Issuu on Google+

Harga Eceran Rp2.500,-

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) KAMIS, Pahing, 20 September 2012/4 Zulqaidah 1433 H


AKSI PILKADA JAKARTA: Seorang warga menggunakan kostum Solo Batik Carnival melakukan aksi dukungan terhadap terselenggaranya PIlkada DKI Jakarta dengan aman dan lancar di Solo, Jateng, Rabu (19/9).

No: 23988 Tahun Ke-66

Terbit 24 Halaman (A1-12, B1-12)

Hari Ini Pilkada DKI

Survei: Jokowi Menang JAKARTA (Waspada): Lembaga Riset Kebijakan Otonomi Daerah atau Rekode mengisyaratkan dalam surveinya pasangan Jokowi-Ahok menang dalam pemilihan putaran II yang akan digelar pada hari ini (Kamis, 20/9).


MOHON RESTU IBU: Walikota Solo, Joko Widodo memohon doa restu kepada ibunya sebelum berangkat mengikuti Pilgub DKI Jakarta di Sumber, Solo, Jateng, Rabu (19/9).

Konsulat AS Di Medan Tutup MEDAN (Waspada): Amerika Serikat menutup sementara konsulatnya di Medan, Rabu (19/9), setelah perwakilan pemerintah AS di Medan, itu terus-terusan didemo massa, terkait film ‘Innoncence of Muslims’ yang menghina Nabi Muhammad SAW yang diproduksi di Amerika Serikat. The Associated Press melaporkan Kedutaanbesar AS telah mengirimkan pesan itu kepada semua warga AS dengan mengatakan Konsulat AS di Medan akan ditutup sementara karena adanya unjukrasa tersebut. Waspada yang menghubungi Dian Lumbantoruan, salah seorang staf Konsulat AS di Medan mengatakan, pihaknya tidak ada keterangan resmi saat ini. Mungkin itu saja yang dapat kami sampaikan’. Demo HTI dan IMM Aksi demo memprotes Amerika Serikat di Medan terkait film Innocence of Muslims terus berlanjut. Rabu (19/9) pagi, massa dari Hizbut Tahrir Indonesia (HTI) dan Ikatan Mahasiswa Muhammadiyah (IMM)

Lanjut ke hal A2 kol. 2

Meski ada pengaruh suku, agama, ras dan antargolongan (SARA) yang melibatkan H. Rhoma Irama beberapa waktu lalu yang mencapai 27 persen di kalangan masyarakat bawah, namun jika keterlibatan pemilih mencapai 60 persen, maka SARA tidak berpengaruh dan Jokowi-Ahok dipastikan tetap menang. Demikian diungkapkan Yunandar (Rekode) dan Dolfi (FPDIP) dalam keterangan persnya di Gedung DPR RI Jakarta, Rabu (19/9). Tapi, kalau keterlibatan atau kedatangan masyarakat pemilih itu mencapai 100 persen dan itu mayoritas warga yang terpengaruh

SARA tersebut, maka ada kekhawatiran sekaligus menjadi ancaman bagi kemenangan Jokowi-Ahok. Karena itu, pihaknya berharap kalangan menengah ke atas jumlahnya lebih besar dalam keikutsertaan dalam pemilihan hari ini. Metodologi survei dilakukan di wilayah Jakarta pada warga yang berusia di atas 17 tahun, yang mempunyai hak pilih. Sampel survei dilakukan terhadap warga yang masuk dalam daftar pemilih tetap (DPT) 2012, sebanyak 400 responden di 42 kelurahan pada 11 September 2012. Dengan

Lanjut ke hal A2 kol. 4


TERIMA KARTU PEMILIH: Gubernur DKI Jakarta Fauzi Bowo bersama istrinya Sri Hartati Fauzi Bowo (kanan) menunjukkan undangan disaksikan Ketua KPPS W Soehadi (kiri) saat penyerahan undangan dan kartu pemilih di rumah dinas Gubernur, di Jakarta, Rabu (19/9).

Emas Sepakbola Tertunda PEKANBARU (Waspada): Kekalahan tim Sumatera Utara (Sumut) 1-0 dari Kalimantan Timur (Kaltim) pada

babak final cabang sepakbola Pekan Olahraga Nasional (PON) XVIII/2012 di Stadion Kaharudin Nasution, Pekanbaru, Rabu

(19/9) malam, disambut haru insan olahraga Sumut. Pasalnya, perjuangan tim besutan pelatih Rudi Saari

dianggap sudah cukup maksimal, meski keberuntungan belum berpihak. Pertandingan di partai puncak ini sejak

laga dimulai berjalan alot. Namun serangan demi serangan kedua tim gagal menghasilkan gol hingga laga ter-

Waspada/Arianda Tanjung

ANGGOTA tim sepakbola Sumut tetap bangga mendulang medali perak PON 2012 setelah dikalahkan Kaltim 0-1 di Stadion Kaharudin Nasution, Pekanbaru, Rabu (19/9) malam.

paksa diteruskan ke babak extra time. Di sini Sumut mampu membangun serangan hingga hampir membuahkan gol pada menit 95. Namun serangan Muhammad Irfan membentur mistar gawang kiper Dwi Yuda Pratama. Akhirnya Kaltim mampu menciptakan gol pada akhir pertandingan tersebut sekaligus gol kemenangan yang dicetak Loudry Mailana. Di sisa waktu, Sumut berusaha membalas, namun usaha Safri Koto cs belum berhasil. Alhasil, Kaltim berhak membawa meraih medali emas sepakbola disusul Sumut yang harus puas dengan medali perak. Sebelumnya, medali perunggu diperoleh Jawa Tengah yang menang 1-0 atas Papua. Usai menyaksikan perjuangan anak-anak Sumut, Gatot Pudjo Nugroho bersama sejumlah petinggu Sumut lainnya menyatakan tetap mengapresiasi tim sepakbola Sumut.

Lanjut ke hal A 1 2 kol. 4

Beredar Sayembara Penangkapan Presiden SBY JAKARTA (Antara): Pemerintah Inggris telah menjamin keamanan dan keselamatan Presiden Susilo Bambang Yudhoyono (SBY) saat memenuhi undangan Ratu Inggris bulan Oktober mendatang menyusul munculnya rumor sayembara penangkapan Presiden di Inggris, kata Juru Bicara (Jubir) Presiden, Julian A Pasha. Julian menyampaikan pernyataan itu di Jakarta, Rabu (19/9) menanggapi berita yang menyebutkan seorang bernama Ed Mc Williams yang mengaku sebagai aktivis The West Papua Advocacy Team (WPAT) menawarkan hadiah 80.000 dolar AS (sekitar Rp790 juta) bagi warga Inggris yang bisa menangkap Presiden Yudhoyono ketika mengunjungi Inggris. “Kami juga mendapat jaminan dari polisi Inggris Raya bahwa hal-hal itu tidak akan terjadi dan dijamin sepenuhnya oleh pemerintah Inggris,” kata Julian. Julian mengatakan, informasi yang beredar mengenai

Lanjut ke hal A2 kol. 2

Gatot Minta Calhaj Fokus Suara Ondim Dan Sutan Meningkat Hasbullah Hadi Tercatat Di PKS MEDAN (Waspada): Posisi Chairuman dalam bursa kupon PAPS (Partai Apa Pilih Siapa) Rabu (19/9) sedikit melemah di Partai Golkar dan PAN, namun tetap bertahan di PDI Perjuangan. Jika sebelumnya pendukung Chairuman mengharapkan Partai Golkar mencalonkannya sebagai Balon Gubsu

dengan persentase 93% maka kemarin jadi 90%, dukungan untuk Gus Irawan naik dari 7% menjadi 8%, sedangkan pendatang baru di Partai Golkar Amri Tambunan 2%. Begitu pula di PAN, nama Chairuman juga melemah. Jika sebelumnya 95% pendukung anggota DPR-RI itu meminta PAN mencalonkannya sbg

Balon Gubsu mencapai 95%, maka kemarin suara itu merosot menjadi 86%, suara untuk Syah Afandin alias Ondim meningkat dari 5% menjadi 14%. Sedangkan pertarungan di Partai Demokrat juga mengalami fluktuasi, Amri Tambunan sebelumnya 46% menjadi 40%,

Lanjut ke hal A2 kol. 2

MEDAN (Waspada) : Asrama Haji Embarkasi Medan sejak Kamis (20/9) hari ini siap mengantar keberangkatan para calon haji Sumut ke tanah suci Makkah, dimulai kelompok terbang (Kloter) 1 sampai 19. Kedatangan para Calhaj disambut dengan baik dan fasilitas yang disiapkan secara khusus sebelum bertolak ke tanah suci dari Bandara Polonia Medan. ‘’ Semoga para Calhaj yang berangkat ke Tanah Suci dengan selamat, dan kembali ke Tanah Air menjadi haji mabrur,’’ demikian disampaikan Kepala Kantor Kementerian AgamaWilayah Sumut sekaligus ketua Panitia Penyelenggara Ibadah

Haji (PPIH) Embarkasi Medan, Drs H. Abd Rahim M.Hum. Abd Rahim bersama Sekretaris Drs Abd Rahman Harahap MA dan Kordinator Humas Drs HM Sazli, Rabu (19/9), meninjau langsung per-siapan Asrama Haji Embarkasi Medan. Hadir Plt Gubsu H Gatot Pudjo Nugroho, Ketua MUI Sumut Prof HM Abdulah Syah MA serta undangan. Abd Rahim menyebutkan, persiapan yang dilakukan seluruh petugas di Asrama Haji telah optimal dalam rangka memberikan pelayanan terbaik bagi Calhaj yang akan berangkat pada musim haji tahun ini. Lanjut ke hal A2 kol. 2

Waspada/Surya Efendi

PLT Gubsu H Gatot Pujo Nugroho, ST didampingi Ka Kanwil Kemenag Sumut Drs H Abdul Rahim, MHum dan pejabat lainnya meninjau kesiapan Asrama Haji Pangkalan Masyhur Medan menyambut kedatangan jamaah calon haji, Rabu (19/9). Kloter I asal Medan masuk asrama hari ini.

Aseng Komit Ada-ada Saja Menangkan Ditembak Hewan Dedi-Affan Kesayangan DUA pria di tempat ber-

Al Bayan

Syi’ah Ghullah Oleh Tgk H Ameer Hamzah Syiah ghullah sudah di luar Islam. Mereka itu ditunggangi oleh Yahudi dan musuh-musuh Islam lainnya. Umat Islam harus menjauhi mereka. Ghullah itu ibarat kanker dari tubuh Islam. (Prof Dr Ihsan Ilahi Dzahir). PENGARANG buku “Bahaya Syiah” Prof Dr Ihsan Ilahi Dzahir mengatakan: SYI’AH adalah aliran sempalan yang lahir dari Islam. Pada mulanya syiah hanya sebuah gerakan politik yang berpihak kepada Ali bin Abi Thalib. Masa itu Syiah masih murni aqidah dan syariahnya. Tidak ada perbedaan sedikitpun dengan kaum muslimin lainnya. Selanjutnya, Ihsan Ilahi Dzahir mengatakan; Paham Syiah mulai menyimpang setelah gerakan ini ini disusup oleh kaum Yahudi dan Majusi yang pura-pura masuk Islam. Mereka membawa paham agama lamanya dalam Islam. Salah seorang tokoh Yahudi yang sangat berjasa merusak

Lanjut ke hal A2 kol. 3


MIAMI SEPERTI KOTA MATI: Krisis ekonomi di Amerika Serikat berdampak kepada kota wisata terkenal Miami Beach, negara bagian Florida. Kota itu seperti kota mati tanpa lalu lalang turis mancanegara di tepi pantai maupun di jalan. Bukan hanya berdampak pada wisata, tapi juga maskapai penerbangan American Airlines menyatakan bangkrut dan akan memberhentikan 11.000 karyawannya dalam waktu dekat, meskipun pesawat itu mengangkut penuh penumpang dari ibukota AS, Washington DC, ke Miami, Selasa (18/9). Tampak pada gambar, pantai Miami Beach sejajar jalan Collins Ave tampak sepi seperti diabadikan wartawan Waspada, Rabu (19/9).

P. SIDIMPUAN (Waspada): Mardiansyah alias Aseng, seorang Koordinator Kecamatan (Korcam) Tim Pemenangan pasangan calon wali kota dan wakil wali kota Padangsidimpuan nomor urut 4, Dedi Jaminsyah Putra Harahap SSTP. MAP-H. Affan Siregar SE, untuk wilayah Kec. Sidimpuan Utara, dan sempat ‘berpaling’ serta mendeklarasikan diri mendukung pasangan calon lain, kini telah kembali dan komit memenangkan pasangan Dedi-Affan. Aseng menyatakan niatnya yang sempat hendak berpaling ke pasangan calon lain dan menghadiri pendeklarasian peralihan dukungan, itu terjadi

Lanjut ke hal A2 kol. 2

beda ditembak oleh hewan peliharaan mereka sendiri. Seorang pria di Utah, Amerika Serikat, didor anjing kesayangannya di bagian pantat. Sementara, di Prancis, seorang

Lanjut ke hal A2 kol. 2


- He...he...he...

WASPADA Demi Kebenaran Dan Keadilan

KAMIS, Pahing, 20 September 2012/4 Zulqaidah 1433 H z zNo: 23988 * Tahun Ke-66

Terbit 24 Halaman (A1-12, B1-12) z zHarga Eceran: Rp 2.500,-

Survei: Jokowi-Ahok Menang JAKARTA (Waspada): Lembaga Riset Kebijakan Otonomi Daerah atau Rekode mengisyaratkan dalam surveinya pasangan Jokowi-Ahok menang dalam pemilihan putaran II yang akan digelar pada hari ini (Kamis, 20/9). Meski ada pengaruh suku, agama, ras dan antargolongan (SARA) yang melibatkan H. Rhoma Irama beberapa waktu lalu yang mencapai 27 persen di kalangan masyarakat bawah, namun jika keterlibatan pemilih mencapai 60 persen, maka SARA tidak berpengaruh dan Jokowi-Ahok dipastikan tetap menang. Demikian diungkapkan Yunandar (Rekode) dan Dolfi (FPDIP) dalam keterangan persnya di Gedung DPR RI Jakarta, Rabu (19/9). Tapi, kalau keterlibatan atau kedatangan masyarakat pemilih itu mencapai 100 persen dan itu mayoritas warga yang terpengaruh SARA tersebut, maka ada kekhawatiran sekaligus menjadi ancaman bagi kemenangan Jokowi-Ahok. Karena itu, pihaknya berharap kalangan menengah ke atas jumlahnya lebih besar Lanjut ke hal A2 kol 6

Beredar Sayembara Penangkapan SBY


SEORANG warga melintas di dekat mural yang ditempel di dinding jembatan DUkuh Atas, Jakarta, Rabu (19/9). Mural tersebut berisi pesan perdamain bagi kedua calon gubernur yang akan bertarung pada putaran ke 2 Pilkada DKI Jakarta, Kamis (20/9).

JAKARTA (Waspada): Presiden Susilo Bambang Yudhoyono merasa terganggu dengan munculnya berita sayembara penangkapan dirinya. Berita itu beredar luas jelang kunjungan SBY ke Inggris pada Oktober-November mendatang. Juru Bicara Presiden, Julian Aldrin Pasha, mengatakan pihak Istana telah berkomunikasi dengan Kedutaan Besar Inggris di Jakarta terkait berita tersebut. “Terus terang, ini mengganggu hubungan baik kedua negara, ini tidak nyaman bagi kami, perlu diluruskan,” kata Julian di Kantor Presiden, Rabu (19/9). Dia mengatakan, kunjungan SBY ke Inggris yang direncanakan sekitar OktoberNovember itu dalam rangka memenuhi undangan ratu Inggris. Kapasitas SBY dalam kunjungan itu sebagai kepala negara. “Jadi jelas tidak mungkin kepala negara ditahan atau ditangkap,” kata Julian. Keamanan dan keselamatan presiden selama kunjungan di Kerajaan Inggris dijamin sepenuhnya oleh tuan rumah. “Kami juga dapat jaminan dari polisi metropolitan, polisi Inggris Raya bahwa Lanjut ke hal A2 kol 6

Konsulat AS Di Medan Tutup Majalah Prancis Siarkan Kartun Nabi Muhammad PARIS (AP): Prancis meningkatkan pengamanan di sejumlah kedutaanbesarnya Rabu (19/9), setelah satu media mingguan satirikal di Paris menerbitkan karikatur Nabi Muhammad SAW. PM Prancis mengatakan dia akan menghambat unjukrasa oleh orang-orang yang marah atas satu film yang merendahkan Nabi Muhammad SAW dan Islam, pada saat

negeri itu terseret pada perdebatan tentang kebebasan berbicara. Pemerintah membela hak majalah Charlie Hebdo untuk menerbitkan kartun tersebut, yang ingin mengalihkan perhatian dari film The Innocence Muslim, yang diproduksi di AS dan polisi anti huruhara mengambil posisi di luar kantor majalah tersebut, yang dibom tahun lalu setelah

merilis edisi yang mengejek Islam radikal. Film amatiran dari AS itu telah mengundang kemarahan umat Islam dan Dutabesar AS untuk Libya Christopher Stevens tewas dalam kerusuhan di Konsulat AS di Benghazi poekan lalu. Kemlu Prancis mengeluarkan satu peringatan agar Lanjut ke hal A2 kol 2

MEDAN (Waspada): Amerika Serikat menutup sementara konsulatnya di Medan, Rabu (19/9), sehubungan dengan unjukrasa memprotes film yang menghina Nabi Muhammad SAW yang diproduksi di Amerika Serikat. Kira-kira 300 anggota gerakan Islam Hizbut Tahrir berunjukrasa, Rabu pagi di depan Konsulat AS di Medan. Kemudian, kira-kira 50 mahasiswa muslim yang tergabung dalam Ikatan Mahasiswa Muhammadiyah (IMM), menandai hari ketiga protes film antiIslam itu di tempat yang sama. Kedua kelompok pengunjukrasa tersebut menyerukan agar menghukum para pembuat film Innocence of Muslims, yang telah merendahkan Nabi Muhammad SAW.

The Associated Press melaporkan Kedutaanbesar AS telah mengirimkan pesan itu kepada semua warga AS dengan mengatakan Konsulat AS di Medan akan ditutup sementara karena adanya unjukrasa tersebut. Waspada yang menghubungi Dian Lumbantoruan, salah seorang staf Konsulat AS di Medan, mengatakan, “pihaknya tidak ada keterangan resmi saat ini. Mungkin itu saja yang dapat kami sampaikan’’. (m10)

Embarkasi Banda Aceh Siap Terima Tamu Allah Kloter 01 Banda Aceh Dilepas Gubernur BANDA ACEH(Waspada): Embarkasi haji Banda Aceh siap menerima kedatangan jamaah calon haji musim haji tahun 2012 ini. “Seluruh persiapan telah dirampungkan, termasuk visa paspor Calhaj sudah 99 persen selesai diproses,” ungkap Kakanwil Kemenag Aceh Ibnu Sa’dan didampingi Kasubbag

Hukmas dan KUB Juniazi, kepada Waspada, Rabu (19/9). Menurut Ibnu, satu persen lagi paspor Calhaj Aceh yang belum siap dan kini sedang diproses di Jakarta merupakan calhaj kloter terakhir. “Kita berharap dalam waktu dekat, bersamaan dengan keberangkatan kloter awal, visa paspor tersebut telah selesai,” ungkap

Ibnu. Menyangkut dengan sisa kuota Aceh saat batas akhir pelunasan akhir BPIH tahap III, pada(14/9) lalu,sebanyak 14 porsi lagi, kata Ibnu, ke-14 porsi haji untuk Aceh ini seterusnya menjadi kewenangan Menteri Agama RI. Kecuali Lanjut ke hal A2 kol 1

Rumah Bupati Bireuen Dilontar Bom


TOLAK PENGHINAAN NABI. Mahasiswa muslim dari berbagai perguruan tinggi di Aceh menggelar aksi menolak penghinaan Nabi Muhammad SAW di Bundaran Simpang Lima, Banda Aceh, Kamis (19/9). Mahasiswa Aceh mengutuk keras film Innocence of Muslim yang mengina nabi serta menyerukan umat muslim dunia memboikot pruduk Amerika.

JK: Kasus Century Misterius Dan Senyap JAKARTA (Antara): Mantan Wakil Presiden Jusuf Kalla (JK) menilai kasus Bank Century adalah kasus misterius dan gelap karena dilakukan melalui operasi senyap yakni tidak memberikan laporan kepada Presiden dan Wakil Presiden. ���Karena operasi pemberian dana talangan ke Bank Century ini melalui operasi senyap sehingga menjadi masalah hingga saat ini,” kata

Jusuf Kalla ketika memberikan penjelasan pada rapat Tim Pengawas Bank Century DPR RI di Gedung MPR/DPR/DPD RI, Jakarta, Rabu (19/9). Menurut Kalla, kasus ini bermula ketika Bank Indonesia memberikan dana talangan ke Bank Century sebesar Rp50 miliar pada 13 Nopember 2008, tapi tidak memberikan laporan kepada Presiden Susilo Bambang Yudhoyono

Al Bayan

Syi’ah Ghullah Oleh: H. Ameer Hamzah Syiah ghullah sudah di luar Islam. Mereka itu ditunggangi oleh Yahudi dan musuh-musuh Islam lainnya. Umat Islam harus menjauhi mereka. Ghullah itu ibarat kanker dari tubuh Islam. (Prof Dr Ihsan Ilahi Dzahir) PENGARANG buku “Bahaya Syiah” Prof Dr Ihsan Ilahi Dzahir mengatakan: SYI’AH adalah aliran sempalan yang lahir dari Islam. Pada mulanya syiah hanya sebuah gerakan politik yang berpihak kepada Ali bin Abi Thalib.

Lanjut ke hal A2 kol 2

dan Wakil Presiden Jusuf Kalla. Kalla menyatakan tertarik pada persoalan pemberian dana talangan ke Bank Century, ini karena menilai persoalan sangat besar tapi dasar hukumnya tidak jelas. Karena itu, Kalla yang saat itu menduduki jabatan sebagai wakil presiden mengundang Menteri Keuangan Sri Lanjut ke hal A2 kol 6

Aseng Komit Menangkan Dedi-Affan P.SIDIMPUAN (Waspada): Mardiansyah alias Aseng, seorang Koordinator Kecamatan (Korcam) Tim Pemenangan pasangan calon wali kota dan wakil wali kota Padangsidimpuan nomor urut 4, Dedi Jaminsyah Putra Harahap SSTP.MAP-H. Affan Siregar SE, untuk wilayah Kec. Sidimpuan Utara, dan sempat ‘berpaling’ serta mendeklarasikan diri mendukung pasangan calon lain, kini telah kembali dan komit memenangkan pasangan Dedi-Affan. Aseng menyatakan niatnya yang sempat hendak berpaling ke pasangan calon lain dan menghadiri pendeklarasian Lanjut ke hal A2 kol 5

BIREUEN (Waspada): Masyarakat kawasan Paya Karueng dikejutkan dengan penembakan tabung pelontar bom GLM oleh orang tak dikenal (OTK) di kawasan kediaman Bupati Bireuen Ruslan HM Daud di Kompleks Hotel Meuligoe, kawasan Cot Gapu, Rabu (19/9) pukul 04:00. Beruntung tabung bom pelontar yang jatuh di atas atap kawasan kediaman Bupati Bireuen tidak meledak. Wakapolres Bireuen Kompol W Eko Sulistiyo yang di-

konfirmasi, Rabu (19/9) membenarkan kejadian itu. Dikatakan, begitu mendapat laporan, Rabu pagi pihaknya menurunkan tim penjinak bom dari Brimob Detasemen B Lhokseumawe untuk melakukan penyelidikan dan pengamanan terhadap bom GLM di TKP yang tidak sempat meledak. Hasil penyelidikan petugas, bom GLM yang dilontarkan ke komplek kediaman bupati dan Hotel Meuligoe Lanjut ke hal A2 kol 5

Letusan Senpi Warnai Iringan Truk Pengangkut Alat Berat PEUREULAK (Waspada): Letusan senjata api mewarnai iring-iringan truk pengangkut alat berat milik PT Medco E&P Malaka. Diduga, OTK sengaja memberon-dongnya, tapi tidak ada tembakan yang mengenai truk ataupun alat berat di kawasan jalan antar desa di Desa Kabu, Kec. Peureulak Barat, Kab. Aceh Timur, Selasa (18/9) malam. Informasi diperoleh Waspada, letusan senjata api (senpi) mencapai 7 kali terjadi ketika sejumlah mobil pengangkut alat berat sedang iring-iringan dari kawasan Desa Kabu (Peureulak Barat) hendak menuju Blang Simpo (Peureulak Kota). Kapolres Aceh Timur AKBP Iwan Eka Putra, S.Ik melalui Kapolsek Peureulak Kota Iptu Masri Aswara ketika dihubungi Waspada kemarin, membenarkan adanya laporan warga yang menyebutkan telah terjadi penembakan terhadap truk pengangkut alat berat milik PT Medco. (b24)

Waspada/Surya Efendi

TINJAU KESIAPAN ASRAMA HAJI: Plt Gubsu H Gatot Pujo Nugroho, ST didampingi Ka Kanwil Kemenag Sumut Drs H Abdul Rahim, MHum dan pejabat lainnya meninjau kesiapan Asrama Haji Pangkalan Masyhur Medan menyambut kedatangan jamaah calon haji, Rabu (19/9). Kloter I asal Medan masuk asrama hari ini.

Tidak Tuntas Di Mendagri, Pilkada Aceh Tengah Ke Presiden TAKENGEN (Waspada): Dua kali rapat yang diselengarakan Kepmendagri membahas persoalan Pilkada di Aceh Tengah, tidak menemukan titik terang. Peserta rapat sepakat Gubernur Aceh, membuat laporan resmi ke Presiden. “Gubernur akan membuat laporan resmi dan menghadap

Presiden dengan Mendagri atau Dirjen Otda, tentang persoalan Pilkada di Aceh Tengah.,” sebut Mursid, anggota DPD Aceh Tengah yang ikut hadir dalam pertemuan, Rabu (19/9) sore di Kepmendagri. Menurut Mursid yang menghubungi Waspada via selular usai pertemuan, daftar


kesalahan KIP Aceh Tengah dalam pertemuan itu terkuak ke pemerkuaan. Walau KIP sudah mendapatkan legitimasi secara hukum dengan putusan MK, namun cara KIP mendapatkan kemenangan itu yang menjadi persoalan. KIP diduga melakukan Lanjut ke hal A2 kol 4

Ada-ada Saja

Ditembak Hewan Kesayangan

DUA pria di tempat berbeda ditembak oleh hewan peliharaan mereka sendiri. Seorang pria di Utah, Amerika Serikat, didor anjing kesayangannya di bagian pantat. Sementara, di Prancis, seorang pemburu diamputasi karena Lanjut ke hal A2 kol 5 Waspada/YRit.

KRISIS ekonomi di Amerika Serikat berdampak kepada kota wisata terkenal Miami Beach, negara bagian Florida. Kota itu seperti kota mati tanpa lalu lalang turis mancanegara di tepi pantai maupun di jalan. Bukan hanya berdampak pada wisata, tapi juga maskapai penerbangan American Airlines menyatakan bangkrut dan akan memberhentikan 11.000 karyawannya dalam waktu dekat, meskipun pesawat itu mengangkut penuh penumpang dari ibukota AS, Washington DC, ke Miami, Selasa (18/9). Tampak pada gambar, pantai Miami Beach sejajar jalan Collins Ave tampak sepi seperti diabadikan wartawan Waspada, Rabu (19/9).


- He.... he....he....

Berita Utama


Poktan Tuntut Pembebasan 65,5 Ha Lahan PT Paya Pinang

Myanmar Belajar Penyelesaian Konflik Ke Aceh BANDA ACEH (Waspada): Delegasi pemerintah Myanmar berkunjung ke Aceh untuk melakukan sharing informasi, masukan dan pengalaman penyelesaian konflik yang pernah terjadi di bumi Serambi Mekkah, hingga berakhir dengan sebuah perdamaian. Penyelesaian konflik Aceh, telah menjadi model di dunia yang wilayahnya dilanda konflik berkepanjangan. “Kami ingin belajar resolusi konflik pada anda,” ujar Mr. Ko Ko, dalam pertemuan d e n g a n Wa g u b Mu z a k i r Manaf, Rabu (19/9) di Banda Aceh. Mr. Ko Ko Hlaing, penasehat politik utama Presiden Myanmar memimpin delegasi pemerintah Myanmar ke Aceh bersama Mr. Lahpai Zau Goone, anggota Komisi HAM Myanmar, dan Ms. L. Ja Nan Lahtaw, Direktur Program Nyein Fondation Myanmar. Delegasi Myanmar ini, sebagaimana diakui Mr. Ko Ko, berkunjung ke Aceh secara khusus untuk menjumpai Muzakir Manaf, mantan

Enam Pencuri Uang Dari Mobil Warga Luar Aceh BANDA ACEH (Waspada): Penjahat yang mencuri uang di dalam mobil dengan cara memecahkan kaca mobil di Kota Jantho dan Kota Banda Aceh, Rabu (18/9), dipastikan bukan warga Aceh. Keenam pelaku yang ditangkap aparat kepolisian di kawasan Bundaran Lambaro Aceh Besar tak lama setelah melakukan aksi mereka di depan sebuah toko fotocopy di Jl. Diponegoro, Banda Aceh, di antaranya, HR, 24 dan MJH, 34, MJ, 40 dan AY, 18.Mereka diringkus setelah sempat kejar-kejaran dengan petugas kepolisian, “Dalam pemeriksaan awal, mereka mengaku berasal dari luar Aceh. (b05)

Embarkasi ....

terkait biaya hidup Calhaj (living cost) selama di tanah suci sebesar 1500 rial, sudah selesai didrop oleh PT.Bank BNI Cabang Banda Aceh. ”Insya Allah,nantinya saat keberangkatan akan dibagikan kepada masing- masing kloter.” Begitu juga, dengan kartu Baitul Asy’i juga sudah dipersiapkan panitia, karena kartu ini perlu tandatangan gubernur. Masing-masing Calhajakan mendapat satu lembar kartu, untuk mendapatkan konpensasi dari Baitul Asy’i. Untuk tahun ini belum tahu berapa angka pastinya, tapi tahun lalu para calhaj mendapat dari konpensasi Baitul Asy’i masing-masing 1200 rial,” tutur Ibnu.

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Bfxa6+, Rf7. 2. Ba6-a8, Bxe4 atau yang lain. 3. Ba8-f8+mat (Jika 1. ...., Rd7. 2. Bg-d8+, Rc7. 3. d6+mat).

Jawaban TTS: TTS Topik


Jawaban Sudoku:

9 5 8 3 6 1 2 4 7

2 3 1 4 7 5 9 6 8

7 6 4 8 2 9 5 3 1

4 9 5 7 1 8 6 2 3

3 1 7 2 5 6 8 9 4

6 8 2 9 3 4 1 7 5

8 4 6 1 9 3 7 5 2

5 2 3 6 8 7 4 1 9

1 7 9 5 4 2 3 8 6

Panglima TNA semasa konflik yang kini menjabat sebagai Wakil Gubernur Aceh. Mr. Ko Ko menyampaikan di Myanmar saat ini ada 18 kelompok yang mengangkat senjata melawan pemerintah. Dari 18 kelompok itu, 13 kelompok telah menandatangani perjanjian damai serta satu kelompok sedang dalam proses negoisasi untuk membuat kesepakatan damai. Di samping 18 kelompok pemberontak, di Myanmar juga terjadi konflik etnis dan sekretarian. Salah satunya yang melanda kawasan Karakan atau yang dikenal dengan Rakhine di wilayah Myanmar barat, di tempat ini terjadi konflik antara umat Islam yang beretnis Melayu dengan penganut Budha yang beretnis Thai. Mr. Lahpai Zau Goone yang sangat intens mengikuti dinamika perkembangan proses perdamaian di Aceh, mengakui banyak kemajuan di bidang perdamaian dan demokrasi di Aceh. “Karena itu kami ingin belajar banyak disini,” cetusnya. Lahpai mengatakan prioritas Pemerintah Myanmar saat ini adalah rekonsiliasi socsal politik. Namun, menurutnya, karena kemajemukan etnis dan sosial budaya di sana, maka usaha kearah rekonsiliasi tersebut perlu tenaga ekstra. Sementara Wagub Muzakir Manaf mengatakan pra syarat utama terwujudnya fase damai pasca konflik adalah kejujuran dan keikhlasan para pihak. Semua tindakan dan sikap yang ditujukan untuk mewujudkan damai, harus dilandasi kejujuran dan keikhlasan. “Tanpa kejujuran dan keikhlasan dan saling percaya antara para pihak, maka damai itu sulit diwujudkan,” sebut Muzakir seraya menambahkan pemerintah Myanmar berkehendak melakukan rekonsiliasi, maka langkah pertama yang harus dilakukan adalah membangun rasa saling percaya. (b06)

Waspada/Rudi Arman

USTADZ DR. Azhar Sitompul, MA (berdiri) memberikan ceramah saat acara menepungtawari dua calon jamaah haji asal Harian Waspada, Amir Syarifuddin (wartawan) dan Zulfan Syam (percetakan) di Bumi Warta Waspada, Rabu (19/9).

Penepungtawaran Dua Calhaj Dari Harian Waspada MEDAN (Waspada): Keluarga besar Harian Waspada, Rabu (19/9) di gedung Bumi Warta Jl.Letjen Suprapto menggelar acara tepung tawar terhadap dua calon jamaah haji asal Harian Waspada, yakni Amir Syarifuddin (wartawan) dan Zulfan Syam (percetakan) yang masing-masing akan berangkat dengan Kloter I dan Kloter IX. Acara dihadiri Pemimpin Umum Harian Waspada Hj. Rayati Syafrin, Wapenjab H. Sofyan Harahap, Wakil Pimpinan Perusahaan H. Bachtiar Tanjung, para Redaktur, Bagian Personalia Chaidir Anwar, Bagian Litbang Akmal AZ dan H. Erwan Effendi Batubara, wartawan dan karyawan. Acara diawali pembacaan ayat-ayat suci Alquran, selanjutnya diisi ceramah seputar pelaksanaan ibadah haji di Tanah Suci Makkah oleh Ustadz DR. Azhar Sitompul, MA. Dalam ceramahnya, Azhar Sitompul menyampaikan, Madinah dan Mekkah merupakan tanah suci, justru itu tidak boleh dikotori. Berkaitan dengan itu, setiap orang yang hendak menunaikan ibadah haji semestinya harus benarbenar bersih. ‘’Jadi sesuatu yang suci tidak boleh dikotori oleh orang dan sesuatu yang tidak suci,’’ papar Azhar dan menambahkan, pergi atau datang ke Ta-

nah Suci adalah benar-benar hendak melaksanakan ibadah yang semata-mata karena Allah SWT. Maka itu, semua persiapan bagi calon jamaah haji adalah persiapan untuk melaksanakan ibadah, bukan yang lain. Dalam kaitan itu, Azhar mengutip paparan sebuah buku karangan seorang muallaf dari Amerika, dan berkaitan dengan pelaksanaan ibadah haji, yakni: sedikitnya ada delapan langkah yang harus dilaksanakan sebelum berangkat untuk menunaikan ibadah haji di Tanah Suci. Di antaranya, mesti membersihkan harta-benda, kemudian saat tiba di Madinah dan Makkah jangan pernah mengeluh, melainkan menerima apa

adanya yang datang dari Allah SWT. Selain itu, kita harus menyadari bahwa kita adalah hamba Allah dan sebagai tamu Allah. Sebelumnya, H. Syarifuddin El-Hayat mewakili pimpinan menyampaikan sambutan, yang pada intinya berharap kedua karyawan Harian Waspada yang akan berangkat ke Tanah Suci Makkah dapat melaksanakan ibadah-ibadah yang berkaitan dengan ibadah haji tersebut. Penepungtawaran diawali oleh Pemimpin Umum Harian Waspada Hj. Rayati Syafrin, disusul Wakil Pimpinan Perusahaan, Wakil Penanggungjawab, Redaktur Kota David Swayana, Redaktur Sumut H. T. Doni serta lainnya. (m34)

Tidak Tuntas ....

MK yang didapatkan KIP Aceh Tengah dengan tidak jujur, lalu dipaksakan pelantikan, bila terjadi insiden apakah pihak pusat mau bertanggungjawab dalam menyelesaikan persoalan, sebut Mursid yang mengutip statemen gubernur dalam pertemuan itu. Penjelasan Panwas Aceh Te n g a h y a n g d i k u a t k a n dengan surat laporan ke Panwaslu, tentang adanya cacat hukum dalam pelaksanaan Pilkada di sana, ditambah dengan 5 kecamatan belum direkap, menjadi pembahasan hangat dalam pertemuan itu. Namun KIP Aceh Tengah dan KIP Aceh tetap menyebutkan pihaknya melaksanakan tugas sudah sesuai dengan norma hukum. KIP menetapkan surat nomor 32 /BA/V/2012 sebagai hasil rekap kemudian disusul nomor 33/BA/V/2012 sebagai daftar hadir. Dari nomor ini saja sudah nampak kesalahan. Mengapa rekap duluan dibuat baru daftar hadir, seharusnya daftar hadir dulu, baru disusul surat rekapitulasi suara dan penetapan pemenang, sebut Mursid. (b32)

Dilepas gubernur Kakanwil Kemenag Aceh menjelaskan, untuk pelepasan Kloter 01 asal Kota Banda Aceh sebanyak 320 Calhaj plus lima petugas, dijadwalkan pelepasannya oleh Gubernur Aceh dr.Zaini Abdullah. Dalam pelepasan tersebut, kata Ibnu, turut hadir anggota DPR-RI dari komisi VIII, termasuk salah satunya anggota DPR asal Aceh Drs. H.Sayed Fuad zakaria dan beberapa anggota komisi VIII lainnya. Sementara, lanjut Ibnu, informasi yang diterimanya Maskapai Garuda, pesawat terbang yang akan membawa Calhaj Provinsi Aceh telah tiba di Bandara Sultan Iskandar

Muda (SIM), Aceh Besar. Pesawat Air Bus 300 yang berkafasitas 325 JCH, itu dicarter dari Maskapai Inggris. Menyangkut pengantar jamaah haji, menurut Ibnu, sama dengan tahun-tahun yang lalu. “Tidak ada pertemuan antara keluarga dengan jamaah,” tuturnya. Ini kita lakukan semata-mata untuk kenyamanan dan ketenangan calhaj selama berada di embarkasi Banda Aceh, tambah Ibnu Sa’dan. Disamping itu, untuk menekan jumlah Calhaj waiting list yang saat ini sudah masuk tahun ke 12, Kakanwil berharap kepada masyarakat yang sudah berhaji untuk tidak lagi mendaftar haji. (b02)

penipuan dalam menetapkan nomor rekapitulasi suara dan daftar pemenang Pilkada. Pakar hukum dalam pertemuan itu juga mempersoalkan mengapa KIP terlebih dahulu menetapkan pemenang, baru disusul dengan surat rekap dan daftar hadir, sebut Mursid. Dalam pertemuan itu, disepakati, Gubernur Aceh harus tetap memelihara stabilitas keamanan di Aceh. Mengkondisikan daerah untuk tenang dan bukan persoalan pelantikan Bupati Aceh Tengah yang menjadi persoalan utama, namun tingkat hukum dan tatanan social masyarakat yang dikedepankan. Selain menjaga stabilitas di daerah, Gubernur membuat laporan tertulis untuk disampaikan kepada presdien bersama Menteri Dalam Negeri. Menurut Mursid, dalam pertemuan itu, gubernur Aceh mengakui, SK Mahkamah Agung tentang Pilkada Aceh Tengah sudah final. Namun yang perlu dipelajari dan dicermati, hukum masyarakat dan hukum sosial di daerah. Rakyat tahu ada kecurangan dan bagaimana KIP menang dalam persidangan MK. Dalam hal ini. Gubernur meminta jaminan, apakah dengan menerapkan hukum

Majalah Prancis ....

kartun Nabi Muhammad SAW diterbitkan di satu majalah di negara itu, yang menggerakkan kekhawatiran akan semakin berkobarnya ketegangan film mengejek Nabi. Mingguan satir Charlie Hebdo yang Rabu menerbitkan kartun Nabi Muhammad SAW, telah dikritik pemerintah Prancis, yang mengirim pasukan huruhara untuk melindungi kantor majalah itu. Sampul depan majalah tersebut menunjukkan seorang Yahudi Ortodoks mendorong sosok bersorban di

kursi roda dan beberapa karikatur Nabi dimasukkan pada halaman isinya. Publikasi itu terjadi di tengah-tengah kemarahan meluas umat Muslim di seluruh dunia berkaitan dengan beredarnya film anti-Islam Innocence of Muslims di Internet. Menteri Luar Negeri Prancis Laurent Fabius mengecam keputusan Charlie Hebdo sebagai provokasi, dan mengatakan ia telah memerintahkan keamanan ditingkatkan di kantorkantor perwakilan diplomat Prancis di dunia Muslim. (m10)

Ada-ada Saja ....

Telegraph. Kevin Potter, Deputi Box Elder County Sheriff mengatakan: “(Anjing) itu melakukan sesuatu sehingga pistol meletus. Saya tidak tahu apakah perangkat pengamannya sedang terbuka. Tak mungkin anjing dapat mematikan perangkat pengaman itu.” Sementara di Perancis, seorang pemburu yang diidentifikasi bernama Rene, mengatakan kepada radio France Bleu, anjingnya secara tak sengaja menarik picu senapan saat hewan itu melompat mendekati dirinya ketika mereka berburu di wilayah Dordogne, akhir pekan lalu.

Rene mengatakan kala itu dia berburu dengan tiga anjingnya. Ketika dua anjingnya kabur memburu rusa, anjing paling kecil tertinggal di belakang. “Dia melompat ke arah saya untuk dipeluk, dan tanpa sengaja menembakkan pistol hingga mengenai tangan kanan,” kata Rene. Sang pemburu akhinya dibawa dengan helikopter ke rumah sakit di Bordeaux, dan tangannya harus diamputasi. “Itu bukan kesalahan anjing,” Rene menegaskan. “Dan dia menggemaskan, seharusnya saya tidak meninggalkan senapan dalam kondisi menyala, itu saja!” (net/rzl)

Al Bayan ....

Sayyidina Ali bin Abi Thhalib lebih berhak menjadi Khalifah (peganti Nabi) ketimbang shahabat yang lain. Abubakar, Umar bin Khattab da Usman bin Affan telah merampas hak Ali. Kekejaman Bani Umayyah dan Bani Abbas terhadap gerakan Syiah ini menyebabkan mereka mengarang ribuan hadis palsu yang mengkultus Ali bin Abi Thalib dengan Fathimah Az-Zahra serta anak keturunannya. Sebaliknya pihak Umayyah, juga dilanjutkan pihak Abbasiyah, mereka juga mengarang ratusan hadits palsu untuk menandingi hadis

palsu dari Syiah. Tidak semua Syiah itu sesat, ada juga yang tidak menyimpang. Khusus Syiah yang menyimpang dari aqidah yang benar disebut Syiah Ghullah (Ekstrim). Syiah inilah yang perlu diwaspadai, sebab mereka mengkafirkan para sahabat Nabi, istri Nabi, menolak hadis-hadis dari Abu Hurairah, Aisyah dan Ibnu Abbas. Bahkan ada di antara mereka yang tidak lagi shalat lima waktu (Syiah Druz) di Lebanun, menuhankan Ali (Syiah Sabaiyah) di Israel. Ada sekte Syiah yang menghalalkan zina, arak dan narkoba.

warganya di negara Islam ‘berhati-hati dan meningkatkan kewaspadaan ekstra, menghindari semua kerumunan dan gedung-gedung yang sensitif. Pihak berwenang dan pemimpin Muslim di Prancis — negara terbanyak warga Muslim di barat Eropa — mendesak agar masyarakat tenang. Reuters melaporkan, Prancis mengatakan pihaknya akan menutup sementara kedutaan dan sekolahnya di 20 negara Jumat (21/9) setelah

tangan kanannya tanpa sengaja ditembak oleh anjingnya. Kedua insiden ini punya cerita masing-masing, mengutip, Selasa (18/9). Kisah di AS, pria yang tidak disebutkan namanya membawa peliharan setianya untuk berburu bebek di hutan Utah. “Tanpa sengaja” anjingnya menginjak senapanya yang kemudian meletus dan peluru bersarang di pantatnya. Pria itu keluar dari perahu ketika anjingnya menembaki dia dari haluan. Pria malang itu kemudian dilarikan ke rumah sakit untuk mencegah cedera parah, menurut The Masa itu Syiah masih murni aqidah dan syariahnya. Tidak ada perbedaan sedikitpun dengan kaum muslimin lainnya. Selanjutnya, Ihsan Ilahi Dzahir mengatakan; Paham Syiah mulai menyimpang setelah gerakan ini ini disusup oleh kaum Yahudi dan Majusi yang pura-pura masuk Islam. Mereka membawa paham agama lamanya dalam Islam. Salah seorang tokoh Yahudi yang sangat berjasa merusak aqidah Syiah adalah Abdullah bin Saba’. Dialah pelopor khurafat dan bid’ah. Ia katakan

WASPADA Kamis 20 September 2012

Rumah Bupati ....

kawasan Cot Gapu masih aktif dan bom tersebut sudah dibawa ke Markas Brimob Detasemen B di Lhokseumawe. Diperkirakan tabung pelontar bom itu ditembakkan OTK di kawasan Paya Karueng sebelah timur rumah kediaman bupati dan Hotel Meuligoe, sementara Polres akan terus memburu pelaku. Bupati Bireuen Ruslan HM Daud mengaku baru mengetahui terjadinya pelontaran GLM ke kawasan rumah kediamannya saat diberitahu petugas, setelah dia melaksanakan shalat subuh. (b12)

Aseng Komit ....

peralihan dukungan, itu terjadi karena kekalutan pemikirannya. Pasalnya, saat itu terjadi ketersumbatan informasi antara dia dengan pusat Tim Pemenangan DediAffan, sehingga membuat pemikirannya galau. “Saat itu pikiran saya sedang dalam kondisi galau. Kini setelah berjumpa dan berbicara langsung dengan Dedi-Affan, pikiran saya telah terang kembali. Kini saya kembali ke Dedi-Affan dan siap berjuang keras untuk memenangkannya di Pilkada 18 Oktober nanti,” tegas Aseng saat bertemu Dedi dan Affan d i w a r u n g Wa k G a r e n g , Sigiring-giring, Kelurahan Timbangan, Kec. Sidimpuan Utara, Rabu (19/9). Kepada wartawan, Aseng menjelaskan, pada Jumat (7/ 9) kemar in dia bersama s e j u m l a h a n g g o t a Tim Pemenangan Dedi-Affan sempat mengundurkan diri. Kemudian mengalihkan dan mendeklarasikan dukungan ke pasangan calon lain. Hal ini terjadi karena pikirannya kalut dan belum ada solusi akibat terjadinya ketersumbatan komunikasi dengan pusat Tim Pemenangan. (a27)

TEBINGTINGGI ( Waspada): Ratusan warga tergabung dalam Kelompok Tani (Poktan) Maju Jaya menuntut PTPD Paya Pinang membebaskan lahan yang dikuasai perkebunan seluas 65,5 Ha. Alasannya, lahan itu berada di luar hak guna usaha perkebunan dan dulunya merupakan lahan garapan masyarakat. Poktan berunjukrasa ke kantor perkebunan PTPD Paya Pinang, Rabu (19/9), di Desa Paya Pinang, Kec. Tebing Syahbandar, Kab. Sergai. Mereka datang dengan menggunakan bus menuju kantor perkebunan dengan pengawalan

Polres Tebingtinggi dipimpin langsung Kapolres AKB Andi R Jayadi, SIK dan Wakapolres Ko m p o l M a d e A r y. Us a i berunjuk rasa, Poktan diterima Manager Kebun Paya Pinang Mustafa dan jajarannya. Dalam dialog itu, delapan perwakilan Poktan menyampaikan sejumlah tuntutan. Juru bicara Poktan mengungkapkan saat ini ada 65,5 Ha dengan 13 titik lahan yang dikuasai perkebunan swasta itu berada di luar HGU. Jubir lain Supriadi, mengklaim selama ini lahan seluas 65, 5 Ha itu tidak membayar pajak. Malah, ada di antara lahan itu yang telah memiliki

sertifikat camat. “Jadi, diperkirakan lahan di dalam HGU Kebun Paya Pinang itu sudah 28 tahun tidak membayar pajak,” ungkap warga Kel. Bagelen itu. Terkait itu, pimpinan PTPD Paya Pinang Rizal mewakili manager, mengatakan lahan itu, benar telah digarap oleh warga saat berada di bawah PT Hafinis. Juga membenarkan pihak perkebunan mengambil kembali lahan itu, dengan ganti rugi tanaman di atas lahan garapan. “Saat itu ada 106 warga penggarap yang menerima ganti rugi,” ujar Rizal sambil menunjukkan data. (a09)

JK: Kasus Century ....

kan untuk menangkap pemilik Bank Century,” katanya. Rapat Tim Pengawas Kasus Bank Century dipimpin oleh Wakil Ketua DPR RI, Pramono Anung Wibowo dan dihadiri oleh anggota Tim Pengawas Kasus Bank Centiry DPR RI dari sembilan fraksi. Semula, Jusuf Kalla dijadwalkan akan memberikan penjelasan pada rapat Tim Pengawas Kasus Bank Century DPR RI,pada Rabu (12/9) lalu, tapi karena saat itu masih berada di China, sehingga ditunda hingga Rabu. KPK Tak Ingin Century Jadi Beban Sejarah Ketua Komisi Pemberantasan Korupsi (KPK) Abraham Samad menegaskan, KPK berkomitmen menyelesaikan kasus pemberian dana talangan untuk Bank Century agar tidak menjadi beban sejarah. “Kami pimpinan KPK tetap berkomitmen agar bisa selesaikan kasus Bank Century, agar kasus ini tidak menjadi beban sejarah seperti halnya kasus Super Semar, atau pun BLBI,” katanya saat memberikan penjelasan kepada Tim

Pengawas ( Timwas) Bank Century DPR RI di Jakarta, Rabu (19/9). Abraham mengatakan KPK berkomitmen menyelesaikan kasus Bank Century secara transparan dan menegaskan bahwa KPK tak pernah ingin menutupi penanganan kasus tersebut. “Sama sekali tak punya niat, terbersit sedikitpun tidak ada. Karena ini menjadi visi dan misi KPK untuk memberantas korupsi,” katanya. Rapat dengar pendapat a n t a r a Ti m w a s C e n t u r y dengan KPK yang dipimpin Wakil Ketua DPR RI Pramono Anung antara lain dihadiri komisioner KPK Adnan Pandu Pradja. Wakil Ketua KPK Bambang Widjojanto meminta izin tidak hadir karena sedang melakukan seleksi, sedang Busyro Muqoddas tidak bisa hadir karena sedang berada di Aceh. Sebelum memanggil pimpinan KPK, Timwas Bank Century sudah meminta keterangan dari mantan Wakil Presiden M Jusuf Kalla tentang kronologis pengucuran dana talangan untuk Bank Century.

Beredar ....

benarnya tidak ingin menanggapi. “Tapi sejak semalam banyak yang bertanya, oleh karena itu saya kira kami memiliki standing yang sama, pemerintah Inggris melalui kedubesnya di Jakarta sepakat untuk tidak perlu menanggapi, tapi ini harus diclearkan agar publik mengetahui situasinya,” ujarnya. Menurut dia, sampai saat ini pihaknya baru memastikan sayembara itu bukan dari pemerintah atau lembaga resmi. Sayembara itu disuarakan oleh sekelompok orang yang memiliki kepentingan, politik tertentu. “Inggris dan Indonesia terlalu penting un-

tuk diganggu atau dipengaruhi rumor yang tidak bermutu ini,” kata Julian. Sebelumnya, Radio New Zealand International melansir adanya sayembara penangkapan Presiden SBY saat berkunjung ke Inggris pada awal November mendatang. Sayembara ini menawarkan 80 ribu dolar AS bagi warga yang bisa menangkap SBY. Dalam sayembara ini juga disebutkan bahwa SBY tengah dicar i oleh Pengadilan Kriminal Internasional karena mendalangi genosida yang sedang berlangsung di Papua. Genosida itu menewaskan lebih dari 500.000 orang tak bersalah. (vn)

Survei: Jokowi-Ahok ....

ternyata tidak berbanding lurus dengan kebesaran partai yang berkoalisi mendukung Foke-Nara dan Jokowi-Ahok. Demokrat misalnya hanya 40 persen yang memilih, Golkar 22 persen, PKS 23 persen, PAN 50 persen, PPP 33 persen yang memilih Foke-Nara. Sedangkan PDIP 14 persen dan Gerindra 17 persen yang tidak memilih Jokowi-Ahok. PKB tidak masuk dalam elektabilitas partai ini. Sedangkan warga yang akan ke TPS dipastikan sebanyak 11,0 persen (tidak datang), 20,8 persen (kemungkinan kecil tidak datang), 59 persen (dipastikan datang), dan tidak tahu sebesar 9,3 persen. “Nah, dari keikutsertaan

warga yang 59,0 atau 60 persen, berubah menjadi 100 persen keikutsertaan pemilih ke TPS, maka akan merubah kontelasi perolehan suara kedua pasangan dan bisa menguntungkan salah satu calon,” tambah Dolfi. Di sisi lain yang percaya akan isu SARA selama ini sebanyak 27,1 persen, tidak terpengaruh sebesar 67,9 persen, dan tidak tahu menahu dengan SARA tersebut sebanyak 5,0 persen. “Yang jelas isu negatif bisa memenangkan siapa saja,” ujar Dolfi. Rekode ini sudah melakukan riset dan survei sejak 2007, dan bukan saja survei di Pilkada DKI Jakarta, tapi juga di daerah seluruh Indonesia. (j07)

Mulyani dan beberapa pejabat terkait untuk rapat di Istana Wakil Presiden pada 20 November 2008. Menurut Kalla, pada rapat tersebut, Sri Mulyani dan pejabat lainnya menjelaskan akan terjadi krisis keuangan, sehingga membuat dirinya marah. “Saya bertanya kepada Sri Mulyani, mengapa memberikan dana talangan ke Bank Century,” kata Kalla. Ia menambahkan, Sri Mulyani saat itu menjelaskan dirinya mendapat laporan dari Bank Indonesia bahwa terjadi krisis Bank Century yang berdampak sistemik sehingga perlu memberikan dana talangan. Menurut Kalla, Sri Mulyani menyatakan dirinya ditipu oleh Bank Indonesia. Kalla menjelaskan, Bank Century adalah bank kecil sehingga kalau bank tersebut krisis tidak akan menimbulkan dampak krisis keuangan. “Kalau kondisinya tidak krisis dan diberikan bantuan dana talangan itu artinya ada perampokan terhadap uang negara, sehingga memerintahhal-hal itu tidak akan terjadi dan dijamin sepenuhnya oleh pemerintah Inggris,” ujar Julian. Meski beredar berita sayembara penangkapan itu, kata Julian, jadwal kunjungan SBY tidak terganggu sama sekali. Pemerintah Inggris, tambah dia, minta pemerintah Indonesia tidak salah paham dengan isu sayembara tersebut. “Sayembara itu tidak ganggu rencana yang dijadwalkan saat ini,” katanya. Julian menambahkan, pemerintah juga tidak perlu memprotes adanya sayembara itu. Bahkan, kata dia, sedalam keikutsertaan dalam pemilihan hari ini. Metodologi survei dilakukan di wilayah Jakarta pada warga yang berusia di atas 17 tahun, yang mempunyai hak pilih. Sampel survey dilakukan terhadap warga yang masuk dalam daftar pemilih tetap (DPT ) 2012, sebanyak 400 responden di 42 kelurahan pada 11 September 2012. Dengan sampel error sekitar 4,9 persen pada tingkat kepercayaan 95 persen. Responden dipilih secara acak melalui wawancara langsung dan kontrol dilakukan melalui telepon langsung terhadap 90 persen responden. Sementara itu elektabilitas pendukung kedua pasangan

Berita Utama


WASPADA Kamis 20 September 2012

Pemuda Asal Polonia Dihajar Warga STM Hilir


PULUHAN pengunjuk rasa yang tergabung dalam Hizbut Tahrir Indonesia (HTI) berunjuk rasa di depan Konjen AS, di Medan, Rabu (19/9).

Konsulat AS Di Medan ... Kota Medan, mendesak pemerintah RI memutuskan hubungan diplomatik dengan AS. Massa juga meminta sutradara film tersebut meminta maaf kepada seluruh umat Islam di dunia dan dihukum berat. “Kami mendesak agar pemerintah segera memutuskan hubungan diplomatik dengan Amerika Serikat , karena film Innocence of Muslims telah menghina seluruh umat Islam di dunia. Tidak hanya menghina umat Islam, tapi Amerika telah merampas kekayaan dari bumi Indonesia,” kata Ustadz Azwir Ibnu Aziz saat berorasi di depan kantor Konsulat Jenderal (Konjen) AS di gedung Uniland Jl. MT Haryono Medan. Ustadz Azwir Ibnu Aziz mensinyalir Indonesia merupakan negara boneka Amerika Serikat. “Kita sudah berkali-kali mendesak pemerintah RI agar memutuskan hubungan diplomatik dengan AS, namun tidak pernah mendapat tanggapan,” ujarnya. Dalam pernyatan sikap, massa HTI mengutuk penyebarluasan film tersebut karena telah menghina Nabi Muhammad SAW. HTI menyerukan kepada seluruh umat Islam untuk bahu membahu membela kehormatan Nabi Muhammad dan menolak keras setiap paham atau doktrin yang tidak Islami seperti doktrin tentang HAM, sekulerisme dan liberalisme serta sungguh-sungguh berjuang menegakkan khilafah. Usai menyampaikan orasi, massa HTI yang didominasi kaum hawa itu meninggalkan gedung Uniland menuju titik kumpul di Masjid Raya Medan. Setelah massa HTI meninggalkan gedung Uniland, massa dari Ikatan Mahasiswa Muhammadiyah (IMM) Kota Medan, melakukan aksi serupa. Usai menggelar orasi di Bundaran Majestik Jl. Gatot Subroto Medan, massa mendatangi kantor Konjen AS di gedung Uniland. Setelah berorasi, mereka membubarkan diri. (m10/h04)

Aseng Komit Menangkan ... karena kekalutan pemikirannya. Pasalnya, saat itu terjadi ketersumbatan informasi antara dia dengan pusat Tim Pemenangan Dedi-Affan, sehingga membuat pemikirannya galau. “Saat itu pikiran saya sedang dalam kondisi galau. Kini setelah berjumpa dan berbicara langsung dengan Dedi-Affan, pikiran saya telah terang kembali. Kini saya kembali ke Dedi-Affan dan siap berjuang keras untuk memenangkannya di Pilkada 18 Oktober nanti,” tegas Aseng saat bertemu Dedi dan Affan di warung Wak Gareng, Sigiring-giring, Kelurahan Timbangan, Kec. Sidimpuan Utara, Rabu (19/9). Kepada wartawan, Aseng menjelaskan, pada Jumat (7/9) kemarin dia bersama sejumlah anggota Tim Pemenangan DediAffan sempat mengundurkan diri. Kemudian mengalihkan dan mendeklarasikan dukungan ke pasangan calon lain. Hal ini terjadi karena pikirannya kalut dan belum ada solusi akibat terjadinya ketersumbatan komunikasi dengan pusat Tim Pemenangan. (a27)

Suara Ondim Dan Sutan ... Gus Irawan dari 31% turun menjadi 27%, Sutan Bhatoeghana Siregar dari 23% naik menjadi 33%. Untuk PDI Perjuangan belum terjadi perubahan dukungan, seperti kemarin untuk Chairuman 64% dan RE Nainggolan 36%. Pada PKS, suara untuk Gatot Pujo Nugroho tetap 67%, suara untuk Gus Irawan melemah dari 33% menjadi 17% dengan masuknya nama baru yakni Hasbullah Hadi 16%. Harian Waspada memberikan kesempatan kepada pembaca untuk memberikan kontribusi kepada partai maupun Balon Gubsu dalam memecahkan masalah ‘sampan’ yang cocok untuk mengantarkan mereka menjadi orang nomor satu di Sumatera Utara. Segera isi kupon PAPS yang terdapat di Halaman PoliJawaban Problem Catur, tik dan Hukum, dukung kandidat kesayangan Anda dan daTTS Dan Sudoku patkan hadiahnya. (Tim)

Dari Halaman Sport.

Ada-ada Saja ...

Jawaban Problem Catur: 1. Bfxa6+, Rf7. 2. Ba6-a8, Bxe4 atau yang lain. 3. Ba8-f8+mat (Jika 1. ...., Rd7. 2. Bg-d8+, Rc7. 3. d6+mat).

Jawaban TTS: TTS Topik


Jawaban Sudoku:

9 5 8 3 6 1 2 4 7

2 3 1 4 7 5 9 6 8

7 6 4 8 2 9 5 3 1

4 9 5 7 1 8 6 2 3

3 1 7 2 5 6 8 9 4

6 8 2 9 3 4 1 7 5

8 4 6 1 9 3 7 5 2

5 2 3 6 8 7 4 1 9

1 7 9 5 4 2 3 8 6

pemburu diamputasi karena tangan kanannya tanpa sengaja ditembak oleh anjingnya. Kedua insiden ini punya cerita masing-masing, mengutip, Selasa (18/9). Kisah di AS, pria yang tidak disebutkan namanya membawa peliharan setianya untuk berburu bebek di hutan Utah. “Tanpa sengaja” anjingnya menginjak senapanya yang kemudian meletus dan peluru bersarang di pantatnya. Pria itu keluar dari perahu ketika anjingnya menembaki dia dari haluan. Pria malang itu kemudian dilarikan ke rumah sakit untuk mencegah cedera parah, menurut The Telegraph. Kevin Potter, Deputi Box Elder County Sheriff mengatakan: “(Anjing) itu melakukan sesuatu sehingga pistol meletus. Saya tidak tahu apakah perangkat pengamannya sedang terbuka. Tak mungkin anjing dapat mematikan perangkat pengaman itu.” Sementara di Perancis, seorang pemburu yang diidentifikasi bernama Rene, mengatakan kepada radio France Bleu, anjingnya secara tak sengaja menarikpicusenapansaathewan itu melompat mendekati dirinya ketika mereka berburu di wilayah Dordogne, akhir pekan lalu. Rene mengatakan kala itu dia berburu dengan tiga anjingnya. Ketika dua anjingnya kabur memburu rusa, anjing paling kecil tertinggal di belakang. “Dia melompat ke arah saya untuk dipeluk, dan tanpa sengaja menembakkan pistol hingga mengenai tangan kanan,” kata Rene. Sang pemburu akhinya dibawadenganhelikopterkerumah sakit di Bordeaux, dan tangannya harus diamputasi. “Itu bukan kesalahan anjing,” Rene menegaskan. “Dan dia menggemaskan, seharusnya saya tidak meninggalkan senapan dalam kondisi menyala, itu saja!” (net/rzl)

TALUNKENAS (Waspada): Seorang pemuda, An, 20, (foto) warga Starban, Kel. Polonia, Medan, babak belur dihajar warga di Dusun Namo Pecawir, Desa Sumbul, Kec. Sinembah Tanjung Muda (STM) Hilir Deliserdang, Rabu (19/9) sore. Peristiwa itu terjadi ketika tiga hari lalu, Senin (17/9), An meminjam sepedamotor dari temannya, MS, 16, warga Starban, Kel. Polonia, Medan, dengan alasan untuk menjemput kakaknya. Tapi An, tak kunjung mengembalikan sepedamotor itu. Tiga hari kemudian, Safi’i, teman si pemilik sepedamotor, MS, melihat An melintas di Desa Sumbul, Kec. STM Hilir mengendarai sepedamotor BK 6480 FH yang dipinjam dari MS. Saat itulah Safi’i meneriaki “maling” ke arah An, yang kemudian tancap gas melarikan diri. Melihat itu, warga merespon, mengejar An, dan berhasil mencegat An. Setelah dihentikan, An dibabakbelurkan. Aparat Polsek Talun Kenas yang turun ke TKP segera mengamankan An yang sudah terkapar dalam kondisi bonyok, kemudian membawanya ke Puskesmas Talun Kenas, selanjutnya dibawa ke RSU Sembiring, Delitua. Kapolsek Talun Kenas, AKP. Julianus Tarigan, saat dikonfirmasi mengatakan, pihaknya masih menunggu laporan dari pemilik sepedamotor. (a07)

JK: Kasus Century Misterius Dan Melalui ‘Operasi Senyap’ JAKARTA (Waspada): Mantan Wakil Presiden Jusuf Kalla (JK) menilai kasus Bank Century adalah kasus misterius dan gelap karena dilakukan melalui ‘operasi senyap’ yakni tidak memberikan laporan kepada Presiden dan Wakil Presiden. “Karena operasi pemberian dana talangan ke Bank Century ini melalui ‘operasi senyap’ sehingga menjadi masalah hingga saat ini,” kata Jusuf Kalla ketika memberikan penjelasan pada rapat Tim Pengawas Bank CenturyDPRRIdiGedungMPR/DPR/ DPD RI, Jakarta, Rabu (19/9). Menurut Kalla, kasus ini bermula ketika Bank Indonesia memberikan dana talangan ke Bank Century sebesar Rp50 miliar pada 13 November 2008, tapi tidak memberikan laporan kepada Presiden Susilo BambangYudhoyono danWakil Presiden Jusuf Kalla. Kalla menyatakan tertarik pada persoalan pemberian dana talangan ke Bank Century, ini karena menilai persoalan sangat besar tapi dasar hukumnya tidak jelas. Karena itu, Kalla yang saat itu menduduki jabatan sebagai wakil presiden mengundang Menteri Keuangan Sri Mulyani dan beberapa pejabat terkait untuk rapat di Istana Wakil Presiden pada 20 November 2008. Menurut Kalla, pada rapat tersebut, Sri Mulyani dan pejabat lainnya menjelaskan akan terjadi krisis keuangan, sehingga

membuat dirinya marah. “Saya bertanya kepada Sri Mulyani, mengapa memberikan dana talangan ke Bank Century,” kata Kalla. Ia menambahkan, Sri Mulyani saat itu menjelaskan dirinya mendapat laporan dari Bank Indonesia bahwa terjadi krisis Bank Century yang berdampak sistemik sehingga perlu memberikan dana talangan. Menurut Kalla, Sri Mulyani menyatakan dirinya ditipu oleh Bank Indonesia. Kalla menjelaskan, Bank Century adalah bank kecil sehingga kalau bank tersebut krisis tidak akan menimbulkan dampak krisis keuangan. “Kalau kondisinya tidak krisis dan diberikan bantuan dana talangan itu artinya ada perampokan terhadap uang negara, sehingga memerintahkan untuk menangkap pemilik Bank Century,” katanya. Rapat Tim Pengawas Kasus Bank Century dipimpin oleh Wakil Ketua DPR RI, Pramono Anung Wibowo dan dihadiri oleh anggota Tim Pengawas Kasus Bank Centiry DPR RI dari sembilan fraksi. KPK Tak Ingin Century Jadi Beban Sejarah Sementara Ketua Komisi Pemberantasan Korupsi (KPK) Abraham Samad menegaskan, KPK berkomitmen menyelesaikan kasus pemberian dana talangan untuk Bank Century agar tidak menjadi beban sejarah. “Kami pimpinan KPK tetap

berkomitmen agar bisa selesaikan kasus Bank Century, agar kasus ini tidak menjadi beban sejarah seperti halnya kasus Super Semar, atau pun BLBI,” katanya saat memberikan penjelasan kepada Tim Pengawas (Timwas) Bank Century DPR RI di Jakarta, Rabu (19/9). Abraham mengatakan KPK berkomitmen menyelesaikan kasus Bank Century secara transparan dan menegaskan bahwa KPK tak pernah ingin menutupi penanganan kasus tersebut. “Sama sekali tak punya niat, terbersit sedikitpun tidak ada. Karena ini menjadi visi dan misi KPK untuk memberantas korupsi,” katanya. Menurut Abraham, kekurangan penyidik menjadi kendala utama. “Kalau kita punya penyidik yang banyak, mungkin pertemuan kita kali ini akan mengatakan penyelidikan Century naik ke penyidikan,” kata Abraham. Dia mengatakan, akibat kekurangan penyidik tersebut, banyak kasus di KPK yang terbengkalai. Terlebih, saat ini 20 penyidik KPK ditarik oleh Polri. “Satu orang penyidik itu bisa memegang 5-6 kasus. Meski demikian, KPK akan terus bekerja keras untuk menyelesaikan semua kasus yang ada di KPK, termasuk kasus Bank Century. Khusus Century, pertemuan berikutnya kita sudah akan berada dalam tahapan yang berbeda,” tambah Samad. (j07/ant)

Majalah Prancis Siarkan Kilang Padi Kartun Nabi Muhammad Terbakar PARIS (AP): Prancis meningkatkan pengamanan di sejumlah kedutaanbesarnya Rabu (19/ 9), setelah satu media mingguan satirikal di Paris menerbitkan karikatur Nabi Muhammad SAW. PM Prancis mengatakan dia akan menghambat unjukrasa oleh orang-orang yang marah atas satu film yang merendahkan Nabi Muhammad SAW dan Islam, pada saat negeri itu terseret pada perdebatan tentang kebebasan berbicara. Pemerintah membela hak majalah Charlie Hebdo untuk menerbitkan kartun tersebut, yang ingin mengalihkan perhatian dari film The Innocence Muslim, yang diproduksi di AS dan polisi anti huruhara meng-

ambil posisi di luar kantor majalah tersebut, yang dibom tahun lalu setelah merilis edisi yang mengejek Islam radikal. Reuters melaporkan, Prancis mengatakan pihaknya akan menutup sementara kedutaan dan sekolahnya di 20 negara Jumat (21/9) setelah kartun Nabi Muhammad SAW diterbitkan di satu majalah di negara itu, yang menggerakkan kekhawatiran akan semakin berkobarnya ketegangan film mengejek Nabi. Mingguan satir Charlie Hebdo yang Rabu menerbitkan kartun Nabi Muhammad SAW, telah dikritik pemerintah Prancis, yang mengirim pasukan huruhara untuk melindungi kantor majalah itu. (m10)

TELUKMENGKUDU(Waspada): Satu kilang padi Harapan Tani milik A Sui Joni Leo di Dusun I,Desa Sentang,Kec.Teluk Mengkudu, Kab.Serdang Bedagai terbakar, Rabu(19/9) sore. Dalam peristiwa itu tidak ada korban jiwa, kerugian diperhitungkan Rp100 juta. A Sui kepada Waspada di lokasi kejadian mengatakan, asal api diduga dari arus pendek listrik korsleting mengakibatkan terjadinya percikan api. Setelah apimemercikmenyambarkeelevator alat untuk menaikkan padi dari bawah ke penggorengan. Duaunitmobilpemadamkebakaran Serdang Bedagai yang turun ke lokasi kejadian berhasil memadamkan api . (a08)

Survei: Jokowi ...

isuSARAselamainisebanyak27,1 persen, tidak terpengaruh sebesar 67,9 persen, dan tidak tahu menahu dengan SARA tersebut sebanyak 5,0 persen. “Yang jelas isu negatif bisa memenangkan siapa saja,” ujar Dolfi. Rekode ini sudah melakukan riset dan survei sejak 2007, dan bukan saja survei di Pilkada DKI Jakarta, tapi juga di daerah seluruh Indonesia. Jokowi Sungkem Jokowi, sebelum berangkat ke Jakarta untuk mengikuti Pemilihan Gubernur DKI Jakarta Kamis (20/9), terlebih dahulu melakukan sungkeman pada ibunya, Sujiatmi Notomiatdjo di kediamannya di jalan Pleret Raya no.9A,Sumber,RT01/VII,Kecamatan Banjarsari, Solo, Rabu (19/9). Jokowi menyampaikan, acara sungkeman dilakukan untuk meminta doa restu dari sang ibunda sebelum dirinya berangkat ke Jakarta. Foke Optimistis Fauzi Bowo bersyukur bisa mendapatkan kepercayaan dari masyarakat. Padahal pada putaran pertama lalu, perolehan suaranya tertinggal jauh dari Jokowi. “Alhamdulillah, saya bersyukur berhasil mendapatkan kepercayaan dari warga untuk kembali pada posisi yang seimbang tadi, survei kan ada margin error-nya,” katanya di Balaikota

DKI Jakarta, kemarin. Foke masih optimistis bisa menang pada putaran kedua nanti. Menurutnya, pada pemungutan suara 20 September 2012 nanti, hanya yang terbaik yang akan menjadi pemenangnya. Hasil jajak pendapat dari Lingkar Survei Indonesia (LSI), pasangan Joko Widodo-Basuki Tjahaya Purnama unggul tipis sebesar 45,6 persen, dibandingkan pasangan Fauzi Bowo-Nachrowi Ramli sebesar 44,7 persen. Dalam survei diketahui bahwa Fauzi Bowo lebih populer dibandingkan Joko Widodo. Namun, Jokowi lebih disukai dibandingkan Fauzi Bowo. Polda Metro Jaya sudah menyiapkan pengamanan Pilkada DKI Jakarta secara merata di seluruh wilayah untuk pengamanan di Tempat Pemungutan Suara (TPS) yang dianggap rawan termasuk adanya ancaman atau pemaksaan untuk memilih kandidat gubernur. Kerawanan dipertimbangkan dari adanya potensi kericuhan dan protes massa. “Kita fokus ke semua TPS. Karena potensi kerawanan selalu ada. Ini harus fokus semua, tidak boleh underestimate,” kata Kabid Humas Kombes Pol Rikwanto kepa da wartawan di Jakarta,Rabu (19/9). (j07/ant/vvn/j02)

sampel error sekitar 4,9 persen pada tingkat kepercayaan 95 persen. Responden dipilih secara acak melalui wawancara langsung dan kontrol dilakukan melalui telepon langsung terhadap 90 persen responden. Sementara itu elektabilitas pendukung kedua pasangan ternyata tidak berbanding lurus dengan kebesaran partai yang berkoalisimendukungFoke-Nara dan Jokowi-Ahok. Demokrat misalnya hanya 40 persen yang memilih,Golkar22persen,PKS23persen,PAN50persen,PPP33persen yangmemilihFoke-Nara.Sedangkan PDIP 14 persen dan Gerindra 17 persen yang tidak memilih Jokowi-Ahok. PKB tidak masuk dalam elektabilitas partai ini. Sedangkan warga yang akan ke TPS diperkirakan 11,0 persen (tidak datang), 20,8 persen (kemungkinan kecil tidak datang), 59persen(dipastikandatang),dan tidak tahu sebesar 9,3 persen. “Nah, dari keikutsertaan warga yang 59,0 atau 60 persen, berubah menjadi 100 persen keikutsertaanpemilihkeTPS,makaakan merubah kontelasi perolehan suara kedua pasangan dan bisa menguntungkan salah satu calon,” tambah Dolfi. Di sisi lain yang percaya akan

Al Bayan ... aqidah Syiah adalah Abdullah bin Saba’. Dialah pelopor khurafat dan bid’ah. Ia katakan Sayyidina Ali bin Abi Thhalib lebih berhak menjadi Khalifah (peganti Nabi) ketimbang shahabat yang lain. Abubakar, Umar bin Khattab da Usman bin Affan telah merampas hak Ali. Kekejaman Bani Umayyah dan Bani Abbas terhadap gerakan Syiah ini menyebabkan mereka mengarang ribuan hadis palsu yang mengkultus Ali bin Abi Thalib dengan Fathimah Az-Zahra serta anak keturunannya. Sebaliknya phak Umayyah, juga dilanjutkan pihak Abbasiyah,

mereka juga mengarang ratusan hadits palsu untuk menandingi hadis palsu dari Syiah. Tidak semua Syiah itu sesat, ada juga yang tidak menyimpang. Khusus Syiah yang menyimpang dari aqidah yang benar disebut Syiah Ghullah (Ekstrim). Syiah inilah yang perlu diwaspadai, sebab mereka mengkafirkan para sahabat Nabi, istri Nabi, menolak hadishadis dari Abu Hurairah, Aisyah dan Ibnu Abbas. Bahkan ada di antara mereka yang tidak lagi shalat lima waktu (Syiah Druz) di Lebanon, menuhankan Ali (Syiah Sabaiyah) di Israel. Ada sekte Syiah yang menghalalkan zina, arak dan narkoba.

