuputen Simeulue dan Palang Merah Indonesia (PMI) Simeulue.(cb08)

WASPADA

Waspada/Muhammad Riza

SAMSUL BAHRI, pemilik salah satu warung kopi di Desa Raya Paya, Kemukiman Bungie, Kecamatan Simpang Tiga, Pidie, Senin (24/6) sedang meracik minuman kopi yang dijual per gelas Rp1.000.

Di Pedalaman Pidie

Segelas Kopi Masih Dijual Rp1.000 SIGLI (Waspada): Meski pemerintah pusat telah menaikkan harga Bahan Bakar Minyak (BBM), namun nun jauh di pedalaman Pidie, tepatnya di Desa Raya Paya, Kemukiman Bungie, Kecamatan Simpang Tiga, Pidie, harga satu gelas air kopi masih dijual Rp1.000. Padahal, seiring dinaikkan harga BBM, sejumlah bahan pokok, seperti gula pasir, minyak goreng dan tepung sudah ikut naik. Samsul Bahri, 35, salah seorang pemilik Warung Kopi (Warkop) di Desa Raya Paya, mengatakan, ia tidak menaikkan harga air kopi per gelas Rp1.000, yang selama ini dijualnya. Karena dilihat dari daya beli warga di desa itu tidak terjangkau bila dibandingkan dengan pendapatan sehari-hari yang

mayoritas berprofesi sebagai buruh dan petani. “Kalau saya naikkan harga air kopi Rp2.000 per gelas, jujur saja mereka tidak sanggup, karena pendapatan warga yang mayoritas sebagai petani atau buruh tani per hari Rp30.000,” katanya. Dengan pendapatan ratarata Rp30.000 itu per hari, kata Samsul, digunakan warga untuk membeli ikan, jajan sekolah anak saja sudah tidak mencukupi. “Saya meski menjual Rp1.000 segelas kopi, namun masih punya untung meski tidak banyak, tetapi cukup untuk menghidupi anak dan istri,” katanya. Meski dalam dua hari terakhir ini saat berbelanja membeli kebutuhan untuk warkopnya, seperti bubuk kopi dan gula

pasir serta kebutuhan lainnya, Samsul harus memutar otak, karena harga barang di pasar sungguh mencekik leher. “Pemerintah jago menaikkan harga BBM, tetapi tidak tegas terhadap harga barang lain yang dinaikkan secara sepihak oleh pedagang di pasar yang memanfaatkan naiknya harga BBM,” tutur Samsul. Harga Rp1.000 yang dijual di desa itu tidak sama dengan harga jual segelas kopi di Kota Sigli dan Beureunuen, Pidie. Di beberapa warkop di Kota Sigli, harga segelas kopi juga masih belum dinaikkan. “Kami masih menjual segelas kopi saring senilai Rp3.000,” kata Marzuki, pemilik warkop di terminal, Kota Sigli. (b10)

BANDA ACEH (Waspada): Sedikitnya 534 calon mahasiswa Unsyiah yang awalnya telah dinyatakan lulus melalui jalur Seleksi Nasional Masuk Perguruan Tinggi Negeri (SNMPTN) dinyatakan gugur. Kepala Humas Unsyiah, Dr.rer.nat. Ilham Maulana, Rabu (26/6) menjelaskan, sebelumnya, ada 2.921 lulusan SMA dinyatakan lulus ke Unsyiah melalui jalur SNMPTN. “Itu jumlah belum verifikasi,” kata dia. Namun, lanjut Ilham, setelah proses verifikasi yang dilakukan Unsyiah pada 18-19 Juni 2013 lalu, hanya 2.148 orang dari jumlah tersebut yang dinyatakan lulus dari tahap ini. Sementara

773 orang masih diharuskan mengklarifikasi data-data yang telah diisi saat pendaftaran. Lalu, klarifikasi yang dilakukan pada 21-24 Juni lalu kemudian meluluskan 239 orang, sementara 534 orang dinyatakan gugur. Di antara 534 orang tersebut, hanya 31 orang yang benarbenar ditolak karena dianggap bermasalah dengan rapor SMA mereka. Sementara 503 orang tidak melakukan pendaftaran ulang. “Baik yang ditolak maupun yang tidak melakukan pendaftaran ulang dinyatakan gugur sebagai calon mahasiswa Unsyiah,” tutur Ilham yang juga dosen Fakultas MIPA ini. (b07)

Sediakan Data Akurat Membangun Daerah BLANGPIDIE (Waspada) : Dalam membangun perencanaan di daerah mesti tersedia data yang lengkap dan akurat supaya kebutuhan dalam suatu daerah itu dapat terpenuhi tanpa ada tumpang tindih dan perbuatan mubazir. Pernyataan itu dikatakan Sekda Abdya Ramli Bahar saat membuka acara Sosialisasi Aceh Barat Daya Dalam Angka (ABDA) dan Pendapatan Domestik Regional Bruto (PDRB) tahun 2013 di aula Dinas Kesehatan setempat, Selasa (25/6). Dikatakan Ramli, banyak data yang terdapat dalam daerah saat ini sangat berbeda-beda, untuk data lahan pertanian saja belum ada yang akurat, dalam Rencana Tata Ruang Wilayah (RTRW) lahan pertanian dinyatakan dengan luas 8 ribu hektare, sementara data di Badan Pusat Statistik (BPS) Abdya seluas 11 ribu hektare, malah berapa tahun yang lalu sempat disebutkan bahwa lahan pertanian di Abdya sempat sampai 23.000 hektare. “Kita jangan bermain-main dalam menen-

tukan data untuk daerah, akibat pemalsuan data yang kita kirimkan ke pusat tersebut, maka pembangunan dalam daerah akan amburadul sehingga akan menjadi temuan, contohnya bibit padi akan menumpuk dan kadaluarsa karena ditumpuk di gudang dan tidak tersalurkan secara menyeluruh, ini perlu kita hindari bersama,” paparnya. Sekda Ramli menyampaikan, tidak mungkin membangun daerah tanpa data yang lengkap dan akurat, karena membangun butuh dana yang besar, apabila membangun tanpa data, maka akan lebih besar lagi dana yang akan dikeluarkan oleh daerah itu. “Untuk itu kita meminta kepada seluruh jajaran SKPK di Abdya untuk memberikan data yang sah, kita tidak bisa merancang pembangunan ke depannya apabila data yang kita gunakan tersebut tidak sesuai dengan RTRW, ini mesti hati-hati sekali karena akan berimbas untuk perencanaan 2014 nantinya,” tuturnya. (b08)


Aceh

WASPADA Kamis 27 Juni 2013

Bupati Pidie Sampaikan Pesan Politik Pada Rakerda KNPI

BBM Naik, Petani Kewalahan Beli Solar LHOKSEUMAWE (Waspada) : Akibat kenaikan harga Bahan Bakar Minyak (BBM), ratusan petani di Desa Babah Buloh, Kecamatan Sawang, Aceh Utara mengeluhkarena petani harus membeli harga solar Rp5.500 per liter untuk menghidupkan mesin pompaninasi. “Kami mengairi air ke sawah untuk bercocok tanam mengandalkan pompanisasi karena daratan tinggi. Saat ini juga sedang musim kering, otomatis kami harus membeli solar dalam jumlah banyak. Belum lagi harga solar naik sekarang ini,” kata M Husen, petani Babah Buloh. Dikatakan seiring kenaikan harga BBM di mana solar sebelumnya Rp4.500 per liter dan naik menjadi Rp5.500 per liter sangat memberatkan, karena sebelumnya dengan uang Rp30.000 ribu sudah dapat memenuhi kebutuhan air untuk satu rante (per rante=400 meter), tetapi kalau sekarang tak cukup lagi, minimal harus dikeluarkan Rp40 ribu. “Bagi yang punya uang ini tidak menjadi persoalan, dan tetap saja dapat menggarap sawahnya dengan tepat waktu, sedangkan bagi petani yang ekonominya lemah terpaksa utang dulu untuk dapat mengairi sawah yang sudah dilanda kekeringan,” ujarnya. (cmk)

Dukung Nazir Adam Untuk DPD RI

Anak Usia Sekolah Tak Boleh DO BIREUEN (Waspada) : Pada penerimaan murid baru tahun 2013,anak-anakusiasekolahtidakboleh drop-out (tidakbersekolah). Kadis P dan K Bireuen Nasrul Yuliansyah di ruang kerjanya, Rabu (26/6) mengemukakan, pihaknya sudah menginstruksikan kepada para kepala UPTD kecamatan untuk menyampaikan hal itu kepada para kepala sekolah untuk menchek anak-anak drop-out di wilayah kerjanya masing-masing. Jika kedapatan masih ada anak-anak drop-out, para Kasek berkewajiban menjemput untuk dimasukkan ke sekolah. Para Kaek harus berkoordinasi dengan para geuchiek dan Sekdes setempat agar dapat mengetahui secara jelas terhadap anak usia sekolah yang drop-out. (b12)

