Page 1

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

KAMIS, Pon, 15 April 2010/30 Rabiul Akhir 1431 H

SEORANG anggota Satuan Polisi Pamong Praja (Satpol PP) menjadi korban amukan massa di daerah Koja, Jakarta Utara, Rabu (14/4). Bentrok yang dipicu pembebasan lahan tersebut mengakibatkan 144 luka berat dan ringan, 20 kendaraan terbakar.

No: 23119 Tahun Ke-64

Terbit 24 Halaman (A1-8, B1-8, C1-8)

Harga Eceran: Rp 2.500,-


Mbah Priok Berasal Dari Sumatera JAKARTA (Waspada): Makam Habib Hasan bin Muhammad al Haddad atau yang dikenal sebagai Makam Mbah Priok, Koja, Jakarta Utara, menyimpan cerita sejarah sehingga sangat dihormati warga. Bahkan, ketika pendopo makam akan dibongkar pemerintah, pengikut rela mati mempertahankannya. Informasi yang dihimpun di lapangan menyebutkan Habib Hasan merupakan salah satu tokoh yang dikenal


JAKARTA (Waspada): Upaya pembongkaran makam Habib Hasan bin Muhammad al Haddad alias Mbah Priok yang berlokasi di Koja, Jakarta Utara, Rabu (14/4) mendapat perlawanan dari ratusan orang. Massa yang menentang aksi pembongkaran ini menyerbu petugas Satpol PP dan Polri yang memaksa masuk areal makam.

Massa pendukung Mbah Priok menyerang ratusan petugas dengan lemparan batu. Mereka juga membawa berbagai jenis senjata seperti tombak, bambu runcing, dan garpu besar. Akibat peristiwa ini 144 orang luka berat dan ringan, 20 kendaraan dibakar dan 15

kapal dikerahkan untuk mengevakuasi aparat lewat laut. Aksi pelemparan massa mendapat balasan dari petugas yang sudah berpakaian lengkap. Bom molotov juga dilemparkan massa ke arah petugas.

Lanjut ke hal A2 kol. 1


SEORANG remaja tanggung menjadi korban bulanbulanan aparat satpol PP saat terjadi bentrok massal di Koja, Jakarta Utara, Rabu (14/4). Foto tengah, warga mengacungkan senjata tajam saat menghadapi brikade aparat Polri dan Satpol PP.

Tak Ada Rencana Gusur Makam JAKARTA (Waspada): Kerusuhan di kawasan makam Mbah Priok, Koja, Tanjung Priok terus meluas. Kerusuhan kini tidak hanya terjadi di area makam tapi meluas di sekitar RS Koja dan sekitar terminal peti kemas. Bagaimana sebenarnya kasus ini bermula? Kepala Bidang Informasi dan Komunikasi Pemrov DKI Cucu Ahmad Kurnia saat jumpa pers di Balaikota, Jl Medan Merdeka Selatan, Jakarta Pusat, Rabu (14/4), mengatakan,

Lanjut ke hal A2 kol. 2

Lanjut ke hal A2 kol. 3

PDIP Resmi Tolak Menkeu

Sjahril Djohan Tersangka, Sebut Beberapa Nama J A K A RTA ( Wa s p a d a ) : Mabes Polri telah secara resmi menetapkan Sjahril Djohan sebagai tersangka penyuapan dan tindak pidana korupsi dalam kasus markus Gayus Tambunan. Dari hasil pemeriksaan, Sjahril menyebutkan banyak pihak yang terlibat dalam kasus ini. “Masih banyak nama yang disebutkan yang tahu tentang permasalahan ini. Nama-nama itu akan dipanggil baik sebagai

saksi atau tersangka untuk kepentingan penyidikan,” ujar Kadiv Humas Mabes Polri, Irjen Pol Edward Aritonang, dalam jumpa pers di Mabes Polri, Jl Trunojoyo, Jakarta Selatan, Selasa (14/4). Edward menjelaskan, hingga saat ini tim penyidik masih terus melakukan pemeriksaan terhadap Sjahril. Namun, pihaknya belum bisa

Vonis Hengky Samuel Daud Tambah 3 Tahun

Riau. Modus yang dilakukan dalam kasus tersebut sama dengan kasus GayusTambunan. “Saya amati kasusnya yang nilainya mencapai ratusan miliar. Pertama jaksa peneliti sama, terkecuali Cirus Sinaga. Kedua, pengacara sama. Ketiga, bonekanya saksi Andi Kosasih dan keempat, Mr X-nya sama,” tambahnya. Namun Susno mengelak kalau kemudian dia menuduh

J A K A RTA ( A n t a ra ) : Pengadilan Tinggi Tindak Pidana Korupsi pada Pengadilan Tinggi DKI Jakarta menambah vonis penjara terdakwa korupsi pengadaan mobil pemadam kebakaran Hengky Samuel Daud selama tiga tahun, menjadi 18 tahun. “Majelis berpendapat, hukuman yang bersangkutan perlu diperberat,” kata Juru Bicara Pengadilan Tinggi DKI Jakarta, Andi Samsan Nganro ketika dihubungi di Jakarta, Rabu (14/4). Vonis pada tingkat banding itu lebih berat ketimbang

Lanjut ke hal A2 kol. 3

Lanjut ke hal A2 kol. 3

Lanjut ke hal A2 kol. 3

Susno Siap Dikonfrontir JAKARTA (Waspada): Komjen Pol Susno Duadji siap dikonfrontir dengan Sjahril Djohan. Bahkan Susno menantikan pertemuan itu agar semuanya bisa menjadi jelas, perihal makelar kasus di Polri. “Enggak perlu ditanya. Mana ada seorang Bareskrim tidak bersedia.Wait and see saja,” kata Susno dalam jumpa pers di kediamannya di Cinere, Depok, Rabu (14/4). Dia juga kembali menjelaskan perihal kasus Arwana di


SEBUAH kendaraan pengendali huru-hara milik Brimob Polri dibakar massa usai terjadi bentrok antara warga dan Satuan Polisi Pamong Praja (Satpol PP) yang dibantu Polisi di daerah Koja, Jakarta Utara, Rabu (14/4).

BACA DI HALAMAN DALAM Satgas, Kejagung Bahas Sjahril Djohan Satgas Mafia Hukum menyambangi Kejagung untuk berkordinasi masalah Sjahril Djohan.


WNI RRC Tewas Di Hotel JW Merriott Seorang WN RRC ditemukan tewas mencurigakan di kawasan kolam renang lantai 17 hotel JW Merriott. Korban adalah mantan guru agama di RRC.

Petugas Pasar Horas Brutal


164 Kios Pasar Inpres Kwala Bekala Terbakar MEDAN (Waspada): 164 Dari 185 kios di Pasar Inpres Kwala Bekala Jl. Tali Air P. Bulan, Kec. Medan Johor, musnah terbakar, Rabu (14/4) pukul 01.15 dinihari. Penyebab kebakaran belum diketahui, namun api diduga berasal dari toko tukang mesin jahit atau warung kopi yang letaknya berdempetan. P. Siburian, salah seorang warga, mengatakan, dinihari itu dia mendengar teriakan kebakaran dari warga di sekitar pasar. Mendengar teriakan tersebut, dia bersama sejumlah warga lainnya mendatangi lokasi kebakaran. “Kami tidak tahu pasti penyebabnya, api begitu

cepat menyambar karena kebanyakan kios ini dindingnya dari papan,” kata Siburian. Hal senada juga diungkapkan Lurah Kwala Bekala, Enoh PT. Tarigan. Dikatakannya, penyebab kebakaran masih belum diketahui, apakah dari arus pendek atau lainnya. “Mengenai penyebabnya masih simpang siur. Namun, sebelum terjadi kebakaran itu tidak ada pemadaman listrik,” ujarnya. Tarigan menjelaskan, kebakaran yang terjadi sekitar pukul 01.15 berhasil dipadamkan oleh petugas pemadaman Pemko Medan dan Deliserdang sekitar pukul 04.00 pagi. “Tak ada lagi yang berjualan pada jam

segitu. Pedagang tutup sekitar pukul 19.30. Saya dapat kabar dari petugas jaga malam. Tidak ada korban jiwa dalam kebakaran ini. Namun kerugian ditaksir ratusan juta rupiah,” jelasnya. Dia mengimbau kepada kelompok pasar agar mendata pemilik kios yang menjadi korban kebakaran, sehingga pihaknya bisa berkoordinasi dengan PD Pasar untuk mencari solusinya. “Tidak mungkinkan mereka tidak jualan lagi,” katanya. Salah satu pemilik toko pecah belah Semua Sebayang, 50,

Lanjut ke hal A2 kol. 3

JAKARTA (Antara): Ketua Fraksi PDI DPR Tjahjo Kumolo menyatakan pihaknya secara resmi telah menolak kehadiran Menteri Keuangan Sri Mulyani untuk mewakili pemerintah dalam setiap sidang, baik di Komisi XI maupun Badan Anggaran. “Pimpinan Fraksi sudah mengirim ‘memo’ kepada Ketua Kelompok Fraksi (XI) PDI P DPR dan Kelompok Fraksi Badan Anggaran yakni Emir Muis mengenai hal tersebut,” katanya di Jakarta, Rabu(14/4). Ia menegaskan, tidak ada

Panas Berkepanjangan Picu Penuaan Dan Kanker Kulit MEDAN (Waspada): Badan Meteorologi Klimatologi dan Geofisika (BMKG) Wilayah I stasiun Bandara Polonia memperkirakan cuaca panas akan melanda Kota Medan sekitarnya hingga Juni 2010. Jika demikian, masyarakat harus mewaspadainya karena berdampak terhadap kesehatan terutama gangguan pada bagian kulit.

Rahudman - Eldin Bertekad Rabu (14/4). Dari paparan pembuka calon dengan nomor urut 6 itu, berbeda dari penampilan calon sebelumnya, berlangsung di Lantai III

Lanjut ke hal A2 kol. 6


Petugas Pasar Horas bertindak brutal terhadap para pedagang kaki lima yang mempertahankan lokasi mereka. Seorang perempuan berusia lanjut ditunjang jatuh pingsan.

DALAM foto yang disiarkan oleh Kantor Berita Xinhua, beberapa bangunan hancur setelah gempa bumi di Jiegu Town, dari Yushu, satu prefektur otonomi Tibet di barat provinsi Qinghai di baratlaut China, Rabu (14/4).


Unsyiah Tampung 1.228 Mahasiswa

Gempa Kuat Guncang China, 400 Tewas

Universitas Syiah Kuala pada tahun ini menampung 1.228 mahasiswa baru yang masuk melalui jalur Ujian Masuk Bersama (UMB) di 12 PTN.


Diimingi Jadi PNS, Puluhan Juta Raib

Diiming-imingi bakal diangkat jadi PNS, uang senilai Rp20 juta raib dibawa orang yang mengaku sebagai Kepala Badan SDM Pusat. C4

Waspada/Hang Tuah J Said

CALON walikota Medan nomor urut 6, H Rahudman Harahap (tengah) didampingi pasangannya calon wakil walikota Medan, H Dzulmi Eldin (kanan), sedang berbicara seputar visi misinya dalam acara Bedah Visi Misi Calon Walikota Periode 2010-2015, di lt.3 gedung Harian Waspada, Jl Letjen Suprapto, Medan, Rabu (14/4).

“Sinar matahari yang mengandung radiasi ultraviolet, berpotensi menyebabkan kerusakan kulit sehingga terjadi penuaan lebih cepat. Bahkan, radiasi ultraviolet bisa memicu kanker kulit jika terpapar langsung dalam waktu relatif lama,” kata ahli penyakit kulit dan kelamin RSU Dr. Pirngadi

Lanjut ke hal A2 kol. 7

D.L. Sitorus Tak Penuhi Panggilan KPK

Bedah Visi Misi Di Waspada MEDAN (Waspada): “Kami tidak punya jargon. Visi misi kami pun tidak banyak dan singkat saja,” kata Calon Walikota Medan Rahudman Harahap dalam acara Bedah Visi Misi Calon Walikota Medan Periode 20102015 yang diadakan oleh Harian Waspada,

kompromi untuk Sri Mulyani hadir untuk mewakili pemerintah. Kehadiran Sri Mulyani, katanya, dapat digantikan oleh Menko Perekonomian atau Menkeu Ad Interim. “Kalau toh Sri Mulyani hadir, posisinya hanya mendampingi saja dan tidak menyampaikan materi atas nama pemerintah,” ujarnya menegaskan. Dia menambahkan, sikap itu terkait konsistensi terhadap keputusan paripurna DPR perihal hasil angket skandal Bank Century sampai proses hukumnya selesai.