Waspada/Rudi Arman

USTADZ DR. Azhar Sitompul, MA (berdiri) memberikan ceramah saat acara menepungtawari dua calon jamaah haji asal Harian Waspada, Amir Syarifuddin (wartawan) dan Zulfan Syam (percetakan) di Bumi Warta Waspada, Rabu (19/9).

Penepungtawaran Dua Calhaj Dari Harian Waspada

MEDAN (Waspada): Keluarga besar Harian Waspada, Rabu (19/9) di gedung Bumi Warta Jl. Letjen Suprapto menggelar acara tepung tawar terhadap dua calon haji asal Harian Waspada, yakni Amir Syarifuddin (wartawan) dan Zulfan Syam (percetakan) yang masing-masing akan berangkat dengan Kloter I dan Kloter IX. Acara dihadiri Pemimpin Umum Harian Waspada Hj. Rayati Syafrin, Wapenjab H. Sofyan Harahap,Wakil Pimpinan Perusahaan H. Bachtiar Tanjung, para Redaktur, Bagian Personalia Chaidir Anwar, Bagian Litbang Akmal AZ dan H. Erwan Effendi Batubara, wartawan dan karyawan. Acara diawali pembacaan ayat-ayat suci Alquran, selanjutnya diisi ceramah seputar pelaksanaan ibadah haji di Tanah Suci Makkah oleh Ustadz DR. Azhar Sitompul, MA. Dalam ceramahnya, Azhar

Sitompul menyampaikan, Madinah dan Makkah merupakan tanah suci, justru itu tidak boleh dikotori. Berkaitan dengan itu, setiap orang yang hendak menunaikan ibadah haji semestinya harus benar-benar bersih. ‘’Jadi sesuatu yang suci tidak boleh dikotori oleh orang dan sesuatu yang tidak suci,’’papar Azhar dan menambahkan, pergi atau datang ke Tanah Suci adalah benar-benar hendak melaksanakan ibadah yang semata-mata karena Allah SWT. Maka itu, semua persiapan bagi calon jamaah haji adalah persiapan untuk melaksanakan ibadah, bukan yang lain. Dalam kaitan itu, Azhar mengutip paparan sebuah buku karangan seorang muallaf dari Amerika, dan berkaitan dengan pelaksanaan ibadah haji, yakni: sedikitnya ada delapan langkah yang harus dilaksanakan sebelum berangkat untuk menunai-

kan ibadah haji di Tanah Suci. Di antaranya, mesti membersihkan harta-benda, kemudian saat tiba di Madinah dan Makkah jangan pernah mengeluh, melainkan menerima apa adanya yang datang dari Allah SWT. Selain itu, kita harus menyadari bahwa kita adalah hamba Allah dan sebagai tamu Allah. Sebelumnya, H. Syarifuddin El-Hayat mewakili pimpinan menyampaikan sambutan, yang pada intinya berharap kedua karyawan Harian Waspada yang akan berangkat ke Tanah Suci Makkah dapat melaksanakan ibadah-ibadah yang berkaitan dengan ibadah haji tersebut. Penepungtawaran diawali oleh Pemimpin Umum Harian Waspada Hj. Rayati Syafrin, disusulWakil Pimpinan Perusahaan,Wakil Penanggungjawab, Redaktur Kota David Swayana, Redaktur Sumut H. T. Doni serta lainnya. (m34)

Gatot Minta ...

dan mengimbau para Calhaj mengikuti arahan pembimbing seperti menjaga kesehatan serta memaksimalkan pelaksanaan ibadah haji agar menjadi haji mabrur. “ Informasi yang saya peroleh,dari 8.180 kuota haji, yang melunasi sekitar 8.114, jadi yang tidak melunasi ada 66 orang. Untuk itu, saya meminta Kemenag Sumut sebagai leading sektor, untuk terus mengkomunikasikan ke pusat, agar kuota yang 66 itu bisa kembali ke Sumut dan digantikan dengan waitinglist Sumut yang mencapai 82 ribu. Informasinya, sudah diusulkan 174 orang. Mudahmudahan dengan komunikasi yang baik dari Kanwil Kemenagsu bisa kembali ke Sumut, apalagi waiting list kita sudah 82 ribu untuk 8 tahun,” kata Gatot. Dia berharap kepada Panitia Penyelenggara Ibadah Haji (PPIH) Medan untuk memberikan kenyamanan kepada Calhaj selama menginap di Asrama Haji Medan. Wamen Puji Pada peninjauan di Asrama Haji, Wakil Menteri Agama RI,

Prof DR H Nasaruddin Umar memberikan pujian dengan berbagai fasilitas dan kesiapan para petugas yang siap menerima kedatangan Calhaj. Dia menilai fasilitas yang tersedia bagi jamaah dari penyambutan sampai ruangan untuk prosesi pemeriksaan nama dan tanda pengenal jamaah sampai pusat pemeriksaan kesehatan cukup baik. “Saya menilainya cukup baik, apalagi petugas yang memberikan pelayanan dan pengamanan cukup banyak. Ini menggambarkan bahwa jamaah haji mendapatkan pelayanan yang optimal,”kata Nasaruddin. Cek Kesehatan Sementara itu, Kabid Upaya Kesehatan dan Lintas Wilayah Kantor Kesehatan Pelabuhan Kelas I Medan dr. Ariyanti mengatakan, saat masuk ke Asrama Haji, kesehatan Calhaj kembali diperiksa. “Akan dilakukan pemeriksaan terakhir, dari sinilah nanti diketahui apakah Calhaj itu masuk dalam kelompok resiko tinggi (Risti) atau tidak,” katanya. Pada pemeriksaan terakhir, katanya, akan dilakukan pemeriksaan urin bagi wanita usia subur (di bawah 50 tahun), untuk mengetahui apakah wanita itu hamil atau tidak. “Dalam peraturan SK Menkes dan Kemenag, wanita hamil tidak diperbolehkan berangkat untuk menunaikan ibadah haji di Tanah Suci. Ini juga diatur dalam Undang-undang Kesehatan penerbangan,” jelasnya. Selain pemeriksaan urin, juga dilakukan pemeriksaan umum kepada seluruh Calhaj. Menurutnya, Calhaj yang masuk dalam kelompok Risti harus menjaga pola makan dan istirahat cukup saat di sana. Saat ini Kemenkes RI sudah menyuplai obat-obatan untuk Calhaj seperti obat diare, pusing dan lainnya. (m37/h02)

Sebanyak 8.114 jamaah telah melakukan pelunasan biaya perjalanan haji, sedangkan kuota untuk Sumatera Utara sebanyak 8.180 jamaah, ditambah petugas sebanyak 93 orang. Sedangkan petugas Kloter, yakni ketua regu sebanyak 738 orang dan ketua rombongan 181 orang. “Kepada mereka telah diberikan pembekalan dan pelatihan secara berkala sebelum melakukan tugasnya,”kata Abd Rahim. Fokus Ibadah Sementara, Plt Gubsu H Gatot Pudjo Nugroho mengingatkan Calhaj agar fokus dalam melaksanakan ibadah haji, karena pemerintah telah berupaya memberikan berbagai fasilitas yang memberi kemudahan kepada jamaah. Gatot mengingatkan para jamaah agar tidak terpengaruh memikirkan oleh-oleh yang akan dibawa pulang. “Jamaah calon haji Sumut kita imbau fokus kepada pelaksanaan ibadah haji,” kata Gatot

Beredar Sayembara ... sayembara itu telah menimbulkan ketidaknyamanan mengingat Presiden Yudhoyono datang ke negara itu untuk memenuhi undangan Ratu Inggris dalam kapasitasnya sebagai Kepala Negara. “Kami sudah berkomunikasi dengan Kedubes Inggris di Jakarta. Terus terang ini tidak nyaman bagi kami, perlu diluruskan,” katanya. Kedua negara, tambah Julian, melakukan komunikasi untuk menghindari kesalahpahaman mengenai isu sayembara tersebut. “Pemerintah Inggris khususnya Ratu Inggris mengundang Presiden salah satunya karena beliau dikenal sebagai tokoh yang sangat berjasa mema-

jukan demokrasi di Indonesia,” katanya. Julian mengatakan pemerintah sebetulnya tidak ingin menanggapi rumor tersebut namun karena telah ramai di publik maka pemerintah merasa perlu memberikan penjelasan. “Ini harus dijelaskan agar publik mengetahui situasinya, sayembara menangkap Presiden itu kan dinilai melecehkan simbol negara,” ujarnya. Namun, menurut Julian, pemerintah belum memutuskan untuk mengambil tindakan lebih lanjut dan hanya memastikan bahwa hal itu bukan berasal dari pemerintah atau lembaga resmi. “Lebih-lebih itu disuarakan oleh sekelompok orang yang mungkin memiliki kepentingan, politik atau lainnya,” katanya.

WASPADA Rabu 19 September 2012

Medan Metropolitan


Soal Kasus Perubuhan Masjid Al Khairiyah

Penetapan Tersangka Jangan Hanya Wacana MEDAN (Waspada): Penasehat hukum Forum Umat Islam Sumatera Utara Irwansyah Gultom, SH menegaskan, penetapan tersangka bukan menjadi akhir penyelesaian kasus perubuhan Masjid Al Khairiyah. Penyidik harus menangkap aktor intelektual kasus tersebut dan menahannya. “Yang paling penting, penetapan tersangka dalam kasus perubuhan Masjid Al Khairiyah jangan hanya wacana. Kasus itu dilaporkan sejak 2004 ke Poltabes Medan (kini Polresta Medan), namun hingga kini berkasnya belum rampung juga.

Pelaku perubuhan masjid tersebut belum juga ditangkap. Kapan lagi kasus ini disidangkan di meja hijau,” ujar Irwansyah Gultom kepada Waspada, Rabu (19/9). Menurut Irwansyah, belum ditangkapnya tersangka dalam kasus tersebut, membuktikan aparat Polresta Medan tidak serius menyelesaikan kasus ini. “Padahal, tersangka ditangkap, maka penyidik akan mengetahui siapa dalang kasus perubuhan masjid. Dari tersangka itu, polisi akan mendapat informasi siapa yang menyuruhnya melakukan perubuhan masjid,” tambahnya. Sementara itu, Ketua Aliansi Ormas Islam Pembela Masjid

Sumatera Utara Drs. Leo Imsar Adnans mengatakan, penetapan tersangka harus dibuktikan dengan menangkap para pelaku bersama pihak pengembang. Penyidikannya juga harus dilakukan secara profesional dan bukan setengah hati. Namun, tambah Leo Imsar, yang menjadi tanda tanya apakah polisi berani menangkap dan menahan pelaku. Sebab, pelaku merupakan perpanjangan tangan dari PT Jatimasindo. Sementara PT Jatimasindo merupakan grup perusahaan Adlin Lis, pengusaha kuat yang sangat berpengaruh di Sumatera Utara. Buktinya, sejak kasus ini dilaporkan ke Polresta Medan tahun 2004, tidak ada tindak lanjut dari

pihak kepolisian sehingga kasusnya mengendap. Menurut Leo Imsar, citra kepolisian akan semakin membaik bila penyidik menangkap para pelaku dan aktor intelektual perubuhan masjid tersebut demi terciptanya penegakan hukum. “Semoga citra kepolisian akan semakin membaik dan semoga Kapolresta Medan Kombes Monang Situmorang bisa sesegera mungkin menyelesaikan kasus ini. Apalagi pak Kapolresta benar-benar mengetahui kasus ini,” ujar Leo Imsar. Sebagaimana diketahui, pembongkaran secara paksa terhadap Masjid Al Khairiyah dan Madrasah Ibtidaiyah tanpa

sepengetahuan pengurus BKM yang sah pada 27 Desember 2003 atau tiga hari menjelang bulan suci Ramadhan. Kasus pembongkaran paksa tersebut

telah dilaporkan ke Poltabes Medan (kini Polresta) sesuai No Pol LP/1655/K3/VI/2004/Ops Tabes tertanggal 8 Juni 2004 yang diterima oleh Briptu Eva Selly

Pardede. Namun, proses penyelidikan kasus pengrusakan dan pembongkaran secara paksa tersebut tidak ditindaklanjuti

oleh pihak kepolisian. Buktinya, sudah hampir 8 tahun kasus tersebut belum juga disidangkan oleh Pengadilan Negeri Medan. (h04)

Polisi Kejar Dalang Perampokan, Penikaman MEDAN (Waspada): Polsek Sunggal bentuk timsus memburu dalang pelaku perampokan dan penikaman hingga nyaris menewaskan korbannya Fery Azhari, 44, yang mengalami luka 10 tusukan senjata tajam dan clurit. Perampokan itu terjadi di rumah korban Komplek PLN, Jln. Binjai Km 10,5 Gang Masjid, Desa Payageli, Kec. Sunggal, Kab. Deliserdang. “Satu tim sudah kita turunkan, kini mereka sedang bekerja dilapangan mengumpulkan berbagai informasi baik dari sekitar kediaman korban maupun tempat dalang pelaku bermain yakni di kawasan Jln. Kapten Muslim, Pasar Sei Sikambing Medan,” kata Kanit Reskrim Polsek Sunggal AKP Victor Ziliwu, SH, SIK kepada Waspada di lapangan, Rabu (19/9) sore. Victor didampingi Panit Reskrim Aiptu B Sebayang SH mengatakan, tim yang diturunkan itu dengan target dalang pelaku perampokan berinitial AC tertangkap. “Kita sebarkan personel baik di sekitar kediaman pelaku AC, tempat ngumpul minum tuak dan lokasi permainannya,” sebutnya. Sementara satu pelaku berinisial YA, 40, sudah ditangkap ketika hendak berobat kepalanya yang sempat dibacok korban di RSU Sari Mutiara Jln. Kapten Muslim Medan. Sedangkan otak pelakunya mengendarai sepedamotor Yamaha Mio kini masih terus dikejar. “Kita sedang

mencari foto pelaku AC, bila ditemukan akan diperbanyak untuk disebarkan jajaran kepolisian dan tempat lainnya,” ujar Victor. Sedangkan korban Fery Azhari kepada Waspada di rumahnya, usai menjalani perawatan di RSU Sundari Jln. TB Simatupang, Medan Sunggal, mengatakan, tindakan kedua perampok itu cukup sadis. Kejadian berawal pada Minggu (16/9) malam, korban bersama istrinya Lenny Saputri, 25, dan buah hatinya berusia beberapa bulan serta orangtuanya sedang duduk-duduk ketika usai shalat Mahgrib. Korban Fery Azhari duduk diteras rumah, sedangkan istri bersama anak dan orangtuanya mantan pensiunan PLN itu duduk di dalam rumah sambil menonton telivisi. Tiba-tiba terlihat dua pelaku bersenjata tajam dan clurit berada di halaman rumah, tidak diketahui mereka itu masuk dari mana diduga pelaku lompat pagar. Selanjutnya tersangka YA, penduduk Jln. Kapten Muslim Gang Jawa, Kel. Sei Sikambing C-2, Kec. Medan Helvetia, langsung mengalungkan clurit di leher korban. Untuk melepaskan clurit yang dikalungkan di lehernya, korban dengan cepat jongkok hingga lolos dari maut terus masuk ke dalam rumah sambil mengunci pintu dari dalam. Kedua pelaku terus mendobrak pintu hingga kunci pintu

Waspada/Ismanto Ismail

KORBAN Fery Azhari terbaring di rumahnya didampingi istrinya Lenny Saputri. rusak. Korban lari ke dapur mengambil parang dan keluar dari pintu belakang lalu kembali ke depan langsung mengayunkan parangnya dan mengenai kepala tersangka YA. Melihat kejadian itu, AC terus mengejar korban sambil menikami tubuh korban dengan pisau dan clurit. Melihat korban terpakar berlumuran darah, pelaku masuk ke dalam rumah dengan mengobrakabrik yang ada di atas meja bahkan sempat mendorong orangtua korban hingga nyaris terjatuh ke lantai. Tindakan pelaku bukan sampai disitu saja, melainkan mereka menyempatkan meng-

ambil dua handpohne milik korban. Takut ditangkap massa, perampok bersenjata tajam langsung kabur. Kanit Reskr im Polsek Sunggal AKP Victor Ziliwu, SH, SIK bersama timnya terus menindaklanjuti dan tempo satu jam tersangkaYA dibekuk ketika sedang menjalani perobatan di RSU Sari Mutiara Medan. “Kami mengucapkan terimakasih kepada Polsek Sunggal cepat mengungkapkan kasus itu dan tempo satu jam seorang dari dua pelaku berhasil ditangkap. Pelaku itu datang untuk merampok dan kami sama sekali tidak kenal mereka,” ungkap Zul, keluarga korban. (m36)

Medan Metropolitan


WASPADA Kamis 20 September 2012

Jadwal Penerbangan Di Bandara Polonia No. Penerbangan Ke Flight


Tiba Dari


GARUDA INDONESIA 1 Jakarta GA-181 2 Jakarta GA-183 3 Jakarta GA-185 4 Jakarta GA-187 5 Jakarta GA-189 6 Jakarta GA-191 7 Jakarta GA-193 8 Jakarta GA-147 9 Jakarta GA-195 10 Banda Aceh GA-142 11 Banda Aceh GA-14.6

05.20 08.45 10.30 11.55 14.10 15.55 17.55 18.45 19.55 09.45 14.50

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Banda Aceh Banda Aceh

GA-180 GA-182 GA-184 GA-186 GA-146 GA-188 GA-190 GA-192 GA-196 GA-143 GA-147

08.00 09.45 11.10 13.20 14.20 15.10 17.10 19.10 22.00 12.25 17.55


CITILINK 1 Jakarta 2 Jakarta 3 Jakarta 4 Batam 5 Batam

QG-831 QG-833 QG-835 QG-880 QG-882

8.40 18.50 20.05 10.00 14.20

Jakarta Jakarta Jakarta Batam Batam

QG-830 QG-832 QG-834 QG -881 QG-883

08.05 09.05 09.35 13.15 17.55

AIR ASIA 1 Kuala Lumpur 2 Kuala Lumpur 3 Kuala Lumpur 4 Kuala Lumpur 5 Penang 6 Penang 7 Kuala Lumpur 8 Baangkook 9 Bandung 10 Surabaya 11 Bandung

QZ-8050 QZ- 8054 AK- 1351 AK-1355 QZ-8072 AK-5837 AK-1357 QZ-8084 QZ-7987 QZ-7611 QZ-7981

06.05 11.20 08.00 17.25 104.10 18.30 21.25 17.00 08.25 11.35 17.10

Kuala Lumpur Kuala Lumpur Kuala Lumpur Kuala Lumpur Penang Penang Kuala Lumpur Bangkok (2,4,6) Bandung Surabaya Bandung

QZ-8051 QZ-8055 AK-1350 AK-1354 QZ-8073 AK-5836 AK-1356 QZ-8085 QZ-7986 QZ-7610 QZ-7980

08.30 10.55 07.35 17.00 16.30 18.15 21.05 29.55 05.35 11.10 19.55

LION AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Jakarta 5 Jakarta 6 Jakarta 7 Jakarta 8. Jakarta 9 Jakarta 10 Jakarta 11 Jakarta 12 Jakarta 13 Jakarta 14 Penang 15 Penang 16 Jakarta 17 Jakarta 18 Jakarta 19 Jakarta 20 Jakarta 21 Surabaya 22 Surabaya 23 Banda Aceh 24 Jakarta

JT- 211 JT- 381 JT- 397 JT- 207 JT- 301 JT- 395 JT- 303 JT- 215 JT-201 JT- 387 JT-399 JT-383 JT-385 JT-1282 JT-1288 JT-205 JT-203 JT-219 JT-309 JT-209 JT-0970 JT-972 JT-396 JT-305

0545 06.45 07.50 08.40 10.00 11.00 11.50 12.25 12.50 13.50 15.20 15.50 17.00 08.05 13.35 2010 18.00 20.40 19.10 21.00 07.00 12.55 12.15 18.30

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Penang Penang Jakarta Jakarta Jakarta Jakarta Jakarta Surabaya Surabaya Banda Aceh Jakarta

JT-380 JT-300 JT-394 JT-302 JT-214 JT-200 JT-204 JT-398 JT-382 JT-384 JT-202 JT-212 JT-396 JT- 1283 JT-1289 JT-206 JT-208 JT-386 JT-308 JT-218 JT-971 JT-973 JT-397 JT-210

08.20 09.20 10.20 11.10 11.40 12.10 13.10 14.40 15.10 16.20 17.20 17.50 19.45 10.25 15.55 9.20 18.25. 21.05 22.20 23.20 12.15 16.00 07.05 07.20

MALAYSIA 1 Kuala Lumpur 2 Kuala Lumpur

MH-861 MH-865

09.40 15.45

Kuala Lumpur Kuala Lumpur

MH-860 MH-864

08.50 15.00

SILK AIR 1 Singapura 2 Singapura

MI-233 MI-237

08.40 20.35

Singapura Singapura

MI-232 MI-238

07.50 19.50

VALUAIR 1 Singapura (2.4,7) VF-282 2 Singapura (1,3,6) VF-284

10.55 18.25

Singapura (2.4.7) VF-281 Singapura (1,3,6) VF-283

09.55 17.40

BATAVIA AIR 1 Jakarta 2 Jakarta 3 Batam

Y6-594 Y6-596 7P-568

16.00 18.15 12.25

Jakarta Jakarta Batam

Y6-593 Y6-595 YP-567

13.00 15.15 10.30

SRIWIJAYA AIR 1 Jakarta 2 Jakarta 3 Batam 4 Pekanbaru 5 Pekanbaru 6 Banda Aceh 7 Penang 8 Padang

SJ-015 SJ-011 SJ-035 SJ-043 SJ-041 SJ-010 SJ-102 SJ-021

13.25 15.55 16.50 10.20 17.20 12.50 07.20 16.00

Jakarta Jakarta Batam Pekanbaru Pekanbaru Banda Aceh Penang Padang

SJ-010 SJ-016 SJ-034 SJ-042 SJ-040 SJ-011 SJ-103 SJ-020

11.00 16.20 14.55 11.50 15.45 14.20 09.50 14.10

FIRE FLY 1 Subang 2 Penang 3. Penang

FY -3413 FY- 3403 FY- 3407

14.35 10.55 18.20

Subang Penang Penang

FY-3412 FY-3402 FY-3406

14.05 10.35 17.55

MANDALA AIRLINE 1 Jakarta 2 Singapura 3. Jakarta 4 Jakarta (5.7)

RI-092 RI-861 RI-096 RI-096

06.40 11.00 18.50 16.40

Singapura Jakarta Jakarta Jakarta (5.7)

RI-862 RI-093 RI-097 RI-097

07.20 11.30 19.20 20.55

Jadwal Perjalanan Kereta Api No KA

Nama KA

U.2 Sri Bilah U.4 Sri Bilah U.6 Sri Bilah U.8 Sri Bilah U.1 Sri Bilah U.3 Sri Bilah U.5 Sri Bilah U.7 Sri Bilah U.10 Sri Bilah U.12 Sri Bilah U.9 Sri Bilah U.11 Sri Bilah U.14 Putri Deli U.16 Putri Deli U.18 Putri Deli U.13 Putri Deli U.15 Putri Deli U.17 Putri Deli U.22 Siantar Ekspres U.21 Siantar Ekspres PLB 7000 Sri Lelawangsa PLB 7002 Sri Lelawangsa PLB 7004 Sri Lelawangsa PLB 7008 Sri Lelawangsa PLB 7010 Sri Lelawangsa PLB 7012 Sri Lelawangsa PLB 7001 Sri Lelawangsa PLB 7003 Sri Lelawangsa PLB 700 Sri Lelawangsa PLB 7009 Sri Lelawangsa PLB 7011 Sri Lelawangsa PLB 7012 Sri Lelawangsa


Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Bisnis Bisnis Bisnis Bisnis Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi



Berangkat Datang

Medan Medan Medan Medan Rantau Prapat Rantau Prapat Rantau Prapat Rantau Prapat Medan Medan Binjai Binjai Medan Medan Medan Tanjung Balai Tanjung Balai Tanjung Balai Medan Siantar Medan Medan Medan Medan Medan Medan Tebing Tinggi Binjai Binjai Binjai Binjai Binjai

Rantau Prapat Rantau Prapat Rantau Prapat Rantau Prapat Medan Medan Medan Medan Binjai Binjai Medan Medan Tanjung Balai Tanjung Balai Tanjung Balai Medan Medan Medan Siantar Medan Tebing Tinggi Binjai Binjai Binjai Binjai Binjai Medan Medan Medan Medan Medan Medan

08.00 10.30 15.00 22.50 08.05 14.35 16.55 23.25 04.50 20.15 09.20 21.40 06.50 12.50 17.10 07.15 11.55 19.25 11.25 07.00 18.00 07.30 05.00 09.50 12.15 14.40 05.20 08.55 06.30 11.00 13.30 15.50

13.16 15.31 20.18 03.34 13.12 19.49 21.50 04.21 05.42 21.07 10.12 22.32 11.17 17.27 22.15 11.54 16.28 22.47 14.50 10.45 20.04 08.22 05.52 10.42 13.07 15.32 07.22 09.47 07.22 11.52 14.22 16.42


Pemko Didesak Tingkatkan Fasilitas Sarana Pendidikan Madrasah MEDAN (Waspada): Delapan fraksi di DPRD Medan mendesak Pemko Medan harus segera memperbaiki dan meningkatkan fasilitas sarana pendidikan seluruh madrasah baik negeri maupun swasta yang ada di Kota Medan. Hal ini dimaksudkan untuk memperkuat peran generasi muda dalam kehidupan beragama yang lebih baik. Hal tersebut disampaikan delapan fraksi di DPRD Medan, Rabu (19/9), melalui rapat paripurna DPRD Medan saat menyampaikan pemandangan umum terhadap rancangan peraturan daerah (Ranperda) tentang wajib belajar Madrasah Diniyah Tamiliyah Awaliyah (MDTA) dan lembaga kemasyarakatan. Rapat paripurna DPRD Medan itu dipimpin Wakil Ketua DPRD Medan Ikrimah Hamydi dihadiri para anggota dewan. Sementara dari eksekutif dihadiri langsung Wakil Wali Kota

Medan Dzulmi Eldin beserta sejumlah SKPD. Ahmad Arif dari Fraksi Partai Amanat Nasional (PAN) menyebutkan, pembuatan Ranperda tentang MDTA ini dinilai hanya menjadi kepentingan pihak Pemko Medan, dimana Pemko terkesan ingin mengawasi dan mengatur keberadaan MDTA. Menurut dia, Pemko Medan sendiri tidak terlihat semangat untuk memberdayakan dan mengembangkan MDTA. Sebagai bukti untuk pendataan saja Pemko Medan, dinilai tidak maksimal karena yang terdata yakni hanya 440, sementara faktanya jauh lebih banyak. Fraksi PAN menyayangkan Pemko Medan karena tidak adanya pembinaan terhadap MDTA. Khususnya masalah penggajian bagi guru MDTA di Medan hanya Rp200 ribu s/d Rp 500 ribu per bulan. Fraksi ini juga mendesak Pemko Medan agar ke depan dapat menambah penghasilan guru MDTA yang ditampung di APBD.

Fraksi Demokrat DPRD Medan melalui juru bicaranya Ir Yahyah Payungan Lubis mempertanyakan peran yang dilakukan Pemko Medan, untuk pembinaan dan pengawasan terhadap Madrasah Diniyah Takmiliyah Awaliyah (MDTA) yang ada di Kota Medan selama ini. Dengan penetapan Ranperda ini nantinya, Fraksi Demokrat mengharapkan Pemko dapat memfasilitasi sarana dan prasarana pendidikan ke depan. Menurut Yahya, setelah penetapan Ranperda MDTA ini, Pemko Medan harus mengantisipasi perpindahan sekolah bagi setiap tamatan SD yang berasal dari luar Medan hanya mendapat rekomendasi. Melalui proses tersebut sering terjadi tindakan tidak terpuji dengan melakukan pungutan yang membebani mayarakat. Sama halnya dengan rencana tambahan pengetahuan agama maupun pembentukan mental keagamaan dan budi pengerti. Fraksi Demokrat me-

nganggap perlu dibuat sanksi bagi yang tidak mengikutinya. Namun diharapkan masih dianggap perlu dilakukan kajian lebih mendalam terhadap sanksi dimaksud. Pendapat hal yang hampir sama juga disampaikan Fraksi PKS melalui juru bicaranya Juliandi Siregar menyebutkan, pengajuan Ranperda MDTA dinilai sangat positif karena diwajibkan untuk mengikuti pendidikan dasar Islam non formal sejak dini. Hal tersebut dianggap perlu karena sangat mendukung penambahan mata pelajaran agama di sekolah yang sangat minim dan berperan sebagai pendukung. Ditambahkan Juliandi, penerapan Perda MDTA harus realistis dan berangkat dari kondisi sistem pendidikan yang ada di Kota Medan. Dalam pembuatan Ranperda ini juga Fraksi PKS mempertanyakan sejauh mananaskahakademispembuatan Ranperda dimaksud serta keterlibatanberbagaipihak.(m30)

Musim Hujan, Penderita DBD Diperkirakan Meningkat MEDAN (Waspada): Penderita Demam Berdarah Dengue (DBD) di Sumatera Utara, diperkirakan meningkat pada musim hujan. Pemerintah kabupaten/ kota diminta agar meningkatkan pelayanan. “Artinya, petugas melakukan surveillance (pemantauan) di daerahnya, kalau ada kasus segera dilaporkan ke Dinas Kesehatan supaya bisa dilakukan penyidikan epidemiologi,” kata Kepala Seksi P2P Bidang PMK Dinas Kesehatan Sumatera Utara Sukarni, Senin (17/9). Berdasarkan data Dinkes

Sumut, penderita DBD hingga Juni 2012 di Sumatera Utara mencapai 2.182 orang. Dari jumlah itu, 14 orang meninggal dunia. Kata Sukarni, Medan merupakan daerah yang terbanyak penderita DBD-nya yakni mencapai 747 orang. Selain merupakan daerah dengan jumlah penduduk terbanyak yakni 2.117. 224 jiwa, Kota Medan juga termasuk daerah yang padat pemukiman sehingga rawan terjangkit DBD. “Selain Medan, daerah Pematang Siantar juga banyak penderita DBDnya mencapai

297 orang, Deliserdang 250 orang, Simalungun 267 orang, Sibolga 65 orang, Binjai 59 orang, Asahan 61 orang. Pada musim hujan ini bisa saja kemungkinan penderitanya naik, makanya kita minta agar kabupaten/kota tingkatkan pemantauan di daerahnya,” sebutnya. Kata dia, dalam masalah DBD yang harus dilakukan adalah pencegahannya. Di antaranya, meminimalkan tempattempat nyamuk bersarang, terutama air-air yang terlantar dan umumnya banyak ditemui di sekolah, perkantoran, rumah.

Al Washliyah Kecam Film Innocence Of Muslim MEDAN (Waspada): Al Jamiyatul Washliyah mengecam Film Innocence Of Muslim yang marak beredar di Youtobe dan mendapat protes melalui aksi demonstrasi umat muslim di berbagai negara di dunia terhadap Amerika Serikat dimana film itu berasal dan telah menewaskan sejumlah orang. Ketua PD Al Washliyah Kota Medan Azzam Rizal didampingi pengurus lainnya di Sekretariat PD Al Washliyah Kota Medan, Selasa (18/9) mengatakan, film Innocence Of Muslim menceritakan tentang Nabi Muhammad SAW jelas bertujuan menghina Islam. Bahkan sutradaranya Sam Bacile berkali-kali mengatakan Islam adalah kanker secara terbuka pada media. Bahkan salah seorang pemuka agama di Amerika, pen-

deta Terry Jones mendukung sepenuhnya film tersebut dan mengatakan Nabi Muhammad SAW hanya orang gila yang tidak ada hubungannya dengan Tuhan. Hal yang diungkapkan itu tak mengejutkan karena Jones sendiri pernah membakar Alquran di depan umum. Pengulangan kasus pelecehan agama, tambahnya, bukanlah hal yang membingungkan. Sebab perundang-undangan Amerika membolehkan untuk membuat pernyataan dengan media apapun untuk menghina. Bahkan konstitusi Amerika menjamin siapa pun yang menghina keyakinan lain dengan dasar kebebasan bersuara ala Amerika dan tidak akan masuk penjara. “Artinya bagi Amerika ini suatu yang biasa melakukan

penghinaan, hujatan dan memecah belah umat beragama di dunia sehingga akhirnya kita terpancing dengan cara-cara yang mereka lakukan terhadap misinya,” sebutnya. Hal itu sudah jelas dinyatakan di dalam Alquran surat Al Baqarah ayat 120 yang menyebutkan “Mereka tidak akan pernah senang kepada Islam”. “Maka dalam hal ini sewajarnya diletakkan suatu batasan yang membedakan di antara penghinaan dan penyelewengan agama dengan kebebasan bersuara dan hak untuk berkarya. Perlu kesepahaman tokohtokoh agama serta menunjukkan bahwa kebebasan berkarya tidak boleh disalahgunakan untuk tujuan pelecehan suatu agama. Kalau tidak, kita sangat mengecam film dan sutradaranya,”tutur Azzam. (m39)

Begitu juga ditempat-tempat umum seperti pasar. “Intinya masyarakat harus melakukan pencegahan yakni 3 M ditambah 1 plus. Selain itu, pemerintah juga ada program pengasapan atau fogging. Itu merupakan kegiatan rutin, tapi biasanya memang dilakukan kalau disuatu daerah sudah terjadi kasus,” tuturnya. Sedangkan, Kepala Dinas Kesehatan Medan dr Edwin Effendi MSc mengatakan, fluktuasi iklim akan mempengaruhi kondisi kesehatan pada saat musim hujan. Biasanya, pada saat musim hujan penyakit-penyakit yang berbasis lingkungan akan rentan dialami warga misalnya, DBD, diare, infeksi kulit dan Infeksi Saluran Pernafasan Atas (ISPA). “Untuk itu, supaya terhindar dari penyakit-penyakit yang berbasis lingkungan, masyarakat disarankan mengkonsumsi makanan dengan gizi seimbang. Selain itu menghindari hujan,” ujarnya. Untuk mengantisipasi penyakit berbasis lingkungan terutama DBD, lanjut Edwin, pihaknya melakukan fogging di daerah-daerah yang rawan DBD seperti, Amplas, Helvetia, dan Tembung. Sebab, daerah tersebut merupakan daerah yang padat pemukiman. “Kita sudah lakukan fogging ditempat-tempat yang rawan DBD, diutamakan yang terjadi kasus. Selain itu, masyarakat juga kita harapkan melakukan pencegahan dengan menjaga lingkungan tetap bersih,” ujarnya. (h02)

Waspada/Abdullah Dadeh

PLT GUBSU H Gatot Pujo Nugroho (tengah) didampingi Kadishub Sumut Anthoni Siahaan, GM AP-II Bandara Polonia Medan H Said Ridwan (kanan), Pangkosek Hanudnas III Marsma Yuyu Sutisna, foto bersama taruna ATKP Medan.

Pelayanan Transportasi Baik Jika Dilakukan Melalui Kerjasama MEDAN (Waspada): Pelaksanaan pengembangan dan pelayanan transportasi terwujud dengan baik jika dilakukan melalui sinergi dan kerjasama yang baik antara pemerintah pusat dengan pemerintah provinsi, kabupaten/kota, operator, dan masyarakat. Demikian penegasan Menteri Perhubungan EE Mangindaan dalam kata sambutan tertulis yang dibacakan Plt Gubsu H Gatot Pujo Nugroho ST, pada peringatan Hari Perhubungan Nasional 2012, di lapangan Angkasa Pura-II Bandara Polonia Medan, Senin (17/9). Hadir pada kesempatan itu antara lain Kadis Kementerian Perhubungan Sumut Anthony Siahaan, GM AP-II Bandara Polonia Medan HT Said Ridwan, Kabid Darat Dishub Sumut Darwin Purba, Kadis Perhubungan Medan Renward Parapat, dan SKPD Sumut maupun Medan. Acara diawali mengheningkan cipta dipimpin Plt Gubsu, diakhiri dengan atraksi drumband para taruna Akademi Teknik dan Keselamatan Penerbangan (ATKP) Medan. Kata Menhub, seiring dengan peningkatan kebutuhan pelayanan transportasi ini, maka tidak sedikit timbul persoalan di dalam penyelenggaraannya. Diperlukan kebersamaan dan kerjasama di antara regulator, operator dan para pemangku kepentingan (stakeholder). Melalui kebersamaan, diharapkan akan melahirkan semangat dan kedisiplinan serta mampu bersifat lebih peka dan tanggap terhadap fenomena persoalan yang berkembang, dengan tetap mengedepankan pada keselamatan, keamanan, kenyamanan bagi setiap pengguna jasa. Kata Mangindaan, proses reformasi birokrasi di Kementerian Perhubungan sampai saat ini masih terus bergulir untuk mewujudkan pemerintahan bersih dan transparan. Namun proses tersebut masih terus berjalan dengan berbagai kendala dan tantangan. Karena itu, Menhub mengajak seluruh kalangan untuk turut mensukseskan program reformasi birokrasi yang tengah dilakukan Kementerian Perhubungan. (m32)

1000 Kepling Ikut Orientasi Penerapan PBM MEDAN (Waspada): Keberagaman harus dilihat sebagai kekuatan dan bukan sebaliknya sebagai pemicu konflik disintegrasi bangsa. Sebab, kerukunan umat beragama di dalam keberagaman juga merupakan karakteristik dan barometer stabilitas politik daerah. “Pemerintah berkewajiban memantapkan kerukunan umat beragama untuk menjaga keharmonisan hubungan umat beragama dilandasi toleransi,” kataWali Kota Medan diwakili Kaban Kesbangpolinmas Medan Ceko Wahda Ritonga SH, pada pembukaan orientasi penerapan PBM (Peraturan Bersama Menteri) No. 9 dan 8 tahun 2006 bagi kepala lingkungan se Kota Medan di Balaikota Medan, Sabtu (15/9). Wali Kota menegaskan, selain perkembangan yang cukup pesat sebagai kota metropolitan. Kota Medan juga memiliki identitas yang cukup menonjol sebagai kota multikulturalisme. Oleh sebab itu sering kali Kota Medan disebut sebagai miniaturnya Indonesia, yang bercirikan keragaman etnis, budaya dan agama. Untuk itu, sebagai penyelenggara pemerintahan, pemerintah kota memiliki kewajiban terutama untuk menjaga keharmonisan hubungan sesama umat beragama yang dilandasi toleransi, saling menghormati, menghargai kesetaraan dalam pengamalan ajaran agamanya, serta interaksi sosial dalam kehidupan bermasyarakat, ber-bangsa dan bernegara. MenurutWali Kota, dalam kaitan ini pihaknya perlu memfasilitasi terwujudnya kerukunan umat beragama, mengkoordinasikan kegiatan instansi vertikal, menumbuhkembangkan keharmonisan, saling pengertian, saling menghormati, saling percaya di antara keberagaman etnis, budaya dan agama. Kepada kepala lingkungan (kepling), Wali Kota menegaskan, bahwa mereka adalah komonikator terdepan dalam antraksi antar pemerintah dan masyarakat. Demikian juga sebaliknya. “Saudarasaudara merupakan tujuan pertama dalam berhubungan dengan pemerintah,” ujarnya. Ketua FKUB Medan Drs H Palid Muda Harahapa MA menyebutkan, kegiatan ini bertujuan untuk memberi pemahamanan kepada para kepling tentang penerapan PBM No. 9 dan 8 tahun 2006 tentang kerukunan umat beragama dan pendirian rumah ibadah. Selain itu juga untuk meningkatkan koordinasi dan antisipasi jika di lapanga terdapat disharmonis kerukunan antar umat berama dan pendirian rumah ibadah. Ketua panitia Ir Sutopo melaporkan, kegiatan dilakukan selama lima hari dan berakhir pada 20 September 2012 dengan peserta 1000 kepling, dan setiap hari diikuti sebanyak 200 kepling.(m26)

WASPADA Kamis 20 September 2012

Medan Metropolitan


Sumut Berpotensi Jadi Tujuan Penanaman Modal Uni Eropa MEDAN (Waspada): “SumateraUtaraberpotensimenjaditujuanpenanamanmodal Uni Eropa,” kata anggota DPD RI asal Sumut Parlindungan Purba, SH, MM disela-sela SosialisasiCEPA(Comprehensive Economic Partnership Agreement) atau Perjanjian Kemitraan Ekonomi Komprehensif di Hotel JW Marriott, Medan, Selasa (18/9). Kendati krisis ekonomi melanda banyak negara di Eropa, kata Parlindungan, namun Uni Eropa tetap menjadi pasar terbesar di dunia dan menyumbang 20 persen dari PDB global. Uni Eropa tercatat sebagai mitra dagang terbesar ketiga Indonesia pada tahun 2011 dengan nilai perdagangan lebih dari AS$30 miliar. “Indonesia mengalami surplus perdagangan sebesar AS$8 miliar per tahun. Hal ini menjadi dasar Pemerintah Indonesia masuk da-

lam Perjanjian Kemitraan Ekonomi Komprehensif atau Comprehensive Economic Partnership Agreement (CEPA),” ujar Parlindungan. Sementara itu, Ketua Umum DPN Asosiasi Pengusaha Indonesia (Apindo) Sofyan Wanandi mengatakan, CEPA adalah langkah baru dalam penyegaran kembali hubungan ekonomi antara Indonesia-Uni Eropa. Diharapkan, CEPA mendatangkan keuntungan bagi Indonesia dan Uni Eropa. Sebab, perjanjian ini didukung oleh konstruksi berupa akses pasar, pengembangan kapasitas, serta fasilitasi perdagangan dan investasi untuk menjamin kepentingan Indonesia. “Dengan kata lain, CEPA dapat membantu mengamankan akses pasar Indonesia ke Uni Eropa, menarik penanaman modal asing yang lebih besar, menaikkan volume dan surplus perdagangan Indonesia,

menjamin adanya pengembangan kapasitas serta menciptakan lapangan kerja baru melalui jalur perdagangan dan investasi,” ujarnya. Sofyan Wanandi menambahkan, nilai investasi Uni Eropa di Indonesia mencapai 130 miliar Euro. Ini menjadikan Eropa sebagai sumber investasi terbesar kedua bagi Indonesia. Meski demikian, Indonesia baru menerima 1,6 persen dari total investasi Uni Eropa ke Asia. Angka ini lebih kecil dibanding dengan Malaysia (dua kali lebih besar) dan Singapura (lima kali lebih besar). Sedangkan Dirjen Kerjasama Industri Internasional Kementerian Perindustrian RI Agus Tjahayana Wirakusumah mengatakan, kepentingan dunia usaha belum tentu sama dengan yang lain. Dalam hal ini, masukan dari Apindo sangat penting bagi negosiasi CEPA. “Kita perlu mengenal kekuatan dunia usaha dengan Uni

Eropa. Karena pada saat ACFTA dibuka tahun 2010, ada 10 asosiasi yang menyatakan tidak sanggup bersaing sehingga ada 228 nomor HS yang harus dilakukan renegosiasi. Jadi, hal ini diharapkan tidak akan terjadi dalam CEPA,” katanya. Sementara itu, Wakil Kepala Delegasi Ekonomi Uni Eropa Untuk ASEAN HE Mr. Colin Crooks mengemukakan, Uni Eropa merupakan mitra dagang ke-3 dan sumber penanaman modal asing (PMA) ke-2 bagi Indonesia. “Ini akan membuat kerjasama CEPA bisa menaikkan nilai dan volume ekspor dan menarik PMA lebih besar. Juga meningkatkan daya saing Indonesia terhadap pesaing di ASEAN,” katanya seraya menambahkan, CEPA bisa menciptakan lapangan kerja baru melalui jalur perdagangan dan investasi. Parlindungan Purba selaku Ketua Umum Apindo Sumut menambahkan, sosialisasi ke-

pada pelaku usaha ini untuk mengidentifikasi tantangan, peluang serta rekomendasi kongkrit berbagai sektor usaha di Indonesia. “Nantinya, rekomendasi ini akan disampai-kan kepada pemerintah sebagai bahan pertimbangan dalam negosiasi CEPA dengan Uni Eropa. Jadi, akan bisa mengakomodasi kepentingan dunia usaha. Dengan begitu, berbagai kekhawatiran yang dirasakan dalam implementasi Perjanjian Perdagangan Bebas ASEAN dan China (ACFTA) tidak akan terulang lagi dalam CEPA,” katanya. Dia juga berharap agar Sumatera Utara sebagai salah satu provinsi terbesar di Indonesia dengan berbagai potensi hasil bumi dan industri yang dapat mendukung peningkatan ekonomi, dapat dijadikan sebagai salah satu pilihan Uni Eropa untuk penanaman modal dalam negosiasi CEPA dan Uni Eropa.


KETUA Apindo Sumut Parlindungan Purba, SH, MM (kanan) , Ketua Umum Apindo Sofyan Wanandi (dua kanan), Dirjen Kerja Sama Industri Internasional Kementerian Perindustrian RI Agus Tjahayana Wirakusumah (tiga kanan), Shinta W. Kamdani (tiga kiri), Wakil Kepala Delegasi Ekonomi Uni Eropa Untuk ASEAN Colin Crooks (dua kiri) dan Sekretaris Utama Delegasi Ekonomi Dan Perdagangan Uni Eropa Walter Van Hattum (kiri). “Sumatera Utara punya modal Bandara Internasional Kualanamu yang segera beroperasi pada 2013, punya Pelabuhan Belawan, Kawasan Ekonomi Khusus Sei Mangkei dan potensi lain yang semakin baik bila dikembangkan,” ujarnya. Sosialisasi CEPA bertujuan

untuk mendapatkan masukan dari para pelaku usaha sebelum dilaksanakan penandatanganan Nota Kesepahaman (Memorandum Of Understanding – MoU) bersama Presiden SBY di Bali pada November mendatang. Kegiatan ini merupakan

bagian dari kerjasama antara DPN Apindo dan Uni Eropa di bawah program “Advancing Indonesia’s Civil Society in Trade and Investment (ACTIVE)” dan sebelumnya telah diselenggarakan di Jakarta, Bandung, Surabaya dan Pontianak.(m25)

Birokrasi Amburadul Dan Korupsi Penghambat Utama Pembangunan 2012, Tidak Ada Penerimaan CPNS MEDAN (Waspada): Menteri Pendayagunaan Aparatur Negara (Menpan) dan Reformasi Birokrasi RI menegaskan, ada tiga masalah besar penghambat utama pembangunan di Indonesia. Pertama, birokrasi amburadul dan tidak tertata secara baik. Artinya, para Pegawai Negeri Sipil (PNS) belum profesional. “Kedua, banyak penyelewengan dan penyalahgunaan keuangan negara di berbagai instansi pemerintah,” kata Menpan Azwar Abubakar dalam sambutannya dibacakan staf ahli Menpan Kushardo pada acara wisuda 600 mahasiswa Universitas Setia Budi Mandiri (SBM), di Tiara Covention Hotel, Rabu (19/9). Turut hadir Ketua Yayasan Universitas Setia Budi Mandiri Drs. Arnold Budiman Hutasoit, MBA; Ketua Asoisasi PTS, Rektor SBM Drs Daniel Sitanggang, SE, MM; Ketua Panitia Wisuda Tahun Ajaran 2011-2012 Drs FJ Pinem, para dekan dan pembantu dekan, DPW PAN Sumut,

mewakili Kapoldasu, Wali Kota Medan, sejumlah artis kondang seperti Gading Martin, Katon Bagaskara, Andjie Drive, Ivan Seventeen, Adly Fairuz dan Mikail Hutasoit serta seluruh undangan. Persoalan ketiga, lanjut Menpan, kondisi infrastruktur belum memadai serta anggaran negara untuk pemeliharan dan pembangunan masih relatif kecil. “Ketiga persoalan ini menjadi prioritas bagi Menpan ke depan. Jika tidak, maka proses pembangunan terhambat, “ tegasnya. Karena itu, Menpan terus melakukan upaya penataan struktur birokrasi dengan membentuk Tim Nasional Penata (TNP) organisasi. Melakukan evaluasi pada sembilan kementerian dan delapan LNPK. Pemantauan dan evaluasi terhadap Pemda sebanyak 33 provinsi, 25 kabupaten dan 25 kota. Tidak kalah pentingnya, menurut Menpan, penataan jumlah dan distribusi pegawai negeri sipil (PNS) di negeri ini. Pelaksanaan moratorium rekrutmen PNS 2012. “Artinya ta-

hun 2012 ini, tidak ada penerimaan CPNS karena pemberian formasi harus dipertimbangkan dengan belanja pegawai di bawah 50 persen,” ujarnya. Moratorium penerimaan CPNS hendaknya dipahami dengan menyeluruh oleh pihakpihak yang berkepentingan. Kebijakan moratorium penerimaan CPNS ini adalah upaya pemerintah dalam melakukan penataan pegawai di instansiinstansi pemerintah dan bukan sekadar penundaaan penerimaan CPNS. Pelaksanaan moratorium penerimaan CPNS ini dilakukan sejak 1 September 2011 hingga 31 Desember 2012. Berdasarkan Peraturan Bersama tentang Penundaan Sementara Penerimaan CPNS, maka tenaga honorer merupakan salah satu unsur yang dikecualikan dalam pelaksanaan moratorium. Pengecualian terhadap moratorium ini juga berlaku pada kementerian/lembaga yang membutuhkan beberapa formasi seperti: tenaga pendidik, tenaga dokter dan perawat pada

UPT Kesehatan serta jabatan yang bersifat khusus dan mendesak, Pemerintah Daerah yang belanja pegawainya di bawah/ kurang dari 50 persen nilai APBD. Menpan menambahkan, tiap instansi pemerintah perlu melaksanakan penataan pegawai dengan baik. Guna mewujudkan hal ini, Analisis Jabatan dan Analisis Beban Kerja mutlak dimplementasikan. Guna pemerataan distribusi tenaga pelayanan masyarakat, PNS harus bersedia ditempatkan di instansi dan wilayah di seluruh Indonesia yang membutuhkannya. “Profesionalisme PNS sangat penting guna menunjang suksesnya pembangunan dan penggunaan anggaran belanja negara. Transparansi dan akuntabilitas serta integritas harus dijunjung tinggi. Disamping peningkatan pelayanan publik harus dilakukan dengan mengacu kepada standar pelayanan publik,” katanya. Pada prinsipnya, kata Menpan, reformasi birokrasi merupakan jalan bagi bangsa ini untuk meningkatkan pelayanan

Waspada/M.Ferdinan Sembiring

STAF Ahli Menpan dan Reformasi Birokrasi RI Kushardo, Ketua Yayasan Universitas Setia Budi Mandiri Drs Arnold Budiman Hutasoit, MBA foto bersama usai menyerahkan beasiswa kepada 200 keluarga besar Partai Amanat Nasional (PAN).


PARA pengurus IKA SMA Perguruan Khalsa Medan periode 2012-2015 foto bersama saat Halal Bi Halal. kepada masyarakat yang pada hakekatnya mewujudkan kemakmuran rakyat Indonesia. Sedangkan Kapoldasu Irjen Pol Wisjnu Amat Satra dalam sambutannya dibacakan Irwasda Poldasu Kombes Pol W. Manulang mengharapkan, para sarjana Universitas SBM tidak melanggar peraturan, hukum dan norma-norma sosial serta ajaran agama yang dianutnya.”Teruslah melakukan tindakan positif sehingga nama almamater tetap terjaga. Jadilah contoh dan panutan bagi masyarakat sekaligus sebagai agen perubahan,” tegasnya. Kapoldasu mengimbau agar para alumni tidak ikutikutan aksi geng kereta, tawuran dan penyalahgunaan narkoba. “Saudara semua harus menjadi agen-agen dalam mewujudkan kamtibmas yang kondusif dan bersama-sama membantu aparat keamanan menghalau gangguan teroris, “ ujarnya. Sedangkan Ketua Yayasan Universitas Setia Budi Mandiri Drs Arnold Budiman Hutasoit mengimbau seluruh wisudawan/ti membuktikan diri bahwa mereka adalah sarjana dari universitas SBM yang berkualitas, bermoral, kreatif, inovatif dan mandiri. “Meski saudara-saudara meninggalkan kampus ini, tapi jangan pernah berhenti menimba ilmu. Tidak kalah pentingnya, semua alumni SBM harus beperan dalam pembangunan bangsa dan negara kita sebagaimana misi dan visi kampus yang dikenal dengan Tri Dharma Perguruan Tinggi,” katanya. Ada 600 mahasiswa dari sejumlah program studi diantaranya dari Fakultas Hukum, Ilmu Komputer, Teknik, Ekonomi dan FKIP yang diwisuda pada hari itu. “Kami terus melakukan berbagai terobosan dan penelitian guna meningkat kualitas sehingga lulusan kami dapat bersaing di dunia internasional,” demikian Arnold. (m49)

Ikan Impor Tidak Sumbangkan PAD BELAWAN (Waspada): Ribuan ton ikan impor yang hampir setiap hari masuk ke Sumut melalui Pelabuhan Belawan, tidak menyumbangkan pendapatan asli daerah (PAD). Padahal bisnis ikan impor yang pada awal kehadirannya ditolak organisasi dan tokoh nelayan itu, semakin marak belakangan ini. Situasi itu juga menunjukkan kinerja pemerintah daerah dalam hal ini Dinas Pertanian dan Kelautan Kota Medan, lemah atau tidak mampu menarik restribusi dari ikan impor, walau payung hukumnya sudah ada yakni Perda Kota Medan No 14 tahun 2002 tentang retribusi izin usaha perikanan khususnya kepada impor tir ikan di Belawan. Dalam Perda itu disebutkan, pemerintah akan menarik restribusi ikan impor sebesar Rp100 per kilo. Sayangnya, tarif tersebut oleh sebahagian pengusaha ikan impor dinilai cukup tinggi dan harus dikurangi. Akibatnya, perda itu tidak berlaku sejak diundangkan. Wakil Ketua Asosiasi Pemindangan Ikan Indonesia (Appikando) Drs Mullen Gultom mengatakan, selaku delapan pengusaha ikan impor yang bernaung di organisasinya bersedia

membayar restribusi ikan impor kepada pemerintah daerah selama tarifnya tidak terlalu tinggi. ”Kita siap mendukung pemerintah namun tarif yang diatur dalam Perda nomor 14 itu masih terlalu tinggi,” katanya. Dijelaskan Mullen, sebelum diedarkan ke sejumlah usaha pemindangan di Kota Medan, Tebing Tinggi, Siantar, Langkat dan Batu Bara, pengusaha telah membayar bea ikan impor di kantor Bea dan Cukai. Sehingga jika pengusaha dikenakan lagi dengan tagihan restribusi, maka beban pengusaha akan semakin bertambah. “Berdasarkan aturan yang ada pajak atau pungutan sejenisnya tidak boleh dikenakan terhadap barang yang objek sama. Untuk itu, seharusnya pemerintah bekerjasama dengan BC, agar hasil yang didapat bisa dibagi sebahagian ke Pemko Medan,” sebutnya. Ketua Presedium Masyarakat Medan Utara (PMMU) Saharuddin mendesak Pemko Medan tegas dan bertindak cepat untuk menyelesaikan masalah penerapan Perda Kota Medan No 14 tahun 2002 tersebut dan selama belum ada keputusan, ikan impor harus dihentikan. “Jika kita lihat dari kuota

yang ada maka sudah miliaran rupiah PAD Kota Medan yang hilang karena ketidakmampuan Pemko menariknya. Padahal jika uang itu ada, maka akan bermanfaat untuk pembangunan infrastruktur Medan Utara yang saat ini memprihatinkan,” ujarnya. Pengawasan Sementara itu, Kepala Peng-

awas Sumber Daya Kelautan Perikanan (PSDKP) Belawan Muktar mengaku, pihaknya telah berusaha bekerja maksimal dalam melakukan pengawasan ikan impor dengan cara meminta laporan bulanan peredaran ikan impor dari pengusaha. Walaupun demikian, pihaknya juga mengakui kalau kebocoran tetap terjadi dengan ada-

nya penjualan ikan impor kepada sejumlah pedagang ikan keliling yang banyak datang ke Pelabuhan Perikanan Samudera Belawan (PPSB). “Itupun jumlahnya tidak banyak dan biasanya itu untuk kebutuhan usaha pemindangan kecil yang menurut saya masih wajar dan belum mengganggu pasar ikan lokal,” katanya. (h03)

Sifat Moderat Jangan Sampai Korbankan Ajaran Agama MEDAN (Waspada): Pemahaman keagamaan seharusnya bersifat moderat dengan tanpa mengorbankan ajaran-ajaran dasar agama, disamping perlunya penguatan etika moral dan karakter bangsa di semua lapisan masyarakat. Ketua FKUB (Forum Kerukunan Umat Beragama) Sumut Dr H Maratua Simanjuntak menegaskan itu pada silaturahmi dan dialog dengan mahasiswa Universitas Katolik St Thomas Medan, di kampus Jalan Setia Budi Medan, Selasa (18/9). Dialog yang dibuka oleh Rektor Universitas Katolik St Thomas Hiyeronymus Simorangkir juga menampilkan narasumber Pastor Alfonsus Very Ara dan Drs Hidayat Nasution serta dimoderatori oleh Albert

Pakpahan Menurut Maratua, wawasan seperti itu perlu ditumbuhkembangkan untuk mewujudkan kerukunan antara umat beragama. Upaya lain yang harus dilakukan adalah meningkatkan kerjasama antar umat beragama baik bidang ekonomi maupun sosial. “Selalu mencari persamaan tidak meruncing perbedaan,” sebutnya. Kata Maratau, dalam kaitan inipenguatanakhlakanakda-lam upayamencegahadanyakorupsi, kekerasan, konflik sosial, narkoba, miras, pornografi, demo anarkis serta menumbuhkan minat bekerjakeras, bertanggungjawab dan kesetiakawanan sosial. Rektor Universitas Katolik St Thomas Hiyeronymus Simorangkir menyebutkan, bangsa

Indonesia memang berbedabeda agama, suku, etnis dan lainnya. Namun, kita harus tetap satu dan satu dalam perbedaan. Disebutkan dia, satu hal yang bisa menyatukan dan mempererat bangsa Indonesia adalah nilai-nilai kultural. Dimana adat istiadat kita dari dulu telah mengajarkan kita untuk saling menghormati, menghargai, dan bekerjasama. “Nilai kultur seperti inilah yang bisa merukunkan kita,” ujarnyar. Sementara Pastor Alfonso Very Ara menyebutkan, agama berbeda dengan iman. Sebab, bisa saja orang memiliki agama tapi tidak beriman. Relasi dan dialog hanya bisa terjadi apabila ada iman. Sedang dialog sendiri harus dilandasi dengan kebenaran dan keadilan. (m26)

Alumni Akan Urus Izin Operasional Perguruan Khalsa MEDAN (Waspada): Menghidupkan kembali Perguruan Khalsa Medan yang ditutup sekitar tahun 1994/1995 bukan untuk mencari popularitas murahan. Tapi keinginan itu muncul dari lubuk hati para alumninya di Jakarta, Bandung dan Sumut yang merasa prihatin terhadap keberadan perguruan tersebut. Bahkan dalam waktu dekat Ikatan Keluarga Alumni (IKA) SMA Perguruan Khalsa Medan akan menyusun delegasi untuk berdialog dengan AS Dillon, staf ahli pejabat tinggi di pemerintahan pusat yang juga salah seorang keluarga dari Yayasan Pendidikan Nasional Khalsa Medan. Hal tersebut terungkap saat Halal Bi Halal dan pengukuhan pengurus IKA SMA Perguruan Khalsa Medan periode 20122015 di Intermezzo Restoran Medan, Sabtu (15/9) malam. “Jika dialog dengan keluarga ahli waris di Jakarta dan Sumut tidak membuahkan hasil, maka IKA SMA Perguruan Khalsa Medan akan mengurus izin operasional perguruan tersebut dengan menyewa tempat atau membangun sekolah di tempat yang lain,” ujar Ketua Umum IKA SMA Perguruan Khalsa

Medan H.Helman Herdady, SH, MAP seusai pengukuhan tersebut. Acara turut dihadiri Anuar Shah, SE selaku penasehat alumni yang juga Ketua MPW Pemuda Pancasila Sumut. Menurut Helman, yang juga Kadisbudparpora Pemkab Batubara, Perguruan Khalsa satusatunya lembaga pendidikan yang memiliki keberagaman suku, agama dan ras seperti Belanda, Pakistan, India, Malaysia, Tionghoa, Afghanistan dan Indonesia. Salah satu program IKA SMA Perguruan Khalsa Medan yakni menyelenggarakan bhakti sosial. Pertemuan alumni akan dilakukan dua bulan sekali untuk meningkatkan silaturahmi. “Kami berharap niat untuk membuka kembali perguruan tersebut bisa terlaksana secepat mungkin,” tambah Zullyta didampingi Srie Muliani Mirza dan Hj.Erlita Faurita Nasution. Sementara mewakili guru, Mislan memberikan apresiasi kepada para alumni Perguruan Khalsa Medan yang sudah membentuk keluarga alumni dan menggelar halal bi halal untuk meningkatkan kebersamaan hingga berencana ingin

menghidupkan kembali salah satu perguruan kebanggaan Kota Medan itu. Sebagaimana diketahui, sekolah tersebut ditutup pihak yayasan sekitar tahun 1994/1995 sebagai dampak perseteruan di kalangan pengurus yayasan. “Kami juga menggugah keluarga pendiri yayasan untuk membuka kembali perguruan tersebut dan tidak melupakan cita-cita pendiri yayasan yang ingin memajukan Indonesia melalui bidang pendidikan,” kata Mislan, yang sudah mengabdi sebagai tenaga pengajar sejak tahun 1963. Pengurus IKA SMA Perguruan Khalsa Medan Periode 2012-2015 yakni : Pembina: seluruh mantan guru SMA Perguruan Nasional Khalsa Medan. Penasehat: Anuar Shah; Alamsyah Hamdany, SH; dr. Beby Darwis. Ketua Umum H.Helman Herdady, SH, MAP. Ketua I-II Charlie dan Edy Zulkarnain. Sekretaris I-III Dra. Zullyta AC Nelwan, MSi; Isfan Dahriyan Nasution dan Roni Radius. Bendahara I-III, Srie Muliani Mirza, Suprayudi, H.M.Nasir Siregar. Kepengurusan juga dilengkapi dengan bidang-bidang dan seksi.(m08)

Pengurus IKKT Terkesan Dengan YPSA MEDAN (Waspada): Guna meningkatkan program kerja sekaligus mengetahui lebih jauh tentang Yayasan Pendidikan Shafiyyatul Amaliyyah (YPSA), pengurus Ikatan Kesejahteraan KeluargaTNI(IKKT)PWARanting 04-Kosek Hanudnas III melakukan kunjungan keYP. Shafiyyatul Amaliyyah (YPSA), Rabu (19/9). Rombongan diterima Pembina YPSA Buya Drs. H. Sofyan Raz, Ak, MM, Ketua Umum YPSA Hj. Rahmawaty Sofyan Raz, dan para staf YPSA lainnya. Kedatangan Ny. Ayu Yuyu Sutisna beserta rombongan ini guna melihat secara langsung sekolah Islam yang bertaraf internasional dan mempunyai motto Disiplin, Religius dan Cerdas serta mempunyai visi misi menjadikan siswa-siswi generasi emas ke depan. Dalam kunjungan tersebut, Ny. Ayu Yuyu Sutisna beserta rombongan terkejut melihat siswa-siswi Primary (SD)YPSA kelas 2 menjawab dan bertanya menggunakan Bahasa Inggris dengan lancar. Sebelumnya Ny. Ayu mengunjungi TK Diamond Kids YPSA dan merasa kagum melihat TK Diamond Kids YPSA yang menggunakan konsep homey yaitu anak-anak belajar seperti di rumah sendiri. “Anak-anak YPSA ini sangat luar biasa. Mereka sangat cerdas dan aktif semua. “Saya melihat anak-anak dididik dengan metode belajar yang fun. Bermain sambil belajar dan menyenangkan,” kata Ny. Ayu Yuyu Sutisna. Pada kesempatan itu, Pembina YPSA Drs. H. Sofyan Raz, Ak, MM memberikan Buku Biografi “Sofyan Raz Membangun Generasi Emas” kepada Ketua IKKT Pragati Wira Anggini Ranting 04 Kosekhanudnas III Medan Ny. AyuYuyu Sutisna. Selanjutnya Ketua Umum YPSA Hj. Rahmawaty Sofyan Raz saling bertukar cenderamata dengan IKKT PWA Ranting 04 Kosekhanudnas III Medan. Sofyan Raz mengaku bangga atas kedatangan istri Pangkosek Hanudnas III Medan Marsekal Pertama TNIYuyu Sutisna,

SE beserta rombongan. “ Ini merupakan kunjungan kedua Ketua IKKT PragatiWira Anggini Ranting 04-Kosek Hanudnas III Medan. Kunjungan yang sama

pernah dilakukan Ketua IKKT PragatiWira Anggini Ranting 04Kosek Hanudnas III Medan sebelumnya, Ny. Juwita Bonar Hutagaol,” ujarnya.(m49)


ROMBONGAN Ikatan Kesejahteraan Keluarga TNI (IKKT) PWA Ranting 04-Kosek Hanudnas III dipimpin Ny. Ayu Yuyu Sutisna, SE foto bersama Ketua Yayasan YPSA Pembina YPSA Drs. H. Sofyan Raz, Ak, MM dan Ketua Umum YPSA Hj Rahmawaty Sofyan Raz.

Haji 1433 H

A6 40 Hari Menuju Tanah Suci (Tafsir Ayat-ayat Haji) Bersama Dr.H. Azhari Akmal Tarigan, M,Ag

Haji Hanya Sekali KATA haji yang di dalam bahasa Arab disebut al-hajj (hajja-yahujju-hajjan-hijjan) mengandung arti al-qasd (menyengaja), datang (ata) dan ziarah (ziyarah). Di dalam Munjid kata tersebut diartikan dengan menyengaja datang ke suatu tempat yang suci atau menziarahi tempat tersebut. Sedangkan di dalam arti terminologisnya (istilahan) kata haji oleh Al-Zuhaily diartikan dengan menyengaja untuk mengunjungi, menziarahi Kabah untuk menunaikan amalan-amalan tertentu, pada waktu tertentu. Definisi yang lebih tegas adalah, haji berarti sengaja mengunjungi tanah suci Makkah untuk menunaikan ibadah haji, baik ibadah wajib maupun sunat di dalam waktu dan ketentuan-ketentuan yang telah ditetapkan syariat. Di dalam Al-Quran kata haji dengan segala derivasinya disebut 33 kali dalam berbagai tempat. Bahkan kata al-hajj sendiri menjadi nama salah satu surah di dalam Al-Quran tepatnya surah ke 22. Sebagian mufassir menyebut bahwa kata haji (hajji) untuk pertama kali disebut Al-Quran seperti yang terdapat di dalam QS Al-Hajj/22:27 yang artinya adalah, “Dan kumandangkanlah haji itu kepada manusia; niscaya mereka mendatangimu (Ibrahim) dengan cara berjalan kaki atau mengendarai unta kurus dari segenap penjuru dunia. Perintah ini diterima Ibrahim As. Setelah ia selesai membangun Kabah bersama putranya Ismail As. Jika ditelusuri kata-kata haji di dalam Al-Quran, tidak ditemukan kata haji yang didahului dengan kata kutiba (diwajibkan) sebagaimana ayat puasa. Kendatipun pada QS. Al-Baqarah/2;197 ditemukan kata farada namun konteksnya tidak dalam arti wajib atau fardhu. Makna ayat tersebut adalah, barang siapa yang telah menetapkan buat dirinya niat untuk berhaji maka ia tidak lagi diperkenankan untuk rafas, jidal dan fusuq. Tentu saja bukan berarti tidak ada kata tersebut berarti haji hukumnya tidak wajib. Hukum haji tidak ada keraguan sedikit pun adalah wajib. Namun Al-Quran menggunakan kata yang berbeda. Lewat kata ‘ala sebagaimana QS. Ali Imran: 97 dengan tegas Allah mewajibkan haji bagi yang mampu. (dan hanya untuk Allah, diwajibkan atas manusia untuk menunaikan haji ke Baitullah bagi siapa yang sanggup (istita’ah). Tegasnya, wajibnya haji dikhususkan bagi mereka yang memiliki kemampuan untuk menunaikannya. Dimensi lain yang tidak kalah menariknya adalah, Al-Quran juga menggunakan kata atimmu yang mengandung arti sempurnakan. Para mufassir memahami kata atimmu itu dengan sempurnakan. Dr.Wahbah Al-Zuhaily memaknai kata atimmu dengan adduhuma bihuquqihima (menunaikan dengan segala hak atau aturan-aturan yang telah ditetapkan syariat). Pertanyaannya adalah mengapa Allah memerintahkan manusia untuk menyempurnakan haji dan umrah. Sebagian mufassir dan pengkaji Al-Quran mencoba menganalisis bahwa sesungguhnya ibadah haji sudah dikenal sejak zaman Nabi Ibrahim AS. Akan tetapi seiring dengan perkembangan zaman, bahkan sampai pada era Jahiliyah, ibadah haji telah mengalami deviasi (penyimpangan) baik secara konseptual ataupun praktikal. Ibadah haji sudah bercampur dengan perbuatan syirik dan mungkar, seperti mengangungkan berhala yang digantungkan di Kabah sambil bernyanyi dan bersyair yang dipenuhi dengan kemusyrikan. Ada pula yang melaksanakan thawaf dengan bertelanjang. Perintah wa atimmu al-hajja…yang khitabnya adalah Nabi Muhammad SAW, menjadi penegasan bahwa haji bagi umat Islam adalah menyempurnakan praktik yang selama ini telah menyimpang. Bagi umat Islam, ibadah haji adalah ibadah yang hanya diorientasikan hanya kepada Allah SWT, dan bukan kepada yang lain. Apapun aktivitas yang dilakukan selama pelaksanaan ibadah haji sematamata merupakan manifestasi dari ucapan talbiah yang tidak pernah putus dikumandangkan. Labbaika Allah (aku penuhi panggilan-Mu ya Allah). Kendatipun ibadah haji hanya untuk Allah, tidak berarti umat Islam dilarang melakukan aktivitas lain seperti berdagang atau aktivitas bisnis lainnya. Namun harus dicatat, semuanya dilakukan dalam kerangka ibadah kepada Allah SWT. Dari sisi sejarah, ibadah haji baru dilaksanakan umat Islam pada abad ke-9 Hijriyah walaupun QS.Ali Imran :97 turun setelah perang Uhud tepatnya pada abad ke-4 Hijriyah, namun pada waktu itu umat Islam belum bisa masuk ke kota Makkah karena masih dikuasai kafir Quraisy. Umat Islam baru bisa melaksanakan haji setelah peristiwa fath Makkah atau Futuh Makkah (penaklukan kota Makkah). Sedangkan Rasul sendiri baru bisa melaksanakan ibadah haji pada abad ke-10 Hijriyah dan sekaligus sebagai haji yang pertama dan terakhir. Ketika Rasul ditanya sahabat, apakah ibadah haji diwajibkan setiap tahun ? Rasul menjawab, jika aku katakan ya, niscaya itu akan memberatkanmu. Ibadah haji hanya satu kali saja, siapa yang menambah, berarti ia menyukainya. Wallahu a’lam bi al-shawab.

WASPADA Kamis 20 September 2012

Asrama Haji Medan Siap Sambut Calhaj MEDAN (Waspada): Menyambut jamaah calon haji (calhaj) dari beberapa kabupaten/ kota di Sumut, Asrama Haji Medan mulai berbenah. Panitia Pemberangkatan Ibadah Haji (PPIH) Embarkasi Medan, melakukan berbagai persiapan, mulai dari mengecat gedung, pemasangan tenda kerucut, hingga menyuratiPLNdanPDAMTirtanadi. Sekretaris PPIH 2012 Drs Abd Rahman Harahap MA mengatakan, penyuratan terhadap PLN dan Tirtanadi agar pasokan listrik dan air tetap aman selama calhaj berada di Asrama Haji Medan. “Agar air tidak nyendat dan listrik tidakpadamsaatcalhajdiAsrama Haji Medan, kami sudah menyurati PDAM dan PLN, sehingga masalah air dan listrik tidak menjadikeluhancalhajnantinya,”kata dia, Selasa (18/9). Selain itu, lanjutnya, PPIH Embarkasih Medan juga melakukan gotong-royong untuk mem-

bersihkan Asrama Haji Medan. “Dinas Kebersihan juga sudah melakukan pengisapan debu. Rencananya,besokdilakukanfogging(pengasapan-red).Insyaallah, kita siap tampung calhaj sesuai dengankemampuankita,”ujarnya. Menurut dia, PPIH sudah menyiapkan enam gedung yang terdiri dari 487 tempat tidur springbed untuk memberikan kenyamanan kepada calhaj saat beristirahat. “Sedangkan tempat tidurpetugasnyaada300-anlebih. Nanti,calhajyangberusia50tahun ke bawah, tempat istirahatnya di lantai II, sedangkan yang sudah tua-tuadilantaiI,sehinggamereka tidak susah untuk naik ke lantai II,” sebutnya. Pemeriksaan kesehatan Sementara itu, Kabid Upaya Kesehatan dan Lintas Wilayah Kantor Kesehatan Pelabuhan Kelas I Medan dr Ariyanti mengatakan, saat masuk ke Asrama Haji nanti, kesehatan calhaj kembali

Waspada/Surya Efendi

PETUGAS mengecat salah satu gedung di Asrama Haji Medan, untuk menyambut kedatangan jamaah calhaj.

diperiksa.“Akan dilakukan pemeriksaan terakhir, dari sinilah nanti diketahuiapakahcalhajitumasuk dalam kelompok resiko tinggi (Risti),” katanya. Pada pemeriksaan terakhir itu, sebutnya, akan dilakukan pemeriksaan urin bagi wanita usia subur (dibawah 50 tahun). Hal ini dilakukan, untuk mengetahui apakahwanitaituhamilatautidak. “Jika hamil tidak diperbolehkan berangkat. Dalam peraturan SK Menkes dan Kemenag, wanita hamil tidak diperbolehkan berangkat untuk menunaikan ibadah haji di Tanah Suci tersebut. InijugadiaturdalamUndangUndang Kesehatan Penerbangan,” tuturnya. Selain pemeriksaan urin, juga dilakukan pemeriksaan umum kepada seluruh calhaj. “Ini untuk mendeteksi penyakit yang akan diderita calhaj. Jika perlu penangananmedis,makanantidirujuk ke RS Haji Medan. Dari sinilah baru diketahui calhaj masuk dalam kelompok Risti tersebut. Jika masuk dalam kelompok Risti, petugas kita akan memberikan tanda. Biasanya, 40 sampai 50 persen dari jumlah calhaj termasuk dalam kelompok risti,” sebutnya. Menurutnya, calhaj yang masuk dalam kelompok Risti harus menjaga pola makan dan istirahat yang cukup saat di sana. “Ibadah haji itukan memerlukan fisik yang kuat. Yang masuk dalam kategori risti yakni usia lanjut,memilikiriwayatsakitdiabetes mellitus dan jantung serta penyakit kronis lainnya,” ujarnya sembari menambahkan Kemenkes RI sudah menyuplai obatobatan untuk calhaj seperti obat diare, pusing, dan lainnya. (h02)


SALAH seorang pengurus Az Zikra Sumut Hj Ernawati Lubis memberikan cenderamata kepada calhaj yang akan bertolak ke Tanah Suci Mekkah.