Kasus Alkes RS Cut Meutia Ke PN Tipikor LHOKSUKON (Waspada): Kejaksaan Negeri Lhoksukon melimpahkan kasus dugaan korupsi pengadaan alat kesehatan (Alkes) Rumah Sakit Umum Cut Meutia (RSUCM) Aceh Utara ke Pengadilan Tindak Pidana Korupsi (Tipikor) Banda Aceh, Kamis (27/6) hari ini. “Tim Jaksa Penuntut Umum (JPU) sudah berangkat dari Lhoksukon. InsyaAllah, kalau tak ada halangan, besok (hari inired) berkasnya sudah masuk ke PN Tipikor Banda Aceh,” kata KepalaKejaksaanNegeri(Kajari)LhoksukonTRahmatsyah, kemarin. Proyek pengadaan Alkes RSUCM ini menyedot dana APBN Tahun 2012, senilai Rp25 miliar. Namun sebagian besar alat tersebut dilaporkan tak sesuai spek, bahkan ada yang rusak sebelum dipakai. Kerugian negara ditaksir mencapai Rp3,5 miliar. Kasus ini menyeret tiga tersangka, masing-masing, SDN, selaku Pejabat Pembuat Komitmen (PPK), MSA, Direktur PT Visa Karya Mandiri, selaku rekanan dan Direktur RSUCM Aceh UTara, AS. (b19)

PT PIM Tutup Pelatihan Pembuatan Kue ACEH UTARA (Waspada) : Fitriani, Komisaris PT PIM, Selasa (25/6) menutup kegiatan pelatihan pembuatan kue yang dilaksanakan di gedung Diklat PIM Kepada 20-an ibu dari desa binaan. Meskipun belajar dalam waktu singkat, para peserta telah mampu menyerap beberapa ilmu pembuatan kue dari instruktur Aan Hendarman dari PT Sico Jakarta dan Toko Fahmi Lhokseumawe. Menurut Komisaris PIM tersebut, pelatihan pembuatan kue bagi ibu-ibu desa binaan merupakan kegiatan yang cukup bagus karena dapat melatih kemandirian kaum perempuan. Kepada para peserta diharapkan dapat mengajak ibu-ibu lainnya yang belum berkesempatan mengikuti pelatihan tersebut untuk mengajari ilmu pembuatan kue dari PT Sico dan Toko Fahmi kepada mereka. “Training seperti ini bagus, alangkah bagusnya lagi jika kue hasil produksi para peserta dapat dipasarkan dengan baik, selain itu juga mampu mengkreasikan hasil produksi. Sehingga semua orang nanti tahu bagaimana kuekue khas Aceh khususnya khas Aceh Utara,” kata Fitiriani yang diamini Usman Mahmud, Direktur Umum dan SDM PIM. Junuiati, peserta dari Gampong Tambon Tunong saat menyampaikan kesan dan pesan mengucapkan terimakasih kepada PIm yang telah bersedia menyediakan bantuan untuk pelatihan tersebut, diharapkan bantuan serupa akan terus dilakukan secara berkelanjutan sehingga ilmu para instruktur dapat diserab sepenuhnya. (b18)

NasDem Karang Baru Serahkan Santunan KUALASIMPANG (Waspada): DPC Partai Nasdem Karang Baru menyerahkan santunan asuransi kepada ahli waris almarhum Jumianto dan Etti, anggota PartaiNasDemDesaPayaTampah, Kecamatan Karang Baru, Aceh Tamiang, Rabu (26/6). Ketua DPC Partai Nasdem Karang Baru, Riza Zahari menyatakan, kedua ahli waris anggota Partai Nasdem tersebut masingmasing mendapat santunan asuransi anggota NasDem Rp1 juta. “Penyerahan santunan ini sebagai wujud komitmen Partai NasDem kepada semua anggota yang telah meninggal dunia, “ ungkap Ketua DPC NasDem Karang Baru Kab. Aceh Tamiang Riza Zahari ketika menyerahkan santunan asuransi tersebut didampingi Wakil Ketua DPD Nasdem Bidang Bapilu Almahdar. Ahli waris dari Jumianto, Andita Wahyu dan ahli waris Etti, Tati Herawati sekeluarga berharap semoga Partai NasDem menjadi Partai Pemenang di Pemilu 2014. (b23)

Waspada/Muhammad Hanafiah

KETUA DPC Partai NasDem Karang Baru, Aceh Tamiang Riza Zahari menyerahkan santunan asuransi kepada kedua ahli waris anggota Partai NasDem, Jumianto dan Etti di Desa Paya Tampah, Karang Baru, Rabu (26/6)

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu)

Garuda Indonesia

GA 0278 Medan GA 0142 Jakarta/Medan GA 0146 Jakarta/Medan

Lion Air

JT 304 Jakarta JT 306 Jakarta/Medan JT 396 Jakarta/Medan

Sriwijaya Air

SJ 010 Jakarta/Medan

Air Asia

QZ 8023 Medan AK 1305 Kuala Lumpur *

Fire Fly

FY 3401 Penang* * Setiap Senin, Rabu, Jumat dan Minggu.

Berangkat (flight, tujuan, waktu)

07:05 10:45 14:50

GA 0279 Medan GA 0143 Medan/Jakarta GA 0147 Medan/Jakarta

07:45 11:3 0 15:45

11:35 15:55 21:30

JT 397 Medan/Jakarta JT 307 Jakarta JT 305 Medan/Jakarta

06:00 12:15 16:35

12:50

SJ 011 Medan/Jakarta

13:35

12:00 11:20

QZ 8022 Medan AK 1306 Kuala Lumpur*

12:25 11:45

14:00

FY 3400 Penang*

14:20

B7

Waspada/Muhammad Riza

KETUA KNPI Pidie yang baru Fadhlullah memberikan kata sambutan usai dilantik bersama puluhan pengurus KNPI Pidie di gedung Meusapat Ureung Pidie, Rabu (26/6)

Kasus Anak Gajah Tanggungjawab BKSDA BANDA ACEH (Waspada): Lembaga Swadaya Masyarakat Selamatkan Isi Alam dan Flora Fauna (LSMSILFA) mengecam keras lambannya Balai Konservasi Sumber Daya Alam (BKSDA) Provinsi Aceh menangani anak gajah yang dipelihara warga di Aceh Utara sehingga mengakibatkan kematian. Sebagaimana diketahui, anak gajah berusia sekitar 2 tahun yang diberi nama “Raja Biram” akhirnya mati pada

Senin (24/6) setelah sempat dipelihara selama sekitar 2 bulan warga Desa Blang Pante, Kecamatan Payabakong, Kabupaten Aceh Utara. Armia Jamil selaku Manajer Operasional di LSM SILFA mengatakan, kematian anak gajah tersebut disebabkan pihak BKSDA Aceh lamban menangani secara serius, bahkan tidak diambil dari warga untuk dirawat sebagaimana mestinya. “Anak gajah itu merupakan tanggungjawab BKSDA untuk menyelamatkan species dan satwa yang dilindungi undangundang. Namun kenyataan yang kita lihat, BKSDA justru tidak melakukan kerjanya dan bahkan terkesan melepas tang-

gungjawab,” ujar Armia Jamil, Rabu (26/6). Armia Jamil juga mendesak Pemerintah Aceh agar mengevaluasi kembali kinerja BKSDA Aceh agar bisa bekerja sesuai tugas dan tanggungjawabnya sehingga ke depan tidak ditemukan lagi kasus yang sama. Selain itu, LSM SILFA juga mendesak BKSDA dan Pemkab Aceh Utara agar segera mengambil seekor lagi anak gajah yang masih dipelihara warga. Bayi gajah yang masih berusia sekitar satu bulan tersebut ditemukan warga pada 18 Juni 2013 dan hingga saat ini masih di tangan warga yang belum berpengalaman merawat anak gajah. (b04)