BEIJING, China (AP): Serangkaian gempa kuat menggoncang provinsi Qinghai, satu kawasan paling barat Tibet di China, Rabu (14/4), menewaskan sedikitnya 400 orang, mencederai 10.000 lainnya dan banyak korban lainnya terkubur di dalam rumah-rumah yang rubuh di kawasan pegunungan itu, lapor para pejabat dan media pemerintah. Survei Geologi AS (USGS) mengatakan gempa dengan kekuatan 6,9 skala Richter itu mengantam bagian selatan Qinghai, Rabu pagi dan diikuti 18 gempa susulan. Pusat gempa terjadi di Golmud, kota terbesar di Qinghai, dengan kedalaman 10 km, kata USGS. Gempa terkuat menyebabkan para penduduk berlarian keluar rumah dan seiring dengan itu gempa merubuhkan

Lanjut ke hal A2 kol. 5

JAKARTA (Antara): Pengusaha Darianus Lungguk Sitorus tidak memenuhi panggilan tim penyidik KPK untuk diperiksa dalam kasus dugaan suap Rp300 juta terhadap hakim Pengadilan Tinggi Tata Usaha Negara (TUN) Jakarta, Ibrahim. “Kami belum menerima pemberitahuan tentang alasan ketidakhadiran yang bersangkutan,” kata Juru Bicara Komisi Pemberantasan Korupsi (KPK), Johan Budi, di Jakarta, Rabu (14/4) sore. Johan menjelaskan, KPK kemungkinan akan mengirimkan panggilan kedua lepada D.L. Sitorus. Namun, dia belum

Lanjut ke hal A2 kol. 3

Seramp ang erampang - Memang lebih kejam ibukota dari ibu ..... - He...he...he...

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

KAMIS, Pon, 15 April 2010/30 Rabiul Akhir 1431 H

No: 23119 Tahun Ke-64

Edisi Aceh

Terbit 24 Halaman (A1-8, B1-8, C1-8)

Harga Eceran: Rp 2.500,- (belum termasuk ongkos kirim)

Priok Rusuh JAKARTA (Waspada): Aksi brutal Satpol PP dalam menangani penggusuran makam Mbah Priok, Jakarta Utara berujung rusuh. 5 Mobil aparat Kepolisian dan Satpol PP dibakar masa. Sementara, puluhan mobil aparat dari kepolisian dan Satpol PP juga dihancurkan. Sementara korban luka hingga sore kemarin mencapai 100 orang. Pantauan detikcom, pukul 16.30WIB, Rabu (14/4), pembakaran dilakukan setelah massa Lanjut ke hal A2 kol. 3 AFP/HO/CCTV

Petugas mencari korban yang tertimbun reruntuhan bangunan. Bencana alam ini sedikitnya mengakibatkan sedikitnya 400 orang tewas.

6,9 SR Renggut 400 Jiwa Di China BEIJING (Waspada): Hingga kemarin sore korban jiwa akibat gempa dahsyat di Provinsi Qinghai, China terus bertambah. Tercatat sekitar 400 nyawa telah melayang akibat gempa berkekuatan 6,9 Skala Richter

di dekat Tibet itu. Lebih dari 10.00 orang lainnya mengalami luka-luka. Demikian diberitakan kantor berita resmi China, Xinhua dan dilansir Reuters, Rabu (14/4). “Saya melihat orang-orang

terluka di mana-mana. Masalah terbesar sekarang adalah kami kekurangan tenda, kami kekurangan peralatan medis, obatobatan dan pekerja medis,” kata Lanjut ke hal A2 kol. 1


5 Mobil aparat kepolisian dan Satpol PP dibakar massa dalam bentrokan di depan Mbah Priok, Jakarta, Rabu (14/4). Pembakaran ini dilakukan setelah massa tidak bisa menahan emosi saat melihat Satpol PP berusaha mengeksekusi kompleks makam Mbah Priok. Asap hitam membumbung dari mobil yang dibakar.

Cabut Travel Warning Ke Aceh Gubernur: Aceh Kawasan Rawan Bencana Alam BANDA ACEH (Waspada): Gubernur Aceh IrwandiYusuf, menyatakan musibah tsunami sekitar enam tahun silam itu menunjukkan wilayahnya berada dalam kawasan rawan bencana alam. “Memori Tsunami 26 Desember 2004 menyadarkan bahwa kita hidup dalam kawasan rawan bencana alam,” katanya di Banda Aceh, Rabu (13/4). Hal itu disampaikan gubernur saat membuka “7th Intergovernmental Coordination Group for the Indian Ocean Tsunami Warning and mitigation System/Kelompok Koordinasi Antarpemerintah/Sistem Peringatan Tsunami Samudera Hindia (ICG/IOTWS), yang dihadiri perwakilan sejumlah negara. Perwakilan sejumlah negara asing yang menghadiri ICG/IOTWS itu yakni Jerman, India, Cina, Australia, Amerika Serikat, Oman, Maldives, Thailand, Malaysia, Perancis, Tanzania, Pakistan, Singapura, Sri Lanka, Kenya, Qatar dan Jepang. “Visi Aceh Green yang saya gagas adalah salah satu upaya dalam mengurangi risiko bencana akibat ulah manusia. Mengurangi risiko bencana alam dengan konsep pembangunan ekonomi berkelanjutan melalui strategi investasi hijau untuk Aceh,” tambahnya. Lanjut ke hal A2 kol. 3

Desakan Gubernur Pada PBB Dan Australia BANDA ACEH (Waspada): Gubernur Aceh Irwandi Yusuf mendesak Badan Perserikatan Bangsa-Bangsa (PBB) dan Pemerintah Australia, mencabut status travel warning ke Aceh, yang sebelumnya diberlakukan bagi warganya. Ini untuk kedua kali, gubernur mendesak badan dunia dan negara Kangguru itu. Irwandi mengatakan itu dalam konferensi international Indian Ocean Tsunami Warning

and Mitigation System (IOTWS) di Hotel Hermes Palace, Banda Aceh, Rabu (14/4) yang dihadiri

29 perwakilan negara semenanjung Samudera Hindia. Gubernur menyebutkan, Aceh sudah sangat aman dan tidak ada lagi gangguan terorisme di provinsi yang baru lepas dari konflik. “Saya minta negaranegara yang telah terlanjur mengeluarkan travel warning ke Lanjut ke hal A2 kol. 7

Polri: SJ Penghubung Kasus JAKARTA (Waspada): Pelaksana tugas Kepala Bidang Penerangan Umum (Kabid Penum) Divisi Humas Mabes Polri, Komisaris Besar Zulkarnain Lubis mengatakan dugaan sementara tentang peranan Sjahril Djohan (SJ) adalah sebagai penghubung kasus di kepolisian. “Penghubunglah ya dengan

berkasus, antara Haposan ke SJ kepada kepolisian,” kata Zulkarnain di Mabes Polri, Rabu (14/4). Zulkarnain menuturkan, kepastian itu harus melalui pemeriksaan lebih lanjut terhadap SJ dengan mengkonfrontasikan dengan pihak terkait lainnya. Zulkarnain menyatakan, ke-

mungkinan penyidik akan mengkonfrontasikan Sjahril Djohan (SJ) dengan mantan Kabareskrim, Komjen Susno Duadji dan tersangka korupsi, penggelapan pajak, serta pencucian uang senilai Rp25 miliar, Gayus Tambunan. Lanjut ke hal A2 kol. 7

Universitas Syiah Kuala pada tahun ini akan menampung 1.228 mahasiswa baru yang masuk melalui jalur Ujian Masuk Bersama (UMB) di 12 Perguruan Tinggi Negeri. Kecuali itu, ada empat jalur lain yang bisa dipakai calon mahasiswa untuk belajar di Unsyiah. Hal C4


Oleh H. Ameer Hamzah Sesungguhnya orang-orang yang beriman dan beramal saleh, bagi mereka adalah surga Firdaus menjadi tempat tinggal, (QS. Al-Kaffi:107) Surah ke-18 dalam al-Quran adalah Surah al-Kaffi (Gua Kaffi). Isi surat ini antara lain; tentang kekuasaan Allah sebagai penguasa langit dan bumi dan seluruh isinya, manusia wajib menyembah Allah SWT karena Dia yang berhak disembah. Balasan orang-orang yang menyembah Allah dengan benar adalah surga. Dalam surah ini juga ada empat kisah yang sangat Lanjut ke hal A2 kol. 1

LEMBAH SEULAWAH, Aceh Besar (Antara): Gubernur Aceh Irwandi Yusuf ikut dalam operasi penemuan empat senjata api laras panjang yang diduga milik jaringan teroris di kawasan Meunasah Tunong, gampong Lamteuba, Kecamatan Lembah Seulawah, Kabupaten Aceh Besar, Rabu (14/4). Dari lokasi yang berjarak 35 Km dari Banda Aceh disebutkan, senjata yang terdiri dari dua pucuk jenis SK dan dua pucuk M-16 tersebut ditemukan di dalam sebuah gubuk berukuran 4x5 meter yang ditanam sedalam 4 Cm. Selain senjata, aparat juga metemukan 16 magazen, yang terdiri dari sembilan buah

jenis AK-47 dan tjuh buah jenis M-16. Gubernur Irwandi yang didampingi mantan Kapolres Poso, Kombes Pol Rudy Sufahriadi dan personil Brimob saat menuju lokasi yang harus berjalan kaki sejauh 3 Km melewati jurang dan penuh semak belukar. Lokasi penemuan senjata tersebut dikelilingi lembah dan perbukitan. Di daerah itulah diduga tempat latihan para teroris. Rombongan tiba di lokasi pada pukul 16.30 WIB dengan membawa dua tersangka teroris berinisial Ubt dan Mtk sebagai penunjuk jalan dan lokasi Lanjut ke hal A2 kol. 1

Kasus Irham Perlu Kajian Hukum

Baca Halaman Dalam Unsyiah Akan Tampung 1.228 Mahasiswa

Delapan Belas

Ikut Operasi, Gubernur Temukan Senjata Teroris

18 PERTANYAAN: Kuasa Hukum untuk Sjahril Djohan, Hotma Sitompul, melambaikan tangan usai memberi keterangan mengenai perkembangan pemeriksaan Sjahril Djohan sebagai saksi di Mabes Polri Jakarta, Rabu pagi (14/4). Sebanyak 18 pertanyaan diajukan penyidik terhadap kliennya tersebut.

BANDA ACEH(Waspada): Lembaga Konsultasi dan Bantuan Hukum (LKBH) Pengurus Besar Persatuan Guru Seluruh Indonesia (PGRI) Pusat melihat banyak terjadi penyimpangan dalam hal proses hukum terhadap Irham bin Mahmud dalam kasus dugaan pencabulan terhadap korban WH, murid SDN Lampeuneurut, Aceh Besar, pada awal Desember 2009 lalu. “Karenanya, perlu dilakukan kajian hukum terhadap kasus yang sempat menghebohkan kalangan guru di Provinsi Aceh ini,” ungkap Wakil Ketua LKBH PB PGRI Pusat DR. Ahmad Dalil Harahap, SH, MH dalam acara konferensi pers di gedung PGRI Aceh, Rabu (14/4).