Az Zikra Tepung Tawar Calhaj MEDAN (Waspada): Keluarga Besar Majelis Zikir Az Zikra Sumatera Utara, menepungtawari 9 jamaah Az Zikra yang akan menunaikan ibadah haji.Tepung tawar calon haji (calhaj) dirangkai zikir bersama di Masjid Al-Amin, Minggu (16/9). Acara itu turut dihadiri Penasehat Az Zikra Sumut H Azwir Ibu Aziz,sedangkancalhajyangditepungtawaridiantaranyaKurniaTarigan warga Perumnas Simalingkar, Mariani warga Jalan Pintu Air I, Sugiati warga Pajak Tanjung Morawa, Mukhlis warga Tanjung Morawa, Dr Sumiati Kalingga warga Jalan Halat Medan, Jumilah warga Tanjung Morawa, danYohana Numaida warga Jalan Palang Merah Medan. Selain penasehat, pengurus Az Zikra lainnya turut melakukan tepung tawar di antaranya Ustadz Muslim, Ustadz Bahrum yang juga Ketua Az Zikra Tanah Karo, HA Siahaan, Hj Ernawati Lubis, Hj Masnah, Hj Ningsih, Hj Fahmi, Hj Mariati, Endah dan lainnya. Dalam kesempatan itu, Hj Ernawati Lubis memberikan cenderamata kepada para calhaj yang akan bertolak ke Tanah Suci Mekkah. Dia berharap para calhaj bisa menjaga kesehatan selama berada di Tanah Suci, sehingga rangkaian ibadah untuk memenuhi tuntunan haji bisa dilakukan dengan baik. H Azwir Ibnu Aziz mengingatkan para jamaah calon haji agar tidak lari dari niat yang tulus dan ikhlas kepada Allah SWT dan siapkan fisikdanmental,hinggaprosespelaksanaanibadahhajidapatberjalan dengan baik serta dapat memaknai arti ibadah haji itu sendiri. Sebelum dilaksanakan penepungtawaran calhaj, dilakukan shalat tasbih dan zikir bersama dipimpin Ustadz Muslim yang diawali dengan pembacaan ayat suci Alquran. Sementara itu, Ustadz Bahrum dalam tausiyahnya mengajak para jamaah Az Zikra untuk terus membesarkan Majelis Zikir Az Zikra. Kata dia, Majelis Zikir Az Zikra yang didirikan almarhum H Rizal Mahaputra memiliki visi dan misi yang jelas. “Sejak didirikan Az Zikra merupakan salah satu majelis zikir yang kegiatan dan tujuannya jelas yaitu meningkatkan silaturahim dan dakwah. Untuk itu, mari sama-sama kita meningkatkan silaturahim sembari membesarkan Az Zikra. Agar keinginan almarhum Rizal Mahaputra supaya Az Zikra terus maju dan berkembang, tetap terjaga dan terpelihara,” ujar Bahrum. (cwan)

Nama Calon Jamaah Haji Kloter 1 Asal Kota Medan, Masuk Asrama Haji Kamis (20/9) Berangkat Jumat (21/9) Melalui Bandara Polonia Embarkasi Medan 01. Amarullah Bin Salman Khalik Bin Salma (TPHI) 02 .Muniruddin Bin Ahmad Awal Bin Ahmad (TPIHI) 03 .Muhammad Akbar Muhammad Deen Bin Muhamad (TKHI) 04. Khairunnisah Abdul Majid Roni Binti (TKHI) 05. Muniroh Marpaung Abdul Salam Binti H (TKHI) 06. Zulfiqar Hajar’ Bin Ibnu Hajar . 07. Junaidi Bin Syamsu B. 08 .Nurlely Binti H.Sabullah 09. Yusniar Lubis Binti Mhd. Saleh Lubis 10. Rosita Binti Bachtiar Nasution,H. 11. Sri Arni Wahyu Wardani Binti Margono. 12 .Amanah Binti Zainal Abidin . 13. Cayadani Binti Muhammad Sikurik . 14. Hartati Pohan Binti M Yusuf H . 15 . Rusmini Binti Alil . 16. Susan Maidawaty Binti Sutopo . 17. Sulaiman Abdul Rani Bin Abdul Rani. 18. Hakim Tua Harahap, Sh, Mh Bin Diapari 19 .Sri Wahyuni S, Sh Binti Sarmin Siregar 20. Sri Wardani Binti Sarmin Siregar 21. T. Fauziah Binti T. Muhammad Arifin 22 .Asmah Br Sinaga Binti Subuh Sinaga 23. Asnah Binti Usman 24. Sri Novianti Binti M Saleh 25. Melny.H Binti Nyak Halim 26 .Norman Chan Bin By Enek 27 .Syamsul Rizal,Ir Bin By Enek 28 .Parlin Hutasuhut Bin Eb Hutasuhut 29. Muhammad Rinaldi Rangkuti, Ir Bin H.A 30 . Dewi Asih Angkasari Binti K.Iskandar 31. Sri Budiasih Dra Binti Legiman Berkah 32 .Erwanto Indroyono Irsan, Dr Bin Irawa 33. Ahmad,Sh Bin H.Ahmad Kamil 34. Mardiani Hasibuan,Sh Binti Bandar Kun 35. Yusmarni Binti Bustanuddin 36 .Halimahtussa’diyah Binti H.Zainul Ari 37 .Eldy Mustafa,Sh Bin Mustafa Said 38 .Muhammad Arif Harahap, Be Bin Ali Ras 39. Jusma Ningsih Binti Sakidi 40 .Amiruddin Pohan Se Bin Kholipah Zakar 41 .Kartini Siregar Binti Amir Husin Sire 42 . Lisna Susanti Nasution Binti Burhanud 43 .Farida Hanum Binti Anwar Chaidir Hara 44 .Arifin Siregar Bin Bariun Siregar 45 .Hasrun Tanjung Bin Abdul Hamid Tanjun 46 . Halimah Siregar Binti Bariun Siregar 47 . Suyatin Suzinara Bin Kasiman 48 .Kesuma Hati Binti M Idris Lubis 49. Safitri Handayani Binti Syafri Yusuf 50 .Abd.Hadi Husin Nasution,Se Bin Amir H 51. Selamat Munthe Bin Rajo Munthe 52 .Erwin Hidayat Se Bin Machudum 53 .Ir.M.Rizal.Msi Bin H.Muhammad Zahar 54 . Ir Endri Fida Binti H.Yusmar Tanjung 55 .Nozmy Burhan Binti Burhan 56. Rahma Yulis Binti Rahmat 57. Candrawati Binti Anwar Sb 58. Dewi Kesumawati Binti Jumiran 59 .Zainur Maulina Binti Ali Ibrahim Ramb 60. Jesmawati Binti Jamaluti 61 .Joni Anwar, Ir Binti Syahbuddin 62. Oly Auli Bin M. Isa 63 .Sugiono Bin M Jayusman 64 .Deny Roza Binti H. Misran Jono 65 .Ernawati Se Binti Zainuddin 66. Yusmaniar Sitohang Binti B Sitohang 67. Yusnisar Dalimunthe Binti H.Hasan Bas 68 .Abdul Gani Lubis Drs Bin H.Jamangaris 69 .Irwan Sitompul Bin Muhammad Din Sitom 70. .Wagiani Binti Boimin 71 . Sri Deswelly Effendi Binti Chaidir Ef 72 .M Tavip Efendie Se Bin Misran Jono 73 .Anwar Purba Bin Kala Purba 74 .Masri Lubis Drs. Bin M.Yaman Lubis 75 .Nurlela Nasution.Dra Binti Sulian Ahm 76 Roslinawati Harahap.Dra Binti Nuroni 77 .Muhammad Daud Lubis.Drs Bin Haji Abdu 78 .Mulia Siregar Bin H.Marasat Siregar 79 .Minda Yanti Binti Daud Harahap 80. Mastina Siregar Binti Sutan Martua Siregar 81. Nazaruddin Pohan Se Bin Haidir Pohan 82. Deliana Harahap Spd Binti Abdul Halim 83 .Fauziah Binti Husin Syah 84. H Revan Surahva Bin H Mustafa Zain 85 . Muhammad Iksan Bin Abdullah Sani 86 .Isnaeni Binti Syamsul Bahri 87 .Rita Binti Amirudin 88 . Rosmawar Lubis Binti Nurdin Lubis 89 .Komala Sari Binti Abdul Aziz Nasution 90 .Nilawati Binti Abdul Hamid 91 .Zahara Binti M.Yaqub

92 .Salbiah Binti Muhammad Said 93 .Ida Mariana Ir Msi Binti Abdul Malik 94 .Asril Nizar Ir Bin Arsaduddin 95 .Supryadi Bin Abdul Muin 96. Ahmad Nizar Drs Bin Marsyumi 97. Rizky Uliandyka Bin Dahnial Lubis,H 98. Zulkifli Bin Achmad 99. Siti Rafiah Binti Adly Rauf 100. Rahimi Binti Achmad 101. Tirania Binti Kasmin Tambunan 102. Waslina Binti Abdul Wahab 103 . Ramlah Sari,Dra Binti Hamzah 104 .Eliafrita Binti Syarifuddin 105 .Sederhana Siregar Binti Banua Siregar 106 .Menik Binti Ponijo 107. Muftiar Bachtiar Bin Sidi Bachtiar Is 108 .Ramli Siregar Drs Bin Mangaraja Guru 109 .Indral Bin Ahmad 110 .Zuraidah Daulay Binti Abdul Gani Daul 111 .Sarkiah Daulay Binti Abdul Gani Daulay 112 . Salamah Z Binti Abdurrahman 113. Fitrizia Binti M. Riaz Rifai 114. Sri Herlina Binti Raflin Dico 115 . Rokiba Binti Makmun 116.Idawati Bangko Binti Sanusi Bangko 117 . Elis Yulianti Binti Sumirta 118. Ridwan Abdullah Sani Bin Adbullah San 119 .Ahmad Mulia Budi Rangkuti Bin H M Yak 120 .Syahniar Nasution Binti Syahril Nasution 121.Iyen Makoan Sari Dewi Binti Ainu Hars 122. M Zulkarnain Harahap Ir Bin Rikkot Im 123. Irsan Harahap, Se Bin Tindi Harahap 124. Syofia Nurleily, Bba Binti Amar Nurdi 125 .Nur Dewina Nst Binti H.Akhsyah Nst 126. Nelly Arjuna Dalimunthe Dra Binti Ada 127.Setiawati Binti Siping 128. Nusrawaty Toweran, Spd Binti Banta Cu 129. Hasan As, Drs Bin Djahin 130. Tondi Nasha, St Bin Abdullah Nasution 131.Mursidin Rizal Hsb Bin Mujahidin Hasi 132..Azhar Sh Bin Abdul Gani 133 . Hr Rabithah Binti Jamhir Mustafa H 134 .Risnawati Nasution Binti Rahmad Nasut 135. Islah,Dra Binti Mhd.Said 136 .Rohaedah Binti Yosadi 137 . Syarifah, Dra Binti H Kari Usman Lubi 138 Zuraida Hanum Binti Rs.Pranoto Sujitn 139. Juliana Br Tarigan Binti Abdul Jalil 140 Sungkunen Pandia Sh Bin Ngelak Pandia 141. Mahyudin Lubis Se Bin Sutan Mulia Lubis 142 Helmi Yusuf Bin H.Muhammad Yusuf 143 .Juliana Matondang Binti H.Muhammad 144. Anna Wati Dewi Purba, S.Psi Binti H. 145 Hj. Rachmawaty Binti Abdul Rahman 146 Siti Aminah Lubis Binti H Achmad Azzu 147 Zainani Hj Binti Ahmad.H 148 Raminah Binti Hasan Martorejo 149 .Babay Nurbayani Binti H E Nursyamsu 150. Atep Supriadi Bin H.R Baharudin 151. Hasan Basri Bin Sutan Arif 152 .Nurfianus Bin Nurdin 153.Sulaiman Bin Ngadimin 154. Mahyuddin Bin Abdullah Sani 155. Sumardi Admojo Bin Ngadimun 156 .Ngatmini Binti Sabar 157. Sumiasih Binti H. Muhammad Ijab 158. Mardiah Binti Mariadi 159 .Saini Binti Sardipai 160. Martina Binti Mahyuddin 161. Syahbuddin Bin Abd.Jabbar 162. Poniman Yus Bin Yusman 163.Sholakhudin Bin Ahmad Ma’i 164 .Asri. Ar Bin Arifin 165. Nurlaini, Sh Binti M. Adlin 166. Nurmala Binti Arifin 167. M. Hasbi Bin Arsad 168 .Mahmud Hs Bin H. Sulaiman 169. Mawarni Binti Mahmud Hs 170. Iriansyah Bin M. Nasir 171.Afrin Yusuf, Drs Bin Tm, Yusuf 172 .Rosfiati Binti Tamrin 173. Neni Djalal Binti Djalaluddin Zen 174 .Ahmad Suryadin Bin Abdul Manaf. As 175 .Amir Hasan Bin Hamzah 176 .Asmanur Binti Abd. Manap 177. Samiah Binti Anggi 178. Rosni Binti Ubad 179 Darima Kasumi Binti Hm. Amin 180 .Nurjamilah Binti H. Abd Manaf 181. Nur Sakya Binti M.Nur 182 .Rakain Binti Tgk. Molok

183 .Rasyidah Binti Muhammad Wali A 184.Rasyidah Binti Munir 185 .M. Uzir Bin Nyak Man 186 .Rozal Indra Bin Amiruddin 187 . Harrisyah Putra Bin H Datuk Muda Maru 188 .Kasah S Bin Siyaya 189.Yudiar Arif Nasution Bin Zainul Arifi 190 Jakaria Harahap Bin H. Abd Halim Harahap 191 .Nursani Mungkur Binti Burhan Mungkur 192 .Erwina Binti M. Zaini Dahlan 193 .Irsan Pane Bin Tuongku Gulingan Pane 194 .Feriyanto Bin Sihapuddin 195 .Susi Ariyanti,Se Binti Mhd.Saman, 196 .Sami Binti Sandiman 197. Faizal Hamdi, Ba Bin M. K. Sutan Mang 198. Asril Bin Julius 199 . Siti Armeini P. Binti H.Totop Pulunga 200. Hasnaniar Binti Abbas 201.Siti Hawa Binti Bakri Arif 202.Jasmah Binti Jafar 203..Mariatun Binti Ibrahim Kiran 204.Siti Nurbaya Binti H.Temmy 205.Nurshafni, Dra Binti Nurman, H 206.Arman Efendi, Js Bin Chorma, 207.Chairuddin Bin Harun 208.Guswedi Bin Sumarsono 209.Sahlun Nasution,Se. Bin Taisir Abdul 210.Syamsul Azwar.Dr Bin Tm.Ishak 211.Wati Bersari.Dr Binti Hasyim Mayeid 212. Sumarno Bin Muhammad Nayak 213. Nursyam Binti Anwar 214.Marimin Bin Ponidjo 215.Faiz Ahyaningsih, S.Si Binti H. Amir 216.Ramala Damanik Bin Jamuda Damanik 217..Zuraidah Lingga Binti Mhd. Yasin Ling 218. Hanum Lingga Binti Mhd. Yasin Lingga 219 ..Chairani Ningsih Binti Muhammad Arsya 220 .Fadhillah Nasution Binti H. Abd. Mana 221. Syafruddin Ms Bin Musa 222. Drs M Amin Tarigan Ak Bin Muhammad Ar 223 .Suhalina Br Siregar Binti Sutan Sireg 224 . Azhar Lubis Bin Adnan Lubis 225 .Nurlela Hayati Binti Bagindo Makmur 226. Amir Syarifuddin Bin M. Nasir 227 Azhar Moein Bin Moein 228 .Rita Mestika Hayati Ir Binti Azhar Mo 229 . Irwan Zufri Siregar Se Bin Amrul Zaha 230.Hairani Binti Sanusi Nasution 231. Hafniar Binti Hanafi Ahyar 232. Muhammad Yusuf Bin Ibnu 233.Heryanto Bin Sukarmin 234 .Bagi Astra Sitompul Drs Bin Kamaluddi 235 .Kasmida Binti Mumai Sembiring 236 . Jhon Khaidir, Ir Bin Oka Idris, H 237 Dra. Ipa Ratna Mutiara Binti H. Karan 238 .Drs. Syamsul Bahri Nasution Bin H. Ab 239 .Siti Halimah, Dra. Binti Raja Mukhtar 240 .Yunah Br.Hasibuan Binti Naredden Hasibuan 241. Budi Rahini, Se Binti Atma 242 .Sri Puspita Andayani Binti Atman 243 .Kholifa Binti Suwar 244 Fatimah Zahara S.Ag Binti Masdar 245. Syarifuddin,Drs Bin Hifni H 246. Elfa Juita Binti Munir 247. Abdul Syukur Siregar Bin Djalaluddin 248 .Arwida Lubis,Hj Binti Abdul Hamid Lub 249. Riyatno Bin Rebin S 250 .Srianie Binti H Tusibon 251. Leginem Binti Karyo Di Kromo 252 Rosmaini Lubis Binti Ramli 253 .Awaluddin Rangkuti Bin Junit Rangkuti 254. Sudirman Bin Suparjo Bin Suparjo 255 .Mahmud Shaleh Zakaria Bin Zakaria Ras 256. Asruddin Harahap Bin Raja Adil 257.Rosmina Batubara Sag Binti Maraiman 258. Samsir Batubara Bin Maraiman Batubara 259 Rosdanni Binti Guslan Harahap 260 .Edison Pandiangan Bin Kadir Pandianga 261. Rodiah Nasution Binti Utu Daim 262. Mente Purba Bin Moradim Purba Alm 263.Hasim Purba Sh Bin Mente Purba 264. Yunita Sari Hasibuan Dra Binti H Maki 265. Marnah Binti Marta 266. Khotimah Binti Muhali 267. Ramlan Siregar Bin H.Aman Siregar 268. Rahmad Syafii,Drs Bin Alm.H.Sutan Har 269. Elidawati,Se Binti Alm.H.Maskun Hsb 270. Maradoli Nasution, Drs, Map Bin H. 271. Rosmawarni Pane, S. Ag Bin Hakim Pane 272.Drs. Henri Siregar Bin H. Mhd. Idris 273.Sri Kurniati, Spd Binti Abdul Manaf

274. Sahnum Binti Abdul Latif 275. Tahan Bin Suro Setiko 276. Nirwaty Binti Salikin 277. Farida Hanum Siregar Binti Ahmad Salo 278.Ahmad Kholidi Nasution Bin H.M.Bakri A 279. Azhari Bin Abidan 280. Fadlan Zuchri Lubis,Se. Bin Fachruddi 281.Wagirun Bin Saliman 282. Sumiatin Binti Ngadimo 283. Latifah Binti Mhd Nurdin Chaidir H 284. Sri Wulan Sukani Binti Ono 285.Poniatik Binti Warso Ijoyo 286. Sariah Binti Muhammad Yusuf 287. Neni Mariani Binti Muhammad Nasir 288.Warno Amri Bin Amat Muhaini 289 M.Nur Tanjung Bin M.Jamil Tanjung 290 .Misrianto Bin Sarikan 291 . Endang Erwanto Bin Kadar Hw 292 . Tupon Ys Bin Muhammad Yusuf 293 . Sulasmi Binti Jaman 294 . Suratni Binti Jaman 295 .Sunarti Binti Sukardi.H 296 .Syahlan Jukhri Nasution,St Bin Rasmi 297 .Mursiyem Binti Sanmunawi 298. Netty,Dra Binti Azhar 299.Diah Iriani Binti Kaspan Utomo 300.Sumiati Binti Suramini 301.Jumiadi Bin Supardi 302.Ragian Solin Bin Monggal Solin 303. Muhammad Basir Bin Abd.Manap 304.Nuraidah Binti H.Hasan Lebai 305.Zakaria Bin Haji Bustami 306. Masitah Binti H.Jamaluddin 307.Ngatini Binti Edi Haryono 308.Elfi Dana Binti H.Burhanuddin 309.Syahruddin Nasution Bin Aminasan 310. Rubinem Binti Warimin 311. Nursyam Binti Chalifah Abdul Hamid 312. Soeripto Bin Asmadikrama 313 . Muhammad Nasution Bin Abdul Nasution 314. Sariniati Binti Sardi 315. Norma Binti Ahmad Zein 316. Erwin Syahputra Bin Makmal 317. Kizan Bin Kasiman 318. Nina Syahputri Binti Makmal 319. Ernawati Binti Kizan 320. Zamilah Binti Surdijoyo 321. Tedy Bin Amiruddin Lubis 322. Taufiq Haris Lubis Bin Abdul Haris Lubis 323. Olivia Riskana Rosada Binti Fadlan Syafi’i 324. Arifin Bin Abdul Kani 325.Syamsidar, Hj Binti Abdul Aziz, H 326.Syahyudin P. Bin Putih 327.Siti Aminah Binti Rosip 328. Aidah Binti H.Amir Rani 329. Ibrahim Jusuf Bin Alun 330. Sunarti Binti Sarimin 331. Zuriaty Binti H.Syahbudin 332.Legiem Binti Karyo Sentono 333. Syahrizal Bin Sarbaini 334. Selvita Permata Amd Binti Muhammad Ha 335 Abd Kadir Zailani Bin Jali 336 Irwansyah Lubis Bin H Arifin Basir 337. Darmawati Simbolon Bin Husin 338. Siti Aisyah Bin Husin 339 Nursiah Binti Nursam 340. Amnah Binti Dami 341. H.Kumala Ketaren, Ir.Mm Bin Sanggup K 342 .T.Zam Zam Safina Binti T.Syaifuddin 343 .Sofyan Batu Bara Bin A. Dollah Batubara 344 .Jonnes Hasan, Ir Bin Hasan 345 . Sudiar,H,Dr,Mm,Mha Bin Sakiman 346. Elyza Binti Nazarullah 347. Sarini Binti Darman 348. Asril Muas Tanjung Drs Bin Muas 349. Yulidarma Binti Sabaruddin 350. Suryani Pohan Binti Mhd.Akir 351 . Sri Eriati Binti Suharjo 352. Zulmiati Binti Bm Etek 353. Hamidah Tanjung Binti M.Djian 354. Hasanuddin Hasibuan Bin Pokir Hasibua 355. Ermawati Nawailis Binti Nawailis 356. Emi Faujiah, Se Binti H.Anwar Husin 357. Ahmad Efendi Bin Mhd Nur 358.Nurmah Binti Mhd Nur 359.Abdullah Bin Mhd Nur 360.Ainun Binti Mhd Nur 361.Rosimah Hutasuhut Binti Saribun Hutas 362.Azka Hafiza Darmawan Binti Wawan Darm 363. Mawardah Binti Badaruddin 364. Hisyamuddin Amir Bin Amiruddin

365. Risnawati Tanjung Binti Arifin Koto 366 .lham Maulana Bin Suparno 367. Purwanto Sutrisno Bin Sutrisno Ad 368.Sumarsih Binti Markani 369. Siti Zaleha Binti Tasman 370. Saodah Binti Saimin 371. Rosmawati Simatupang Binti Marajo Sim 372. Yusnawizar Binti Junan 373.Kamsani Binti Kapur 374 .Sri Hartati Binti Janu 375. Winarti Dewi Binti Djamaluddin 376.Hasan Basri Bin Bahaudin 377 . M. Salim Bin Abdullah Angkat 378 .Abdul Rahmansyah Bin Mhd. Ali 379. Arbaiyah Binti Hamdan 380. Masyithah Binti Ismail Arkasan 381. Elmawati Binti Muhammad 382. Erni Roza Binti Muhammad 383.Harlis Binti Syamsunar 384. Ratna Juami Binti Muhammad Daud 385. Rohani Binti Abdur Rahman 386. Marsini Binti Samkip 387.Sadimin Bin Atemat 388. Sofian Nasution Bin Ali Hasan Nasutio 389. M.Ansyari Bin Anwar 390.Muhammad Ansyor Bin Syarif 391.Rosmawaty Binti Sidin 392.Nila Kesuma Binti Abdul Jalil Sinaga 393.Nurhayati Binti H Nyak Bugis 394.Nurliana Rosmita Purba Binti R Purba 395. Nurmaini Binti M Nurdin 396. Nuraini Binti M. Yakub 397. H. Muhammad Syarif Bin Mhd. Amin 398.Tengku Taufiddin Bin Tengku Chalid 399. Wan Chairani Binti Ok.H. Anur Ali 400. Ashari Bin Abdul Hamid 401. Ismail Dagang Bin Abas 402.Armaini Binti Saidi Ibrahim 403. Rasmakh Tarigan Binti Enggo Malem Tar 404. Hijrah Ginting Spd Binti Umar Ginting 405. Siti Zahara Binti Rauf Junus 406. Tima Sari Pasaribu Binti Sutan Raja 407. Achyar Indra Surya Bin Sulaiman Maton 408. Nurhayati Binti Ma‘Sum 409.Mahyuni Binti Sidik 410.Rumainur Bin Ramli 411. Syahruddin,Drs. Bin Abdul Muin Samosi 412.Siti Chalijah Samosir Binti H. Abd Manap Pane 413 .Denty Suharni Binti M. Tahar Muncak 414.Tri Astuti Binti Rajiman 415. Nuraini As Hj Binti Abdul Sani 416. Eliza Binti Mhd.Efendi 417. Nurul Huda Binti Baharuddin 418. Azhar Bin Ismail 419. Mukhtar Harahap Bin Marabunga Harahap 420. Marwiyah Pohan Binti Mara Bakti Pohan 421.Saripah Binti H.Ibrahim Markum 422.Budhi Dharmawan St.,Mm Bin Tony Tanu 423.Mulyadi Bin Djojo Winoto 424. Misnatun Nurazlina Binti Sudarmo 425. Sugiarni Binti Mas‘Ot 426.Ernawati Binti Burhan As 427.Siti Aisah Binti Maksah 428.Sri Muliati Binti Ngadimun 429. Hawadis Binti Kocik 430. Bustami Bin Hasim Meneh 431. Bahrum Siregar Bin Nurdin Siregar 432. Kaharuddin Batubara Bin Mustafa Batub 433. Roslansari Harahap Binti Batara Mahod 434.Abdul Rais Bin H Abdul Latif 435. Indah Arniati Binti Jasiman 436. Iranawang Wulan Binti Abdul Rais 437. Gema Akegara Putra Bin Abdul Rais 438. Muhammad Panca Arjuna Bin Abdul Rais 439. Amajon Simorangkir Bin Bistok Simoran 440 .Dahlia Siregar Binti Kaslan Siregar 441. Rumiasih Binti Sebo 442. Masriah Pane Binti Abdul Manaf Pane 443. Sri Rahmawaty Binti Masduki 444.Sumarni Binti Sadiran 445. Djemadi Bin Ratem 446. Sugiati Binti Salam Santoso 447. Herawati Binti H.M. Arsyad 448.Riswani F Binti Alamin 449. Lely Hasnida Binti O K Latif Noerdin 450. Fatmawati Binti Abdullah 451. Sukarseh Binti Suparman 452 Maisiyah Binti Mahmud 453 Hermawani Syafriani Matondang Binti H 454 Try Harianto Kawegian Bin F.H.Kawegia 455 Dahlan Bin Ishak Bin Ishak (m37/m32/m50/h02/m46) * Sumber PPIH Embarkasi Medan.

WASPADA Kamis 20 September 2012

Politik & Hukum A7 Persoalan Serius Jika Anggaran Panwaslukada Tak Kunjung Cair MEDAN (Waspada) :Tak kunjung cairnya anggaran untuk Panwaslukada Sumut Rp5 miliar mendapat perhatian dari pengamat politik USU Ridwan Rangkuty, MA. Waspada/ist

BALON Gubsu dari Partai Golkar,Dr H.Chairuman Harahap,SH,MH saat menyampaikan sambutannya di acara silaturahim Masyarakat Pasar Siborang Padangsidimpuan, Senin (17/9) malam.

Silaturahim Chairuman Ratusan Warga Siborang P. Sidimpuan PADANGSIDIMPUAN (Waspada): Bakal calon gubernur Sumut (Balon Gubsu) dari Partai Golkar Dr H.Chairuman Harahap, SH, MH bersilaturahim dengan masyarakat Pasar Siborang, di Lingkungan 4, KelurahanWEKV, Padangsidimpuan Selatan, Senin (17/9) malam. Kegiatan mempererat hubungan kekerabatan yang difasilitasi Naposo Nauli Bulung Lingkungan 4 berlangsung hikmat dan meriah, dihadiri sekitar 800an masyarakat. Chairuman yang juga anggota DPR RI dalam sambutannya menyampaikan bahwa acara tersebut merupakan kegiatan kekeluargaan mengingat sudah lama tidak bertemu. “Panitia Sutan Pasaribu, Abdul Jalil Girsang datang kepada saya agar dibuat acara silaturahim, agar bisa sama-sama berjumlah kita di Siborang ini. Sudah banyak perubahan di Padangsidimpuan ini, sewaktu anak muda tahun 50-an dan tahun 60an kita di sini,” kata pemegang gelar Doktor bidang Hukum dari Universitas Padjajaran Bandung dengan kualitas cumlaude ini. “Inilah mungkin kesempatan yang diberikan kepada kita untuk bersilaturahim,” sambung Chairuman didampingi istri, Hj.Ratna Sari Lubis dan saudara perempuanya, Hj.Tetty Harahap. Chairuman menceritakan, mereka yang bersaudara selama ini besar di Siborang. “Syukur Alhamdulillah begitu banyak berkumpul untuk bersilaturahim. Karena silaturahim itu dalam ajaran agama kita, memperpanjang umur dan memudahkan rezeki,” tutur Chairuman. Disampaikan politisi Partai Golkar ini, bahwa dia terpilih menjadi anggota DPR-RI tetap berupaya untuk tidak mengecewakan masyarakat. “Berperan sebagai putra Padangsidimpuan di dalam gelanggang politik nasional, kita mesti membawa nama baik semuanya, bahwa masyarakat terwakili dengan baik. Ini yang harus kita buat dengan baik ke depan, termasuk Sumut ke depan,” ungkap Chairuman. Dia merasa bersyukur bisa berjumpa dengan masyarakat dan bergembira dengan masyarakat. “Terima kasih atas kehadiran semuanya. Marilah kita melaksanakan suruhan agama, bersilaturahimdengansesama hingga kedepannya,” tuturnya. Dalam kesempatan itu juga turut menyampaikan mewakili tokoh adat seperti H Tongku Lelo Lubuk Raya Harahap dan lainnya, kepling

di Kelurahan WEK V dan lainnya. Acara halal bi halal atau silaturahim masyarakat Pasar Siborang dengan Chairuman Harahap tersebut dihadiri Ketua Badan Kehormatan DPRD Kota Padangisimpuan, H.Marataman Siregar, ulama, tokoh adat, akademisi, pemuda dan lainnya. Juga turut hadir Calon Wali Kota Padangsidimpuan, Dedi Jaminsyah Putra Harahap, SSTP MSP dan pasangan Calon Wali Kota dan Wakil Wali Kota Padangsidimpuan lainnya, Mohammad Habib Nasution-H Soripada Harahap.(m07/rel)

BATANGKUIS (Waspada) : Para Kepala Desa yang tergabung dalam Asosiasi Pemerintahan Desa Seluruh Indonesia (APDESI) kabupaten Deliserdang bersama Gerak Mantab (Gerakan Rakyat Mendukung Amri Tambunan) menyatakan siap untuk mengamankan jalannya Pilgubsu serta bertekad untuk memenangkan Drs.H.Amri Tambunan menjadi Gubernur Sumatera Utara pada 2013-2018 mendatang. Pernyataan itu ditegaskan Ketua APDESI Kabupaten Deliserdang Edi Suprianto didampingi Ketua Gerak Mantab Bambang Hartoko kepada Waspada, Senin (17/9) di kantornya. Menurutnya, ada beberapa alasan mendasar

Waspada/Khairul K Siregar

KETUA APDESI Kabupaten Deliserdang Edi Suprianto (kiri) didampingi Ketua Gerak Mantab Bambang Hartoko ketika memberikan keterangan.

milik penyewa rumah saya, Bambang dan Dwi namanya,” ujar dia mengaku perusahaan pengelasan tersebut baru beroperasi sebulan dengan sewa Rp5 juta. Sementara Dwi Midiyan Toro, Manager PT Kharisma Pratama Abadisejatindo mengaku saat menyewa gedung, listrik sudah terpasang. “Perusahaan kami di bidang kontruksi besi, dan saat menyewa gudang, instalasi dan jaringan arus listrik sudah terpasang, bahkan arus tenaga listrik sudah masuk ke bengkel sehingga PT Kharisma Pratama hanya tinggal menggunakan fasilitas tersebut,” kata dia kepada penyidik Poldasu. Tetapi, karyawan perusahaan konstruksi itu, Bambang Suradi kepada penyidik mengatakan mereka mendapat aliran listrik dengan menyambung kabel dari perusahaan ke kabel aliran listrik milik PLN. “Kemudian arus listrik dialirkan ke trafo las lalu dipasang ke setang las komplit untuk membuat isi dalam pabrik kelapa sawit, berupa fiber siklut, elevator dan natgreding,” katanya. Hingga kini polisi telah memeriksa tujuh saksi, yakni Bambang Suryadi, Dwi Midiyan Toro, Sugianto dan empat orang dari PLN atas nama Suwito dan kawan-kawan.Tentang pemakaian listrik ilegal itu, Sadono menyebutkan, sekitar satu tahun. “Tersangka akan dijerat pasal 51 ayat (3) Undang Undang Nomor 30 tahun 2009 tentang Ketenagalistrikan dengan ancaman 7 tahun penjara dan denda mencapai Rp1,5 miliar,” sebutnya.(m27)

Perusak Lapak Pedagang Divonis 6 Bulan Percobaan MEDAN (Waspada): Sembilan terdakwa kasus pengrusakan lapak pedagang ikan Pajak Simpang Limun dijatuhi hukuman enam bulan percobaan pada persidangan di Pengadilan Negeri Medan, Selasa (18/9). Majelis hakim yang diketuai I Dewa Gede Ngurah Adyana SH menyatakan, terdakwa Erdianto, Rudolok Simanungkalit, Damerson, Muhammad Candra, Ridwan, Heri, Indra, Naedak dan Maratua diyakini bersalah melakukan tindak pidana pengrusakan lapak-lapak pedagang. “Terdakwa diyakini bersalah merusak lapak para pedagang dan dijatuhi hukuman 6 bulan percobaan. Jika dalam sepuluh bulan ini terdakwa melakukan tindak pidana akan dijebloskan ke dalam penjara,” ujar I Dewa Gede. Menurut I Dewa Gede, berdasarkan keterangan para saksi diketahui kalau sebelum peristiwa pengrusakan lapak pedagang, pihak PT Inatex ada melayangkan surat pemberitahuan kepada pedagang untuk melakukan pengosongan lapak karena alasan akan melakukan renovasi. PT Inatex tidak lagi menyewakan lapak mereka kepada para pedagang yang memang telah puluhan tahun mencari nafkah di lahan tersebut. Kata dia, tidak ada hal yang memberatkan para terdakwa selama persidangan. Namun hal yang meringankan mereka selama persidangan berlaku sopan serta tidak pernah dihukum. Sementara itu, Sugianto pendamping para pedagang mengaku sangat menyesalkan

“Menjadi lengkaplah penderitaan Panwaslu Sumut. Sudahlah anggaran tak cair, Pergub untuk menunjang kinerja Panwaslu pun tak kunjung terbit,” ujarnya. Ditambahkan, dengan tidak dicairkannya anggaran akan membuka peluang kerawanan keuangan Panwaslu apabila selalu mendulukan pembiayaan kegiatan. Apabila Pergub tersebut tidak segera terbit, hal ini juga dinilai akan melemahkan Panwaslu dalam melakukan pengawasan Pemilukada. Hasan juga menyampaikan keheranannya kenapa sampai saat ini Pergub yang diminta Panwaslu Sumut tak kunjung terbit. Padahal Sekdaprov Sumut Nurdin Lubis beserta pejabat lainnya sudah melakukan pengayaan ke Provinsi Jawa Barat dengan mengikutsertakan KPU dan Panwaslu. ‘’Untuk apa studi banding ke Jabar dilaksanakan. Itu menghambur-hamburkan angga-

APDESI DS Dan Gerak Mantab Siap Jadi Pasukan Terdepan Hantarkan Amri Jadi Gubsu

Curi Arus Listrik Terancam Denda Rp1,5 M MEDAN (Waspada): Gudang konstruksi dan pengelasan PT Kharisma Pratama Abadi Jln. Veteran PasarVI Gang Tanjung Raya, Medan Deli, digerebek petugas Dit. Reskrimsus Poldasu dan PT PLN, karena mencuri arus listrik. Polisi menetapkan dua tersangka, yakni MAH, 51, pemilik gudang warga Jln. Pasar 10, Dusun VI A, Kec. Labuhan Deli, dan karyawan outsourhing Su alias Anto, 33, warga Dusun VII A, Jln. Veteran Pasar X, Kec. Labuhan Deli. Dari gudang itu diamankan barang bukti enam trafo, 12 meter kabel TIC ukuran 3 x 35 mm2 dan 1x25 mm2, satu kotak kawat las ukuran 3,2 mili, kwitansi tanda terima Rp10 juta panjar sewa gedung. Direktur Dit Reskrimsus Poldasu Kombes Pol. Sadono Budi Nugroho di dampingi Kanit III Tipiter Kompol Robin Simatupang kepada wartawan di Mapoldasu, Selasa (18/9) mengatakan, keduanya ditangkap Kamis (13/9) sekira pukul 11:00. “Tersangka Anto atas permintaan Arifin menyambung langsung arus dari tiang listrik milik PLN tanpa izin. Karenanya mereka yang dijadikan tersangka kasus itu,” ujarnya. Sadono mengatakan, dari keterangan PLN, bangunan itu sudah tiga kali kena razia P2TL. “Tiga kali diputus oleh petugas P2TL, namun tak pernah diselesaikan,” ujarnya sembari mengatakan, di dalam gudang juga ditemukan penggerak mesin pres, namun tidak dibawa ke Polda karena berat. Namun tersangka MAH membantah trafo yang disita itu miliknya. “Bukan punya saya, itu

Ridwan menyebutkan, hal itu merupakan persoalan serius jika dibiarkan berlarut-larut sebab akan berdampak pada kinerja Plt Gubsu Gatot Pudjo Nugroho. “Plt Gubsu harus tegas terhadap pejabat yang tidak becus dalam memperoses anggaran untuk Panwaslukada tersebut hingga anggaran tidak cair padahal tahapan Pilgubsu sudah berjalan,” ujar Ridwan kepada wartawan, Selasa (18/9) di Medan. Ketika ditanya, apakah Kabiro Keuangan Bahar Siagian dan Kaban Kesbangpolinmas Sumut Edy Sofyan harus dievaluasi, Ridwan menjelaskan, kalau benar dua pejabat ini yang membuat terhambatnya ang-

garan Panwaslukada tak cair, memang harus di evaluasi. Ridwan menjelaskan semestinya Pemprovsu sudah menyiapkan anggaran sebelum Panwaslukada melakukan tahapan sehingga tidak menghambat kerja Panwaslukada terlebih saat ini Panwaslukada sedang merekrut Panwaslukada Kabupaten/Kota. “Saya khawatir dengan terhambatnya pencairan anggaran untuk Panwaslukada oleh Pemprovsu akan memperburuk citra Pilgubsu 2013,” sebut Ridwan. Pemprovsu sebut Ridwan, bukan pertama kali melaksanakan Pilgubsu secara langsung, semestinya sudah mempersiapkan segala sesuatu secara matang termasuk anggaran penyelenggara yakni Panwaslukada dan KPU. Secara terpisah, Direktur LBH Trisila Sumut, Hasan L Raja SH mengemukakan rasa keprihatinannya atas tak kunjung cairnya anggaran Panwaslu Sumut.

hukuman yang diterima para terdakwa yang dianggap terlalu ringan. Hukuman yang diberikan kepada terdakwa tidak akan memberi efek jera dan dikuatirkan terdakwa akan mengulangi perbuatannya kembali. Menurut dia, persoalan yang dihadapi para pedagang ikan Simpang Limun bukan hanya sebatas pengrusakan lapak saja. Namun jauh dari pada itu perihal kemanusian dan keadilan yang melibatkan nasib orang banyak. “Yang kita tuntut rasa keadilan bukan hanya sekedar perkara pengrusakan. Saat ini pedagang harus berjualan dipinggir jalan. Ini nantinya pasti akan menimbulkan masalah baru. Untuk itu Pemko Medan kami harap bisa mencarikan solusi atas perkara ini,”sebutnya. Tuntutan enam bulan yang diberikan kepada para terdakwa, lanjutnya, dinilai sarat dengan permainan. Apalagi para terdakwa dijerat dengan Pasal 170 ayat (1) dan pasal 406 ayat (1) jo pasal 55 KUHPidana dengan ancaman hukuman minimal dua tahun kurungan. “Kita telah menyurati Pengawas Kejatisu untuk memeriksa para jaksa yang kita duga melakukan permainan. Selain tuntutan yang sangat minim, dalam perkara ini jaksa juga tidak menggali otak dari pelaku pengrusakan. Karena tidak mungkin mereka nekad berbuat seperti itu tanpa ada yang memerintahkannya,” ujarnya sembari akan meminta Jaksa Penuntut Umum melakukan banding. (m38)

yang membuat mereka memberikan dukungan penuh kepada Drs H Amri Tambunan untuk jadi Gubsu. Antara lain sejak Deliserdang dibawah pimpinan Drs H Amri TAmbunan sudah banyak yang diperbuatnya dengan melakukan berbagai terobosan program pembangunan di segala bidang yang kesemuanya itu untuk kemajuan dan mensejahterakan masyarakatnya. Disamping itu, Amri telah memiliki berbagai pengalaman yang cukup matang di bidang pemerintahan karena ia merupakan seorang birokrat tulen yang sangat faham tentang selukbeluk pemerintahan. “Pak Amri ini merupakan seorang pejabat birokrat yang pernah menduduki jabatan penting di Propinsi Sumatera Utara diantaranya pernah menjabat sebagai Kepala Biro Humasy, Sekdako Medan dan terakhir pernah menjabat sebagai Kepala Badan Informsi dan Komunikasi Propinsi Sumatera Utara sebelum menduduki jabatan sebagai Bupati Delisedang dua priode” ujar mereka. Hal ini menunjukkan bahwa Drs.H. Amri Tambunan sudah memiliki cukup syarat untuk menduduki jabatan sebagai Gubsu dengan berbagai jabatan yang pernah diembannya itu. Ditambahkan, apa yang dilakukan saat ini sangat pantas ditujukan kepada Drs.H. Amri Tambunan karena yang bersangkutan dinilai telah berhasil mendorong kembali semangat kegotong royongan dengan didukung tiga pilar kekuatan

yakni pemerintah, masyarakat dan pihak swasta sehingga berbagai program pembangunan dapat dilaksanakan dengan baik di kabupaten Deliserdang ini. Semangat membangun melalui program Gerakan Deli Serdang Membangun (GDSM) benarbenar telah menyentuh langsung kepentingan masyarakat. Bukan saja pada bidang pembuatan jalan baru atau rehabilitasi dan pemeliharaan jalan dan jembatan, bahkan sarana irigasi, pembangunan gedung sekolah dan pemberdayaan pusat kesahatan masyarakat, juga terbukti sangat menyentuh kepentingan masyarakat. Jadi, lanjutnya, apa yang sudah dilakukan Bupati Amri Tambunan sangatlah wajar bila diteruskan ke seluruh wilayah Sumatera Utara dan sangatlah tepat jika seluruh warga di Sumut ini mendukung beliau menjadi orang nomor satu di Sumut ini dalam Pilgubsu yang direncanakan akan dilaksanakan pada Tahun 2013 ini. Oleh karenanya, untuk mendukung beliau ini kami baik atas nama APDESI maupun Gerak Mantab turut mendoakannya bahkan siap menjadi pasukan terdepan agar sukses dalam mengikuti persaingan merebut kursi Sumut-1 itu. “Beliau sangat pantas didaulat menjadi gubernur, karena selain sebagai seorang birokrat sejati, beliau juga memiliki sikap santun, terpuji, dan selalu terjum ke masyarakat untuk mendengar dari dekat aspirasi masyarakatnya,” tambah Ketua Gerak Mantab Bambang Hartoko (crul)

Polisi Gelar Rekonstruksi Pembunuhan Pengusaha Butut MEDAN (Waspada): Dua pelaku pembunuhan terhadap pengusaha barang bekas (butut) di Dusun II, Desa Sei Rotan, Kec. Percut Seituan, pada akhir Agustus 2012 lalu, mengaku nekad membunuh Husin karena kerap dituduh mencuri di dalam gudang milik korban. Korban dipukul pakai kayu balok dan besi hingga tewas. Pengakuan kedua tersangka berinisial SBP, 21, warga asal Rantau Prapat yang bermukim di Jln. Makmur Ujung, Komplek Cemara Asri Blok O, Desa Sena, Kec. Batangkuis, dan AGH alias Sani, 22, warga Jln. Perintis, Desa Bandar Khalipah, Kec. Percut Seituan, terungkap saat dilakukannya rekonstruksi (reka ulang) kasus pembunuhan terhadap pengusaha butut bernama Husin, 52, warga Jln. Palang Merah, Kel. Kesawan, Kec. Medan Barat, Rabu (19/9) sekira pukul 12:30, di lokasi gudang butut milik korban. Rekonstruksi tersebut diawali dengan kedatangan tersangka SBP ke gudang tersebut untuk menemui tersangka AGH alias Sani yang tinggal di dalam gudang itu. Saat keduanya sedang ngobrol, tiba-tiba korban yang juga berada dalam gudang tersebut menuduh tersangka SBP telah mencuri barangbarang miliknya, sehingga pertengkaran terjadi di antara mereka.

Karena kesal dengan sikap Husin, tersangka SBP menceritakannya kepada Sani dan mereka sepakat untuk melakukan pembunuhan kepada bos mereka itu. Selanjutnya karena kesediaan Sani untuk menjadi wali nikah, SBP menjemputnya. Usai melangsungkan pernikahan, tersangka SBP dan Sani kembali lagi membahas rencana mereka untuk membunuh Husin. Kedua menyiapkan kayu balok dan sebilah besi sepanjang 1 meter. Alat untuk membunuh korban disimpan di dalam kamar Sani. Sabtu (25/8), saat kedua tersangka berada di dalam gudang, tiba-tiba Husin datang. Kedua tersangka langsung masuk ke dalam kamar untuk mengambil kayu balok dan besi, sementara Husin terlihat sedang berdiri di pintu gudang sembari berbicara dengan seseorang melalui telefon selulernya. Kedua tersangka langsung memukul kepala korban dari arah belakang hingga terkapar. Enam kali pukulan membuat pengusaha butut itu tewas. Selanjutnya tersangka Sani menutup pintu dan mengambil seutas tali karena Husin dilihat masih bernyawa. Selanjutnya tali tersebut dililitkan ke leher korban. Karena tangan mereka sakit oleh tali itu, Sani kembali masuk ke dalam gudang mengambil obeng, sedangkan ter-

sangka SBP mengambil sapu tangan lalu menjerat leher korban selama 20 menit. Kemudian tersangka SBP mengambil dompet Husin yang berisi uang Rp240 ribu. Setelah memastikan korban tewas, kedua tersangka menyeret mayat Husin ke tempat pembuangan sampah di belakang gudang butut. Mayat itu ditimbun dengan sampah dan ditutup dengan goni dan rantingranting kayu. Selain itu, kedua pelaku juga membakar jeket korban di tempat pembakaran sampah lalu pergi dengan membawa sepedamotor Supra X BK 3017 KJ. Sepedamotor korban dijual oleh kedua pelaku dengan harga murah. Jalannya rekonstruksi tersebut disaksikan oleh puluhan warga dan dipimpin oleh Kanit Reskrim Polsek Percut Seituan AKP Faidir Chan. Selain pihak kepolisian, dan keluarga korban yang diwakili oleh kakak korban A Cien, rekonstruksi tersebut juga dihadiri oleh perwakilan dari Kejari Lubuk Pakam, Cabang Labuhan Deli. AKP Faidir Chan menjelaskan, akibat perbuatannya itu, kedua tersangka dijerat Pasal 340 subs 339 lebih subsider 338 atau 365 ayat 4 KUH Pidana dengan ancaman penjara seumur hidup atau minimal 20 tahun penjara. (h04)

Pegawai Biro Umum Mangkir Dari Pemeriksaan MEDAN (Waspada): Pegawai Biro Umum Setda Pemprovsu berinisial Su, yang dijadikan tersangka atas dugaan korupsi di Biro Umum ‘mangkir’ dari jadwal pemeriksaan lanjutan yang direncanakan Rabu (19/ 9), dengan alasan sakit. Karenanya penyidik Subdit III/Tipikor Direktorat Reskrimsus Polda Sumut menjadwal ulang pemeriksaannya, Kamis (20/9). “Semestinya hari ini pemeriksaan lanjutan, tetapi tidak datang karena mengaku sakit. Pemeriksaannya akan kita lanjutkan besok,” kata Direktur Dit Reskrimsus Polda Sumut Kombes Pol. Sadono Budi Nugroho kepada wartawan, Rabu. Ditanya hasil pemeriksaan sebelumnya terhadap Su, Sadono belum mengetahui hasilnya karena berkasnya masih di tangan penyidik. Demikian juga

soal kemungkinan dilakukannya penahanan terhadap Su.“Belum tahu karena hasil pemeriksaan sementara masih sama penyidik. Ditahan atau tidak, tunggu hasil penyidikannya,” sebutnya. Tersangka Su, Selasa kemarin telah diperiksa di Poldasu terkait dugaan korupsi Rp13 miliar di Biro Umum Setda Provsu. Pemeriksaan dilakukan hingga malam, sehingga dilanjutkan esok harinya. Namun dia tidak datang dengan alasan sakit. Terkait kasus itu, Polda akan terus mengembangkan penyelidikan. Saat ini mantan Bendahara Umum Aminuddin dan Plt. Kabag Rumah Tangga Neman Sitepu yang merupakan atasan Su, telah mendekam di tahanan Polda Sumut. Subdit III/Tipikor Polda Sumut masih berusaha mengembangkan penyelidikan terhadap

Kepala Biro Umum selaku Kuasa Pengguna Anggaran (KPA) Hj Nurlela SH, setelah ditemukannya sejumlah kwitansi pengeluaran yang ditandatanganinya. Dalam kasus ini, Polda juga memeriksa Sutyas Handayani, istri Plt Gubsu Gatot Pudjo Nugroho dan Fatimah Habibi, istri Gubsu non aktif Syamsul Arifin sebagai saksi. Keduanya diperiksa karena ditemukan kwitansi yang mereka tandatangani. Kabid Humas Polda Sumut Kombes Pol. Heru Prakoso pernah mengatakan, ada sejumlah calon tersangka lain dalam ka-sus tersebut,yaituRahmatsyah(mantanPltSekda),AsrinNaim(Asisten IV/Administrasi Pemprovsu), Harianto Butar-Butar (Kabag Perbendaharaan Biro Umum), RidwanPanjaitan(AsistenPribadiPlt. Gubsu)danRajali(mantanKepala Biro Umum).(m27)

ran,” tandasnya. Sebelumnya disebutkan, pennyelenggara Pilgubsu yakni KPU, Panwaslukada Sumut dan Pemprovsu studi banding ke Jawa Barat, Depdagri dan Departemen Keuangan mempelajari format keuangan untuk Pilgubsu. Bahkan antara Pemprovsu KPU-Panwaslukada Sumut sudah melakukan MoU mengenai

anggaran. Terhambatnya pencairan anggaran disinyalir akibat ada tarik-menarik kepentingan antara Biro Keuangan dan Bakesbang Pol dan Linmas Sumut. Hal itu dibenarkan Kabiro Keuangan Pemprovsu Bahar Siagian ketika dikonfirmasi wartawan. Bahar mengarakan silahkan tanya ke Kaban Kesbangpol dan Linmas Sumut.(m34/rel)

Warga Pancuran Bambu Sibolga Dukung RE Nainggolan SIBOLGA(Waspada):KalangankaumtuawargaKelurahanPancuran Bambu Kecamatan Sibolga Sambas Kota Sibolga dukung DR. Rustam Efendi Nainggolan sebagai calon Gubsu periode 2013-2018. Demikian dikatakan Parlin, Paisal Pasaribu dan Uak Robet Tamebaha kepada Waspada di Sibolga, Selasa (18/9). Menurut mereka RE Nainggolan diyakini mampu memimpin Sumut kearah yang lebih baik. “Saya melihat jejak rekam pengalaman RE Nainggolan selama duduk di birokrasi ide-ide yang ditelurkan banyak membawa manfaat memajukan Propinsi Sumut, hal ini membuktikan bahwa RE Nainggolan telah teruji”, jelas Parlin. Dikatakan, Parlin dirinya terus mengikuti perkembangan para kandidat yang ingin bertarung dalam pilgubsu nanti, siapa yang pantas memimpin Sumut kedepan tentang program kerja yang ditawarkan pada masyarakat apakah sesuai dengan hati masyarakat. Sementara Paisal mengatakan hal yang sama, selaku kaum tua tentu sangat hati-hati menentukan dukungan calon agar nanti tidak membeli kucing dalam karung akhirnya menyesal selama 5 tahun.“Kami melihat selaku kalangan tua RE Nainggolan orangnya sangat sederhana dan mudah senyum, walaupun belum pernah bertemu langsung namun dari media terlihat orangnya tidak sombong dan siapa tahu nanti datang ke Sibolga bisa bertemu langsung”, harap Robet Tamebaha. Dalam kesempatan itu mereka berharap agar RE Nainggolan mendapat dukungan dari Partai sebagai salah satu syarat menjadi calon dalam Gubsu, dimana warga Sibolga punya ikatan emosional dengan RE Nainggolan sangat layak untuk didukung, terang Paisal diamini lainnya.(a24)


PAISAL Pasaribu, Parlin Pasaribu dan Wak Robet Tamebaha Warga Kelurahan pancuran Bambu Kota Sibolga Dukung RE Nainggolan sebagai Gubsu saat memberikan keterangan Pers, Selasa malam (18/9)



WASPADA Kamis 20 September 2012

Chairuman: Kasus Bank Century Bisa Diungkap


ANAK GAJAH SUMATERA: Mahout membersihkan tempat penangkaran induk gajah yang baru melahirkan di CRU Sampoiniet Kabupaten Aceh Jaya, Provinsi Aceh, Rabu (19/9). Anak gajah Sumatera betina yang diberi nama Ije Ayu Rosalina lahir pada 18 September 2012 dengan berat 82,6 kg, tinggi 81 Cm, lingkar dada 101 Cm dan panjang 86 Cm.

JAKARTA (Waspada): Misteri kasus Bank Century sudah bisa diungkap oleh Komisi Pemberantasan Korupsi (KPK) melalui keterangan mantan Wakil Presiden (Wapres) M Jusuf Kalla (JK). Anggota Tim Pengawas Century DPR RI, Dr H.Chairuman Harahap, SH, MH mengemukakan pendapatnya kepada Waspada usai Rapat Timwas Century DPR RI mendengarkan keterangan mantan Wapres Jusuf Kalla dan Ketua KPK Abraham Samad di DPR RI Jakarta Rabu (19/9). Menurut Chairuman yang juga Balon Gubsu dari Partai Golkar itu, dari keterangan JK terlihat bahwa para pengelola atau pengambil kebijakan perekonomian ingin memberikan blanket guarantee atau pemerintah mengeluarkan kebijakan penjaminan penuh terhadap dana nasabah. “Namun itu hanya untuk alasan produk yuridisnya, karena rencana sebenarnya ingin memberikan bailout (dana talangan) kepada Bank Century, sehingga terjadilah kasus tersebut,” ujar Chairuman. Menjawab pertanyaan kesimpulan rapat belum memberikan kepastian atau kasus Century masih merupakan misteri, Chairuman memastikan akan ditindaklanjuti oleh KPK, apalagi Timwas DPR RI masih akan mendengarkan keterangan dari pihak Bank Indonesia. “Tetapi dari keterangan Pak Jusuf Kalla, KPK sebenarnya sudah bisa melangkah menyelidiki orang-orang di Bank Indonesia yang menggelontorkan bailout kepada Bank Century, dan kemana saja aliran dananya,” tandasnya. (j07)

1,5 Juta Petani Tembakau Terncam JAKARTA (Waspada): Sebanyak 1,5 juta petani tembakau diIndonesia terancam mata pencahariannya. Hal itu dapat terjadi apabila Indonesia sampai menandatangani usulan Kerangka Kerja Pengendalian Tembakau atau Framework Convention on Tobacco Control (FCTC) yang digalang Organisasi Kesehatan Dunia (WHO). “Meskipun Indonesia bukanlah penandatangan FCTC, petani tembakau Indonesia tetap merasa khawatir akan usulan pedoman yang semenamena tersebut. Jika Indonesia sampai menandatangani FCTC, mata pencaharian 1,5 juta petani tembakau di Indonesia bisa musnah,” kata Sekjen Asosiasi Asosiasi Petani Tembakau Indonesia (APTI), Budidoyo, kepada sejumlah wartawan di Jakarta, Rabu (19/9). Rancangan pedoman ini dikenal sebagai ‘Pasal 17 & 18’ dan akan dibahas pada COP 5 (Conference of the Parties), yang akan berlangsung di Seoul, Korea Selatan, pada 12-17 November 2012 mendatang. 175 negara yang telah menandatangani FCTC berhak menghadiri Konferensi untuk memberikan suara. Menurut Budidoyo, rancangan pedoman ini telah me-

lenceng dari amanat awal FCTC yang bertujuan untuk menyediakan “bantuan teknis dan keuangan untuk membantu transisi ekonomi bagi petani dan pekerja tembakau yang mata pencahariannya terkena dampak karena turunnya permintaan yang disebabkan oleh program pengendalian tembakau”. “Alih-alih membantu petani tembakau, pedoman ini malah dirancang untuk mematikan petani tembakau melalui berbagai pembatasan-pembatasan mulai dari pembatasan produksi dengan mengatur musim untuk menanam tembakau, pengurangan area yang diperbolehkan untuk menanam tembakau, pelarangan pemberian dukungan keuangan dan teknis untuk petani tembakau, sampai dengan pembubaran semua lembaga yang menghubungkan petani dengan pemerintah,” papar Budidoyo yang jugaWakil Ketua Umum Aliansi Masyarakat Tembakau Indonesia (AMTI) ini. Sementara itu Ketua Departemen Advokasi AMTI Soeseno menegaskan bahwa hingga saat ini belum ditemukan pengganti tanaman tembakau yang dapat memberikan keuntungan bagi kesejahteraan petani tembakau. “Kami belum menemukan

tanaman pengganti yang dapat memberikan keuntungan setara dengan tembakau, terutama di tempat-tempat yang karena kondisi tanahnya yang sedemikian rupa, hanya dapat ditanami tembakau,” kata Soeseno. Sebagai bentuk solidaritas dalam upaya perlawanan terhadap usulan ini di Indonesia, APTI bergabung dengan International Tobacco Growers’ Association (ITGA) dalam mendapatkan dukungan global, melalui pengumpulan petisi secara online maupun secara langsung kepada anggota APTI. Petisi ini berisi permintaan kepada pemerintah untuk “menolak usulan yang irasional dan merusak dan agar mengedepankan pendekatan yang lebih realistis dalam membantu petani beradaptasi saat terjadi perubahan permintaan tembakau”. Sebelumnya, Menteri Kesehatan Nafsiah Mboi menyatakan pemerintah siap menandatangani FCTC guna melindungi masyarakat dari bahaya merokok dan asap rokok. “Indonesia siap menandatangani FCTC. Karena kami me-lihat sudah banyak efek merokok yang sangat merugikan masyarakat,” tanda Menkes. (dianw)

Soal RUU Kamnas

IPW Nilai Pemerintah Arogan JAKARTA (Waspada): Ketua Presidium Indonesia Police Watch (IPW) Neta S.Pane menilai sikap pemerintah yang kembali menyerahkan Rancangan Undang-Undang Keamanan Nasional ke DPR tanpa adanya revisi terhadap berbagai pasal yang multi tafsir dan berpotensi melanggar Hak Asasi Manusia (HAM ) sebagai bentuk arogansi. Pada hal, RUU Kamnas ini, juga berpotensi melanggar TAP MPR dan UU Pembentukan Perundang-undangan, sebab dalam prosesnya diduga ada yang tidak sehat. ” Proses RUU Kamnas ini, IPW melihat jelas tidak sehat apa lagi berbagai pasal di dalam RUU itu jelas dikondisikan pemberangusankebebasansipil,”ujar Neta, Selasa (18/9) di Jakarta. Dia menjelaskan, sekitar enam bulan lalu, DPR sudah mengembalikan draft RUU Kamnas kepada pemerintah disertai berbagai catatan agar dilakukan revisi terhadap beberapa pasal yang dinilai sangat multi tafsir dan berpotensi melanggar HAM. Namun bulan ini, pemerintah mengembalikan RUU kepada DPR tanpa mengubah sedikit pun pasalpasal yang sebelumnya diminta DPR untuk direvisi. ”Anehnya, seluruh fraksi yang tergabung dalam koalisi plus fraksi Gerindra justru menerimanya. Ini yang saya maksud tidak sehat,” tandasnya Bukti lain ketidaksehatan RUU itu, menurut Neta, sesuai Pasal 18 UU Nomor 10 tahun 2004 tentang Pembentukan Perundang-undangan, disebutkan setiap undang-undang harus dibuat atau melibatkan pihak yang berkepentingan. Selain itu, TAP MPR Nomor VI tentang pemisahan TNI dan Polri, maupun TAP MPR Nomor VII tahun 2000 tentang wewenang TNI dan Polri disebutkan kepolisian berwewenang dalam keamanan nasional

dan TNI berwewenang dalam pertahanan nasional. ”Nah, dalam konteks RUU Kamnas yang jelas-jelas tema utamanya keamanan mengapa tidak melibatkan kepolisian sebagai institusi negara yang bertugas dalam keamanan sesuai TAP MPR VI itu?. Mengapa RUU Kamnas hanya dibuat dan diajukan Kementerian Pertahanan dibantu Kemenko Polhukam lantas diserahkan ke Komisi I DPR yang membidangi pertahanan ? Artinya ada pelanggaran TAP MPR dan UU No. 10 tahun 2004 tentang pembentukan perundang-undangan dalam hal ini. Tapi kenapa RUU itu tetap diterima ? Ini juga yang saya maksud tidak sehat,” jelas Neta. Berbahayanya dari RUU Kamnas ini, menurut Neta, dimana keamanan dilihat dari kaca mata pertahanan, sehingga mencampuradukan antara keamanan dan pertahanan. Padahal, ada perbedaan sifat yang sangat besar antara keamanan dan pertahanan, yakni keamanan yang bersifat preventif dan pertahanan yang bersifat represif . “Kalau anda teliti pasalpasal didalamnya, jelas terlihat sudut pandang yang digunakan dalam penanganan keamanan menggunakan pendekatan represif kok,” tegas Neta. Dia pun menilai ada ”kerja sama” antara Pemerintah cq Kemenhan dan Kemenko Polhukam dengan DPR untuk menggolkan RUU Kamnas ini menjadi sebuah produk UU. ”Terus terang saja, saat ini ada upaya pemerintah untuk mengembalikan peranan militer seperti jaman Orde Baru. Presiden SBY itu bagaimanapun demokratnya dan reformisnya beliau, namun tetap saja beliau berlatar belakang militer. Makanya periode kedua yang akan selesai dua tahun lagi, ia nampak ingin mengambil hati militer dengan kembali memberikan peranan besar melalui RUU Kamnas ini,” pungkasnya.

Sedangkan Wakil Ketua Komisi I DPRRI TB Hasanudin menilai ada beberapa gagasan yang belum jelas di dalam pasalpasal RUU Kamnas. Misalnya definisi keamanan nasional maupun ancaman nasional yang belum jelas ukuran dan kategorinya Ia menegaskan, selain pasal-pasalnya banyak bermasalah, banyak pasal-pasal karet yang dapat diselewengkan penguasa demi kepentingan politiknya. ”Pasal karet itu kan bisa menjadi multi tafsir karena bersifat elastis. Nah, pemerintah seharusnya memperbaiki dulu pasal-pasal itu karena dapat saja diselewengkan demi kepentingan penguasa,” ujar TB Hasanudin di gedung DPR RI. Dicontohkannya, Pasal 54 e dalam RUU Kamnas versi pemerintah itu yang menyebutkan adanya kuasa khusus yang dimiliki Dewan Keamanan Nasional yang berhak menyadap, menangkap, memeriksa dan memaksa, dinilai Hasanudin sebagai pelanggaran HAM. ”Lantas di dalam pasal 59 RUU ini menjadi (bersifat khusus) lex spesialis, dijadikan semacam payung yang menghapus UU lainnya. Termasuk bisa menghapus UU nomor 3 tentang Pertahanan Negara,” tuturnya Sedangkan Pasal 22 jo Pasal 23 RUU Kamnas, lanjut Hasanudin lagi, nampak jelas memberi peran terlalu luas kepada unsur badan Intelijen Negara (BIN) sebagai penyelenggara Kamnas. ”Lantas pasal 10, pasal 15 jo pasal 34 tentang darurat sipil dan militer sudah tidak relevan lagi bila acuannya pada UU Keadaan Bahaya. Kemudian Pasal 17 (4) yang sangat berpotensi membayakan demokrasi dan bersifat sangat mutlak karena disebutkan di dalam pasal itu bahwa ancaman potensial dan non potensial diatur dengan keputusan presiden,” tutup TB Hasanudin . (aya)

Gubernur Akan Lepas Kloter I Padang PADANG (Antara): Gubernur Sumatera Barat Irwan Prayitno dijadwalkan melepas keberangkatan jamaah calon haji kloter pertama Embar kasi Padang pada Kamis (20/9) di Asrama Haji Tabing Padang. Sebanyak 369 jamaah calon haji kloter pertama yang berasal dari Kota Padang dan Kabupaten Pasaman Barat akan langsung dilepas Gubernur Irwan Prayitno, kata Kepala

Kantor Wilayah Kementerian Agama Sumbar Ismail Usman di Padang, Rabu (19/9). Kloter pertama akan bertolak menuju Jeddah pada Jumat (21/9) pukul 11:15WIB dari Bandara Internasional Minangkabau di Padangpariaman menggunakan maskapai Garuda Indonesia. Dikatakannya, setelah dilakukan pemeriksaan dan tes kesehatan serta pembagian

living cost atau biaya hidup jamaah dipersilahkan untuk beristirahat dan menunggu acara pelepasan secara resmi oleh gubernur. Total calon jamaah haji yang berangkat melalui embarkasi Padang berjumlah 7.443 orang dalam 20 kloter. Dari 7.443 orang itu sebanyak 4.498 orang berasal dari Sumbar, 1.614 orang dari Bengkulu dan Jambi 1.231 orang ditambah 100 petugas haji.


KELAHIRAN ANAK HARIMAU: Manis, seekor harimau Benggala (panthera tigris tigris) menyusui keempat anaknya yang baru dilahirkan di kandangnya, di Taman Margasatwa Mangkang Semarang, Jateng, Rabu (19/9). Harimau betina yang berusia sembilan tahun itu melahirkan empat anak pada Selasa (18/9) dan merupakan kelahiran pertama baginya.

Selingkuh= Korupsi Antara

TERDAKWA Angelina Sondakh didampingi ayahnya (kanan) ketika berada di ruang tunggu tunggu tahanan Pengadilan Tipikor, Jakarta, Rabu (19/9). Dalam sidang tersebut jaksa penuntut umum meminta majelis hakim menolak semua nota keberatan terdakwa.

Jaksa Tolak Eksepsi Angie JAKARTA (Antara): Jaksa penuntut umum Komisi Pemberantasan Korupsi (KPK) menolak nota keberatan atau eksepsi dakwaan yang disampaikan oleh terdakwa Angelina Sondakh (Angie). Jaksa saat membaca jawaban atas eksepsi Angelina Sondakh di Pengadilan Khusus Tindak Pidana Korupsi (Tipikor) Jakarta,Rabu (19/9) memohon Majelis Hakim Tipikor untuk menolak keberatan terdakwa, menyatakan surat dakwaan penuntut umum dijadikan sebagai dasar pemeriksaan, dan melanjutkan persidangan. Menurut jaksa, keberatan yang disampaikan dalam nota keberatan oleh kuasa hukum terdakwa dalam persidangan sebelumnya di mana pihak terdakwa menganggap dakwaan kabur tidaklah benar. Sedangkan terkait pemilihan dakwaan apakah alternatif atau subsidaritas sepenuhnya kewenangan jaksa penuntut umum. Selain itu adanya dakwaan alternatif akan memberi kesempatan lebih luas pada terdakwa melakukan pembelaan. Sedangkan keberatan terdakwa mengenai jumlah penerimaan uang oleh Angie dalam proyek Kemendiknas mau pun Kemenpora, menurut jaksa, hal tersebut telah dijelaskan terperinci dalam surat dakwaan. Terkait kebenaran fakta penerimaan jumlah tersebut akan dibuktikan dalam persidangan, ujar jaksa penuntut umum KPK. Sedangkan keberatan atas penerapan pasal 12 huruf a UndangUndang (UU) Pemberantasan Tindak Pidana Korupsi dalam dakwaan pertama hal tersebut merupakan kewenangan sepenuhnya jaksa penuntut umum. Angie didakwa telah menerima uang sebanyak Rp12,58 miliar dan 2,35 juta dolar dari Grup Permai pada kurun waktu Maret hingga November 2010. Pemberian tersebut dalam rangka pengurusan proyek di sejumlah perguruan tinggi di Ditjen Pendidikan Tinggi (Dikti) Kemendiknas juga terkait program pengadaan sarana dan prasarana di Kemenpora.


SUASANA pengajian akbar/sosialisasi pengenalan MTA kepada masyarakat dan Muspida di Jambi di desa Pulau Tujuh, Kec. Pamenangbarat, Kab. Merangin/Bangko, Jambi, kemarin.

MTA Berdakwah Di Pedalaman Jambi JAMBI (Waspada): Majlis Tafsir Alquran (MTA) perwakilan wilayah Sumatera Utara mengirimkan tim dakwah ke Jambi sebanyak 42 orang .Tujuan pengiriman tim ini sebagai penguatan atas aktivitas dakwah yang selama ini telah dilaksanakan di Jambi. Kegiatan pembinaan dakwah yang dilaksanakan MTA telah berlangsung selama tiga tahun lebih. Berawal dari berita harian Waspada dan internet tentang aktivitas MTA menarik perhatian dan minat masyarakat untuk membina hidup berdasarkan Alquran dan sunah di pengajian Majlis Tafsir Alquran. Dari hanya beberapa keluarga saja, kini pengajian rutin dilaksanakan secara periodik setiap bulannya di isi oleh Al Ustadz Sarijo, SAg selaku pimpinan MTA wilayah Sumatera Utara. Pengajian rutin tersebut selalu dihadiri lebih dari 150 umat Muslim yang berdatangan dari Rimbo Bujang, Tebingtinggi, Jambi Kota, Sungai Bahar, Kerinci/Sungai Penuh, Sungai Rumbai (Sumbar), Rawas (Sumsel). Pengajian rutin Jambi Raya tersebut dilaksanakan di desa Pulau Tujuh kecamatan Pamenang barat kabupaten Merangin/Bangko Jambi. Di hadapan umat Muslim dan tim safari dakwah desa Pulau Tujuh kecamatan Pamenang barat kabupaten Merangin/Bangko Jambi Al Ustadz Sarijo, SAg menyampaikan tausiyah dengan tema ’’Islam menjunjung tinggi persatuan dan kesatuan serta membenci perpecahan dan permusuhan”. Ia mengutip sabda nabi yang mafhum-nya “menjaga persatuan itu pahalanya lebih besar dari shalat, puasa dan sedekah. “Orang Mumin satu dengan yang lain seperti satu bangunan yang saling kuat menguatkan,” katanya. Oleh karena itu, dia menghimbau, umat Islam untuk tidak gampang terhasut oleh pihak-pihak yang tidak bertanggungjawab melalui pemberitaan media atau isu yang berkembang di tengah masyarakat. “Islam telah “mempersenjatai” kaum Muslimin untuk menghadapi berita yang tersebar di tengah tengah masyarakat dengan tabayyun (check and recheck),” katanya.(m07/rel)

JAKARTA (Antara): Ketua Komisi Pemberantasan Korupsi (KPK) Abraham Samad mengatakan, selingkuh sama dengan tindak pidana korupsi, khususnya suap. “Itu melanggar, itu pelanggaran berat kalau di KPK sama dengan menerima suap,” kata Abraham di Gedung DPR RI, Jakarta, Rabu (19/9). Abraham mengakui, pihaknya memecat pegawainya berinisial MNHS yang berasal Badan Pengawasan Keuangan dan Pembangunan (BPKP) karena selingkuh, bukan karena suap. “Yang jelas, yang bersangkutan telah dipulangkan terkait pelanggaran etik, bukan masalah penyuapan tapi melakukan hubungan seperti semacam perselingkuhan,” ujar Abraham. Abraham mengatakan, berdasarkan kode etik KPK semua pagawai dan pejabat KPK tidak diperbolehkan melakukan perselingkuhan. “Kode etik tersebut berlaku untuk semua pejabat dan pegawai KPK,” ujarnya. Abraham meminta kepada

BPKP untuk memberikan sanksi kepada MNHS terkait dengan pelanggaran yang dilakukan. Pemecatan MHSN dikarenakan KPK memiliki bukti kuat adanya perselingkuhan yang dilakukannya. “Itu kan pelanggaran etika. Tidak boleh seorang pegawai KPK itu melakuan selingkuh. Dia melakukan perselingkuhan dan itu kuat sekali datanya,” tambah Abraham. Sebelumnya MNHS diduga menerima suap dalam melaksanakan tugasnya. Namun terkait dengan dugaan tersebut KPK masih mendalami. “Kita akan telusuri lagi. Tapi untuk sementara yang ditemukan KPK itu adalah perselingkuhan,” tegas Abraham. Rekrut Penyidik Samad mengatakan, KPK tengah melakukan rekrutmen penyidik. “Kita akan melakukan rekrutmen 30 orang penyidik pada tahap pertama. Dan itu sedang berlangsung,” kata Abraham. Menurut Abraham, rekrutmen penyidik independen itu didasarkan pada rekomendasi Mahkamah Agung.

“Dasar hukumnya ada. Itu ada persetujuan MA dan tempat pelatihan akan dilakukan di Pusdiklat MA. Itu adalah bentuk legalitas rekrutmen itu,” kata Abraham. Bahkan, kata Samad, penyidik yang direkrut itu nantinya bakal menjadi Pegawai Negeri Sipil. “Penyidik KPK jadi PNS akan dicoba,” katanya. Sementara itu, terkait penandatanganan MoU dengan TNI, Abraham menegaskan, tak ada satupun pihak yang bisa membatalkan MoU tersebut. “Saya tegaskan, bahwa siapapun tidak bisa memaksa KPK untuk membatalkan MoU. Saya tegaskan, saya tidak akan mundur selangkahpun untuk membatalkan MoU yang sudah saya tanda tangani dengan pihak TNI,” kata Samad. MoU dengan TNI, lanjutnya, sudah berlangsung lama, sejak KPK dipimpin oleh Taufiqqurahman Ruki. “Saya tinggal memperpanjang. Ini harus saya jelaskan, agar clear. Jangan ada kesan MoU dibangun karena ada masalah. Ini sudah lama,” pungkas Samad.