Dua Wanita Bawa 23 Kg Ganja KUTACANE (Waspada) : Jajaran kepolisian yang bertugas di pos Perbatasan Lawe Pakam, Selasa (25/6) malam, menyita 23 kilogram ganja kering dan mengamankan dua pemiliknya, penumpang mopen Jurusan Blangkejeren-Medan. Dua wanita yang diamankan dan tertangkap tangan membawa ganja kering seberat 23 kg tersebut, masing-masing BYH alias Mak S,55, warga Desa Bustanussalam, Kecamatan Blangkejeren dan SLMH, 37, penduduk Dusun Terminal, Kota Blangkejeren, Kecamatan Blangkejeren, Kabupaten Gayo Lues. Kapolres Agara AKBP Trisno Rianto didampingi Kasat Narkoba Iptu Yusra di ruang kerjanya, Rabu (26/13) mengatakan, keberhasilan petugas mengamankan pemilik bersama barang bukti ganja kering itu berawal

dari pemeriksaan rutin di Pos Perbatasan Lawe Pakam. Sekira pukul 23:30 , dari arah Kutacane-menuju Sumatera Utara, petugas tang merasa curiga melakukan pemeriksaan setiap mopen dan kendaraan yang melintas dari pos perbatasan Lawe Pakam. Ketika memeriksa Mopen Karsima BK1047 GD, dua wanita yang merupakan penumpang mopen dari Blangkejeren terlihat merasa gugup, begitu petugas melakukan pemeriksaan terhadap tas yang diletakkan tersangka di sebelah tempat duduknya, petugas menemukan bungkusan yang dimasukkan dalam plastik kresek. Setelah petugas di bawah pimpinan Pos Pol Aiptu Peterson Simangunsong melakukan pemeriksaan, dari dalam tas milik tersangka ditemukan 11 bungkus yang berisi ganja ke-

ring, sedangkan dari badan tersangka, ditemukan lagi ganja kering seberat 4 kg. Usai memeriksa BYH, petugas kembali melakukan pemeriksaan terhadap temannya SLMH, hasilnya dari dalam tas dan dari badan tersangka, ditemukan lagi ganja seberat 8 kg. “Selain dalam bungkusan yang dimasukkan dalam tas kresek dan dibalut dalam pakaian yang tersusun di dalam tas yang dibawa kedua tersangka, beberapa kilogram ganja kering juga ditemukan dari badan kedua tersangka warga Gayo Lues tersebut,” ujar Kasat Narkoba. Kepada petugas kedua tersangka mengakui, ganja yang dibawa keluar Aceh Tenggara itu milik orang lain, sedangkan mereka hanya sebagai upahan dengan janji bila sampai ke Medan, mereka akan diberikan upah Rp200 ribu per kilo gram. (b26)

Warga Serbu Kantor Bea Cukai BANDA ACEH (Waspada): Seratusan warga yang mengaku berasal dari Sabang menyerbu Kantor Pengawasan dan Pelayanan Bea Cukai Tipe C Madya Pabean Banda Aceh menuntut pengembalian gula dan beras mereka yang disita pihak Bea Cukai dan meminta kejelasan hukum terkait aturan gula dan beras impor. Massa mendatangi kantor BC, Rabu (26/6) sejak pukul 10:00 dan berlangsung hingga pukul 17:00. Namun aksi massa tersebut berlangsung anarkis, ratusan warga memaksa membobol gudang di dalam pekarangan kantor Bea Cukai saat polisi sedang lengah. Massa membawa kabur sejumlah karung zak berisi beras ketan dan gula yang berada di dalam gudang. Polisi yang melihat aksi tersebut langsung menghalau masyarakat keluar dari pekarangan kantor Bea Cukai,

kericuhan pun tidak dapat dielakkan. Dalam aksi itu, polisi menciduk lima orang yang diduga sebagai provokator untuk menjarah barang-barang sitaan Bea cukai di gudang. “Kami sudah cukup bersabar mengawal aksi massa, namun mereka tidak menghargai polisi dan berani melawan polisi, bahkan mereka tidak ada izin untuk demo,” kata perwira bidang intelijen Polresta Banda Aceh. Sebelum aksi penjarahan, beberapa perwakilan warga sempat diterima pihak bea cukai untuk bernegosiasi dengan kepala bea cukai. Setelah bernegosiasi, salah sorang warga menyampaikan hasil pertemuan tersebut kepada warga lain yang sudah menunggu di luar ruangan. “Pihak bea cukai meminta waktu satu minggu untuk berkoordinasi dengan atasan dan

kita diminta untuk kembali kemari minggu depan,” jelas salah seorang warga. Namun spontan semua warga menolak, mereka ingin barang mereka dikembalikan hari itu juga. “Kami sudah lelah menunggu, kami meminta barang yang telah disita untuk dikembalikan kepada kami hari ini juga,” tegas seorang warga. Kemudian seorang petugas bea cukai keluar untuk memberi pengarahan dan pengertian kepada warga, namun warga tetap bersikeras, gula dan beras mereka harus dikembalikan segera. Kepala KPPBC TMP C Banda Aceh, Beni Novri mengatakan, barang sitaan yang dilakukan pihak bea cukai di Pelabuhan Ulee Lheue Banda Aceh sudah menjadi barang milik negara dan tidak bisa dikembalikan begitu saja, karena masih dalam proses hukum. (cb01)

Badan Kesbangpolinmas Latih Pemuda Gampong BANDA ACEH (Waspada): 180 Pemuda dari 90 gampong se-Kota Banda Aceh dibekali ilmu tentang cara mengendalikan keamanan dan kenyamanan di gampongnya masingmasing diprakarsai Badan Kesbangpolinmas Banda Aceh, itu berlangsung di aula SMK Lhong Raya Banda Aceh, Selasa (25/6). Staf ahli walikota Banda Aceh bidang hukum dan politik T Iwan Kesuma mewakili Wali Kota Banda Aceh ketika membuka acara tersebut mengatakan, pihaknya sangat mengapresiasi Badan Kesbangpolinmas Kota Banda Aceh yang telah memprakarsai kegiatan pelatihan tersebut. Hal ini, katanya, menunjukkan kepedulian dalam membe-

rikan sumbangsih tenaga dan pikiran untuk masalah pengendalian keamanan dan kenyamanan di Banda Aceh. Dan dari hasil pelatihan ini, Iwan berharap peserta mampu mendeteksi serta mencermati sedini mungkin gangguan keamanan di lingkungan terkecil di gampong yang mempunyai peluang untuk jadi embrio masalah keamanan dengan skala lebih besar dan luas. “Merekalah yang akan menjadi ujung tombak pelaksanaan keamanan gampong, apakah gampong tersebut nyaman dan aman mereka yang bertanggung jawab,” jelasnya. Menurutnya, unsur yang terpenting dalam membentuk keamanan gampong adalah

perlunya menciptakan suasana keagamaan yang kental di gampong seperti mengaktifkan remaja masjid, memakmurkan masjid, mengadakan pengajian dan kegiatan lainnya. Kepala Badan Kesbangpolinmas Kota Banda Aceh Syahrullah mengatakan, pelatihan pengendalian keamanan dan kenyamanan lingkungan bertujuan untuk peningkatan kemampuan dalam pengendalian keamanan di gampong masingmasing. Pelatihan tersebut diikuti 180 peserta yang berasal dari 90 gampong, dimana setiap gampong menyertakan dua tokoh pemuda untuk mengikuti pelatihan tersebut. (b02)