Ahmad Dalil Harahap yang berbicara didampingi Ketua Pengurus Daerah PGRI Provinsi Aceh Drs. Ramli Rasyid, M.Pd dan Ketua PGRI Aceh Besar Saifullah Musa, S.Pd lebih lanjut mengatakan, kajian hukum terhadap terdakwa Irham Bin Mahmud sangat diperlukan untuk mengungkap motif yang sebenarnya di belakangi kasus ini. Kajian hukum ini, sebut Ahmad Dalil Harahap, akan melibatkan berbagai pihak termasuk pers. Pasalnya, kata dia, dalam proses hukum kasus guru bantu pada SDN Lampeuneurut, itu telah banyak terjadi penyimpangan hukum. Artinya, proses hukum itu tidak sesuai dengan KUHAP, tuturnya. Jadi dengan

BPKEL: Ada Bisnis Gading Gajah Di Aceh Timur IDI, Aceh Timur (Waspada): Mengganasnya puluhan ekor gajah liar di Kabupaten Aceh Timur, Provinsi Aceh, tidak hanya oleh faktor menyempit habitat akibat pembalakan liar dan pembukaan lahan baru, namun informasi terbaru menyebutkan, amukan puluhan ekor gajah lebih dititikberatkan adanya perburuan gading. “BPKEL Aceh hanya lambung koordinator. Untuk Aceh Timur, BP Kel banyak mendapat laporan dari sana bahwa marak terjadi perburuan gading gajah secara besar-besaran, namun kita sulit membuktikannya,” kata Staf Operasional BPKEL Wilayah Aceh, Badrul Irfan, menjawab Waspada, Rabu (14/4) sore. Dia menjelaskan, informasi mengganasnya gajah dibeberapa desa dalam Kecamatan Serbajadi—Lokop, Kabupaten Aceh Timur, sudah diketahui melalui media massa. Bahkan, sejauh ini Badan Pengelola Kawasan Ekosistem Leuser (BPKEL) Wilayah Aceh, telah melakukan koordinasi dengan beberapa lembaga dalam penanggulangan gajah yang kian mengganas di pantai timur Aceh. Dalam penanggulangan itu, lanjut Badrul Irfan, pihaknya hanya melakukan sharing dan koordinasi dengan lembaga-lembaga lingkungan, seperti Badan Konservasi Sumber Daya Alam (BKSDA) Provinsi Aceh dan Dinas Kehutanan dan Perkebunan Aceh. Sehingga langkah yang dilakukan tepat dan sesuai

dengan petunjuk tehnis (Juknis) di lapangan. Lebih lanjut Badrul Irfan mengemukakan, konflik gajah yang terjadi di Aceh Timur, tidak terlepas dari beberapa faktor, diantaranya habitat gajah menyempit karena penebangan hutan secara liar yang diduga masih terjadi, kemudian pemukiman penduduk banyak yang berdekatan dengan kawasan yang menjadi habitat gajah. “Anehnya, meski gajah ngamuk masih ada informasi, bahwa di sana masih terjadi perburuan gading gajah yang akhirnya dijadikan ajang bisnis mancanegara,” kata Badrul Irfan seraya mengaku, dalam waktu dekat pihaknya resmi mendirikan Badan Protokoler (BP) di kabupaten/kota yang pusatnya di Banda Aceh, dimana masyarakat akan dapat melaporkan langsung setiap aksi yang terjadi di KEL dan konflik satwa. Badrul Irfan mengaku, setiap tahun untuk program yang dijalankan dananya bersumber dari Anggaran Pendapatan Belanja Aceh (APBA), namun untuk tahun 2010 usulan dana senilai Rp1 miliar tidak disahkan oleh DPR Aceh, sehingga ke depan untuk kegiatan dan program yang diemabannya diperkirakan akan tersendat. Lanjut ke hal A2 kol. 7

dibuat kajian hukum, supaya masyarakat tahu kasus ini yang sebenarnya, katanya. Dia membeberkan “dosa” yang dilakukan pihak penyidik polisi pada saat melakukan penangkapan terhadap terdakwa Irham bin Mahmud tidak ditunjukkan surat perintah penangkapan terhadap pelaku. Dan juga penangkapan itu tidak sepengetahuan kepala sekolah. Bukan itu saja, sebut Ahmad Dalil Harahap, selama dalam pemeriksaan penyidik Poltabes Banda Aceh terdakwa Irham bin Mahmud tidak didampingi oleh penasehat hukum. “Padahal kasus yang ancamannya lima tahun ke atas harus didampingi penasehat hukum. Kalau tidak ada penasehat hukum penyidik wajib menunjuk penasehat hukum,” ucapnya. “Untuk itu, terhadap BAP yang tidak didampingi penasehat hukum, maka dengan sendirinya BAP tersebut batal demi hukum,” sebut Ahmad Dalil Harahap, yang juga tercatat sebagai Lanjut ke hal A2 kol. 1

Serampang - Euntreuk na nyang bengeh Pak - He... he... he...

A2 6,9 SR Renggut 400 Jiwa ... Zhuohuaxia, juru bicara pemerintah setempat kepada Xinhua. Tentara-tentara telah dikerahkan ke lokasi bencana untuk membantu pencarian korban. Dilaporkan masih banyak warga yang tertimpa reruntuhan bangunan. Menurut Badan Survei Geologi AS atau USGS, gempa itu berkekuatan 6,9 pada sala Richter. Namun menurut otoritas China, kekuatan gempa mencapai 7,1 Richter. Sementara lebih dari 85 persen rumah di dekat pusat gempa, Kotapraja Jiegu, telah ambruk, kata Zhuohuaxia, pejabat urusan penyiaran di Prefektur Otonomi Tibet, sebagaimana dikutip dari Xinhua-OANA kemarin. “Banyak orang tertimbun rumah yang ambruk, dan masih ada banyak orang lagi yang cedera dan kini dirawat di beberapa rumah sakit setempat,” katanya. Banyak murid sekolah dasar termasuk di antara yang tertimbun, tapi jumlah mereka tak diketahui, kata Shi Huajie, perwira di polisi militer dalam operasi pertolongan. “Kami terutama harus mengandalkan tangan kami untuk membersihkan puing karena kami tak memiliki mesin besar untuk melakukan penggalian,” katanya. “Kami juga tak memiliki peralatan medis.” Gempa tersebut mengguncang Kabupaten Yushu di Prefektur Yushu pukul 07:49 waktu setempat dengan kedalaman sekitar 33 kilometer. Pusat gempa diperkirakan berada di 33,1 lintang utara dan 96,7 bujur timur, demikian laporan Pusat Jaringan Gempa China. Sedikitnya tiga gempa susulan telah dilaporkan sejauh ini, dan yang paling kuat tercatat 6,3 pada skala Richter sekitar satu jam 36 menit kemudian. Sebelumnya, pada pukul 05:39 waktu setempat, gempa dengan kekuatan 4,7 pada skala Richter mengguncang kabupaten itu dengan kedalaman sekitar 6 kilometer, kata pusat tersebut. Pusat gempa berada sekitar 30 kilometer dari Kotapraja Jiegu, pusat pemerintahan Prefektur Yushu, dan sekitar 800 kilometer dari Xining, ibukota provinsi itu.Tiga gempa susulan telah terjadi menyusul gempa utama yang mengguncang daerah pegunungan dekat Tibet itu. Menurut USGS, gempa-gempa susulan tersebut berkekuatan hingga 5,8 pada skala Richter.(dtc/ant/m27)

Kasus Irham Perlu ... tim penasehat hukum terdakwa Irham bin Mahmud. Karena itu, dalam proses pemeriksaan di tingkat penyidikan maupun proses persidangan terdakwa membantah dan mencabut semua tuduhan (BAP) terhadap perbuatan pencabulan tersebut. Karena terdakwa tidak pernah melakukan perbuatan tersebut. Menyinggung pengakuan korban adanya noda darah di celana korban yang disebut-sebut dilakukan terdakwa, Ahmad Dalil Harahap mengatakan perlu dibuktikan. Pasalnya, BB celana dalam milik korban tidak pernah diajukan kepersidangan. Juga termasuk visum yang tidak dapat dijelaskan bahwa noda darah itu merupakan perbuatan dari terdakwa. Sementara Ketua Pengurus Daerah PGRI Provinsi Aceh Ramli Rasyid menyambut positif dilakukannya kajian hukum terhadap kasus Irham bin Mahmud. “Kita akan segera membentuk timm kajian hukum tersebut,” ungkap Ramli. Bahkan, lanjut Ramli, pemberian perlindungan hukum terhadap Irham selaku guru ini merupakan perintah Undang-undang yaitu pasal 42 UU No.14 tahun 2005, tentang guru.. “Jadi apa yang kita lakukan itu bukan sensasi atau melakukan intervensi terhadap pengadilan,” papar staf ahli Pemko Banda Aceh ini. (b06)

Ikut Operasi Gubernur ... penanaman senjata. “Jadi, lokasi penanaman senjata ini diperoleh dari tersangka teroris yang berhasil ditangkap beberapa hari lalu,” kata Irwandi. Gubernur berharap pihak kepolisian terus melakukan penyelidikan karena diduga masih ada beberapa lokasi yang dijadikan jaringan teroris untuk penyimpanan senjata. “Kita bersyukur, pada hari ini berhasil menemukan beberapa pucuk senjata dan ini akan terus dikembangkan karena kemungkinan di lokasi lainnya masih ada,” katanya.

Delapan Belas ... menarik. Pertama cerita pemuda Kaffi (Aulia Tujuh) yang beriman kepada Allah SWT di tengah-tengah kaumnya yang menyembah raja sesat, Raja Dikyanus yang mengaku dirinya tuhan. Demi menyelamatkan agama dan keimanannya para pemuda ini melarikan diri dari pemburuan raja dzalim tersebut. Bersama mereka ada seekor anjing. Setelah bersembunyi dalam gua, mereka tertidur sampai 309 tahun lamanya. Kemudian Allah Subhanahu wa Ta’ala mengembalikan nyawa mereka. Karena merasa lapar, lalu salah seorang di antara mereka diutus untuk turun ke kota membeli makanan. Dirham yang ada sama bersangkutan tentu tidak berlaku lagi. Pemilik warung makanan tersebut tentu tidak bias menerima mata uang tersebut. Akhirnya pembeli diamankan oleh pihak keamanan. Setelah dinterogasi baru terungkap bahwa pemmbeli itu tidak berdusta. Silakan membaca sendiri di awal surat tersebut. Cerita kedua adalah tentang dua orang bersaudara, yang satu kaya raya dan seorang lagi miskin. Si kaya sangat sombong dan tidak beriman, si miskin beriman dan tidak sombong. Saudaranya yang miskin meminta pertolongan kepada yang kaya, tetapi si kaya sangat kikir. Akhirnya Allah membinasakan semua hartanya, kebunnya yang Jawaban Problem Catur, ranum berbuah menjadi TTS Dan Sudoku layu dan mati semuanya. Dari Halaman Sport. Meski ini kisah perumpamaan, namun sangat baik kita renungkan. Jawaban Problem Catur: Cerita ketiga adalah tentang kisah Nabi Musa yang 1. ........., Bxg3+. berguru kepada Nabi Khidir. 2. GxB, MxM (Jika Meski Musa sebagai Rasul yang sangat dekat dengan 2. Rh2, Bg2+. Allah, ternyata ada lain ham3. Rh1, Bxf2+mat). ba Allah yang lebih alim. Musa minta ikut perjalanan Putih menyerah. Khidir. Bagi Khidir tidak keberatan asal saja Musa dapat Jawaban TTS: bersabar. Musa menyangguTTS Topik Olahraga pi, maka berjalanlah keduaH O L Y F I E L D nya dengan menumpang A I A I K A R O perahu dan seterusnya. (ayat K E B U N B U N G A O D 60—82). E L I A S S N Cerita keempat adalah L M L F U T S A L tentang Dzulkarnain seB A L A P I L I orang Raja yang beriman S T O O F D kepada Allah SWT dari beE B A Y E R N I S S I R O E W L N nua Eropa. Dzulkarnain berD A L L A S I I H asal dari Mecedonia. Raja A I O L I M P I C O penakluk ini selalu menranN N D I H B kan kepada penduduk negeV A L E N T I N O G R O G I ri-negeri yang ditaklukkanO S A N L nya supaya beriman kepada C A T U R S A M A Allah yang Maha Esa. Meski Jawaban Sudoku: dia bukan seorang rasul, namun Allah mewahyukan ke1 7 5 2 9 4 3 8 6 padanya agar menghukum 9 6 3 1 5 8 2 7 4 orang-oang yang zalim dan 2 8 4 7 3 6 9 1 5 melindungi orang-orang yang berbuat baik. Dzulkarna8 5 3 9 6 7 2 1 4 in menguasai sebagian Ero7 2 1 4 8 3 5 6 9 pa, sebagian Asia dan seba8 4 6 9 1 5 7 2 3 gian Afrika. Kerajaannya sangat luas karena mendapat 3 1 8 5 6 7 4 9 2 pertolongan dari Allah SWT. 4 5 7 8 2 9 6 3 1 Kisah Dzulkarnain mulai 6 9 2 3 4 1 8 5 7 dari ayat 83 –99.