RUU Kebudayaan Sangat Diperlukan Lindungi Keanekaragaman Budaya YOGYAKARTA (Waspada): Keberadaan Rancangan Undang-Undang (RUU) Kebudayaan dinilai sangat diperlukan. Pasalnya, masih banyak kekayaan budaya yang belum terakomodir, termasuk upaya melindungi dan melestarikan nilainilai budaya bangsa di masyarakat, melindungi kota-kota bersejarah dan meningkatkan manajemen permusiuman. “RUU Kebudayaan akan melindungi kita sudah siap bertemuan para ahli bidang sosial dan budaya. Saat ini draft nya sedang disusun dan dikembangkan terus. Kemungkinan besar sudah akan diusulkan pada 2013,” kataWakil Menteri Pendidikan dan Kebudayaan bidang Kebudayaan, Wiendu Nuryanti dalam jumpa pers penutupan Pertemuan Tingkat Menteri Kebudayaan Asia Eropa/Asia Europe Meeting-Culture Minister’s Meeting (ASEM-CMM) ke-5 di Hotel Hyaat Regency Yogyakarta, Rabu (19/9). Saat ini, lanjut Wiendu, sudah ada dua UU yang terkait kebudayaan yakni UU No 33/2009 tentang perfilman dan UU No

11/2010 tentang cagar budaya. Namun menurut Wiendu, keduanya tidak berperan dalam mengoptimalkan perkembangan sejarah dan budaya bangsa Indonesia yang sangat beraneka ragam. “Banyak sendi-sendi kehidupan berbudaya lainnya di luar perfilman dan cagar budaya yang belum masuk ranah hukum. Apalagi tentang tata kelola kota tua, sama sekali belum tersentuh,” kataWiendu. Dalam kesempatan itu Wiendu didampingi sejumlah peserta ASEM CMM di antaranya Duta Besar Cyprus untuk Indonesia, Nicolas Papayi; perwakilan delegasi China Jean Wee Mei Yin serta anggota delegasi Belanda, Sander Bersee. Dikatakan Wiendu, saat ini banyak kota-kota bersejarah yang sudah kehilangan karakternya. Kondisi itu dapat dilihat dengan terbengkalainya bangunan-bangunan tua bersejarah yang justru menyimpan nilainilai budaya tinggi. Kalau tidak hancur, bangunan-bangunan tua juga banyak yang berubah penampilan dan fungsi sehingga tidak menggambarkan keber-

adaan sejarahnya di masa lampau. Di jalanan, lanjut dia, kota tua juga semakin dipenuhi dengan baliho-baliho atau papan iklan besar yang mempersempit pandangan. Pemerintah daerah menganggap hal itu sahsah saja, apalagi terkait dengan pendapatan daerahnya. ‘Kondisi-kondisi demikian secara tidak langsung juga mengubah apresiasi generasi muda terhadap sejarah dan budaya setempat. Kalau ini didiamkan saja, kemungkinan bangsa ini akan kehilangan jati dirinya,” tegas Wiendu. Selain terkait pelestarian kota bersejarah, RUU Kebudayaan rencananya juga akan meningkatkan apresiasi pemerintah dan seluruh pemegang keputusan terhadap keberadaan musium. Sejumlah negara, diantaranya Perancis, Switzerland dan Estonia sudah menyetujui untuk bekerjasama dalam peningkatan permusiuman di Indonesia. Dalam fo-rum ASEM CMM, ketiga negara tersebut menyatakan diri siap mendatangkan para ahli permusiuman ke Indonesia. (dianw)

Tim Pemantau Aceh DPR RI Akan Panggil Menteri ESDM JAKARTA (Waspada): Tim Pemantau Otsus Pemerintahan Aceh DPR RI akan memanggil Menteri ESDM Jero Wacik karena keputusan Menteri ESDM telah memperpanjang kontrak kerja Triangle Pase Inc untuk mengelola Blok Pase tanpa persetujuan pemerintah Aceh. Rapat Tim Pemantau Otsus Aceh DPR RI memutuskan selain Menteri Jerok Wacik dan Kepala BP Migas akan dipanggil ke DPR untuk melakukan rapat kerja (Raker) khusus membicarakan perpanjangan kontrak pengelolaan wilayah kerja Pase tersebut. Juru bicara Tim Pemantau Otsus Aceh dan Papua DPR RI, Sayed Muhammad Mulyadi, SH mengatakan hal itu kepada Waspada di Jakarta Selasa (18/9). Menurut Sayed M Mulyadi, Menteri Energi dan Sumber Daya Mineral (ESDM), Ir Jero

Wacik dinilai telah melanggar Undang-Undang Pemerintah Aceh (UUPA) karena memperpanjang izin pengelolaan blok Pase kepada perusahaan Triangle Pase Inc tanpa berkonsultasi dengan pemerintah Aceh. Untuk itu Tim Pemantau akan mempertanyakan masalah perpanjangan kontrak pengelolaan wilayah kerja Pase tersebut. “Menteri Jero Wacik dinilai telah melakukan pelanggaran serius karena mengabaikan isi UUPA pasal 160 dan 161. Kita menaruh perhatian atas pelanggaran ini,” tandas Sayed Muhammad Mulyadi, putra Aceh yang juga anggota Komisi III DPR RI Fraksi PDI Perjuangan Dapil Jawa Timur itu. Menteri ESDM Jero Wacik dalam suratnya tanggal 16 Agustus 2012 yang ditujukan kepada Kepala Badan Pelaksana

Kegiatan Usaha Hulu Migas (BP-MIGAS) menyatakan memperpanjang izin pengelolaan wilayah kerja Pase kepada Triangle Pase Inc sejak 24 Agustus 2012. Itu dimaksudkan dalam rangka menjaga kelangsungan produksi gas dari wilayah kerja Pase, karena sampai saat ini belum ada perusahaan pengelola definitif. Gubernur Aceh Zaini Abdullah sebelumnya juga memprotes kebijakan Menteri ESDM tersebut. Protes gubernur dikirimkan melalui surat tertanggal 10 Sepember 2012. Menurut gubernur, Pasal 161 UUPA menyatakan terhadap perpanjangan perjanjian kerjasama harus mendapat kesepakatan dengan pemerintah Aceh. “Ketentuan pengelolaan bersama ini berlaku bagi semua kontrak kerjasama,” demikian Gubernur Zaini Abdullah. (j07)

Luar Negeri Obama: Pemimpin Muslim Tolong Lindungi Warga AS



Kamis 20 September 2012

Seputar ASEAN Mantan Kepala Polisi China Minta Suaka Politik Pada AS

Innocence of Muslims menjijikkan, Tetapi Bukan Alasan Untuk Kekerasan WASHINGTON (Waspada): Ulah Nakoula Basseley Nakoula, otak di balik film anti-Islam, Innocence of Muslims, membuat pusing Pemerintah dan Korps diplomatik Amerika Serikat di luar negeri karena telah jadi sasaran protes, kemarahan dan bendera dibakar. Keselamatan warga AS juga terancam, bahkan sudah ada diplomatnya yang jadi korban. Presiden Barack Obama lalu meminta para pemimpin dunia muslim untuk menjamin keamanan warga Amerika di luar negeri. “PesankepadaduniaMuslim, kamiberharapkerjasamanyauntukmemastikankeamananwarga AS,” kata Obama dalam sebuah wawancara yang direkam CBS di NewYork, seperti dimuat Reuters. “Kami berharap kerja sama penuh,karenaitulahsatu-satunya cara dunia bekerja.” Dalam serangan di konsulat AS di kota Benghazi pekan lalu, Dutabesar AS untuk Libya, Christopher Stevens, dan tiga diplomat Amerika lainnya tewas. Mereka jadi pelampiasan kemarahan massa atas film itu. Obamatelahmemerintahkan pengetatan keamanan di AS. Soal cuplikan Innocence of Muslims, dia menegaskan itu adalah video ofensif, namun tak seharusnya menjadi alasan untuk melakukan kekerasan. Sebelumnya, Menteri Luar Negeri AS Hillary Clinton menegaskan pemerintah AS tidak ada hubungannyadenganyangmenghina Nabi Muhammad itu, yang dibuatSamBacile,namasamaran Nakoula Basseley Nakoula. “Pemerintah AS sama sekali tidak ada hubungannya dengan video itu. Kami benar-benar menolak isi dan pesannya,” ujarnya kepada pejabat senior Maroko. “Bagi kami, dan bagi saya pribadi, video itu sangat menjijikkan dan tercela. Tampak jelas sekali itu memiliki tujuan yang sangat sinis,

yakni merendahkan agama dan memancing kemarahan,” lanjutnya. Di Chiang Mai, Thailand, puluhan Muslim di kota itu Rabu menggelar protes di depan Konsulat AS terhadap film yang dianggap menyinggung Islam yang memicukekerasananti-ASprotes di seluruh dunia Muslim. Protesituberlangsungdamai, namun 30 petugas polisi berdiri untuk menjaga ketertiban dalam kasus gangguan apapun. Para demonstran mengecam orangorang yang ikut ambil bagian dalam produksi film Innocence of MuslimsdanmenuntutASmenghukumproduserfilmsertasemua mereka yang terlibat. Mereka juga mengajukan surat melalui pejabat konsulat AS untuk Dutabesar AS Kristie Kenney yang dijadwalkan akan menghadiri seminar pada Rabu di Universitas Chiang Mai. Di Moskow, Pengadilan NegeriTverskoyMoskowakanmempertimbangkan segera permohonanpenuntutumumMoskowagar mengkonfirmasivideoitusebagai film ekstrimis, yang telah menarik tanggapanluasdimasyarakat,kata sekretaris pers pengadilan Murad Dalgarov, Selasa. Menurut prosedur pengadilan, pengadilan sebelumnya memiliki lima hari untuk melakukan dengar pendapat. Seperti diketahui, film tentang Nabi Muhammad SAW ini disiarkan di layanan YouTube, dan beberapa negara Muslim termasuk Libya, Mesir, Tunisia, dan Sudan mengalami gelombang protes anti-Amerika. Ratusan warga Muslim di

Iran Luncurkan Kapal Selam, Kapal Perusak Di Teluk Persia TEHERAN (Antara/Xinhua-OANA): Angkatan Laut Iran meluncurkan kapal selam super berat dan kapal perusak pribumi di Teluk Persia. Kapal selam super berat Tareq 901, diperbaiki oleh para ahli Iran, dan kapal perusak Sahand berhasil diluncurkan di pelabuhan Bandar Abbas, Iran selatan, kata laporan Press TV. Komandan Angkatan Laut Iran Laksamana Habibollah Sayyari mengatakan,bahwa“sistemanti-radar,sayap,sistempneumatik,sistem kompresi udara, pompa dan sensor, sistem telekomunikasi, sistem dorong,danbagian-bagianmesin(kapalselam)adalahdiantarabagianbagian yang diperbaiki dalam proyek yang semua ditangani oleh para insinyur Iran,” kata laporan tersebut Selasa (18/9). Agustus, menteri pertahanan Iran mengatakan bahwa kementerian pertahanan negara itu berencana untuk memproduksi berbagai jet tempur, rudal, pesawat, kapal selam dan kendaraan militer pada akhir tahun kalender Iran (mulai 20 Maret 2012). Februari, Sayyari mengumumkan bahwa Angkatan Laut Iran menambah dua kapal selam kelas Ghadir (sedang) yang diproduksi di dalam negeri untuk armada angkatan laut negara tersebut. Kapal-kapal selam itu benar-benar dirancang dan diproduksi oleh pakar Iran sendiri, untuk meningkatkan kemampuan angkatan laut Republik Islam, kata Sayyari seperti dikutip oleh Press TV.

Anggota PKK Bakar 18 Kendaraan Di Turki Timur ANKARA (Antara/Xinhua-OANA): Anggota kelompok terlarang Partai Pekerja Kurdistan (PKK) membakar 18 kendaraan di Provinsi Agri dan Bitlis di Turki Timur untuk menyabot kegiatan komersial di wilayah tersebut, demikian laporan harian lokal, Today’s Zaman, di jejaringnya. Sekelompok anggota PKK menyerbu tempat pembangunan di kota kecil Dogubayazit, Provinsi Agri, dan membakar 11 kendaraan, kata pejabatTurki Nurettin Dayan sebagaimana dikutip. Ditambahkannya,pasukankeamananTurkitelahmelancarkanoperasididaerah tersebut. Dalam kejadian terpisah, anggota PKK menyerbu satu lagi tempatpembangunandiKotaKecilTatvan,ProvinsiBitlis,danmembakar tujuhkendaraan,katalaporanitu.Ditambahkannya,puluhanpetugas pemadam dikirim ke daerah tersebut untuk memadamkan api. Pasukan keamanan Turki telah melancarkan operasi militer berskala besar di daerah itu untuk menangkap anggota PKK, demikian laporan Xinhua Selasa (18/9). Sepuluh personel pasukan keamanan Turki tewas dan 60 lagi cedera, Selasa (18/9), setelah satu rombongan militer Turki yang mengangkut tentara tak bersenjata dihantam roket oleh tersangka anggota PKK di Provinsi Bingol di Turki timur, demikian laporan kantor berita swasta, Dogan.

Kolombo,ibukotaSriLanka,Rabu memprotes film yang menghina Islam yang diproduksi di AS itu dan mereka membakar patung Presiden Barack Obama. Kira-kira 300 pemrotes berpawai di Kolombo, dengan membawaberbagaispandukdan poster yang terbaca, “Larang film anti-Islam itu di seluruh dunia. AS harus minta maaf pada umat Islam.” Mereka meneriakkan, “Gantungpembuatdansutradara film tersebut. (ap/vn/rtr/m10) Selidiki kematian Dubes AS Kematian Dubes AS untuk

Libya Christopher Stevens di Bengazhimulaidiselidiki.Menteri Luar Negeri AS Hillary Clinton mengatakan, tim FBI dilaporkan sudah tiba di Libya untuk melakukan penyelidikan. Kedatangan FBI sempat tertunda setelah adanya kekhawatiran mengenai kekerasan yang berlanjut di wilayah timur Libya. Namun Menlu Clinton tidak memberikan keterangan berapa jumlah agen FBI yang dikirim untuk melakukan penyelidikan. “FBI sudah bergabung untuk melakukan penyelidikan di Libya

dan kami tidak akan berhenti hingga pihak yang berada di balik serangan ini ditemukan. Kami akan menghukum mereka,” ujar Clinton seperti dikutip The Washington Post, Rabu. Aktris dalam film itu, Cindy Lee Garcia menerima ancaman mati lewat internet. Garcia sebelumnyasempatmengatakanbahwa dirinya merasa ditipu oleh sutradara Nakoula Basseley Nakoula yang menggunakan nama Sam Bacile. “Saya menerima ancaman mati dari internet, banyak orang

yang mengancam akan mencincang dan membunuh saya, beserta keluarga saya,” ujar Garcia, seperti dikutip Daily Mail, Rabu. Ancaman-ancamanitumunculdiakunjejaringsosialFacebook Garcia. Salah satu pria bernama AhmadNazirBashirimengatakan, dirinya siap memenggal kepala Garcia dan siap menerima konsekuensi hukum atas hal itu. “Saya benar-benar tidak terlibatdalamhalapapun,saatinibanyakorangyangtewasdalamfilm itudanhalinimembuatsayamual,” imbuh Garcia.(ap/vn/rtr/m10)

BEIJING (AP): Satu akun dari pemerintah China mengatakan mantan kepala polisi yang menjadi pusat perhatian dalam skandal politik, telah meminta diplomat AS agar memberinya suaka setelah dia membantu untuk menutupi pembunuhan seorang pebisnis Inggris. Akun yang disiarkan Rabu (19/9) itu memuat penjelasan penuh pemerintah tentang skandal tersebut yang terpicu oleh Wang Lijun yang berusaha mendapatkan perlindungan di salah satu konsulat AS di China.Washington membantah bahwa Wang memohon suaka. Akun itu mengatakanWang menutupi pembunuhan pebisnis Inggris itu oleh Gu Kailai, istri boss Partai Komunis Bo Xilai. Namun ketika dia kemudian mencemaskan keselamatannya, dia mengungkapkan kekhawatirannya itu kepada seorang pejabat senior partai yang menamparnya. Kemudian, katanya,Wang pergi ke konsulat tersebut dan meminta suaka. (m10)

Suu Kyi Yakinkan, Hubungan Dengan AS Tak Rugikan China WASHINGTON (Antara/AFP): Tokoh oposisi Myanmar Aung San Suu Kyi berupaya meyakinkan China bahwa hubungan yang menghangat antara Myanmar dan Amerika Serikat tidak akan merugikan China. Suu Kyi juga mengisyaratkan bahwa ia terbuka bagi diakhirinya sanksi-sanksi AS terhadap negaranya. Dalam pernyataan penting pertama yang ia sampaikan dalam kunjungan bersejarahnya di AS, penerima penghargaan Nobel Perdamaian itu mengatakan ia tidak ingin hubungan AS dengan Myanmar terlihat“berbahaya” oleh China, yang selama ini menjadi sekutu utama bekas junta negaranya. Suu Kyi, yang berbicara di Institute of Peace and Asia Society Amerika Serikat, Selasa (18/9) mengatakan adalah pertanyaan yang alami apakah AS sedang memusatkan perhatian kepada Myanmar sebagai upaya untuk menahan pengaruh China. Dia mengatakan, “Bukan berarti bahwa karena Amerika Serikat berhubungan dengan Burma (Myanmar, red) lalu ini dilihat sebagai langkah membahayakan bagi China. Kita dapat menggunakan keadaan baru kita ini untuk memperkuat hubungan di antara ketiga negara,” kata Suu Kyi.

Fasilitas Penjara Filipina Penuh, 279 Tahanan Dideportasi


PARA pemrotes Afghanistan membakar bendera AS dan meneriakkan slogan anti-AS dalam satu unjukrasa menentang film antiIslam yang dibuat di AS, Innocence of Muslims, yang merendahkan Nabi Muhammad SAW di provinsi Jalalabad, Rabu (19/9).

China Redam Protes Anti-Jepang, Ketegangan Tetap Tinggi BEIJING (Reuters): China bergerak cepat Rabu (19/9) untuk memadamkan aksi protes antiJepang setelah aksi demonstrasi penuh kemarahan berlangsung selamabeberapahariterkaitperebutan wilayah yang memaksa sejumlah perusahaan Jepang tutup dan mengancam perekonomian negara itu. Hubunganantaraduanegara dengan tingkat perekonomian terbesar di Asia tersebut jatuh terpuruk sampai ke titik terendah dalam kurun waktu puluhan tahun Selasa ketika China memperingati pendudukan Jepang atas negara tetangganya itu pada tahun 1931. Ketegangan masih tinggi di daratan dan di laut, di mana empatharilamanyaberlangsungaksi unjukrasa besar-besaran di beberapa kota di seluruh penjuru Chi-

na dan kapal-kapal milik Jepang dan China saling mengintai di perairan di sekitar kepulauan Laut China Timur yang diperebutkan, yang dikenal di Jepang dengan nama Senkaku dan di China Diaoyu. “Sepertinya aksi unjukrasa di depan kedutaan kami sudah mereda,” kata kedutaan Jepang di Beijing, titik panas aksi protes, dalam email kepada warga Jepang. Kedutaan itu mengutip pesan dari biro keamanan public Beijing yang mengatakan “pihak berwenang meminta kerjasama semua pihak agar tidak melakukan aksi unjukrasa di kawasan kedutaan.”Diluarkedutaan,polisi menindakseorangpengunjukrasa yang meneriakkan “Taklukkan Jepang yang kecil’ Rabu pagi. Jepang menutup ratusan tokodanpabrikdiseluruhpenjuru

China, sebagian di antaranya mengirim para pekerja pulang ke Jepang karena khawatir aksi unjukrasa akan berlangsung tidak terkendali. Kedutaan Jepang di Beijing dikepung para pengunjukrasa yang melempari gedung itudenganbotolair,mengibarkan bendera China dan meneriakkan slogan-sloganyangmengingatkan kembalimasapenjajahanJepang. Untuk mencegah terjadinya kembali aksi unjukrasa, sejumlah polisi anti huru-hara dikerahkan ke kawasan kedutaan dan kereta apibawahtanahBeijingmenutup stasiun yang dekat ke kedutaan Jepang. Kenangan pahit Selasa, sekitar 50 pengunjukrasa China mengepung dan menghancurkan satu mobil yang membawa Dutabesar AS untuk China, Gary Locke, kata jubir ke-

dutaan AS Nolan Barkhouse. Namun,Locketidakmengalamicidera. “Pejabat kedutaan telah menyampaikankeprihatinanmereka tentang insiden kemarin kepada kementrian urusan luar negeri Chinadanmendesakpemerintah China untuk melakukan yang terbaik untuk melindungi fasilitas dan personil Amerika,” kata Barkhouse. Hari Selasa menjadi istimewa karena China memperingati hari di mana Jepang mulai menjajah China di tahun 1931.Hubungan China-Jepang telah lama dirongrong kenangan pahit China pada agresi militer Jepang di tahun 30an dan 40-an dan permusuhan terbaru terkait sumber daya alam. Kepulauan yang diperebutkan tersebut diyakini dikelilingi sejumlah cadangan energy yang luar biasa besar.(m23)

Saat-saat Akhir Dubes AS Di Libya VIDEO yang menggambarkan saat-saat kematian Dutabesar AS untuk Libya, Christopher Stevens, beredar di internet. Stevens bukan diroket ketika di dalam mobil, seperti berita yang beredar sebelumnya. Melainkan, tewas karena sesak napas akibat banyaknya asap di ruang saat massa menyerbu Konsulat AS, Selasa 11 September lalu. Siapa yang merekam peristiwa itu? Dia adalah Fahd AlBakoush, seorang aktivis. Ba-


KEBAKARAN BESAR DI FILIPINA. Warga berusaha menyelamatkan harta milik mereka setelah satu kebakaran besar meludeskan kira-kira 200 rumah saat fajar di Quezon City, Metro Manila, Filipina, Rabu (19/9). Satu orang tewas dan sekurang-kurangnya 800 keluarga kehilangan tempat tinggal, kata laporan media.

koush mengaku, melihat duta besar masih “menggerakkan bibir dan matanya, dan tubuhnya menjadi gelap karena asap”. Kepada Reuters, Bakoush menuturkan, penyerbuan kedutaan terjadi tak lama setelah beberapa petugas keamanan bersenjata Kedutaan AS di Libya menolak tuntutan pengunjuk rasa untuk menurunkan bendera dan memasuki kompleks kedutaan. Kekerasan pun dimulai setelah aparat menembakkan senjatanya untuk menakut-nakuti para demonstran. Aksi inilah yang kemudian memprovokasi pengunjuk rasa marah, dan mendorong elemen-elemen garis keras untuk melemparkan granat serta bom molotov. Tak lama setelah itu, hampir 100 demonstran masuk ke kompleks dengan sedikit perlawanan dari petugas keamanan kedutaan. Para demonstran itu kemudian dengan bebas menghancurkan gedung kedutaan. Al-Bakoush baru menyadari bahwa yang ditemukan itu adalah dutabesar AS di hari berikutnya. Namun, dia terkejut, mengapa seorang dutabesar ditinggalkan sendiri di sebuah ruangan tanpa ada ajudannya. “Saya pikir, dutabesar seharusnya menjadi orang yang pertama untuk melarikan diri (dalamkeadaansepertiitu),”ka-tanya. Dari Libya, unjuk rasa mengecam film Innocence of Muslims menyebar ke negara-negara lain di Timur Tengah dan Afrika. Para demonstran juga merusak

kedutaan besar Amerika Serikat dan menyerukan slogan-slogan anti AS. Kabar terakhir menyebutkan korban tewas telah mencapai 17 orang. Ratusan lainnya luka-luka. Menteri Luar Negeri AS Hillary Clinton menegaskan pemerintah AS tidak ada hubungannya dengan film konyol itu. Meski dibuat oleh warga negara AS, Clinton menyatakan dia termasuk orang yang menentangnya. “Kami benar-benar menolak isi dan pesannya,”dia mene-gaskan. “Bagi kami, dan saya pribadi, video itu sangat menjijikkan dan tercela. Tampak jelas sekali itu memilikitujuanyangsangatsinis, yakni merendahkan agama dan memancing kema-rahan.” Serangan ke Kedubes tak Islami Sementara itu, Imam Besar Arab Saudi — lembaga agama tertinggi di tempat kelahiran Islam— Sabtu lalu, mencela serangan terhadap diplomat dan kedutaan besar asing sebagai tidak Islami, setelah protes maut terhadap film buatan AS yang mencemooh Nabi Muhammad SAW. Sheikh Abdulaziz bin Abdullah Al ash-Sheikh juga menyeru semua pemerintah dan lembaga internasional agar menjadikan kejahatan penghinaan terhadap Nabi Muhammad SAW dan mengecam film tersebut —yang telah menyulut gelombang kemarahan di seluruh dunia Muslim. “Dilarang untuk menghukum orang yang tak bersalah atas kejahatan keji orang lain yang bersalah, atau menye-rang

mereka yang telah diberi jaminan keselamatan nyawa dan harta, atau membakar atau merusakbangunanumum,”kata Alash-Sheikhdidalamceramah yang dilaporkan oleh kantor berita resmi Arab Saudi,SPA.(rtr/ vn/ok/r-m10)

Polisi Dubai Bongkar Prostitusi DUBAI (Antara/Xinhua-OANA): Satu jaringan penyelundupan manusia yang memaksa remaja melakukan tindak prostitusi dibongkar, kata polisi Dubai, Uni Emirat Arab. Jaringan prostitusi tersebut dipimpin oleh seorang perempuan “berkebangsaan Asia”, kata polisi Dubai di dalam satu pernyataan kepada masyarakat,tanpamenyebutkannegara asal perempuan itu. Selama penggerebekan terhadap kompleks tidak sah jaringan tersebut, polisi membebaskanseoranganakperempuanyang berusia 15 tahun. Selain itu, satu fail yang berisi nama dan nomor telefon pelanggan ditemukan, serta uang yang telah dibayarkan untuk rumah bordil itu. Polisitelahmeningkatkanperangnya melawan penyelundupanmanusiadanprostitusidalam beberapa bulan belakangan, demikian laporan Xinhua. Pada April dan Juni tahun ini, polisi Dubai membongkar satu jaringan penyelundupan manusia yang dilakukan oleh gerombolan Filipina dan Eropa.

MANILA (Waspada): Pemerintah Filipina terpaksa mendeportasi sekira 279 tahanan asalTaiwan yang ditahan di sebuah penjara setempat. Deportasi ini dilakukan, setelah satu orang tahanan tewas dan banyak dari mereka jatuh sakit akibat kondisi tahanan yang penuh sesak. Sebelumnya 279 tahanan tersebut dipenjara karena terlibat dalam kasus penipuan lewat internet. Pemerintah Taiwan pun mendesakpihakFilipinauntukmengirimmerekakembalinegaranya, untuk menjalani proses pengadilan. Tahanan ini dituduh telah melakukan penipuan terhadap anggota polisi, jaksa dan pegawai bank, untuk meyakin korban mereka di China danTaiwan untuk memindahkan uang ke rekening yang disediakan sindikat tersebut. Mereka mengelabui korban dengan menceritakan bank atau rekening kartu kredit mereka telah dibobol oleh para peretas. Seperti dilansir ABC News, Rabu (20/9), beberapa korban bahkan diyakinkan oleh pelaku bahwa uang mereka digunakan untukmencuciuangataukejahatanlainnya.Sementara100tahanan lainnya dikabarkan juga menderita sakit.

50 Warga China Serang Mobil Dubes AS BEIJING (AP): Kementerian Luar Negeri AS melaporkan, 50 orang demonstran di Beijing, China, mengepung mobil Dutabesar AS Gary Locke. Mereka memprotes AS yang dianggapnya sebagai mitra Jepang. Dubes Locke selamat dan tidak terluka, namun mobil yang dikendarainya mengalami kerusakan. Diplomat-diplomat AS juga mengutarakan kekhawatirannya atas peristiwa itu. Sejumlah demonstran yang menyerang mobil Dubes AS itu adalah demonstran yang berpartisipasi dalam protes anti-Jepang. Saat ini, protes anti-Jepang juga sudah menyebar ke wilayah di dekat kantor Kedubes AS, demikian menurut laporan The Associated Press, Rabu (19/9). Seperti diketahui, protes anti-Jepang di Negeri Panda itu kian mengalami eskalasi. Kedubes Jepang beserta pabrik-pabrik asal Jepang ikut diserang oleh para demonstran yang mengecam klaim Negeri Sakura atas Pulau Diaoyu (Senkaku). Demonstran ternyata ikut menyerang AS yang selama ini menjadi mitra penting Jepang di Asia. Insiden penyerangan itu pun terjadi ketika kantor-kantor misi diplomatik AS diTimurTengah diserang. Pihak Kedubes AS mendesak Pemerintah China agar melindungi seluruh pejabat misi diplomatik Negeri Paman Sam yang berada di China. Namun Pemerintah Jepang belum mengutarakan komentarnya atas masalah ini. (m10)

Peluang Romney Terbentur Palestina WASHINGTON (AP/Antara News): Peluang Mitt Romney sebagai kandidat presiden Amerika Serikat kembali terbentur berkaitan dengan gambar video yang diambil secara rahasia dan memperlihatkanRomneymengesampingkanrakyatPalestina—denganmengatakan tidak ada gunanya melanjutkan perdamaian Timur Tengah. Komentar-komentarnya itu mengundang kemarahan dari jururunding perdamaian Palestina, Saeb Erakat, yang menyebut komentar Romney “sangat tidak dapat diterima”, lapor AFP Selasa (18/9). Pada saat yang bersamaan, komentar Romney memberi amunisi baru bagi pihak Barack Obama untuk menunjukkan betapa kandidat dari Partai Republik itu tidak pantas menjadi presiden. Romney menghadapi berondongan kritik dari dalam negeri, Senin, karena saat berbicara di depan para donatur kampanyenya —sepertidiperlihatkandalamvideorahasia—diamengesampingkan kalangan pemilih Demokrat sebagai“korban-korban” yang bergantung kepada bantuan pemerintah. Majalah liberal Mother Jones kemudian menyebarkan pidato Romney di acara tersebut, yang berisi lebih banyak materi bermasalah, terutama soal Israel-Palestina. Ketika dia ditanya dalam acara penggalangan dana itu apakah “masalah Palestina” bisa diselesaikan, Romney mengatakan pihak Palestina “bagaimanapun tidak tertarik membangun perdamaian dan jalan menuju perdamaian hampir tidak bisa dibayangkan bisa dicapai”. Dengan menampilkan sedikit nuansa tentang perilaku faksifaksi di Tepi Barat dan Jalur Gaza, Romney terlihat meremehkan pihak Palestina dan menyiratkan dirinya sebagai presiden tidak akan serius menawarkan perdamaian Timur Tengah. “SayamelihatpihakPalestinabagaimanapuntidakmenginginkan perdamaian, untuk tujuan-tujuan politis, mereka melakukan pengrusakan dan melenyapkan Israel, dan masalah-masalah tajam ini, dan saya katakan tidak ada jalan,” kata Romney. “Kita menggerakkan sesuatu dengan cara terbaik yang bisa dilakukan. Kita berharap adanya stabilitas, tapi kita tahu bahwa masalah ini akan tetap menjadi masalah yang tidak terselesaikan.” Kepercayaan terhadap kebijakan luar negeri Romney menjadi sorotan setelah ia dikecam melancarkan serangan pedas terhadap Presiden Barack Obama tak lama setelah terjadinya serangan mematikan yang dialami konsulat AS di Libya. Pihak Gedung Putih mengatakan pernyataan-pernyataan Romney menunjukkan bahwa dia tidak bisa menjadi pemimpin. Gedung Putih juga mencatat bahwa para pendahulu Obama, baik Bill Clinton dari Demokrat dan George W. Bush dari Republik, menjalankan upaya keras bagi perdamaian Timur Tengah. Romney sebelumnya menyerang Obama dengan menyebut kebijakan Obama soal Timur Tengah salah arah. (m10)



WASPADA Kamis 20 September 2012


Mancini Salahkan Pertahanan City MANAJER Manchester City, Roberto Mancini (foto), menyalahkan barisan pertahanan timnya saat kalah 3-2 dari Real Madrid, Rabu (19/9) dinihari. Meski City sempat unggul di sisa waktu lima menit, rentetan gol dari Karim Benzema dan Cristiano Ronaldo membalikkan keadaan. “Kami tidak kehilangan konsentrasi, kami bermain terlalu ke dalam dan itu satu-satunya kesalahan. Saat ini kami kecewa, tetapi saya pikir hal ini akan membantu kami lebih kuat di masa mendatang,” ucap Mancio. “Kami sangat kecewa karena ketika Anda menang 2-1 dengan sisa lima menit di Bernabeu, Anda mungkin akan berpikir tidak mungkin kalah. Tetapi inilah sepakbola,” imbuhnya sembari menyalahkan pertahanan timnya yang bermain terlalu mundur hingga memberikan ruang bagi pemain Madrid. Pelatih berusia 47 tahun ini juga merasa timnya kurang beruntung karena cedera beberapa pilar seperti Samir Nasri dan Maicon. Kedua pemain tersebut pun terpaksa ditarik keluar lapangan. AP

SEISI Stadion Santiago Bernabeu bergemuruh ketika Cristiano Ronaldo (duduk) mencetak gol kemenangan Real Madrid atas Manchester City dalam laga Grup D Liga Champions, Rabu (19/9).

Real Jaga Kesucian Bernabeu MADRID (Waspada): Real Madrid mengalahkan Manchester City 3-2 dan mempertahankan rekor hebatnya di Liga Champions, Rabu (19/9). Dua kali tertinggal, Madrid dua kali menyamakan kedudukan dan berbalik menang di penghujung laga. Laga spektakuler tersaji di Santiago Bernabeu ketika Madrid menjamu City pada matchday pertama penyisihan Grup D Liga Champions 2012/ 2013. Tanpa gol di babak pertama, lima tercipta di paruh kedua. Edin Dzeko dan Aleksandar Kolarov dua kali membawa City memimpin, tapi Marcelo dan Karim Benzema dua kali pula

menyamakan kedudukan untuk Madrid. Gol ketiga Madrid tercipta di menit akhir pertandingan oleh bintang andalannya, Cristiano Ronaldo. Hasil ini membuat Madrid berdiri di puncak klasemen sementara dengan tiga angka diikuti Borussia Dortmund. Di laga lainnya, Dortmund menang 1-0 atas Ajax Amsterdam berkat gol Robert Lewandowski.

Jelang duel kontra City, Madrid bermodal sederet hasil mengecewakan di La Liga. Sebelumnya, Madrid takluk 0-1 di kandang Sevilla dan tertinggal delapan poin dari Barcelona di klasemen sementara dalam empat pertandingan awal. Meski begitu, pasukan Jose Mourinho tetap diunggulkan menang atas City. Selain statusnya sebagai‘raja’ di kompetisi ini dengan torehan sembilan gelar, Madrid juga didukung oleh sejumlah catatan sejarah. Selama dilatih Mourinho, Madrid tak pernah menelan dua kekalahan beruntun di ajang apapun. Di Liga Champions, rekor Madrid bahkan lebih mente-

reng. Sepanjang 57 tahun keikutsertaannya, Madrid tak pernah kalah dalam laga pembuka di kandang. Dari 42 pertandingan, hanya dua kali Bernabeu disambangi hasil imbang di laga perdana. Rekor itulah yang ingin dijaga Madrid ketika melawan tim asuhan Roberto Mancini. Kendati Madrid mendominasi 45 menit pertama, justru gawang Iker Casillas yang kebobolan lebih dulu. Secara mengejutkan, City memecahkan kebuntuan pada menit 69 lewat serangan balik yang dimotori Yaya Toure dan diselesaikan oleh Edin Dzeko. Madrid tersentak dan langsung berupaya bangkit.

Mourinho pun merombak komposisi dengan memasukkan Luka Modric, Mesut Ozil, dan Benzema. Dampaknya langsung terasa ketika tendangan Marcelo pada menit 76 melengkung masuk gawang Joe Hart. Ketika serangan ditingkatkan, Madrid justru kembali bobol di menit 85. Kali ini, gol free kick Alexsandr Kolarov spontan membuat Bernabeu terdiam. Beruntung, Benzema menunjukkan kualitasnya dan membuat City patah hati dengan golnya di menit 87. Menit 90, Madrid menunjukkan mental juara dan membuktikan status Raja Eropa-nya dengan berbalik menang. TerhalangVincent Kompany, Hart pun gagal


Hasil Rabu (19/9) Grup A Dinamo Zagreb vs FC Porto 0-2 PSG vs Dynamo Kiev 4-1 Grup B Montpellier vs Arsenal Olympiakos vs Schalke

1-2 1-2

Grup C AC Milan vs Anderlecht 0-0 Malaga vs Zenit St Petersburg 3-0 Grup D Real Madrid vs Man City Borussia Dortmund vs Ajax

3-2 1-0

menepis sepakan CR7 sehingga pulang dari Negeri Matador tanpa poin. (m33/uefa/goal)

Allegri Akui Banyak Kesalahan AC Milan memulai penyisihan Liga Champions Grup C dengan hasil imbang lawan Anderlecht. Massimiliano Allegri (foto) menyebut pemain Milan banyak melakukan kesalahan teknis. Meski bermain di San Siro, Milan tak mampu mencetak satu pun gol ke gawang Anderlecht. Tak banyak peluang yang diciptakan Milan di laga ini. Alhasil, mereka harus puas dengan raihan satu poin. “Saya mengatakan bahwa pemain banyak melakukan kesalahan teknis di babak pertama. Ini bukan moment yang mudah dan tentu saja tekanan besar ada di kami untuk meraih kemenangan,” kata Allegri, Rabu (19/9). “Di babak kedua, tim bermain lebih berani dan menyerang serta membuat beberapa peluang. Kemenangan di laga ini tentu akan membuat langkah kami sedikit lebih ringan, tapi nyatanya kami gagal. Kami harus terus bekerja keras dan berkembang. Saya pikir rasa gugup dan banyak bicara tidak akan banyak membantu,” ungkapnya.

PSG Tancapkan Taring PARIS ( Waspada): Paris Saint-Germain (PSG) mulai menancapkan taring mereka di kancah Eropa. Dynamo Kiev yang datang berkunjung ke Parc de Princes Stadium pada laga perdana Grup A Liga Champions 2012/2013, Rabu (19/9), dihantam dengan skor telak 4-1. Sepanjang musim panas, PSG telah melakukan perombakan besar-besaran dengan merekrut sejumlah pemain bintang seperti Zlatan Ibrahimovic dan Thiago Silva dari AC Milan. Pasukan Carlo Ancelotti sudah menjelma jadi klub bertabur bintang, sehingga klub elit Prancis itu ingin menunjukkan diri layak berada di pentas Liga Champions. Ibrahimovic, Silva, Alex, dan Javier Pastore mencetak masing-masing satu gol ke gawang Kiev, sedangkan satu-satunya gol tim kuat Ukraina itu datang dari kaki Miguel Veloso. Hasil ini membuat PSG memimpin klasemen sementara Grup A de-

ngan tiga poin. Di bawahnya, ada FC Porto yang menekuk tuan rumah Dinamo Zagreb 2-0. Begitu wasit Bjorn Kuipers meniupkan peluit tanda dimulainya permainan, PSG langsung menggebrak. Menit 19, PSG sudah unggul lewat penalti Ibra setelah Jeremy Menez dijatuhkan di area terlarang. Bagi Ibra sendiri, laga ini adalah sebuah sejarah. Ibra kini tercatat sebagai pemain pertama yang tampil di Liga Champions dengan enam klub berbeda dan menandainya dengan gol dari titik 12 pas. Sepuluh menit berselang, Thiago Silva mencetak gol perdananya untuk PSG. Tak lama kemudian, PSG bahkan unggul tiga gol lewat Alex. Delapan tahun absen di Liga Champions, PSG langsung tampil trengginas. Di babak kedua, pertandingan tetap berjalan nyaris seimbang dan tercipta sejumlah

peluang. Gol keempat di laga ini lahir pada menit 87, ketika finishing brilian Veloso mengubah keadaan jadi 1-3 untuk timnya. Selisih tiga gol kembali tercipta pada injury time. Lewat sebuah serangan balik, Nene mengumpan Pastore yang meneruskan bola dengan sempurna. Di Zagreb, kegembiraan Lucho Gonzalez yang mencetak gol pembuka bagi kemenangan FC Porto ternyata terselip kesedihan. Pasalnya, setelah pertandingan kapten Porto itu mengungkapkan sang ayah telah meninggal dunia beberapa jam sebelum pertandingan. Setelah gol Lucho. Porto menggenapkan kemenangan lewat Steven Defour. “Saya berjanji akan mencetak sebuah gol untuk ayah. Di saat mendengar berita duka itu, saya berbicara dengan pelatih dan jajarannya. Mereka memberi dukungan penuh bagiku,” kata Lucho. (m33/uefa/goal)

Milan Masih Tersendat MILAN, Italia (Waspada): AC Milan meraih hasil mengecewakan dalam ujian perdananya di Liga Champions 2012/ 2013. Menjamu Anderlecht di San Siro, Rabu (19/9), Milan hanya sanggup bermain imbang tanpa gol dan gagal meraup poin maksimal.

Bermain di hadapan pendukungnya sendiri dan dibekali tradisi kuat di Eropa, pasukan Massimiliano Allegri justru tampil jauh dari harapan. Tidak ada gol yang tercipta dan kedua tim harus puas berbagi satu angka. Hasil ini membuat Milan menempati peringkat dua kla-


GIAMPAOLO Pazzini (tengah) tertunduk lesu ketika AC Milan gagal mengalahkan Anderlecht dalam laga Grup C Liga Champions di San Siro Milan, Rabu (19/9).

semen sementara di atas Anderlecht dan di bawah Malaga yang menghantam Zenit St Petersburg. Sepanjang babak pertama, Milan kalah penguasaan bola (45% berbanding 55%) dari tim elit Belgia tersebut. Namun mereka unggul shot on target. Penyelamatan demi penyelamatan Christian Abbiati di bawah mistar Milan juga menyelamatkan tuan rumah dari kekalahan. Sebaliknya, Malaga melakoni debutnya di Liga Champions dengan mencetak kemenangan kandang. Semangat juang Javier Saviola cs menjadi kunci sukses klub Spanyol tersebut. Menjamu Zenit St Petersburg di Estadio La Rosaleda, Malaga berhasil memenangi pertandingan 3-0. Gelandang Isco membuka skor di menit ketiga dengan Saviola menggandakan keunggulan Malaga tepat 10 menit kemudian. Isco kembali menjadi bintang Malaga berkat golnya di menit 76. “Asyik sekali bisa tampil seperti ini di La Rosaleda. Salah satu dari tujuan kami adalah memainkan Liga Champions dan La Liga dengan cara yang sama. Kami meningkatkan keseimbangan pertahanan, tapi hal terbaik adalah semangat pemain,” tutur Pelatih Manuel Pellegrini. (m33/uefa/goal)


PSG Memang Lebih Baik


STRIKER PSG, Zlatan Ibrahimovic (tengah), kesakitan akibat tekel Danilo Silva (Dynamo Kiev) dalam laga Grup A Liga Champions di Paris, Rabu (19/9).

Kepuasan Peluru London MONTPELLIER, Prancis (Waspada): Arsenal membuka laga perdana penyisihan Grup B Liga Champions dengan kemenangan atas Montpellier 2-1, Rabu (19/9). Kemenangan di kandang lawan membuat The Gunners puas. Bermain di Stade de la Mosson, Arsenal sempat tertekan. Bahkan, tim asuhan Arsene Wenger itu tertinggal lebih dulu di menit kesembilan melalui tendangan penalti Younes Belhanda. Beruntung Arsenal memiliki Lukas Podolski dan Gervinho yang mampu membalikkan kedudukan masing-masing di menit 16 dan 18. “Saya sangat senang dengan hasil ini. Jelas Montpellier bukan

lawan yang mudah. Saya pikir kami tampil baik di babak pertama. Kami mampu menguasai bola dan membuat pendukung tuan ruma terdiam,” ujar Asisten Pelatih Arsenal, Steve Bould. “Menyenangkan bisa membuka dengan kemenangan tandang. Kami memulai musim ini dengan cukup baik dan harus terus mempertahankan hasil positif ini, bukan hanya di Liga Champions. Kami memiliki semangat juang yang bagus dan pertandingan ini menjadi bukti,” ujarnya. Di laga lain, Pelatih Huub Stevens tidak terlalu puas kala Schalke 04 mampu meraih kemenangan 2-1 di kandang Olympiakos. Beberapa hal se-

perti kekalahan mendasar menjadi perhatian serius Stevens dalam pertandingan ini. “Awalnya kami kesulitan, tapi kalau dilihat 90 menit secara keseluruhan, seharusnya kami mampu menang lebih besar. Kami harus tetap tenang, karena tahu pertandingan bisa menjadi sangat sengit. Beruntung, pemain saya mampu mengatasinya,” papar Stevens. Kapten Benedikt Howedes membuka keunggulan pada menit 41 dan dibalas tuan rumah melalui Djamel Abdoun di menit 58. Kedudukan imbang hanya bertahan semenit setelah Klaas-Jan Huntelaar menjebol gawang Balazs Megyeri. (m33/uefa/ini)

PELATIH Paris Saint-Germain (PSG), Carlo Ancelotti (foto), mengatakan timnya menang 4-1 atas Dynamo Kiev pada laga perdana Grup A Liga Champions, Rabu (19/9), karena PSG memang tampil apik. “Saya sangat gembira. Pertandingan pertama tak pernah mudah, tetapi kami menyiapkan diri dengan baik. Kami sangat fokus pada taktik kami di mana babak pertama berjalan dalam hal tempo dan kualitas. Penyerang kami bekerja dengan sangat baik menekan bek lawan sampai jauh di lini belakangnya,” ulas Ancelotti. “Kiev bukan tim terbaik di Liga Champions, tetapi kami menang bukan karena mereka tampil buruk. Kami menang karena kami tampil bagus. FC Porto, tim yang lebih baik, akan menjadi lawan berikutnya, tetapi menyenangkan bisa memenangi laga pertama,” lanjutnya. “Saya tak ingin menyalahkan siapapun. Kami kalah sebagai tim. Jadi, langkah awal kami di Liga Champions tidak bagus, tetapi kami harus menatap ke depan dan bersiap untuk pertandingan berikut. Meski kalah, kami akan terus berjuang untuk lolos dari fase grup,” papar pelatih Kiev, Yuri Semin.


Pellegrini Puji Performa Malaga

LUKAS Podolski (tengah) mengawali kebangkitan Arsenal saat dijamu Montpellier dalam laga Grup B Liga Champions, Rabu (19/9). -AP-

ARSITEK Malaga, Manuel Pellegrini (foto), memuji penampilan Javier Saviola cs yang mengalahkan Zenit St Petersburg 3-0. Menurut Pellegrini, Malaga memainkan sepakbola fantastis dan hasil di La Rosaleda ini benar-benar pantas diraih karena pemain fokus selama 90 menit. “Salah satu tujuan kami adalah tidak memprioritaskan satu kompetisi di atas kompetisi lain. Tim ini telah bekerja sangat baik dan memiliki motivasi melanjutkan performa baik dan bekerja keras,” katanya, Rabu (19/9). “Ini adalah hari yang sangat indah layaknya tidak ada pertandingan lain yang bisa disandingkan,” tambah mantan pelatih Real Madrid itu. Pellegrini pun memuji Isco yang dinilainya memiliki masa depan cerah. Pemain berusia 20 tahun itu disebutnya sebagai masa depan Malaga dan Timnas Spanyol. Isco memang tampil gemilang dan membawa Malaga memimpin Grup C dengan tiga poin. (m33/uefa/goal/fbi)


WASPADA Kamis 20 September 2012

Polo Air Sumut Gagal PEKANBARU (Waspada): Tim polo air Sumut dipastikan gagal mempertahankan gelar juara setelah ditaklukkan DKI Jaya 6-17 pada semifinal PON XVIII/2012 di Stadion Renang Kalinjuhang Pekanbaru, Rabu (19/9). Pada laga yang dipimpin wasit Irwan Sugandi dan M Zamri itu, para pemain Sumut banyak melakukan personal foul dengan 16 kali pelanggaran, sehingga menjadi keuntungan bagi kubu DKI untuk menambah angka. DKI sendiri merupa-

kan tim favorit juara karena skuadnya didominasi mantan pemain SEA Games 2011 dan lima bulan berlatih di China. Pelatih Sumut, Edi Irianto dan Supriadi, tetap mempertahankan formasi pemain dengan menurunkan Hendra Jaya

Putra, Silvester Golbert Manik, Ismayana Taufan, Beby Eka Paksi, Edi Purwanto, dan kiper Ade Mahdanul. Babak pertama, Sumut tertinggal 0-4. Gol Sumut baru terjadi pada menit keenam babak kedua melalui Beby Eka Paksi Tarigan dan Kapten Tim Hendra Jaya Putra. Namun kubu Sumut kebobolan enam gol membuat skor sementara hingga babak kedua 2-10. Pada babak ketiga, Sumut coba meningkatkan serangan-

nya dan sempat memperkecil kekalahan dengan tambahan empat gol yang diciptakan Beby (2), Edi Purwanto, dan Reza Desda Sembi-ring. Namun Sumut tetap saja tertinggal karena DKI juga mencetak empat gol. Stamina pemain Sumut terlihat menurun di babak keempat bahkan tanpa ada tambahan angka. DKI memanfaatkan kelemahan itu dan membobol gawang Sumut dengan tiga gol hingga akhirnya tim besutan Calvin Legawa itu menutup laga

Lagi, Indri Raih Perunggu PEKANBARU (Waspada): Peboling debutan Sumatera Utara, Aldila Indryati (foto), kembali membuat kejutan di PON XVIII/2012 dengan meraih medali perunggu nomor master di Lintasan Boling Centre Pekanbaru, Rabu (19/9). Dara cantik yang akrab disapa Indri ini lolos ke babak stepladders secara dramatis setelah hanya unggul satu poin atas Novie Phang (DKI Jaya) 3.359-3.358 (16 game). Pada babak stepladders, Indri yang berpeluang menantang posisi pertama Tannya Roumimper (Jabar) dikalahkan Sharon Limansantoso (DKI) 188-204, sehingga hanya berhak atas perungu. Sukses Indri pada ajang PON pertamanya itu cukup fantastis

dengan menyumbang satu medali perak dan dua perunggu. Indri memperoleh perak di nomor double putri berpasangan dengan Angelina Karto, serta nomor trio bersama Angelina dan Kartika Wahyu Putri. Ketua Umum Pengprov PBI Sumut, Singgih Goenawan, memberikan apresiasi kepada Indri. Dia pun sangat optimis Indri bakal menjadi bagian dari tim boling putri nasional. Terlebih selama pelaksanaan PON, PB PBI telah mengerahkan tim pemandu bakat. “Saya siap menjalani pelatihan nasional jika memang dibutuhkan,” ujar Indri yang baru berusia 17 tahun dan juga mahasiswi Fisip USU. (m18)

dengan kemenangan telak. Pada semifinal lainnya, Sumsel melaju ke final setelah mencatat kemenangan atas Jabar 11-6. Dengan hasil itu, harapan tim polo air Sumut mempertahankan medali emas yang diraihnya pada PON XVII/2008 pupus dan tinggal berharap merebut medali perunggu, Kamis (20/9) ini. Pertemuan dengan Jabar merupakan ulangan di babak penyisihan pool B. Pada laga itu, Sumut menderita kekalahan 8-10. (m18)

donesia Bersatu, dan para duta besar,” ucap Rusli Rabu (19/9). Dikatakan, pihaknya menyediakan 28.000 kursi dan untuk warga Riau sendiri hanya 15.000. Ini karena pihaknya ingin menghargai kontingen luar daerah, tetapi sayangnya tidak semua atlet menghadiri pembukaan, karena sebagian sudah pulang ke daerah masing-masing. Uniknya, pada upacara pembukaan sebelumnya, masyarakat memprotes penjualan tiket yang dilakukan panitia. Hal tersebut terjadi karena panitia justru memberi kesempatan kepada warga yang tidak memiliki tiket setelah kursi di dalam stadion terlihat kosong. Rusli sendiri mengakui penyelenggaraan PON kali ini

Waspada/ Arianda Tanjung

mengalami banyak kendala seperti marak diberitakan oleh media. Namun menurutnya bukan berarti pihak penyelenggara mengabaikan hal itu. Dia mengklaim panitia sudah melakukan upaya-upaya perbaikan. Advisor Event Organizer penutupan PON 2012, HelmyYahya, mengatakan acara penutupan akan dimeriahkan sejumlah artis ibu kota seperti Titi DJ, Ruth Sahanaya, Ahmad Dhani, dan Steven Jam. Selain itu, panitia akan memamerkan teknologi digital berupa laser. “Penutupan bakal meriah, pokoknya penutupan tidak boleh kalah dengan pembukaan. Kami juga berharap cuaca bagus agar mendukung pelaksanaan,” katanya. (m18)

Senam Pernafasan MEDAN (Waspada): Lembaga Senam Pernafasan (LSP) Satria Nusantara (SN) Sumut mengajak masyarakat untuk melakukan olahraga senam pernafasan yang dinilai sangat bermanfaat untuk menjaga kesehatan baik bagi kaum mudah mapun lanjut usia. “Satria Nusantara dalam hal ini ingin mendukung pemerintah meningkatkan taraf kesehatan masyarakat melalui olahraga senam pernafasan. Olahraga ini bisa dijadikan salah satu pola hidup sehat masyarakat,” ujar Ketua LSP SN Sumut, Sahabudin Duha SE, didampingi Penasehat H Adhan Gusti SH, Rabu (19/9). Bahkan, lanjut Sahabuddin,

Plt Gubsu Apresiasi Surya SBW 2012 MEDAN (Waspada): Plt Gubernur Sumut, H Gatot Pujo Nugroho ST, memberikan apresiasi atas penyelenggaraan event Surya Sumatera Bike Week (Surya SBW) 2012 yang pelaksanaannya dipusatkan di Lapangan Benteng Medan, 26-30 September nanti. Hal itu diungkapkan Plt Gubsu saat menerima audiensi Ketua Harley Davidson Club Indonesia (HDCI) Sumut Ijeck didampingi Wakil Ketua Panpel Surya SBW 2012 Ationg Usman, Bidang Acara Sofyan, dan Humas Deddy Dermawan di Medan, Rabu (19/9). Menurut Gubsu, event tersebut pantas diapresiasi karena bisa dikemas dengan paket pariwisata daerah, sehingga dapat menarik minat sponsor berpartisipasi. “Event ini juga bisa menstimulan kegiatan ekonomi di daerah ini. Karenanya tentu harus didukung,” ungkap Gubsu yang berjanji akan meluangkan waktu untuk menyaksikan langsung kegiatan. Dalam audiensi yang berlangsung di rumah Dinas Gubsu

Jl Sudirman Medan ini, Gubsu begitu antusias menggali informasi tentang Surya SBW dengan melontarkan banyak pertanyaan kepada Ijeck. Di antaranya menanyakan rentang waktu pelaksanaan yang enam hari itu apakah ada kegiatan bersifat edukasi kepada pengendara motor dan juga tentang acara promosi budaya. Ketua HDCI Sumut yang juga Ketua Pengprov IMI Sumut, Ijeck, melaporkan kesiapan Panpel serta memaparkan banyak hal kepada Gubsu soal Surya SBW yang dikatakan sebagai








1 D


event komunitas bermotor terbesar yang pernah terlaksana di tanah air. Panpel, katanya, berharap bisa mengumpulkan 10 ribu biker, termasuk 1.000 pengendara motor dengan cc besar yang akan melakukan touring dari Pulau Jawa dan Sumatera dengan rute Lampung-Medan. “Ini adalah event roda dua terbesar yang ide dasarnya datang dari tujuan untuk mempersatukan teman-teman para biker di seluruh penjuru tanah air,” ucapnya. Terpisah, Wakil Ketua Pan-


Jawaban di halaman A2


Waspada/Arianda Tanjung

CHARLELY Tessi bersama PR II Unimed yang juga Sekum KONI Sumut, Chairul Azmi Hutasuhut, seusai meraih gelar MNW pada PON XVIII/2012, Rabu (19/9).

MPd, yang turut menyaksikan pertandingan. “Gelar Master Nasional ini merupakan langkah awal bagi Tessi lebih menekuni olahraga catur ke depan,” kata Sekretaris Umum KONI Sumut tersebut. (m18)

Ketua Umum KONI Sumut, Gus Irawan Pasaribu, saat melantik kepengurusan LSP SN Sumut beberapa waktu lalu, meminta agar olahraga senam pernafan tersebut lebih disosialisasikan kepada masyarakat. Sahabuddin pun mengajak masyarakat segera bergabung dengan mendaftar hingga 23 September nanti. Pihaknya juga mengundang anggota lama dan baru mengikuti latihan bersama di Halaman Gedung Keuangan Negara, Jl Diponegoro Medan, Minggu (23/9) pukul 06:30 WIB. “Acara akan dimulai dengan jalan santai sekaligus peragaan jurus senam pernafasan oleh para anggota dan pelatih se-Sumut,” kata Sahabudin seraya mengatakan bagi masyarakat yang ingin bergabung dapat menghubungi sekretariat di Jl Mustafa No 130 A Medan atau menghubungi 0813 7571 4512/ 0811 6173 97. (m42)

PEKANBARU (Waspada): Pejudo Sumut, Riki Ramadhani, menyumbangkan medali perak kelas -55 kg PON XVIII/2012 di GOR Tribuana Pekanbaru, Rabu (19/9). Medali perak yang diraih Riki setidaknya sedikit mengobati kegagalan seniornya, Deny Zulfendri, meraih medali kelas +100 kg. Di final, Riki kalah 2 UKO atas Tomi Irawan (Jabar). Sebelum ke final, Riki menumbangkan Herma-

wan Sugandhi (Kepri) dengan ipong. “Perjuangan Riki sudah maksimal. Dia sudah berusaha memberikan yang terbaik, tetapi hasilnya memang masih medali perak,” ujar Pelatih Sumut, Josef. Riki sendiri mengakui bahagia dengan raihan medali perak. Terlebih ia mengaku sudah tampil maksimal. Pada PON empat tahun lalu di Kaltim, Riki juga menyumbangkan medali perak. (m18)

Marzuki Meradang Kena Eliminasi JAKARTA (Waspada): Ketua DPR RI, Marzuki Ali, mengingatkan agar panitia Musyawarah Nasional Persatuan Bulutangkis Seluruh Indonesia (Munas PBSI), tidak bersikap arogan kepada anak bangsa yang ingin masuk dalam bursa calon Ketua Umum PBSI periode 2012-2016. Hal tersebut terkait dengan keputusan mengeleminasi pencalonan dirinya sebagai kandidat Ketua Umum PBSI periode 2012-2016, yang akan bertarung pada Munas di Yogyakarta, 20-22 September mendatang, dengan alasan yang menurutnya tidak masuk akal. “Mereka (Panpel Munas PBSI) berdalih bahwa persyaratan menjadi kandidat ketua umum yang saya sampaikan masih kurang, yakni tidak adanya dukungan dari pemilik suara. Padahal, syarat yang dimaksud sudah saya sampaikan,” keluh Marzuki, Rabu (19/9). “Panpel Munas PBSI sudah jelas mengadaada, karena semua syarat yang ditetapkan sudah kami penuhi. Karena itu, saya minta agar jangan ada diskriminasi. Berilah kesempatan kepada setiap anak bangsa yang ingin maju menjadi kandidat Ketua Umum PBSI,” tambahnya. Meski begitu, politikus dari Partai Demokrat ini menegaskan tidak akan melakukan tindakan menyikapi sikap arogansi Panpel Munas PBSI.

Ia hanya berharap agar pemilihan pucuk pimpinan cabang olahraga yang mengharumkan nama bangsa Indonesia di pentas dunia tersebut berjalan demokrasi. “Silakan teman-teman wartawan mau menyampaikan seperti apa kepada PBSI. Yang jelas, saya tidak akan melakukan tindakan (perlawanan) atas putusan mereka mengeliminasi saya,” tambah Marzuki. Icuk Sugiarto, salah satu kandidat yang ingin maju dalam bursa pemilihan Ketua Umum PBSI nanti, menyayangkan putusan mengeliminasi Marzuki. Menurut mantan juara dunia bulutangkis ini, putusan eliminasi tersebut bukan wewenang Panpel, akan tetapi di tingkat pleno. “Saya sebagai salah satu calon Ketua Umum PBSI yang akan maju dalam Munas nanti, tidak setuju akan sikap arogansi Panpel. Sebab hal ini bukan kewenangan mereka untuk menganulir peserta. Mereka itu hanya bertugas menerima berkas pendaftaran bakal calon,” ucapnya. Ketua Pengprov PBSI DKI Jakarta ini menambahkan keputusan menganulir salah satu bakal calon tersebut dilakukan oleh orang-orang yang takut akan kehilangan posisinya. Sebab, masuknya Marzuki sudah pasti memiliki peluang cukup besar untuk memenangkan pertarungan. (yuslan)

Waspada/Armansyah Th

Putih melangkah, mematikan lawannya tiga langkah.


PEKANBARU (Waspada): Pecatur putri Charlely Tessi menjadi pengobat pupusnya cabang catur menyumbangkan medali bagi kontingen Sumut, setelah memperoleh gelar Master Nasional Wanita (MNW) pada PON XVIII di Hotel Pangeran Pekanbaru, Rabu (19/9). Mahasiswa Universitas Negeri Medan semester akhir jurusan matematika ini memperoleh gelar MNW dengan raihan 6 Match Point (MP). Tessi menunjukkan performa positif dengan menahan remis dan mengalahkan pecatur unggulan. Di antaranya bermain remis dengan MFW Baiq Vina (Riau), selanjutnya menang atas Dewi (Jambi), MNW Shinta (Bali), MNW Suyati (Jateng), Gina (DIY), MNW Yulianti (Banten), MCW Gerhana (Riau), MNW Nivianti (Jambi), dan MPW Lintang (DIY). “Saya sudah tampil maksimal, tetapi belum mampu menyumbangkan medali, melainkan baru mendapat gelar Master Nasional Wanita,” kata Tessi yang bercita-cita menjadi guru matematika nanti. Tessi pun mengaku bertekad tetap menggeluti olahraga catur dan berharap bisa meraih gelar Master FIDE (MF) dengan mengikuti berbagai kejuaraan internasional. Pelatih catur putri Sumut, Erhan Tarmizi WN, menyebutkan Tessi melakukan persiapan PON XVIII selama 1,5 tahun. Namun dia mengaku Tessi masih minim jam tanding bisa dibanding peserta lainnya. Motivasi turut diberikan Pembantu Rektor II Universitas Negeri Medan, Drs Chairul Azmi

PLT Gubsu H Gatot Pujo Nugroho ST (tengah) bersama Ketua HDCI Sumut Ijeck dan Panpel Surya SBW 2012 seusai audiensi di Medan, Rabu (19/9).

Problem Catur


Tessi Sandang Gelar MNW

Riki Sumbang Perak Judo

Penutupan PON Tetap Mewah SN Ajak Masyarakat PEKANBARU (Waspada): Perhelatan akbar PON XVIII/ 2012 berakhir Kamis (20/9) malam ini dan akan ditutup resmi oleh Wakil Presiden RI, Budiono, di Stadion Utama Pekanbaru. Diperkirakan seremonial penutupan tidak kalah mewahnya dengan pembukaan. Gubernur Riau, Rusli Zainal, mengatakan pihaknya sudah mengadakan pertemuan dengan pihak event organizer untuk membahas hal-hal teknis. Dia juga menjelaskan bahwa pada acara penutupan akan dibebani biaya tiket bagi penonton. “Penerapan tiket ini guna mengantisipasi hal-hal yang tidak diinginkan, mengingat pada acara penutupan nanti akan dihadiriWapres Boediono, sejumlah menteri Kabinet In-





pel, Ationg Usman, menambahkan pembukaan event berlangsung pada Rabu (26/9) diawali aksi bakti sosial berupa donor darah bersama PMI Medan serta pemberian komputer kepada 21 kecamatan di Kota Medan. “Setelah itu, selama empat hari gelaran Surya SBW akan diisi banyak program, termasuk paket touring ke tiga lokasi wisata di Sumut, pameran, kontes modifikasi, workshop, free style, festival makanan/budaya, bazar, games, festival seni/budaya, atraksi band serta lainnya,” pungkas Ationg. (m47)



1. Tempat duduk untuk penunggang kuda; Alat untuk pegangan yang terpasang pada kuda-kuda dalam olahraga senam. 4. Alat berbunyi yang ditiup wasit dalam memimpin pertandingan. 6. Persatuan Sepakbola Makassar. 8. Sabuk; Ikat pinggang (Inggris). Sabuk hitam karate disebut black ___. 9. Arti kata court dalam olahraga tenis atau diamond dalam bisbol. 11. Persatuan Squash Indonesia. 15. Arti kata stick dalam olahraga hoki dan polo. 16. Sarung tangan tinju (Inggris, jamak). 17. Kata yang diucapkan pemain catur untuk memperingatkan raja lawan sedang terancam. 19. Gerak dalam karate, yudo dan aikido. 20. Liga Pendidikan Indonesia. 22. Salah satu perlombaan dalam karate, dijagoi atlet Sumut, Jintar Simanjuntak dan Donny Dharmawan di SEA Games 2011. 23. Mencetak skor dalam bisbol setelah pemain memukul bola keluar lapangan (dua kata Inggris populer, tulis tanpa spasi). 24. Hati-hati; Nama koran di Medan yang menggelar pertandingan olahraga dalam rangka peringatan ulang tahunnya pada


11 Januari. 25. Olahraga bela diri asal Korea.


1. Tendangan hukuman di titik 12 pas dalam sepakbola. 2. Gelanggang. 3. Medan; Tempat (untuk bertanding dsb). 4. Kayu tipis (tempat meletakkan buah catur). 5. Javelin dalam atletik adalah lempar ____. 7. Cabang olahraga yang memerlukan kekuatan, ketangkasan dan kecepatan, terdiri atas nomor-nomor lari, lompat dan lempar. 10. Salah satu kategori yang dinilai dalam olahraga senam dan lomba renang indah. 12. Cabang olahraga yang kompetisinya saat ini ada ISL dan IPL. 13. Cabang olahraga yang menerapkan aturan 35 detik untuk melakukan tembakan bola ke gawang selain bola basket (dua kata tanpa spasi). 14. Alat ringan yang dilempar dalam cabang atletik (Inggris). 18. Perjanjian tertulis antara dua pihak, dalam sewa menyewa pemain asing. 21. Jenis medali untuk juara satu. 24. Walk Out.

Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tidak ada keterlibatan matematika, hanya membutuhkan pertimbangan dan logika. Tingkat kesulitan: sulit (****), bisa diselesaikan dalam waktu 15 menit. Jawabannya lihat di halaman A2 kolom 1.

7 5 3 6

5 8 7

3 2 9 1

5 2 3 9

4 4 3 9 8 2 9 6 1 6 5 1 8 8 2 4 6




WASPADA Kamis 20 September 2012

Selebrasi Heboh Jose Mourinho


MADRID (Waspada): SOSOK Jose Mourinho (foto) terus menjadi bahan perbincangan di dunia. Baru-baru ini, pelatih Real Madrid itu kembali menjadi buah bibir ketika melakukan selebrasi kemenangan timnya. Menjamu Manchester City di Santiago Bernabeu, Rabu (19/ 9), The Special One langsung meluncur ke tengah lapangan ketika Cristiano Ronaldo mencetak gol kemenangan dalam laga perdana Grup D Liga Champions. Spontan, aksi entrenador asal Portugal tersebut menjadi incaran juru foto di stadion. Ternyata, bukan kali ini Mourinho melakukan selebrasi heboh. Selain di Madrid, tercatat sebelumnya mantan pelatih Inter Milan, Chelsea, dan FC Porto itu pernah melakukannya sebanyak empat kali. Di babak 16 Besar Liga Champions 2003/2004, FC Porto terancam tersingkir dari Liga Champions setelah Manchester United memimpin 1-0 dengan waktu normal tersisa kurang dari 90 detik. Untungnya, Costinha mencetak gol dan Porto

menyamakan kedudukan jadi 1-1. Mourinho, duduk di bench, kemudian langsung beranjak, berlari di pinggir lapangan sambil merayakan kemenangan dengan anak asuhnya seraya mengepalkan tangannya. Porto akhirnya lolos dan menang argregat 3-2. Di final Piala Liga Inggris 2005, Mourinho menukangi Chelsea. Saat itu, Blues tengah tertinggal 0-1 dan akhirnya menyamakan kedudukan lewat gol bunuh diri Steven Gerrard. Setelah gol tersebut, Mourinho kemudian berjalan pelan di depan tribun pendukung Liverpool sambil meletakkan telunjuk di depan bibirnya sebagai isyarat fans The Reds untuk diam. Pindah ke Seri A, pada musim 2009-2010 melawan Udinese, Inter bermain imbang 1-1 hingga 90 menit. Laga di tanggal 3 Oktober 2009 itu tampaknya akan berakhir imbang sebelum akhirnya Wesley Sneijder mencetak gol kemenangan di menit 94. Mourinho pun berlari kecil di pinggir lapangan sambil menggoyangkan tangan, menjulurkan lidah, dan melompat.

Pada leg kedua semifinal Liga Champions 2009/2010 kontra Barcelona, Inter Milan kalah 0-1. Namun Inter tetap menyingkirkan Barcelona dengan agregat 3-2 dan melaju ke final. Ini adalah final pertama Inter dalam 44 tahun terakhir. Keberhasilan itu sontak disambut suka cita oleh skuad Biru Hitam, khususnya Mourinho yang kemudian merayakannya secara emosional kala berlari di dalam lapangan Camp Nou sambil menunjukkan jarinya ke atas. Selebrasi ini membuat Victor Valdes “panas” dan menghampiri Mou. Terakhir, Real Madrid tengah menanti hasil imbang 2-2 dengan Manchester City di laga Grup D Liga Champions, Rabu (19/9). Namun, Cristiano Ronaldo mencetak gol kemenangan di menit 90 dan memaksa Mourinho beranjak langsung dari tempat duduknya untuk melakukan sliding di atas lapangan sambil mengepalkan tangannya. Raut muka bahagia terlihat di wajahnya setelah diterpa kritik akibat hasil buruk Madrid di awal musim ini. (m33/uefa/rm)

Hamilton Percaya Geser Alonso SINGAPURA (Waspada): Pebalap McLaren, Lewis Hamilton, yakin bisa menggeser posisi andalan Ferrari, Fernando Alonso, di puncak klasemen sementara dengan tujuh seri tersisa pada Formula Satu (F1) 2012. Kemenangan Hamilton di GP Italia membuat pebalap asal Inggris itu naik ke peringkat dua klasemen pebalap dengan 142 poin. Kini, juara dunia F1 2008 tersebut hanya tertinggal 37 poin dari Alonso di puncak klasemen. Hamilton berambisi memangkas jarak dengan Alonso saat tampil di GP Singapura, akhir pekan ini. Driver berusia 27 tahun itu menjuarai di Sirkuit Marina Bay pada 2009, namun mengalami nasib sial dalam dua musim terakhir. “Saya pergi ke Singapura dengan penuh optimistis bahwa kami bisa bersaing dengan Alonso. Saya suka tampil di Marina Bay seperti balapan di Hungaria. Ini trek yang mengharuskan Anda memiliki mobil dalam

kondisi terbaik,” ujar Hamilton, Rabu (19/9). Balapan di Singapura merupakan yang terpanjang pada kalender F1 2012. Para pebalap harus melalui 61 putaran dan diperkirakan memakan waktu sekira dua jam. Hamilton sendiri saat ini belum menentukan masa depannya bersama McLaren dan dirumorkan ingin hengkang ke Mercedes. Namun, Hamilton buru-buru menegaskan semua spekulasi itu tidak benar. “Saya tidak punya batas waktu. Fokus saya saat ini adalah berusaha memenangi juara dunia. Tentu saya punya masalah yang harus diselesaikan, tapi saya tidak punya perwakilan untuk mengurusi kontrak saya,” tegas Hamilton.

Isu kepindahan Hamilton merebak setelah mantan pemilik Jordan GP, Eddie Jordan, mengatakan sang pebalap berpeluang menggantikan Michael Schumacher yang akan pensiun di Mercedes GP akhir musim nanti. Dia menyebut Hamilton akan berduet dengan driver Mercedes lainnya, Nico Rosberg. “Saya sudah bersama tim (McLaren) sejak berusia 13 tahun dan bekerja keras sejak 2009 untuk memenangkan kejuaraan. Semoga, akhirnya kami berada di posisi yang sepantasnya. Hal yang paling penting adalah tidak terganggu oleh semua (isu) sampah yang ada,” papar The Briton geram. Ketua Tim McLaren, Martin Whitmarsh, pun tidak memungkiri bahwa pebalapnya ini belum memutuskan 100 persen untuk bertahan. Namun, Whitmarsh mengaku dirinya amat berharap Hamilton tidak hijrah ke tim lain. (m33/auto)

Menanti Janji Gol Borini LIVERPOOL, Inggris (Waspada): Sejak bergabung dengan Liverpool, Fabio Borini baru mencetak satu gol. Borini pun berjanji akan segera membuka keran golnya lagi demi membawa The Reds menang. Borini selalu dimainkan di empat laga Liverpool di Liga Premier, namun belum satu pun gol dicetaknya. Satu gol yang dibuat mantan pemain AS Roma itu adalah saat melawan FC Gomel di babak ketiga kualifikasi Liga Europa 2012, pertengahan Agustus lalu. Meski selalu dipercaya sebagai starter, Borini belum bisa menjawab kepercayaan Brendan Rodgers dengan gol dan ini tentunya bukan awal yang baik untuk memulai karier di Liverpool. Namun, striker asal Italia itu tak khawatir dan yakin puasa golnya akan segera berakhir. Borini mengaku hanya kurang beruntung jika sampai saat ini dirinya masih mandul di depan gawang lain, seperti saat melawan Sunderland akhir pekan lalu. Kala itu, pemain berusia 21 tahun itu punya dua peluang emas. “Tidak ada resep khusus yang bisa membuat peluang berubah jadi gol. Itu hanya soal moment atau keberuntungan semata. Namun aku pikir kami punya kualitas untuk mencetak gol, kami melihatnya itu dalam latihan dan selalu berlatih keras dalam hal menembak. Saatnya akan datang (gol-gol untuk Liverpool),” tukas Borini, Rabu (19/9). Melawan Young Boys, Jumat (21/9) dinihari, penyerang belia Samid Yesil tampaknya akan segera menikmati debut-

Jadwal Liga Europa Jumat (21/9) Grup A Grup B Grup C Grup D Grup E Grup F Grup G Grup H Grup I Grup J Grup K Grup L


: Udinese vs Anzhi Makhachkala Young Boys v Liverpool : Hapoel Tel-Aviv v Atl Madrid Viktoria Plzen v Academica de Coimbra : AEL v Borussia Monchengladbach Fenerbahce v Marseille : Bordeaux v Club Brugge Maritimo v Newcastle United : FC Copenhagen v Molde VfB Stuttgart v Steaua Bucurest : Dnipro v PSV Eindhoven Napoli v AIK : Racing Genk v Videoton FC Fehervar Sporting Lisbon v FC Basel : Inter Milan v FK Rubin Kazan Partizan Belgrade v Neftchi : Ath Bilbao v Hapoel Kiryat Shmona Lyon v Sparta Prague : NK Maribor v Panathinaikos Tottenham Hotspur v Lazio : Bayer Leverkusen v FC Metalist Kharkiv Rapid Vienna v Rosenborg : Levante v Helsingborg Twente FC v Hannover 96

nya. Pasalnya, Rodgers berencana memasangnya di pertandingan tersebut. Stiker Jerman berusia 18 tahun itu baru digaet The Reds dari Bayer Leverkusen, Agustus lalu. “Yesil jelas akan dipromosikan dengan cepat dan dilibatkan di pertandingan Liga Europa. Saya menyaksikannya bermain lawan timnas Inggris U-19 selama jeda internasional dan mencetak dua gol cantik serta mengkreasikan gol lain,” ucap Rodgers. Setelah sekian lama hampa gelar di kejuaraan Eropa, Andre Villas-Boas bertekad membawa Tottenham Hotspurs merajai Liga Europa musim ini. Dalam sebuah keterangan, pria asal Por-

DRIVER McLaren asal Inggris, Lewis Hamilton, menguji kemampuan mobil sport McLaren MP4-12C dalam event promosi jelang GP Singapura, Rabu (19/9).

Massa Fokus Masa Depan

tugal ini bertekad memberi sesuatu yang spesial kepada Spurs. Bersamaan dengan Lazio, The Lilywhites juga akan berhadapan dengan Panathinaikos dan Maribor di Grup J. “Kompetisi ini (Liga Euorpa) sangat penting. Kompetisi itu terbilang berat, Anda harus memainkan 15 partai sebelum Anda dapat mencapai final, jadi akan lebih sulit dan berat ketimbang bermain di Liga Champions,” ujar AVB. “Jika kami dapat memenangi trofi, maka hal itu akan mewakili banyak untuk sejarah Tottenham dan akan menjadi sesuatu yang sangat istimewa,” tutupnya. (m33/goal/fbi)

MARANELLO, Italia (Waspada): Pebalap Ferrari, Felipe Massa (foto), mengaku akan sepenuhnya fokus untuk meraih hasil terbaik pada sisa balapan musim ini demi mengamankan masa depannya bersama Tim Kuda Jingkrak. Massa belakangan dinilai kurang menunjukkan performa mengesankan saat berada di kursi balap Ferrari. Bahkan, sejak musim lalu isu Ferrari bakal mencari pengganti Massa santer diberitakan. “Tidak ada berita tentang masa depan saya saat ini, tetapi tidak ada keraguan bahwa hasil yang baik akan membantu,” kata Massa, Rabu (19/9). “Saya hanya perlu terus berusaha keras dan mendapatkan hasil yang baik, dengan harapan mendengar beberapa kabar baik segera. Itu selalu lebih baik untuk mengetahui bagaimana situasinya, karena tentu saja saya ingin tahu apa yang saya lakukan tahun depan,” terang mantan pebalap Sauber ini. Massa juga menolak anggapan bahwa ketidakpastian akan

masa depannya adalah penyebab penampilan menurun. Namun, pebalap asal Brazil ini tak mau terpengaruh dengan isu tersebut dan memprioritaskan penampilannya agar tidak terganggu di lintasan balap. Meski begitu, Massa mengetahui risiko yang dihadapi bila dianggap kurang memuaskan selama musim 2012. Massa berharap pada balapan selanjutnya di Singapura, 23 September nanti, dirinya bisa mendapat hasil memuaskan. “Tapi saya dapat memberitahu Anda bahwa tidak pernah terjadi saat di dalam mobil dan tengah balapan, saya memikirkan apa yang akan saya lakukan tahun depan. Saya tahu hasil adalah yang menjadi masalah selama ini dan itu risiko dalam lomba,” jelasnya. “Saya suka trek Singapura dan merasa cocok bahkan jika tidak pernah benar-benar beruntung di sana. Jadi saya pasti akan mencari hasil baik dan bisa melakukan lebih baik dari dua balapan terakhir,” pungkasnya. (m33/auto)

Emas Sepakbola ....