SIGLI (Waspada): Bupati Pidie Sarjani Abdullah menyampaikan pesan politiknya, mendukung Nazir Adam sebagai calon anggota Dewan Perwakilan Daerah (DPD) RI, asal daerah itu. Rabu (26/6), di Gedung Meusapat Ureung Pidie. “Nazir Adam yang sekarang sedang merintis jalan menuju Senayan, melalui DPD pada Pemilu 2014. Mudah-mudahan perjalanan saudara mulus. Kami mendukung Nazir, dan juga kita harapkan dukungan bersama,” kata Sarjani Abdullah pada acara pengukuhan pengurus dan Rakerda KNPI Pidie XI. Ketua KNPI Aceh Ihsanuddin mendukung dirinya yang maju sebagai calon legislatif pada Pemilu 2014. Pada kegiatan pengukuhan pengurus KNPI Pidie itu juga dihiasi dengan aksi sosial donor darah, kerja sama KNPI Pidie dengan Palang Merah Indonesia (PMI). Bupati Pidie Sarjani Abdullah berharap dengan pelantikan pengurus baru ini dapat membawa perubahan mendasar terhadap kemajuan organisasi serta bisa memberikan kontribusi nyata terhadap kemajuan Kabupaten Pidie. Begitu juga, dengan program kerja yang telah disusun. “Saya yakin pengurus baru ini dapat

mengimplementasikan program dalam kepeloporan generasi muda dengan menggalang persatuan dan kesatuan, mengkonsolidasi keanekaragaman potensi, membentuk sinkronisasi dan sinergi partisipasi dalam rangka mensukseskan pembangunan nasional,” ujar Sarjani. Dalam konteks pembangunan daerah, kata Sarjani, peran pemuda dalam organisasi KNPI haruslah dioptimalkan dalam rangka menyongsong kemajuan Pidie pada masa datang. Bupati menginginkan pemuda menjadi pilar terdepan dalam pelaksanaan pembangunan. Sebab bagi Sarjani Abdullah pemuda menjadi harapan bagi masyarakat Pidie yang dapat memberikan kontribusi positif demi kemajuan daerah. Sarjani menyadari bahwa Kabupaten Pidie harus tumbuh dan berkembang menuju masa depan lebih baik. Semua elemen masyarakat diharapkan harus tunjukkan sikap sebagai seorang pemenang yang tidak akan menyerah dalam melaksanakan tugas. “Untuk itu saya mengajak kita sekalian untuk mulai membangun tatanan menuju ke sebuah arah yang telah kita cita-citakan yaitu masyarakat Pidie yang Islami, sehat, cerdas, makmur damai dan bermartabat,” tuturnya. (b10)

Cabang Fahmil Aceh Utara Masuk Semi Final SUBULUSSALAM (Waspada): Peroleh nilai 1.825, utusan cabang fahmil Aceh Utara dengan dengan personel Ilham, M Wali Alkhalidh dan Riska Azhari masuk semi final. Tim ini unggul atas Bireuen, 1650 dan Aceh Selatan 425. Hasballah, Seksi Publikasi dan Dokumentasi Kafilah Aceh Utara, selaku Kasubbag Hubungan Media Massa Setdakab Aceh Utara mengatakan, selain cabang fahmil, pihaknya masih menunggu pengumuman panitia pukul 23:00 (Rabu malam). Tampil hari ini (Rabu kemarin), cabang tilawah anak-anak putri (Nurfadhilah), cabang hifzil quran 5 juz putra putri (Wahyu Ridha dan Raudhatul Jannah), 20 juz putra putri (Naufal Abiyu dan NeriWistia), cabang syarhil quran (Awis Kur-

ni, Hafidz Al Mansuri, Vivian Dwinsi Flora) dan cabang khattil quran bidang hiasan mushaf putra putri (Kadarisman dan Husna). Sehari sebelumnya, tampil tilawah remaja (Nurzakki), hifdzil 1 jus putri (Tajul fuzari, Misbahul Jannah), fahmil quran (Sri Berliana), Siti Sarah Munirah dan Siti Naurah. Lalu M2IQ (Khairu Akbar dan Ainul Mardhiah), tafsir (Mastura dan Ichsan Zulfadli) dan hifzil 10 jus putra putri (Farah Nadia dan Habibul Achi). Dari kafilah Kota Subulussalam, seperti disampaikan Hermaini,Wakil Ketua Kafilah, hingga, Rabu (26/6) telah tampil duta daerah ini pada cabang hifzil 5 juz dan tilawah putri, cabang tilawah golongan tartil putra putri serta cabang khattil quran golongan hiasan mushab putra-putri. (b28)

Kafilah MTQ Dilayani Maksimal SUBULUSSALAM (Waspada): Mengetahui isu laporan sejumlah kafilah MTQ ke-31 tingkat Provinsi Aceh di Subulussalam kecewa terkait penginapan hingga konsumsi, panitia pastikan upaya pelayanan maksimal. Salmaza, ketua panitia pelaksana MTQ, Rabu (26/6) mengatakan, pelaksanaan MTQ pihaknya berulangkali menggelar pertemuan dengan warga calon pemilik rumah yang dijadikan pondok bagi sejumlah kafilah. Disepakati, dengan biaya Rp40 juta per penginapan, meski terakhir menjadi Rp46 juta per pondok, kebutuhan para kafilah yang diperkirakan 70 orang harus menjadi tanggung jawab pemilik rumah/pondok.

Dikatakan, Wali Kota Subulussalam Merah Sakti telah memimpin langsung rapat panitia dan membentuk tim khusus untuk menelusuri kebenaran informasi dan meminta petugas penghubung antar kafilah dengan panitia MTQ tidak lalai soal kebutuhan dan keluhan para kafilah. Menurut Salmaza, pemilik pemondokan diamanahkan lebih maksimal melayani para tamu (kafilah) demi suksesnya Kota Subulussalam sebagai penyelenggara. Sejumlah anggota kafilah dari Kota Lhokseumawe terpaksa tidur di masjid, berdampingan pondok, bahkan menikmati menu yang kurang memadai. Salmaza menegaskan telah dilakukan upaya-upaya perbaikan. (b28)

Geucyik Diharap Pantau Penyaluran BLSM LHOKSEUMAWE (Waspada) : Seluruh geucyik dalam setiap desa di Kota Lhokseumawe diharapkan dapat berperan aktif memantau proses penyaluran dana Bantuan Langsung Sementara Masyarakat (BSLM) agar tepat sasaran dan diterima oleh orang yang berhak. Hal itu diungkapkan Wali Kota Lhokseumawe Suadi Yahya melalui Asisten III Lhokseumawe Muzakir Sulaiman, Rabu (26/6) dalam pengarahannya pada acara pelantikan Geucyik Desa Hagu Teungoh Kecamatan Banda Sakti. “Kita harapkan semua orang yang sudah dilantik menjadi geucyik harus bisa berperan aktif kesejahteraan masyarakat. Termasuk memantau perkembanganatauprosespenyaluranBLSMyang harus diterima orang yang berhak,” paparnya. Muzakir mengatakan, keputusan pemerin-

tah menaikkan harga BBM kali ini, tentu berdasarkan adanya alasan kuat, salah satunya ada untuk meningkatkan nilai nominal Bantuan Langsung Sementara Masyarakat dan menambah jumlah penerima. Mengingat pengalaman yang lewat banyak dugaan bantuan tidak tepat sasaran atau diterima orang yang tidak berhak, maka pasca kenaikan harga BBM kali ini bantuan tersebut harus benar –benar bisa dinikmati masyarakat miskin. Ketua Tuha Peut selaku panitia kegiatan pelantikan geucyik Idrus Bantasyam mengatakan, pada kesempatan itu Asisten III Pemko Lhokseumawe melantik Geucyik Hagu Teungoh yang baru yaitu Sulaiman Daud menggantikan yang lama Andreani berlangsung di ruang meunasah desa setempat. (b16)

Saluran Pembuang Tertimbun BIREUEN (Waspada) : Masyaralat Desa Pulo Ara Geudong Teungoh di Kecamatan Kota Juang selalu terancam terendam banjir kiriman. Banjir kiriman yang sudah menjadi langgaran bagi masyarakat Desa Pulo Ara Geudong Teungoh lantaran saluran pembuangan di sisi badan jalinsum Banda Aceh – Medan ke saluran irigasi Cureh dan alur Titi Rumbia sudah tertimbun. Geuchiek Desa Pulo Ara Geudong Teungoh Muchtar Yusuf, Selasa (25/6) mengatakan, terendamnya Desa Pulo Ara setiap turun hujan lantaran saluran pembuangan di sisi badan jalan negara tidak beerfungsi lagi untuk mengalirkan curahan hujan ke saluran pembuangan irigasi Cureh dan Alur Titi Rumbina. Tertimbunnya parit jalan di sisi badan jalan

Jalinsum kota Bireuen tidak hanya mengancam terendamnya rumah-rumah penduduk, pendidikan SDN Pulo Ara, setiap banjir kiriman terpaksa diliburkan. Selain itu setiap turun hujan kedua sisi badan jalan Simpang Arjun Desa Pulo Ara Geudong Teungoh Kota Bireuen selalu tergenang curahan hujan mengancam kerusakan badan jalan Jalinsum lantaran parit jalan negara di dua sisi badan jalan sudah ditimbun sehingga curahan hujan tergenang di dua sisi badan jalan. Masyarakat Desa Pulo Ara Geudong Teungoh sangat berharap kepada Pemkab setempat merehab kembali saluran pembuangan ke saluran irigasi Cureh dan Alur Titi Rumbia yang sudah ditimbun agar masyarakat terbebas dari ancaman banjir kiriman. (b12)