Berita Utama Berkas Kasus Korupsi Disperindag Aceh Selatan Ke Jaksa TAPAKTUAN (Antara): Aparat penyidik Polres Aceh Selatan telah melimpahkan kasus dugaan korupsi pembangunan pabrik mini triplek (plywood) ke Jaksa Penuntut Umum (JPU).

“Berkas kasus korupsi itu telah kami limpahkan ke JPU beberapa hari lalu, sementara tiga tersangka tetap ditahan di Mapolres,” kata Kapolres Aceh Selatan, AKBP Awi Setiyono di Tapaktuan, Rabu (14/4).

Proyek senilai Rp411 juta di Dinas Perindustrian dan Perdagangan Kabupaten Aceh Selatan itu diduga menyimpang dari ketentuan yang ditetapkan, sehingga negara dirugikan senilai Rp199 juta. Dia mengatakan, polisi te-

Pesta Rakyat Tiga Bulan Ramaikan HUT Ke-805 Kota Banda Aceh BANDA ACEH (Antara): Pemerintah Kota (Pemko) Banda Aceh akan menggelar berbagai even pesta rakyat selama tiga bulan dalam rangka memeriahkan ulang tahun ke-805 kota tersebut. “Rangkaian kegiatannya sudah digelar sejak pekan lalu dan akan berlangsung hingga Juni 2010,” kata Ketua Pelaksana Harian HUT Kota Banda Aceh Drs. Ramli Rasyid di Banda Aceh, Rabu (14/4). Ulang tahun Kota Banda Aceh diperingati setiap 22 April. Kota di ujung paling barat Pulau Sumatra itu dibangun Sultan Johan Syah

pada Jumat 1 Ramadhan 601 H atau bertepatan 22 April 1205 M. Rangkaian kegiatannya antara lain Banda Aceh Expo, Festival Taman Sari, perlombaan drum band serta berbagai acara piasan rakyat seperti layang-layang, perahu tradisional dan kesenian Aceh. “HUT kota tahun ini diselenggarakan secara sederhana dan di hari puncaknya akan digelar sidang paripurna istimewa DPRK. Perayaannya pun sama seperti tahun-tahun sebelumnya,” kata dia. Ia mengatakan, Banda Aceh Expo dan Festival Taman Sari digelar bersamaan

pada 21 hingga 25 Mei 2010 dan hingga kini sudah tercatat 30 peserta yang akan mengikuti acara tersebut. Menyangkut dana penyelenggaraan Ramli mengatakan, semuanya murni bantuan pihak ketiga dan sumbangan dinas-dinas di lingkungan Pemko Banda Aceh. Namun, ia tidak menyebutkan total anggaran. “Yang jelas dananya bukan anggaran pemerintah. Pemko tidak mengalokasikan dana dalam APBK 2010,” katanya sambil mengharapkan Banda Aceh Expo bisa menyumbang Pendapatan Asli Daerah (PAD).

Gubernur: Aceh ...

Agung Laksono mengatakan, pemerintah akan mengalokasikan anggaran sebesar Rp400 miliar untuk keberlanjutan sistem peringatan dini tsunami. “Rp400 miliar yang akan dialokasikan dalam tiga tahun anggaran dari APBN dan APBNP untuk keberlanjutan peringatan dini tsunami di Indonesia,” kata Menkokesra Agung Laksono usai pertemuan Kelompok Koordinasi Antarpemerintah/Sistem Peringatan Tsunami Samudera Hindia (ICG/IOTWS) di Banda Aceh kemarin. Menkokesra menjelaskan, untuk tahun ini anggaran yang akan dialokasikan senilai Rp125 miliar. “Sebelumnya kita banyak dibantu oleh negara-negara donor namun donor tersebut akan berakhir pada tahun ini sehingga pemerintah akan menganggarkannya dalam APBN dan APBNP,” katanya. Dari total Rp400 miliar itu, salah satunya untuk pemeliharaan alat-alat pada sistem peringatan dini. Pasalnya alatalat untuk sistem peringatan dini terus bekerja 1x24 jam sehari, dalam satu bulan, sepan-

jang tahun sehingga tidak pernah mati dan perlu perawatan intensif. Kedua untuk pengembangan sistem pendukung pengambilan keputusan. Sistem itu dikembangkan untuk mendapatkan informasi lebih rinci mengenai lokasi gempa, besar kekuatannya dan lain sebagainya. Terakhir, alokasi anggaran diperuntukkan bagi perapatan jaringan sirine. Sementara Kepala Badan Meteorologi, Klimatologi dan Geofisika, Sri Woro B Harijono mengatakan, Indonesia masih membutuhkan banyak sirine. “Jumlah yang ada pada saat ini di seluruh Indonesia sekitar 22 unit,” katanya. Begitupun menurut Irwandi, Aceh masih membutuhkan empat buah buoy (pelampung) tsunami lagi untuk memperkuat sistem peringatan dini tsunami (Early Warning System), yang fasilitasnya sudah terpasang di sejumlah titik bantuan negara donor pascabencana tsunami, pada 26 Desember 2004 lalu. “Sebenarnya kita masih mengharapkan adanya empat titik lagi pelampung buoy, setelah itu mungkin sudah me-

amarah massa. Awalnya, massa sedang menghancurkan mobil Satuan Polisi Pamong Praja (Satpol PP). Kepala Satuan Reserse dan Kriminal Jakarta Utara Komisaris Polisi Susatyo Purnomo mencoba melerai. Massa tetap tak perduli. Entah berasal dari arah mana, tiba-tiba Susatyo terkena bogem mentah beberapa kali di bagian wajah dan bibir. Alhasil, bibir dan hidung Susatyo sobek dan bercucuran darah. Massa masih belum puas dan berniat menyerang lagi. Untung saja, tokoh masyarakat setempat berhasil melerai. Susatyo pun diamankan dan langsung dibawa ke RS Koja, Jakarta Utara. Sampai sore ini, suasana di kawasan itu masih lumpuh total. Ditunda Eksekusi bangunan liar di sekitar kawasan Makam “Mbah Priok” akhirnya ditunda setelah timbul korban lukaluka akibat bentrokan antara warga dengan petugas Satpol PP yang terjadi Rabu pagi kemarin. “Sekda sudah perintahkan pasukan ditarik. Eksekusi ditunda hingga proses persuasif berhasil,” kata Kepala Bidang Informasi Publik Pemprov DKI Jakarta Cucu Ahmad Kurnia di Balaikota Jakarta, Rabu kemarin. Sebanyak 2.000 petugas Satpol PP diturunkan untuk melakukan penertiban itu dengan dibantu 640 petugas polisi gabungan dari Polda Metro Jaya. Ia menegaskan bahwa Pemprov DKI tidak akan membongkar bangunan makam “Mbah Priok” bahkan akan memugar makam tersebut dan dibangun taman disekitarnya. “Yang akan dibongkar itu bangunan di sekitarnya, ada gapura tinggi hingga lima meter, tembok dan beberapa bangunan,” kata Cucu. Pendekatan persuasif me-

nurut Cucu telah dilakukan sejak jauh-jauh hari namun ia tidak menyangkal ada oknumoknum tertentu yang menyebarkan isu bahwa Pemprov DKI akan membongkar bangunan makam. Lokasi makam Mbah Priok itu terletak diatas tanah sengketa antara PT Pelindo II dan para ahli waris melalui persidangan di Pengadilan Negeri Jakarta Utara. Para ahli waris lahan makam Mbah Priok mengklaim kepemilikan tanah di lokasi tersebut hingga 5,4 hektar dengan bukti kepemilikan Eigendom Verponding No.4341 dan No.1780. Pengadilan Negeri Jakarta Utara pada tanggal 5 Juni 2002 telah memutuskan bahwa tanah itu secara sah merupakan milik PT Pelindo II sesuai hak pengelolaan lahan (HPL) nomor 01/Koja dengan luas 1.452.270 meter persegi. Surat Kepala Dinas Pertamanan dan Pemakaman Provinsi DKI Jakarta tanggal 10 Februari 2009 Nomor 80/1.711.11 juga menyebutkan bahwa makam Mbah Priok juga telah dipindahkan ke TPU Semper pada 21 Agustus 1997. Gubernur DKI Jakarta Fauzi Bowo menyatakan rasa keprihatinannya mengenai kerusuhan yang memakan korban luka-luka tersebut. “Saya tekankan bahwa tidak ada niat untuk menggusur makam Mbah Priok, bahkan makam keramat ini akan diperbaiki, dibuatkan monumen dan dibuat lebih bagus agar lebih nyaman bagi pengunjung,” katanya. Petugas Satpol PP menurut Gubernur tidak pernah melakukan perlawanan dan berusaha melakukan negosiasi dan keberadaannya di lokasi tersebut adalah untuk mengimplementasikan keputusan Pengadilan Negeri Jakarta Utara.(dtc/kps/vvn)

Selain itu, Irwandi menyatakan upaya adaptasi dan mitigasi terhadap perubahan iklim menjadi penting dalam proses pembangunan ke depan, termasuk bagaimana tata kelola pemerintahan dalam pengelolaan sumberdaya alam dan mitigasi bencana secara keseluruhan. “Hingga kini, Pemerintah Aceh dan mitra baik lokal maupun internasional, telah melakukan beberapa upaya terkait dengan mitigasi bencana,” tambahnya. Saat ini sedang disusun struktur kelembagaan penanggulangan bencana Aceh, dan dalam proses baik ditingkat provinsi maupun kabupaten kota serta penyusunan prosedur standar operasi (SOP) kebencanaan. “Kami juga sedang mengintegrasikan konsep mitigasi bencana dalam Rencana Tata Ruang Aceh (RTRWA), Rencana Pembangunan Jangka Panjang (RTJP) dan dokumen kebijakan turunannya,” kata Irwandi Yusuf. Rp400 M Sementara Menkokesra

Priok Rusuh ... tidak bisa menahan emosi saat melihat cara Satpol PP menangani penggusuran makam Mbah Priok. Pembakaran itu dilakukan sesaat setelah warga yang berkerumun di belakang Habib Rizieq tak bisa menahan emosinya seusai Rizieq memasuki makam Mbah Priok untuk berziarah. 5 Mobil yang dirusak itu antara lain, pick up Satpol PP dan mobil angkutan polisi. Dua mobil itu dibakar setelah sebelumnya digulingkan. Sementara mobil lainnya dirusak dan digulingkan juga. Mobil-mobil yang dirusak antara lain, mobil tahanan Satpol PP, bus polisi, truk polisi hingga barakuda atau water cannon. Usai dibakar, warga membiarkan mobil itu di tengah jalan. Sementara aparat kepolisian hanya melihat dari jauh aksi tersebut karena kalah jumlah. Korban Jumlah korban kerusuhan di makam Mbah Priok sampai pukul 16.11 mencapai 100 orang. Sebagian besar korban luka adalah anggota Satpol PP. Dari 100-an korban luka itu, dua di antaranya adalah anggota DPRD DKI Jakarta, yaitu Andyka (Fraksi Gerindra) dan Ida Mahmuda (Ketua Komisi A DPRD DKI Jakarta). Kedua wakil rakyat itu jadi korban kerusuhan antara Satpol PP dan masyarakat. “Saya akan menuntut Satpol PP ke proses hukum. Mereka memperlakukan kami semena-mena,” kata Andyka. Massa terus mengamuk, kali ini yang menjadi sasaran adalah Kepala Satuan Reserse dan Kriminal Jakarta Utara. Kasat Reskrim Jadi Sasaran Kepala Satuan Reserse dan Kriminal (Reskrim) Jakarta Utara, juga tak luput jadi korban