Irawan berusaha membangkitkan moral Hardiantono cs. Menurutnya, prestasi sepakbola Sumut di PON 2012 ini cukup meningkat. Sebelumnya, Sumut hanya mampu meraih perunggu pada PON 2004 di Palembang. Lebih pahit lagi, Sumut gagal lolos seleksi PON 2008 di Kaltim. “Tahun ini kita mampu meraih perak, mudah-mudahan empat tahun mendatang anganangan meraih medali emas sepakbola bisa terwujud,” seru Gus lagi menambahkan kekalahan tim Sumut yang cukup dramatis juga mendapat apresiasi dari masyarakat melalui pesan singkat (SMS) yang masuk ke telepon genggamnya. “Banyak yang memberikan semangat dan mengapresiasi tim sepakbola kita dengan mengSMS saya. Masyarakat juga menganggap keberuntungan belum berpihak kepada anakanak,” ungkap mantan Dirut PT Bank Sumut ini. (m18)

(Lanjutan dari hal 1)

“Perjuangan anak-anak sudah cukup maksimal. Namun inilah sepakbola, gol lawan pun merupakan gol nasib,” kata Plt Gubsu didampingi Kepala Dinas Kominfo Sumut H Asren Nasution, Ketua Umum KONI Sumut Gus Irawan Pasaribu, dan manajer tim Sumut H Kamaluddin Harahap. Meski keberuntungan belum berpihak, Gatot juga menilai permainan yang dilakukan anak-anak Sumut cukup baik. Hal senada juga disampaikan Gus Irawan Pasaribu. Menurut Gus, dewi fortuna memang belum menghampiri tim sepakbola PON Sumut yang diharapkan tetap punya motivasi besar untuk berprestasi lebih baik lagi. “Saya berharap tim ini akan menjadi cikal bakal mampu mewujudkan angan-angan Sumut mampu meraih emas di PON mendatang,” ujar Gus

Pasang Iklan Telp. 4528431 HP. 081370328259 FABIO Borini (29) berjanji segera membuka rekening gol bagi Liverpool.




Sumatera Utara

WASPADA Kamis 20 September 2012

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:21 12:34 12:22 12:29 12:28 12:25 12:22 12:17 12:24 12:24

‘Ashar 15:25 15:42 15:26 15:36 15:34 15:26 15:25 15:20 15:28 15:29

Magrib 18:26 18:39 18:26 18:34 18:33 18:29 18:26 18:22 18:29 18:28



Shubuh Syuruq


19:34 19:47 19:34 19:42 19:41 19:37 19:34 19:30 19:37 19:37

04:50 05:03 04:51 04:58 04:57 04:55 04:51 04:47 04:53 04:53

05:00 05:13 05:01 05:08 05:07 05:05 05:01 04:57 05:03 05:03

L.Seumawe 12:27 L. Pakam 12:20 Sei Rampah12:19 Meulaboh 12:31 P.Sidimpuan12:19 P. Siantar 12:19 Balige 12:19 R. Prapat 12:16 Sabang 12:34 Pandan 12:21

06:14 06:27 06:15 06:22 06:22 06:19 06:15 06:11 06:18 06:17

Zhuhur ‘Ashar 15:34 15:24 15:23 15:36 15:19 15:22 15:21 15:17 15:42 15:21





Shubuh Syuruq


Zhuhur ‘Ashar




Shubuh Syuruq


18:32 18:25 18:24 18:36 18:23 18:24 18:24 18:21 18:39 18:25

19:41 19:33 19:33 19:44 19:31 19:32 19:32 19:29 19:47 19:33

04:56 04:49 04:48 05:00 04:48 04:49 04:49 04:46 05:03 04:50

05:06 05:59 04:58 05:10 04:58 04:59 05:59 04:56 05:13 05:00

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:21 12:22 12:32 12:25 12:22 12:28 12:17 12:27 12:20 12:19

18:25 18:26 18:36 18:29 18:26 18:33 18:21 18:31 18:24 18:24

19:33 19:34 19:45 19:37 19:34 19:41 19:29 19:40 19:32 19:32

04:50 04:51 05:01 04:54 04:51 04:57 04:46 04:56 04:49 04:48

05:00 05:01 05:11 05:04 05:01 05:07 04:56 05:06 04:59 04:58

Panyabungan 12:17 Teluk Dalam12:24 Salak 12:22 Limapuluh 12:18 Parapat 12:20 GunungTua 12:17 Sibuhuan 12:17 Lhoksukon 12:27 D.Sanggul 12:21 Kotapinang 12:15 AekKanopan 12:17

06:20 06:14 06:13 06:24 06:12 06:13 06:13 06:10 06:27 06:14

15:21 15:24 15:39 15:26 15:26 15:34 15:19 15:30 15:21 15:22

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

06:14 06:15 06:25 06:18 06:15 06:21 06:10 06:20 06:13 06:12

Zhuhur ‘Ashar 15:19 15:27 15:24 15:21 15:22 15:18 15:18 15:33 15:22 15:16 15:19




Shubuh Syuruq

18:22 18:28 18:27 18:22 18:24 18:21 18:21 18:31 18:25 18:20 18:21

19:30 19:37 19:35 19:31 19:32 19:29 19:29 19:40 19:33 19:28 19:29

04:47 05:54 04:52 04:47 04:49 04:47 04:46 04:55 04:50 04:45 04:46

04:57 05:04 05:02 04:57 04:59 04:57 04:56 05:05 05:00 04:55 04:56

06:11 06:18 06:16 06:11 06:13 06:11 06:10 06:20 06:14 06:09 06:10

Den Jibom Gegana Amankan Peluru PD II Dari TNGL P. BRANDAN (Waspada): Belum hilang dari ingatan warga tentang temuan 7 bom rakitan di kawasan Barakinduk, Kec. Sei Lepan, Langkat, Selasa (18/9) sore warga kembali digegerkan dengan penemuan benda yang diduga bahan peledak di kawasan TNGL Resort Sei Lepan. Temuan ini pun segera dilaporkankekepolisian.Menindaklanjuti laporan warga, Kanit Reskrim Polsek P. Brandan, Iptu Iswanto bersama tim Detasemen

Penjinak Bom (Den Jibom) dari satuanGeganaBrimobdasu,Rabu (19/9) turun ke lokasi mengevakuasi benda tersebut. Benda terbuat dari logam

padat ini ditemukan seorang petani,Yuda, di areal kebunnya. Menurut keterangan, peluru artileri yang dapat mengahancurkan sasaran radius 100 meter ini panjangnya kurang lebih 55 cm, diameter 5 inci, berat sekira 8 kg dan terdapat tulisan PRM 0209611818. Kapolsek P. Brandan, AKP Zainuddin Lubis didampingi Wakapolsek, Iptu Misrianto, dikonfirmasi mengatakan, benda yang diduga peluru meriam tank ini kemarin ditemukan warga

sekitar 2 km dari kawasan Barakinduk yang berbatasan dengan Kec. Besitang. Secara terpisah, AKP Sutoyo, dari Jibom Brimob yang ditemui mengatakan, peluru ini diperkirakan peninggalan Perang Dunia II. Menurut ahli penjinak bahan peledak itu, peluru yang ditemukankondisinyamasihaktif dan dapat meledak jika terbakar dengan suhu panas tinggi. Sementara itu, aksi teror bom rakitan yang dipasang di rumah warga di kawasan Taman

Nasional Gunung Leuser (TNGL) Resort Sei Lepan, tepatnya di kawasanBarakinduk,DesaAman Damai,Langkat,empatbulanlalu hingga kini belum terungkap. Peristiwa teror 6 Juni itu masih diselimuti misteri. Bom dirakit dari komponen besi pipa sepanjangkuranglebih30cmdan diameter 5 cm. Bom rakitan ini dipasang OTK secara terpisah di empat titik rumah warga. Satu dari bom meledak di kediaman Selamet, yang kebetulan sedang tidak berada di rumah.(a02)

Dituduh Punya Begu Ganjang, Satu Keluarga Diusir DOLOKMASIHUL (Waspada): Dituduh memelihara begu ganjang, Adiana br Sagala, 65, wargaDusunVISinurat,DesaBlok 10, Kec. Dolok Masihul, Kab. Serdang Bedagai bersama keluarganya diusir secara paksa oleh ratusan warga, Selasa (18/9) sore. Bahkan rumah yang ditempati bersama anaknya Jarliman Girsang,38,TeguhMaruliGirsang, 28,danmenantunyaRiabrMalau, 38, nyaris dirusak warga. Informasi dihimpun, peristiwa berawal ketika dua bulan terakhir empat warga meninggal dunia secara beruntun, di antaranyaWendy Sitinjak, 3, Aldo Saragih (balita) serta Meresti br Sitohang, 54. Kematian mereka dianggap tidak wajar, karena tibatiba sakit dan akibat kecelakaan lalulintas. Akhirnya, warga bersepakat memanggil paranormal dari Sidamanik Siantar bermarga Boru Sitorus, 60, untuk memas-

tikan hal itu. Sebelum ritual, warga sepakat membuat pernyataan jika setelah ritual terbukti ada warga yang memelihara begu ganjang,harusbersediadiusiratau pindah ke tempat lain. Kesepakatan itu ditandatangani seluruh warga termasuk keluarga korban diketahui pihak Desa Blok 10. Selasa (18/9) pukul 08:00 digelar ritual hingga menjelang sore. Puncaknya, hasil ritual mengarah ke rumah korban dimana kemudian ditemukan beberapa barangtempatsisaminyakgoreng, uang logam kuno, bibit jagung merah, patung, toga wisuda dan satu botol mineral yang dianggap paranormal sebagai bukti, bahwa Andiana br Sagala memelihara begu ganjang. Akibatnya, ratusan warga yangmenyaksikanrituallangsung emosidanberusahamenghakimi sekaligusmerusakrumahkorban. Beruntung Muspika Dolok Masihul dipimpin Camat Dolok

HUT PMI Ke 67 Di Binjai BINJAI (Waspada): Peringatan Hari Ulang Tahun (HUT) Palang Merah Indonesia (PMI) ke 67 di Binjai dilaksanakan di Lapangan Merdeka, Senin (17/9).Wali Kota Binjai HM Idaham, SH, MSi bertindak sebagai inspektur upacara dan membacakan sambutan tertulis Ketua Umum PMI HM Yusuf Kalla. Upacara berlangsung khidmad dihadiri antara lain Kapolres Binjai AKBP Musa Tampubolon, Ketua DPRD Zainuddin Purba, Ketua PMI Lisa Andriani Idaham, diikuti anggota Korpri, Polri, dan anggota Palang Merah Remaja (PMR). Pada peringatan ulang tahun PMIke67dilapanganMerdekaBinjaiditampilkansimulasipertolongan pertama pada kecelakaan oleh anggota PMR. HUT PMI tahun ini mengangkat tema “Kaum Muda Sebagai Agen Perubahan” untuk menekankan kembali pentingnya generasi muda sebagai roda penggerak aksi - aksi kemanusiaan PMI. Ketua umum PMI Pusat HM Yusuf Kalla mengajak generasi muda untuk terjun, terlibat serta berkomitmen dalam menjalankan aksi kemanusiaan. Aksi tersebut dapat diwujudkan dalam penanganan bencana, masalah kesehatan, donor darah, pelestarian lingkungan dan perubahan iklim.(a04)

Masihul, Dimas Kurnianto, Kapolsek Dolok Masihul, AKP Zuhari dan Kepala Desa Blok 10, Subur bersama belasan personel Polres Sergai, Koramil Dolok Masihul dan Polsek Dolok Masihul bersiaga hingga aksi dapat diredam. Sebagai antisipasi akhirnya pihak Muspika Dolok Masihul mengungsikan keluarga korban, sementarawargatetapemosidan minta rumah korban dibongkar. Bahkan ketika keluarga korban

meninggalkanrumahnyaratusan warga berusaha melempari namun dapat diredakan pihak Muspika Dolok Masihul. H. Sinurat, 53, suami mendiangMerestibrSitohangmengatakan istrinya meninggal akibat kecelakaan di Asahan dengan tidak wajar, begitu juga beberapa wargalainnyayangsebagianbesar anak-anak,meninggaltidakwajar, sehingga mereka berkeyakinan itu disebabkan oleh begu ganjang yangdimilikikeluargaboruSagala.

Sementara Andiana br Sagala bersama anak-anaknya membantah dan menyatakan mereka tidak memelihara begu ganjang seperti dituduhkan paranormal dan warga. KapolsekDolokMasihul,AKP Zuhari didampingi Camat Dolok Masihul, Drs. Dimas Kurnianto membenarkan peristiwa itu dan pihak Muspika telah mengungsikan keluarga korban untuk mengantisipasiamukwargayang emosi.(c03)

Program Puskesmas 24 Jam Berlanjut Di Langkat STABAT (Waspada): Bupati Langkat H. Ngogesa Sitepu, SH menegaskan, pelayanan kesehatan masyarakat melalui program Puskesmas 24 jam di setiap kecamatan terus berlanjut. Awal pencanangannya memang banyak kritikan yang menyatakan Langkat belum siap melaksanakan hal tersebut, namun seiring berjalannya waktu dan kesungguhan aparat di bidang kesehatan, akhirnya program tersebut terlaksana dengan baik dan lancar. “Ini tidak terlepas dari peranan Dinkes serta para bidan yang berupayamelaksanakantugasnya dengan baik,” kata bupati dalam sambutannyapadaacaraSilaturahim Keluarga Besar Ikatan Bidan Indonesia (IBI) Kabupaten Langkat di aula Akper-Akbid Pemkab Langkat di Stabat, Selasa (18/9). Bupati juga mengapresiasi kinerja para pelayan kesehatan seraya mengungkapkan peran bidan apalagi yang bertugas hingga pelosok pedesaan merupakan tugasyangtidakringan,yaknimemberi bantuan pertolongan bagi masyarakat yang membutuhkan. Dalamkesempatanitubupati mengaku berupaya untuk mengusulkan tambahan penghasilan

Waspada/Ibnu Kasir

BUPATI Langkat H. Ngogesa Sitepu, SH menyerahkan cenderamata kepada para bidan pada silaturahmi Keluarga Besar Ikatan Bidan Indonesia (IBI) Kabupaten Langkat di Stabat. bagi para bidan dalam APBD TA 2013 dan secara pribadi Ngogesa memberikan cenderamata berupa800helaikainsarunguntuk para bidan yang hadir. Sebelumnya Ketua IBI LangkatHj.SitiHadijah,mengajakpara bidan konsisten dalam berkomitmen menunjukkan aksi nyata

mendukung pencapaian Millenium Development Goals pada 2015 (MDg’s 2015).“Banyak kepedulian serta bantuan diberikan Bupati Langkat terhadap tenaga kesehatan terutama para bidan, sehingga pihaknya semakin terpacu untuk berbuat yang terbaik,” kata Hadijah.(a01)


PETUGAS Jibom dari Brimob mengamankan peluru artileri yang telah dievakuasi dari lokasi temuan di kawasan Barakinduk, Kec. Sei Lepan.

Bupati Sergai Sampaikan RP-APBD 2012 Dan 8 Ranperda SEI RAMPAH (Waspada): Bupati Serdang Bedagai (Sergai) Ir. HT. Erry Nuradi, M.Si didampingiWabup Ir. H. Soekirman, kemarin menyampaikanRancanganPerubahanAnggaranPendapatan dan Belanja Daerah (RP-APBD) tahun anggaran 2012 Rp868,3 miliar dan 8 Rancangan Peraturan Daerah (Ranperda) kepada DPRD Kabupaten Sergai. Rancangan PAPBD 2012 dan Ranperda itu disampaikan Bupati Erry Nuradi di hadapan rapat paripurna DPRD Sergai yang dipimpin olehWakil Ketua Dewan Drs. H. Sayuti Nur, M.Pd, dihadiri Ketua DPRD H. AzmiYuli Sitorus SH, MSP, Kajari Sei Rampah Erwin Panjaitan, SH, MH,Wakil Ketua Dewan MY. Basrun, Sekdakab Drs. H. Haris Fadillah, M.Si,Wakapolres Sergai Kompol Zahrie, para Asisten dan Staf Ahli Bupati, para Kepala SKPD serta Camat se-Kabupaten Sergai. Dalam nota pengantarnya, Bupati Sergai HT. Erry Nuradi menguraikan estimasi pendapatan daerah pada P-APBD tahun anggaran 2012 mengalami pertambahan 1,04 persen dari APBD murni yaitu Rp859.407.104.553 menjadi Rp868.356.312.855. Perubahan pendapatan daerah itu menurut Bupati terdiri dari PAD semula direncanakan Rp40.969.091.848 diestimasi menjadi Rp42.974.354.309 atau naik Rp2.005.262.461 atau 4,89 %. Kemudian pendapatan dari dana perimbangan semula direncanakan Rp672.825.349.530 diperkirakan naik 0,43 persen Rp2.875.784.566 menjadi Rp675.701.134.096. Untuk pendapatan lain-lain pendapatan yang sah semula direncanakan Rp145.612.663.175 setelah perubahan diperkirakanmengalamikenaikanRp4.068.161.275 menjadi Rp149.680.824.450. Sementara perubahan untuk belanja daerah diestimasikan mengalami kenaikan sebesar Rp9.069.096.302 atau 1,08 persen dari jumlah semula Rp838.182.541.321,98 menjadi Rp847.251.637.623,98. Kenaikan belanja daerah ini sebagian besar dialokasikan untuk peningkatan

infrastruktur daerah, tambahan penghasilan dan tunjangan profesi guru serta program/kegiatan dalam rangka persiapan pengalihan PBB sektor P2 (Pedesaan dan Perkotaan) yang akan menjadi kewenangan daerah mulai berlaku 1 Januari 2013. Pada PAPBD 2011 yang diajukan Bupati Ir. HT. Erry Nuradi, M.Si urusan wajib pemerintahan memperoleh alokasi dana Rp813.107.772.399,98 atau sebesar 95,97 persen dari total belanja langsung.Sedangkanurusanpilihanpemerintahan memperolehsisanyaRp34.143.865.224atausebesar 4,03 persen dari total belanja langsung. Dana urusan wajib pemerintahan yang terbesar dialokasikan untuk tiga bidang yaitu bidang pendidikan mencapai Rp378.408.755.124,98, selanjutnya diikuti oleh bidang otonomi daerah, pemerintahan umum, administrasi keuangan daerah, perangkat daerah, kepegawaian dan persandian daerah sebesar Rp200.279.618.528 dan bidangpekerjaanumumsebesarRp99.416.560.802. Sedangkan pada pos pembiayaan daerah terdapat Sisa Lebih Perhitungan Anggaran (SILPA) tahun 2011 sebesar Rp11.752.724.029,98 yang merupakan hasil audit yang dilakukan Badan PemeriksaKeuanganatas laporankeuangantahun anggaran 2011. Delapan Ranperda Dalam sidang paripurna dewan yang sama, Bupati juga mengajukan 6 enam Rancangan Peraturan Daerah (Ranperda) kepada DPRD Sergai, di antaranya tentang pengelolaan sampah, penyertaan modal pada perseroan terbatas pembangunan Serdang Bedagai, pengendalian pencemaran udara, retribusi pelayanan tera ulang, danperubahanatasPerdaBo.2tahun2011tentang retribusi jasa umum. KemudianPerdatentangPerubahanatasPerda No 3 tahun 2011 tentang retribusi jasa umum, Perubahan atas Perda No 4 tahun 2011 tentang retribusi perizinan tertentu, perubahan atas Perda No.21tahun2007tentangpembentukanperseroan terbataspembangunan SerdangBedagai.(a08/c03)

Berangkat 25 September 2012:

490 Calhaj Deliserdang Ikuti Manasik

Waspada/Riswan Rika

WALI KOTA Binjai HM Idaham, SH, M.Si menyerahkan sumbangan untuk Palang Merah Indonesia pada acara HUT ke -67 PMI di lapangan Merdeka.

AKP Rasyid Hartanto Kasat Reskrim Polres Langkat STABAT (Waspada): AKP Rasyid Hartanto diamanahkan sebagai Kasat Reskrim Polres Langkat menggantikan AKP Aldi Subartono, yang sebelumnya dimutasi ke Semarang. Selain itu AKP Lukmin dilantik menjadi Kasat Narkoba menggantikan Iptu KomandoTarigan selaku pejabat sementara. Selanjutnya AKP Zulkarnain menjadi Kapolsek Salapian, menggantikan AKP Adillah yang dimutasi ke Ditlantas Poldasu. Kapolres Langkat AKBP Leonardus Eric Bhismo dalam arahannya saat memimpin serahterima jabatan Selasa (18/9) pagi, mengatakan mutasi hal wajar.(a03)

LUBUKPAKAM (Waspada): Wakil Bupati Deliserdang H. Zainuddin Mars membuka pelaksanaan manasik haji bagi 490 Calhaj (calon haji) asal Kab. Deliserdang yang akan menunaikan ibadah haji ke tanah suci tahun 2012/1433 H. Manasik berlangsung tiga hari dari Senin (17/9) hingga Rabu (19/9), di aula kantor Kemenag Deliserdang di Lubukpakam. Hadir Dandim 0204/DS LetkolArhWawikDwinanto,S.Sos, Kajari Lubukpakam H. Khairil Aswan Harahap, SH, Sekdakab Drs. H. Azwar S, MSi, Kakan Kemenag Deliserdang Drs. H. Dur Brutu, MA, Kadis Infokom Drs. Neken Ketaren, Kabag Kemasyarakatan Setdakab Deliserdang M.

Taher Siagian, SE dan sejumlah pejabat Pemkab Deliserdang. Kepala Kantor Kementerian Agama (Kakan Kemenag) Deliserdang Drs. H. Dur Brutu, MA mengatakan, manasik diikuti 490 Calhaj. Terdiri dari laki-laki 186 orang, perempuan 304 orang berasal dari 18 kecamatan. Calhaj termuda M.Wiko Asnadi, 20, dan tertua Ngairah, 88, sama-sama asal Kec. Labuhan Deli. Calhaj asal Deliserdang yang berangkat dalam Kloter (kelompok terbang) V masuk asrama, Senin (24/9) pukul 07: 00 dan berangkat melalui Embarkasi Polonia Medan, Selasa (25/9). Wabup Deliserdang H. Zainuddin Mars berharap, seluruh Calhaj dapat memperkokoh rasa

persaudaraan, saling membantu mulai dari pemberangkatan, pelaksanaan ibadah di tanah suci hingga kembali ke tanah air sehingga ibadah haji terlaksana dengan sempurna. Diharapkan menjadi haji dan hajah mabrur. “Tidak kalah penting, mendoakan Deliserdang dapat lebih eksis, kondusif serta hidup dalam semangat kebersamaan. Karena kebersamaanlah yang selama ini menjadi andalan untuk percepatan pembangunan,” kataWabup. Sementara Kasi Urusan Haji dan Umrah Kantor Kemenag Deliserdang H. Syawal Harahap, S.Ag menjelaskan, dari 490 Calhaj yang akan berangkat, 35 di antaranya akan bergabung (mutasi) ke Kloter lain.(a06)

Sepedamotor Dirampok Di Binjai BINJAI (Waspada): Sepedamotor milik KikiTamala, 20, penduduk Jalan Bringin Kelurahan Jati Utomo BK 3601 ACK dirampok dua pria tak dikenal di Jalan Yos Sudarso, Kec. Binjai Utara sehingga korban mengalami kerugian Rp14 juta. Kejadian itu dilaporkan korban ke Polsek Binjai Utara. Informasi yang dihimpun, Minggu (16/9) sekira pukul 19:00 korbanhendakmenjemputsuaminyadaritempatnyabekerjamelintasi jalanYos Sudarso Kec. Binjai Utara, namun diikuti dua pria menaiki sepedamotor. Sampai di depan pabrik mihun sepedamotor korban distop ke dua pria tersebut. Seorang kawanan perampok langsung mengancamkan senjata tajam ke leher korban sekaligus merampok sepedamotor korban. Sementara Kapolsek Binjai Utara Kompol PolwanWidya, ketika dikonfirmasi membenarkan kejadian tersebut. Pelakunya masih dalam pengejaran.(a05)

Waspada/HM Husni Siregar

WABUP Deliserdang H. Zainuddin Mars memberi ucapan selamat kepada Calhaj yang akan berangkat ke tanah suci Makkah, pada pembukaan manasik haji di Kantor Kementerian Agama Deliserdang.


BUPATI Sergai Ir. HT. Erry Nuradi, M.Si didampingi Wabup Ir. H. Soekirman disaksikan para Wakil Ketua dan anggota DPRD Sergai menyerahkan Rancangan Perubahan APBD tahun anggaran 2012 kepada Ketua DPRD Sergai H. Azmi Yuli Sitorus SH, MSP dalam rapat paripurna dewan di Gedung DPRD Sergai di Sei Rampah.

Parpol Kecil Dominasi Alat Kelengkapan DPRD T. Tinggi TEBINGTINGGI (Waspada): Partai politik kecil di DPRD kota Tebingtinggi, menjelang dua setengah tahun berakhirnya periodesasi, mendominasi alat kelengkapan lembaga Legislatif itu.Dominasiituterlihatpadapemilihanpimpinan komisi-komisi, badan legislasi dan badan kehormatanDPRD,Selasa(18/9),dihadirisebagian besar anggota Dewan. Anggota DPRD yang terpilih di Komisi I, yakni Ketua Christoph Munthe (Partai Barnas), Wakil Ketua Ir. Alensudin Purba (PDP), Sekretaris Sofiyanis Tambunan (PDIP), Komisi II Ketua Parlindungan Rajagukguk, SE (PDIP),Wakil Ketua H. Hasnan Lubis (PAN), SekretarisWakidi (PKS). Sedangkan Komisi III Ketua Mhd. Erwin Harahap, SE, Wakil Ketua H. Samsul Bahri (PKPB) dan Sekretaris Murli Purba, S.Fil (Republikan). Selanjutnya,untukjabatanBadanKehormatan DPRD, Ketua H. Samsul Bahri (PKPB),Wakil Ketua Mhd. Erwin Harahap, SE dan Sekretaris Sofianis Tambunan (PDIP). Demikian juga untuk Badan Legislasi DPRD Ketua Murli Purba, S.Fil (Republikan), Wakil Ketua Edi Syahputra (PKPB). Dikabarkan rapat berlangsung panas, menggunakan mekanisme pemilihan ‘one man

one vote’ dengan sejumlah calon. Seorang anggota DPRD membeberkan fraksi-fraksi besar yakni F Partai Golkar 6 kursi dan F. Demokrat 4 kursi, kalah telak dalam pemilihan itu. “Umumnya, kawan-kawan sudah merasa tidak cocok lagi dengan kepengurusan sebelumnya yang didominasi Parpol besar.” Ketua Komisi I Christoph Munthe, mengatakan pergantian alat kelengkapan DPRD yang dilakukan merupakan konsekuensi dari peraturan yang ada, berupa tata tertib DPRD. Namun kepercayaan anggota DPRD terhadap kepengurusan yang baru, merupakan amanah yang harus dijaga. Terkait gagalnya Parpol besar dalam menduduki jabatan di alat kelengkapan DPRD, kader Partai Golkar Hasan Damanik, menyesalkan rendahnya kemampuan anggota Dewan dari Partai Golkar.“Itulah dampak dari kecenderungan berpolitik ke dalam. Semestinya berpolitik ke luar. Akibatnya soliditas politik sesama kader jadi lemah,” ujar kader senior partai berlambang pohon beringin itu. Hasan Damanik, minta DPD Partai Golkar Tebingtinggi mengevaluasi kinerja anggota DPRD dari Partai Golkar, karena kekalahan itu.(a09)

Sumatera Utara


Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir

Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu Lusia Damayanti (Jakarta).

Angin Kencang Hambat Aktivitas Nelayan TG TIRAM (Waspada): Angin kencang atau istilah angin ribut menghambat nelayan di Kab. Batubara melakukan aktivitas penangkapan ikan, mengakibatkan hasil tangkapan merosot. “Hari ini total penjualan Rp40 ribu hanya dapat sekali labuh

karena angin koncang (kencang),”sebut Wak Ucok salah

Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana

Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David

Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: H. Halim Hasan. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Zulkifli Harahap. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Promosi: Edward Thahir (Koordinator). Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Sinur Manik (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi). Wartawan Kota Medan: Umum: Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Hajrul Azhari Ritonga, Arianda Tanjung. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebingtinggi: Muhammad Idris, Abdul Khalik. Pematangsiantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanafiah, Hasanul Hidayat. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar, Dedek Juliadi. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Jasvira Sautisa. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan WASPADA dilengkapi dengan kartu pers. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada yang mengaku wartawan WASPADA tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan: hitam-putih Rp. 33.000,-, berwarna Rp. 90.000,Ukuran kolom: 40,5 mm. E-mail Iklan: Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Temuan BPK Belum Tentu Terkait Korupsi RANTAUPRAPAT(Waspada): Temuan Badan Pemeriksa Keuangan (BPK) belum tentu terindikasi dan terkait dengan korupsi, bisasajahalitumerupakan kesalahan administrasi. Lagi pula, tanggung jawab kesalahan itu belum tentu bupati, tetapi bisa saja kepada SKPD selaku pengguna anggaran. Hal itu disampaikan Ketua DPRD Kab. Labuhanbatu Hj Ellya Rossa Siregar SPd ketika menerima perwakilan komunitas rakyat anti korupsi (Korak) Labuhanbatu di ruang badan anggaran (Banggar) DPRD, Selasa (18/09). Ellya Rosa mengatakan, temuan BPK telah disampaikan kepada dewan dan kami akan segera memprosesnya. Dari telaah yang kami lakukan, katanya, hampir seluruh temuan itu dikategorikan kesalahan administrasi. Namun demikian, katanya, DPRD bukanlah lembaga yang berwenang untuk melakukan penyelidikan dan penyidikan terkait temuan BPK tersebut. Apabila kami menemukan adanya unsur tindak pidana korupsi, maka kami akan menyerahkan hal itu sepenuhnyakepadapenegakhukum.“Kamimendukungsepenuhnya penegakan hukum di daerah ini,” tegasnya. Sementara itu Kabag Humas Pemkab Labuhanbatu, AbdurrahmanHasibuan,kepadapersmenanggapiaksiunjukrasayangdilakukan Korak tersebut mengatakan, unjuk rasa atau sejenisnya merupakan hak setiap individu atau organisasi. “Silahkan saja berunjuk rasa, karena itu merupakan ungkapan ekspresi seseorang yang dibenarkan di alam demokrasi dan dilindungi oleh Undang-undang,” katanya. Terkait temuan BPK yang banyak dilansir berbagai media saat ini, Rahman mengatakan, temuan BPK itu benar adanya, namun perlu dipahami bahwa setiap temuan BPK dibarengi dengan perintah dan saran dari BPK itu sendiri untuk ditindaklanjuti oleh SKPD terkait. (c07)

WASPADA Kamis 20 September 2012

Waspada/Iwan Has

SALAH seorang nelayan berskala kecil sepulang dari laut sedang merajut atau istilah membubul jaring yang koyak akibat di hantam tunggul maupun karang di tangkahan Sungai Batubara, Desa Masjid Lama, Kec. Talawi.

seorang nelayan jaring yang bertangkahan di Sungai Batubara Desa Masjid Lama, Kec Talawi, Batubara sepulang dari laut Senin (17/9). Terjadinyaanginributdisertai gelombangsecaratiba-tibamembuat dirinya mengambil langkah pulang ke tangkahan dengan membawa hasil tangkapan apa adanya,walaupunnilainyahanya dapat menutupi biaya operasi demi menjaga keselamatan. “Kita khawatir untuk bertahanataumelabuhkanpukatlebih lanjut, karena angin begitu kencang terjadi,” ujarnya sambil tangannyadenganlincahmerajut jaring yang rusak atau terkoyak akibat di hantam tunggul dan karang di atas sampan tempel digunakan. Sebagian nelayan diakuinya ada bertahan dengan berlindung di Pulau Salah Namom, yang saat iniditataPemkabBatubaradalam upaya pengembangan di sektor wisata, sembari menunggu sampai cuaca normal kembali untuk melakukan penangkapan ikan.“Sudahsodapkito(enakkita) berlindung di pulau karena ada pembangunan di sana, dan bisa menumpang digunakan untuk tempat istirahat,” ujarnya. (a13)

Banyak Pungutan ‘Aneh’ Di SMAN 2 Kotapinang KOTAPINANG (Waspada): Niat baik Bupati Labusel,Wildan Aswan Tanjung untuk menggratiskan pendidikan di daerah ini ternyata belum didukung oleh perangkat pendidikannya. Terbukti, sampai kini masih banyak siswa yang harus membayar beragam pungutan “aneh” di sekolah, bahkan untuk sekolahpun harus bayar. Kondisi itu seperti yang dirasakan siswa di SMA Negeri 2, Desa Mampang, Kec. Kotapinang. Kepada Waspada, Selasa (18/ 9) sejumlah siswa mengaku banyak kutipan terkesan aneh yang diwajibkan pihak sekolah kepada mereka. Padahal semula mereka berharap, sekolah di SMA Negeri lebih murah dan tidak banyak kutipan. Salah seorang siswa yang tidak bersedia namanya disebut mengatakan, sejak awal masuk sekolah,merekadiwajibkanmembayar Rp38 ribu/bulan dengan dalih biaya rutin (SPP) sekaligus Rp21 ribu biaya insidentil. “Nggak

tahu apa maksudnya insidentil yang jelas kedua dana itu harus dibayar setiap bulan,” katanya. Bukan itu saja, dia dan siswa lainnyajugamasihdibebaniiuran OSIS Rp5.000/bulan dan biaya kas Rp2.000/minggu ditambah lagi dalam tiga hari ini mereka dikutip Rp5.000/hari untuk biaya pembelian bendera dan gabagaba. Sebagai siswa yang baik, wanita ini hanya pasrah membayar meski tidak tahu apa tujuan danaitudibayarkan.“Kalaunggak dibayar gurunya marah-marah,” katanya. Siswalainnyayangjugaenggan namanya disebut mengatakan, mereka masih harus membayar uang pembelian LKS Rp8.000 per eksemplar sebanyak tujuh eksemplar/siswa. Ditambah lagi uang pembelian 15 eksemplar buku paket senilai Rp618 ribu yang dicicil tiga kali pembayaran selama setahun. “Kalau seperti ini, lebih baik di sekolah swasta,” katanya. Salah seorang orangtua siswa yang juga takut namanya disebut

mengaku kewalahan menanggung biaya sekolah putrinya di tempat itu. Apa lagi dirinya hanya bekerja sebagai buruh panen kebun yang berpenghasilan paspasan. “Kemarin kami sempat ribut mengenai kutipan Rp10 ribu/hari untuk beli bendera dan gaba-gaba. Lalu kepala sekolah marah-marah kepada guru, tapi kutipan tetap jalan hanya saja menjadi Rp5.000/hari selama tiga hari. Mau masuk saja kemarin bayar Rp200 ribu,” katanya. Kepala Sekolah SMAN 2, Edi Sonti yang dikonfirmasi mengatakan, dirinya tidak pernah mengetahui mengenai adanya pengutipan tersebut. Mengenai uang SPP Rp38 ribu/bulan, menurutnya untuk membayar gaji sembilan orang guru honor yang tidak ditampung dalam APBD Labusel. Sedangkan kutipan insidentil Rp21 ribu, menurutnya, kebijakan komite sekolah. “Besok saya panggil guru dan murid yang melaporkan itu untukmeluruskanpermasalahan ini,” katanya. (c18)

Thamrin 1 Jam Lepas Jabatan Wali Kota BAGANASAHAN, Asahan (Waspada):Selamasatujamlebih, Thamrin Munthe meninggalkan jabatan dan kursi Wali Kota Tanjungbalai, hanya untuk berbaur dengan masyarakat nelayan Kab. Asahan. Kegiatan itu sengaja dilakukannyademimenjadiUstadzsaat pelantikan Persatuan Nelayan Tradisional Indonesia (PNTI) Kab. Asahan di Bagan-asahan, Kec. Tanjungbalai, Selasa (18/9).“Saya datang kemari bukan sebagai sebagai Wali Kota Kota Tanjung-

balai, namun sebagai masyarakat biasa,” ujarnya saat memberikan tausiyah. Thamrin berharap, dengan pelantikan PNTI Asahan, bisa memupuk persaudaraan sesama nelayan baik itu yang ada di Kab. Batubara danTanjungbalai, demi menujukehidupanyanglebihbaik. “Letakwilayahdankabupaten bukanlahsebagaipemecahantara kita,olehsebabitupersatuanharu ditingkatkan, sehingga pembangunan bisa lancar berjalan. Terutama masyarakat nelayan harus

bisa melangkah bersama dan berkerjasama,” kata Thamrin. Menurut Thamrin, dengan persatuan masyarakat bisa bangkit dari keterpurukan dan lebih kuat, karena di mata Allah SWT, kita sama, hanya iman dan ketakwaan yang membedakan kita.“Jabatandankekayaanhanya titipan, yang sewaktu-waktu bisa hilang. Oleh sebab itu marilah kita membina persatuan dan hilangkan semua perbedaan, demi menuju kesejahteraan bersama,” ujar Tahmrin. (a15)

Waspada/Syahri Ilham Siahaan

BUPATI Labura H Kharuddinsyah SE, memberikan hadiah kepada Kapten Inf Sulaiman pada acara pencanangan Bakti Sosial TNI, KB, Kes.

Pemkab Labura, BKKBN Dan TNI Gelar Baksos AEKKANOPAN (Waspada): Pemkab Labubanbatu Utara (Labura) bekerjasama dengan BKKBN Sumatera Utara dan TNI melaksanakan Bakti Sosial (Baksos) TNI, KB, Kes dan Hari Keluarga Nasional XIX, di Lapangan Polri Aekkanopan, Senin (18/9). Acara itu dihadiri, Bupati Labura H. Kharuddinsyah SE, Kapolres Labuhanbatu AKBP Hirbak Wahyu Setiawan, SH, SIK, Dandin 0209/ LB Letkol Inf Dwi Bagus Nugraha SH, Sekdakab Labura H. Amran Matondang, SH, Mhum, Ka BKKBN Sumut diwakili Kabid Advokasi dan Informasi Drs. Datang Sembiring serta para SKPD di jajaran Pemkab Labura. Bupati Labura H Kharuddin Syah Sitorus, SE mengatakan, program KB dan kependudukan berpengaruh besar terhadap keberhasilan pembangunan secara keseluruhan, karena penduduk merupakan subjek dan sekaligus objek pembangunan. Oleh karena itu pertumbuhan penduduk harus dikendalikan dan dikelola dengan baik. “Penduduk yang berkualitas merupakan modal penting bagi proses pembangunan, sementara pertambahan penduduk yang tidak terkendaliakanmenjadibahanbagipembangunan. Disinilah peran penting strategis Kantor Pemberdayaan Perempuan anak dan KB untuk

menggelorakan semangat ber KB,” jelas Kharuruddin Syah. Sementara Dandim 0209/ LB Letkol Inf Dwi Bagus Nugraha mengatakan, program KB Kesehatan Terpadu di laksanakan secara terkoordinir oleh BKKBN bersama dengan TNI untuk mewujudkan solusi mengatasi perkembangan atau permasalahan melalui revitalisasi program KB Nasional yang telah di canangkan. “Untuk itu saya harapkan, program ini dapat terlaksana secara sistimatis, sinergis dan dapat terus dipertahankan serta di tindak lanjuti dan di kembangkan sebagai bentuk partisipasi dalam upaya membangun masyarakat yang sehat , sejahtera dan bahagia,” jelas Dandim. Kakan Pemberdayaan Perempuan Anak dan KB, Dra Nursa’adah menjelaskan, pencanangan Bakti Sosial TNI, KB, Kes dan Hari Keluarga tingkat Labura, menggelar kegiatan pelayanan KB Medis operasi wanita atau MOW, sebanyak 120 orang. Selain itu, juga pemberian hadiah. Padakesempatanitubupatijugamemberikan hadiah secara spontan berupa uang tunai kepada Kapten Inf Sulaiman anggota Kodim 0209/ LB, karena dia merupakan orang pertama di Sumut mengikuti program BKKBN tentang medis operasi pria atau vasektomi. (c08)

FKMDI Minta Pemerintah Ambil Sikap Tegas Soal Film Innocence of Muslims KISARAN (Waspada): Film Innocence of Muslims yang menjelekkan Nabi Muhammad SAW, Forum Komunikasi Da’i Muda Indonesia (FKDMI) Kab. Asahan meminta pemerintah mengambilsikaptegas,dalammenyikapipersoalan tersebut, sehingga kejadian tidak berulang dan hati umat Islam tidak tersakiti. Hal itu disampaikan Ketua Umum FKDMI Kab. Asahan Raja Dedi Hermansyah, didampingi sekretarisnya Zulkhaidir Pinayungan, kepada Waspada, Rabu (19/9). Dia mengatakan bahwa film yang tersebut berakibat fatal karena menjelekkan Nabi Muhammad SAW, dan bisa mengganggu ketertiban masyarakat. “Kami mengutuk film tersebut. Kami minta Pemkab Asahan untuk memberi dukungan nyata kepada pemerintah Indonesia untuk mendesak pemerintah Amerika menghukum sutradara dan pemain film itu dihukum,” ujar Dedi. Dedi juga berharap MUI Asahan untuk mengundang Ormas Islam, tokoh agama dan ustadz dalam menyikapi film tersebut yang menyakiti hati umat. “Umat Islam harus bersatu, menjaga keamanan, kondusifitas. Dan bila menyampaikan

aspirasi dan menyikapi film yang menghina Nabi Muhammad harus disampaikan dengan baik dan sesuai dengan prosedur,” ujar Dedi. (a15)


KETUA Umum FKDMI Kab. Asahan Raja Dedi Hermansyah, didampingi sekretarisnya Zulkhaidir Pinayungan, menunjukkan pernyataan sikap terkait film yang menghina Nabi Muhammad SAW.

Dua Rumah Ludes Terbakar LIMAPULUH (Waspada): Dua rumah semi permanen milik Supriadi, 32, dan Ngadi, 58, warga DusunVI Desa Sukorejo, Kec. Sei Balei, Kab. Batubara, Rabu (19/ 9) sekira pukul 10:30 terbakar, Supriadi dan istrinya Ros alami luka bakar di bagian punggung. Menurut informasi yang diterima Waspada dari salah seorang saksi mata, Tukiran, 49, warga yang sama, saat ia melihat rumah korban terbakar, api sudah membesar dan Supriadi berlari keluar rumah dalam keadaan punggungnya terbakar. “Saya dan warga yang lain berusahamencegahagarapitidak merembet jauh meskipun sudah membakar sebagian rumah di

sebelahnya milik Ngadi orangtua Supriadi, saya hanya melihat Supriadi berlari keluar rumah dalam keadaan punggungnya terbakar dan ditolong warga yang lain,” ujar Tukiran. Disebutkannya juga dalam api yang membesar itu terdengar suara ledakan yang sangat kuat, seperti suara ban truk pecah.Tapi iatidaktahupastiapakahitusuara ledakan gas atau yang lainnya. Dia juga tidak mengetahui asal api. Warga bahu membahu berupayamemadamkanapi,dan terakhir datang bantuan dari Satuan Pemadam Kebakaran yang menuntaskan pemadaman api, namun rumah Supriadi yang separuh papan itu sudah ludes

dimakan api. Pantauan Waspada di Tempat Kejadian Perkara (TKP), rumah semi permanen yang merupakan tempat tinggal korban juga digunakan untuk berjualan kedai sampah.Meskipundidepanrumah digunakansebagaitempatberjualan bensin, namun tidak terlihat tempat berjualan saat terbakar. Kapolsek Labuhan Ruku AKP H Matondang yang ditemui Waspada di TKP mengatakan, ia belum dapat menyimpulkan sebab-sebab kebakaran. “Sejauh ini kita masih menyelidiki sebab - sebab kebakaran, belum dapat dipastikan,” kata Matondang. Sementara kedua korban yang mengalami luka bakar dibawa ke RS Katarina, Kisaran. (c05)

Waspada/Agusdiansyah Hasibuan

SEJUMLAH murid SD memperhatikan petugas pemadam kebakaran Pemkab Batubara bersama warga sekitar mengamankan barang barang berbahaya dari lokasi kebakaran.

Waspada/Rasudin Sihotang

KETUA DPW PNTI Sumut, Sangkot Sirait, menyerahkan pataka kepada Ketua PNTI Asahan, Safri Sitorus, didampingi Sekretaris Rahmad F Siregar dan Bendahara Gustan Pasaribu.

PNTI Asahan Siap Bantu Hapuskan Pukat Trawl TANJUNGBALAI (Waspada): DPD Persatuan Nelayan Tradisional Indonesia (PNTI) Asahan, siapmembantunelayantradisionalmenghapuskan keberadaan pukat trawl dari laut Asahan. “Masyarakatnelayansaatinikrisiskepercayaan terhadap organisasi yang ada. Oleh sebab itu, PNTI hadir memberi asa, membantu menyikapi permasalahan khususnya penghapusan pukat trawl yang sangat meresahkan,” kata Ketua PNTI Asahan Safri Sitorus, saat memberi sambutan usai pelantikan pengurus organisasi nelayan itu, di Desa Baganasahan Pekan, Kec. Tanjungbalai, Kab. Asahan, Selasa (18/9). Menurut Safri, keberadaan pukat trawl menjadimasalahutamayangdihadapinelayantradisional, karena selain menguras hasil laut, alat tangkap terlarang itu juga merusak terumbu karang tempat berkembang biak ikan. Akibatnya, banyak nelayan pulang tak membawa hasil bahkan merugi karena modal membeli minyak tak kembali. “Nelayan tradisional semakin menderita, kemiskinan menghantui, tidak ada yang peduli, mereka tak tau lagi mau kemana mengadukan nasib dan meminta pertolongan. Oleh sebab itu, PNTI siap menjadi garda terdepan membantu nelayan,”tegasSafri,didampingiSekretarisRahmad Fansur Siregar dan Bendahara Gustan Pasaribu. Hal itu dipertegas lagi oleh Ketua DPW PNTI

Sumut, Sangkot Sirait dengan mengatakan akan membela nelayan bukan saja masalah di laut tapi juga persoalan hukum. Saat ini, tambah Sangkot, PNTI mempunyai Lembaga Bantuan Hukum (LBH) khusus untuk mengadvokasi para nelayan. “Kita juga akan memberikan bimbingan dan panyuluhan hukum terutama di bidang perikanan dan laut agar nelayan tidak tersangkut dengan hukum,” imbuh Sangkot. Selain itu, PNTI juga menjadi fasilitator untuk menjembatani antara nelayan dengan pemerintah. Sehingga segala kebutuhan nelayan dapat diakomodir dan dicari jalan keluarnya. “Kita harus dekat dengan nelayan agar semua masalah mereka dapat kita tampung. Begitupula dengan pemerintah, jika kita memiliki akses baik dengan pemerintahan, maka kepentingan nelayan dapat diutamakan,” tegas Sangkot. DalamkesempatanituSangkotSiraitmelantik Ketua PNTI Asahan, Safri Sitorus, Sekretaris RahmadFSiregar,danBendaharaGustanPasaribu. Hadir Ketua DPD PNTI Kota Medan, Marasina Famli Simatupang, Kepala Dinas Perikanan dan Kelautan Pemkab Asahan, mewakili Danlanal TBA, Dandim 0208/AS, dan Kapolres Asahan. Acara pelantikan dirangkai dengan halal bi halal dan pemberian penali asih kepada 50 anak yatim dan kurang mampu. (a32)

Sumatera Utara

WASPADA Kamis 20 September 2012


Warga Terus Tolak Tambang Emas PT. AR Protes Limbah Dialirkan Ke Sungai Batangtoru P.SIDIMPUAN (Waspada): Akhir-akhir ini penolakan masyarakat terhadap keberadaan tambang emas PT. Agincourt Resources semakin terasa, khususnya oleh masyarakat Kec. Muara Batangtoru sekitarnya. “Berbagaikritikan dan unjukrasa terus berdatangan silih berganti dari berbagai unsur masyarakat,” kata Ketua Karang Taruna Tapsel, Mustaqim Hanafi, didampingi Sekretaris Syahrial Efendi DaulaydikantornyaJalanRajaInal Siregar, Batunadua, Kota Padangsidimpuan, Selasa (18/9). Menurut mereka, penolakan ini muncul karena warga merasa hanya menjadi bagian dari penerima dampak negatif akibat munculnya perusahaan tambang emas di daerah itu. Sehingga terdapat beberapa faktor yang

membuatwargaterdoronguntuk bertindak anarkis dan ku-rang menerima kehadiran PT AR. Faktor-faktor itu antara lain, lanjutnya, komunikasi dan sosialisasiyangminim,tidakmeluas, serta tidak efektif dari Humas PT. AR kepada warga Muara Batangtoru. Kemudian sangat minim kepedulian perusahaan kepada masyarakat,danjikapunadayang merasakan, jumlahnya sangat tidak sebanding. “Ini hasil investigasi kita langsung kepada masyarakat, dan kalau tidak percaya silakan tanya langsung,“ kata

Waspada/Sori Parlah Harahap

POLSEK Padangbolak tangkap bandar togel, dua juru tulis dan satu pemasang dengan menggunakan handphone sebagai alat transaksi penjualan togel via seluler.

Polsek Padangbolak Tangkap Bandar Togel GUNUNGTUA (Waspada) : Jajaran Kepolisian sektor Padangbolak dalam memberantas segala bentuk perjudian terutama jenis toto gelap (Togel) terus dibuktikan. Kali ini, mereka menggulung bandar peredaran judi Togel, dua juru tulis dan satu pemasang yang transaksi melalui via seluler (SMS). Mereka ditangkap dalam operasi razia rutin penyakit masyarakat dalam kurun waktu yang singkat dan lokasi terpisah. Tersangka bandar peredaran judi togel melalui pesan singkat tersebut adalah BD, 23, warga desa Gunungtua Jae, Kec. Padangbolak, sedangkan dua juru tulis J, 29, warga KUD Langkimat, Kec. Simangambat, dan S, 27, warga Batangpane 2, Kec. Padangbolak. Sedangkan pemasang HM, 41, warga KUD Langkimat, Kecamatan Simangambat. Dari keempat tersangka ini, polisi menyita barang bukti berupa handphone milik bandar BD, 23, warga Gunungtua Jae sebagai alat transaksi penjualan togel via SMS, uang tunai Rp408.000, satu buku tafsir mimpi, empat blok kupon, dan lima pulpen. Kapolsek Padangbolak AKP JW Sijabat kepada Waspada, Rabu, (19/9) di ruang kerjanya, membenarkan penangkapan tersebut. “Penangkapan terhadap keempat tersangka ini berkat laporan warga yang resah dengan maraknya judi togel,” ujar Kapolsek. Sebelumnya juga pihak kepolisian Padangbolak telah menangkap pelaku perjudian terutama jenis toto gelap (Togel) dan telah melimpahkannya ke kejaksaan. (a35)

Mustaqim. Selain itu faktor klasik juga turut mendukung munculnya penolakan tersebut. Seperti kesenjangan sosial dan kemiskinan, sertaadanyakepentinganoknum dan golongan tertentu dari kalangan masyarakat terhadap PT. AR. Dijelaskan,faktorpenguasaan aspek kearifan lokal dan sikap serta perilaku humas PT.AR yang kurang berterima di tengahtengah masyarakat, juga sangat memicuanarkismedanapatisme ini. Terlebih-lebih, warga Muara

Batangtoru belum melihat adanya itikad baik PT. AR untuk menjawabdenganbenaratastuntutan warga yang menolak rencana megalirkan air sisa uraian tambang ke Sungai Batangtoru. “Masyarakat menginginkan pembuangan air olahan tadi dialirkan ke laut. Sehingga tidak menimbulkan efek negatif terhadap konsumsi dan penggunaan air sungai oleh warga Muara Batangtoru. Memang untuk membuat aliran pipa sepanjang 25 Km dari gate ke pantai butuh dana besar dan memakan waktu.

Tapi ingat, PT.AR ini perusahaan besar dan masyarakat adalah manusia yang hak dan kewajibannya dilindungi negara,” kata Syahrial. Mereka menambahkan, kekecewaan warga berakumulasi dari gagalnya survey dan rencana awal pihak tambang yang akan membuat pelabuhan dan akses jalan ke Muara Upu. Kemudian ditambah lagi dengan commreal (humas) PT.AR yang gagal besar dan tidak mampu melaksanakan komunikasidansosialisasidengan masyarakat setempat. (a27)

Ketua MUI Madina:

Film Innocence of Muslims Sengaja Memancing Amarah Muslim PANYABUNGAN(Waspada): Ketua Majelis Ulama Indonesia (MUI) Kab. Mandailing Natal (Madina) H. Syamsir Batubara mengungkapkan, film Innocence of Muslims sengaja dibuat sejumlah oknum dan diyakini berupa provokasi untuk memancing amarah umat muslim. “Umat Islam harus menahan diri, sabar dan tidak melakukan hal-hal anarkis. Kemudian kita banyak berdoa agar agama Islam tetap selamat dari pelecehan itu,” ujar Syamsir Batubara ketika ditemui usai menghadiri kegiatan zikir dan doa bersama 639 calon jamaahhaji(calhaj)MadinadiMasjid Agung Nur Ala Nur Aek Godang Panyabungan, Senin (17/9). “Marilah kita perkuat per-

satuan dan kesatuan. Silaturahmi kita tingkatkan dan hal tersebut kita anggap sebagai ujian agar kita tetap dalam kesabaran,” katanya lagi Wakil Bupati Madina Dahlan Hasan Nasution ditemui di tempat sama mengaku sangat tidak menerima perlakuan seperti itu. “Maka melalui zikir dan doa yang digelar bersama, kita mendoakan kiranya orang yang membuat video pelecehan Islam itu dibukakan Allah pikirannya,” sebutnya. Melalui zikir dan doa, lanjutnya, merupakan cara paling baik, sehingga tidak perlu melakukan pertumpahan darah.“ Dengan memperbanyak zikir dan doa, agama Islam akan tetap bisa

selamat dari segela bentuk pelecehan. Mari kita bersatu dalam menjaga akidah kita,” sebutnya. Untuk itu, Dahlan mengimbau kepada seluruh umat muslim di Madina agar tetap memelihara ukhuwah Islamiyah dan menjalankan ajaran agama dengan baik serta turut serta mendoakan agar Allah SWT memberikan kesadaran bagi setiap hambanya yang melecehkan agama. “Madina adalah mayoritas Islam. Jadi dengan jumlah umat yangcukupbesarini,kitaberharap agar bisa meningkatkan ukhuwah Islamiyah serta mendoakan agar tidak ada lagi orang yang berbuat seperti itu di dunia ini,” tambahnya. (a28)

Terkait Penyegelan Ruangan

Sekwan DPRD Datangi Polres Madina PANYABUNGAN(Waspada): Terkait penyegalan terhadap ruangan pimpinan dan Sekwan DPRD Madina, Sekwan, Zulkarnaen Siregar, SH, Rabu (19/9) mendatangi Polres Madina guna membuat pengaduan. Namun, sampai di Polres Madina, sekwan tidak jadi membuat laporan pengaduan karena ,menurut Kapolres Madina, AKBP.Fauzi Dalimunthe melalui Wakapolres Kompol Rinaldo, SH, yang seharusnya membuat laporan pengaduan itu berdasarkan tatib DPRD adalah melalui Badan Kehormatan Dewan (BKD), yang punya hak terlebih dahulu me-

nangani terkait permasalahan anggota dewan. “Karena masalah ini di internal dewan dan kejadiannya berlangsung di kantor dewan, maka yang harus menangani lebih dahulu adalah BKD. Jika BKD tidak mampu baru diteruskan ke pihak Polres,” ucap Zulkarnaen Siregar. Wakapolres Madina Kompol.Rinaldo yang dikonfirmasi di ruang kerjanya menjelaskan, pihaknya sama sekali bukan tidak mau menerima pengaduan sekwan DPRD Madina. Polres Madina katanya hanya menaati dan bekerja sesuai prosedur per-

undang-udangan. “Sayasudahbacadanpelajari tatib DPRD c/q fungsi BKD yang punya domain terlebih dahulu menyangkut tindakan persoalan moral dan hukum di internal DPRD.MakanyakitasarankanBKD yangmenanganimasalahitulebih dahulu,” ucap Wakapolres. Di jelaskannya, menyangkut segel di pintu ruangan pimpinan dan Sekwan DPRD Madina, sebenarnya bisa saja dicopot atau dibuka karena tidak menyangkut aspekpidana.Tetapikalausegeloleh pihak polisi maupun pengadilan yang dibuka masyarakat, itu bisa di kenakan pidana. (c14)

Pratugas Pengamanan Perbatasan RI-Malaysia Di Yonif 123 Rajawali

Waspada/Micky Maliki

TERSANGKA RL alias Ateng bersama barang bukti satu batang daun ganja, diapit petugas Tim Khusus di ruangan Narkoba Polres Tanah Karo.

Tanam Ganja, Residivis Ditangkap KABANJAHE (Waspada): Seorang residivis diduga pemilik satu batang ganja diamankan petugas Tim Khusus Narkoba Polres Tanah KarodipimpinAipdaMardingatManihuruk,SHdisebuahperladangan Desa Gunung Mulia, Kec. Merek, Kab. Karo, Rabu (19/9). Penangkapan tersangka RL alias Ateng, 31, warga Simpang Dokan, Kec. Merek, bermula dari laporan masyarakat yang mengatakan di salahsatuperladanganwargamelihatsebuahpohonyangmencurigakan. Laporanwargatersebutsegeraditindaklanjutipetugas,denganmelakukan penyisiran di sekitar perladangan Desa Gunung Mulia. Setelah beberapa lama melakukan penyisiran akhirnya petugas menemukan sebuah tanaman ganja berdiri tegak berumur sekira lima bulan. Petugas kemudian meringkus tersangka RL alias Ateng. Di hadapan petugas, tersangka mengakui tanaman ganja yang berada di sekitar perladangan Desa Gunung Mulia benar miliknya. Informasi diperoleh Waspada, tersangka RL alias Ateng pernah menjalani hukuman tiga tahun dalam kasus sama pada 2004. Kapolres Tanah Karo AKBP Marcelino Sampouw, SH, Sik, MT didampingiKasatNarkobaAKPAzharDalimunte,SHkepada Waspada, membenarkan telah mengamankan seorang tersangka yang diketahui sebagai pemilik tanaman ganja. Tersangka bersama barang bukti kini sudah diamankan guna pemerikssaan lebih lanjut. (c10)

P. SIDIMPUAN (Waspada): Panglima Komando Daerah Militer (Pangdam) I Bukit Barisan (BB) menggelar upacara penutupanlatihanpratugaspengamanan perbatasan (Pamtas) RI-Malaysia dariYonif 123 Rajawali di Kota Padangsidimpuan, Selasa (18/9). Pangdam I/BB, Mayor Jenderal TNI Lodewijk F Paulus melalui Inspektur Upacara (Irup) Irdam I/BB, Kolonel Czi Adi Sudariyanto Sip membacakan amanat Pangdam I/BB di acara tersebut dihadiri Danrem 023 Kawal Samudera (KS), Asisten Pengawas Latihan dari Mabes TNI-AD, Muspida Kabupaten Tapanuli Selatan (Tapsel). Dari Mabes TNI-AD itu Letkol Inf Agustinus, Letkol Inf I Ketut Netan, Danyonif 123 RW Mayor Inf David M Hasibuan, Danrem023KSKolonelInfAndika Perkasa, Dandim 0212 Tapsel Letkol Inf Edi Hartono, Danrindam I/BB Kolonel Inf Teguh Arief Indiatmoko, WaAsop Kasdam Letkol Inf Yusman Madayan, WakahubDam Letkol Chb Kornel Basirun Siahaan, Kaden C Brimob Poldasu AKBP Antoni

Surbakti SH, Kapolres Kota Padangsidimpuan AKBP Andi S Taufik, Bupati Tapsel H Syahrul M Pasaribu beserta wakil, H Aldinz Rapolo Siregar. SedangkanamanatPangdam I/BB itu menegaskan agar latihan pratugas satuan tugas (Satgas) pengamanan perbatasan RIMalaysia dari Bataliyon Infanteri (Yonif) 123 Rajawali (RW) agar kondisi prajurit selalu sehat wal afiat menjaga perbatasan RIMalaysiasertadapatmenerapkan tugas operasi. “Latihan pratugas yang baru kalian laksanakan merupakan kegiatan satuan tugas operasi, tujuannya untuk membekali satuan agar memiliki taktik dan teknikbertempur.Selainituteknik intelijen terbatas, kemampuan binateritorialsertamampumemberikan pelayanan dukungan administrasi sesuai tuntutan tugas,” ujar Kolonel Adi dari Kodam I/BB itu. Selain itu Kolonel Adi mengajak para prajuritYonif 123 Rajawali agar lebih hati-hati menjalankan tugas di perbatasan RI-Malaysia di Kalimatan Barat

Oktober mendatang. “Kondisi di wilayah perbatasan RI-Malaysia sampai saat ini masih rentan terhadap gangguan keamanan. Sebagai prajurit, kalian harus memiliki kewaspadaan tinggi, tumbuhkan naluri intelijen padadirimasing-masing,junjung teguhSaptaMarga,SumpahPrajurit, DelapanWajibTNIdalamaplikasi penugasan serta jaga nama baik bangsa dan korpsTNI,” tegasnya. Usai upacara tersebut, Buptai Tapsel menyerahkan anak kunci untuk dua unit rumah dinas yang baru didirikan beberapa waktu lalu dari bantuan hibah Pemkab Tapsel ke TNI Yonif 123 Rajawali diterima Danrem 023 KS di hadapan ratusan perwira dari pangkat Tamtama, Bintara, Perwira, para rombongan dari Kodam I/BB, Mabes dan Yonif 123 RW. Sebelumnya650prajuritmenggelarpersiapandanlatihanpratugas di dua kabupaten yaitu di Kab. Padanglawas Utara dan Tapsel belumlamaini.Diduakabupaten ituparaprajuritmenggelarberbagai kegiatan bakti sosial, pengobatan gratis bagi warga miskin dan aksiaksi sosial lainnya. (c13)

Perambahan Hutan Di Dairi Di Luar Hutan Konservasi SIDIKALANG (Waspada): Perambahan hutan yang selama ini terjadi tidak masuk di kawasan Konservasi Sicike cike, yang terjadi itu sudah masuk di kawasan Register Adian Tinjaoan Register 67. “JadidikawasanHutanKonservasiSicikeciketidakadaperambahan hutan, karena untuk mengawasi kawasan tersebut ada dua orang petugas di Kantor Resort PSDA di Desa Pancur Nauli yang selalu mengawasi TWA di sana,” ujar Kepala Seksi Konservasi Pengamanan Sumber Daya Alam (PSDA) Dairi. Simbolon di Kantor Bupati Dairi kepada Waspada, Selasa (18/9). Dengan tegas dia membantah perambahan hutan yang terjadi dikawasan Taman Wisata Alam (TWA) Konservasi Sicike-cike. “Berdasarkan Kemenhut.No.78/KPTS.2/1989. Seluas 575 Ha, Hutan Konservasi Sicike-cike merupakan Taman Wisata Alam, di dalamnya terdapat satu danau di wilayah Kabupaten Dairi dan dua berada di wilayah Kabupaten Pakpak Bharat,” ujar Simbolon. Padahal, maraknya perambahan hutan di sekitar Sicike cike pada waktu lalu, dikonfirmasi kepada Dinas Kehutanan Dairi, Ir. Agus Bukka mengatakan bahwa, untuk pengawasan hutan di Sicike cike bukanlah dalam pengawasan Dinas Kehutanan Dairi melainkan tanggungjawab Pengawasan Sumber Daya Alam (PSDA) Dairi. (ckm)

Waspada/Ahmad Cerem Meha

PASUKAN Bataliyon infanteri (Yonif) 123 Rajawali yang akan diberangkatkan ke perbatasan RI-Malaysia tepatnya ke Kalimantan Barat Oktober mendatang serius mendengarkan arahan dari Irup Irdam I/BB, Kol Czi Adi Sudariyanto Sip di Lapangan Mako Yonif 123 RW, Padangsidimpuan.

Waspada/Alpin Lubis

BRONJONG baru selesai sekira tiga minggu di Desa Hutadangka, Kec.Kotanopan Kab. Mandailing Natal, ambruk ke Sungai Batanggadis.

Baru Dibangun, Bronjong Di Hutadangka Ambruk PANYABUNGAN (Waspada): Bronjong yang barudibangununtukpenahanjalanLintasSumatera (Jalinsum) Panyabungan-Muarasipongi, tepatnya di Desa Hutadangka, Kec. Kotanopan, Kab. Mandailing Natal (Madina), ambruk. Bronjong 20 meter lebih itu semuanya sudah runtuh ke Sungai Batanggadis. Informasi dihimpun Waspada, Rabu (19/ 9), bronjong ini siap sekira dua minggu menjelang Idul Fitri 1433 H. Namun, seminggu pasca Idul Fitri, bronjong ini sudah runtuh dan sampai saat ini material bronjong yang jatuh masih tetap dibiarkan di Sungai Batanggadis tanpa ada upaya perbaikan dari pihak pemborong. Runtuhnya bronjong ini cukup disesalkan berbagaipihak,salahsatunyadariwargasetempat, Harun Al Rasyid Nasution,40. “Kitacukupmenyesalkanruntuhnyabronjong tersebut. Betapa tidak, baru berusia tiga minggu namun semuanya sudah hancur. Besar dugaan, penyebab runtuhnya bangunan bronjong ini karena kualitas pembuatan bronjong yang asal jadi. Lebih parahnya lagi, sampai saat ini belum ada niat para pemborong untuk memperbaikinya,” katanya. Ditambahkan, selama pembangunan bronjong ini berlangsung tidak ada plang merk di jumpai lokasi. Masyarakat tidak tahu berapa jumlah anggaran proyek ini dan dananya dari

mana, begitu juga pemborong yang mengerjakannya.“Jadi proyek ini tidakubahnya seperti‘siluman’ yang tidak jelas keberadaannya. Begitu juga saat bronjong ini jatuh, masyarakat tidak tahu siapa yang harus bertanggungjawab,” ujarnya. Padahal,keberadaanbronjonginisangaturgen untuk menopang agar Jalinsum di daerah ini tidak longsor. Selama ini, kawasan ini terkenal dengan rawan longsor, apalagi saat musim penghujan.Pernahbeberapabulanlalu,dikawasan ini macet sampai beberapa kilometer akibat longsor. Jadi apa yang dilakukan pemerintah untuk membangunbronjongdikawasaninisangattepat, tapisayangkeinginanitusepertinyabelumterwujud karena bronjong yang baru dibangun sudah ambruk. “Kita sangat berharap kepada dinas terkait segeramemanggil pihakpemborongagarbronjong yang jatuh ini diperbaiki kembali. Sebab, tanpa hal itu kawasan ini rawan longsor, lagipula kalau tidak diperbaiki uang negara akan sia-sia. Aparat terkait juga harus lebih mengawasai pembangunan bronjong ini, karena diduga penyebab jatuhnyabangunaninikarenapengawasaninstansi terkait juga lemah,” kata dia. KepalaUPTBalaiJembatanNasionalXWilayah II yang di jumpai di kantornya untuk diminta keterangan terkait ambruknya bronjong sedang tidak berada di tempat. (c15)

Jalan Di Simalungun Kupak-kapik, Anggaran Pemeliharaan Miliaran SIMALUNGUN(Waspada):Buruknyakondisi jalan di berbagai kecamatan di Kab. Simalungun telah lama dikeluhkan masyarakat.Tidak sedikit jalan kupak-kapik, bahkan sepeti kubangan kerbau. Kondisi ini dijadikan sejumlah kalangan sebagai barometer dan penilaian terhadap kinerja Kadis Bina Marga Simalungun. Masyarakat mempertanyakan alokasi anggaran pemeliharaan jalan. Pasalnya, biaya pemeliharaan jalan setiap tahunnya ditampung dalam APBD miliaran rupiah. Kinerja Dinas Bina Marga Simalungun dituding lemah dan terkesan kurang serius untuk mengupayakan perbaikan jalan kabupaten dan jalan antar nagori (desa). “Jalan merupakan sarana vital sebagai akses berputarnya perekonomian masyarakat. Jangan harap ekonomi masyarakat akan meningkat jika sistem transportasi tidak lancar,” kata Mulai Adil Saragih, Sekretaris Eksekutif Simalungun CoruptionWatch SiantarSimalungun, kepada Waspada, Selasa (18/9). Menurut Saragih, buruknya kondisi jalan hampir di 31 kecamatan yang ada di Kab. Simalunguntelahmenimbulkankerugiandipihak masyarakat. Akibat parahnya badan jalan membuat harga hasil pertanian rakyat anjlok hingga ke tingkat harga terendah. Ironisnya, lanjut aktivis yang dikenal cukup vokal ini, meskipun sudah banyak ruas jalan yang rusak, pihak instansi terkait tidak memberikan perhatian serius. Buktinya, banyak jalan yang

sudah mengalami kerusakan parah bertahuntahunnamunbelummendapatperbaikan.Apakah memang dana anggaran perbaikannya tidak dialokasikan,ataumemangsengajatidakdikerjakan. “Aneh, betul-betul aneh.Setiap tahun ada dana pemeliharaan rutin yang jumlahnya mencapai puluhan milir rupiah setiap tahun ditampung dalam APBD.Tetapi kok masih banyak ruas jalan kabupaten seperti kubangan kerbau,” ujar Adil dengan nada heran, seraya menambahkan akan melaporkan dugaan penyimpangan penggunaan anggaran pemeliharaan jalan kabupaten jika seluruh data yang dibutuhkan telah lengkap, karena diyakini hampir setiap tahun anggaran pemeliharaan jalan tidak dimanfaatkan maksimal oleh Dinas Bina Marga. Kepala Dinas Bina Marga Simalungun, Jhon Sabiden Purba, saat dikonfirmasi wartawan membantah jika pihaknya tidak maksimal memanfaatkan anggaran pemeliharaan jalan. “Anggaranpemeliharaanjalansetiaptahunnya jauh dari kebutuhan, dan tahun ini tidak sampai Rp20 miliar, padahal kerusakan jalan penanganannyatidaklagidapatdilakukanmelaluipemeliharaan atau perbaikan sementara karena sudah rusak parah,sehingga harus dilakukan perbaikan total,”ujarPurbaserayamenambahkankerusakan jalan yang sudah lebih dua tahun tidak lagi dapat dilakukan melalui pemeliharaan, namun harus ditanganidenganpeningkatanjalanyangmembutuhkan alokasi anggaran yang besar. (a29)

DPRD Minta Pemkab Tobasa

Serahkan Masalah Listrik 2 MW Ke Ranah Hukum BALIGE (Waspada): Rapat Paripurna Khusus DPRDToba Samosir (Tobasa) memutuskan agar Pemkab Tobasa menyerahkan masalah selisih pembayaran listrik 2 MW dari PT Inalum berdasarkan Master Aggrement, ditangani secara hukum jika PT PLN Persero tidak merealisasikan pembayaran kepada masyarakat Porsea dan Balige. Karena, sesuai dengan penelusuran yang dilakukan Panitia Khusus (Pansus) DPRDTobasa yang bekerja selama kurang lebih 1,5 tahun ini, semua pihak baik PT Inalum yang memberikan kuasa kepada Otorita Asahan dan pihak-pihak terkait lainnya, mengakui adanya selisih harga dimaksuduntukselanjutnyakdibayarkankepada Pemkab Toba Samosir. Pada Laporan Pansus 2 MW yang disampaikan Sekretaris Pansus DPRDTobasa Jojor Marintan Napitupulu pada parat paripurna khusus yang dipimpin Ketua DPRD Tobasa Sahat PanjaitansertadihadiriBupatiTobasaPandapotan Kasmin Simanjuntak, Wabup Liberty Pasaribu SH MSi, Ketua PN Balige Agus Widodo SH serta unsur Muspida, Selasa (18/9), meminta PT Inalum dan PT PLN memenuhi hak-hak rakyat khususnya dalam rangka pengembalian selisih harga jual tenaga listrik dari PT Inalum dengan harga pembelian PT PLN Persero untuk masyarakat Porsea dan Balige sesuai hasil perhitungan yang disepakati. “Rp10.391.130.171 diakumulasikan perhitungan tahun 1982 sampai 2010. Untuk 3 tahun terakhir (2011,2012,2013) agar dilakukan perhitungan dan PemkabTobasa untuk menagih

kelebihan pembayaran dari PT PLN,” kata Jojor Napitupulu. Sesuai rekomendasi pada pertemuan 6 September 2012, Pansus DPRD Tobasa bersama Bupati Tobasa menuntut realisasi pembayaran selisih harga jual tenaga listrik 2 MW dengan harga pembelian dari PT Inalum sesuai perhitungan PT PLN selambat-lambatnya pada Kamis (13/9). Namun hingga Rapat Paripurna khusus ini digelar DPRD, PT PLN belum juga merealisasikannya. Dalam perjalanan Pansus DPRD Tobasa, ada 3 perhitungan tentang selisih harga jual 2 MW sesuai dengan Master Aggrement saat pendirian PLTA PT Inalum. Salah satunya sesuai dengan pehitunganyangdilakukanPansusbersama-sama dengan Pemkab Tobasa, selisih harga tersebut sebesar Rp157.395.948.000. Perhitungan yang dilakukan oleh tim kajian teknis yang difasilitasi Otorita Asahan, ada 2 opsi selisih harga jual PT PLN dengan harga khusus PT Inalum yang dilakukan Lembaga Penelitian USUyakniRp15.089.897.135(Dampakpenghentian tahun 1989 dan periode Juni 2003-November 2008. Dan Opsi kedua Rp21.884.827.383 dengan memasukkan perhitungan selish harga walau ada penghentian. Direktorat Jenderal Ketenagalistrikan Kementerian ESDM, nilai selisih harga jual Rp10.391.130.171yangmerupakantotalpemakaian KWH yang dihitung dari harga khusus penjualan listrik 2 MW pada 1982-2010 tanpa pembelian kwh dari tahun 2004-2008 karena trafo MVA milik PT Inalum tidak berfungsi. (a22)

B4 1 CM 2 CM

Rp. 12.000 Rp. 24.000

WASPADA 3 CM Rp. 36.000 4 CM Rp. 48.000


AUTOMOTIVE Informasi Pembaca

Bursa Automotive

A C : Air Condition BR : Ban Radial CL : Central Lock ND : Nippon Denso DB : Double Blower

P S : Power Stearing PW : Power Window RT : Radio Tape VR : Velg Racing EW : Electric Window


Ready Stock Potongan Khusus Terios DP 30 Jt-an. Xenia DP 20 Jt-an Pick Up DP 11 Jt-an. Jamin OK. Data dijemput. Hub. PAIREN 0812 6305 0708


- All New Xenia DP 20 Jt-an..... Angs. 3Jt-an - Pick Up Gran Max DP 10 Jt-an..Angs.2Jt-an Hub. TEDDY Capella 0812 6325 656 / 77884663 DAIHATSU Xenia 10 VVT-i Hitam Model Avanza Semua Th. 2006. Mulus, orisinil, siap pakai, VR, BR, PS, PW, CL RMT, E. Miror, AC Dingin, Hrg. 100Jt. Nego. Abis. Hub. 0813 7025 7908 DAIHATSU BARU CASH-CREDIT-TUKAR TAMBAH. DP MULAI 15% KREDIT 5thn. Ready Stock, Proses cepat, ful diskon. HUB ANDIKA 0852 7074 7744 PROMO DAIHATSU BARU XENIA DP MULAI 20 Jt-An, Terios DP Mulai 30 Jt-an. Pick - Up DP Mulai 11 Jt-an Hub: HASIBUAN ASTRA 0812 6362 4634


Xenia DP 18 Jt-an Angs. 3 Jt-an Terios DP 30 Jt-an Angs. 4 Jt-an PU DP 9 Jt-an Angs. 2 Jt-an Dapatkan Daihatsu NPC 90 Jt-an !!! Hub. ASTRA MULIA 0812 6359 5744 DAIHATSU 2012 Xenia X 22.490.000/4.330.000MT bln Terios TS Extra 22.295.000/5.070.000 x 47 bln Sirion D 19.506.000 / 4.301.000 x 47 bln Luxio D 27.762.000 / 3.800.000 x 47 bln Pick Up 1.3 12.000.000 / 2.434.000 x 48 bln Proses Terpercaya : Tarihoran 0813.18 999 612

DA I H AT S U Te r i o s T X Wr n . Hitam. Thn. 2009. Harga Nego. Hub. 0813 7074 9554 DAIHATSU Xenia Th. 2005 1.3 cc. W. Coklat muda met, Siap pakai. Mulus. Hrg. 106Jt. Hub. 0852 7650 6242

MOBIL 100% BARU XENIA Pick Up, Luxio, G. Max, DP 15%. 0813 6033 3609 / 0852 7085 9366 HYUNDAI Getz Thn. 2005. W. Kuning mulus, lengkap. Hub. 0852 9663 2368 KIA Carens II ‘06 / Hitam, BK Mdn, Tape, terlengkap (limited) pajak panj. Ban Baru, mulus & terawat, siap pakai. Jual Cepat. Hrg. 95 Jt/Nego. Hub. 0852 2070 2428 MERCY E230 Abu2 met a/n. Sendiri Ex Dokter Th. 91. Sgt orisinil, mewah, mesin sehat, AC Dingin, Mobil simpanan. Hrg. 53Jt. Nego. Hub. 0823 6635 9858

MAZDA MR. Thn. 90. AC, Tape, W. Putih, kondisi mulus, orisinil. Hrg. 17,5Jt (Nego). Hub. 0853 7177 8166 MITSUBISHI Kuda GLS Thn. 2000 Dijual. BK Medan, mobil cantik, T. Pertama. Msh orisinil. Harga 78 Nego. Hub. 0812 639 3235


Pajero, L300 PU, Colt Diesel, Mirage Hub: PM. SIMARMATA. 08126 558 178 SUZUKI Carry 1000cc. Karoseri Terbaik Gajah Mada Thn. 86. W. Biru pjk baru, Tape, VR, BR, Mobil simpanan, original. Km. 30. 800. Mobil sangat mulus. BU. Hub. HP. 0821 6177 6086 Mdn. SUZUKI Baleno Th. 2004. 1.600cc. BK Medan W. Hitam met. Cat dan mesin mulus, siap pakai. Hrg. 113Jt HP. 0821 6021 0957

5 CM 6 CM

Rp. 65.000 Rp. 78.000

SUZUKI Carry Futura 1.3 Dijual. Minibus BK Medan Thn. 92. AC DB, BS, T. Tambah. Hub. 0812 8621 4177


Ertiga, APV Arena, Carry Pick Up LIWAN: 0852 6111 7724

7 CM 8 CM

Rp. 91.000 Rp. 104.000


Jaminan apa saja Sertifikat Tanah mobil & Sp. Motor. Segala tahun. Hub. 061-8222774 HP. 0853 6199 1500


BUTUH DANA CEPAT Syarat BPKB dan Surat Tanah. Hub. 0813 7059 0264

OPEL BLAZER Lt. Injection Biru gelap Met Th. 2002. Mulus luar dalam, mesin sehat, AC Dingin, Hrg. 60Jt. Sudah terima BBN Nama pembeli langsung, siap pakai. Hub. 0812 6063 7823.