Warga Olah Limbah Plastik Jadi BBM TAKENGEN (Waspada): Heraferi, warga Kebayakan, Aceh Tengah menciptakan tangki reaktor yang dapat mengolah limbah plastik jadi Bahan Bakar Minyak (BBM) seperti bensin, solar dan minyak tanah. Dalam satu kilogram plastik, ‘mesin’ rakitan ini dapat menghasilkan produksi sekitar 700 gram minyak. Sementara, dalam satu unit alat rakitan sederahana ini, mampu mengolah 20 kilogram limbah sampah per hari. Waspada/Irwandi MN “Ide merakit alat ini lahir pemikiran sangat sederhana. FERAFERI (paling kiri) saat menjelaskan manfaat dan teknis kerja Banyak sampah plastik ter- tangki reaktor BBM rakitannya di hadapan Bupati Aceh Tengah, Nasaruddin (dua dari kiri) saat mengunjungi stan pameran milikbuang sia-sia dan kerap menjadi persoalan yang meresah- nya di pagelaran TTG 2013 di Musara Alun Takengen, Aceh Tengah kan masyarakat. Dari itu, saya coba merakitnya dan Alhamdulillah berhasil,” tangki reaktor ini juga cukup sederhana dan kerap papar Heraferi, Selasa (25/6) saat pihaknya dijumpai di sekitar kita. memamerkan benda tersebut di pagelaran Jadi saya kira, bila teknologi ini mulai dikenal, Tehnologi Tepat Guna (TTG) di Mu-sara Alun semua orang bisa mengolahnya. Hanya saja yang Takengen. harus dipelajari bagaimana mengatur suhu, Menurutnya, bila alat olah ini mulai diber- maupuncarakerjanyahinggamenghasilkanminyak dayakan, tidak menutup kemungkinan keter- layak pakai,” jelasnya. gantungan masyarakat terhadap tingginya kebuDia katakan, meski hasil karya tersebut masih tuhan pasokan minyak dapat teratasi. Lainnya, dibuat dengan jumlah terbatas, namun upaya secara ekonomis jauh lebih murah dan mudah ujicoba ini diharap mampu mengurangi persoadidapat,karenamengunakanbahanlimbahplastik lan sampah dan dapat menyuplai kebutuhan yang kerap tidak dimanfaatkan mayoritas warga. masyarakat terhadap BBM, khususnya minyak “Alat yang digunakan sebagai bahan merakit tanah. (cb09)


Aceh

B8

IDI (Waspada): Berdasarkan laporan masyarakat, lebih dari 70 persen Bantuan Langsung Sementara Masyarakat (BLSM) sebagai kompensasi sementara dari pemerintah atas kenaikan bahan bakar minyak (BBM) dinilai tidak tepat sasaran. Sehingga Bupati Aceh Timur Hasballah M Thaib menghentikan pembagian Kartu Perlindungan Sosial (KPS). “Kita sudah minta secara langsung agar pihak PT Pos (Persero) menghentikan pembagian KPS, khusus untuk seluruh PT Pos di wilayah Kabupaten Aceh Timur,” tegas Bupati Aceh Timur Hasballah M Thaib di Kantor PosIdi Rayeuk, Rabu (26/6) diterima Kepala Kantor POS setempat, Khalifuddin. Langkah itu diambil menyusul laporan masyarakat di sejumlah kecamatan seperti Kecamatan Darul Ihsan dan Idi Rayeuk serta beberapa kecamatan lain di wilayah barat. “Banyak yang menerima KPS ini kalangan orang kaya, seperti toke boat dan orang-orang yang tak berhak, sementara ureung gasien (orang miskin) tidak dapat. Jika kita biarkan, maka imbasnya adalah Pemkab Aceh Timur yaitu

IDI (Waspada): Memasuki hari ketiga Musabaqah Tilawati Quran (MTQ) tingkat Provinsi Aceh ke-31 di Subussalam, kafilah Aceh Timur sudah menunjukkan gigi sebagai mental juara. Hal itu dilihat atas keberhasilan cabang Fahmil putra dan putri melaju ke babak semifinal. Demikian disampaikan Ketua Sekretaris Kafilah Aceh Timur Amiruddin, Rabu (26/6). Adapun kafilah fahmil putra yang masuk babak semi final yaitu Edy Mirza, Muhammad Zoelfakar dan AlifWiga Asyraq, sedangkan kafilah fahmil putri yakni Tutia Rahmi, Ramaza Rizka serta Cut Inanda Zuhra. Dalam MTQ ini cabang fahmil putra Aceh Timur mengungguli Gayo Lues dan Pidie, sementra fahmil putri mengungguli Kabupaten Semelu dan Pidie Jaya. “Dipastikan besok tampil, fahmi putra berhadapan dengan Banda Aceh, Aceh Besar dan Subussalam selaku tuan rumah, untuk putri Aceh Timur akan melawan Aceh Barat, Aceh Besar serta Kota Langsa,” tutur Amiruddin. (cri)

IKBI Gelar Khitan Massal

Paramedis Dituntut Pelayanan Maksimal BIREUEN (Waspada) : Peran medis dan paramedis di jajaran Dinas Kesehatan sangat dituntut dalam memberikan pelayanan kesehatan maksimal kepada masyarakat Kadis Kesehatan Aceh Taqwallah menegaskan hal itu dalam memberikan pengarahannya pada acara kunjungan kerja perdana ke Bireuen di hadapan medis, paramedis RSUD Dr Fauziah, 18 Puskesmas dan bidan desa jajaran Dinas Kesehatan Kabupaten Bireuen. Kadinkes Aceh Taqwallah sebenarnya bukan orang baru bagi masyarakat Kabupaten Bireuen, bahkan cukup lama bertugas sebagai Kepala Puskesmas Samalangqa. Kadinkes BireuenYurizal menyampaikan, wilayah pelayanan kesehatan Kabupaten Bireuen terdiri dari 609 desa sudah memiliki sarana pelayanan kesehatan satu RSUD Fauziah dan beberapa RS swasta, 18 Puskesmas yang tersebar di 17 kecamatan. (b12)

STAIN Cot Kala Duduki Peringkat Kedua LANGSA (Waspada) : STAIN Zawiyah Cot Kala Langsa menduduki peringkat kedua nasional dari jumlah peserta Seleksi Penerimaan Mahasiswa Baru(SPMB-PTAIN) tahun 2013 dengan jumlah peserta mencapai 1.056 orang. Pada posisi pertama ditempati STAIN Jurai Siwo MetroLampung Metro, dengan jumlah peserta 1.213 calon mahasiswa baru.” Alhamdulillah di antara 53 STAIN se-Indoneisa, kita menduduki peringkat kedua dari jumlah peserta SPMB-PTAIN,” ujar Zainuddin, Pembantu ketua III bidang Kemahasiswaan STAIN Cot Kala di sela-sela pelaksanaan ujian tertulis SPMB, Rabu (26/6) menambahkan, banyaknya calon peserta tersebut membuktikan STAIN Cot Kala sangat diminati sebagai tempat melanjutkan studi jenjang S1 di pesisir timur Aceh. Banyaknya peserta tersebut, menurut Zainuddin, juga dipengaruhi oleh kebijakan STAIN Cot Kala yang tahun ini menambah empat Program Studi (Prodi) baru yang sangat banyak diminati seperti Prodi Perbankkan Islam dan Bimbingan Dan Konseling. (b22)

Tuan Rumah Curi Perhatian IDI (Waspada): Penampilan tuan rumah pada perlombaan pidato dalam Bahasa Arab sempat mencuri perhatian pengunjung di halaman Komplek Darussa’adah Cabang Idi Cut, Selasa (25/6) malam. Penampilan ahlil bait (tuan rumah) tingkat cabang itu dalam rangka mengisi berbagai kegiatan dalam rangka Haul Darussa’adah ke-45 yang dipusatkan di Komplek Darussa’adah Cabang Idi Cut, Desa Seuneubok Aceh, Kecamatan Darul Aman, Kabupaten Aceh Timur. Judul pidato Ruslan adalah ‘Islam Merupakan Agama Penyelamat Umat’. Isi pidatonya terkait agama Islam yang dibawa Nabi Muhammad SAW merupakan agama Islam yang suci dan tidak ada agama lain yang mampu menjaga keselamatan umatnya, baik dunia ataupun di akhirat. Ribuan pengunjung malam itu tampak memperhatikan gaya dan mimik pidatonya Ruslan, bahkan saat Ruslan menyelesaikan pidatonya disambut sorak dan teriakan dari pengunjung, meskipun isi pidato Arab Ruslan kurang dipahami masyarakat awam. “Luar biasa, ini luar biasa,” kata salah seorang pengunjung yang berdiri persis di kiri rimbun arena utama. Sekum Haul Darussa’adah Sabaruddin, Rabu (26/6) mengatakan, peringatan haul setelah dibuka Bupati Aceh Timur berjalan lancar hingga sore ini, kemarin. ‘Acara perlombaan sudah kita serahkan ke seksi perlombaan dan kegiatannya kita melihat makin seru, bahkan seluruh kontingen ikut menyaksikan berbagai kegiatan lomba yang dipusatkan di arena utama seperti MTQ Cabang syarhil quran, tilawah dan pidato dalam tiga bahasa. (b24)