lah menetapkan tiga tersangka korupsi, yakni ZT, Direktur CV KK, konsultan pengawas, SF dan MH sebagai Pejabat Pelaksana Teknis Kegiatan (PPTK). “Menurut hasil audit BPK, negara mengalami kerugian akibat perbuatan ketiga tersangka,” kata Kapolres. Didampingi Kasat Reskrim Ipda Novi Edyanto, ia mengatakan proyek yang dananya bersumber dari APBK 2007 dan 2008 tersebut dikerjakan tidak sesuai dengan kontrak yang telah ditetapkan. “Banyak sekali ketidaksesuaian bangunan yang berada di gambung (desa) Jambo Manyang, Kecamatan Kluet Utara itu seperti kayu yang digunakan bukan kwalitas unggulan,” katanya. Selain itu, besi ring balok dan tiang bukan besi ukuran 12 mm tapi besi berukuran 10 mm dan yang lebih menyedihkan bangunan yang belum digunakan itu retak dan rusak. Menurut Kapolres ketiga tersangka diduga telah melanggar pasal-2 dan 3 UndangUndang (UU) No.31/1990 jo UU No.20/2001 tentang Pemberantasan Tindak Pidana Korupsi. madai,” ujar gubernur pada konferensi pers di sela-sela pertemuan tersebut. Pada kesempatan yang sama Menko Kesra Agung Laksono mengharapkan bantuan dan dukungan masyarakat untuk menjaga dan merawat buoy-buoy yang terpasang itu. Buoy-buoy itu penting dalam upaya memberikan peringatan dini kepada masyarakat pesisir ketika tsunami masih di tengah laut, sehingga masyarakat bisa sempat bertindak. “Saya kira ini perlu disosialiasi betapa penting Buoy yang terapung dilaut itu untuk keselamatan manusia, jadi buoy itu harus kita jaga dan kita rawat,” cetus Agung Laksono. Terkait penanganan bencana, Menko Kesra ini mengatakan setiap bencana dilakukan pengelolaan pada masa tanggap darurat yang dibaris terdepan adalah pemerintah daerah. “Jadi kalau sudah ditangani pemda itu sebenarnya sudah ditangani pemerintah,” ujar Agung yang membantah kalau pusat tidak tanggap terhadap bencana di daerah. Pertemuan kelompok koordinasi antar pemerintah/sistem peringatan tsunami Samudera Hindia, International Oceanographic Commission Indian Ocean Tsunami Warning and Mitigation System (ICG/IOTWS) ke 7, diikuti sekitar 150 peserta 70 diantaranya peserta asing dari 28 negara anggota. Saat ini sudah 5 negara anggota yang membangun TWS-nya, yakni Australia, India, Indonesia, Malaysia dan Thailand. (b04/ant)

WASPADA Kamis 15 April 2010

Cabut ‘Travel Warning’ ... Aceh supaya segara mencabutnya,” ungkap dia. Seperti diketahui, travel warning ke Aceh diberlakukan Pemerintah Australia terhadap warganya, sejak 27 Maret 2010. Sebelumnya, PBB juga melakukan hal serupa, melarang stafnya berpergian ke Aceh karena operasi pemburuan teroris oleh Kepolisian. Menyikapi itu, Irwandi menilai, pemberlakuan travel warning ke Aceh berlebihan dan mengesankan seolah wilayah ini tak nyaman bagi warga asing. “Aceh sudah 100 persen aman,” kata gubernur Irwandi. Dia menjelaskan, gembong teroris yang selama ini bersembunyi di Aceh dan paling dicari-cari, semuanya telah terbunuh dan ditangkap polisi. Data teranyar adalah Enal Tao alias Haris alias Zaenal, 38, DPO konflik Poso, Sulawesi Tengah, tewas ditembak di Krueng Barona Jaya, Aceh Besar. Katanya, para teroris yang bersembunyi di Aceh, bukan penduduk tempatan atau warga Aceh. “Prediksi mereka salah. Mereka mengira Aceh, yang warganya mayoritas Islam, dianggap fanatik,” tukasnya dalam forum tersebut. (b05)

BPKEL: Ada Bisnis ... Meluas Sementara Geuchik Gampong Ketibung Busara, Bukhari Muslim MH, kepada Waspada, kemarin sore mengungkapkan, amukan gajah di beberapa desa dalam Kecamatan Serbajadi—Lokop, masih terus terjadi. Setelah, Selasa (13/4) sebanyak 4 rumah rubuh dan 11 KK mengungsi ke Arul Duren, kini giliran 6 KK di kawasan UPT Kuala Pangguh, kembali mengungsi akibat pondoknya dihantam gajah hingga rusak berat. Bukhari Muslim mengharapkan, pendirian CRU sebagaimana dijanjikan Yayasan Leuser Internasional (YLI) akan dibangun di SP 1 Kuala Pangguh, Kecamatan Serbajadi—Lokop, agar segera diwujudkan. Hal itu dianggap penting, guna menanggulangi aksi kawanan gajah yang jumlahnya mencapai 50 ekor lebih. Menurut Bukhari Muslim, untuk menghentikan aksi kawanan gajah liar disana, diperkirakan tidak cukup dengan melakukan kegiatan ritual dan doa, namun lebih dari itu, “gajah yang mengamuk tersebut harus kita usir, karena jika tidak dalam dua atau tiga pekan mendatang ratusan rumah lainnya ikut tumbang dan tidak tertutup kemungkinan akan jatuhnya korban jiwa, sebab aksinya kian mengganas,” tandas Bukhari Muslim. Sebagaimana diwartakan Waspada sebelumnya, aksi puluhan ekor gajah liar telah merubuhkan hampir 100 rumah dan lebih 60 hektar lahan perkebunan dan pertanian lenyap. Beberapa desa yang hingga kini measih menjadi sarang gajah (Po Meurah—Aceh) itu diantaranya, Desa Ketibung Busara, SP 1 Kuala Pangguh, SP 2 Kuala Pangguh, Arul Duren, Arul Solar dan beberapa desa tetangga lainnya. (cmad)

Polri: SJ Penghubung ... “Mungkin saja demikian (dikonfrontasikan ). Prosedurnya ketika satu pihak mengatakan ya maka harus dikonfrontasikan,” ujar Zulkarnain. Namun demikian, perwira menengah kepolisian itu menyebutkan hingga saat ini SJ belum dikonfrontasikan dengan jenderal polisi bintang tiga itu karena masih menunggu perkembangan hasil pemeriksaan. Sebelumnya, Komjen Pol. Susno Duadji menyampaikan Sjahril Djohan terlibat praktik mafia hukum di kepolisian Susno mengatakan hal itu saat bertemu dengan Komisi III DPR dan telah menjelaskan hal itu kepada Satgas Pemberantasan Mafia Hukum. Pada Selasa siang (13/4) Sjahril pulang ke Indonesia dari Australia setelah sebelumnya mampir ke Singapura untuk melakukan cek kesehatan. Ungkap Keterlibatan Susno Sementara saat pemeriksaan Sjahril Djohan di lantai dua Gedung Utama Mabes Polri terungkap Sjahril mengatakan Komisaris Jenderal Polisi Susno Duadji ikut terlibat dalam kasus mafia pajak. Mantan Kabareskrim itu konon juga mencicipi dana haram yang dimiliki Gayus Tambunan. Sementara kuasa hukum Sjahril, Hotma Sitompul, mengatakan kliennya diperlakukan dengan baik selama pemeriksaan. Termasuk masalah kesehatan yang selalu dijaga mengingat usia Sjahril yang sudah lanjut. Hotma juga menegaskan bahwa Susno ikut terlibat dalam kasus mafia pajak ini. “Saya pastikan ada keterlibatan dia (Susno),” tegasnya [baca: Sjahril Djohan Bantah Dirinya Makelar Kasus]. Sedangkan pertemuan antara Satuan Tugas Pemberantasan Mafia Hukum dengan Kapolri yang direncanakan hari ini, ternyata kembali batal. Belum ada penjelasan resmi tentang penjadwalan ulang pertemuan ini.(ant/inc/m27)

Kesempatan Menjadi Wartawan Waspada Waspada membuka kesempatan bagi yang memiliki kemampuan jurnalistik untuk bergabung menjadi wartawan di:

Kota Jantho, Beureuneun, Meureudu, Lhoksukon, Kualasimpang, Calang, Meulaboh, Jeuram, dan Blangpidie. Pelamar harus berdomisili di kota tersebut di atas. Kirim melalui e-mail lamaran, pasfoto, fotokopi tanda pengenal dan CV ke sebelum 30 April 2010.

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

z Edisi Tapanuli KAMIS, Pon, 15 April 2010/30 Rabiul Akhir 1431 H z No: 23119 Tahun Ke-64z

Terbit 24 Halaman (A1-8, B1-8, C1-8) z zHarga Eceran: Rp 2.500,-



Dalam foto yang disiarkan oleh Kantor Berita Xinhua, beberapa bangunan hancur setelah gempa bumi di Jiegu Town, dari Yushu, satu prefektur otonomi Tibet di barat provinsi Qinghai di baratlaut China, Rabu (14/4).

Lima mobil aparat kepolisian dan Satpol PP dibakar massa dalam bentrokan di depan kompleks makam Mbah Priok, Jakarta, Rabu (14/4) sore. Foto dan berita lainnya di halaman A3



JAKARTA (Waspada): Bentrokan massa dengan Satuan Polisi Pamong Praja (Satpol PP) di makam Mbah Priok atau Al Imam Al Arif Billah Al Habib Hasan bin Muhammad Al Haddad, Tanjung Priok, Jakarta Utara, Rabu (14/4). Massa melanjutkan dengan melakukan sweeping di Terminal Peti Kemas Pelindo. Jaraknya sekitar 1 kilometer. Hingga malam tadi, jumlah korban yang mengalami lukaluka mencapai 144 orang. Data yang dikeluarkan RSUD Koja itu membeberkan, jumlah korban luka kebanyakan diderita aparat Satpol PP dan polisi. Sementara Pemerintah Provinsi DKI Jakarta melansir data korban berdarah di penggusuran makam Mbah Priok di Koja, Jakarta Utara. Tercatat ada 90 orang mengalami luka. Lanjut ke hal A2 kol 1


Dalam gambar yang diambil dari rekaman video CCTV yang disiarkan via APTN, regu pertolongan mengeluarkan seorang korban dari satu gedung yang ambruk menyusul gempa bumi keras yang terjadi di provinsi Qinghai, barat China, Rabu (14/4).


Salah satu anggota Satpol PP dilarika ke RSUD Koja. Sementara puluhan orang terluka dalam bentrokan di depan makam Mbah Priok, Jakarta, Rabu (14/4).

Bupati Tapsel Resmikan SMKN 1 Arse

Terdakwa Penyerobotan Lahan Mohon Keadilan Hukum P.SIDIMPUAN (Waspada): Dua terdakwa perkara penyerobotan lahan yang disidangkan di Pengadilan Negeri Padangsidimpuan berdasarkan register perkara No: 230/Pid.B/ 2010/PN.Psp, Bahari Efendi Pasaribu dan Adzan Mulia Pasaribu, Rabu (14/4) memohon keadilan hukum. Keduanya mengaku hanya orang suruhan seseorang sebagai pemilik lahan di Desa

Muara Opu, Kec. Muara Batangtoru, Kab.Tapanuli Selatan, VS (berkas terpisah dan disebut-sebut telah melarikan diri). Majelis hakim diketuai Erwin Eka Saputra SH, bersama hakim anggota Abdul Affandi SH, dan Lodewyk I Simanjuntak, SH, MH, yang menyidangkan perkara ini.

P.SIDIMPUAN (Waspada): Bupati Kabupaten Tapanuli Selatan (Tapsel) H Ir Ongku Parmonangan Hasibuan, MM didampingi Kadis Pendidikan Drs Marasaud Harahap meresmikan SMKN 1 Arse di Jalan Simangambat, Desa Jonggol Jae, Kecamatan Arse, Kabupaten Tapanuli Selatan, Rabu (14/4). Pada kesempatan sama, Ongku Hasibuan juga meresmikan SMKN I Angkola Timur dan SMKN I Sayurmatinggi.