TOYOTA Kijang Capsul Model LGX New Bensin 1,8 Th. 2003. Mulus luar dalam, VR, BR, PS, PW, CL RMT, E. Miror, AC DB, Full sound pake TV. Hrg. 127Jt. Nego. Hub. 0823 6261 5557

TOYOTA Fortuner 2,5 G dijual. Bahan Bakar Solar, Thn. 2009. Pemakaian 2010. Warna silver metalik, tangan pertama, Plat BK, Pajak Juni 2013, kondisi mulus, harga Rp. 330Jt Nego. Hub. 0811 787 492, 061.6630500


Avanza, Innova, Fortuner PURBA: 0813 9736 0333

TOYOTA Kijang LGX Diesel ‘2001. Hijau met, CD Player, BPKB 1 nama. Mobil terawat/siap pakai. Utk Perjalanan jauh. Hrg. 126Jt/Nego. Hub. 0853 7062 7070

TOYOTA Starlet Capsul Jumbo Thn. 96 W. merah maron, BK Medan, mobil cantik. 65Jt/Nego. Hub. 0813 6150 8497 TOYOTA Kijang LX 1.8 Bensin. Thn. 2004. Silver, AC, VR, PS, CL, Jok kulit, Plat BM. Rp. 99 Jt. Hub. 0852 7538 3218 TOYOTA Kijang LSX EFI ‘2000 Double Blower, P. Window, Audio luar dalam, orisinil/siap pakai. Hrg. 98Jt/Nego. Hub. 0812 6003 1100 TOYOTA Yaris Type S. M/T. Thn. 2011/2010. Silver met (Over Kredit). Balik DP. 117Jt (Nego). Sisa Angs: 2,9Jt x 26 Bln. Ass All Risk 26 Bln lagi. Beli dari baru - terawat. Hub. 0811 635 367 - 77756757 Jl. SM. Raja

TOYOTA Innova Type G. Wrn Light Green Thn. 2005. Hrg. Rp. 145Jt. Hub. 0812 6032 3982 TOYOTA Kijang Kapsul LGX Th. ’99 Solr. BK Tebing. Minibus. W. Coklat muda met. Hrg. 106Jt. Siap pakai. HP. 0811 652 506 # TOYOTA BARU READY STOCK #

Avanza, Innova, Rush, Fortuner, Hilux DC, Dyna, Yaris, Altis. Proses Cepat, Terima Tukar Tambah Dapatkan Bonus Tambahan Hub. Tomi 0813 7043 7766

OVER KREDIT Toyota Fortuner 2,7 G A/T Thn. 2008. Warna hitam metalik, BK pilihan asli, mulus & terawat. DP 85Jt/nego. Peminat serius Hub. 0811 604 897 TOYOTA Vios Th. 03. Type G, Warna biru metalik, mobil cantik, 1 tangan dari baru Rp. 105Jt. Manual. Hub. Komplek Villa Gading Mas E.15. 0813 7687 7810 TOYOTA Kijang Innova G, solar Th. ‘08. Wrn Hitam, manual, AC DB, Komplit, 1 tgn dari Baru, Rp. 197Jt. Depan Sekolah Eria no. 200. 0812 6038 5555 / 785 1402



L.300 PU/ Box 2010 FE 74, 6 Ban/ Dyna Box 2011 Panther PU 2011 Khusus Perusahaan (Coorporate) Hubungi: ROLAND HUTAPEA HP: 0812 608 0089


Isuzu D-Max DC 2010 Isuzu D-Max SC 2010 Ford Ranger Base DC 2010 Toyota Hilux DC 2010 Khusus Perusahaan (Coorporate) Hubungi: ILHAMSYAH HARAHAP HP: 0812 650 8294


1 Buah BPKB Asli. BK 2848 AU. A/n. JURNIATI. Yamaha Scorpio 5 BP-Z. Tahun 2009. Tercecer di Daerah Medan dan sekitarnya.

TERCECER / HILANG 1 STNK BK 1974 CF. A/n. KOPERASI SERBA USAHA JAYA. Jl. Limau Manis No. 6. Kec. Tg. Morawa - Deli Serdang dan Speksi. Ya n g m e n e m u k a n m h n d i a n t a r kepada Berthon Tambunan. Asrama TNI AD Glugur Hong Medan.


Satu BPKB A/n. HAFRIJAL PULUNGAN Jl. Bromo No. 5 Medan. BK 1654 JH Merk Daihatsu Minibus Thn. 2008


Satu BPKB E No. 4375936 B. a/n. Harun Al Rasyid H. Mobil KIA. K270 B. Tahun 2007. BK 7669 DN. Warna hitam. Hub. 0813 7045 7424

TERCECER Satu BPKB a/n. Rudi Irawan 8552860 Merk Suzuki Side Kick Thn. 1999. BK 1891 FB. Hub. 0813 70 457 424


Telah hilang dan tercecer surat-surat atas 2 bidang tanah atas nama SECH UMAR BAIT 1. Bidang Tanah yang berukuran 13x44m = Seluas 572m² (Lima ratus tujuh puluh dua meter persegi) m² 2. Bidang Tanah seluas ± 2343m² (Dua ribu empat ratus meter persegi) yang terletak di Jl. Kantil Dusun II Desa Medan Estate Kecamatan Percut Sei Tuan Kabupaten Deli Serdang Yang terletak di Dusun II Desa Medan Estate Kecamatan Percut Sei Tuan berdasarkan Surat Ganti Rugi Tanah tertanggal 23 September 1.959 dan surat ganti rugi tertanggal 11 Djuli 1958, yang diketahui oleh Kepala kampung Medan Estate Kabupaten Deli Serdang yang terdaftar di KRPT pada tanggal 16-5-1956, yang diperkirakan hilang dan tercecer sejak tahun 1983 disekitar rumah/ tempat tinggal dan atau tempat pengajian di Jalan Kantil Dusun II Desa Medan Estate Kecamatan Percut Sei Tuan Kabupaten Deli Serdang

9 CM Rp. 126.000 10 CM Rp. 140.000 TERCECER 1 Buah Surat Asli Jual Beli Tanah / Rumah yang berada. Di Jalan Ngalengko No. 25 D. Kel. Sidorame Barat, Kec. Medan Timur. Tahun 1979 Dari Sdr. Sukidjan Kepada Sdr. Wayat TERCECER

STUK BK 9198 CK. No. Uji : AB 01010456. A/n. BAHARUDIN. Alamat Jl. Pintu Air Gg. Keluarga Kuala Bekala Mdn. Mobil Mitsubishi.


1 (Satu) Bh. Tas berwarna hitam. Berisi BPKB dan Surat2 penting lainnya. Tercecer disekitar kompleks Setia Budi. Bagi yang menemukannya mohon hub. HP. 081 2602 9760 Sendi. Tidak akan dituntut dan diberi hadiah sepantasnya.


11 CM Rp. 165.000 12 CM Rp. 180.000

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000



Servis AC, Kulkas, Mesin Cuci. Perawatan, Cuci AC, B. Pasang, Instalasi. Hub. 061.7676 4660 : 0812 6557 521



Kompor Gas, Dispenser H & C TV, M. Pompa Air Sanyo Hub.


Telp.66482216 - 0813 7589 8757 Siap Ketempat




BERGARANSI HP. 0853 5827 1171



Power QSC 1 PW. 850 Beta 3 2000W (2,5) 660 W (1.8) 1.600 (3.2) Sound Standard 2000W (3.0) 3600 (4.5) 2000 W (4.0) BMB Data 1, 2, 11, 21, 55 Hitam. Spk BMB 10, 12, Terima Visa 0%. Jl. Indragiri 25 Dkt. Asia 061-734 5487






- BUNGA TABUNGAN= 8%/Pa - BUNGA DEPOSITO = 8%/Pa - BUNGA DEPOSITO KHUSUS *) 1 Bln = 9% 6 Bln = 11% 3 Bln = 10% 12 BLn = 12%

Telp. (061) 844 6489, 882 6936, 847 5544, 795 4444, 736 8754, (0622) 430 780, (0623) 348 322, (0624) 573 7456 * Syarat dan ketentuan berlaku TABUNGAN DAN DEPOSITO ANDA AMAN SERTA DIJAMIN OLEH PEMERINTAH/ LEMBAGA PENJAMIN SIMPANAN (LPS) WWW.LPS.GO.ID







0813 6147 0812

Jl. Gatot Subroto Medan Ada Garansi


HP. 8219951

Kamis, 20 September 2012


Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput

DIBUTUHKAN LOWONGAN KERJA Berpengalaman atau belum

Tukang Las Pintu Tukang Potong Pelat Tukang Tekuk Pelat Tukang Press Hidrolik Lamaran ditukukan kepada


Jln. Gatot Subroto No. 329 Seberang Jln. PWS - Medan

Dibutuhkan Guru Bimbingan Belajar (Tentor) untuk mata pelajaran: - MATEMATIKA - BAHASA INDONESIA - BAHASA INGGRIS Untuk Persiapan Ujian Nasional Waktu Belajar jam 15.00-18.00 WIB Persyaratan: 1. Berpengalaman dalam bimbingan belajar 2. Penampilan menarik, energik dan mampu memotivasi siswa untuk belajar 3. Bersedia di kontrak Oktober s.d Maret 2012 Lamaran diantar langsung ke:

SMK TELKOM SANDHY PUTRA MEDAN Jl. Jamin Ginting Km. 11,1 No. 9C Medan (Ruang Waka Kurikulum) Diterima selambat-lambatnya pada tanggal 22 September 2012



HP: 0812 606 2660 0812 6968 1118

Ada Garansi


HP. 0813 7035 7291 Ada Garansi








Dijual: MIXER Mackie 56 Ch, 32 Ch, Yamaha GA 32, POWER CS 800 (ori), Yamaha, Crest Audio, V. Altec, Qanon, SPEAKER SUB Cervin Vega, RCF 2x18, Peavey, Tasso, DRUM Tama, Sonor, Mapex, AMPLI Bass TNT peavey, H+C Laney (Inggris), H+C GK, Ampli Gitar Fender, Marshal JCM 900, AMPLI keyboard KB 100, KB 5, Peavey, Laney, KEYBOARD RD700. Lighting, dll. Menyewakan Sound System partai besar / kecil dan menerima service keyboard, power, mixer, ll. Hub. 0811 613 0971, 0819 863247 Jl. Sei Mencirim No. 167 Medan.




TANAH Dijual 1. di Jl. Karya Jaya 10x40m, Pangk. Mashyur, SHM, 2. di Jl. Sofyan Zakaria Tebing Tinggi Indah, 20x20m, SHM, Pagar keliling Hub. 0812 6350 4583 - 0858 3015 4908 - (061) 7505 8104


Keterangan lebih lengkap silahkan hubungi:

DI TJ. ANOM LUAS 1,2 HA Harga 70 Rb/m Nego Hub. 0852 9619 4310

T ELPON : 061 - 4576602 F AX : 061 - 4561347

* Format: JPG - TIFF (Photoshop) BURSA



LT. 35x20,65/18,55 RUMAH 2 BUAH PERMANEN 1. 11,5x6,10m 2. 19,20x9,75m Pagar tembok/ besi keliling Jl. Mangaan IV Pasar II Mabar Lor. Rahayu Kec. Medan Deli, Harga nego

Informasi Pembaca Bursa Property

G R : Garasi LB : Luas Bangunan KM : Kamar Mandi LT : Luas Tanah KP : Kamar Pembantu RM : Ruang Makan KT : Kamar Tidur RT : Ruang Tamu SHM: Sertifikat Hak Milik

Hub: Rika: 0821 6433 3977 Handoko: 0812 6023 497


Comp. P. Baris Permai 15 Sunggal, 3 KT, 2 KM, Garasi 2 mbl, Gudang + Perabot, LT. 8x21m), LB. 8x16m, SHM, Siap huni (Terawat) Hub. 0811 604 002


Rmh 3 KT, 2 KM, LB. 93m², LT. 8x17,5, AC, Kit. set, Hrg Rp. 450 Jt/nego Lokasi Komplek Lyzzia Garden 2 Kav. 21, Jl. Bakti - Gaperta Ujung - Helvetia, Sertifikat Hub. 0818 821 156/ 7764 5885


LT. 295m², LB. 170m², SHM, 4 KT, RT, RM, R. Sholat, 2 KM, GR, PAM, PLN, Lt. keramik, Skllg pagar B. bata/ besi di Jl. Amaliun Gg. Amal Bakti No. 7 Medan Telp. (061) 736 1092 HP. 0821 6367 0222


PERUMAHAN SETIA JADI JL. BENTENG HILIR UJUNG BANDAR SETIA Type 45 (Luas Tanah 6x16m) Kopel Harga Rp. 160.000.000 Peminat hub: DEBBY: 0812 640 5162 HENDRIK: 0812 6074 1978


LOKASI JL. PUKAT V DEKAT DGNJL.MANDALABYPASS LUAS 190M² (L: 10M², P: 19M²) HUB: 0812 814 0308 - 0818 227 629


WASPADA Kamis 20 September 2012

07:30 Dahsyat 10.00 Intan 11:00 Intens 12:00 Seputar Indonesia Siang 12:30 Masterchef 14:30 Silet 15.15 Kabar Kabari 16.00 Target Operasi 16.30 Seputar Indonesia 17.00 Layar Drama : Hanya Kamu 18.00 Layar Drama Indonesia : Puteri Bidadari 19.15 Layar Drama Indonesia : Yang Masih Di Bawah Umur 20.15 Layar Drama : Tukang Bubur Naik Haji 22.00 Mega Sinetron Dalam Mihrab CInta 23.00 Mega Sinema RCTI 00.30 Seputar Indonesia


07:00 Inbox 09.05 Halo Selebriti 10:00 SCTV FTV Pagi 11.03 SCTV Pagi 12:00 SL Liputan 6 Siang 12:30 SCTV FTV Siang 14.00 Liputan 6 Terkini 14.30 Eat Bulaga Indonesia 16.00 Liputan 6 Terkini 16.30 SCTV FTV 17.00 Liputan 6 Petang 17.30 Putih Abu Abu 19.30 Ustadz Fotocopy 20.00 Liputan 6 Terkini 20.03 Si Biang Kerok 22.30 Liputan 6 Terkini 22.30 SCTV FTV Utama

08:00 Serial Pilihan 09:30 Kisah Unggulan 11:30 Lintas Siang 12:00 Layar Kemilau 13:30 I Drama 15:00 Kribo 15:30 Lintas Petang 16:00 Animasi Spesial : Shaun The Sheep 16:30 Animasi Spesial : Chaplin And Co 17:00 Si Alif 18:00 Tendangan Si Madun Season 2 19:00 Aladdin 20:00 Dewi Bintari 21:00 Raden Kian Santang 22:00 Dia Ayu 23:00 Dangdut 01:00 Sidik

07:30 KISS Pagi 08:00 FTV Pagi 10:00 SinemaTV Spesial 12:00 Patroli 12:30 Drama Asia (Korea): Pasta 13:30 Drama Asia (Korea): Dream High 2 14:30 KISS Sore 15:30 Fokus 16:00 Sinema TV Unggulan 18:00 Miniseri Spesial 19:00 Serial Unggulan Spesial 20:00 Sinetron Unggulan: Tutur Tinular 22:00 Sinema Unggula

07:30 Curious George 08:00 Sinema Spesial 10:00 Pesbukers 11:30 Topik Siang 12:00 Klik ! 13:00 Tom & Jerry 13:30 Little Krishna 14:00 Tom & Jerry 14:30 Sinema Spesial 16:30 Coboy Junior 17:30 Topik Petang 18:00 Pesbukers 19:30 Catatan Si Olga 20:30 Boys Before Flowers 21:30 Sinema Spesial 23:30 Dokumenter

07.05 Editorial Media Indonesia 08.05 Eleven Show 09.00 Headline News 10.05 Eleven Show 11.05 The Spring & Latern Festival 12.05 Metro Siang 13.05 Oasis 13.30 Jakarta Jakarta 14.30 Metro Sore 15.30 Public Corner 17.05 Metro Hari Ini 18.05 Suara Anda 19.05 Suara Anda 19.30 The Beauty Of Harmony 20.30 Genta Demokrasi 21.05 Top Nine News 21.30 The Destroyed In Seconds 22.05 Provocative Proactive 23.05 Inside 23:30 Metro Sports

07:30 Sinema Spesial 09:30 Cinta Cenat Cenut 10:30 Insert Siang 11:30 Jelang Siang 12:00 Reportase Siang 12:30 Sinema Spesial 14:15 Digital Clip 14:45 Sketsa 15:45 Show Imah 16:45 Reportase Sore 17:15 Insert 18:00 Dialogue 19:00 Tahan Tawa 20:00 Sketsa Prime 21:00 Bioskop Trans TV 23:00 Bioskop Trans TV

07.00 Apa Kabar Indonesia 09:30 Live News Kabar Pasar Pagi 10:00 Coffee Break 11:30 Live News Kabar Siang 13:30 Apa Kabar Indonesia Siang 15:30 Tabliqh Akbar 16:00 Live News Kabar Petang 19:00 Kabar Utama 20:00 Apa Kabar Indonesia Malam 21:00 Live News Kabar Malam 22:00 Telusur 22:30 KAbar Arena 23.00 Radio Show

08:00 Avatar 08:30 Dr. Dolittle 3 09:00 Doo Bee Doo 10:30 Obsesi 11.30 Buletin Indonesia Siang 12.00 Indonesia Bicara 13.00 Awas Ada Sule 14.00 Hot Spot 14:00 100% Ampuh 16:00 Fokus Selebriti 16:30 Oggy and The Cockroach 17.00 Kartun 19:00 Mantu Mantu Morotin Mertua 20.00 Big Movies 20:30 Big Movies 21:00 Big Movies 23.00 Big Movies

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

Musisi ternama Ari Lasso mengakui sulitnya melawan tindak pembajakan, terutama dalam kurun beberapa tahun terakhir dengan membanjirnya kaset dan video compact disc (VCD) bajakan. “Sekarang ini, industri penjualan fisik kaset dan VCD original ibarat menyerah dan mengibarkan bendera putih menghadapi pembajakan,” katanya, saat jumpa pers menjelang konsernya bertajuk Love Bug di Entertainment Plaza Semarang. Menurut penyanyi bernama asli Ari Bernardus Lasso itu, sekarang ini banyak toko-toko besar penjualan kaset dan VCD original yang tutup, bahkan toko kaset kecil di daerah-daerah ada yang menjual barang original bercampur dengan barang baja-kan. Ia mengungkapkan tokoto-ko kaset kecil melakukan itu

Ari Lasso/ se-mata-mata untuk menghidupi kelangsungan

usahanya, sebab tidak sanggup kaset dan VCD original dengan

harga Rp30 ri-bu/buah bersaing dengan ba-rang bajakan dijual Rp5.000/buah sudah berisi 30 lagu. Meski demikian, penyanyi kelahiran Madiun, 17 Januari 19-73 itu mengakui bahwa saat ini telah terjadi revolusi industri musik Indonesia, terutama dalam penjualan fisik kaset dan VCD melalui kerja sama atau penjualan secara “bundling” dengan produk-produk tertentu.Langkah penjualan kaset dan VCD original secara bun-dling dengan produk-produk tertentu diakuinya, merupakan upaya penyelamatan yang cukup jenius di tengah maraknya beredar barang bajakan di pasa-ran. “Saya rasa ini bagus, saat para fans-fans saya kesulitan mencari kaset-kaset saya yang original, dengan adanya `bundling` ini bisa terbantu karena pendistribusiannya juga luar bi-

asa,” kata mantan personel Dewa 19 itu. Ari mengatakan bahwa langkah penjualan kaset danVCD secara bundling bisa menjadi penyelamat dan mencerahkan masa depan penjualan dalam industri musik selama akses legal download terhadap lagu-lagu melalui internet belum banyak. Berkaitan dengan album terbarunya bertajuk Yang Terbaik juga dipasarkan secara bundling dengan perusahaan makanan makanan siap saji sampai minggu ini sudah mencatat penjualan mencapai 500 ribu keping. “Saya rasa itu angka yang cukup fantastis di saat sekarang ini,” katanya. Album terbarunya berisi delapan lagu lama dan enam single terbaru featuring dengan sejumlah penyanyi lainnya. (ant)

Artis Indonesia Kecam Film Penodaan Agama Sejumlah artis Indonesia mengecam peredaran dan penayangan film menghina dan menodai agama tertentu karena dinilai mengancam perdama-ian dunia. “Kekerasan dan korban muncul di berbagai penjuru dunia sehingga insan perfilman tidak bisa tinggal diam dan merasa terpanggil menyuarakan isi hati untuk perdamaian,” kata Pendiri dan Direktur Duta Besar Perdamaian Internasional (IPA) Damien Dematra dalam keterangan pers di Jakarta, Selasa.


LOWONGAN DICARI Tukang Pangkas pengalaman Jaminan damai, Hubungi Pangkas Mantap Millenium D.Tua, BRASA 0853 6594 8694

Hadir dalam acara itu sejumlah artis antara lain Dewi Persik, Ari Wibowo, Vonny Sumlang serta Erna Santoso. Para artis juga sepakat bahwa membuat film adalah hak setiap orang, namun jangan sampai dipergunakan untuk melecehkan agama orang lain, karena film seharusnya menjadi sarana hiburan dan perdamaian, bukan menjadi alat propaganda dan provokasi untuk mengadu domba. Dalam keterangan pers tersebut, Damiendansejumlahartis

minta kepada masyarakat Indonesia untuk tidak terpancing dengan provokasi dari Sam Baclle, sutradara film Innocent of Muslim dan kelompoknya. Minta kepada Presiden Barack Obama agar diperjuangkan kehadiran undang-undang penodaan agama, agar setiap orang yang melakukan peno-daan agama dapat ditindak se-cara hukum. Juga minta kepada PBB untuk adanya sebuah konvensi dan aturan mengenai penoda-an agama agar simbol agama jangan

Since 1952


(Gadis/ Janda) Mjd: Prwt + Anak, Prwt sakit, Gaji Rp. 900 Rb - 1,5 Jt/bln (Bersih) Hub “CAHAYA” Jl. Ayahanda 44E 0823 6666 3456 - 0878 6933 0515


2 Orang Tukang Pangkas yg Berpengalaman, Rajin dan jujur, Jaminan 70 Rb, Bagi yg lajang disediakan tempat tinggal, hub langsung Pangkas Pelangi Delitua HP. 0812 6968 1118


SMU/D3/S1 syarat Kreatif, datang langsung: Jl. Karya Wisata No. 23A Johor Tp: 7861690 - 7862156 Medan


butuh cepat SMU/D3/S1 sbg guru, syarat kreatif Datang langsung hub: Jl. KH. Wahid Hasyim 92 Medan Tp, 4533875 - 4569269

DIBUTUHKAN MEKANIK Sepeda motor, syarat:



Menjernihkan air kuning, Bau, berminyak, dll (Garansi) - Buat sumur bor (061) 7724 2772 / 0812 6096 8888

My Residence in Medan


Pemasangan Depot Air Minum Isi Ulang paling murah Sesuai kemampuan anda 1. Depot RO 40 s/d 400 Galon/ hari 2. Depot Air Mineral/ Pegunungan 3. Jual alat-alat depot isi ulang Terima siap untuk jualan







Jl. Veteran Psr. 10 (dpn Mesjid Al-Hidayah) Helvetia Telp. (061) 685.3334 HP. 0813.7580.8866



Anda ingin belajar bhs Inggris, dibimbing oleh guru yang berpengalaman puluhan tahun hubungi: Ny. Haswinder Gill Jl. Hayam Wuruk No. 8 Medan 0856 6082 414




JL. KEDIRI NO. 36 MEDAN TELP. 451.6161




PERABOT TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 7653.2188

SPRING BED DIJUAL MURAH Spring Bed 6 kaki 2 lapis Rp. 1.150.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun

Hub Telp. (061) 661.8116 - (061) 661.6802 - 7653.2188




Jl. Sutomo No. 436 Medan 20231 (samping Bank Maspion) Telp. (061) 452.2588 - 415.7504 - 455.7204 - 455.7194 Fax. (061) 415.7504 SUMUT - INDONESIA

1. Susuk Emas, Intan, Berlian Mutiara Sambar Lilin, Mani Gajah, Buluh Perindu. 2. Cantik, Rapat Vagina, Keturunan, Terlambat Datang Bulan, Flek Pemutih Muka & Badan. 3. Aura Tingkat Sempurna (pesona Tanpa Batas) 4. Pelet Penghisap Jiwa (apapun & Tertuju Untuk Siapapun)


5. Tarik Pasangan Baru / lama, wil/pil (tidak Tertandingi). 6. Asihan Tingkat Sempurna, Mandi Ruwat Buang Sial (semua Akan Tunduk). 7. Kekayaan, Karir, Jodoh, Jabatan, Kesuksesan, Tampan, Wibawa. 8. Penglaris apapun Usahanya/ Menjual Apapun) Pengisi Badan

Alamat: Jl. Paduan Tenaga (masuk Dari Jl. Amaliun Depan Hotel Melati) Medan

Buka Setiap Hari Jam 09.00 - 20.00 Wib

HP. 0821 2070 1444, 0813 1109 6993

takmempermasalahkannyadanmerekasiaptampil di Jakarta. Karena bagi Max – Nathan dkk, konser pada hari pemilihan umum atau pemu-ngutan suara, biasa saja. Apalagi sebagai promotor, semua prosedur konser sudah kami penuhi dan ijin pihak kepolisian sudah ada,” kilah promotor yang tahun lalu sukses menggelar konser Avril Lavigne. Berkat sukses dua album studio bertajuk The Wanted dan Battleground, The Wanted mengusung irama Dance dengan balutan kental music pop energik, berhasil menarik perhatian remaja Eropa, Asia Pasifik, dan benua Amerika. Bahkan, Max – Nathan digadang-gadang pantas menggantikan boyband dari Inggris seperti Boyzone, Blue,Westlife dan beberapa nama dinilai yang popularitasnya mulai meredup. Untuk mensukseskan konsernya di Jakarta, Mahaka Entetainment menggandeng Midas Promotions Asia juga menggelar aksi The Wanted di sejumlah negara Asia Tenggara lainnya seperti Singapura, Malaysia dan Filipina. *(AgusT)

Winona Ryder Bahas Sekuel Beetlejuice Aktris pemeran Lydia Deetz di komedi horor tahun 1988 mengatakan akan menemui sutradara Tim Burton untuk membahas sekuel film tersebut. “Saya akan bertemuTim minggu depan, dan saya kabari,” katanya kepada MTV News, seperti dikutip dari The Sun. Naskah sedang dibuat Seth Grahame-Smith. Aktris berusia 40 tahun ini berkeras bila film jadi dibuat, Michael Keaton harus kembali bermain sebagai Beetlegeuse. “Saya berusaha berpikir bagaimana akan berjalan. Sebenarnya saya bukan fokus utama, tapi Michael. Apa benar akan terjadi?” katanya.“Sedang ditulis, tapi apa jadi? Tim belum mengonfirmasi,” katanya. Burton baru-baru ini mengungkapkan akan membuat sekuel Beetlejuice bila naskah buatan Smith cukup menarik.(ant)

Crrante Gelar New Inspiration 2013

Hanya Tempat Kami Klinik Mak Erot Jl. Laksana No. 55J masuk dari Jl. Amaliun Yuki Simpang Raya Medan (Praktek Tetap) HP .0812.4038.333


DOMINASI Boyband Korea belakangan ini merajai konser musik para kaula muda di Indonesia, berhasil ditembus The Wanted band. Boyband asal Britania Raya dipunggawai Max George – Nathan Sykes – Siva Kaneswaran – Tom Parker, Jay McGuinness dan tengah digan-drungi remaja dunia ini, siap menggoyang Jakarta lewat konser akbar di Istora Senayan, Kamis (20/9). “Selain bakal menembus dominasi konser Boyband Korea tengah merasuki remaja kita, The Wanted popularitasnya tengah membum-bung hingga Amerika Serikat dan Kanada lewat tembang GladYou Came, merupakan jaminan mutu untuk sebuah konser musik band inter-nasional,” papar Hasani Abdulgani, CEO Mahaka Entertainment – promotor The Wanted Live in Jakarta 2012 di Jakarta, baru-baru ini. Menyinggung pelaksanaan konser The Wanted berbarengan dengan putaran kedua Pemilukada DKI Jakarta, Hasani menyatakan hal tersebut tak masalah. “Yang penting semua personel The Wanted

Jonki Pitoy saat melakukan demo penataan rambut trend 2013 di acara New Inspiration Beauty & Style


Siap Membantu Permasalahan Anda: R


Setelah sukses di propinsi di Papua, kini hadir di kota Medan, pengobatan nyata luar biasa, bila anda ingin perkasa, ingat jangan salah informasi disini yang pasi ±30 menit kami akan buktikan alat vital menjadi besar dan perkasa. Dengan metode pengurutan disekitar alat vital melalui totok urat-urat kejantanan. Kami tidak mengumbar janji belaka. Tdk ada efek samping, bebas utk semua agama. Bukan janji tapi bukti ditempat Penanganan khusus pria: - Memperbesar, panjang, keras, kuat dan tahan lama - Kencing manis, diabetes, L. syahwat - Ejakulasi dini/ impotensi Khusus Wanita: - Memperbesar/ kencang payudara - Ingin punya keturunan/ gurah vagina - Ingin kembali perawan/ keputihan Konsultasi umum - Ajian semar mesem/ buka aura - Penglaris/ penghasihan/ cari jodoh - Pasang susuk, karir/ jabatan DIJAMIN 100% Alamat Jl. Halat / Masuk Jl. Senam No. 19C. Belakang Makam Pahlawan HP. 0821.6655.3222

Cucu Asli Mak Erot Bersama




Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041 KHUSUS PRIA: - Ejakulasi dini - Impotensi - Memperbesar “Alvit” - Memperpanjang “Alvit” - Keras dan tahan lama dll KHUSUS WANITA: - Ingin punya keturunan - Memperkencang & memperbesar payudara - Mengobati keputihan dll KONSULTASI UMUM: - Buka Aura - Cari Jodoh - Sesama jenis - Pelaris - Memikat lawan jenis - Besar PYDR


Kembalikan kesehatan N tingkatkan kekebalan tubuh Hub: P’De Anto: 0853 6280 3792




Damien Dematra dengan cara anarkis apalagi sampai menelan korban jiwa seperti terjadi di Timur Tengah. (ant)



- Tamatan STM/ sederajat - Berpengalaman sbg mekanik Lamaran diantar langsung ke: MOTOR 1 Jl. Sudirman No. 7-8-9 Losung Batu-Padang Sidempuan (Depan Rumah Sakit TNI-AD)


Jl. Sisingamangaraja No. 82 Medan Telp. (061) 734.2106


The Wanted Tembus Dominasi Boyband Korea




DIBUTUHKAN: Gadis/ Janda Muslim untuk jaga anak umur 1 thn Gaji 800 Rb/bln bersih untuk penjaga anak Hub. Pak Jov Li 0812 6553 5559

disalah-gunakan dan di-peralat untuk me-ngadu domba. Meminta kepada Google dan Youtube agar segera menghapus fil penodaan agama dari jaringan sehingga tidak menjadi fasilisator tidak langsung untuk penodaan agama. Artis Indonesia menyerukan kepada masyarakatinterna-sional agar tidak membalas tindakan


Tukang pangkas Berpengalaman, Jaminan Rp. 65.000/hari, Berminat hub. Putra 0852 6240 9531

DIBUTUHKAN: Gadis/Janda untuk bekerja sebagai PRT Gaji 800 Rb/bln Bersih Hub. Pak Jov Li 0812 6553 5559

The Wanted


MLM Baru (4 Bln) Bonus Harian Propolis Prosmart Brazil (Import) Cari Leader/Stockist Jl. Sumut - Aceh Kami ahli bangun Network & Cetak org sukses Hub. Founder Ir. Ivan-Bdg 0813 2353 1188

07:30 Selebrita Pagi 08:15 Rekreasi Azis Nunung 08:45 Ga Nyangka 09:15 Ups Salah 09:45 Spotlite 10:45 Warna 11:30 Redaksi Siang 12:00 Selebrita Siang 12:30 Si Bolang 13:00 Laptop Si Unyil 13:30 Cita-Citaku 14:00 Koki Pintar 14:30 Brownies 15:00 Tau Gak Sih? 15:30 Jejak Petualang 16:00 Orang Pinggiran 16:30 Redaksi Sore 17:00 Indonesiaku 18:00 Hitam Putih 19:15 On The Spot 20:00 Opera Van Java 22:00 Bukan Empat Mata


Ari Lasso Akui Kewalahan Lawan Pembajakan



WASIRI (Untuk Ambeien)

Wasiri berani menjamin kesembuhan tuntas ambeien/wasir anda. Sangat berkhasiat dan cepat menghilangkan ambeien. Wasir yang menonjol maupun yang tumbuh di dalam. Redakan rasa sakit, perih dan menghentikan pendarahan waktu buang air besar, mencegah infeksi dan panas dalam serta melancarkan buang air besar. Dpt Diperoleh di Sumatera - Aceh Hub: (061) 7365429 - 7362887

Crrante menggelar New Inspiration 2013 Beauty & Style menampilkan penata rambut Jonki Pitoi serta penyanyi Benigno. Acara digelar di Grand Antares mendapat perhatian cukup besar dari kalangan pemilik salon di Medan maupun undangan lainnya. NewInspiration2013di-awali demo make up kebaya modifikasi bersama Jongki Pitoy serta demo make over bersama Leo Salon dan tak ketinggalan demo cuting & styling blow. Menurut Alexius WinartoNational Sales Manager Crrante, di acara tersebut diperkenalkan juga teknik pengguntingan terbaru bakal mewarnai trend 2013 sampai pelurusan rambut. Sementara Crrante menampilkan produk terbarunya yang menggunakan buah dan susu untuk perawatan dan kesehatan rambut. Acara diakhiri tanya jawab serta parade hasil karya Jongki dan Ute.(m19)

Winona Ryder/



Modal Sosial Dalam Keluarga & Politik


Terharu Lihat Aksi Demo Berharap Ulama Tidak Diam


ibuan umat Islam di Kota Medan dari kalangan pelajar dan mahasiswa maupun organisasi keislaman yang pada umumnya dari kalangan generasi muda terlihat marah. Kemarin mereka dengan poster di tangan melakukan aksi unjuk rasa mengecam pembuatan dan pemuatan film Innocence of Muslims oleh sutradara gila berkebangsaan Amerika Sam Bacile yang memberikan gambaran sangat menghina Nabi Muhammad SAW sebagai tokoh pembawa ajaran palsu maupun sisi kehidupan Nabi umat Islam bersama istri-istrinya divisualisasikan vulgar. Sehari sebelumnya, seribuan massa tergabung dalam Gerakan Muslim Sumatera Utara (Geram SU) juga memprotes film Innocence of Muslims di kantor Konsul Amerika Serikat di Gedung Uniland Jalan MT Haryono Medan, Selasa (18/9). Aksi demo tidak hanya marak di Kota Medan, tapi juga di berbagai daerah di Sumut. Bahkan, di Jakarta dan kotakota besar lainnya di Indonesia. Aksi serupa juga berlangsung di belahan dunia lainnya, termasuk komunitas Muslim di Amerika Serikat. Film Innocence of Muslims, menurut para pengunjuk rasa, merupakan penghinaan yang sulit dimaafkan. Apalagi penghinaan serupa kepada umat Islam acapkali terjadi di Amerika dan negara-negara Eropa dengan menyalahgunakan kebebasan berekspresi. Oknum-oknum anti-Islam tidak hanya menghina Nabi SAW lewat tulisan, membakar Al-Quran seperti dilakukan pendeta sinting Terry Jones, tapi juga melalui karikatur dan karya seni lainnya, seperti novel dll. Mengamati jalannya aksi unjuk rasa kita merasa terharu melihat sikap umat Islam khususnya dari kalangan generasi mudanya. Mereka terpanggil membela Nabinya yang dihina. Mereka sangat tersinggung, Nabi Junjungannya difitnah oleh orang-orang tak bertanggung jawab dari kalangan bangsa lain dan agama lain. Meskipun penghinaan itu bisa saja tidak ada kaitan dengan agama lain atau rekayasa dari tokoh-tokoh agama lain tapi jelas menyulut api kemarahan umat Islam dunia. Untuk sementara kita katakan murni merupakan kebodohan dan tindakan gila, tak bermoral dari oknum pekerja seni, sineas atau sutradara semata. Tapi harusnya diproses sehingga mampu menimbulkan efek jera bagi pekerja seni yang nyeleneh lainnya. Kita mencatat sejumlah organisasi yang turun ke jalan meneriakkan kecaman ke alamat Konsul AS di Medan maupun ke pihak Kedubes Intisari di Jakarta dll di antaranya tergabung dalam Geram SU adalah Komite Solidaritas Muslim, Aksi Mahasiswa Muslim Indonesia Mari bersama-sama umat Kesatuan (KAMMI), Muhammadiyah Medan, Ikatan Islam berjuang menjaga Cendekiawan Muslim Indonesia (ICMI) Muda, Pemuda Muslim Indonesia (PMI) Medan. kesucian Al-Quran dan dan Meski aksi demo kemarin dimotori Ikatan Muhammadiyah (IMM) berlangkemuliaan Nabi SAW Mahasiswa sung begitu meriah, memacetkan jalan, namun tanpa pamrih masyarakat memberi apresiasi atas perhatian para pendemo dan sikapnya yang tegas menyuarakan kecaman dengan mau turun ke jalan berpanas-panasan. Hemat kita, tidak semua orang mau berpanas-panas turun ke jalan. Kebanyakan elite politik dan pejabat agama lebih senang melihat situasi lalu memberi keterangan kepada media massa. Banyak pula kalangan ulama yang malah berdiam diri saja, tidak melakukan aksi apapun sekalipun umat Islam sudah demikian emosinya. Seharusnya para ulama berdiri paling depan memperjuangkan kebenaran, menjaga nama baik, citra agama dan kitab sucinya agar tidak tercemar. Sebab, mereka (para ulama) merupakan titisan penerus Nabi lebih mengerti ajaran Al-Quran dan hadis serta perjuangan Nabi Muhammad SAW ketimbang kalangan masyarakat umum, termasuk para mahasiswa dan pelajar. Jika para ulama ramai-ramai ikut berdemo bersama umat Islam lainnya maka dipastikan menjadi kekuatan hebat untuk menekan lawan, dalam hal ini pihak Amerika Serikat, sehingga mereka minta maaf kepada umat Islam. Memang tidak mudah bagi kita untuk menangkap pelaku penghina Islam di Amerika, kecuali dengan cara-cara melawan hukum. Tapi, sinyal yang diberikan pemimpin Hizbullah Sheikh Hassan Nasrallah yang menjadi target pembunuhan dan ancaman mati dari kalangan Barat, dia saja berani turun ke jalan menuntut si pembuat film Innocence of Muslims memberi support bagi umat Islam di Lebanon. Bandingkan dengan pemimpin Islam di Indonesia. Hanya sebagian saja yang benar-benar berani melakukan perlawanan secara frontal melawan kebiadaban Sam Bacile, Terry Jones, Salman Rousdy dll. Jika Menteri Agama Suryadharma Ali meminta para pendemo tidak berlaku anarkis, hal itu dapat dimaklumi. Tapi akan jauh lebih positif jika Menag pun ikut turun ke jalan untuk memberi tekanan kepada kelompok anti-Islam. Sehingga para ulama di daerah pun akan mengikuti jejak sang menteri. Kita yakin dengan dukungan para ulama ikut turun ke jalan membuat aksi demo lebih tertib dan tidak menimbulkan aksi anarkis. Hemat kita, aksi demo yang terjadi di Medan/Sumut maupun di Jakarta masih dalam tataran wajar. Kalaupun terjadi bentrok dengan petugas, itu akibat kedua belah pihak menjalankan misinya. Kelompok pendemo tak ingin Nabinya dihina dan bersedia mati syahid membela ‘’amar makruf’’ dan mencegah terjadinya ‘’kemungkaran’’, sedangkan kelompok aparat keamanan menginginkan aksi demo berlangsung tertib dan aman. Ke depan dalam menegakkan ‘’amar makruf nahi munkar’’ para ulama harusnya berdiri paling depan. Bersama-sama umat Islam berjuang menjaga kesucian Al-Quran dan kemuliaan sang junjungan Nabi SAW tanpa pamrih.+

Oleh Prof Usman Pelly, Ph.D ...yang terjadi, seperti orang-orang panjat pinang dalam perayaan 17 Agustus,satu sama lain melorotkan menarik pemanjat di atasnya.


dalahRobertD.Putnam,seorang sosiolog kondang dari Harvard University (1963) yang pertama kalimenemukanwacanateoritis yang memukau ekonom, politisi dan negarawan—bahwa modal sosial (socialcapital), merupakan prasyarat jatuh bangunnya sebuah komunitas atau negarabangsa. Menurut Putnam, komponen utama yang dianggap sebagai modal sosial itu adalah (1) jaringan sosial (social networking), (2) moral sosial (social morality), dan (3) kepercayaan masyarakat (social trust). Ketiga komponen ini secara fungsional satu sama lain saling berkaitan dan sinergetik dalam menghasilkan sebuah kinerja(perfomansi).Kuatnyajejaringsosial sebuahkelompokmasyarakatakanmenghasilkan tingkat moral yang tinggi (seperti kepatuhan terhadap hukum) dan pada gilirannya akan menghasilkan tingkat kepercayaan (ligitimasi) yang kuat antar warga dan kelompok. Modal Sosial Dalam Keluarga Ambillah contoh yang sederhana, dalam masyarakat paguyuban Batak Toba dan Mandailing umpamanya. Dalam kedua masyarakatinidikenaladanyajejaring sosial”DalihanNatolu”(tigatungkusepenjerangan). Pertama, kelompok pemberi anak gadis (wife giver), yang disebut hulahula atau mora, kedua, kelompok penerima anak gadis (wife-taker), dan ketiga kelompok semarga, kahanggi (our own lineage). Kalau hubungan sinergetik ketiga jaringan sosial kekeluargaan (kinship) ini berjalan dengan baik, hula-hula (mora) menyayangiboru,danborumenghormati hula-hula(mora)nya.Begitujugahubungan antara dongan-sabutuha (kahanggi) dengan hula-hula (mora) dan boru baik, makadipercayatidakadakerja(horja)yang akan terbengkalai. Jejaring kerja (social net working) yang rapih menimbulkan ketaatan pada aturan dan hukum yang dibina. Inilah yang akan menampilkan moral (rasa malu dan risih terhadap diri sendiri dan orang lain), terutama kalau berpapasan atau berada di tengah jejaring keluarga. Rasa malu itu muncul kalau salah satu pribadi atau komponen tidak berprestasi dalam jaringan kehidupan kelompok tersebut. Sebaliknya rasa saling hormat akan tumbuh kalau masing-masing pribadi dan kelompok jejaring sosial itu menunjukkankenerjasesuaidengantanggung jawab moral yang dipikulnya. Dari pelaksanaantanggungjawabinirasasaling mempercayai(trust)akanterbina.Masingmasing pribadi dan komponen dari dalihandatoluitujugamemilikijejaringsosial dalam dalihan natolu lainnya, maka jejaring sosial kinship ini akan merupakan jejaring laba-laba yang luas dan menembus kawasan kehidupan teritorial dan budaya. Apalagi dewasa ini telah terjadi kawin-mawinantarkelompoketnikdidalam dan di luar kawasan budaya, bahkan antar negara, maka jaringan sosial itu akan me-

Faks 061 4510025

Facebook Smswaspada

+6285260103051 Mita bale saboh tempat. Sinan gadoh peugah haba duek meusapat. Di meunasah suara azan ngon iqamat. Tan dipakoe lale keudroe syaitan peukumat. Sopan santoajee ketat kabeh rata. Keu nuraka tan diingat azeub raya. Bak ureung syik han le geukliek pih geurela. Nyan keuh DAIYUS han teumeung com bee Syuruga. Weuh that hate oh tapike keu agama. Kabeh reule generasi umat dumna. Meuen bola teuhah aurat jeut kutika. Sangat seudeh oh taingat hai syedara. Wahe bangsa beutajaga keu agama. Beutabeda buet yg keji bek tabina. Bek tadukong tapeulurong buet yg murka. Bungeh Tuhan azeub peudeh akan teuka. +626245741871 Kpd Yth Bpk Kanwil Depag Sumut di Medan,mohon perhtian ttg honor insentip guru2 RA se- Labuhanbatu TA 2012/2013 sampai sekarang belum dapat bagian, Bankingnyapun ber-pindah2,, +6285658030013 Brimob,dan hakim PN medan pun pengecut. lengkap sudah memg aparat penegak hukum yg menzolimi umat ini. AFRIAN E SEKJEN LMI SUMUT +6282366748989 PSMS tdk akan pernah bisa maju2 dalam persepakbolaan nasional.. Kalau masih di kelola oleh “vampir2” penghisap darah (uang) dulu masih ada bang Sihar Sitorus.. Semua berjalan mulus walau pd saat itu.. PSMS tim musafir.. Aneh nya pd saat itu bnyk sekali org2 munafik yg mengatakan.. “klo sihar akan jdkan psms milik pribadi..” skrg lht lah sendiri.. Apa jd nya ayam kinantan.!!! Bkn nya berkokok.?? Tp anak2 ayam yg lain.? Pada lari ke klub lain..!! Mau jd apa psms.? Klo cm bnyk berkokok.. Tanpa menancapkan taji kpd lawan2 nya.. Miris sekali rasa nya.??? +6285360689999 Ass wrwb. Yth Waspada. Tolong dimuat setiap hari merk produk2 israel/yahudi yg beredar, agar kami umat islam mengetahui. Tks wass. +6282165293457 “KPK yg bisa menangkap A L”negara telah dirugikan oleh nya. Korban jiwa.mati.stres.gila.cacat.korban harta.kemiskinan.kelaparan. Dll. Dia bisa dianggap super-nya terorisme.(telah membuat kerusakan dimuka bumi). +6281260267051 TNI Polri satu atapkan kembali. Pak MPR dan DPR 2. Karena polisi geng motor aja gak. Bisa amankan. Sama rakyat kecil aja yg berani. +6281397099891 Kpd para balon Gubsu, saya sebagai warga sumut, menghimbau tlg jgn berlebihan, itu baliho di pinggir jalan, di kota2 sdh tdk karuan, percayalah, kalau memang niat kita tulus, tak penting kali hambur2kan uang untuk pasang baliho dimana2, semak kali jadinya. +6285275149722 Kalau lah hukuman si pinokio itu berlaku pada pejabat2 , anggota DPR, Atau penegak hukum di indonesia, mungkin hidung mereka sudah panjang, hingga menembus langit. +6282362689677 Sejak thn 2010 s/d 2012 byk kegiatan difiktifkan. Sehingga PAD tdk terealisasi dgn baik. Yg dianggarkan puluhan juta. Sehingga tanda tangan petugas byk yg dipalsukan.

lintasi batas-batas negara. Modal Sosial Dalam Pembangunan Politik Adalah menarik untuk mencermati kinerjapemerintahantengahkeduapriode kedua (KIB II) Presiden SBY yang sekarang bergandengan dengan Budiono sebagai wakil presiden, dengan memakai tolok ukurmodalsosialdiatas.Politikpencitraan SBY pada Kabinet Indonesia Bersatu (KIB) I yang lalu, didukung oleh modal sosial yangtinggi.Mungkinsajakarena SBYpada KIB I bergandengan dengan Jusuf Kalla (JK), sehingga jaringan sosial dengan tokoh-tokoh ”sabrang” dapat dimamfaatkan dengan maksimal. Tetapi sekarang Dwi-Tunggal ”PusatSabrang” itu secara pisik telah tidak tampil. Dari segi internal pemerintahan (Kabinet danDPR)jaringansosialSBYterasakurang maksimal.Terutama karena ditengarai tidak didukung lagi oleh modal sosial yang kuat dari jajaran pemerintahannya, baik di pusat maupun di daerah. Citra politik SBY itu tidak hanya terpancar dari diri seorang presiden secara individual, tetapi adalah dari akumulasi sinergetik kenerja pemerintahanyangdipimpinnya secara keseluruhan. Rakyat ingin agar sukses KIB I itu diulang kembali oleh SBY. Sebab itu, dalamPemiludanPilpres2009yanglalu, mereka juga tidak hirau kemana perginya nanti seorang Jusuf Kalla, Bakrie, Megawati, Golkar, atau PDI dengan menyoblos SBY. Yang penting Demokrat/ SBY menang. Sebab itu, suara rakyat tumpahruahkepadaDemokrat dan SBY (bahkan semua yang bernomor 39 dijoblos—walaupun itu nomor seorang calon anggota DPD dari Sumatera Utara, bukan nomor Demokrat—sehingga yang punya nomor itu juga mungkin terheranheran dengan limpahan suara yang mencolok itu). Pada waktu KIB II mulai diluncurkan (Juli2009)tingkatkepercayaanmasyarakat masihmencapaititiktertinggi(83%),tetapi setahun kemudian tingkat ligitimasi itu turundrastis(51-56%).MenurutBambang Setiawan dari Kompas (20 Oktober 2010), penurunan ini seiring dengan merosotnya citra SBY yang pernah mencapai 94,3% (Juli 2009) menjadi 67,8% (Oktober 2010). PenurunancitrapribadipresidenSBYtelah berimbas pada ”menurunnya kepuasan terhadap kepemimpinannya dalam kabinet dan preferensi pilihan publik terhadapnya.” Tiga bulan setelah KIB II meluncur, kepuasan terhadap kepemimpinannya masih berkisar 62,3%.Tetapi setelah setahun tinggal 44,3%, jika Pemilu tahun lalu SBY masih mampu meraih 82,6%. Pada tahun-tahun kedua itu, kalau dilangsungkan Pemilu ulang media pers

memprediksi bahwa SBY (Demokrat) hanya akan kebahagian 34,2%. Sekarang (Agustus 2012), mungkin banyak orang yangtidakpercayapenurunanyangdigambarkan oleh media pers (dari hasil berbagai polling pendapat umum), betapa rendahnya rating legitimasi SBY. Disamping kedudukan Partai demokrat dari rating pertama menjadi rating ketiga setelah Golkar dan PDIP. SBY-BudionoDalamkontekModalSosial Modal sosial yang telah dimiliki oleh SBY sebagai buah sukses pada KIB I (20042009) kelihatannya tidak berlanjut pada KIB-II. Jejaring sosial yang terbentuk dalam kabinet, antara SBY-BUDIONO dengan para menteri dan pejabat tinggi negara (sipil, kepolisian dan militer) serta tokohtokoh partai politik koalisi baik di lembaga eksekutif (kabinet) dan legislatif (DPR). Begitu juga antara presiden dan para gubernur di daerah kelihatannya sekarang tidak sesolid pada KIB I. Sekarang orang sehari-hari dapat menonton dan membaca dari media pers kekacauan jejaring sosial antara presiden dan anggota kabinet yang cukup merisaukan. Bahkan menuai dampak yang menggalaukan, walaupun SBY telah melakukan reshuffle tahun yang lalu (2011). Ambillah contoh hubungan komunikasi simbolik antara presiden dan para penegak hukum (kepolisian, kejaksaan dan KPK) yang sebagian besar personilnya sekarang telah berganti—tidak menunjukkan perbaikan kerja yang mampu mendongkak kembali rating ligitimasi SBY seperti pada permulaan KIB II meluncur. Malah hari-hari terakhir ini, orang menyaksikan permasalahan tuduhan korupsi di jajaran internal kepolisian. Masalah yang meruyamkanbukankarena di jajaran kepolisian ditemukan praktek dugaankorupsisaja, tetapi hiruk pikuk perebutan antara pihak kepolisian dan KPK dalam penanganan masalah korupsi itu. Belasan kasus dapat diajukan untuk menunjukkan bagaimana lemahnya jejaring sosial antara SBY dengan aparat penegak hukum yang seharusnya merapikan diri secara sinergetik dalam menangani korupsi yang kelihatannya makin menggurita. Semua itu seyogianya dapat mendongkrak rating ligitimasi SBY sebagai kepala pemerintahan dan kepala negara. Karena masalah korupsi merupakan masalah yang sangat monumental dan historis pada abad XXI ini, untuk negara dan bangsa Indonesia. Sudah selayaknya kesuksesan pemberantasan korupsi itu kelak ditulis dengan tinta emas dalam sejarah kehidupan republik ini. Nama SBY tentu tidak akan luput dari pujian kesejarahan itu. Semua ini menunjukkan betapa jejaring sosial yang dimiliki SBY dewasa ini, sebagaimodalsosialpertamayangpenting belum mampu menumbuhkan modal sosial kedua yaitu sosial morality. Kendatipun orang juga harus mengakuibetapapiawinyaSBYmengembangkan jaringan sosial di luar negeri. Hampir di-

setiap event internasional pidato beliau menjadirujukan,beliauselaluditempatkan dudukberdampingandenganObama,Putin atau Mercel.Tetapi di dalam negeri, banyak tokoh-tokoh ”inner-cycle” SBY nampaknya tidak merasa malu atau risih kalau digiringkepengadilan.Tidakpeduliapakah dia seorang pejabat tinggi, politisi kawakan, penegak hukum, pakar hukum, artis atau ulama/pendeta. Di antara mereka, bukan pula suatu kebetulan, banyak yang yang dianggap ”sangat dekat” dengan SBY. Dalam budaya Timur yang religius, sukarorangtidakmengaitkantragediorang dekat SBY tersebut dengan Citra SBY sendiri. Istilah ”kena-getah” dalam pencitraan SBYseringtidakdapatterhindarkan.Dalam budaya Jepang umpamanya, kalau terjadi peristiwasepertiyangdialamiparakoruptor tersebut, sebagai konsekuensi moral orang yang bersangkutan tadi minimal telah segera mengajukan permohonan berhenti atau banyak yang harakiri (bunuh-diri). Memang di negara sakura itu, bunuh diri dianggap sebagai konsekuensi pertanggungjawabanmoralseseorang,karena itudisebut”honorable-death”(matiterhormat).Tetapi dalam kasus SBY ini yang terjadi, seperti orang-orang panjat pinang dalam perayaan 17 Agustus, satu sama lain melorotkan menarik pemanjat di atasnya. Maka dalam keadaan jejaring sosial yang lemah dan moral sosial yang rendah, bagaimana SBY dapat mengharapkan ”trust” (kepercayaan atau ligitimasi) rakyat yang tinggi untuk dirinya dan pemerintahan yang dipimpinnya. Apakah sisa periode KIB II ini SBY dapat mengemblikan modal sosial yang telah berantakan itu? Apa Yang Harus Dilakukan? Pertama SBY harus memperbaiki jejaring sosial, antar pribadi dan tokohtokoh di berbagai lembaga, baik di pusat maupun di daerah, baik pemerintah atau swasta. Jangan ada kontradiksi pernyataan dan perbuatan, semua harus konsisten, umpamanya kepada kebijakan ”mainstream” propertumbuhan (pro-growth), pro-pemberantasan kemiskinan (pro-poor), dan pro penciptaan lapangan kerja (pro-job)yang telah dilansir dua tahun yang lalu. Kalau ada menteri atau pejabat sipil atau militer yang tidak setuju dengan kebijakan ”mainstream” yang telah digariskan presiden itu, sebaiknya angkat kaki atau mundur saja, tidak perlu berdalih lupa atau salah faham. Rakyat tidak butuh pembelaan (apologi) seperti itu. Dan presiden harustegauntuksegeramenindaknya.Memangtahunyanglalu,adausahaSBYuntuk merangkulkekuatanPDIPatauyangmasih berada di luar kabinet. Namun, kalau kabinet terlalu gemuk, hal ini menyulitkan kontrol dan koordinasi. Rasanya lebih penting membangun komunikasi yang sehat antara pemerintah danoposisisecaraelegandanrasional.Dari jejaring sosial yang kukuh dan sehat ini (di dalam dan di luar kabinet) akan lahir kembali ketaatan kepada peraturan dan hukum, sehingga moral sosial (social morality) dapat tampil pada setiap orang atau kelompok. Dari sinilah ”trust” (ligitimasi) dapat dibina kembali, dan citra politik akan dapat berkembang dengan wajar. Insya Allah! Penulis adalah Antropolog, Unimed, UISU.

Ksatria Yang Terpingit


WASPADA Kamis 20 September 2012

Oleh Hari Murti, SSos Tanda-tanda kelahiran ksatria keempat mulai muncul. Di sana-sini,orang mulai suka dengan tokoh-tokoh yang sedikit bicara, sederhana tampilannya, apa adanya, tetapi berbuat lebih nyata dibanding para ksatria sebelumnya.


ika pingit diartikan secara luas, maka ceritatentangsatriopiningitbukanlah sekadar mitos dalam politik Indonesia. Ksatria-ksatria (kalangan pejabat) yang terpingit adalah fenomena yang hadir sejak reformasi. Setidaknya ada dua musababnya,yaitu (1) traumarakyatpadakekuasaan masa lalu yang otoriter yang kemudian menjadialasankuatrakyatsangatantisipasi pada penguasa masa kini, dan (2) citra sebagai orang demokratis yang ditampilkan penguasa masa kini membuat kekuasaan mereka harus dibatasi lebih jauh secara sendirinya. Demokrasi di tangan rakyat menjadi nama dari keterpingitan kekuasaan ini. Pejabat-pejabat yang menggunakan kekuasaanya dalam konteks kerja konkret banyak disalahkan secara hukum dan demokrasi. Ada yang tidak dipilih/diangkat lagi. Ada juga yang keluar dari pingitan dengan mencari ruang gerak di luar negeri. Banyak yang takut masuk penjara setelah nanti berhenti dari kekuasaan. Banyak pula yang tidak tahu harus berbuat apa atas kekuasaan yang dipegangnya. Pemingitnya adalah faktor dari dalam dan luar diri kalangan ksatria-ksatria itu sendiri. Karena terlalu menjaga citra misalnya, kebijakan yang tidak populis sangat dihindari. Para penguasa kadang bersikap asaltampilberbedadenganpenguasamasa lalu. Pembedaan itu kemudian difokuskan pada penyembuhan trauma rakyat pada penguasa masa lalu dengan cara tidak menggunakanbidang-bidangkewenangan yang kira-kira bisa mengingatkan rakyat pada era lalu itu. Ketidakkonsistenan pada sistem demokrasi presidensiil adalah contoh dekat dalam hal ini. Dari sisi luar diri para ksatria ini, ada kontrol berstandar ganda dari pressure group. Penguasa menjadi serba salah, yang kemudian memilih untuk diam demi memuaskan emosionalitas pengritiknya. Dalam hal penggunaan gas yang banyak meledak itu misalnya, maju terus disalahkan, mundur ke minyak tanah bukanlah

pilihan. Alur Cerita Dalam cerita tentang politik dan kekuasaan yang pernah, sedang, dan akan ada di Nusantara, diceritakan bahwa Indonesia akan dipimpin oleh para ksatria dengan karakter yang berbeda-beda.Yang pertama adalah satrio kinunjara, yaitu para ksatria yang sering keluar - masuk penjara. DizamankolonialismediIndonesia,tokohtokoh pendiri bangsa sering dimasukkan ke penjara karena aktivitas politiknya yang antipenjajah. Pelanjutnya(kedua)adalahsatriomukti wibawa, yaitu para pemimpin negara yang memiliki dan menikmati kekuasaan yang tinggi dan sangat ditakuti. Banyak yang menyebut ini terjadi di zaman Orde Baru. Pada waktu itu, jangan coba mendemo petinggi karena dua atau tiga pleton ABRI bisa turun tangan. Pejabat-pejabat benar-benar menempati posisi sebagai warga kelas satu, terutama mereka yang masih dalam radius kroni-kroni kekuasaan pada waktu itu. Kekuasaan bukan untuk melayani, tetapi dilayani dan dipatuhi. Melihat alur cerita tentang satrio-satrio ini, rasanya tak salah menyebut pascareformasiiniadalahmasaparaksatriayangketiga muncul, yaitu satrio piningit. Satrio piningit mungkin adalah para penguasa yang tak dapatberbuatbanyakkarenabebantrauma politik rakyat, keberatan citra, ragu-ragu, tak tahu kerja, atau takut disalahkan. Bermain dalam kata-kata menjadi ciri keterpingitan itu. Lihat saja, staf-staf di Istana sangat banyak. Anggota kabinetnya pun semakin gemuk. Anehnya, instruksi presiden pada menterinya banyak yang tidak diindahkan. Disana-sini,lahirdaerahbarudenganseperangkat besar jajarannya. Nyatanya, rakyat takmendapatpelayananyangmemuaskan meskipun jarak fisik mereka dengan pemimpindaerahnyasemakindekat.Bahkan, banyakyangbertanya“Negara,dimanakah kau berada” ketika mereka melihat peme-

rintah kecolongan terkait penyerangan antarkelompok baru-baru ini. Sampai akhirnya, tanda-tanda kelahiran ksatria keempat mulai muncul. Di sana-sini, orang mulai suka dengan tokohtokoh yang sedikit bicara, sederhana tampilannya, apa adanya, tetapi berbuat lebih nyata dibanding para ksatria sebelumnya. Orang ingin kekuasaan yang dipegang para ksatria digunakan untuk menyampaikan rakyat pada keinginannya tentang Indonesia yang maju, kuat, dan adil. Keinginan ini dijawab oleh tokoh-tokoh yang belakangan sangat popular dengan prestasinya. Pertanyaanya adalah apakah orang-orang ini akan muncul sebagai ksatria keempat, yaitu ksatria mukti wiguna? Satria mukti wiguna digambarkan sebagai pemimpin yang berguna nyata, yang menjawab ketidaksabaran rakyat pada pemimpin yang terlihat terlalu hati-hati selama ini. Gejolak Estafet kekuasaan dari satu ksatria ke ksatria lainnya bukanlah berjalan dengan mulus. Sejarah menunjukkan ada gejolak besarketikakekuasaanberpindahdariOrde Lama ke Orde Baru, dan kemudian masa reformasi. Malah, gejolak ini sebagai syarat mutlak karena ia dianggap sebagai tonggak besar yang memisahkan ksatria masa lalu dengan yang baru muncul. Tapi sebagai orang yang berpikir, tak cukupkah instrumen Pemilu untuk mendapat pemimpin yang hebat? Dengan kata lain, mengapa pemimpin yang menjawab kebutuhan itu lahir melalui gejolak yang berbiaya sangat mahal di tengah begitu banyaknyaPemiludinegeriini?Bayangkan, banyak yang percaya bahwa reformasi masih kurang efektif sehingga revolusi-lah yang akan menyelesaikan segala ketidakberesan di negeri ini. Bayangan saya ketika kata revolusi disebut adalah apa yang terjadi di beberapa negara Timur Tengah belakangan ini. Darah, perang, kekacauan, kehancuran, apakah kehebatan satria mukti wiguna yang akan muncul itu tidak layu sebelum berkembang oleh revolusi yang duluan terjadi sebelumnya itu? Itulah pikiran saya. Jadi, marilah kita mencari pemimpin yang aksi nyatanya telah terlihat dan teruji jauh sebelum ia menjadi pemimpin negeri. Gunakan Pemilu sebagai instrumen yang efisien untuk mendudukkan mereka. Tujuannya menggunakan Pemilu jelas, yaitu seperti yang tertera dalam pembukaan UUD1945tentangtujuanIndonesiamerde-

ka : Melindungi bangsa Indonesia dan segenap tumpah darah Indonesia. Lihat ilustrasi di bawah ini. Dimanakah Anda akan tinggal jika untuk membangun rumah yang baru dengan mensyaratkan rumah lama harus dibakar terlebih dahulu? Bagaimanakalau kitacaritukangbangunan yang ahli membangun rumah baru dengan masa transisi yang mulus. Kalaupun ada gejolak, cukuplah reformasi saja lagi karena kita sudah berpengalaman tentang sisi plus – minusnya. Penulis adalah Pemerhati Komunikasi Politik, Alumnus Sekolah Tinggi Ilmu Komunikasi “Pembangunan” Medan.

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di Media manapun.Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Chairuman dan Gus terdata di tiga partai - Nyangkutnya kemana ya? * Asia-Eropa sepakat lestarikan kota bersejarah - Di Medan gedung bersejarah ambruk * Rahudman minta Calhaj tenang ke Tanah Suci - Doakan juga yang belum berangkat


D Wak


WASPADA Kamis 20 September 2012


Protes Keras Warga Kecamatan Medan Barat Pada Hari Minggu tanggal 16 September 2012 pukul 18.09 WIB saya tiba di Kantor Camat Medan Barat Jalan Budi Pembangunan No.1 Pulo Brayan Kota Medan, yang bermaksud untuk mengambil Kartu Tanda Penduduk (KTP) elektronik (e-KTP), namun oleh seorang pegawai yang bertugas menerima/meregistrasi kedatangan para pengambil e-KTP dikatakan jadwal pada hari itu sudah berakhir/tutup pada pukul 17.00 WIB, padahal sesuai undangan pengambilan e-KTP yang saya terima (terlampir), tertera jadwal yakni 08.00-12.00 WIB/ 12.00-16.00 WIB/16.00-20.00 WIB dan surat tersebut ditandatangani oleh Camat Medan Barat dan di Stempel resmi dan juga dengan kop surat resmi. Betapa kaget dan kecewanya saya saat itu, ditambah lagi melihat perilaku semua pegawai yang ada, bergegas pulang kerja tanpa mempedulikan saya dan beberapa warga , lain yang juga mulai berdatangan untuk urusan yang sama. Walaupun dengan berat hati marah, kecewa, tetapi tetap dapat menahan diri dari tindakan anarkis yang bisa kami lakukan, saya dan beberapa warga yang hadirpun bersepakat meninggalkan Kantor Camat Medan Barat tersebut tepat pada pukul 20.00 WIB dengan catatan bahwa kami semua atau secara perorangan bebas untuk menindaklanjuti kejadian tersebut selanjutnya. Dan bagi saya dengan mengatasnamakan semua warga yang telah diperlakukan secara semena-mena dengan ini memprotes keras dan menuntut pihak Kecamatan Medan Barat sbb : 1. Pihak Kecamatan Medan Barat harus meminta maaf kepada warga, mengakui kesalahan/ketidak becusan aparatnya dalam melayani warganya, serta menjalankan kewajibannya untuk memberikan apa yang menjadi hak warga, dalam hal ini e-KTP sesuai jadwal dan undangan resmi yang dikeluarkan. 2. Camat Medan Barat harus memberi sanksi kepada aparatnya yang bertugas pada saat itu untuk tidak mengulangi hal yang sama pada saat, tempat dan hikayat lainnya. Apabila pihak Kecamatan Medan Barat tidak merespon/menanggapi dengan baik dua permintaan diatas, maka saya akan melakukan gugatan secara hukum tindakan/ kinerja yang buruk tersebut ke Pengadilan dan meminta pihak Walikota Medan untuk mengambil kebijakan yang semestinya terhadap bawahannya. Serta tidak menutup kemungkinan saya bersama warga Kota Medan untuk melakukan Gerakan Boikot Bayar Pajak, karena pajak yang warga bayar kepada Kota Medan (PBB) dan Negara Kesatuan Republik Indonesia (PPh&PPN) ini tidak digunakan untuk melayani pembayar pajak dan mensejahterakan masyarakat luas. Medan 17 September 2012 Mustafa Kamal Medan


Dedi Sahputra

Manusia Haram Di persimpangan semrawut pagi itu. Seorang pria memboceng dua anaknya ke sekolah, perlahan memotong badan jalan. Arus kendaraan dari arah sana otomatis melambat untuk sepedamotor pria itu melintas. Tapi ada satu yang sepertinya tak rela menginjak rem. Dia wanita berbalut seragam SMA. Tampaknya dia sedang buruburu, sama halnya dengan pria tadi. Wanita itu terus berusaha mendahului pria tadi, meski akhirny gagal. Dia terpaksa menginjak rem dan membiarkan pria itu melintas lebih dulu. “Woooiii... begok,” tiba-tiba wanita itu berteriak nyaring sambil langsung ngacir. Pria itu menoleh lantas manggut-manggut. *** “Manusia haram,” kata budayawan Emha Ainun Nadjib. Ini kategorisasi untuk orang-orang yang kehadirannya tak dikehendaki dan kehilangannya disyukuri. Ini kalau engkau datang selalu mengendong mudharat bagi orang lain, karena itu enyahlah. Pikirkanlah sebanyak-banyaknya hanya kepentinganmu dan bekerjalah hanya untuk itu, persetankan segala penderitaan orang, maka dengan segera engkau akan merugikan bahkan menzalimi orang lain. Sepanjang tak menguntungkanmu, acuhkan saja orang lain, hinakan kalau perlu—dan sepanjang memberi manfaat bagimu bersikaplah semanis madu. Ini adalah jalan yang efektif untuk menjadi manusia haram itu. Lantas ada manusia makruh. Ini tingkatan di atasnya sedikit saja. Engkau tidak diharapkan hadir di tengah-tengah orang karena sesuatu dalam dirimu berpotensi untuk mengurangi kebahagiaan orang. Tapi kalaupun engkau hadir, itu tak pula jadi soal. Jika engkau merasa maqam-mu di level ini, yang perlu engkau lakukan cuma nyadar. Karena ada jenis orang yang dari tongkrongannya saja sudah membuat orang jengah. Sedang jenis lain karena memang “bawaan badan”. Naik sedikit lagi ada manusia mubah. Tidak ada yang menolak dirimu, tapi tak ada pula yang mengharapkanmu. Kehadiranmu tidak akan menambah, absenmu juga tak mengurangi apa-apa. Engkau tahu, dalam hidup, setiap melakukan suatu hal, akan selalu ada risiko menanti di depan sana, tapi tak melakukan apa-apa engkau berisiko menjadi manusia mubah. Manusia haram, makruh, dan mubah itu hanya berbeda kelompok saja, tapi mereka tak lebih baik satu sama lain— sebelum mereka mau beranjak dari maqam

itu. Kalau ada yang lebih baik dari mereka, itu adalah manusia sunnah. Walau ketidakhadirannya tidak mengurangi apapun, namun kehadirannya akan memberi manfaat, karenanya ia sangat diharapkan. Untuk menjadi manusia jenis ini, engkau harus punya perangkat dalam dirimu berupa kesediaan memuliakan orang lain, menghargai, dan mencintai. Perangkat ini harus bertemu dengan gerakan nyata dari seperangkat organ tubuhmu; kaki, tangan, mulut, lidah, mata dan semuanya. Ketika perangkat yang berupa software itu sepadan dengan hardware berupa aksi-aksimu, saat itulah maqam-mu terangkat. Yang paling tinggi adalah jenis manusia wajib. Kalau engkau tak hadir orang lain akan mencari-carimu, merindukanmu, bahkan memimpikan engkau. Karena tidakhadiranmu adalah kerugian bahkan azab bagi mereka, sedang kehadiranmu selalu saja jadi sumber kebahagiaan, sumber inspirasi dan sumber maslahat. Manusia seperti ini tak cukup sekedar menjadi orang baik. Tapi seluruh indranya senantiasa aktif, akalnya kreatif, niatnya progresif, dan aplikasi sikapnya selalu saja konkrit— meski semua itu hanya menyisakan sedikit saja untuk kepentingan dirinya sendiri. Hari-harinya adalah pengorbanan tanpa imbalan. *** Ketika George Bush Junior terpilih untuk kedua kalinya menjadi Presiden AS, ada “mahluk” di dalam diri saya yang berontak. Dia protes keras dan memaksa saya untuk bertindak—meski saya tak pernah bisa melibas bokong si Bush dengan rotan. Yaa, protesnya ini didasari keprihatinan sang mahluk pada ribuan nyawa rakyat Irak dan Aghanistan yang meregang nyawa karena perintahnya. Nyatanya, Bush dipilih lagi jadi presiden. Si preman cowboy itu, tak pernah tahu kegalauan ini, sampai matinya mungkin dia tak akan pernah tahu. Tapi kehadirannya di dunia ini telah membuat penderitaan yang meresonansi ke segala penjuru. Lihatlah betapa dahsyatnya manusia haram itu. Ini pilihan. Manusia haram seperti Bush dipenuhi harga diri yang megah, meski sebenarnya semu. Tapi untuk menjadi manusia wajib engkau harus menahan dengan kesabaranmu caci makian itu. Engkau bahkan aktif mencari kebaikan kepada orang seperti wanita berseragam sekolah itu. Ya, manusia wajib atau haram itu pilihan. Tuhan menyediakan beragam perangkat peristiwa juga impian-impian di sekitarmu. Engkau hanya tinggal pilih.(Vol.447, 20/9/ 2012)

Kolom foliopini dapat juga diakses melalui

Pemimpin Indonesia Akan Datang Oleh Shohibul Anshor Siregar Bagaimana landasan agama menjadi sebuah model nasionalisme modern di Iran,idiologi dan identitas yang selalu diperkuat baik di Eropa,Amerika,Asia maupun Afrika. Indonesia sangat tak mungkin dipisahkan dari pentingnya peran agama...


eberapa bulan lalu sebuah forum diselenggarakan komunitas mahasiswa di Bandung. Salah satu topik yang dibahas ialah kriteria pemimpin pasca SBY-Boediono, atau mencari sosok pemimpin pengganti SBY-Boediono. Komunitas mahasiswa ini kelihatannya sedang berusaha mengkonstruksi panduan objektif menjawab masalah kepemimpinan nasional. Mereka tentu bukan tidak tahu figurfigur yang sudah mempromosikan diri dengan berbagai cara, atau dipromosikan oleh berbagai kalangan khususnya partai politik. Berbagai model perkampanyean yangdigelardenganpilihanberbagaimedia serta kreativitas yang beraneka, rupa-rupanyatidakmembuatmahasiswaitusertamerta nrimo. Keluhan Kebangsaan Dalam setiap transisi (dari agraris ke industrial, dari tertutup ke terbuka, dari militeristik ke sipil, dan sebagainya), akan ada tidak saja ruang tetapi juga waktu yang menunjukkan pengisian peran-peran dari tidaksajaindividu,tetapijugainstitusi,yang berusaha mengadaptasi diri dan bahkan dapat terlihat dominan dalam saling bentur. Adaptasi bisa bergerak ke dua arah, memang, dan itu lazim. Karena dalam setiap transisi akan ada orang dan institusi yang diuntungkan dan sebaliknya. Maka kontradiksi-kontradiksitidakbisadinafikan. Itu sudah lumrah. Teori prismatic society yang dibangun oleh Riggs sedikit banyaknya bercerita tentang itu. Pada umumnya puncak-puncak peradaban dunia pun lahir dengan proses perbenturan seperti ini. Teori-teori besar dan tokoh-tokoh pencetus yang menjadi legendaris dan tidak terpatahkan pengaruhnya sampai hari ini diyakini juga munculdarimekanismeajegsepertiitu.Mengacu pada teori prismatic society dari Riggs, kelihatannya Indonesia terbentur dan

sangat kesulitan dalam mendudukan peran negara terutama dalam kaitannya dengan makan terpentingnya bagi rakyat. Perbenturan nilai-nilai lokal dan nasional di satu pihak dan upaya-upaya adopsi gagasan-gagasan luar diupayakan untuk keserasian sedemikian rupa meskipun tak semuanya berjalan sesuai keinginan. Agenda bangsa dalam transisi ini juga tak lepas dari upaya terus menerus mengkonsolidasikan diri sebagai sebuah bangsa yang jika ditelaah lebih mikro juga penuh dengan kemungkinan ketidak-cocokan di antara para stakeholdernya. Keadilan dan kemakmuran yang terbagi tak merata dan akses untuk progresivitas selalu menjadi isu krusial yang menentukan ketahanannasionalbangsaitu.Pemimpin-pemimpin mereka tampil silih berganti dalam kategori-kategori yang tak seragam. Akan ada idola untuk dijadikan legenda sepanjang masa. Tetapi peluang kemerosotan kenegarawan selalu mengancam kepemimpinan bangsa ini hingga tak jarang sebuah terus-menerus berada di bawah kepemimpinan yang tak setia kepada rakyat karena kenikmatan berkuasa. Saya yakin, itulah kerangka berpikir kelompok mahasiswa yang menyelenggarakan forum itu. Sebuah ketakpuasan yang diekspresikan dalam keluhan wajar. Untungnya, mereka masih sangat sehat berfikir dan karenanya mengajak Indonesia mencari solusi bersama. Solusi Konsepsional Marilah kita lihat Indonesia masa lalu, masa kini dan masa depan. Saya tawarkan variable-variableberikut.Pertama,identitas bersama yang sarat nilai (baik yang bersumber dari nilai-nilai primordial, nilai sakral, nilai personal maupun nilai sipil), yang dibarengi dengan pengukuhan oleh norma dan pembangunan simbol-simbol ekspresif. Kita dapat memperbandingan bekerjanya semua unsur-unsur itu dalam

catatansejarah,misalnyabagaimanaidentitassakraldanpolitikbegitupentingdalam membangun Israel kuno, bagaimana konsepsi Kristianitas, identitas dan tatanan politik, sekaligus menjadi citra umum dalam sejarah Roma. Bagaimana landasan agama menjadi sebuah model nasionalisme modern di Iran, idiologi dan identitas yang selalu diperkuat baik di Eropa, Amerika, Asia maupun Afrika. Indonesia sangat tak mungkin dipisahkan dari pentingnya peran agama dan konsolidasinya dalam menata keserasian dinamis tanpa terkendala oleh dominasi mayoritas yang melindungi minoritas. Kedua, pengorganisasian alat-alat kekuasaan yang efektif sekaligus mengharuskan kita belajar lagi lebih banyak tentang konsep kekuasaan politik, tipe-tipe sumberdaya politik (fisik, ekonomi, normatif, personal dan keahlian) serta penggunaan kekuasaan politik. Kekuasaan yang secara gamblang kerap dipastikan tend to corrupt (cenderung korup) tak jarang membuat suatu bangsa dan negara berkesudahan dengan duka di tangan rezim yang tidak amanah, terlepas apa bahasa apologi dari rezim itu kepada rakyatnya dan kepada dunia. Ada parameter-parameter objektif yang secara konsepsional tadinya dimaksudkan untuk assesment jujur terhadap keadaan,namunbegitumudahdimanipulasi untuk berbicara bagi kepentingan lain. Ada keadilan objektif dan ada penderitaan subjektif. Di antara keduanya begitu sulit dicari titik perdamaian, pun di antara keadian objektif dan keadilan subjektif.Tidak ada orang yang bersedia untuk disabarkan agarterus-menerusmenderita,sedangkan yang lain diterima saja penuh kenikmatan. Indonesia berusaha mengantisipasinya sejakawaldenganmementingkankeadilan di atas kemakmuran. Adil dan makmur. Bukan sebliknya, makmur dan lalu adil. Ketiga, penegakan wewenang yang sah. Dalam prosesnya variable ini telah mengantar Indonesia sebagai salah satu murid terakhir demokrasi dunia tanpa substansi. Paling tidak untuk hari ini, Indonesiahanyatahuprosedurtetapigagalmemahami nilainya. Kerena itu perlu dipelajarisungguh-sungguhkonsepwewenang politik, sikap-sikap terhadap wewenang, legitimasi, serta konsekuensi-konsekuensi politik dari legitimasi. Jangan ada yang

menganggap wewenang menjadi keniscayaan untuk hak-hak khusus yang aneh yang memicu ketidak adilan dan ketidakjujuran. Keempat, produksi barang dan jasa. Adalah fakta yang sulit dibantah bahwa Indonesia belum memiliki sempatan menerapkan sendiri model-model hubungan antara sistem politik dan ekonomi. Itu karena Indonesia lebih mungkin melakukan sesuatu kebanyakan bukan karena kemauannya melainkan karena ketergantungannya kepada dikte asing. Fungsifungsi pemerintahan dalam ekonomi dan kebijakan-kebijakan ekonomi sesungguhnya harus ditata sedemikian rupa dengan belajar banyak kepada guru yang lain. Penutup Keyakinan-keyakinan politik, strukturstruktur politik, rekrutmen orang-orang amanahdankebijakanyangadilamatperlu dipurifikasi mengawali semua langkah. Kitainginpolitikhanyalahsebagaiartikulasi kepentingan publik. Kita ingin terwujud pola pengoperasian negara yang terbaik. Kita ingin kebijakan selalu didasarkan pada asumsi pemihakan yang kuat atas kesejahteraan rakyat. Singkatnya, kita ingin memanusiakan marusia Indonesia, membangsakan bangsa Indonesia dan menegarakannegaraIndonesiadalamaktualisasi diri yang optimum. Dengan segala penghormatan atas ketinggian segala macam pola pikir dan budayanusantara,sayaingintegaskanbahwa ramalan Joyoboyo akan mengantar kita ke sebuah permusuhan dengan urusanurusan aktual yang menjadi kewajiban kita hari ini. Berdirilah secara realistis, fahami ketertinggalanmu,beripenyadarankepada rakyatmu dan berpuasalah dari korupsi dengan memulai hidup sederhana. Ini bukan sebentuk negasi atas nilai-nilai leluhur bangsa, melainkan ketercerahan dengan kesiapan meninggalkan segala sesuatu yangsemestinyasudahterkuburolehmasa. Pertanyaan Indonesia ke depan bukanlah pada kapabilitas pemimpin.Tetapi lebih pada integritas. Tetapi, bagaimana integritas dapat dihargai oleh mekanisme yang meniscayakan keterpilihan melalui demokrasi “danga-danga” yang tak substantif? Menangislah untuk Indonesia. Penulis adalah dosen FISIP UMSU, Koordinator Umum ‘nBASIS.