Waspada/M Ishak

RUSLAN tampil pada perlombaan dalam rangka memeriahkan Haul Darussa’adah ke-45 seAceh di Komplek Darussa’adah Cabang Idi Cut, Kecamatan Darul Aman, Kabupaten Aceh Timur, Selasa (25/6)

Kamis 27 Juni 2013

BLSM Dinilai Tak Tepat Sasaran

Kafilah Fahmil Aceh Timur Ke Semi Final

JULOK (Waspada): Ikatan Keluarga Besar Istri (IKBI) karyawan KSO PTPN-I dan PTPN-III unit Kebun Julok Rayeuk Seletan (KJLRS) menggelar khitanan massal bagi puluhan anak yang berdomisili di gampong Julok Seulatan, Kecamatan Indra Makmu, Kabupaten Aceh Timur. Manajer Kebun KSO Julok Rayeuk Selatan Seno Adji melaui Humasnya Sartim, Rabu (26/6) di sela-sela kegiatan tersebut mengatakan, khitan massal itu program dari IKBI dan SPBUN, serta harapannya dapat dilaksanakan setiap tahun. “Kegiatan khitan massal ini diadakan sebagai bentuk kepedulian dan solidaritas terhadap lingkungan di Kebun Julok Rayeuk Selatan,” ungkapnya. (cri)

WASPADA

Waspada/M Ishak

BUPATI Aceh Timur Hasballah M Thaib bersama Kepala Kantor PosIdi Rayeuk, Khalifuddin menghentikan penyaluran KPS dan menariknya dari masyarakat.

Dua Kandidat KNPI Aceh Saling Klaim Jamal Di Atas Angin BANDA ACEH (Waspada): Dua kandidat Ketua DPD KNPI Aceh saling klaim mendapat dukungan mayoritas. Kubu Fakhrizal Murfy mengklaim sudah didukung lebih 50 persen. Saingan kuat Fakhrizal, yakni Jalamuddin Jamil dilaporkan hingga kemarin masih di atas angin. Dukungan kepada Jamal terus mengalir untuk memenangi perebutan kursi puncak di KNPI Aceh itu. Amri M Ali, Tim Ses Pemenangan Fakhrizal Murphy mengatakan, dukungan untuk Fakhrizal Murphy sebagai Ketua KNPI Aceh sudah mencapai 50 persen. “Kami optimis Fakhrizal Murphy mendapat suara terbanyak dalam Musda pada 28-29 Juni mendatang,” katanya. Kata dia, Fakhrizal akan mengusung visi membangun karakter pemuda Aceh berbasis wirausaha (enterpreuneurship), dan merubah makna KNPI yang selama ini dianggap sebagai OKP. “Seharusnya KNPI sebuah lembaga yang menjadi wadah untuk mengubah maindset pemuda menjadi wirausahawan untuk kemajuan pemuda Aceh,” kata Amri M Ali seraya menyebut, Kamis hari ini (red)

akan diselenggarakan deklarasi Fakhrizal Murphy sebagai calon ketua KNPI Aceh di Sultan Hotel. Syamsul Bahri, Ketua Timses Jamaluddin Jamil, haqul yakin calon yang diusungnya mendapat dukungan mayoritas peserta Musda. Sebab, visi dan misi Jamal sama dengan visi sebagian besar OKP yang intinya ingin membawa perubahan dan warna baru di KNPI ke depan.“Jamal, figur muda yang belum terkontaminasi dengan masalah-masalah politik dan lainnya. Karena itu di tangan Jamal KNPI Aceh akan bisa jauh lebih baik lagi,” tegasnya, ketika memberi sambutan dukungan saat deklarasi untuk Jamaluddin Jamil. Hingga kemarin, dukungan untuk Jamaluddin jamil terus mengalir. Ketua KNPI Aceh Selatan dan KNPI Pidie memberi dukungan penuh kepada Jamal. Bahkan Fadlullah, Ketua terpilih KNPI Pidie, kemarin menyatakan akan bekerja all-out dan melobi OKP-OKP untuk kemenangan Jamal. Begitu juga Zerhan, Ketua KNPI Aceh Selatan yang siap bekerja maksimal di arena Musda demi terpilihnya Jamal. Dukungan untuk Jamal juga disampaikan Bupati Pidie Sarjani Abdullah.“Saya minta kawankawan OKP memberikan dukungan kepada Jamal,” kata Bupati pada pelantikan Ketua KNPI Pidie, kemarin.

Kamaruddin Abubakar alias Abu Razak,Wakil Ketua KPA Pusat mendukung penuh Jamaluddin menjadi Ketua DPD KNPI Aceh. “Kemajuan Aceh di tangan pemuda, oleh karena itu KNPI harus bisa bersinergi dengan pemerintah Aceh dalam membangun Aceh,” ujarnya. Figur Jamal, selama ini bisa diterima banyak kalangan, tidak kecuali dari kalangan PA dan KPA Aceh. Dukungan untuk Jamaluddin sebelumnya dilaporkan datang dari 3 OKP Islam yakni NU, Muhammadiyah dan Alwasliyah yang memiliki 15 suara. Dari OKP lainnya sebanyak 14 suara, selanjutnya dari OKP “kuning” yang merupakan sayap partai Golkar dikabarkan juga memberi maksimal dari 15 suara yang ada. Berikutnya dukungan mengalir dari suara wakil KNPI kab/kota, setidaknya delapan kab/kota sudah final dan menyatakan siap memenangkan Jamaluddin. Ditambah lagi dukungan dari KNPI Aceh Selatan dan Pidie yang kemarin selesai menggelar Musda lokal. Kandidat Ketua KNPI Aceh, kemarin melakukan tes baca Alquran di kantor KNPI Aceh, kawasan Beurawe Banda Aceh, sebagai prasyarat bisa maju sebagai calon dan kedua kandidat yakni Fakhrizal Murfy dan Jamaluddin Jamil dinyatakan lulus. (b01/cb01)

Segera Tangkap Dalang Pembunuhan Sejumlah Tokoh Aceh ACEH BESAR (Waspada) : Dr Husaini Hasan, Menteri Pertahanan GAM di luar negeri yang pernah diklaim MP GAM oleh sekelompok orang saat Aceh masih konflik dulu, meminta penegak hukum untuk segera menangkap dalang pembunuhan sejumlah tokoh Aceh yang telah diketahui oleh publik. Supaya hal itu menjadi jelas dan terungkap kebenaran yang sebenarnya kepada rakyat Aceh serta dunia internasional. “Rakyat Aceh sudah bertanya-tanya mengapa dalang yang membunuh tokoh Aceh termasuk mantan petinggi GAM, masih dibiarkan berkeliaran di Aceh. Malahan yang lebih ganjil lagi dia juga yang mendalangi pemimpin Aceh sekarang ini sehingga masyarakat Aceh terluka hatinya, apalagi yang dia lakukan adalah untuk pribadi dan kelompoknya,” katanya melalui orang yang mengaku namanya Waled Batee Iliek dan Abu Bireuen, Rabu (26/ 6) via telepon selular. Menurut Husaini Hasan sebagaimana disampaikanWaled batee Iliek dan Abu Bireuen, dalang pembunuhan sejumlah tokoh Aceh sejak masa konflik hingga sekarang ini adalah berinisial Mal bersama Zak dan telah diungkap ke permukaan dan diketahui publik, bahkan pernah secara vulgar disampaikan namanya lengkapnya oleh beberapa sumber. Namun, anehnya karena kasus yang dilakukan telah banyak menghilangkan nyawa orang lain, mengapa masih dibiarkan melanggang kangkung di Aceh tanpa ada tanda-tanda akan diproses sesuai hukum yang berlaku di negara ini. “Kasus ini harus segera diungkap dan segera menangkap pelakunya supaya masyarakat Aceh tahu semuanya termasuk masalah pemerintahan Aceh yang sekarang ini,” tegasnya. Para tokoh Aceh yang telah dibunuh antara lain, Safwan