Hadir dalam acara itu mewakili DPRD Husni Sogot, SMTP, Mujur Pangidoan Harahap, Muhammad Yakuf Harahap, para camat, Kadis dan Kabag, guru kepala SMK se- Tapsel, tokoh adat dan masyarakat, serta ratusan warga yang antusias mengikuti peresmian sekolah. Sekolah itu dibangun di atas tanah yang dihibahkan keluarga Marasaud Siregar dan Muhammad Nur Pane kepada

Pemkab Tapsel seluas 3 hektare. Sekolah itu merupakan sekolah SMK pertama yang ada setelah SMUN I Hutapadang dibangun 25 tahun lalu. Selama ini, masyarakat Arse sekitarnya hanya mengandalkan SMUN Hutapadang, makanya masyarakat sangat bersyukur atas dibangunnya SMK dengan jurusan pertanian, peternakan dan perkebunan. Lanjut ke hal A2 kol 2

Lanjut ke hal A2 kol 6

Polres Tapsel Diminta Konsisten Dalam Penanggulangan Illegal Logging Di Palas SIBUHUAN (Waspada): Polres Tapanuli Selatan di-minta konsisten dalam pe-nanganan kasus penebangan liar (illegal logging) di Desa Uluaer, Kecamatan Sosopan, Kabupaten Padanglawas berdasarkan hasil temuan tim DPRD Palas beberapa waktu lalu. Demikian Ketua Gerakan Mahasiswa Padanglawas (Gema Padanglawas) Ansor Harahap didampingi Ahmad Habi-

bi Dalimunthe, Jabaluddin Siregar, Jumiani Rambe, Hafsah Pohan dan Afandi Harahap bersama Sekjend Gema Paluta Julpikar Harahap kepada Waspada, Selasa (13/4). “Kita meminta Polres Tapsel tidak sekadar menjalankan ‘kewajiban’ prosedural, tapi harus dapat menjawab tuntutan hukum masyarakat Lanjut ke hal A2 kol 4

BACA DI HALAMAN DALAM 3.167 KK Di Madina Belum Nikmati Aliran Listrik

B7 Mahasiswa Dukung Kejatisu Usut Tuntas Dugaan Korupsi Di Tabagsel B7 Warga Desa Janji Raja Tuntut Kembali Lahan B7

Waspada/Sarmin Harahap

RESMIKAN: Bupati Tapsel Ongku P Hasibuan didampingi Kadis Pendidikan Marasaud Harahap menandatangani peresmian SMKN 1Arse, SMKN I Angkola Timur, dan SMKN I Sayurmatinggi, Rabu (14/4) di J Desa Jonggol Jae, Kec. Arse.

Lanjut ke hal A2 kol

Lanjut ke hal A2 kol 3

KPK Jadwalkan Periksa DL Sitorus JAKARTA (Antara): Tim penyidik Komisi Pemberantasan Korupsi (KPK) menjadwalkan pemeriksaan terhadap Darianus Lungguk (DL) Sitorus dalam kasus dugaan suap Rp300 juta terhadap hakim Pengadilan Tinggi Tata Usaha Negara (TUN) Jakarta, Ibrahim. “Darianus Lungguk Sitorus dijadwalkan diperiksa sebagai saksi,” kata Juru Bicara KPK Johan Budi ketika ditanya wartawan di Jakarta, Rabu (14/4). Johan menjelaskan bahwa hasil pemeriksaan DL Sitorus akan digunakan untuk melengkapi berkas perkara Adner Sirait, seorang pengacara yang sudah ditetapkan sebagai tersangka dalam kasus suap tersebut. Hingga berita ini diturunkan, belum ada keterangan resmi apakah pengusaha asal Sumatera Utara itu sudah memenuhi panggilan KPK atau belum. Komisi Pemberantasan Korupsi telah menetapkan Ibrahim dan Adner Sirait sebagai tersangka kasus dugaan Lanjut ke hal A2 kol 4

Lokasi Pembangunan Bandara Silangit-Taput Jadi Lahan Garapan TARUTUNG (Waspada): Sebanyak 50 persil inventaris tanah yang telah dibebaskan dan diganti pemerintah, untuk tindaklanjut pembangunan Bandar Udara Silangit di Desa Pariksabungan, Kecamatan Siborongborong, Kabupaten Tapanuli Utara digarap warga dengan mengklaim tanah itu miliknya. Kini sebagian tanah di area pembangunan Bandara itu digarap warga tanpa ada larangan dari instansi terkait Pemkab Taput yang memberikan ganti rugi kepada masyarakat. Berbagai kalangan mengaku heran, kenapa lahan yang sudah diganti rugi secara bertahap sejak tahun 1995 s/d 2009 itu digarap warga yang mengaku pemilik tanah. Harusnya oknum itu harus dihentikan, sebab Pemkab Taput sudah memberikan ganti rugi pelepasan lahan untuk pembangunan Bandara Silangit. Lahan yang digarap itu di Apron I pintu pertama Bandara, persis di

BEIJING, China (AP/Reuters): Serangkaian gempa kuat menggun-cang provinsi Qinghai di bagian barat China Rabu (14/4). Jumlah korban jiwa hingga kini sekitar 400 tewas dan lebih dari 10.000 orang lainnya mengalami luka-luka. Demikian diberitakan kantor berita resmi China, Xinhua dan dilansir Reuters, Rabu (14/4). Gempa juga menyebabkan banyak korban lainnya terkubur di dalam rumah-rumah yang rubuh di kawasan pegunungan itu, lapor para pejabat dan media negara. Survei Geologi AS (USGS) kan gempa dengan kekuatan 6,9 skala richter itu mengantam bagian selatan Qinghai, dekat Tibet, Rabu pagi dan diikuti 18 gempa susulan. Pusat gempa terjadi di Golmud, kota terbesar di Qinghai, dengan kedalaman 10 km, kata USGS. Gempa terkuat menyebabkan para penduduk berlarian keluar rumah dan seiring dengan itu gempa merubuhkan

Waspada/Parlindungan Hutasoit

LAHAN BANDARA: Lahan di lokasi Bandara Silangit - Taput di Apron I pintu pertama persis di belakang perumahan pegawai, yang telah diganti rugi oleh Pemkab Taput, kini justru digarap warga setempat.

Sjahril Djohan Jadi Tersangka Dan Ditahan J A K A RTA ( Wa s p a d a ) : Mantan diplomat Sjahril Djohan alias SJ akhirnya ditetapkan sebagai tersangka dalam kasus penyuapan dan korupsi yang melibatkan Gayus Tambunan. Penetapan tersangka ini setelah SJ menjalani pemeriksaan sejak kemarin sore. “Kami sudah mempunyai alat bukti yang cukup,” kata Kepala Divisi Humas Mabes Polri Irjen Pol Edward Aritonang

dalam keterangannya di Mabes Polri, Jakarta, Rabu (14/4). Selanjutnya Sjahril ditahan di Bareskrim Mabes Polri. Dalam pemeriksaan itu, SJ telah melanggar Undang-undang Tindak Pidana Korupsi pasal penyuapan, dan Undangundang Pencucian Uang. Sebut Nama Perwira Tinggi Sjahril Djohan telah Lanjut ke hal A2 kol 6

164 KiosTerbakar MEDAN (Waspada): Sebanyak 164 dari 185 kios di Pasar Inpres Kwala Bekala Jl. Tali Air P. Bulan, Kec. Medan Johor, musnah terbakar, Rabu (14/ 4) pukul 01:15 dinihari. Penyebab kebakaran belum diketahui, namun api diduga berasal dari toko tukang mesin jahit atau warung kopi yang letaknya berdempetan. P. Siburian, salah seorang warga, mengatakan, dinihari itu dia mendengar teriakan kebakaran dari warga di sekitar

pasar. Mendengar teriakan tersebut, dia bersama sejumlah warga lainnya mendatangi lokasi kebakaran. “Kami tidak tahu pasti penyebabnya, api begitu cepat menyambar karena kebanyakan kios ini dindingnya dari papan,” kata Siburian. Hal senada juga diungkapkan Lurah Kwala Bekala, Enoh PT. Tarigan. Dikatakannya, penyebab kebakaran masih Lanjut ke hal A2 kol 3

Dinkes Madina Siapkan Tim Dokter Selama MTQN SU PANYABUNGAN (Waspada): Selama MTQ Nasional ke-32 tingkat Sumut berlangsung di Panyabungan, Pemkab Madina melalui Dinas Kesehatan bersama RSUD Panyabungan menyiapkan sejumlah tim dokter yang siap melayani para peserta selama 24 jam. “Para dokter itu akan berjaga di rumah sakit dan poskoposko kesehatan di beberapa titik lokasi kegiatan MTQ, berlangsung mulai 19 April hingga 29 April 2010,” ujar Kabag Humas Pemkab Madina M.Taufik Lubis kepada Waspada di Panyabungan, Rabu ( 14/4). Menurutnya, tenaga dok-

ter ini untuk mengantisipasi kemungkinan adanya gangguan kesehatan para peserta MTQ Sumut. “Untuk membantu para kafilah, Pemkab Madina juga meminta para

Lanjut ke hal A2 kol 1

Serampang - Memalukan dan memprihatinkan .... - He.... he....he....

Berita Utama

A2 Lokasi ....

belakang perumahaan pegawai. Oknum itu terus ngotot bahwa tanah yang telah diganti rugi masih hak miliknya. Bahkan mereka membuat batas tanah dengan tali plastik. Anehnya, di saat lahan tersebut dikerjakan sebagai tindaklanjut pembangunan bandara, mereka melakukan pengancaman. Pengancaman dan permasalahan ini telah dilaporkan kepada pihak kepolisian,”ujar Martinus Hutasoit, Kepala Bandara Silangit. Dia juga meminta pemerintah atau instansi terkait segera mengatasinya dengan menghentikan oknum tersebut. “Jangan karena ulah oknum ini, tindaklanjut pembangunan Bandara Silangit jadi terhambat.Yang rugi, masyarakat Tapanuli,” ujar Hutasoit. Untuk itu, dia berharap agar Pemkab Taput dapat menyelesaikan permasalahan menyangkut tanah yang telah diganti rugi, sehingga jelas lahan milik Bandara Silangit dan dimana lahan milik masyarakat.

Dinkes Madina .... dokter di Puskesmas terdekat untuk membuka layanan darurat dan tetap berada di tempat,” katanya. Untuk keperluan tersebut, tambahnya, RSUD Panyabungan sebagai rumah sakit rujukan dari berbagai tempat pelayanan di Madina telah menyiapkan segala sesuatunya untuk penanganan kalau ada peserta MTQ yang memerlukan rujukan. “RSUD Panyabungan siap menampung dan menerima rujukan peserta yang terganggu kesehatannya, utamanya keperluan obat-obatan,” ujarnya. Taufik menjelaskan juga, selain menyiapkan sejumlah posko kesehatan di titik-titik yang akan dijadikan sebagai arena perlombaan, maka Bupati Madina H.Amru Daulay, SH juga telah berkoordinasi dengan Kadis Kesehatan Dr. Sakdiah Lubis,MM dan Direktur RSUD Panyabungan drg.

Priok Rusuh ....

“Tujuh orang luka kritis dan 83 luka berat dan ringan,” kata Kepala Bidang Informasi dan Komunikasi Pemrov DKI Cucu Ahmad Kurnia saat dihubungi Rabu (14/4). 5 Mobil Aparat Dibakar, Puluhan Dirusak Aksi brutal Satpol PP dalam menangani pengusuran makam Mbah Priok, Jakarta Utara berujung rusuh. Lima mobil aparat Kepolisian dan Satpol PP dibakar masa. Sementara, puluhan mobil aparat dari kepolisian dan Satpol PP juga dihancurkan. Pantauan pukul 16:30, pembakaran ini dilakukan setelah massa tidak bisa menahan emosi saat melihat cara Satpol PP menangani penggusuran makam Mbah Priok. Pembakaran itu dilakukan sesaat setelah warga yang berkerumun di belakang Habib Rizieq tak bisa menahan emosinya seusai Rizieq memasuki makam Mbah Priok untuk berziarah. 5 Mobil yang dirusak itu

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. ........., Bxg3+. 2. GxB, MxM (Jika 2. Rh2, Bg2+. 3. Rh1, Bxf2+mat). Putih menyerah.