Pilkada 2013 & Galau Golkar Sumut Oleh Riza Fakhrumi Tahir Kendali Golkar Sumut semakin lemah, akibatnya, bermunculan“ketua-ketua kecil” yang memanfaatkan kelemahan kontrol untuk kepentingan pribadi dan kelompok.


enurut kamus besar bahasa Indonesia (KBI, 2002), galau berarti kacau tidak menentu (pikiran).Kalauditerjemahkansecaraumum, kegalauanberartikekacauanberfikirdalam menyikapi suatu keadaan. Mindset-nya tidak jelas, rancu, amburadul bahkan bisa disebut disorientasi. Situasi seperti itulah yang terjadi saat ini di DPD Partai Golkar Provinsi Sumatera Utara, bahkan DPP Partai Golkar, dalam menghadapi Pemilihan Kepala Daerah (Pilkada) Sumatera Utara 2013. Keterlambatan Golkar Sumut, bahkan pelanggaran pelaksanaan tahapan Pilkada sesuai PetunjukPelaksana(Juklak)DPPPartaiGolkar No : JUKLAK-13/DPP/GOLKAR/XI/2011 tentangTatacara Pemilihan Kepala Daerah indikasi adanya kekacauan cara berfikir para elitnya dalam merumuskan rencara strategi pemenangan Pilkada 2013. Pihak pertama yang mengungkap indikasi kegalauan Golkar dalam menghadapi Pilkada Sumut 2013 adalah DPP Golkar, ketika Mei lalu melalui Wakil Sekjen LeoNababanmengatakankemedia,sudah 20 bakal calon Gubsu yang mendaftar di Golkar. Padahal, saat itu Golkar Sumut belum membuka pendaftaran. Golkar Sumut baru membuka pendaftaran pada 12 s/d 25 Juni. Pernyataan ini telah membuka aib adanya kegalauan dalam penentuan bakal Cagubsu dan menjadi sebuah kesalahan(individualdanlembaga)karena pernyatan Leo Nababan tidak didasari

fakta-fakta. Kegalauan berikutnya, ketika PelaksanaTugas (Plt) Ketua Golkar Provinsi SumutAndiAhmadDara(Aday)mengatakan GolkarSumuthanyaakanmerekomendasi dua kader Golkar, Chairuman Harahap dan Tengku Erry Nuradi, ke DPP Partai GOLKAR sebagai bakal calon gubernur (6/8). Sejumlah pengurus Golkar Sumut kemudian membuat pernyataan berbeda dengan Aday. Kontraproduktif Munculnya pernyataan Aday dan pernyataan berbeda dari para wakil ketua, merupakan cermin adanya disinformasi di Golkar Sumut. Boleh jadi ada pihak yang menutup-nutupi dan memanipulasi fakta (disinformasi) sehingga Aday menerima informasi tidak utuh. Dalam menghadapi Pilkada Sumut, kegalauan seperti ini seharusnya tidak terjadi. Apalagi, Golkar Sumut baru saja merevitalisasi kepengurusan, yang seharusnya mampu menghalau kekacauan berpikir seperti itu. Dampak dari kegalauan elit Golkar terhadap pelaksanaan fungsi-fungsi koordinasi adalah tidak terlaksananya Juklak DPP Partai GOLKAR No : JUKLAK-13/ DPP/GOLKAR/XI/2011 tentangTatacara Pemilihan Kepala Daerah secara utuh, terutama dalam proses inventarisasi namanamatokohyangdiperkirakanberpeluang menjadi calon kepala daerah/wakil kepala

daerah. Sesuai Juklak, dalam proses inventarisasibakalcalon,GolkarSumutterlebihdahulumendengarmasukandariDPD Partai Golkar Kabupaten dan Kota, selambatnya H-13 bulan sebelum hari pemungutan suara. Ternyatahinggakini(H-6bulan)Golkar Sumutbelumpernahmenerimamasukan dariGolkarkabupatendankota,baiksecara administratif maupun melalui Rapat Pimpinan Daerah (Rapimda). Jadi, Golkar Sumut sudah mengabaikan aspirasi dan hakhakkonstitusionalDPDPartaiGolkarkabupaten dan kota dalam proses penjaringan bakal calon. Ini merupakan pelanggaran jadwal dan tahapan penjaringan sesuai Juklak No. 13/2011. Dalam menghadapi Pilkada Sumut 2013, sikap Golkar Sumut sangat paradoks dengan langkah-langkah yang diambilnya pada bulan Mei lalu, ketika Aday dengan kekuasaan yang dimilikinya memobilisasi ketua-ketuaDPDPartaiGolkarkabupaten/ kota se Sumatera Utara ke Jakarta untuk menyatakan kebulatan tekad mendukung AburizalBakriesebagaisatu–satunyacalon presidendari PartaiGolkar.Padahal,Pilpres masih dua tahu lagi. Kenapa saat menginventarisasi bakal calon pada tahapan penjaringan Cagubsu, Aday tidak mendengarkan pendapat dan masukan DPD Partai Golkar kabupaten/kota se Sumatera Utara hingga H-6 bulan saat ini ? Padahal, Juklak No. 13/2011 mengatur hal itu. Penutup ApakahpernyataanWakilKetuaGolkar Sumut Amru Daulay bahwa Golkar akan mengumumkan Cagubsu pada Oktober mendatang merupakan sikap lembaga atau pribadi? Dalam situasi ketika terjadi kegalauan dan Aday sangat pasif memimpin Golkar Sumut, saya sangat meragukan kompetensi dan akurasi pernyataan-

pernyataan para wakil ketua dan sekretaris di media massa. Pernyataan-pernyataan penting, seperti yang disampaikan Amru Daulay, seharusnya dilakukan oleh Aday. Hal ini bukan hanya untuk kepentingan publikasi,tapijugapentinguntukmemberi kepastianparabakalcalondanpartai-partai politikdalammembuatkeputusan,apakah mereka akan menggunakan kenderaan politik Golkar atau tidak, apakah Golkar dijadikan mitra koalisi atau tidak. Kompleksitas persoalan yang terjadi selama lebih setahun ini—apalagi pernyataan itu hanya diklarifikasi oleh para wakil ketua. Semua orang tahu, kepemimpinan Parpol maupun Ormas adalah kolegial, ter-masuk di Golkar. Tapi, kita juga tahu persis seperti apa kinerja Golkar Sumut tiga bulan terakhir pasca revitalisasi, sehingga kita sulit percaya bahwa klarifikasi para wakil ketua itu merupakan cermin kolegialitas pengurus. Apalagi pernyataan Aday adalah pernyataan resmi seorang Plt. Ketua, penanggungjawab partai, sehingga publik menganggap sikap Golkar Sumut hingga saat ini seperti yang dikatakan Aday. Klarifikasi atas pernyataan Aday hanya bisa dilakukan oleh Aday sendiri atau DPP Golkar, bukan para wakil ketua meskipun semangat kolegialitas itu ada. Kendali dan pengawasan yang dilakukan Aday selaku Plt.Ketua terhadap aktivitas politik Golkar Sumut semakin lemah (kalau tidak ingin disebut tidak ada). Akibatnya, sekarang ini di Golkar Sumut bermunculan “ketua – ketua kecil” yang memanfaatkan kelemahan kontrol untuk kepentingan pribadi dan kelompok. Penulis adalah Sekretaris PDK Kosgoro 1957 Sumut, Ketua DPD Barisan Muda Kosgoro 1957 Sumut, Dan Mantan Wakil Sekretaris (Bidang Kajian Strategis) DPD Golkar Sumut.

Ekonomi & Bisnis


WASPADA Kamis 20 September 2012

Masyarakat Kecil Tidak Kena Kenaikan Tarif Listrik BANDUNG (Waspada): Menteri Energi Sumber Daya Mineral (ESDM) Jero Wacik menjamin masyarakat kecil pengguna listrik 450 dan 900 watt tidak akan terkena imbas rencana kenaikan tarif tenaga listrik (TTL) sebesar 15 persen yang akan diberlakukan awal 2013.

Konsumen Mulai Ragu Beli BB

“Jadi untuk listrik tahun depan (2013), di APBN yang baru itu akan disesuaikan menambah 15 persen. Itu pun kami usulkan kepada DPR yang pengguna listrik 450 dan 900 watt tidak kena kenaikan, artinya masyarakat kecil tidak kena kenaikan,” kata JeroWacik, di Kota Bandung, Rabu (19/9). Ditemui usai menghadiri silahturahmi Dharma Wanita Kementerian ESDM, di Kantor Badan Geologi Kementerian ESDM Kota Bandung, Jero Wacik mengatakan kenaikan

yang hanya memberikan garansi toko dan harganya bisa lebih murah dari BB yang bergaransi resmi RIM. Tapi biasanya, kata Aliong, itu tergantung dari konsumennya sendiri untuk memilih, karena ada juga konsumen, yang penting bisa dapat baru, murah dan bisa dipakai, tanpa mementingkan garansi yang diberikan. Hal yang sama juga disampaikan penjaga toko Metro Ponsel yang khusus menjual BB resmi bergaransi RIM. Dia mengatakan, pasca dilakukannya razia BB rekondisi, suasana di Plaza Millenium masih seperti biasa, begitu juga dengan para pengunjungnya. “Memang kalau masyarakat untuk membeli BB sangat sedikit bila dibandingkan dengan HP lainnya, terutama untuk HP produk China, itu banyak yang beli karena harganya murah. Kalau kami tidak menjual BB yang murah, tapi sesuai dengan standar resmi dari RIM,” ujarnya yang tak ingin disebutkan namanya. Sementara itu,Yuni, seorang mahasiswa UMA yang berkunjung ke Plaza Millenium Medan mengaku mulai ragu untuk membeli BB. Tidak hanya di tempat tersebut tapi juga di tempat lain, karena dikhawatirkan akan mendapat produk rekondisi. (m41)

SIMALUNGUN (Waspada): Produksi hasil pertanian (perkebunan) petani di Simalungun masih jauh di bawah standar dari hasil produksi perkebunan milik BUMN (Badan Usaha Milik Negara). Hal ini akibat kualitas tanaman dan sistim perawatan yang tidak maksimal. Kepala Dinas Perkebunan Kab. Simalungun, Ir Amran Sinaga, MSi, mengatakan itu kepada Waspada, Rabu (19/9), menanggapi minimnya hasil rata-rata yang diperoleh petani dari hasil produksi perkebunannya, seperti kelapa sawit, karet dan kakao. Dikatakan, perbandingan hasil BUMN dengan petani cukup mencolok, antara 50 s/d 60 persen. Misalnya tanaman kelapa sawit, jika produksi perkebunan milik BUMN bisa mencapai rata-rata 24 ton/hektare/ tahun, maka hasil produksi kelapa sawit milik petani hanya berkisar 12 s/d 14 ton/ hektar/ tahun. Demikian halnya tanaman karet, produksi kebun BUMN mencapai rata-rata 2 ton/hektar/tahun, sedangkan hasil kebun petani hanya berkisar 800 s/d 900 kg/hektar/


Beberapa orang konsumen sedang mengunjungi salah satu toko ponsel yang menjual BlackBerry di Plaza Millenium Medan, Rabu (19/9).

MEDAN (Waspada): Pasca ditemukannya 137 unit BlackBerry (BB) rekondisi atau bekas menjadi baru, di Plaza Millenium Medan oleh Ditreskrimsus Polda Sumut, sebagian konsumen mulai ragu untuk membeli BB. Mereka khawatir BB yang dibelinya ternyata BB bekas yang dibuat seolah-olah baru kembali. Dari pantauan Waspada di Plaza Millenium Medan, Kamis (19/9), aktivitas penjualan handphone di tempat tersebut ber-

jalan normal. Pengunjung tetap berdatangan untuk membeli berbagai jenis handphone yang diinginkan. Namun untuk pembelian BB, konsumen mulai berhati-hati. Terutama untuk produk yang bergaransi took. Aliong, salah seorang penjual HP di Plaza Millenium Medan menyebutkan, setelah adanya razia dan ditemukannya BB rekondisi beberapa hari lalu, konsumen mulai lebih berhatihati untuk membeli BB baru. Mereka selalu menanyakan

garansi yang diberikan. “Setelah ditemukan BB rekondisi kemarin, sedikit mempengaruhi dengan penjualan BB. Konsumen mulai mencurigai setiap BB yang akan dibeli. Namun kami selalu menawarkan BB yang bergaransi nasional RIM atau garansi dari distributor yang memiliki service center, agar konsumen tidak kecewa,” ujarnya. Kata Aliong, BB yang tidak memiliki service center, itu biasanya BB black market (BM),

Apindo-Uni Eropa Lakukan Perjanjian Perkuat Daya Saing M E D A N ( Wa s p a d a ) : Asosiasi Pengusaha Indonesia (Apindo) bekerjasama dengan Uni Eropa berencana melakukan Perjanjian Kemitraan Ekonomi Komprehensif (Comprehensive Economic Partnership Agreement/CEPA). Dengan kerjasama tersebut Indonesia akan lebih diuntungkan dengan penguatan daya saing dan dijamin akses bebas tarif ke UE. Ketua Umum Dewan Pengurus Nasional (DPN) Apindo Sofjan Wanandi, berbicara kepada sekitar 200 pelaku usaha di Medan, Selasa (18/9). Dia datang ke sini untuk menghadiri acara sosialisasi CEPA. Didampingi Ketua Apindo Sumut Parlindungan Purba, Sofjan, menyebutkan Indonesia akan diuntungkan dalam kerjasama ini, karena produk yang diproduksi Indonesia, tidak diproduksi negara-negara UniEropa ini. Karena itu, perjanjian merupakan instrumen yang bagus untuk merevitalisasi hubungan ekonomi ini. Selain untuk menaikkan volume surplus perdagangan, menjamin adanya

pengembangan kapasitas, juga diharapkan menciptakan lapangan kerja baru melalui jalur perdagangan dan investasi. ‘’Karenanya kita harus mempersiapkan diri untuk pelaksanaan kerjasama ini. Jangan sampai kesalahan dengan China diulang kembali,” ujar Sofjan Wanandi. Untuk Sumut, katanya, kerjasama ini dapat memperlancar ekspor ke Uni Eropa, begitu juga sebaliknya, Uni Eropa juga dapat berinvestasi infrastruktur karena Sumut saat ini masih kekurangan gas, listrik dan lainnya. “Apa yang bisa ditawarkan oleh Sumut untuk kerjasama ekonomi ini yang menentukan investasi tersebut. Untuk itu, pengusaha jangan menunggu, harus berinisiatif untuk menawarkan produk. Sehingga investor akan masuk. Karena Sumut juga harus bersaing dengan wilayah lainnya. Kita juga harus menyiapkan terlebih dahulu infrastruktur dan perbaikan birokrasi yang selama ini mempersulit pengusaha,” kata Sofjan. Secara riil, lanjut Sofjan, CEPA diharapkan dapat men-

dorong perdagangan Indonesia dengan menciptakan ekspor tambahan sebesar 9 miliar Dolar AS, terutama untuk industri ringan dan perlengakapan transportasi. CEPA juga akan mendorong perekonomian Indonesia dengan menciptakan PDB tambahan sebesar 6,3 miliar Dolar AS. Menurut Sofyan, meski dilanda krisis ekonomi, Uni Eropa tetap merupakan pasar terbesar di dunia dan menyumbang 20 persen dari Produk Domestik Bruto (PDB) global. Uni Eropa tercatat sebagai mitra dagang terbesar ketiga Indonesia pada tahun 2011, dengan nilai perdagangan lebih dari 30 miliar Dolar AS. Indonesia sendiri, mengalami surplus perdagangan sebesar 8 miliar Dolar AS per tahun. Wakil Kepala Delegasi Uni Eropa untuk Indonesia, Brunei Darussalam dan ASEAN Colin Crooks, mengatakan hubungan Uni Eropa dengan Indonesia berkembang semakin kuat sejak 2004. Uni Eropa memperkirakan perdagangan dengan Indonesia akan lebih berkembang lagi nantinya. (m41)

J A K A RTA ( Wa s p a d a ) : Daihatsu Motor Corporation Ltd (DMC) dan Toyota Motor Corporation (TMC) melalui PT Astra International Tbk sebagai partner kedua merek ini, secara resmi mengumumkan program kolaborasi pembuatan mobil Low Cost Green Car (LCGC) di Indonesia. ‘’Mobil kompak hasil kolaborasi ini dinamakan Astra Daihatsu Ayla dan Astra Toyota Agya. Ayla artinya cahaya dan Agya artinya cepat. Kedua nama ini diambil dari bahasa Sansekerta , mewakili produksi nasional,’’ kata Prijono Sugiarto, Presdir PT Astra International Tbk, saat memberi sambutan di Jakarta, Rabu (19/9). Menurutnya, mobal Ayla dan Agya akan dipasarkan setelah kebijakan LCGC dikeluarkan oleh pemerintah. Diperkirakan akan diproduksi dan dipasarkan pada tahun 2013. ‘’Banyak kalangan menilai, mobil ini adalah terobosan baru bagi dunia otomotif Indonesia,’’ ujar Prijono. Meskipun belum ada kepastian dari pemerintah terkait kebijakan LCGC, tetapi Daihatsu dan Toyota ingin menunjukkan bahwa mereka telah siap menghadirkan mobil berkapasitas lima penumpang dan mesin 1.000 cc. Harganyapun sangat terjangkau dan hemat BBM serta memiliki tingkat emisi gas buang yang ramah lingkungan.’’Inilah hasil kolaborasi ketiga, setelah Avanza-Xenia dan RushTerios,’’ ungkap Prijono. Menteri Perindustrian MS. Hidayat, mengatakan mobil Astra Toyota Agya dan Astra Daihatsu Ayla diperkirakan harganya di bawah Rp 90 juta. Namun penjualannya masih menunggu Peraturan Presiden (Perpres) SBY soal keringanan

Daihatsu Motor Corporation Ltd (DMC) dan Toyota Motor Corporation (TMC) melalui PT Astra International Tbk menunjukkan miniatur varian terbaru dengan harga Rp90 juta. dari anak bangsa. Mereka adalah anak-anak muda dari PT Astra Daihatsu Motor (ADM) di Indonesia. Disebutkan Presdir PT ADM Sudirman MR, hampir tiga tahun, tim Daihatsu mengembangkan mobil ini. Pihak principal Jepang mempercayakan kepada mereka untuk menyusun konsep dasar. ‘’Mereka menilai, tim ADM lebih mengerti apa saja keinginan konsumen Indonesia akan sebuah kendaraan dan bagaimana kondisi infrastrukturnya,” ujarnya Dijelaskan, setelah mendapatkan informasi mengenai kebutuhan masyarakat Indonesia akan sebuah kendaraan, barulah pihak principal menggelar kompetisi untuk desain mobil sesungguhnya. Sejumlah Desainer dari berbagai negara mengikuti kompetisi itu. Ternyata, hasilnya mengejutkan. Kompetisi itu dimenangkan Mark Widjaja, Senior Styling Desainer PT ADM. Anak muda asal Surabaya yang berusia 35 tahun ini berhasil menyisihkan lima perancang lainnya dari Jepang dan Italia yang masuk seleksi akhir. (J03)

J A K A RTA ( Wa s p a d a ) : Setelah sukses di segmen elektronik, Polytron kini merambah ke segmen smartphone yang terjangkau dan mampu diandalkan baik komunikasi maupun sebagai camera profesional. ‘’Nama Polytron sudah tidak asing lagi. Jadi produk yang kami luncurkan bisa diandalkan,’’ ujar direktur pemasaran Polytron TeknoWibowo, pada pembukaan display Polytron Mobile Phone di Jakarta Selasa (18/9). Dalam segmen elektronik, ujar Tekno Wibowo, Polytron sudah menjadi jaminan. Tetapi dalam bidang smartphone, pihaknya baru berjalan satu setengah tahun. ‘’Jadi kami masih pemain muda. Tetapi kami yakin bisa menjadi pemain dibidang smartphone, karena yang kami luncurkan smartphone berbasis android dengan kemampuan yang semakin baik,’’ katanya. Bahkan Tekno, memprediksi target penjualan nanti akan meningkat. Alasannya, karena kebutuhan mobile phone dipastikan akan meningkat men-

pajak. ‘’Tinggal menunggu Perpres keluar saja,’’ jelasnya. Adapun aturan yang akan dikeluarkan Presiden SBY adalah terkait keringanan fiskal mobil ramah lingkungan atau Low Cost Green Car (LCGC). Selain mobil murah dan ramah lingkungan, regulasi itu juga mengatur keringanan fiskal untuk mobil hybrid, listrik, dan mobil untuk petani. Menurut Hidayat, deregulasi hampir selesai dibahas dan saat ini sedang digodok oleh Kementerian Keuangan dan Sekretariat Negara mengenai aturan bagaimana pemberian insentif pajak. Proses perundingan ini menurut Hidayat, sudah memakan waktu 2 tahun. “Sudah 2 tahun proses perundingan, mereka (Astra) mau jual tetapi Perpres belum keluar. Tadi saya lihat modelnya bagus dan harganya hanya 10.000 dolar AS sekitar Rp 90 juta. Modelnya green car jarak 21-22 km/liter dan sudah memiliki 84 persen kandungan lokal,” tuturnya. Yang menarik dari kendaraan fenomenal ini. Rancangan desain Mobil LCGC terbaru ini sepenuhnya adalah hasil karya

Hasil Perkebunan Petani Simalungun Di Bawah Standar tahun. Sedangkan tanaman kakao (coklat), hasil kebun BUMN rata-rata sekitar 1,2 ton/ hektar/tahun, hasil tanaman petani hanya sekitar 600 s/d 800 kg/hektar/tahun. Sementara hasil tanaman kopi rakyat ratarata 1,2 s/d 1,5 ton/hektar/ tahun. Menurut Amran, rendahnya hasil produksi perkebunan milik petani akibat bibit tanaman kurang berkualitas dan sistim pemeliharaan serta pemupukannya yang tidak maksimal. “ Bibit sewaktu ditanam tidak berkualitas dan pemeliharaan dan pemupukannya kurang maksimal, sehingga akhirnya hasil produksi jauh dibawah standar yang diharapkan,” ujar Amran. Siapkan Bibit Sekaitan itu, Kadis Perkebunan Simalungun Amran Sinaga, menyatakan pihaknya untuk Tahun Anggaran (TA) 2012 telah menyiapkan bibit tanaman perkebunan berkualitas, seperti bibit kelapa sawit 60 ribu batang, bibit coklat okulasi 100 ribu batang, bibit karet okulasi 100 ribu batang dan bibit kopi 30 ribu batang.(a29)

Polandia-Sumut Kembangkan Perdagangan Dan Investasi MEDAN (Waspada): Negara Polandia berencana akan mengembangkan perdagangan dan investasi dengan Sumatera Utara. Untuk mewujudkan kerjasama itu, Selasa (18/9), telah dilaksanakan pertemuan antara pengurus Kamar Dagang dan Industri (Kadin) Sumut dengan Kepala TIPD Konselor Pertama Romuald Morawski. Pada pertemuan yang berlangsung di kantor Kadin Sumut itu, hadir Ketua Kadin Irfan Mutyara, Wakil Ketua Kadin yang juga Konsul Kehormatan Republik Polandia di Medan Jonner Napitupulu dan Ketua Komite Dalbir S. Kapoor. Pada pertemuan itu terungkap bahwa Polandian, melalui Divisi Promosi Perdagangan dan Investasi (TIPD) Kedutaan Besar Polandia di Jakarta bekerjasama dengan Konsulat Kehormatan Polandia di Medan akan mengembangkan perdagangan dan investasi di daerah ini. Disebutkan Jonner Napitupulu, menyampaikan pertemuan tersebut mengundang

Daihatsu, Toyota Umumkan Kolaborasi Produksi Mobil LCGC

TTL awal tahun 2013 tersebut akan dibebankan pada masyarakat pengguna listrik di atas 1.300 watt. “Yang kena kenaikan itu adalah yang 1.300 ke atas. Atau yang sudah punya AC (pending-in ruangan), punya TV tiga masa nggak mau naikkan listriknya sedikit. Kalau kita hitunghitung naiknya itu ada yang Rp3 ribu per bulan ada yang Rp5 ribu per bulan. Memang beban tapi tidak berat lah tapi dibandingkan beli pulsa lebih sedikit lah,” katanya.

para perwakilan dari Dinas Perindustrian dan Perdagangan, Badan Penanaman Modal, Kamar Dagang dan Industri serta kalangan pengusaha di Sumut. ‘’Pertemuan ini merupakan pertukaran informasi untuk mengupayakan peningkatan kontrak antara para pelaku usaha Polandia dan Sumut, saling mendorong perdagangan dan investasi dua arah,’’ ujarnya. Pada kesempatan itu, Morawski menyampaikan, Polandia merupakan negara anggota Uni Eropa yang memiliki luas wilayah dan jumlah populasi terbesar ke-6 di Uni Eropa. Dalam nilai Gross Domestic Product (GDP) mencapai 514 miliar Dolar AS pada 2011, menempati urutan ke-7 terbesar di Uni Eropa dan ke22 di dunia. “Pada 2009, Polandia merupakan satu-satunya negara anggota Uni Eropa yang mencatat pertumbuhan GDP yang positif. Tahun lalu, pertumbuhan GDP sebesar 4,3 persen, termasuk

yang tertinggi di Eropa dan nilai GDP per kapita Polandia mencapai 20.334 Dolar AS,’’ ujar Morawski. Disebutkannya, impor utama Polandia dari Indonesia di antaranya minyak nabati, karet, kopi, teh, tembakau, hasil kayu, tekstil, produk kaca, peralatan rumah tangga, dan furnitur. Sedangkan ekspor Polandia ke Indonesia di antaranya peralatan permesinan, elektronik, zat-zat kimia, peralatan militer, hasil pertanian dan peternakan (daging), serta produk olahan susu. “Dalam waktu dekat, proses sertifikasi halal daging sapi dan ayam Polandia akan rampung,” ujarnya Morawski. Ketua Kadin Sumut Irfan Mutyara, sangat menyambut baik upaya pengembangan kerjasama tersebut. Namun dia berharap kerjasama itu tidak hanya sekedar mengirimkan bahan baku ke Polandia saja. Diharapkan ke depan Polandia bisa membuka pabrik pengolahan bahan baku.(m41)

Polytron Rambah Segmen Smartphone jelang hari-hari besar keagamaan. PT Hartono Istana Teknologi, sebagai produsen Polytron menargetkan dapat menguasai 10 persen pasar android di dalam negeri. Dalam acara kemarin, Polytron meluncurkan dua tipe baru yaitu W3430 dan PW11100S. Kedua tipe itu berada dalam keluarga wizard. W3430 mempunyai keunggulan tersendiri, yaitu wizard Crystal ‘The art of clarity. Karena layarW3430 adalah layar super amoled, sehingga gambar yang dihasilkan sejernih kristal. Ukuran layar yang 4,3 inci dapat menampilkan jutaan warna yang sngat jernih dengan contrast ratio yang tinggi, membuat gambar yang dijepret tampil lebih sempurna. Tipe ini dilengkapi juga dengan Gigahertz processor serta memory yang cukup besar. Sedangkan android yang digunakan adalah ICS versi 4.0.3. Dengan kelengkapan memory 4GB, tipe 3430 bisa menjalankan aplikasi_aplikasi terbaru yang berada di Google Play Store

dengan baik dan lancar. Tipe ini idukung pula kamera wizard crystal memiliki resolusi 8 Mega Pixel dan berkemampuan auto focus dan flash light. W3430 Wizard Crystal diperuntukkan sebagai smartphone untuk pelaku bisnis yang membutuhkan stylish smartphone dengan kualitas bagus dan bisa beragam aplikasi yang dibutuhkan. Harganya akan dijual Rp 2.999.000. Polytron memberikan potongan harga Rp500.000 sampai akhir September tahun ini. Untuk pengguna smartphone pertama, Polytron sudah memiliki W1350 yang dijual seharga Rp799.000. Produk baru dikategori ini yaitu PW1100S yang merupakan upgrade W1350. Tentu saja ditambah dengan fitur-fitur dan dilengkapi fasilitas dan design yang menarik akan dijual Rp 999.000. ‘’Untuk layanan pelanggan, saat ini Polytron memiliki lebih dari 50 lokasi service center yang tersebar di seluruh Indonesia,’’ d e m i k i a n k a t a Te k n o Wibowo.(j07)

Wakil Ketua Umum Kadin Bidang Industri, Riset dan Teknologi Bambang Sujagad mengatakan keputusan kenaikan TDL tersebut akan berpengaruh pada biaya produksi, karena biaya listrik masuk dalam biaya produksi sebesar 20 persen. “Jadi itu akan berpengaruh karena struktur listrik itu 20 persen dari struktur produksi. Kalau naik 15 persen itu sangat berpengaruh secara signifikan,” kata Bambang, di JW Marriot Hotel Mega Kuningan, Jakarta, Rabu (19/9). Menurut Bambang, dengan adanya kenaikan TDL tersebut dikhawatirkan akan tejadinya penurunan daya saing produksi barang dalam negeri karena masuknya barang impor. “Kita kalah bersaing dan khawatir industri kita jadi berkurang karena 60 persen pasar itu sudah dikuasai barang impor,” ungkap Bambang. Bambang menjelaskan nantinya industri yang akan terkena dampak kenaikan TDL tersebut adalah industri besi baja, industri metal dan industri scrap karena aktifitas produksinya cukup tinggi dalam menggunakan listrik. “Industri yang banyak gunakan listrik, industri besi, metal, scrap itu kan listrik terus,” tutup Bambang. (okz/ant)

Pihaknya mengimbau agar masyarakat tidak perlu panik dengan rencana kenaikan TDL tersebut karena pemerintah sudah menghitung dan mengkalkulasikan dengan benar rencana kenaikan TTL itu dengan semua DPR. “Jadi jangan terlalu resah lah, listrik naik wah jadi gimana gitu. Kami menghitung dan kami tahu kok bagaimana perasaan rakyat agar naiknya ini tidak terlalu kaget,” ujar dia. Dikatakannya, kenaikan TTL yang naik 15 persen pada tahun 2013 juga akan dilakukan dengan dua metode pertama ialah kenaikannya dibagi per tiga bulan dan kedua ialah kenaikannya dibagi per satu bulan. Oleh karena itu, pihaknya meminta kepada masyarakat khususnya pelanggan listrik dari kalangan industri untuk bisa mengerti maksud dari kenaikan TTL itu. “Jadi wajar saja kalau penolakan, semua menolak (TTL) naik. Tapi saya minta industri mengerti,” katanya. Picu Kenaikan Harga Kamar Dagang dan Industri (Kadin) Indonesia menyatakan dengan adanya kenaikan Tarif Dasar Listrik (TDL) sebesar 15 persen pada 2013 akan berdampak pada kenaikan harga produksi yang signifikan.

Pelaku UKM Terancam MEDAN (Waspada) : Para pelaku Usaha Kecil Menengah (UKM), khususnya di Pusat Industri Kecil (PIK), Jalan Menteng Medan mulai resah. Mereka tidak yakin, usaha mereka akan bertahan lama, dan segera gulung tikar. Produk luar negeri sekaang ini menguasai pasar. Sejumlah perajin sepatu kulit di PIK, berbicara kepadaWaspada, Selasa (18/9). Mereka mengaku perhatian pemerintah kota (Pemko), khususnya Dinas Koperasi sangat minim. Tidak ada bantuan dan pembinaan yang diberikan kepada peraji. Sementara produk luar negeri terus masuk. Seorang perajin, Agus, mengatakan sudah banyak mereka yang gulung tikar, karena tidak kuat bersaing. Perlindungan dari pemerintah kepada UKM di daerah ini tidak ada sama sekali. Mekanisme pasar benar-benar dibuka. ‘’Akibatnya kami sangat sulit untuk mendapatkan pasar. Harusnya pemerintah mampu memberikan solusi bagi para UKM. Pemerintah juga harus mampu membatasi masuknya barang impor agar para UKM tak gulung tikar,’’katanya. Ditambahkannya, selama tujuh tahun menggeluti usaha sepatu, hanya pada bulan Ramadhan saja Agus, merasakan untung yang lumayan. Di luar itu, menjual dua lusin per minggu saja sangat sulit. ‘’Satu pasang sepatu modalnya Rp40.000,’’ kata Agus. Para pelaku UKM di PIK berharap agar Pemko Medan lebih memperhatikan para UKM serta mengawasi produk-produk luar yang beredar dipasaran. Karena hal tersebut dapat mematikan perekonomian para UKM di daerah ini. Dari pantauan Waspada, lokasi PIK sekarang ini terlihat sunyi. Hanya sebagian pemilik UKM saja yang terlihat beraktivitas. Mulai dari menjahit sepatu dan menjahit pakaian jadi. Bahkan, bangunan Ruko dua lantai itu banyak yang tertutup. (cdu)

Daftar Harga Bahan Pokok Di Medan, Rabu (20/9) -Beras IR 64 -Beras Ramos -Beras Kuku Balam -Beras Kita -Beras Aceh -Minyak Goreng Kuning -Minyak Goreng Tropical -Minyak Goreng Bimoli -IKan Teri Belah -Ikan Teri Nasi Jumbo -Ikan Teri Medan -Ikan Asin Kakap -Ikan Asin Senangin -Ikan Asin Kepala Batu -Ikan Asin Gabus -Gula Merah Aren -Tepung Terigu Biasa -Tepung Terigu Bogasari -Kacang Tanah -Kacang Hijau -Telur Ayam Ras -Telur Ayam Kampung -Telur Bebek -Telur Puyuh -Cabai Merah -Cabai Rawit -Cabai Hijau -Bawang Merah -Bawang Putih -Gula Pasir -Daging Sapi -Ikan Tongkol -Ikan Dencis -Ikan Mujair -Ikan Kakap -Ikan Bawal

: Rp8.500 per kg : Rp9.500 per kg : Rp9.500 per kg : Rp8.000 per kg : Rp8.000 per kg : Rp10.500 per kg : Rp24.000 per 2 Liter : Rp24.000 per 2 Liter : Rp80.000 per kg : Rp65.000 per kg : Rp60.000 per kg : Rp70.000 per kg : Rp85.000 per kg : Rp45.000 per kg : Rp60.000 per kg : Rp20.000 per kg : Rp6.700 per kg : Rp7.000 per kg : Rp18.000 per kg : Rp13.000 per kg : Rp9.000 : Rp2.000 : Rp1.700 : Rp350 : Rp16.000 per kg : Rp24.000 per kg : Rp13.000 per kg : Rp15.000 per kg : Rp18.000 per kg : Rp13.000 per kg : Rp75.000 per kg : Rp25.000 per kg : Rp20.000 per kg : Rp20.000 per kg : Rp30.000 per kg : Rp40.000 per kg (cdu)

Harga Emas London Murni (LM) Emas 22 Karat (97%) Emas 17 Karat (70%) Suasa

535.000 490.500 380.000 270.000


Nilai Mata Uang Rupiah Terhadap Mata Uang Asing Mata Uang




Dolar AS Dolar Singapura Dolar Australia Euro Eropa Yen Jepang Dolar Hongkong Ringgit Malaysia Rial Saudi Arabia Poundsterling Inggris


9.535 7.780 9.930 12.435 121,25 1.218 3.080 2.512 15.438

9.555 7.795 9.955 12.460 121,55 1.228 3.120 2.556 15.458


*) Kurs dapat berubah sewaktu-waktu Sumber: PT Bank Mandiri (Persero)


WASPADA Kamis 20 September 2012

Jembatan Seuneubok Teungoh Mengundang Maut

Mahasiswa Singkil Tolak Beasiswa SINGKIL (Waspada) : Mahasiswa Aceh Singkil yang berada di Banda Aceh menolak dengan tegas bantuan beasiswa dari pemerintah melalui Dinas Pendidikan setempat. Pasalnya selain dapat menimbulkan kecemburuan sosial bagi mahasiswa, bantuan Rp190 juta yang bersumber dari APBK Aceh Singkil tahun 2012 itu juga diduga rawan kecurangan. “Untuk itu Kami menolak bantuan beasiswa tersebut,” tegas Jirin Capah, Ketua Himpunan Mahasiswa dan Pelajar Aceh Singkil di Banda Aceh, Selasa (18/9). Menurut Jirin, bantuan sebanyak itu hanya didapatkan mahasiswa yang merupakan orang –orang terdekat pejabat di Aceh Singkil saja, sebab selain anggarannya tidak mencukupi, syarat untuk memperoleh beasiswa tersebut juga sangat sulit dan membebani mahasiswa. Jirin juga mensyinyalir bahwa pemberian bantuan beasiswa tahun ini oleh Pemkab Aceh Singkil hanya sebagai melepaskan tanggungjawab atas keberadaan mahasiswa. Pasalnya jumlah yang dianggarkan tidak sebanding dengan penerima dan ini sangat berbeda jauh dari tahun sebelumnya di mana bantuan yang diberikan Pemkab Aceh Singkil sifatnya merata. “Untuk itu kami mahasiswa Banda Aceh menolak bantuan tersebut,” ujarnya. Kadis Pendidikan Kabupatan Aceh Singkil Sanusi belum berhasil dikonfirmasi, namun menurut sumber di dinas tersebut, bantuan beasiswa hanya diberikan kepada mahasiswa yang memenuhi persyaratan yang ditentukan dengan kategori mahasiswa kurang mampu, berprestasi dan mahasiswa yang sedang melaksanakan skripsi. (cdin)

Calhaj Bandar Bireuen Dilepas BIREUEN (Waspada) : Pelepasan delapan pasangan calhaj Bandar Bireuen di Meunasah Kota, Senin (17/9) malam berlangsung dalam suasana haru. Kedelapan pasangan calhaj Bandar Bireuen yang dilepas perangkat Desa Bandar Bireuen dan Pengurus Meunasah Kota, tiga pasangan calhaj di antaranya H Jasri, Pemimpin Bank Aceh Cabang Bireuen bersama istri, Tgk Muslim, staf kantor Bupati Bireuen bersama istri dan Fahrul Walidin, Kepala SMPN-4 Bireuen bersama istri. Sedangkan lima pasangan calhaj lainnya merupakan pedagang warga Bandar Bireuen. Keuchiek Bandar Bireuen Adnan Adan dan pengurus Meunasah Kota H Adsyiek Yusuf mengatakan, acara pelepasan tamu Allah warga Bandar Bireuen sudah menjadi kegiatan rutin pengurus meunasah kota setiap tahunnya. (b12)

Terdakwa Sabu Kabur Usai Sidang LHOKSEUMAWE (Waspada): Seorang tahanan jaksa atas kasus sabu-sabu, Muzakir, 28, warga Nase, Kecamatan Pandrah, Bireuen kabur dari mobil tahanan usai menjalani sidang di pengadilan menuju LP, Senin (17/9) pukul 15:00. Informasi dihimpun, Muzakir sesudah menjalani sidang di Pengadilan Negeri Lhokseumawe, hendak dibawa pulang ke Lembaga Permasyarakatan (LP) Kelas IIA yang berjarak sekitar 400 meter. Dia dibawa dengan mobil tahanan dengan tangan diborgol bersama teman lainnya. Namun, saat petugas membawa tahanan tersebut, sempat singgah sebentar di warung untuk membeli nasi. Tapi, terdakwa ini malah kabur dan petugas jaksa langsung berusaha mencarinya. Namun, hingga sore kemarin, terdakwa belum ditemukan. “Sampai sore terdakwa belum ditemukan,” kata salah satu sumber di pengadilan. (cmk)

HMI Harus Berpikir Konstruktif SIGLI (Waspada):Wakil Bupati Pidie M Iriawan mengingatkan organisasi Himpunan Mahasiswa Islam (HMI) Cabang Sigli untuk berpikir konstruktif, dari kalangan anti-Islam yang sedang berusaha merusak aqidah dan citra Islam di mata dunia. Apalagi dalam beberapa hari belakangan ini telah terjadi suatu usaha yang sistematis dari kalangan anti-Islam, baik dengan cara melahirkan sekte-sekte agama dari kalangan dalam yang menyimpang dengan hakikat agama yang kita anut, maupun dengan cara penguasaan media massa yang digunakan untuk menjelekkan Islam, seperti yang sedang memanas di berbagai belahan dunia. “Untuk itu, mari kita hadapi dengan bijak dan cerdas. Jangan anarkis meskipun kita sadari yang mereka lakukan itu adalah salah. Mari kita jaga aqidah generasi ini dengan ilmu dan akhlak yang baik,” kata Wabub Pidie M Iriawan pada acara pembukaan Intermediate Training (LKII) dan Senior Course (SC) tingkat nasional Himpunan Mahasiswa Islam (HMI) Cabang Sigli, di Panti AsuhanYayasan Mina Raya, Kecamatan Padang Tiji, Kabupaten Pidie (18/9). (b10)

Calhaj Subulussalam Dilepas SUBULUSSALAM (Waspada): Wakil Wali Kota Subulussalam H Affan Alfian Bintang melepas calon jamaah haji (calhaj) di Masjid Assilmi Subulussalam, Selasa (18/9). Pelepasan dihadiri perwakilan Muspida, Kakan Kemenag, Ketua KomisiDDPRKHAnsariIdrusSambo,KetuaMajelisPer-musyawaratan Ulama (MPU) Qaharuddin Kombih, Ketua IPHI H Darwis Chaniago, Ketua Majelis Adat Aceh (MAA) Layari Kombih, unsur Kepala SKPK, Plt Camat Simpang Kiri Mustoliq, Kades SubulussalamTiber Padang dan undangan lain diawali pembacaan Alquran. Mewakili calhaj, Saripuddin Padang, anggota DPRK sampaikan maaf dan mohon doa agar baik saat berangkat, kembali dan kemudahan menunaikan semua ketentuan ibadah haji diberikan Allah kepada para calhaj. Kadis Syariat Islam Usni B melaporkan, calhaj daerah ini 2012 sebanyak 42 orang, sembilan melalui embarkasi Banda Aceh dan 31 Medan. Embarkasi Medan tergabung dalam kloter VIII masuk asrama, Jumat (28/9) dan Banda Aceh kloter VI gabungan calhaj Nagan Raya, Bireuen dan Subulussalam. (b28)

Waspada/Khairul Boangmanalu

MARIANI Harahap, istri Wakil Wali Kota dan anggota DPRK Subulussalam mempeusijuek calhaj Subulussalam.

Kloter 01 Banda Aceh Dilepas Gubernur BANDA ACEH (Waspada): Kakanwil Kemenag Aceh Ibnu Sa’dan mengatakan, embarkasi haji Banda Aceh telah siap menerima kedatangan jamaah calon haji Provinsi Aceh musim haji tahun 2012 ini. “Seluruh persiapan telah dirampungkan, termasuk visa paspor calhaj sudah 99 persen selesai diproses,” ungkap Ibnu didampingi Kasubbag Hukmas dan KUB Juniazi, Rabu (19/9). Menurut Ibnu, satu persen lagi paspor Calhaj Aceh yang belum siap dan kini sedang diproses di Jakarta merupakan calhaj kloter terakhir. “Kita berharap dalam waktu dekat, bersamaan dengan keberangkatan kloter awal, visa paspor tersebut telah selesai,” ungkap Ibnu. Menyangkut dengan sisa kuota Aceh saat batas akhir pelunasan akhir BPIH tahap III, pada(14/9) lalu,sebanyak 14 porsi lagi, kata Ibnu, ke-14 porsi haji untuk Aceh ini seterusnya menjadi kewenangan Menteri Agama RI. Kecuali itu, terkait biaya hidup calhaj (living cost) selama di Tanah Suci sebesar 1500 rial, sudah selesai didrop oleh PT.Bank BNI Cabang Banda Aceh.Insya Allah,nantinya saat keberangkatan akan dibagikan kepada masing- masing kloter . (b02)


Waspada/Muhammad H Ishak

PENGGUNA jalan melintas di jembatan yang patah di Desa Seuneubok Teungoh, Kec.Idi Rayeuk, Aceh Timur, Rabu (19/9).

Masih Ada Warga Gunakan KTP Merah-Putih KUALASIMPANG (Waspada): Masih ada warga di Kabupaten Aceh Tamiang yang menggunakan Kartu Tanda Penduduk ( KTP) Merah Putih yang pernah diterbitkan oleh pemerintah semasa Provinsi Aceh diwarnai konflik dan diberlakukan wajib bagi warga menggunakan KTP Merah Putih pada masa darurat militer di Aceh. Sedangkan pada zaman sekarang warga harus sudah menggunakan e-KTP secara nasional diberlakukan di Indonesia, sebab batas waktu penggunaan KTP biasa di Aceh akan berakhir pada 31 Desember 2012 sesuai dengan instruksi Gubernur Aceh. Hal itu diungkapkan Kadis Catatan Sipil dan Kependudukan Aceh Tamiang, Ansharuddin menjawab di ruang kerjanya, Rabu (19/9)sehubungan dengan realisasi pembuatan

dan penyaluran e-KTP bagi masyarakat Aceh Tamiang. “Saya juga heran sampai kini masih ada warga yang menggunakan KTP Merah-Putih sisa konflik Aceh .Padahal KTP Merah Putih itu sudah tidak berlaku lagi.Namun, masih ada warga yang berurusan datang ke kantor Capil ini menggunakan KTP Merah –Putih ketika mengurus surat-surat yang diperlukannya,” terang Ansharuddin. Menyinggung tentang realisasi pembuatan dan penyaluran e KTP bagi masyarakat di Kabupaten Aceh Tamiang, Ansharuddin merincikan jumlah penduduk di Kabupaten Aceh Tamiang tercatat sebanyak 288.916 jiwa, sedangkan jumlah riil yang wajib KTP sebanyak 191.218 jiwa dan dari jumlah tersebut sebanyak 154.217 jiwa yang masuk kontrak pembua-

tan e-KTP di Aceh Tamiang ditangani oleh pemerintah pusat. Ansharuddin menjelaskan, dari jumlah 154.217 jiwa itu yang sudah ada realisasinya e-KTP mencapai 146.024 jiwa,sehingga persentase kontraknya angkanya mencapai 94,69 persen. Kadis Capil Kabupaten Aceh Tamiang itu juga menyatakan adapun daftar penerimaan e-KTP Konsorsium PNRI Dinas Kependudukan dan Pencatatan Sipil Kabupaten Aceh Tamiang tercatat jumlah yang diterima dari Pemerintah Pusat mencapai 90.280 e-KTP dan penyerahannya sudah dilaksanakan mencapai 16.021 e-KTP, sedangkan sisa yang belum diterima untuk 12 kecamatan mencapai 63.937 e-KTP dan sisa yang belum diserahkan pihak kecamatan kepada warga mencapai 74.259 e-KTP se-Aceh Tamiang. (b23)

Pasar Labuhan Haji Terancam Gulung Tikar LABUHAN HAJI RAYA (Waspada) : Para pedagang pasar rakyat Blangkejeren di Kecamatan Labuhan Haji Barat, Aceh Selatan mengeluh, pasalnya mereka mengaku mengalami kerugian dan akan berhenti untuk berdagang, karena sepi pembeli. Kepada Waspada, Senin (17/9), Nasir, pedagang suku cadang sepedamotor mengatakan, sudah 3 tahun terakhir ini kondisi pasar di Blangkejeren mulai menurun drastis. “Kami kewalahan hasil dagangan kami yang beberapa hari ini tidak mengalami peningkatan, malah yang ada justru penurunan, padahal kita sudah menjual dengan harga yang lebih murah,”

jelas Nasir yang mengaku sudah 20 tahun berjualan di pasar tersebut. Selama ini, lanjutnya, hasil yang sudah dicapai tidak bisa untuk dijadikan modal selanjutnya, maka terpaksa para pedagang harus menghabiskan dulu barang dagangannya baru nantinya bisa dibelanjakan lagi. “Kalau seperti ini terus otomatis kami pedagang di sini akan melakukan tutup toko dan mencoba untuk mencari usaha lain, atau pindah ke lokasi yang lebih ramai,” ungkapnya. Dilain pihak, Azwardi, pedagang toko kain mengatakan, merosotnya penjualan pedagang di daerah itu karena ekonomi masyarakat di sekitar wila-

yah tersebut sedang dalam kondisi melemah. “Kita sangat tahu kantong masyarakat saat ini, bahkan kadang untuk makan seharihari saja mereka susah, bagaimana untuk belanja kebutuhan sekunder sangat tidak mungkin,” katanya. Pemerintah, ujar dia selama ini dinilai kurang tanggap memberikan pemberdayaan terutama dalam memperhatikan nasib para pedagang di pasar tersebut, apalagi dengan kondisi masyarakat yang hanya berpenghasilan dari memanen pala di gunung dan juga sebagian bertani dan hanya sedikit yang berpropesi sebagai PNS. (b01)

Tiga Bulan Pertama Satukan Diri Dengan Lingkungan Kerja SABANG (Waspada): Sang pemimpin Kota Sabang hasil Pilkada 2012, Zulkifli H Adam dan Nazaruddian alias Tgk Agam yang diusung dari Partai Aceh kini telah dilantik sebagai Wali Kota dan Wakil Wali Kota Sabang oleh Gubernur Aceh Zaini Abdullah di gedung dewan, Senin (17/9). Terpilihnya kedua tokoh dari Partai Aceh ini sebagai pemimpin daerah yang berpenduduk 37 ribu jiwa itu merupakan sejarah baru bagi masyarakat Sabang. Sebab baru kali ini Wali Kota Sabang dipimpin putra daerah asli. Zulkifli H Adam, yang dikaruniai 5 orang anak dari hasil perkawinannya dengan Mulyanasari hanya mampu meraih pendidikan terakhir pada SMA PGRI, sedangkan istrinya tamatan SMK Cot Ba’u Sabang. Sungguh sangat berbahagia pemuda kelahiran 17 September 1975 itu dilantik sebagaiWali Kota Sabang bertepatan pada hari ulang tahunnya ke-37. Gubernur Aceh. Zaini Abdullah sempat menyampaikan ucapan selaat ulang tahun kepada sang pemimpin Sabang ini. Ketika duduk di kursi kehormatan di gedung DPRK Sabang, Wakil Wali Kota Sabang Tgk Agam panggilan akrab Nazaruddin yang lahir di Sabang, 12 Maret 1972 ini dengan ciri khas senyumnya seperti tidak canggung lagi duduk berdapingan denganWali Kota Sabang Zulkifli H Adam. Sebab kedua figur yang berasal dari arus bawah ini sebelum mencalonkan diri sebagaiWali Kota danWakilWali Kota Sabang berprofesi sebagai anggota DPRK Sabang hasil Pemilu

IDI (Waspada): Jembatan utama lintasan jalan raya ke Idi Timur, Kabupaten Aceh Timur kini mengundang maut. Meski tergolong belum kritis, namun akibat ketiadaan lantai mengakibatkan roda empat tidak bisa melintas. Tak hanya itu, kondisi jembatan yang sudah lama tidak diperbaiki juga membuat sarana transportasi tersebut kian parah. Bahkan beberapa lantai sudah lapuk dimakan usia. Meski demikian, warga terpaksa menggunakan jembatan itu karena jembatan yang tidak jauh dari dayah/pesantren itu merupakan satu-satunya jembatan sebagai akses sejumlah desa di Kecamatan Idi Timur ke Kota Idi sebagai Pusat Pemkab Aceh Timur. “Kita meminta Dinas Pekerjaan Umum (PU) melihat langsung kondisi jembatan ini sehingga bisa dialokasikan dalam Anggaran Pendapatan Belanja Kabupaten (APBK) ataupun APBA 2013,” kata Abdullah, 35, pengguna

jalan, Rabu (19/9). Dia mengaku, kondisi jembatan sepintas masih dalam kondisi baik, tetapi beberapa lantai yang terbuat dari papan itu sudah mulai lapuk dan mengancam pengguna jalan, baik roda dua ataupun roda empat. “Lebih-lebih jembatan itu selama ini dilintasi truk pengangkut material pembangunan PNPM-MPd dan BKPG di gampong-gampong,” kata Abdullah lagi. Camat Idi Timur Mukhtaruddin ketika dikonfirmasi secara terpisah membenarkan kondisi jembatan utama menuju sejumlah desa di sana dalam kondisi rusak, bahkan pihaknya telah mengusulkan ke Pemkab Aceh Timur melalui Musrembang. “Pembangunan jembatan ini sudah layak plat beton sehingga dengan kondisi permanen membuat pemerintah tidak harus memikirkan lagi kondisi jembatan tersebut untuk jangka waktu di atas 25 tahun,” tuturnya. (b24)

WH Aceh Utara Dikembalikan Ke Dinas Syariat Islam ACEH UTARA (Waspada): Kinerja Polisi Wilayatul Hisbah (WH) Aceh Utara dinilai melempem sejak digabungkan dengan Satuan Polisi Pamong Praja (Satpol-PP). Karena itu, Muhammad Thaib, Bupati Aceh Utara akan mengembalikan WH ke Dinas Syariat Islam pada awal 2013. “Sekarang ini kita sedang melaksanakan berbagai persiapan baik soal administrasi maupun lainnya. Pokoknya, pada awal 2013, WH sudah harus kita kembalikan ke Dinas Syariat Islam. Ini lebih baik dari pada bersama SatpolPP. Selama bergabung dengan Satpol-PP, kinerja WH lemah,” kata Muhammad Thaib.

Satpol-PP tidak berhak melakukan pengawasan terhadap pelaksanaan Syariat Islam di Aceh, Satpol-PP merupakan perpanjangan tangan aparat kepolisian. Beberapa tugas Satpol-PP yaitu jika ada demo mereka ditempatkan sebagai tenaga pengaman, juga melakukan penertiban kota dan lain sebagainya. Sementara tugas Polisi Wilayatul Hisbah (WH) untuk melaksanakan kegiatan pengawasan terhadap jalannya pelaksanaan Syariat Islam di Aceh. Karena tugas yang mereka emban berbeda sehingga kegiatan WH melempem dan kurang mendapat perhatian dari lembaga tempat mereka bernaung. (b18)

Kisruh Pilkades Matangguru Kian Panas MADAT (Waspada): Meski hanya pesta demokrasi tingkat desa, kisruh Pilkades di Desa Matangguru, Kec. Madat, Aceh Timur, tak kalah seru dengan Pilkada. Suhu politik di desa pesisir ini kian panas. Bahkan koordinator Keuchik Kec. Madat, ikut angkat bicara. “Panitia Pemilihan Kepala Desa (P2K) Matangguru tak berwenang menolak berkas pendaftaran mantan Keuchik Matangguru, Adnan Bahri, hanya karena ia mendapat nilai D saat uji baca Alquran,” tegas Koordinator Keuchik Kec. Madat, Mukhtar alias Keuchik Adek, Selasa (18/9). Pernyataan ini disampaikan Keuchik Adek menanggapi berita Waspada edisi Selasa, 18 September 2012, soal penyataan Ketua P2K

Matangguru, Alhadi, yang menyebut Adnan tak memenuhi syarat diterima sebagai bakal calon lantaran yang bersangkutan tak mampu baca Alquran. “Salah kalau dikatakan Adnan tak mampu baca Alquran. Sebab, dalam surat rekomendasi yang dikeluarkan kepala kantor KUA Madat, Adnan mendapat nilai D. Nilai ini memang tidak bagus, tapi bukan berarti Adnan sama sekali tak mampu baca Alquran,” tambahnya. Lagi pula, lanjut Keuchik Adek, Qanun Nomor 4, 2009, yang mengatur soal pilkades, masih tahap sosialisasi. Artinya, masih ada peluang untuk diambil kebijakan sehingga Adnan bisa diloloskan sebagai bakal calon keuchik. (b19)

Januari 2013, PLTU Nagan Pasok Listrik 100 MW BANDA ACEH (Waspada): Pembangkit Listrik Tenaga Uap (PLTU) di Nagan Raya akan mulai pasok listrik ke sistem kelistrikan Sumatera, dengan daya 1 x 100 megawatt (MW) dari 2 x 100 MW kapasitas pembangkit pertama yang dibangun di Aceh itu. “Informasi terakhir yang kita terima, PLTU Nagan Raya akan pasok listrik 100 MW ke sistem Sumatera Januari 2013 mendatang,” papar Sulaiman Daud, General Manajer PT PLN (Persero) Wilayah Aceh, Selasa (18/9) di Banda Aceh. PLTU Nagan Raya dibangun dengan kapasitas 2 x 100 MW termasuk 25 PLTU yang dibangun di luar Pulau Jawa dan Bali dalam program listrik 10.000 MW. “Sisanya 100 MW lagi akan masuk sistem dan dioperasikan antara Maret-Mai 2013,” tambahnya. Sehingga, papar Sulaiman, Aceh yang masuk dalam sistem kelistrikan Sumatera sudah mempunyai pembangkit. “Sistem kelistrikan itu dibangun seimbang, dan setiap daerah ada pembangkit sendiri. Insya Allah, Aceh sudah mempunyai pembangkit,” tuturnya. Tambahan pembangkit listrik di Aceh, saat ini juga sedang dibangun pembangkit listrik tenaga air (PLTA) Peusangan di Takengon, Aceh Tengah dengan kapasitas 68 MW. “Saat ini masih dalam proses pembangunan,” ungkapnya. Pada sisi lain, PLN Aceh saat ini juga sedang

membangun transmisi pantai timur, barat, tengah dan tenggara untuk memperkuat pelayanan. Di antaranya transmisi di Nagan Raya, Meulaboh, Jantho, Biereun dan dari Sidikalang (Sumut) ke Kutacane. Sebelumnya, GM PT PLN (Persero)Wilayah Aceh ini membuka pelatihan payment point onlinebank(PPOBB)danintegritaslayananpublik (ILP) yang diikuti 50 peserta, di aula PLN Aceh. (b06)

Baitul Mall Aceh Gelar Sosialisasi Berzakat REDELONG (Waspada): Sebanyak 100 peserta dari berbagai unsur di Bener Meriah, mengikuti pelatihan tentang sosialisasi kesadaran berzakat yang diselenggarakan Pengurus Baitul Mall Aceh bekerjasama dengan Baitul Mall Bener Meriah di mess Pemda setempat, Rabu (19/09). Ketua paniti sosialisasi Kesadaran Zakat Bener Meriah Tgk Usman Saleh, dalam laporannya menyebutkan, sosialisasi kesadaran Zakat itu diikuti dari berbagai unsur meliputi unit pengeluaran kas pada instansi pemerintah Bener Meriah dan lainnya. (b33)

Taufik, Calhaj Termuda Aceh

Zulkifli Adam,Walikota Sabang

Nazaruddin, Wakil Walikota Sabang

Legislatif tahun 2009. Zulkifli . Adam sebelumnya pernah berprofesi sebagai pedagang kecil dan sopir truk, sedangkan Tgk Agam sebelumnya berprofesi sebagai nelayan dan abang becak. Siapa sangka kedua anak manusia ini dari jalanan menuju pucuk pimpinan tertinggi di kawasan Perdagangan Bebas dan Pelabuhan Bebas Sabang. Ketika ditanya Waspada di rumahnya beberapa waktu lalu Zulkifli dan Tgk Agam menjelaskan, pihaknya mempunyai program sesuai dengan visi dan misi yang pernah disampaikan selama kampanye lalu. Untuk tiga bulan pertama Zul-Nazar akan menyatukan diri dengan lingkungan kerja mengadakan pembenahan ke dalam dalam upaya memperkuat kabinetnya sehingga bersama-sama menjalankan tugas sesuai dengan yang diamanahkan kepadanya. Melakukan silaturrahmi dengan Muspida dan

tokoh-tokoh masyarakat Sabang seraya meminta dukungan agar programnya dapat berjalan dengan mulus. Pada tiga bulan kedua pihaknya akan melakukan pendekatan dengan Pemerintah Provinsi Aceh dan jajarannya serta dengan Unsyiah serta lembaga lainnya. Tiga bulan ketiga, melakukan terobosan pendekatan dengan pemerintah pusat di beberapa kementerian dalam upaya mencari dukungan untuk membangun Sabang ke depan dan tiga bulan keempat tidak ada salahnya Pemko Sabang akan go internasional untuk mencari dan mengajak investor menanamkan modalnya di Kawasan Sabang. Sosok pemimpin dari kalangan tokoh muda ini bersamasama dengan BPKS akan berusaha keras menghidupkan kembali masa kejayaan Sabang seperti yang pernah pada tahun 1970-an yang berakhir pada 1985.T Zakaria Al Bahri

TAUFIK Nurcholisuddin IJ Bin Ilyas adalah putra kelahiran Langsa, 15 Juni 1994. Dia kini tercatat sebagai pelajar Madrasah Aliyah (MA) Almadinatuddiniyah Syamsuddhuha di Desa Cot Murong, Kecamatan Dewantara, Kabupaten Aceh Utara. Mantan murid SDN Seuneubok Aceh Idi Cut tersebut kini tercatat sebagai calon haji termuda untuk Kabupaten Aceh Timur dan juga calhaj termuda tahun 2012 untuk Provinsi Aceh. Taufik mendapatkan Waspada/Muhammad H Ishak Nomor Porsi 0100025926 pada tanggal 2 Oktober CALHAJ termuda se-Aceh, Taufik Nurcholisuddin (dua kanan) 2007 ataupun bertepatan foto bersama dengan Ketua PGRI Aceh Timur Agussalim (dua dengan 12 Ramadhan 1428 kiri) diapit ayahnya Ilyas bin M Nur (kiri) dan ibunya, Jurniati Hijriyah lalu. Taufik yang (kanan) usai dipeusijuek (tepung tawar) calhaj PGRI Aceh Timur, memiliki cita-cita menjadi baru-baru ini. dokter spesialis dalam itu berdomisili di Gam- ngaku akan berdoa untuk kedamaian Aceh pong Baroe, Kecamatan Darul Aman. Pada dan untuk kesejahteraan Aceh di Mekkah Mudasarnya, Taufik berangkat ke Tanah Suci tahun karramah dan di Masjid Nabawi di Madinah. 2011, namun karena usianya belum men- “Saya bersama kedua orangtuanya InsyaAllah cukupi syarat sehingga kedua orangtuanya akan berdoa untuk Aceh, agar perdamaian bersama Taufik terpaksa menunda pem- Aceh yang sudah dicapai melalui MoU Helsinki berangkatan ke tahun 2012. antara Pemerintah RI – GAM terus terjalin dan Taufik kini sudah berusia 18 tahun, konflik berkepanjangan tak terulang lagi di 3 bulan, 14 hari. Ketika dijumpai di kediaman bumi Serambi Mekah,” kata Taufik. orangtuanya, Taufik mengaku sudah siap Kepala Kemenag Aceh Timur Tgk Faisal untuk berangkat ke Tanah Suci bersama kedua Hasan mengatakan, Taufik Nurcholisuddin orangtuanya yakni Ilyas bin M Nur-Jurniati adalah calhaj termuda untuk Kabupaten Aceh binti M Husin. Taufik yang memiliki hobi Timur di tahun 2012. Bahkan, dia sesuai dengan mengajar, olahraga, memancing dan memba- porsi mendapat jatah berangkat tahun lalu, ca itu dalam tiga bulan terakhir terus mengha- namun karena usianya belum mencukupi fal berbagai doa dan bacaan melalui Buku Pe- syarat, maka Taufik menunda keberangkatan doman Haji yang dibekali Kementerian Agama bersama kedua orangtuanya di tahun ini. RI melalui Kemenag Aceh Timur. Anak pertama dari 3 bersaudara ini meMuhammad H Ishak



Warga Matangpanyang Blokir Jalan

Aceh Utara Juara Umum Lomba Masak

SAMPOINIET (Waspada): Puluhan warga Matangpanyang, Kec. Baktiya Barat—Sampoiniet, Aceh Utara, Rabu (19/9) memprotes keberadaan komplek peternakan ayam broiler di desa itu dengan cara memblokir jalan. Akses ditutup dengan menancapkan kayu gelondongan di tengah jalan sehingga tidak bisa lagi dilalui mobil. “Blokir baru kami buka jika semua kandang ayam sudah dibongkar dan dipindahkan ke tempat lain,” kata M Adam, 50, perwakilan warga. Menurut Adam, aksi pemblokiran jalan itu merupakan aksi protes yang kesekian kali. Sebelumnya, warga juga sudah melapor dan mengeluh ke camat hingga ke bupati. Namun komplek peternakan berkapasitas 18 ribu ekor ayam tersebut tak kunjung direlokasi.

ACEH UTARA (Waspada): Setelah meraih juara 1 dalam lomba masak di tingkat Kabupaten Aceh Utara, kini peserta lomba masak dari Kecamatan Banda Baro kembali meraih juara umum dalam lomba cipta menu bergizi, seimbang dan aman di tingkat Provinsi Aceh, Rabu (19/9). Hal tersebut disampaikan Cut Ratna Irawati, Ketua PKK Kabupaten Aceh Utara melalui Nurjannah, istri Syahbuddin Usman, Sekretaris Daerah. Peserta lomba masak dari Kecamatan Banda Baro ikut dalam lomba masak di tingkat provinsi mewakili PKK Aceh Utara. Dalam lomba tersebut, peserta dari Aceh Utara meraih juara I kategori kreatifitas pengembangan resep makanan dan kategori pemanfaatan pangan lokal spesifikasi wilayah. “Peserta kita mengolah resep makanan non beras, seperti membuat jagung menjadi satu jenis makanan yang bergizi dan beberapa jenis makanan non beras lainnya. Juga menyabet juara I dalam kategori kreatifitas pengembangan resep makanan,” terang Nurjannah, Rabu (19/9). (b18)

BIREUEN (Waspada) : Delapan pasangan calhaj Bandar Bireuen yang akan menunaikan ibadah haji tahun ini dipeusijuek dalam acara pelepasan di Meunasah Kota Bireuen, Senin (17/ 9) malam. Kedelapan pasangan calhaj Bandar Bireuen yang dilepas perangkat Desa Bandar Bireuen dan Pengurus Meunasah Kota, tiga pasangan calhaj di antaranya Jasri, Pemimpin Bank Aceh Cabang Bireuen bersama istri, Tgk Muslim, staf kantor Bupati Bireuen bersama istri dan Fahrul Walidin, Kepala SMPN-4 Bireuen bersama isteri. Sedangkan lima pasangan calhaj lainnya merupakan pedagang warga Bandar Bireuen. Kedelapan pasangan calhaj Bandar Bireuenn tergabung dalam kloterVI, akan berttolak ke tanah suci dari Masjids Agung Bireuen, Senin (24/9) malam. Keuchiek Bandar Bireuen Adnan Adam dan pengurus Meunasah Kota Adsyiek H Yusuf mengatakan, acara pelepasan tamu Allah warga Bandar Bireuen sudah menjadi kegiatan rutin pengurus meunasah kota setiap tahunnya. (b12)


WARGA Matangpanyang, Kec. Baktiya Barat, memblokir jalan menuju komplek peternakan ayam, Rabu (19/9)

Banjir Masih Mengancam

Warga Terpencil Persiapkan Tenda Darurat PIRAKTIMU (Waspada): Musibah banjir dinilai masih mengancam sejumlah kecamatan di pedalaman Aceh Utara. Memasuki musim hujan, warga terpencil kabupaten ini mempersiapkan tenda darurat dan sampan untuk evakuasi warga. Camat Pirak Timu, T Azwar, Rabu (19/9) mengakui, kecamatan ini salah satu kecamatan

Waspada/H AR Djuli

TGK Nasri, Dayah Darul Istiqamah Geulanggang Teungoh sedang melaksanakan peusijuek calhaj Bandar Bireuen di Meunasah Kota, Senin (17/9).