Idris, Dayan Dawood, Teungku Nashruddin Daud dan Jakfar Siddik. “Pembunuhan Safwan Idris, 16 September 2000, jelasjelas dalangnya dia, namun tidak diketahui ayahnya Tgk Idris, sehingga pada saat pulangnya Mal dari luar negeri, Tgk Idris ayah dari almarhum Safwan juga yang peusijuek (menepungtawari),” ungkapnya. Kemudian, Mal dan Zak juga yang mengotaki pembunuhan Dayan Daud, 6 September 2001 lalu dengan cara memerintahkan pasukan Katak Kijau Pidie. Seterusnya, keduanya juga yang memerintahkan membunuh Jafar Sidiq di Medan, dituduh ada hubungan dengan MP-GAM, pimpinan Husaini Hasan. Lalu, mengotaki pembunuhan Tengku Nashruddin Daud, anggota DPRD Aceh Selatan, dituduh tak menyukai pemimpin GAM. Selanjutnya mengotaki pembunuhan Ismail Shah Putra, sesudah mengirim miliaran rupiah ke rekening abangnya Amir Mahmud di Singapura. Kemudian mengotaki pembunuhan Brigjen HT Johan, mantanWagub dan otak pembunuh Zaini Sulaiman, anggota DPRD Aceh. Lalu mengotaki pembunuhan atas Tengku Usman Pasie Lhok dan Tengku Wabah di Sungi Cincin, Gombak Malaysia, dengan cara dituduh rapat dengan MP-GAM dan MBGAM. Eropa. Mengotaki pembunuhan Iftah Habib danWin Zuhdi Banta Mude yang dibunuh oleh Ilh Lb dkk setelah mengirim Rp2 miliar ke rekening abangnya Amir Mahmud di Singapura dan 1999 Mal dan Zak memerintahkan pasukan TNA untuk menghabisi semua anggota DPR dan pejabat di Aceh yang dianggap pro Indonesia dan tidak membantu perjuangan GAM. Memerintahkan panglima wilayah Pidie untuk mengu-

cilkan Abdullah Syafii dan tidak dibolehkan mengawalnya setelah dituduh memberi komentar salah kepada Bondan Gunawan sehingga ditembak pasukan Indonesia tanpa pengawalan pasukan GAM, pengawal rekan setia dan istrinya. Kemudian keduanya juga mencopot jabatan panglima wilayah Peureulak dari Ishak Daud dan melucuti senjata dari pasukan Ishak Daud karena dituduh sering memprotes kebijakan Mal. “Saya harap informasi ini dapat menjadi bahan masukan untuk semua bangsa Aceh untuk dapat melihat siapa sebenarnya Ma dan Zak itu,” katanya seraya mengatakan, silakan baca sendiri di website The Government of Independen Acheh Sumatera atau di milis IACSF, agar terbaca utuh rilis tersebut,” katanya. Dikatakan, apa yang diungkapkan ini sebenarnya sudah lama dibeberkan sejumlah masyarakat. Namun, dilihatnya sampai sekarang belum ada tindaklanjut dan juga si tersangka terkesan makin bertambah-tambah arogan dan ulahnya, termasuk ada kabar bahwa kantor Wali Nanggroe dilarang foto. Padahal, bangunan tersebut dibangun dengan uang rakyat dan berhak diketahui keberadaannya oleh rakyat. Husaini Hasan mengatakan, perjuangan gerakan yang bisa jadi sebagai tandingan Gerakan Aceh Merdeka di bagian header, terdapat lambang buraq singa (lambang Gerakan Aceh Merdeka) dan di bawahnya tertulis ‘The Government of Independent Acheh Sumatera’. Di bagian header juga terdapat foto gerakan Referendum 8 November 1999 serta sejumlah random terkait konflik Aceh. Penjelasan soal lambang buraq singa bisa kita dapatkan di menu ‘Acheh’. Gerakan ini mengakui jika lambang buraq singa ini digagas oleh Teungku Hasan Tiro. (tim)

ke bupati,” katanya. Oleh karenanya, dia akan menyurati seluruh Kantor Pos untuk segera menarik seluruh KPS yang sudah dibagi ke masyarakat. “Tidak ada alasan, pembagian KPS harus dihentikan dan yang sudah terlanjur dibagi harus ditarik,” katanya. Kepala Kantor Pos Idi Rayeuk, Khalifuddin mengatakan, pihaknya telah menyalurkan 1.000 KPS, namun sekitar 100 KPS dikembalikan dari Gampong Tanoh Anoe, Kecamatan Idi Rayeuk. “Tanoh Anoe mengembalikan, karena calon penerima BLSM ini dinilai tak layak oleh aparatur desa,” katanya. Ketika singgung jumlah calon penerima, Khalifuddin menyebutkan 3.026 khusus dalam empat kecamatan yakni Darul Ihsan, Idi Timur, Peudawa dan Kecamatan Idi Rayeuk. Keuchik Gampong Tanoh Anoe, Iswandi menjelaskan, pihaknya telah menarik 100 KPS, hal itu dilakukan menyusul banyak masyarakat yang dinilai tak layak menerima, bahkan ada KPS yang ditujukan kepada orang-orang yang sudah meninggal. (b24)

Pilkades Matangweng Cacat Hukum SIMPANG ULIM (Waspada): Proses pemilihan kepala desa (Pilkades) Matangweng, Kec. Simpang Ulim, Aceh Timur, yang pemungutan suaranya dilakukan 20 Juni 2013, dinilai cacat hukum. “Prosesnya tidak sesuai Qanun Aceh Nomor 4 Tahun 2009, tentang tata cara pemilihan dan pemberhentian geuchik. Itu sebabnya, hasil pilkades itu harus dibatalkan, lalu digelar pilkades ulang,” kata Zulkifli, kandidat yang kalah dalam pilkades tersebut. Zulkifli merincikan kejanggalan paling nyata dalam proses pilkades Matangweng, menyangkut syarat pendidikan minimal bagi bakal calon keuchik. Kandidat terpilih, A Munir, diduga tidak memiliki ijazah atau surat tanda tamat belajar (STTB). A Munir hanya melampirkan fotocopy surat kehilangan ijazah yang ditandatangani kepala sekolah. “Padahal, dalam Qanun Aceh nomor 4 Tahun 2009, Pasal 13 huruf e dan Pasal 15 ayat 2 huruf h, jelas disebutkan, bakal calon keuchik harus berpendidikan paling rendah SMP sederajat, dibuktikan dengan STTB. Lalu, bakal calon keuchik juga harus melampirkan fotocopy ijazah yang dilegalisir, dalam surat permohonan menjadi bakal calon keuchik. Artinya, ijazah atau fotocopy ijazah tidak bisa digantikan dengan surat kehilangan ijazah,” kata Zulkifli. Pria ini mengaku baru tahu soal surat kehilangan ijazah dari lawan politiknya itu setelah pemungutan suara selesai. Sebelumnya, Zulkifli sempat meminta fotocopy berkas tersebut dari Panitia Pemilihan Keuchik (P2K), tapi tidak dikasih. “Surat kehilangan ijazah itu dikeluarkan oleh SMPN 2 Lhokseumawe, 10 Januari 2013. Surat ditandatangani kepala sekolah, Hj Sri Aryati dan turut diketahui Kadis Pendidikan Pemuda dan Olahraga Lhokseumawe A Madjid. Isinya menerangkan, A Munir, tamatan Sekolah Menengah Ekonomi Pertama (SMEP—Nama lama SMPN2 Lhokseumawe) tahun 1970. Ijazahnya hilang Desember 2012 di sekitar Kota Lhokseumawe. Anehnya, nama dalam surat itu Munir saja, bukan A Munir,” ujar Zulkifli. Kejanggalan lain, lanjut Zulkifli, kandidat terpilih yang merupakan incumbent atau keuchik yang mencalonkan diri untuk kedua kalinya, juga diduga tidak sedang cuti atau non aktif, sebagaimana diatur dalam Pasal 16 Qanun Aceh Nomor 4 Tahun 2009. “Dalam pasal itu disebutkan, keuchik yang ingin mencalonkan diri kedua kalinya, wajib menjalani cuti berdasarkan izin dari bupati dan pada saat bersamaan bupati menunjuk sekdes sebagai pelaksana tugas (Plt). Tapi, kenyataan-