Jawaban TTS: TTS Topik








Jawaban Sudoku:

1 9 2 5 7 8 3 4 6

7 6 8 3 2 4 1 5 9

5 3 4 9 1 6 8 7 2

2 1 7 6 4 9 5 8 3

9 5 3 7 8 1 6 2 4

4 8 6 2 3 5 7 9 1

3 2 9 1 5 7 4 6 8

8 7 1 4 6 2 9 3 5

6 4 5 8 9 3 2 1 7

Marthinus Hutasoit mengatakan, hingga saat ini tidak mengetahui dimana alasan hak kepemilikan lokasi Bandara Silangit, sehingga menjadi kendala untuk melakukan pengukuran agar disertifikatkan Departemen Perhubungan. Selain itu, Pemkab Taput atau instansi terkait belum ada memberikan jumlah luas dan lokasi lahan milik bandara Silangit yang telah diganti rugi. Sementara Kabag Tata Pemerintahan Taput, Ober Tambunan, S.Sos yang dikonfirmasi wartawan, menyebut, dalam waktu dekat pihaknya turun ke lokasi Bandara Silangit untuk melihat lokasi tanah yang digarap warga tersebut. “Kita akan mempersiapkan dokumen tanah milik bandara yang telah diganti rugi. Itu jelas ada dokumennya,” ujarnya. Dia menegaskan, tidak bisa masyarakat hanya mengaku- ngaku bahwa tanah itu miliknya tanpa didukung dokumen atau surat alas hak. “Segala tanah yang telah kita ganti rugi lengkap surat jual beli, luas dan lebar lahan tersebut dari warga,” katanya. (a13) Bidasari Siregar agar bekerja lebih ekstra. “Selain berada di poskoposko perlombaan, para petugas kesehatan maupun dokter dianjurkan untuk terus melakukan kunjungan ke setiap pemondokan kafilah, tujuannya untuk melihat secara dekat kondisi kesehatan para peserta maupun official,” tambahnya. Sementara, Wakil Sekretaris Panitia Penyelenggara H.Sahrul Matondang yang dihubungi melalui selularnya, mengatakan, para peserta yang berasal dari kabupaten/kota sudah mulai mendaftarkan keikutsertaannya dalam penyelenggaraan MTQN ke-32 Sumut. “Para peserta sudah mulai mendaftarkan kafilahnya baik secara tertulis mapun telepon, namun kami belum bisa memastikan berapa jumlah peserta yang akan dikirimkan dari setiap kabupaten/kota, karena masih dalam perekapan,” jelasnya. (a24)

Kamis 15 April 2010

Wakil Walikota Dan Ketua DPRD Sibolga Sidak Ke Pasar Swadaya Perjuangkan Bantuan Modal Bagi Pedagang

Waspada/Zulfan Nasution

SIDAK PASAR: Wakil Walikota Sibolga H Afifi Lubis, SH terlihat serius berdialog dengan para pedagang di Pasar Swadaya Sibolga saat melakukan sidak bersama Ketua DPRD Sibolga Syahlul U Situmeang, anggota DPRD Sibolga Jamil Zeb Tumory dan Kamil Gulo SpdI, Rabu (14/4).

Gempa Guncang ....

rumah-rumah yang terbuat dari lumpur dan kayu, kata Karsum Nyima, wakil kepala berita stasiun televisi kawasan Yushu, yang berbicara lewat telepon dengan penyiar CCTV. Gempa itu melanda kawasan Yushu, daerah Tibet di bagian selatan Qinghai, kata Pusat Jaringan Gempa China, yang mencatat kekuatan gempa 7,1 skala richter. Badan Gempa China mengatakan jaringan telepon putus, sehingga menghalangi usaha penyelamatan, sementara para pekerja bekerja keras untuk mengeluarkan air dari satu bendungan. (m07)

164 Kios ....

belum diketahui, apakah dari arus pendek atau lainnya. ”Mengenai penyebabnya masih simpang siur. Namun, sebelum terjadi kebakaran itu tidak ada pemadaman listrik,” ujarnya. Tarigan menjelaskan, kebakaran yang terjadi sekitar pukul 01.15 berhasil dipadamkan oleh petugas pemadaman Pemko Medan dan Deliserdang sekitar pukul 04.00 pagi.

antara lain, Pick Up Satpol PP dan mobil angkutan polisi. Dua mobil itu dibakar setelah sebelumnya digulingkan. Sementara mobil lainnya dirusak dan digulingkan juga. Mobil-mobil yang dirusak antara lain, mobil tahanan Satpol PP, Bus Polisi, truk polisi hingga barakuda atau water cannon. Usai dibakar, warga membiarkan mobil itu di tengah jalan. Sementara, aparat kepolisian hanya melihat dari jauh aksi tersebut karena kalah jumlah. Dievakuasi Lewat Laut Sejumlah Satpol PP dan anggota kepolisian yang terjepit di lokasi kejadian bentrok makam Mbah Priok sudah dievakuasi. Evakuasi dilakukan lewat laut untuk mengamankan aparat dari massa. “Satpol PP dan polisi yang

terjepit sudah dievakuasi dari Koja sejak sebelum pukul 18.00 WIB,” ujar Kepala Puskom Publik Bambang S Ervan Rabu Bambang mengatakan, evakuasi tersebut dilakukan dengan menggunakan kapal. Namun Bambang enggan menjelaskan kemana polisi dan Satpol PP tersebut dievakuasi. Tindakan Satpol PP Brutal Tindakan Satpol PP pada warga sekitar areal pemakaman Mbah Priok sungguh brutal. Satpol PP bertindak layaknya segerombolan preman, bukan aparat penegak hukum. “Jelas ini suatu tindakan yang sangat brutal dan melanggar HAM. Satpol PP kan aparat hukum yang menegakkan Perda. Kita melihat tindakan Satpol PP bukan seperti aparat hukum yang sedang

Bupati Tapsel ....

Karena itu, Pemkab Tapsel telah membuka program bea siswa bagi siswa SMK berprestasi untuk sekolah di dalam negeri maupun luar negeri. Sementara untuk tingkat siswa SMA yang mencapai prestasi 10 besar, akan dibayar biaya kuliahnya di universitas terkemuka didalam negeri. Dikatakannya, tanggal 2 Mei 2010 mendatang bertepatan dengan Hari Pendidikan Nasional (Hardiknas) akan diadakan program pemberian penghargaan khusus dari Pemkab Tapsel kepada masyarakat yang telah menghibahkan hartanya untuk mendukung kemajuan pendidikan. Bupati Tapanuli Selatan Ir.H Ongku Parmonangan Hasibuan mengatakan, hibah warga untuk pendidikan merupakan amal bhakti dan ibadah yang tidak akan pupus dan hilang selama dipergunakan untuk kebenaran. Katanya, ke depan SMK di Tapsel harus lebih banyak daripada SMU, pengembangan SMK berbasis kompetensi merupakan prioritas pemerintah untuk mengurangi banyaknya penganguran berpendidikan di Tapanuli Selatan khususnya, Indonesia umumnya. Karena itu setiap kecamatan di Kabupaten Tapanuli Selatan harus ada sekolah SMK. Tahun 2010 ini diupayakan pembangunan 3 unit SMK di kawasan Sangkunur, Angkola Selatan dan Muara Batangtoru, kemudian 3 unit lagi tahun 2011 untuk wilayah Sipirok Dolok Hole, Angkola Barat, dan Sayurmatinggi. (csh)

Bugis Siregar, ketua pelaksana acara merangkap ketua komite dan juga keluarga ahli waris dalam kata sambutannya mengatakan syukur yang tiada terhingga atas kebijakan Pemda Tapsel mendirikan sekolah di kampungnya. “Ini suatu mukjizat bagi masyarakat, anugrah bagi keluarga kami serta menambah amal ibadah terhadap almarhum orangtua kami,” katanya. Ia berharap, pemerintah tidak hanya membangun gedung sekolahnya saja, tapi juga membantu kelengkapan fasilitas yang dibutuhkan siswa dalam menimba ilmu, sehingga sekolah itu dapat melahirkan anak didik yang cerdas dan berperestasi. Bugis juga meminta supaya jalan tanah menuju sekolah sepanjang lebih kurang 500 meter dapat ditingkatkan. “Kasihan pak, murid dan guru buka sepatu kalau musim hujan,” ucapnya. Kadis Pendidikan Kabupaten Tapanuli Selatan Drs H Marasaud Harahap mengatakan, tanah yang dihibahkan warga untuk pengembangan sekolah SMK, merupakan salah satu simbol dorongan moral masyarakat kepada pemerintah, dalam pengembangan pendidikan di Tapanuli Selatan. Katanya, sesuai arahan bupati, pengembangan sekolah kejuruan di Tapselsudah mencapai 9 unit, merupakan prioritas utama pembangunan di bidang pendidikan, tujuannya untuk menghasilkan lapangan kerja, baik individu maupun orang lain.


Biaya Dipotong Sekwan, Anggota DPRD Dapem II Palas Kecewa Tak Bisa Ikut Reses SIBUHUAN (Waspada): Anggota DPRD Padanglawas (Palas) Daerah Pemilihan (Dapem) II mengkau kecewa karena gagal melaksanakan reses untuk periode pertama tahun 2010. Pasalnya Sekretaris Dewan (Sekwan) Aritonga Siregar melakukan pemotongan biaya reses yang telah dianggarkan melalui APBD 2010. Anggota DPRD Dapem II, Kec. Sosopan, Ulu Barumun dan Lubuk Barumun yakni Amirhud Nasution, Sukri Anda Hasibuan, Guntur Hasibuan, M Soleh Daulay dan H. Hotman Parhimpunan Nasution mengungkapkan hal itu di Sibuhuan, Rabu (14/4). Dikatakannya, biaya reses yang terakumulasi Rp 50 juta lebih diperuntukkan meninjau konsituen ke daerah untuk menjaring aspirasi masyarakat yang telah memilih mereka tersebut diterima secara utuh yakni Rp 10 juta lebih tiap dewan asal Dapem II. Namun sekretaris dewan melakukan pemotongan sebesar Rp 15 juta atau Rp 3 juta tiap anggota dewan dengan alasan pengembalian dana kelebihan biaya reses tahun lalu. Hal yang sama diungkankan anggota DPRD asal Dapem III, Baharuddin Daulay. Sekwan memotong biaya reses untuk Kec. Huristak dan Barumun Tengah sebesar Rp 10,5 Juta atau Rp 1,5 Juta per anggota dewan asal dapem tersebut. Sekretaris DPRD Padanglawas Aritonga Siregar yang kini berkantor di Kantor Bupati Padanglawas tidak bisa ditemui karena pintu ruang kerjanya di gedung dewan dipalang dengan kayu balok 5 x 7 cm. (crif/a32) bertindak tetapi seperti segerombolan preman,” ujar Ketua Komnas HAM Ifdhal Kasim. Ifdhal menyaksikan insiden Priok berdarah itu lewat siaran televisi. Dia juga menyatakan, pihaknya sudah mengirimkan tim ke lokasi kericuhan. Tim dipimpin Wakil Ketua Komnas HAM Ridha Saleh. “Kita akan melihat berapa korbannya, bagaimana proses penggusuran apakah mematuhi hukum, bagaimana dalam menangani anak-anak dan orangtua. Satpol PP juga tidak bisa serta merta menggunakan cara di luar hukum misalnya pemukulan dan menyerang anak dan orangtua,” jelasnya. Tim Komnas HAM, lanjut Ifdhal, nantinya juga akan menyelidiki tindakan brutal Satpol PP itu. Akan Panggil Fauzi Bowo DPRD DKI langsung menggelar rapim untuk menindaklanjuti pecahnya ke-

rusuhan di Koja, Tanjung Priok, Jakarta Utara. Hasilnya, DPRD sepakat akan memanggil Gubernur DKI Jakarta Fauzi Bowo dalam waktu dekat. “Kami akan minta pertanggungjawaban Gubernur. Dalam waktu 2-3 hari ke depan kita akan bertemu dengan Gubernur,” ujar Ketua DPRD Ferrial Sofyan usai rapat di Gedung DPRD, Jakarta, Rabu (14/4). Rapat yang dihadiri pimpinan komisi dan para wakil ketua berlangsung tertutup. “Kita juga menyesalkan ketika konflik itu terjadi pasukan tidak segera ditarik mundur,” ujar Ferrial. Saat ditanya terkait ketua Komisi A Ida Mahmudah yang menginginkan kepala Satpol PP dicopot, politisi dari Partai Demokrat ini belum membahas sampai ke arah sana. Ferrial meminta keputusan yang diambil tidak berat sebelah. (ant/dtc/vivanews)

Polres Tapsel ....

di Uluaer hanyalah salah satu contoh yang menggambarkan tentang kondisi potensi illegal logging di Padanglawas. Karena, menurut informasi yang diperoleh hingga sekarang diduga masih terus terjadi aktivitas yang sama di beberapa titik di seluruh Padanglawas. Diduga masih banyak titiktitik yang belum diketahui atau disikapi Polres Tapsel, dugaan tersebut seperti di Desa Hulim, Huta Baru Siundol dan Pagaranbira, berdasarkan keterangan warga, kayu-kayu hasil tebangan yang telah diolah terus diangkut dari daerah itu. Pengangkutan kayu tersebut dilakukan pada malam hari dan terkesan disengaja agar terhindar dari pantauan publik. Untuk itu Gema Padalawas meminta DPRD Padanglawas serius dan komit mengawal proses hukum terhadap kasus illegal logging Uluaer, terlebihlebih anggota DPRD yang berasal dari Dapem Sosopan. (a32)

KPK Jadwalkan ....

diduga untuk memenangkan perusahaan tersebut. Perkara nomor 36/B/2010/ PTUN.JKT itu ditangani oleh majelis hakim yang terdiri atas Ibrahim (ketua), Arifin Marpaung dan Santer Sitorus. Setelah penangkapan, pengadilan mengganti susunan majelis hakim, sehingga perkara itu ditangani oleh H.R. Suhardoto (ketua), Bambang Edy Sutanto dan Sulistyo.