Bupati Aceh Utara Ancam Pindahkan Perawat RSUD ACEHUTARA (Waspada): Karena sudah banyak menerima informasi dari masyarakat tentang buruknya pelayanan kesehatan di Rumah Sakit Umum Daerah (RSUD) Cut Mutia, Bupati Aceh Utara Muhammad Thaib mengancam akan memindahkan semua perawat di RS tersebut ke puskesmas-puskesmas yang ada di 27 kecamatan. Buruknya pelayanan kesehatan bukan hanya disebabkan oleh para perawat juga disebabkan buruknya kepemimpinan di RS itu. “Mungkin mereka sudah terlalu lama bekerja di rumah sakit, karena itu mereka mungkin sudah jenuh bekerja di satusatu tempat, karena itu kita berencana dalam waktu dekat, jika memang tidak ada perubahan setelah kita ingatkan, maka semua perawat di RS itu kita pindahkan saja ke puskesmas, dan perawat yang selama ini bekerja di puskesmas kita pindahkan ke RS,” kata Muhammad Thaib, Selasa (18/9). Jimbron, Direktur Eksekutif Lembaga Swadaya MasyarakatReuncong Aceh, mengaku mendukung gebrakan yang akan dilakukan Bupati Aceh Utara. Direktur RSUD Cut Mutia Drg Anita, ketika dikonfirmasi, Rabu (19/9) ketika dikonfirmasi tidak bersedia mengangkat, meskipun telah dicoba beberapa kali. (b18)

30 Perajin Perabot Ikuti Pelatihan BIREUEN (Waspada) : Dinas Perindustrian, Perdagangan dan Usaha Kecil dan Menengah Bireuen memberikan pelatihan bagi 30 perajin perabot di 17 kecamatan di Kabupaten Bireuen di aula SMKN-1 Bireuen, Selasa (18/9) Kadis Perindagkop dan UKM Asnawi S Pd dalam sambutannya saat membuka pelatihan antara lain mengatakan, pelatihan yang diberikan kepada perajin perabotan asal Kabupaten Bireuen untuk menghadapi kendala yang dihadapi masih minimnya pengetahuan dan keterampilan para perajin. Dikatakan, Kabupaten Bireuen memiliki beberapa produk unggulan di antaranya produk yang terbuat dari perabot memiliki pangsa pasar yang prospektif dan harga jual yang tinggi. Ketua panitia penyelenggara Epi Rizal menjelaskan, pelatihan perajin perabot se-Kabupaten Bireuen diikuti 30 peserta berasal dari 17 kecamatan berlangsung selama lima hari 18-22 September. Pelatihan ini mendatangkan dua tutor berpengalaman masing-masing Akmal dari Kuta Blang Bireuen dan Zulfan dari Desa Geulanggang Kulam, Kecamatan Kota Juang memberikan pelatihan bidang perabot ukiran Jepara dan ukiran Aceh. (b12)

Penerbangan Di Bandara SIM Banda Aceh Berangkat (flight, tujuan, waktu)

GA 142 Jakarta/Medan GA 146 Jakarta/Medan

10:40 15:50

GA 143 Medan/Jakarta GA 147 Medan/Jakarta

11:25 16:45

Y6 555 Jakarta * Y6 537 Jakarta/Medan

19:05 12:30

Y6 556 Jakarta** Y6 538 Medan/Jakarta

07:05 12:30

JT 304 Jakarta JT 396 Jakarta/Medan

11:35 20:00

JT 397 Medan/Jakarta JT 307 Jakarta

06:40 12:15

SJ 010 Jakarta/Medan


SJ 011 Medan/Jakarta


Batavia Air Lion Air

Sriwijaya Air Air Asia

AK 305 Kuala Lumpur *** 12:20

AK 306 Kuala Lumpur*** 12:45

FY 3401 Penang ****

FY3400 Penang ****

Fire Fly


* Setiap Selasa, Kamis, Minggu. ** Setiap Senin, Rabu, Jumat. *** Setiap Senin, Rabu , Jumat dan Minggu. **** Setiap Selasa, Kamis dan Minggu.


“Peternakan ini milik anggota DPRK Aceh Utara. Dibuka sekitar dua tahun lalu dan selama itu pula kami harus menghirup bau kotoran ayam dan sering diserbu lalat. Warga di sekitar komplek juga sering sakit-sakitan,” ungkap Adam. Khaidir Abdurrahman, Ketua Komisi B DPRK Aceh Utara, yang dikonfirmasi terpisah menyatakan, komplek peternakan itu sedang dalam proses relokasi. Warga yang melakukan protes diminta bersabar karena proses relokasi butuh dana besar dan mesti dilakukan bertahap. “Rencananya kandang kita pindahkan ke perbatasan Desa Buket Seuntang- Desa Blang Rubeik, Kec. Lhoksukon, Aceh Utara. Lokasinya aman karena terpaut sekitar 1,5 Km dari rumah penduduk,” kata Khaidir via telefon selular. (b19)

Penelepon Gelap Coba Peras Ketua MPU Aceh Utara

Delapan Calhaj Bandar Bireuen Dipeusijuek

Tiba (flight, asal, waktu) Garuda Indonesia

WASPADA Kamis 20 September 2012

rawan banjir warga akan membutuhkan bantuan darurat. Pemerintah Kecamatan Pirak Timu, telah mempersiapkan tenda untuk tempat tinggal darurat, bila banjir. Begitu juga dengan sampan, juga disiagakan untuk mengangkut barang-barang kebutuhan pengungsian darurat. “Peralatan ini disiapkan LSM untuk masyarakat,” jelas Azwar kembali. Lembaga Swadaya Masyarakat Bumo Malikussaleh (LSMBM) yang bergerak di bidang penanggulangan bencana alam juga menyerahkan bantuan

yang sama ke beberapa kecamatan lain sekitar aliran Sungai Peuto dan Sungai Keuruto. Delapan unit sampan disiapkan di gampong-gampong dan di Kecamatan Pirak Timu. Sedangkan dua unit disiagakan di ibu kota Kecamatan Matang Kuli. “Sebelumnya juga telah dibagikan 20 unit sampan untuk antisipasi bencana banjir, termasuk Langkahan,” jelas Ketua LSM-BM pada acara penyerahan bantuan yang ikut dihadiri Humas ExxonMobil Aceh Production, Armia. (b15)

Lanjutan Sidang Sengketa Lahan Sawit PTPN I Di PN Lhoksukon LHOKSUKON (Waspada): Kliping berita Harian Waspada dan SK Bupati Aceh Utara ikut menjadi alat bukti dalam perkara sengketa lahan sawit PTPN I kebun Cot Girek, di PN Lhoksukon, Selasa (18/9). Lanjutan sidang, Selasa dan Rabu (19/9), di Pengadilan Negeri Lhoksukon, Aceh Utara, membahas akumulasi 17 berkas perkara atas gugatan kelompok tani (Poktan) tradisional, warga Gampong (Desa) Matang Serdang, Tanah Jambo Aye, dengan Poktan intensif warga eks trans Bola Mas Desa Langkahan, Aceh Utara. Majelis hakim yang menangani displit (perkara terpisah No25-32),terdiridariZanalHasan (ketua),TAlmadyandanMuhammad Dede Idham (anggota). Sementara displit (perkara terpisah No.8 –14, 21 dan 22), diadili Rabu (19/9) oleh majelis hakim (ketua PN Lhoksukon/ ketua majelis), Tohari Tapsirin, dengan hakim anggota Muhammad Dede Idham dan Ny Mustabsyirah. Agenda sidang

sama, yaitu pembuktian surat kepemilikan lahan dari para penggugat. Sesi sidang hari itu, tiba pada tahapan pembuktian atau alat bukti surat-surat kepemilikan lahan dari Poktan tradisional (penggugat). Kuasa hukum penggugat dari lembaga hukum M Ali Ahmad, SH & Partner’s Bireuen, mengajukan 10 alat bukti (P-1 s/d P-10), antara alat bukti tersebut ikut diajukan kliping berita Waspada, lengkap foto para pejabat ketika meninjau tapal batas antara konsesi PIR/ plasma sawit PTPN I kebun Cot Girek, dengan lahan warga Poktan tradisional. Surat Keputusan (SK) Bupati Aceh Utara, No.146/51, 12 April 2010 (masa kebupatian Ilyas A Hamid) menjadi alat bukti utama, karena di SK tersebut termuat ketegasan batas antara Kec. Jambo Aye – Kec Langkahan. Objek perkara seluas 50 hektare kebun sawit tersebut, sangat jelas di luar konsesi Perusahaan Inti Rakyat (PIR) plasma

yang kini di bawah naungan PTPN I Langsa, c/q kebun Cot Girek, Aceh Utara. “Dua judul berita yang pernah dimuat Waspada Medan, selain mensosialisasi tapal batas sesuai SK Bupati Aceh Utara, juga mengungkap kronologis penyerobotan lahan ketika kebun sawit pola PIR/plasma itu dibangun pada masa Pemerintahan Orde Baru,” kata anggota tim kuasa hukum penggugat, Tgk Asnawi Ahmad, usai sidang. Sedang alat bukti lainnya yang ikut diserahkan kepada hakim, menurut Tgk Asnawi Ahmad berupa surat keterangan kontraktor landclering CV Mahligai, 7 Mei 1988 yang menyatakan, rekanan tersebut mengaku terlanjur membersihkan lahan di luar konsesi lahan PIR/ plasma sawit trans Bola Mas Langkahan. Usai menerima alat bukti tersebut, ketua majelis hakim PN Lhoksukon, Zainal Hasan melanjutkan sidang ini, 25 September. (b13)

Diduga Gelapkan Bantuan Korban Konflik, Oknum BRA Diamankan KRUENGGEUKUEH (Waspada): Diduga gelapkan bantuan untuk korban konflik, oknum petugas Badan Integrasi Aceh (BRA) Kecamatan Dewantara diamankan polisi. Oknum berinisial JA diamankan atas laporan korban konflik Mariati Idrus, 45, asal Gampong Uteun Geulinggang. Kapolres Lhokseumawe AKBP Kukuh Santoso melalui Kapolsek Dewantara Iptu Sofyan, Rabu (19/9) mengatakan, kepolisian mengamankan JA, oknum petugas BRA Aceh Utara

sebagai terlapor dalam kasus dugaan penggelapan dana bantuan korban konflik. Dia hadir ke Mapolsek untuk memenuhi panggilan polisi, dan kini telah diamankan. “Dia telah kami periksa, tapi dalam pengakuannya masih simpang siur, alias belum mengarah. Pun itu, pemeriksaan kami tingkatkan dan penambahan saksi-saksi lain. Oknum ini, terlibat kasus penipuan, kalau lihat dari laporan korban, tapi kita belum pastikan keterlibatannya,” ucap Kapolsek.

Namun, pada 4 September 2012, penyidik telah melakukan pemanggilan terhadap terlapor tersebut usai dilaporkan Mariati. Karena ketika itu tidak memenuhi panggilan polisi sehingga penyidik langsung membuat panggilan kedua kalinya. Katanya lagi, sebelumnya penyidik juga telah melakukan pemeriksaan terhadap sejumlah saksi dari pihak terlapor dan juga dari petugas Bank Aceh Cabang Pembantu (Capem) Krueng Geukueh, Aceh Utara. (cmk)

Pembelian Pupuk Hasil Rapat Kelompok Tani LHOKSUKON (Waspada): Menurut saksi dalam persidangan kasus KUD Buket Makmur-Cot Girek, pembelian pupuk bersubsidi berdasarkan rapat kelompok tani yang dipimpin Kepada Desa Alue Luhob, Kecamatan Cot Girek, Aceh Utara. Pengakuan tersebut disampaikan pada sidang saksi adcharge (meringankan) di Pengadilan Negeri Lhoksukon, Selasa (19/9). Saksi Muzakir Husen kepada majelis hakim yang diketuai Zainal Hasan, menjelaskan, sebelum pembelian pupuk, petani mengadakan rapat yang ikut dihadiri kepala desa dan penyuluh pertanian lapangan (PPL). Sementara dana pembelian diambil dari simpanan

para petani. Muzakir juga mengakui, dia sebagai anggota KUD Bukit Makmur yang diketuai Kusyairi (tersangka kasus pembelian pupuk bersubsidi). Ketika majelis hakim mempertanyakan apakah petani mengetahui tentang rencana pembelian pupuk bersubsidi, saksi menjelaskan, karena petani meminta pupuk yang murah sehingga dalam rapat itu diambil inisiatif pembelian pupuk bersubsidi. Bahkan ketika hakim menanyakan kelanjutan hasil rapat, saksi mengatakan kelompok tani diminta menyiapkan Rencana Definitif Kebutuhan Kelompok (RDKK). Atas dasar RDKK inilah akhirnya tersangka membeli pupuk bersubsidi untuk kebutuhan petani

kelapa sawit. Terkait dengan dana pembelian pupuk yang dipertanyakan Syukri (Kuasa Hukum Kusyairi), saksi mengakui dana itu dari petani yang dipotong tiap bulan di KUD Bukit Makmur. Seperti diberitakan, PN Lhoksukon menyidangkan kasus pembelian pupuk bersubsidi yang dilakukan KUD Bukit Makmur, Cot Girek, Aceh Utara. Ketua KUD, Kusyairi dijadikan tersangka. Sementara dia mengaku pembelian pupuk tersebut sesuai dengan permintaan petani melalui RDDK yang ditandatangani kepala desa dan PPL setempat. Sehingga pembelian tersebut tidak melanggar hukum. (b15/b11)

LHOKSEUMAWE (Waspada): Penipu lewat hendphone, semakin tidak pilih bulu. Ketua MPU Aceh Utara Tgk H Mustafa Ahmad mengaku coba diperas Rp20 juta. Ia mengaku sempat panik. Si penelepon mengaku dari anggota polisi, memberitahukan anak atau keluarga mengalami kecelakaan lalulintas. Ketua Majelis Permusyawaratan Ulama (MPU) Aceh Utara, Abu Paloh Gadeng (panggilan akrab), Selasa (18/9), HP-nya berdering. karena sedang wirid, dibiarkan. Usai shalat seorang putrinya mengambil telepon, lalu penelpon mengaku dari kepolisian, memberitahukan bahwa anaknya yang bernama Muhammad, mengalami kecelakaan dan menderita patah tulang. Penelepon gelap meminta segera dikirim uang ke rekening sebesar Rp20 juta. Karuan saja, anak Abu paloh Gadeng (si kakak) yang menerima telepon itupun panik.

Menurut ketua MUI Aceh Utara, tidak hanya itu, tapi penelepon gelap yang mengaku polisi itu juga menjelaskan. anaknya tertangkap membawa sabu-sabu, saat ini berada di kantor polisi, mohon dikirim dana ke rekening sebanyak Rp20 juta. Pimpinan dayah Paloh Gadeng itu, mulai curiga berat bahwa penelepon itu penipu. Menanggapi maksud jahat penelepon, Abu Paloh gadeng mengatakan, saya tak punya dana Rp20 juta, yang ada hanya Rp200 (dua ratus rupiah) mau itu.” Mendengar jawaban tersebut, si penelepon menjadi berang seraya mengancam, kalau Abu tidak memenuhi permintaannya, anak Abu akan diproses sesuai hukum,” ujar penelpon. Terkait perlakuan yang dialaminya dari orang tidak jelas tersebut, Ketua MUI Aceh Utara mengingatkan masyarakat agar hati-hati jangan panik kalau menerima telepon dari orang yang tidak diketahui indentitasnya. (b13)

Traffic Light Krueng Geukueh 2013 Baru Normal LHOKSEUMAWE (Waspada): Traffic light (lampu merah) di Simpang IV Krueng Geukueh, Aceh Utara ditargetkan pada 2013 baru normal kembali. Selama ini, traffic light di persimpangan ini sudah tak berfungsi hampir dua minggu. Hal ini dikatakan Kadis Perhubungan Budaya dan Pariwisata Aceh Utara Badli, Selasa (18/9). Kata dia, memang traffic light tersebut telah dinonaktifkan karena tidak berfungsi normal. Dan, tidak dipasang pengganti, selama ini telah dipasang, tapi tidak bertahan lama.

Pun demikian, pihaknya telah mengusulkan dalam APBK 2011, tapi usulan tersebut hilang saat disahkan. Dan, kini dalam APBK P 2012 telah dimasukkan, ditargetkan pada 2013 traffic light ini akan dipasang baru, yaitu model timer system berbentuk tiga fase. Pemasangan baru traffic light menghabiskan anggaran sekitar Rp350 juta. Namun, dua tempat akan dipasang baru, yaitu di Simpang IV Lhoksukon dan Simpang Landing Lhoksukon melalui dana APBN 2013. (cmk)

Aceh Kluster Pengolahan Rotan Indonesia BANDA ACEH (Waspada) : Provinsi Aceh yang kaya dengan berbagai sumber daya alam (SDA) termasuk hasil hutan, kini merupakan kluster (pusat-red) industri pengolahan rotan di Indonesia bagian barat. Ketua Asosiasi Pengusaha Rotan Indonesia (APRI) Provinsi Aceh, Razali Idris di Banda Aceh, Selasa (18/9) mengatakan, Puslitbang Kementerian Kehutanan (Dephut) RI merilis bahwa Aceh salah satu provinsi penghasil rotan di Indonesia dalam jumlah banyak mencapai 386,8 ton rotan kering per tahun. “Sebagai perwujudan awal bahwa Aceh daerah penghasil rotan di Indonesia, maka pemerintah pusat bekerjasama Pemerintah Aceh dan Pemkab Pidie membangun sebuah pabrik pengolahan rotan untuk Indonesia bagian barat yakni dibangun di Desa Bambi, Kecamatan Peukan Baro, Kabupaten Pidie,” kata Razali. “Pembangunan pabrik pengolahan rotan yang dibangun di Pidie, Aceh itu juga sesuai dengan Kebijakan Industri Nasional Perpres No: 28/2008 dan konsep Strategis Pengembangan Industri Pengolahan Rotan Nasioan (Depperin),” ungkap Razali. “Pabrik pengolahan rotan yang dibangun di atas lahan seluas 3.000 m2 didanai dan difasilitasi Pemkab Pidie, seperti pengadaan lahan, sedangkan bangunan fisik (konsruksi)-nya dilakukan Pemerintah Aceh. Sementara pengadaan peralatan atau mesin dilakukan pemerintah pusat Cq Depperin,” jelas Razali. Menurut Razali, untuk menjalankan operasional pabrik rotan tersebut, pemerintah pusat melalui Kementerian Perindustrian menyediakan dana dari perusahaan atau Corporate Sosial dan Responsibility (CSR). Dana dimaksud untuk mengembangkan industri rotan dalam negeri pasca pelarangan ekspor bahan baku mentah rotan (rotan golondongan-red) setengah jadi. Namun dengan

pelarangan ekspor itu, maka bahan baku rotan harus terserap untuk dalam negeri. Dikatakan Razali, pembangunan pabrik pengolahan rotan dilakukan pemerintah tak lain untuk menyelamatkan petani pengumpul rotan dan pengusaha rotan, agar dapat membuat rotan lebih simple seperti bangku dan meja untuk sekolah dasar, SMP maupun hotel. “Kebijakan ini juga sekaitan larangan mengekspor rotan. Hasil rotan Indonesia dimanfaatkan untuk kebutuhan dalam negeri, karena itu pemerintah meminta sekolah-sekolah dan hotel untuk memanfaatkan mobiler atau mebel yang berbahan baku rotan,” katanya. Menurut Razali, selama ini pengusaha rotan di Aceh hanya menjadi pedagang rotan antar daerah dan pulau. Namun dengan pengolahan rotan setengah jadi, persaingan memperoleh bahan baku rotan mentah dari para pengumpul akan semakin ketat. Untuk dapat bersaing perusahaan harus membeli rotan dengan harga lebih tinggi. “Menjadi pemasok rotan setengah jadi ke industri dalam negeri. Persaingan terjadi pada sisi permintaan (demand side) dengan para pedagang rotan skala besar yang sudah mapan,” kata Razali. Sementara untuk menjadi eksportir rotan setengah jadi, di Aceh belum ada kompetitornya, di tingkat nasional akan bersaing dengan para pedagang rotan skala besar dari daerah lain seperti Kalimanatan dan Sulawesi. Sementara nilai investasi industri mebel rotan dan kerajinan rotan pada 2010 sebesar Rp15 miliar. Sementara sebaran dan perkiraan volume produksi rotan di Aceh mencapai 89.500 ton pertahun. Disebutkan Razali, perkiraan volume produksi rotan di Aceh teridentifikasi ada 7 jenis yang mempunyai nilai ekonomis yakni jenis rotan Manau, Semambu, Cacing, Sega, Tabutabu dan Slimit serta Jernang. (b09)

Pertumbuhan Ekonomi Aceh Di Atas Tujuh Persen BANDAACEH (Waspada) : Pertumbuhan ekonomi di Provinsi Aceh tahun 2012 diperkirakan di atas tujuh persen, kalau proyek Masterplan Percepatan dan Perluasan Pembangunan Ekonomi Indonesia berjalan. Prakiraan itu diungkapkan Ketua Umum Kamar Dagang dan Industri (Kadin) Provinsi Aceh Firmandez di Banda Aceh, Selasa (18/9). Dari ekspor Aceh saja, pertumbuhan ekonomi diperkirakan bisa mencapai 7 persen, apalagi kalau proyek MP3EI (Masterplan Percepatan dan Perluasan Pembangunan Ekonomi Indonesia) itu berjalan lancar,” kata Firmandez. Tahun ini, pertumbuhan ekonomi Aceh akan mencapai6,7persenataunaikdari2010yangmasih 6,3 persen. MP3EI yang merupakan program pemerintahdandidukungberbagaikalanganakan menjadikan sektor rill bergerak cepat sehingga memicu pertumbuhan eko-nomi. MP3EI yang pendanaannya sudah jelas, dapat membangun infrastruktur seperti sarana pelabuhan, pasokan gas dan listrik selama ini masih dikeluhkan pengusaha, dapat secepatnya teratasi. Menurut Firmandez, pengusaha anggota Kadin Aceh harus proaktif dan kreatif serta tetap eksis membantu pemerintah dalam meningkatkan pembangunan. Pengusaha di Aceh akan semakin diminati sebagai tempat investasi kalau infrastruktur memadai. “Kesulitan pasokan gas yang terjadi

dewasa ini harus dapat diatasi,” kata Firmandez. Disebutkan Firmandez, musim kering berkepanjangan dan ketidakmampuan pemerintah dalam menyediakan air untuk dialirkan ke sawah telah mengakibatkan petani padi di tujuh kecamatan di Pidie gagal panen. Kerugian mencapai ratusan juta rupiah. Zulkifli, warga Ceureucok, Simpang Tiga, Pidie mengatakan, musim tanam ini dia mengalami kerugian hingga Rp6 juta, karena sawah garapan satu hektare gagal panen. Dia berharap dinas terkait mampu menangani persoalan air untuk petani sawah musim kering. Kadis Pertanian dan Peternakan Pidie, Anas, mengatakan, 774,5 hektare areal tanaman padi di Kecamatan Mutiara Timur, Simpang Tiga, Peukan Baro, Indrajaya, Kembang Tanjong dan Geulumpang Tiga pada musim tanam ini gagal panen. Kadis Sumber Daya Air (SDA) Pidie, Samsulrizal menyebutkan, kekeringan yang melanda Pidie salah satu penyebabnya karena debit air Sungai Krueng Tiro dan Keumala menurun drastis. “Saat musim kemarau air sungai berkurang, sumber utama air yang berasal dari hutan lindung tidak ada. Karena hutan tidak bisa menyimpan air saat musim hujan, banyak pepohonan telah ditebang sehingga saat hujan turun, air langsung terbuang dari hulu ke hilir,” katanya. (b09)


WASPADA Kamis 20 September 2012

DPRK Terima LKPJ Bupati Aceh Selatan 2011

Parlementaria DPR Kota Banda Aceh Dewan Pertanyakan Minimnya Penerimaan Zakat Baitul Mal Banda Aceh Badan Anggaran (Banggar) DPR Kota Banda Aceh mempertanyakan kepada Wali Kota Banda Aceh tentang minimnya pengumpulan zakat oleh Baitul Mal Kota Banda Aceh pada tahun anggaran 2011, padahal keberadaan lembaga Baitul Mal Kota Banda Aceh sangat strategis dalam rangka mewujudkan misi Kota Banda Aceh yang “melayani warga.” Pelapor Badan Anggaran (Banggar) DPR Kota Banda Aceh Tgk Muhibban HM Hajat menyampaikan ini dalam usul, saran dan pendapat Banggar terhadap Raqan Pertanggungjawaban APBK Banda Aceh tahun anggaran 2011 dalam sidang Paripurna DPRK Banda Aceh, Selasa (18/9). Dikatakan Muhibban, potensi zakat di ibukota Provinsi Aceh itu adalah sebesar Rp40 miliar sesuai laporan BPK-RI Perwakilan Aceh. Sementara zakat yang dapat dikumpulkan Baitul Mal Banda Aceh adalah sekitar Rp9 miliar. Artinya, baru sekitar 23 persen dari potensi zakat yang ada, yang dicapai Baitul Mal. Dan ini masih jauh dari potensi yang ada. Wakil Ketua Komisi D itu juga meminta penjelasan wali kota hal apa saja yang menjadi persoalan dan kendala baik secara internal atau eksternal yang menyebabkan pencapaiannya masih minim dan apa saja yang dibutuhkan agar pengumpulan zakat di Kota Banda Aceh, minimal mendekati potensi yang ada. Wakil Wali Kota Banda Aceh Illiza Saaduddin Djamal dalam penjelasannya atas saran, usul dan pendapat Banggar DPR Kota Banda Aceh dalam sidang paripurna yang dipimpin Wakil Ketua DPRK Edi Aryansah, Rabu (19/9) mengatakan, ada beberapa kendala minimnya penerimaan zakat dari Baitul Mal Kota Banda Aceh antara lain, belum adanya tenaga yang profesional dan dapat diandalkan untuk melakukan pemungutan zakat secara langsung kepada muzakki. Belum diterapkan sistem NPWZ sehingga keterikatan para muzakki untuk membayar zakat masih minim. Selain itu, kata dia, juga belum optimal dilakukan sosialisasi kepada masyarakat serta masih adanya perbedaan persepsi para ulama tentang kewajiban membayar zakat pada Baitul Mal dan zakat penghasilan/gaji PNS. Karenanya, menurut Illiza, untuk meningkatkan penerimaan zakat ke depan, akan dilakukan berbagai upaya yaitu dengan merekrut tenaga pengumpul zakat yang tanggap dan profesional, mengupayakan penggunaan sistem NPWZ. Selain itu, meningkatkan koordinasi dengan lembaga terkait yang menjadi amil zakat dan melayani masyarakat Kota Banda Aceh, seperti Rumah Zakat, Dompet Dhuafa, serta meningkatkan sosialisasi melalui berbagai media dan mengevaluasi serta meninjau kembali kinerja kepengurusan Baitul Mal. (adv)

Bila Diminta, Bus Sekolah Disediakan LHOKSEUMAWE (Waspada): Pemkab Aceh Utara memiliki 22 unit bus sekolah saat ini. Ketersediaan bus ini, pemkab siap memberikan untuk keperluan di kecamatan bila membutuhkan dan bertanggungjawab. Hal ini dikatakan Kadis Perhubungan, Budaya dan Pariwisata Aceh Utara, Badli kemarin. Kata Badli, Aceh Utara kini memiliki bus sekolah sekitar 22 unit, jumlah ini sekarang sedang dioperasikan, termasuk menjemput anak-anak sekolah dari daerah menuju ke Kota Lhokseumawe. “Sampai saat ini, daerah belum ada yang meminta kepada kami untuk penyediaan bus sekolah. Tapi, bus sekolah kini sedang beroperasi di sejumlah daerah seperti di Kecamatan, Samudera, Tanah Pasir, Kuta Makmur, Nisam, Krueng Geukueh dan beberapa kecamatan lain. Begitu juga yang menuju ke Lhokseumawe,” ucapnya. (cmk)

Puluhan Wanita Terjaring Razia Busana Muslim BANDA ACEH (Waspada): Puluhan wanita dan kaum ibu kembali terjaring dalam razia busana muslim yang digelar petugas gabungan Satpol PP WH, TNI dan Polri di kawasan Jalan T Umar Setui Banda Aceh, Rabu (19/9). Dari razia sekitar satu jam, petugas menjaring sedikitnya 74 wanita yang melintas di kawasan tersebut karena dinilai melanggar qanun syariat Islam. “Razia ini kita gelar bagi masyarakat yang belum melaksanakan peraturan daerah (Qanun) khususnya No.11 tahun 2002 masalah aqidah dan ibadah,” kata Kasatpol PP dan WH Aceh, Khalidin usai razia. Menurut Khalidin, sesuai qanun tersebut seorang muslim telah diatur cara berpakaian yang dianjurkan Islam yakni menutup aurat baik bagi pria maupun wanita. (cb06)

Polmas Dinilai Sinergis ACEH UTARA (Waspada): Gubernur dan Kapolda Aceh memerintahkan AKBP Ruslan, Kabag Opsnal Direktorat Bimas bersama dengan MAA untuk mengevaluasi kinerja Polisi Masyarakat di setiap kabupaten/kota di Aceh, termasuk mencari tahu tentang kendala yang dihadapi di lapangan selama ini. Kegiatan evaluasi berlangsung di aula Mapolres Aceh Utara, Rabu (19/9). “Tujuan kami dikirim ke kabupaten/kota oleh Kapolda dan Gubernur Aceh untuk melihat sejauhmana pelaksanaan kepolisian masyarakat yang bekerjasama dengan majelis adat dalam menyelesaikan persoalan-persoalan kecil dalam lingkungan masyarakat, seperti kasus perkelahian, cekcok dalam rumah tangga dan lain sebagainya,” kata Ruslan. Dalam hal ini, polisi tidak bisa bekerja sediri, dan membutuhkan dukungan masyarakat, karena 60 persen polisi bertugas untuk memberdayakan masyarakat. Polmas tidak lahir secara serta merta di Indonesia, tapi Polmas dibentuk setelah mengadopsi sistem kepolisian masyarakat di beberapa negara lainnya. (b18/b11)

Tak Tuntas Di Mendagri, Pilkada Aceh Tengah Ke Presiden TAKENGEN (Waspada): Dua kali rapat yang diselengarakan Kemendagri membahas persoalan Pilkada di Aceh Tengah, tidak menemukan titik terang. Peserta rapat akhirnya sepakat Gubernur Aceh,membuat laporan resmi ke Presiden. “Gubernur akan membuat laporan resmi dan menghadap Presiden dengan Mendagri atau Dirjen Otda, tentang persoalan Pilkada di Aceh Tengah,” kata Mursid, anggota DPD Aceh Tengah yang ikut hadir dalam pertemuan, Rabu (19/9) di Kemendagri. Menurut Mursid usai pertemuan menyebutkan, daftar kesalahan KIP Aceh Tengah dalam pertemuan itu terkuak ke permukaan. Walau KIP sudah mendapatkan legitimasi secara hukum dengan putusan MK, namun cara KIP mendapatkan kemenangan itu yang menjadi persoalan. KIP telah melakukan penipuan dalam menetapkan nomor rekapitulasi suara dan daftar pemenang Pilkada. Pakar hukum dalam pertemuan itu juga mempersoalkan mengapa KIP terlebih dahulu menetapkan pemenang, baru kemudian disusul dengan surat rekap dan daftar hadir. (b32)


Waspada/Jaka Rasyid

2 kapal nelayan asal sibolga di amankan di dermaga pendaratan ikan ujung serangga susoh.

Aceh Tengah Alokasikan Rp1,173 M Untuk PNPM TAKENGEN (Waspada): Pemerintah Kabupaten Aceh Tengah alokasikan dana sebesar Rp1.173.750.000, untuk keberlanjutan Program Nasional Pemberdayaan Masyarakat Mandiri (PNPM – Mandiri) Perkotaan dan Perdesaan di Kabupaten Aceh Tengah pada tahun Anggaran 2013 mendatang. Seperti yang dikatakan Bardan Sahidi, anggota DPRK Aceh Tengah, Rabu (19/9) menyebutkan, pernyataan kesanggupan itu tertuang dalam Komitmen Pemerintahan Kabupaten Aceh Tengah atas kerjasama Pelaksanaan PNPM Mandiri Perkotaan dan PNPM Mandiri Perdesaan Tahun Anggaran 2013, yang ditandatangani Ketua Dewan Perwakilan Rakyat Kabupaten (DPRK) Aceh Tengah dan Penjabat Bupati Aceh Tengah. Dia menyebutkan bahwa, dana ini dari komponen Dana

Daerah Untuk Urusan Bersama (DDUB) dengan alokasi sebesar Rp1.173.750.000 untuk buddget sharing dengan pola Bantuan Langsung Masyarakat (BLM) dari Anggaran Pendapatan Belanja Negara APBN Tahun Anggaran 2013. Sedangkan untuk PNPM Mandiri Perdesaan sebesar, Rp21.477.500.000 dan PNPM Mandiri Perkotaan sebesar Rp1.923.750.00 dan dana Sharing sebesar Rp1.173.750. 000. Maka total anggaran yang akan dikelola oleh program PNPM mandiri di Kabupaten Aceh Tengah sebesar Rp24.575. 000.000, yang tersebar di 14 kecamatan di Kabupaten Aceh Tengah. Dirincikan politisi Partai Keadilan Sejahtera (PKS) itu, masing- masing kecamatan akan menerima program kegiatan dengan besaran anggaran masing- masing, Kecamatan Atu Lintang sebesar Rp850 juta,

Kecamatan Bebesen Rp900 juta, Kecamatan Bies Rp850 juta, Kecamatan Bintang Rp3,1 miliar, Kecamatan Celala Rp3,1 miliar, Kecamatan Jagong Jeget Rp950 juta, Kecamatan Kebayakan Rp850 juta, Kecamatan Ketol Rp950 juta, Kecamatan Kute Panang Rp1,8 miliar, Kecamatan Linge Rp3,1 miliar, Kecamatan Pegasing Rp1,1 miliar Kecamatan Rusip Antara Rp1,8 miliar Kecamatan Silih Nara Rp3,1 miliar dan KecamatanLut Tawar Rp2 miliar lebih. “Komitmen ini telah disampaikan kepada pemerintah pusat melalui Kementerian Keuangan, Kementerian Dalam Negeri, Direktorat Jendaral Anggaran Daerah dan Dirjen Pemberdayaan Masyarakat (PMD), dalam pelaksanaanya kami akan melakukan pengawasan berjalan sehingga dana dan kegaiatan ini benar – benar sampai dan bermanfaat bagi rakyat,” papar Bardan Sahidi.(b32/b33)

Diserang Virus, Peternak Ayam Kampung Merugi BANDA ACEH (Waspada) : Banyak peternak ayam petelur kampong yang selama ini menuai hasil sangat memuaskan. Namun dalam setahun terakhir mengalami kerugian besar menyusul virus mematikan menyerang ternak ayam tersebut. Dalam kondisi buruk yang demikian membuat sejumlah peternak di kawasan Peukan Bada, Aceh Besar mengalami kerugian besar. “Bahkan mereka memilih untuk beralih usaha sebagai sumber pendapatan baru,” papar beberapa peternak ayam kampung, Minggu (16/9). Seperti diungkapkan Siti Hajar, penghasillan peternak ayam kampung yang sebelumnya berpendapatan lumayan dari hasil menjual telur ayam, sekarang ini tak bisa diharapkan lagi. Ayam hanya tersisa beberapa ekor lagi akibat serangan virus mematikan. Kalangan peternak ayam kampong petelur itu menyebutkan virus yang mematikan menyerang ayam mereka dalam bahasa Aceh disebutkan atau dikenal sebagai penyakit Tae’un yang dapat memus-

nahkan sejumlah ayam dalam waktu sekejab. Meskipun ayam hanya tersisa beberapa ekor, namun masih coba mempertahankan usaha tersebut dengan maksud menambah ayam lainnya. Tapi itu terkendala karena untuk membeli bibit baru tak punya modal, ditambah lagi kekhawatiran terhadap serangan virus yang masih mengganas itu. Padahal lewat beternak ayam kampong yang menghasilkan telur itu dijual ke warungwarung atau pedagang yang telah menjadi langganan seharga Rp2.000 per butirnya. “Dalam seminggu bisa dua sampai tiga kali bawa ke pasar, hasilnya lumayan buat membantu belanja dapur,” katanya. “Kini semua harapan itu nyaris jadi sirna, sejumlah peternak ayam kampong petelur di Aceh Besar dan Kota Banda Aceh dihebohkan dengan kematian ayam secara mendadak. Peristiwa matinya ternak ayam warga ini sudah terjadi beberapa waktu lalu,” kata Munah, peternak lain. Matinya ternak ayam kampung warga sudah terjadi bebe-

rapa waktu lalu juga telah menyebabkan Juwairiah, peternak ayam kampong petelur, asal Desa Lam Isek, Peukan Bada, Aceh Besar, hampir semua ayam miliknya mati diserang virus tersebut. Menurut Juwairiah, ayam yang terjangkit virus tae’un hanya bisa bertahan paling lama satu sampai dua hari, setelah itu langsung mati meski diobati. Hal sama diakui Zoel, tetangga Juwairiah. Ia mengaku, dari jumlah 40 ekor, kini hanya tersisa dua ekor. “Itu juga terjangkit virus yang sama,” katanya. Dia mengisahkan masamasa kejayaannya, banyak keuntungan diperoleh dari beter-nak ayam hias dan pertelur jenis itu. Satu ekor ayam berumur satu minggu dijual Rp15.000 sampai Rp20.000. Sejumlah peternak ayam kampung lainnya di Geucue, Banda Aceh juga mengaku sejumlah ayam mereka diamuk virus tae’un. “Sedikitnya sekira 35 ekor ayam saya dalam dua hari ludes dimakan virus ta’un,” kata Helmi, seorang peternak. (b09)

TAPAKTUAN (Waspada): Setelah melalui pembahasan yang cukup alot, empat fraksi DPRK Aceh Selatan akhirnya sepakat menyetujui dan menerima laporan keterangan pertanggungjawaban (LKPJ) Bupati Aceh Selatan Husin Yusuf tahun anggaran 2011. Kesepakatan tersebut tertuang dalam sebuah qanun dewan, setelah sebelumnya mendapat persetujuan melalui pendapat akhir fraksinya, menjelang penutupan sidang pleno yang dipimpin Ketua DPRK Safiron, didampingi wakilnya Marsidiq dan Khaidir Amin, juga dihadiri Bupati Husin Yusuf bersama unsur Muspida, Rabu (19/9) di gedung dewan di Tapaktuan. Keempat fraksi tersebut meliputi Fraksi Demokrat melalui juru bicaranya A Azis Kadir, Fraksi PKPI melalui juru bicaranya Zulfar Arifin, Fraksi Partai Aceh melalui juru bicaranya Zulfadhli dan Fraksi Karya Bangsa dengan juru bicaranya Azmir. Meski menerima, fraksi-fraksi dewan memberi sejumlah catatan penting dan meminta bupati fokus menjalankan pembenahan di

berbagai lini terutama dalam bidang penataan keuangan, pemerintahan dan pembangunan. “Saudara bupati kami minta lebih fokus membenahi daerah ini terutama bidang pemerintahan yang selama ini terkesan mati suri,” ucap Azmir sembari mengatakan perlu segera dievaluasi kinerja segenap SKPK secara menyuluruh. Hal serupa juga dikatakan Zulfadhli, selaku Ketua Fraksi Partai Aceh. Bahkan ia mengaku kecewa terhadap Sekdakab yang dinilai lepas tangan terhadap kondisi keuangan yang mengalami defisit dan mendapat sorotan masyarakat belakangan ini. Bupati Aceh Selatan Husin Yusuf dalam sambutannya menyampaikan apresiasi terhadap dewan yang telah membahas LKPJ tahun 2012, melalui berbagai tahapan persidangan dan Pansus ke lapangan. “Semua sarana, pendapat dan kritikan menjadi bahan masukan bagi kami dalam rangka pembenahan guna memajukan Aceh Selatan ke depan,” kata Husin Yusuf. (b30)

RSUZA Gelar Seminar Talasemia BANDA ACEH (Waspada): Kelompok Kerja Talasemia Bagian Anak Rumah Sakit Umum dr Zainoel abidin (RSUZA) Banda Aceh menggelar seminar internasional sehari tentang penyakit talasemia. Seminar internasional talasemia tersebut menghadirkan pembicara Dr Tahira Zafar (Konsultan Darah dari Pakistan), Dr Suharti (Konsultan Farmakologi RSCM) dan Dr Heru Noviat Herdata Utju Ali Basyah dari RSUZA. Seminar yang diikuti sekitar 100-an dokter dan paramedis dari RSUZA dan berbagai rumah sakit di Banda Aceh ini dibuka ini Wadir Pelayanan RSUZA, dr M Andalas, Selasa (18/ 9) di auditorium RSUZA Banda Aceh. Pelaksanaan seminar ini bersamaan dengan dimulainya pelayanan mandiri rawat talasemia di RSUZA, yang selama ini menurut Koordinator Unit Talasemia, dr Heru, tercatat 141 kasus mayoritas anak usia bawah 10 tahun yang setiap bulan masuk RS untuk transfusi dan membutuhkan 2 sampai 4 kantong darah. Umumnya, kata dia, pasien tersebut datang dari Banda Aceh, Sigli, Jantho dan Sabang. Saat ini mereka dilayani dengan program jaminal talasemia dari pemerintah. “Dengan dibukanya pelayanan mandiri ini, diharapkan kualitas hidup anak telasemia menjadi lebih baik,” papar Heru. Talasemia adalah suatu penyakit keturunan yang mengganggu produksi hemoglobin dalam sel darah merah yang berfungsi mengikat oksigen. Keadaan berkurangnya hemoglobin

dalam darah dikenal dengan anemia. Di seluruh dunia, terdapat sekitar 100.000 bayi lahir setiap tahun dengan talasemia berat. Penyebab utamanya adalah karena gangguan pembentukan gen hemoglobin. Berat ringannya penyakit yang diturunkan tergantung dari berapa banyaknya gangguan gen saat pembentukan tadi, apakah di rantai alfa atau di rantai beta. Thalasemia alfa sering menyerang penduduk Asia Tenggara, sedangkan talasemia jenis beta menyerang penduduk dari mediteranian, semisal Yunani, Itali dan Afrika. Keluhan dari seorang bayi baru akan muncul di usia 2 tahun. Misal mual, malas makan dan lainnya. Bila pasangan menikah keduanya berbakat penyakit talasemia, maka anak mereka berpeluang mendapatkan penyakit ini. Sedang bila salah seorang saja, maka peluang sang anak sebagai pembawa bakat (carrier). Karena penyakit ini diturunkan secara genetic dari kedua orangtua, maka konseling pranikah dengan pemeriksaan laboratorium dan konseling prenatal atau sebelum lahir dengan mengambil jaringan bakal plasenta janin di usia kehamilan janin 11 minggu atau periksa cairan ketuban janin saat 14-15 minggu, adalah salah satu cara deteksi awal dan konseling bagi keluarga yang mempunyai riwayat keluarga dengan talasemia. Kemungkinan besar terapi genetic menjadi satu solusi jalan keluar terapi penyakit ini. (b04)

Warga Banda Aceh Keluhkan Listrik Sering Padam BANDAACEH (Waspada) : Warga Kota Banda Aceh akhir-akhir ini mengeluhkan kondisi listrik yang sering padam secara tibatiba dan berkali-kali sejak beberapa hari terakhir ini. Hal itu sebagaimana terjadi pada, Rabu (12/ 9) sekira pukul 17:00 di beberapa kawasan tertentu di Kota Banda Aceh terjadi pemutusan suplai arus listrik. “Di desa kami Lamlagang, Kecamatan Banda Raya, listrik padam sejak pukul 17:00 hingga pukul 22:00 baru hidup (nyala) kembali,“ ungkap Marta, 58, warga Dusun Satu, Lamlagang. Sementara kawasan lain yang mengalami padamnya listrik meliputi kawasan Blangpadang, Seutui (Baiturrahman), Syiahkuala, Blangpadang, listrik padam sejak sore hingga tengah malam. Hal sama dialami warga Gampong Lamdingin, arus listrik mulai putus sejak pukul 16:00 hingga tengah malam yang terjadi pada, Rabu (12/9). “Sering padamnya listrik sangat meng-

ganggu aktivitas warga seperti jam belajar dan pengajian anak-anak serta kegiatan lainnya,” ujar Mahmud, warga Lamdingin. Menyangkut kondisi yang merugikan para pelanggan dan warga itu, pihak PLN menyatakan, padamnya arus listrik secara tiba-tiba akibat gangguan kabel bawah tanah. “Pihak PLN mengaku listrik di sejumlah kawasan di Banda Aceh padam akibat terganggu kabel bawah tanah di kawasan Lampeunurut, Kabupaten Aceh Besar,” ujar staf Bagian Operasional PT PLN Area Banda Aceh, Riza. Kerusakan itun juga terjadi saat dilakukan pengerjaan drainase di sepanjang Jalan Soekarno –Hatta. Manager PLN Area Banda Aceh, Zarmidi mengaku padamnya listrik di sejumlah kawasan di Banda Aceh, akibat terganggu kabel bawah tanah. Dia menambahkan, setiap ada gangguan terkait padamnya lampu, masyarakat bisa mengirimkan pesan singkat (SMS) ke nomor pengaduan PLN, dengan nomor 085260000505. (b09)

Pelanggaran HAM Di Aceh Tak Boleh Dilupakan HARI Jumat (10/8) adalah hari terakhir peserta International Human Rights Training dari SpeakOut2012! UNPO. Kali ini, giliran kantor Kementerian Luar Negeri Belanda yang dikunjungi. Berjarak hanya dua kali lemparan batu dari stasiun kereta api Den Haag Central. Di depan kantor itu, bendera warna merah, putih dan biru berkibar-kibar ditiup angin. Di papan pintu masuk tertulis “Ministerie van Buitenlandse Zaken”. Begitu tiba di pintu masuk semua peserta berkumpul untuk absen ulang. “Please do not forget to bring your passport,” papar seorang staf UNPO mengingatkan. Layaknya pemeriksaan keamanan memasuki bandara udara, semua peserta yang berjumlah 30 orang memasukkan tas jinjingnya untuk dilewati mesin pemindai bagasi. Sedangkan staf pekerja kantor luar negeri Belanda bebas masuk dengan hanya memperlihatkan kartus identitas elektronik. Maklum saja, sebagai kantor diplomat, di sinilah pusat keluarnya kebijaksanaan luar negeri Belanda. Malam hari sebelumnya, sebuah percakapan telepon dari Swedia menyarankan saat pertemuan nanti agar peserta asal Aceh duduk paling depan untuk mengajukan beberapa pertanyaan. Tepat pukul dua siang, dalam sebuah ruangan konferensi kantor Departemen Luar negeri Belanda, seorang pria Belanda memperkenalkan diri.

Dia, Jochem de Groot akan mempresentasikan tentang “Internet and Human Rights” dalam perspektif dan kebijakan Belanda. Jochem, jabatannya sebagai penasihat senior dan pembuat kebijakan mengenai internet dan hak asasi manusia di Departemen Luar Negeri Belanda. Monitor setengah ukuran layar bioskop memperlihatkan aktivitas bantuan Belanda dalam kontribusinya meningkatkan perkembangan HAM di 13 negara. “Belanda sebagai negara donor dalam proyek yang disebut Human Rights Fund (MRF),” kata Jochem tentang kebijaksanaan HAM negaranya. Dalam paparannya, dari 13 negara itu proyek MRF tidak memasukan Indonesia, melainkan terbanyak adalah negara di kawasan Arab yang baru saja menjalankan pemerintahan baru. “Belanda mengkampanyekan kebebasan beragama, berekspresi termasuk kebebasan internet dan juga yang paling penting melindungi pembela hak asasi manusia,” papar Jochem. Di samping itu, dijelaskan pula prinsip-prinsip dasar kebijakan HAM Belanda seperti perlindungan suaka, penghapusan hukuman mati dan hak-hak minoritas. Meskipun sudah duduk di bangku paling depan penulis tetap menerawang berfikir ke belakang akan sejarah Belanda. Masih segar dalam ingatan penulis, setahun lalu, hari Rabu 17 Agustus saat Indonesia me-

rayakan hari kemerdekaannya, penulis pernah mengajukan pertanyaan terhadap Jan A Soer, wakil duta besar Belanda untuk Malaysia di Kuala Lumpur. Kala itu, penulis memberanikan diri untuk menanyakan “mengapa Belanda tidak menarik kembali maklumat perang terhadap Aceh serta mengapa ketika perang berakhir kedaulatan Aceh tidak dikembalikan kepada rakyatnya melainkan diberikan kepada bangsa lain”. Sekali-kali terkonsentrasi penuh menyimak setiap ucapan Jochem de Groot saat terdengat kata “Human Right”. Persis saat di bangku universitas Syiah Kuala Kuala, Banda Aceh kala seorang dosen memberikan perkuliahan. Tersadar akan batas waktu yang diberikan hanya 1,5 jam ditambah lagi bosan dengan bahasan normatif, tibatiba penulis memberanikan diri menginterupsi staf Deplu Belanda, Jochem de Groot, yang sedang berceramah. “Do we have question and answer session?” Semua dalam ruangan memaling muka kepada penulis. “It’s soon, just a few minutes more we will into question and answer time” ucap Jochem de Groot yang sangat fasih berbahasa Inggris. Tanpa perlu mikrophon untuk bertanya, penulis mengawali pengenalan sejarah antara Aceh dan Belanda dengan mengatakan kalau pertanyaan ini adalah yang banyak ditanya oleh orang Aceh, dan sampai hari ini tidak pernah

ada jawaban. “Pertanyaan serupa sudah pernah saya ajukan kepadaWakil Duta Besar Belanda di Kuala Lumpur. Namun tidak ada jawaban kongkrit, malah diberikan secarik kertas hasil kutipan pencarian Google,” papar penulis sambil mengingati pertemuan saat bulan puasa tahun lalu di Malaysia. Sambil menahan emosional yang meluap, penulis langsung mengajukan pertanyaan dengan santun. Dari tadi Anda berbicara tentang peningkatan HAM dan juga masalah pelanggaran HAM yang terjadi di negara-negara lain, itu semua telah terjadi di masa lalu. “Bagaimana kebijaksanaan pemerintah Belanda sendiri berkenaan pelanggaran HAM masa lampau terhadap bekas koloninya yang disebut Netherland East Indies. Maksud saya, di mana tanggung jawab pemerintah Belanda saat membunuh bangsa Aceh dan kemudian mengembalikan daulat negerinya tanpa Referendum melalui Konferensi Meja Bundar (KMB) kepada bangsa lain bukan kepada rakyatnya sendiri” yang penulis pinta untuk menjawabnya dengan jujur. Di ujung kalimat, penulis yang duduk paling depan didampingi dua warga Aceh lainnya dari Swedia dalam forum tersebut menambahkan, “Our Achehnese great grandparents were brutally shot to death by your soldiers called “Marsose”. We do demand your responsibility on what has hap-

pened in the past to our land, Aceh. should we neglect the truth?” Sambil memberikan bukti sejarah, penulis menambahkan argumen perumpamaan, what if our people invade your land and colonize as you did to us, will you accept it? what will you do then? Terakhir, untuk meyakinkan Jochem de Groot sebagai pembuat kebijaksanaan masalah HAM Belanda itu, penulis memberikan tambahan argumen bahwa medio September tahun lalu pengadilan Den Haag memutuskan pemerintah Belanda bersalah dan wajib bertanggungjawab terhadap korban Rawagede dengan meminta maaf serta memberikan korban ganti rugi terhadap janda korban pembantaian massal pasukan Belanda di Desa Rawagede, Karawang, Jawa Barat pada 1947. Semua bahan pertanyaan sebenarnya sudah penulis hafal sehari sebelumnya. Beruntung, tanpa dilarang, dalam forum itu akhirnya uneg-uneg yang selama ini terpendam disampaikan juga. Namun, bukan seorang diplomat Belanda namanya jika tidak bisa berkelit untuk menjawab dari pertanyaan sensitif. Merasa pertanyaan berat, Jochem de Groot mengelak halus dengan memberikan sebuah kontak person di plomat lain, beserta email yang lebih layak untuk ditanyakan mengenai sejarah Aceh dan Belanda. Di samping itu, imbuh Jochem, sekarang kita fokus dalam topik

HAM terkini ditambah lagi kampanye sosialisasi HAM menerusi internet. Jochem juga berjanji setelah selesai acara akan berbicara sejenak dengan penulis. Jika memang diplomat tersebut jujur, bahasan yang dibincangkan mencakup HAM yang universal dan pelanggaran HAM kejadian masa lalu tidak boleh dilupakan, apalagi masalah daulat sebuah negara yang menyebabkan sumber dari segala sumber konflik di Aceh. Setelah insiden itu, peserta International Human Rights Training dari SpeakOut2012! UNPO lainnya mulai beruntun menanyakan prihal yang menyangkut kepentingan negerinya masing-masing. Sebelum semua rombongan peserta kembali ke gedung “Netherlands Institute of International Relations Clingendael”, sambil diantar berjalan keluar gedung kantor Departemen Luar Negeri Belanda di Den Haag itu, berkenaan Aceh, kawan-kawan peserta berdiskusi sambil menyarankan bahwa sebaiknya warga Aceh diaspora untuk membuat komunikasi dengan setiap kedutaan Belanda di negara mana mereka bermukim. Penulis bersetuju sambil berencana setiba di Swedia juga akan mencoba membuat temu janji dengan staf kedutaan Belanda di Stockholm. Jaka Rasyid/Asnawi Ali, bekas anak koran Waspada Aceh 19981999, kini bermukim di Swedia



Gedung SDN Rawa Pakis Terbengkalai

Aceh Timur Gelar Rakor PKH IDI (Waspada): Dalam rangka percepatan penanggulangan kemiskinan, Pemkab Aceh Timur melaksanakan Program Bantuan Tunai Bersyarat (BTB) yang saat ini dikenal dengan nama Program Keluarga Harapan (PKH). Hal ini disampaikan Bupati Aceh Timur melalui Asisten Bidan Keistimewaan Aceh, Ekonomi dan Pembangunan Sekretariat Daerah Kabupaten Aceh Timur M Yasin, pada Rakor Program Keluarga Harapan, Rabu (19/9) di Aula Bappeda Aceh Timur di Idi. Dia menambahkan, Program Bantuan Bersyarat ini perlu dilaksanakan karena telah terbukti berhasil di beberapa negara. “Program bantuan ini telah dilaksanakan di beberapa negara yang dikenal dengan Conditional Cash Transfer (CCT) dan cukup berhasil dalam menanggulangi masalah kemiskinan di negaranegara yang telah menjalankannya,” katanya. (b24)

PEUNARUN (Waspada): Gedung Sekolah Dasar (SD) Negeri Rawa Pakis di Desa Peunarun Baro, Kecamatan Peunarun, Kabupaten Aceh Timur kondisinya kini terbengkalai dan terlantar sejak konflik memuncak di Aceh sekitar tahun 2000-an. Kondisi gedung kini sudah sangat memprihatinkan. Sejumlah pepohonan yang tumbang ke atap mengakibatkan gedung semakin rusak. Benalu yang melilit pohon kini sudah masuk ke dalam ruang kelas belajar. Tak hanya gedung sekolah, mess guru yang berada di sana juga rusak parah dan tidak layak pakai lagi. Camat Peunarun Jaman, Rabu (19/9) menyebutkan, SDN Rawa Pakis terbengkalai akibat konflik. Rata-rata sebelum konflik memuncak, murid SD itu adalah anak dari para transmigrasi

Buket Selamat, Desa Terbaik Aceh Timur SUNGAIRAYA (Waspada): Meski Kecamatan Sungai Raya pernah menjadi salah satu kecamatan yang mengalami gizi buruk, tetapi di tahun 2012 ini Desa Buket Selamat, Kecamatan Sungai Raya terpilih menjadi Desa Terbaik di Kabupaten Aceh Timur. Buket Selamat juga akan mewakili Aceh Timur untuk dinilai menjadi desa terbaik se-Provinsi Aceh. “Di Desa Buket Selamat ada 4 kegiatan Pokja dan keempatnya berjalan lancar dengan baik sesuai diharapkan,” kata Ketua Tim Penggerak PKK Gampong Buket Selamat Ny Husna dihadapan unsur Muspika dan para Penggerak PKK Aceh Timur Rabu (19/9) di kantor Geuchik Buket Selamat. Dia menyebutkan, empat pokja yaitu yang dijalankan tentang akhlakul qarimah yang bergerak di bidang pengajian ibu-ibu dan bapak-bapak, arisan, jimpitan, rukun kematian dan kegiatan lainnya yang bersifat keagamaan dan pokja lain juga berjalan seperti bergerak di bidang pendidikan, meliputi PAUD, paket, UP2K serya pokja bergerak yang di bidang pertanian seperti pembuatan kue, jualan air kelapa muda, kerajinan anyaman dan kebun PKK. “Pokja lain juga berjalan yakni berkaitan dengan kesehatan seperti posyandu, BKB, KB,” kata Husna seraya melanjutkan dengan adanya pembinaan P2WKSS tahun ini banyak bantuan yang diterima Desa Buket Selamat dari beberapan dinas di antaranya dari Dinas Syariat Islam, BPMP-KS, Disperindag, Bag. Hukum & PMG Setdakab Aceh Timur, Dinas Pendidikan, Dinas PU, Disnaker, Badan LH dan KPA. Ketua Tim Penilai P2WKSS Provinsi Aceh, Muzakkir mengatakan, kedatangan tim penilai dari provinsi bukan hanya untuk menilai saja selain merupakan salah satu ajang silaturahmi juga momen untuk pembinaan agar lebih baik lagi ke depan program P2WKSS yang telah berjalan. (b24)

Wabup Aceh Timur Sidak Kantor Camat Rantau Selamat LANGSA (Waspada): Wakil Bupati Aceh Timur,Syahrul Syamaun, Selasa (18/9) melakukan sidak atau inspeksi mendadak ke Kantor Camat Rantau Selamat guna melihat secara langsung kinerja para pejabat dan PNS di pusat pelayanan pemerintahan kecamatan tersebut. Kehadiran wabup secara mendadak itu sempat membuat kaget para pegawai di kantor Camat Rantau Selamat. Apalagi dalam sidak itu, wabup juga sempat mengecek absensi kehadiran pegawai dan juga melakukan interaksi langsung dengan camat dan sejumlah pegawai lainnya. Menurut Kasubbag Pelaporan Perencanaan Humas Pemkab Aceh Timur, Rukiah, dalam sidaknya itu wabup berpesan agar para pegawai terus meningkatkan kinerja dan pelayanan kepada masyarakat dengan baik. (b20)

Atasi Air Bersih Di Kuala Langsa LANGSA (Waspada): Masyarakat pesisir pantai di Desa Kuala Langsa, Kecamatan Langsa Barat meminta Wali Kota Langsa memberikan fasilitas air bersih untuk masyarakat yang selama ini menjadi permasalahan yang mereka hadapi untuk melakukan aktivitas sehari-hari. Demikian diungkapkan M Yassin, warga Desa Kuala Langsa, Dusun Harapan, Langsa Barat kepada wartawan, Rabu (19/9). Dikatakannya, keberadaan air bersih di tempat ini sangat dibutuhkan untuk MCK dan kebutuhan air minum. Sementara saat ini ada setiap hari air bersih yang masuk ke gampong, namun untuk mendapatkan air bersih itu terpaksa kami harus merogoh kocek lagi. “Untuk membeli air berih kami harus mengeluarkan duit minimal Rp15 ribu setiap harinya untuk tiga drum berisikan 200 liter. Jadi bisa dibayangkan berapa setiap bulan kami harus mengeluarkan uang untuk air bersih saja, sementara pendapatan dari nelayan sangat minim,” katanya. Keuchik Kuala Langsa Elisuddin mengaku permasalahan air bersih ini sudah lama menjadi permasalahan di daerah ini, bahkan juga telah melaporkan kepada wali kota lama tentang kondisi masyarakat di sini. (m43)


SATU unit truk tanki sedang mendistribusikan air ke salah satu rumah di Desa Kuala Langsa, Dusun Harapan, Kec. Langsa Barat, Rabu (19/9)

Bappenas Diminta Bantu Percepatan Pembangunan Perkantoran Aceh Timur IDI (Waspada) : Untuk memberi dan meningkatkan pelayanan, peningkatan peran serta, prakarsa dan pemberdayaan masyarakat dengan tujuan untuk peningkatan kesejahteraan rakyat, Pemerintah Kabupaten Aceh Timur melaksanakan Rapat Kerja dan Sosialisasi Percepatan Penerapan Standar Pelayanan Minimal (SPM) yang dilaksanakan di aula Dinas Kesehatan setempat di Idi, Rabu (19/9). Wakil Bupati Aceh Timur Syahrul bin Syamaun pada kesempatan membuka rapat tersebut mengatakan, rapat kerja dan sosialisasi ini merupakan hal yang sangat penting dan strategis untuk dilaksanakan sebagai langkah awal perwujudan dalam keserasian hubungan kerja antara pemerintah dan pemerintah daerah. “Pentingnya penyelenggaraan SPM di daerah sebagai pendukung dalam mewujudkan tanggungjawab pemerintah dan pemerintah daerah dalam memberikan pelayanan dasar kepada masyarakat,” katanya. (b24)

WASPADA Kamis 20 September 2012

Waspada/Muhammad H Ishak

SDN Rawa Pakis di Desa Peunarun Baro, Kec.Peunarun, Aceh Timur tampak sebagian atap ditutupi semak belukar akibat terbengkalai sejak tahun 2000-an akibat konflik dan penduduk di sana sudah eksodus. Foto diambil baru-baru ini.

Ketua Komisi B DPRK Aceh Utara Dilaporkan Ke Polisi LHOKSUKON (Waspada): Khaidir Abdurrahman, Ketua Komisi B DPRK Aceh Utara, dilaporkan warga ke polisi karena dituduh melakukan tindak pidana pencemaran lingkungan melalui peternakan ayam broiler di Desa Matangpanyang, Kec. Baktiya Barat—Sampoiniet, Aceh Utara. Politisi Partai Aceh ini dilaporkan bersama adik kandungnya Irwansyah Abdurrahman, ke Mapolres Aceh Utara oleh warga Desa Matangpanyang, M Yusuf bin Basyah, 40, Jumat (14/9). “Laporan diterima kepala Sentral Pelayanan Kepolisian Terpadu (SPKT) Polres Aceh Utara, Aiptu Anung Hariyono, dengan nomor laporan LP/175/ IX/PA/2012/Res Aut/SPKT,” kata Razali, penasihat hukum pela-

por, Rabu (19/9). Kapolres Aceh Utara AKBP Farid BE melalui Kasat Reskrim AKP Marzuki didampingi KBO Reskrim Aiptu Jimmiy Hasibuan membenarkan pihaknya sudah menerima laporan tersebut. Sementara Khaidir Abdurrahman yang dihubungi terpisah mengaku belum tahu kalau dirinya sudah dilaporkan warga ke polisi karena tuduhan mencemari lingkungan.

Khaidir juga menilai, laporan itu salah alamat. Seharusnya, kata Khaidir, masalah yang timbul dari peternakan ayam dilaporkan ke Dinas Peternakan atau Kantor Lingkungan Hidup, karena itu bukan perbuatan kriminal. “Lagipula, pihak kantor lingkungan hidup sudah mensurvei komplek peternakan kita dan mereka tidak menemukan masalah apa-apa,” papar Khaidir. (b19)

Crew Film Innocent Of Muslims Lengkapi Status Kekafirannya LHOKSEUMAWE (Waspada): Ketua Majelis Permusyawaratan Ulama (MPU) Aceh Utara, Tgk H Mustafa Ahmad mengatakan, kreativitas crew Film Innocent of Muslims, melengkapi status kekafirannya. “Saya harap umat Islam harus hati-hati berkawan dengan kafir, sebab kafir dari awal punya misi tertentu merontokkan Agama Islam,” kata ketua MUI Aceh Utara, di ruang kerjanya, Rabu (19/9). “Bahkan, sejak masih ada Nabi Muhammad, orang-orang kafir menghina, menghujat dan memfitnah Rasulullah. Umat Islam diimbau agar memposisikan posisi Kafir itu sebagai musuh Islam, musuh orang Muslim seluruh dunia. (b13)

Umat Islam Jangan Terpengaruh LANGSA (Waspada): Kadis Syariat Islam Kota Langsa Ibrahim Latif mengatakan, dosa yang harus ditanggung seorang muslim lebih besar jika melanggar perintah Allah daripada melanggar aturan-aturan lain yang dibuat manusia. “Apalagi kalau menjadikan aturan lain sebagai alat untuk menghambat terlaksananya perintah Allah, itu lebih besar lagi dosanya. Karena perbuatan seperti itu sama seperti yang dilakukan orang-orang yahudi untuk memprotes terlaksananya Syariat Islam di suatu negara atau daerah yang berpenduduk muslim,” papar Ibrahim Latif di Langsa, Rabu (19/9). Umat Islam, kata dia, jangan sampai terpengaruh memberi dukungan kepada orang-orang yang memprotes pelaksanaan

Ibrahim Latif,Kadis Syariat Islam Kota Langsa Syariat Islam. Karena protesprotes tersebut sering dilakukan secara halus, misalnya jika diadakan razia terhadap pelanggar Syariat Islam disebut telah mela-

kukan pelanggaran HAM atau kode etik-kode etik tertentu yang semuanya itu aturan hasil buatan manusia. Padahal, tambahnya, pada dasarnya HAM dan kode etik semua profesi umumnya baik dan tidak ada yang bertentangan dengan Syariat Islam, tapi sering terjadi pihak-pihak tertentu sengaja ditafsir lain supaya bisa dibenturkan dengan hukum Islam. Bertitik tolak dari pemikiran tersebut, maka dia meminta elemen masyarakat di Kota Langsa supaya dapat memberikan dukungan penuh dalam usaha pelaksanaan Syariat Islam di Kota Langsa, dan hal itu sudah sesuai dengan keinginan Wali Kota Langsa Usman Abdullah yang sering dikatakannya tiap ada kesempatan berbicara di depan umum. (b20)

dari Jawa, namun saat konflik berkecamuk para orangtua/wali eksodus meninggalkan Aceh sehingga hampir keseluruhan murid ikut pindah sekolah. “Karena lokasinya juga jauh ke pedalaman sehingga warga yang berdomisili mengungsi ke Langsa dan sekitarnya sehingga dalam hitungan hari sekolah yang terletak 75 kilometer ke arah timur selatan Kota Idi kosong dan terbengkalai hingga sekarang,” jelas Camat Jaman. Kadis Pendidikan Aceh Timur Agussalim membenarkan kondisi SDN Rawa Pakis sudah tidak memiliki murid lagi karena pindah ikut bersama ortangtuanya saat konflik dan hingga sekarang belum kembali. “Jika sudah ada penduduk dan muridnya ada, maka kita siap mengaktifkan kembali melaksanakan proses pembelajaran,” katanya. (b24)

BLBU Belum Diterima Petani Di Aceh Tamiang KUALASIMPANG (Waspada) : Bantuan Langsung Bibit Unggul ( BLBU) untuk para petani di Kabupaten Aceh Tamiang sebanyak 175 ton yang akan digunakan pada areal musim tanam padi seluas 7.000 ha dan setiap hektare ditanam 25 kg per ha yang menggunakan dana APBN Tahun Anggaran 2012 sampai saat ini belum juga disalurkan kepada petani. Menurut Pengurus Kelompok Tani Nelayan Andalan (KTNA) Kecamatan Bandar Pusaka,M Hendra Vramenia, Rabu (19/9), biasayna Program BLBU sudah masuk ke Dinas Pertanian dan Peternakan Aceh Tamiang pada April-Mei setiap tahunnya yang sumber dananya berasal dari APBN. “ Namun untuk tahun 2012 ini sampai detik ini program BLBU belum juga direalisasikan

oleh perusahaan pemenang tender yaitu PT HDN dan tentu saja karena belum ada realisasinya sangat merugikan bagi petani di Aceh Tamiang,” ungkap Hendra. Kadis Pertanian dan Peternakan Aceh Tamiang, Muhammad Yunus ketika dikonfirmasi, Rabu (19/9) membenarkan memang sampai saat ini pihak perusahaan pemenang tender belum merealisasikan program BLBU tersebut untuk petani di Kabupaten Aceh Tamiang. Menurut Yunus, pihaknya juga sudah pernah menyurati perusahaan pemenang tender BLBU untuk segera merealisasikan BLBU, namun kata perusahaan pemenang tender BLBU yang menggunakan dana APBN itu nanti mereka akan merealisasikannya. (b23)

Wali Kota Peusijuek 158 Calhaj Kota Langsa LANGSA (Wadpada) : WakilWali Kota Langsa Marzuki Hamid melakukan tepung tawar (peusijuek) terhadap 158 calon jamaah haji asal Kota Langsa yang akan menunaikan ibadah haji tahun 1433 H/2012 M bertempat di aula Pemko Langsa, Rabu (19/9). Selain Marzuki Hamid yang melakukannya atas namaWali Kota Tgk Usman Abdullah, juga jajaran Muspida dan ketua lembaga ulama dan adat serta Kepala Kemenag Kota Langsa. Di antara calhaj tersebut, terdapat beberapa pejaWaspada/Syahrul Karim bat Pemko seperti Syahrul WAKIL Wali Kota Langsa Marzuki Hamid saat tepung tawar Thaib (Kepala BKPP), Mardani (Kepala Badan PMD) (peusijuek) terhadap calon jamaah haji asal Kota Langsa di aula dan Abdullah Gade, man- Pemko Langsa, Rabu (19/9). tan Kadis Pendidikan serta sejumlah guru dan dosen. Wakil Wali Kota Taib, 90 tahun. Dijelaskan, calhaj asal Kota Langsa secara Marzuki Hamid mengharapkan jamaah untuk dapat melaksanakan ibadah dengan baik. resmi akan dilepasWali Kota Langsa Tgk Usman Abdullah pada 21 September pukul 22:00 di “Semoga menjadi haji mabrur,” katanya. Menurut Kepala Bagian Keistimewaan Aceh Islamic Centre. Calhaj Kota Langsa yang Samsul Bahri, pejabat yang menangani acara dipimpin Nawawi (ketua kloter) ini akan peusijuek, calhaj asal Kota Langsa seluruhnya berangkat ke Tanah Suci dengan kloter 3 pada berjumlah 158 orang setelah satu orang (Cut Minggu, 23 September pukul 12:00 melalui Marniati binti TM Ali, 53 tahun) mengundurkan Embarkasi Banda Aceh. Bergabung dengan diri dan menunda berangkat pada tahun depan. jamaah Kota Langsa, Aceh Tenggara, Simeulue Jamaah termuda Nur Suraiya binti Amri, 23 dan Aceh Barat Daya sehingga seluruhnya 320 tahun dan tertua Nur Habsah binti Muhammad orang. (b21/m43)

Mawar, Penderita Tumor Butuh Uluran Tangan MAWAR, nama yang indah diberikan orangtuanya. Dia tercatat sebagai warga Desa Sukajadi, Kecamatan Karang Baru, Kabupaten Aceh Timur. Tetapi nasib kurang baik dialami Mawar mengundang perhatian semua pihak dan menjadi tolak ukur kinerja Dinas Kesehatan Aceh Tamiang yang terkesan menutup-nutupi kasus tumor di wilayahnya. Mawar yang telah berusia 16 tahun itu tercatat sebagai salah satu siswi SMK di Aceh Tamiang. Berat dugaan, Mawar menderita tumor payudara, kondisinya kian membesar dan kerap berdenyut sehingga lembaga pemerhati masyarakat miskin dan kesehatan masyarakat Aceh itu memperkirakan Mawar menderita tumor ganas yang harus segera mendapat perhatian khusus dari pihak RSUD A.Tamiang. Muhammad Sahudra, tetangga Mawar, Rabu (19/9) menjelaskan, Mawar mulai membesar sejenis tumor di payudaranya sejak Maret lalu. Menurut pengakuan Mawar kepadanya, sejak Mawar sekolah di SMP sudah mulai menderita penyakit tersebut, namun karena bisa disembuhkan dengan obat sehingga kondisi Mawar tidak terlalu terlihat dan penyakit yang dideranya tidak diketahui orang banyak. “Tapi karena sejak 6 bulan lalu kondisinya kian memprihatinkan sehingga penyakit yang diderita Mawar diketahui banyak orang khususnya para


WALI Kota Langsa Usman Abdullah diwakili Asisten Zainal Arifin (pakai topi) didampingi Kabid Bansos Dinas Kota Langsa T Saifuddin, Keuchik Kuala Langsa Elisuddin dan Aceh Program Koordinator Muslim Aid Indonesia foto bersama usai penanaman di Desa Kuala Langsa, Rabu (19/9).

13.200 Bibit Mangrove Ditanam Di Kuala Langsa


MAWAR, 16, penderita tumor yang butuh perhatian asal Desa Sukajadi, Kecamatan Karang Baru, Kabupaten Aceh Tamiang. tetangganya hingga diketahui pihak lembaga pemerhati kesehatan di Aceh,” kata Muhammad Sahura. Direktur Eksekutif Yayasan Advokasi Rakyat Aceh (YARA) Safaruddin secara terpisah membenarkan, pihaknya telah menerima laporan dari keluarga dan tetangga Mawar yang sedang membutuhkan perhatian serius dari instansi terkait. “Mawar yang anak piatu butuh perhatian serius dari Dinkes Aceh,” katanya. Pasalnya, Mawar kini sedang menderita tomor di payudara sejak beberapa tahun lalu dan kini sudah membesar. Meski dilakukan perawatan pihak Puskesmas setempat dan pihak RSUD setempat, namun menu-

rut Safaruddin, tumor yang sedang diderita Mawar harus segera diangkat. “Untuk meringankan beban Mawar, YARA selaku lembaga pemerhati kesehatan Aceh siap mendampingi dan mengadvokasi Mawar untuk proses angkat tumor di bagian payudaranya,” kata Safaruddin seraya menandaskan, pihak YARA mengharapkan bantuan dari semua pihak untuk diantar langsung ke kediaman orangtua Mawar di Desa Sukajadi, Kec.Karang Baru, Aceh Tamiang ataupun dikirim melalui rekening BRI Syariah Cabang Banda Aceh 0037-0108213350-5 a.n Yayasan Advokasi Rakyat Aceh. Muhammad H Ishak

LANGSA (Waspada): Muslim Aid Indonesia bersama Dinas Sosial, Dinas Kelautan dan Perikanan Kota Langsa dan BPDAS Aceh melakukan penanaman mangrove (Rhizopoa spp) bersama masyarakat Desa Kuala Langsa, Dusun Harapan, Kec. Langsa Barat, Rabu-Kamis (19-20/9). “Kegiatan ini merupakan rencana aksi masyarakat Kuala Langsa yang difasilitasi Muslim Aid Indonesia bersama dengan dinas terkait dalam rangka program pengurangan risiko bencana dan adaptasi perubahan iklim,” kata Aceh Program Koordinator Muslim Aid Indonesia, Teuku Youvan kepada wartawan, Rabu (19/9). Menurutnya, Muslim Aid Indonesia, dalam melaksanakan program kerja ini melakukan serangkaian pertemuan dengan masyarakat Kuala Langsa dalam mengidentifikasi jenis– jenis ancaman di sekitar daerah pantai dalam lingkup adaptasi terhadap gejala alam dan kerusakan lingkungan. Hal ini dapat dianalisis dari kejadian – kejadian yang terjadi selama beberapa kurun waktu di daerah pantai seperti terjadi kenaikan air pasang (ie tuara), abrasi dan angin kencang. Kondisi alam yang semakin rusak akibat penebangan liar pohon mangrove menyebabkan semakin rentannya masyarakat sekitar pantai terhadap risiko rusaknya habitat pantai dan keseimbangan keanekaragaman hayati. “Dalam kaitan ini Muslim Aid Indonesia bersama-sama dengan pihak Dinas Sosial dan TAGANA juga melatih dasar - dasar ilmu kebencanaan kepada masyarakat Kuala Langsa dan

lebih jauh bersama – sama menganalisa bersama masyarakat akan sumber ancaman, risiko, kerentanan dan juga kapasitas, dalam hal itu dibentuk juga rencana aksi desa yang melahirkan sejumlah rencana aksi masyarakat Kuala Langsa seperti aksi penanaman mangrove, pembentukan aturan desa (reusam) terhadap pelindungan mangrove, dilakukannya penguatan kapasitas masyarakat, dan pelatihan terhadap adaptasi perubahan iklim yang terjadi pada masyarakat Kuala Langsa khususnya pada musim di mana masyarakat sulit untuk melaut dan mendapatkan tangkapan ikan,” tutur Youfan lagi. Maka itu, Muslim Aid Indonesia bersama Dinas Kelautan dan Perikanan jmelakukan serangkaian program seperti pelatihan budidaya mangrove dan juga pengelolaan bibit ikan. “Penanaman mangrove di Kuala Langsa selama dua tahapan dengan jumlah total 13.200 bibit mangrove,” jelasnya Wali Kota Langsa Usman Abdullah diwakili Asisten Zainal Arifin yang hadir menyaksikan penanaman mangrove mengucapkan terima kasih atas kepedulian Muslim Aid Indonesia terhadap masyarakat Kuala Langsa “Dengan program ini setidaknya masyarakat bisa terbantu sehingga semakin banyak mangrove di sekeliling mereka, semakin banyak pula biota laut yang bertelur maupun berkembang biak sehingga menjadi income dan mensejahterakan kehidupan masyarakat pesisir ini,” katanya. (m43)

Waspada, Kamis 20 September 2012