nya, sampai dua hari menjelang pemungutan suara, Sekdes belum menerima SK Plt. Ini mengindikasikan, SK cuti untuk A Munir belum turun. Sebab, SK Plt dan surat non aktif, dikeluarkan secara bersamaan,” paparnya. Camat Simpang Ulim, Lukman SP mengatakan, sejauh yang ia pahami, surat keterangan kehilangan ijazah milik A Munir bisa dianggap sebagai pengganti ijazah. “Soal keabsahan, itu bukan wewenang kita. Tapi secara logika, surat itu membuktikan yang bersangkutan pernah punya ijazah,” katanya. Sedangkan menyangkut surat non aktif dan SK penunjukan Sekdes sebagai Plt, , P2K tetap bisa melaksanakan proses tahapan Pilkades, meski surat nonaktif keuchik (incumbent) dan SK Plt belum turun. Sebab, kandidat incumbent juga turut meneruskan surat permohonan cuti kepada P2K. “Kita sebenarnya sudah jauh hari mengirim berkas itu ke tingkat kabupaten. Tapi, yang namanya birokrasi, prosesnya tidak bisa cepat. SK non aktif dan SK penunjukan Plt baru kita ambil pada hari H (pemungutan suara). SK non aktif untuk A Munir sudah kita kasih. Sementara SK Plt saya kurang tahu apakah sudah diambil oleh sekdes atau belum, karena SK itu dipegang Kasi Pemerintahan,” katanya. Sekretaris P2K Matangweng, Syarbaini membantah pihaknya tidak mengizinkan Zulkifli melihat Surat Keterangan Kehilangan Ijazah milik A Munir sebelum pemungutan suara. “Hanya saja, fotocopynya ketika itu belum bisa kita kasih, karena memang belum difotocopy,” tutur Syarbaini. Meski demikian, ketika ditanya soal terusan surat permohonan non aktif dari A Munir, Syarbaini mengaku ragu-ragu apakah surat itu ada atau tidak. “Sang, hana (sepertinya tidak ada),” kata Syarbaini seraya menjelaskan, selisih suara antara A Munir dan Zulkifli, hanya 3 suara. A Munir meraup 119 suara. Sementara Zulkifli 116 suara. Sekdes Matangweng, Mahdi, yang juga ditemui terpisah menyatakan, sepengetahuan dirinya, kandidat keuchik terpilih, A Munir, sampai kemarin belum non aktif dari jabatan lamanya sebagai Keuchik Matangweng. “Sekitar 20 hari sebelum pemungutan suara, saya mempertanyakan hal itu pada Kasi Pemerintahan, Pak Murni. Ketika itu, Pak Murni, bilang A Munir belum non aktif dan kalau sudah non aktif pihak kecamatan pasti memanggil saya. Lalu, dua hari menjelang pemungutan suara, hal itu saya tanya ulang. Pak Murni juga bilang SK non aktif belum turun, tapi usulannya sudah dikirim ke kabupaten,” papar Mahdi. (b19)

Kasus CPNS K-1 Langsa Terkesan Dipaksakan tidak cukup bukti untuk LANGSA (Waspada): Terdisidangkan. kait kasus persidangan peneBegitu juga hasil keterangan rimaan CPNS honor kategori saksi ahli Ojak Murdani yang I (K-1) yang menimpa Kepala ditunjuk sebagai ketua TimVerBadan Kepegawaian Pelatifikasi dan Validasi Tenaga Hohan dan Pendidikan (BKPP) norer K-I Pusat, bahwa BKPP Kota Langsa Syahrul Thaib, Kota Langsa hanya mengumKabid Pengembangan, Zulfipulkan berkas dan data-data, qar SP, Kasubbid Formasi dan selanjutnya tim pusat yang meRekrutmen, Muhammad Rilakukan verfikasi dan validasi zal, yang saat ini sedang berdata-data dan bahan tersebut. gulir di Pengadilan Negeri Kemudian, dalam keteraLangsa sejak dibacakan surat ngan itu bahwa verifikasi dan dakwaan Jaksa Penuntut Muslim A Gani, Penasihat validasi serta bisa atau tidaknya Umum (JPU) tanggal 20 JaHukum Syahrul Thaib tenaga honorer masuk ke dalam nuari 2013 terkesan dipaksadatabase adalah tim pusat dan kan oleh pihak kejaksaan. Demikian dikatakan penasihat hukum BKN pusat. Setelah menjadi daftar nominatif, Syahrul Thaib, Muslim A Gani yang juga advokat maka hasil verifikasi dan validasi ini tim yang dari Acheh Legal Consult kepada wartawan, melaporkan ke BKN pusat setelah itu BKN pusat mengeluarkan listing daftar no-minatif tenaga Rabu (26/6). Menurutnya, dari seluruh keterangan saksi honorer K-I yang akan diusulkan kembali untuk yang dihadirkan di Pengadilan Negeri Langsa menjadi CPNS. Daftar nominatif ini harus tidakberkualitasdantidaklayakditampilansebagai dilakukan uji publik terlebih dahulu sebelum saksi. Karena dari seluruh keterangan saksi, tidak diusulkan kembali ke BKN pusat. Jadi yang bertanggungjawab verifikasi dan ada hubungan atau keterkaitan satu yang lain denganperkarayangsedangdisidangkan.Bahkan, validasi serta penerbitan listing nominatif adalah tidak ada keterangan dakwaan yang menjurus BKN pusat melaluli tim yang sudah diberi tugas. Jadi tidak ada sangkut pautnya dengan BKPP ke Syahrul Thaib dan kawan-kawan. “Kasus ini terlalu prematur untuk diangkat Kota Langsa.“Jika melihat keterangan itu, dak-waan dalam sebuah kasus. Melihat alat bukti dan kete- yang dipersidangkan ini telah keliru. Kalau dakwaan rangan saksi-saksi tidak ada satu pun yang me- itukeliru,tuntutanyangdilayangkankepadaSyahrul Tahib dan kawan-kawan itu batal demi hukum. ngarah ke Syahrul Thaib,” katanya. Dijelaskan, peradilan itu terkesan dimain- Lantas para terdakwa harus dibe-baskan dari segala kan oleh orang-orang yang memiliki kepenti- tuntutan hukum,” kata Muslim. Ketua Pengadilan Negeri Langsa Efendi, mengan terhadap terdakwa. Tapi saya yakin dan percaya, Ketua Majelis Hakim Langsa, Efendi, ngatakan, kasus ini masih dalam proses persangat jeli, arif dan objektif melihat kasus ini. sidangan dengan agenda persidangan pemeApalagi, sejak awal pemeriksaan Berita riksaan saksi silang. “Menyangkut kasus ini yang Acara Pemeriksaan (BAP) di kepolisian yang sudah relatif lama sejak dibacakan surat dakwaan terkesan dipaksakan hingga ke pihak kejaksaan, para terdakwa, makanya kita buat persidangan yang seharusnya menolak kasus itu. Seharusnya seminggu dua kali agar segera bisa diputuskan berkas itu tidak dibawa ke pengadilan, karena kasus ini,” katanya. (m43)

RS Rehab Medik Belum Layani Pasien Askes IDI (Waspada): Meskipun usianya sudah tiga tahun, namun Rumah Sakit Rehap Medik Peureulak di Gampong Lhok Dalam, Kecamatan Peureulak, Kabupaten Aceh Timur hingga hari ini belum bisa melayani pasien Asuransi Kesehatan (Askes). Ketua Komite Kesehatan Peureulak Barat Anwar Abda mengatakan, banyak keluhan dari masyarakat ataupun keluarga pasien yang berobat ke RS Rehab Medik, sebab instansi kesehatan itu belum bisa melayani pasien yang menggunakan jasa PT Askes. “Kita menyesalkan kondisi ini, padahal RS Rehab Medik sudah setingkat dengan RSUD, apalagi tergolong lengkap ber-

bagai fasilitas dan peralatan medis dan sumber daya yang memadai,” katanya. Direktur RS Rehab Medik Alamsyah membenarkan RS Rehab Medik belum bisa melayani pasien yang menggunakan Askes bagi PNS. “Sedangkan untuk pasien yang menggunakan asuransi JKA dan Jamkesmas sudah bisa,” katanya seraya mengaku, ketiadaan layanan Askes karena PT Askes belum melakukan rekomendasi. “PT Askes menganggap RS Rehab Medik belum memenuhi syarat untuk melayani pasien Askes, karena belum memiliki ruang rawat inap,” kata Alamsyah. (b24)

Waspada, kamis 27 juni 2013  
Read more
Read more
Similar to
Popular now
Just for you