Padanglawas dalam setiap penanganan kasus, termasuk kasus illegal logging di Uluaer,” katanya. Proses hukum yang dilakukan Polres Tapsel sebagai tindaklanjut penemuan kasus penebangan kayu liar (illegal logging) di Uluaer Padanglawas diharapkan membuahkan hasil sesuai harapan masyarakat. Dimana proses hukum yang dilakukan sampai kepada putusan hukum yang dapat menjerat para cukong dan agen perambahan kayu yang bermoduskan pembukaan lahan perkebunan tersebut. “Untuk itu diminta konsistensi Polres Tapsel dan jangan terpengaruh dengan alibi atau tawaran-tawaran yang bertentangan dengan penegakan supremasi hukum,” ujar Ansor. Gema Padanglawas juga menyampaikan kepada Polres Tapsel bahwa illegal logging

Ibrahim terancam dikenai Pasal 6 Ayat (2) dan/atau Pasal 12 Undang-Undang Pemberantasan Tindak Pidana Korupsi, sedangkan Adner dijerat Pasal 6 Ayat (1) dan/atau Pasal 15. Adner Sirait adalah kuasa hukum PT Sabar Ganda milik DL Sitorus dalam sengketa tanah dengan Pemerintah Provinsi DKI Jakarta. Suap itu

SIBOLGA (Waspada): Wakil Walikota Sibolga H Afifi Lubis, SH dan Ketua DPRD Sibolga Syahlul U Situmeang melakukan inspeksi mendadak ke Pasar Swadaya Sibolga, Rabu (14/4). Terlihat turut dalam sidak tersebut Ketua Komisi II DPRD Sibolga Jamil Zeb Tumory (F-P.Golkar) dan Kamil Gulo, SPdi (PPP). Sebelum melakukan sidak ke Pasar Swadaya Sibolga, Wakil Walikota Sibolga menyempatkan diri mengunjungi Kantor Dinas Perhubungan dan Terminal Sibolga. Kedatangan Wakil Walikota Sibolga H.Afifi Lubis SH ke Pasar Swadaya Sibolga mendapat sambutan hangat dari para pedagang. Bahkan terjadi dialog yang cukup akrab antara Wakil Walikota Sibolga dengan para pedagang. Kepada Wakil Walikota Sibolga, para pedagang di antaranya Lince br Hutabarat, Elisabet Hutauruk serta B br Situmorang mengeluhkan penataan pedagang di Pasar Swadaya Sibolga. Mereka juga mengeluhkan minimnya per-

modalan guna mengembangkan usaha. “Kami para pedagang berharap kepada Pak Afifi yang memang turun ke pasar agar dapat memperjuangkan dana bantuan kepada para pedagang untuk penambahan modal usaha. Kami tahu Pak Afifi mampu menyahuti kami,” kata Elisabet Hutauruk. Me re k a m e n g a t a k a n , menjelang pelaksanaan Pilkada mereka sering mendapatkan kunjungan dari orangorang yang dianggap mendadak bermurah hati, padahal sebelumnya tidak pernah sama sekali menginjakkan kaki ke pasar ini. “Yakin Pak, kami masyarakat sudah tahu dan tidak lagi bodoh dan mau dibodoh-bodohi, dan kami selalu mengingat jauh sebelum pelaksanaan Pilkada di Kota Sibolga, Pak Afifi sering mengunjungi kami, jadi silahkan saja mereka janji-janji tapi hati kami sudah jelas,” tegas para pedagang. Menyahuti aspirasi para pedagang, Wakil Walikota Si-

bolga Afifi Lubis menyatakan, Pemerintah Kota Sibolga selalu memantau perkembangan Pasar Swadaya Sibolga termasuk penataan para pedagangnya. Mengenai bantuan modal usaha, kata Afifi Lubis, Pemerintah Kota Sibolga juga sudah menampung dana bergulir untuk para pedagang tidak saja di Pasar Swadaya Sibolga, namun pasar tradisional lainnya di Sibolga. “Ibu-ibu mohon bersabar tentu dengan keterbatasan dana pemerintah terpaksa harus melakukan bergulir dan bergantian. Namun demikian yakinlah para pedagang semua pasti bantuan itu akan didapatkan,” tegas Afifi Lubis. Mendapat jawaban dari Wakil Walikota Sibolga yang juga diaminkan Ketua DPRD Sibolga, para ibu pedagang terlihat puas, bahkan secara spontan tanpa komando mereka menyatakan akan memberikan suara mereka kepada Afifi Lubis pada Pilkada 12 Mei 2010 ini. (a18)

Terdakwa ....

tuk mengantar dan menjemput pekerja ke lahan tersebut. Saya tidak tahu apa-apa selain membawa mobil, tapi dijadikan tersangka penyerobotan lahan dan ditahan jaksa hingga sekarang,” kata Adzan. Perkara ini berlanjut ke pengadilan didasari pengaduan Ali Hasyim Lubis SH.Cn, mengaku Ketua Koperasi Makaty Karya ke Polres Tapsel. Dia melaporkan bahwa sekitar 2 hektare lahan milik koperasi di Desa Muara Opu telah diserobot Bahari Efendi Pasaribu dan kawan-kawan. Perkara inipun diproses pihak kepolisian, dan tidak dilakukan penahanan terhadap Adzan dan Bahari. Namun setelah dilimpahkan ke Kejaksaan, JPU Gabena Pohan SH, menahan keduanya. Hingga berkas dilimpahkan ke pengadilan dan menjalani sidang pertama, Rabu (14/4) keduanya masih ditahan. Dalam dakwaannya, JPU Gabena Pohan mengatakan, sejak awal Agustus 2009 Bahari Efendi Pasaribu dan Adzan Mulia Pasaribu telah menebangi pohon di sekitar perkebunan kelapa sawit Koperasi Makaty Karya di Desa Muara Opu. Lahan yang mereka tebangi sekira 6 hektare, dan diupahi VS (berkas terpisah dan tidak ditahan) sebesar Rp 1,5 juta per hektarenya. Menurut dakwaan JPU, dari 6 Ha lahan yang ditebangi itu, 2 Ha diantarnya telah masuk ke lahan Koperasi Makaty Karya. Dalam melakukan tindakan itu, Bahari mengajak Manra Siregar, Rahmat Napitupulu, dan Marga Sihombing. Sedangkan Adzan Mulia Pasaribu hanya bertugas mengantar dan menjemput Bahari dan kawan-kawan dengan menggunakan mobil Pick Up L300. Setiap mengantar dan menjemput, VS memberi Adzan upah sebesar Rp 250.000. Selain itu, VS pernah meminta Adzan untuk menyuruh As-

min Dahlan Siregar membuat gubuk kebun di lahan tersebut. “Akibat perbuatan para terdakwa, Koperasi Makaty Karya mengalami kerugian sekitar Rp 200 juta,” kata JPU yang mendakwa para terdakwa dengan Pasal 21 yuncto Pasal 47 ayat (1) UU No. 18 tahun 2004 tentang Perkebunan yuncto Pasal 55 ayat (1) ke 1e KUH Pidana. Usai pembacaan dakwaan di persidangan, majelis hakim menunda sidang dan melanj u t k a n n y a Se l a s a ( 2 0 / 4 ) dengan agenda pembelaan terdakwa atas dakwaan JPU (eksepsi). Selain kedua terdakwa, penasehat hukum mereka Marwan Rangkuty SH, kepada Waspada mengatakan bahwa perkara ini sebenarnya mengandung unsur perdata. VS dan Koperasi Makaty Karya sama-sama memiliki alas hak atas kepemilikan lahan tersebut. “Kita belum tahu siapa sebenarnya pemilik sah dari 2 hektare lahan yang menjadi objek perkara tersebut. Keduanya sama-sama punya alas hak, harusnya perkara ini diperiksa dulu secara perdata,” katanya. Karena menurut Marwan, sangat rancu sekali apabila Bahari dan Adzan diproses secara pidana dan didakwa menyerobot lahan. Padahal belum diketahui secara pasti siapa yang jadi pemilik sahnya, apakah VS sebagai orang yang menyuruh para terdakwa atau Koperasi Makaty Karya. Demikianpun, Marwan sangat berharap keadilan hukum diberikan kepada kliennya dan majelis hakim membebaskan kliennya dari tahanan dan segala tuntutan hukum. “Kita juga akan mengajukan perkara lahan ini secara perdata ke Pengadilan Negeri Padangsidimpuan,” jelas Marwan. (a20)

Sedangkan Jaksa Penuntut Umum (JPU) nya Gabena Pohan, SH. Bahari Efendi Pasaribu, 39, warga Kelurahan Kayu Ombun, Kota Padangsidimpuan, dan Adzan Mulia Pasaribu, 25, warga Kelurahan Sitinjak, Kec. Angkola Barat, Kab.Tapsel, didampingi penasehat hukum Marwan Rangkuty, SH. Kepada Waspada usai persidangan, Adzan dan Bahari mengungkapkan perasaan mereka yang seolah-olah ditumbalkan pada perkara ini. Keadilan hukum, menurut keduanya, tidak diberikan kepada mereka. Mereka hanya cari makan dan tidak tahu menahu mengenai permasalahan lahan yang tumpang tindih kepemilikan antara VS dengan Koperasi Makaty Karya. “Kami hanya pekerja upahan,” katanya. Karenanya mereka menuntut keadilan hukum. Kemudian memohon majelis hakim segera membebaskan mereka dari tahanan dan segala tuntutan hukum. “Saya hanya diupah VS un-

Sjahril ....

membeberkan aliran dana ke sejumlah polisi, termasuk seorang perwira tinggi. “Ya, nyebut. Satu (perwira tinggi) ya menurut pemeriksa,” kata Kabid Penum Mabes Polri Kombes Pol Zulkarnain di Mabes Polri, Jl Trunojoyo, Jakarta, Rabu (14/4). Apakah perwira tinggi itu Susno Duadji, Polri masih melakukan pengembangan. “Masih dalam perkembangan. Ya dia menyebutkan. Tapi ya itu, polisi senantiasa menganut praduga tidak bersalah,” tambahnya. Sjahril Djohan mengaku ikut ‘bermain’ dalam kasus Gayus Tambunan. Tapi bagaimana perannya, kata pengacaranya Hotma Sitompul. (vivanews/dtc)

Berita Utama

A2 PRIOK BERDARAH ... Dua anggota Satpol PP yang tertangkap pun jadi bulan-bulanan massa. “Tadi ada dua (anggota Satpo) yang ketangkap, ngumpet di Pelindo. Sempat digebuki. Parah deh, pokoknya mandi darah,” ujar salah seorang warga di Pelindo, Tanjung Priok. Pelindo yang berada di kompleks Terminal Peti Kemas Koja terletak di seberang areal makam Mbah Priok. Massa tidak menghabisi anggota polisi pamong praja itu karena dilarang ustad. “Nggak boleh dimatiin sama ustadnya. Yang satu dibawa ke kompleks makam, yang satu lagi diamanin di Pelindo,” kata warga itu. Massa hanya menyasar Satpol PP saja, tidak polisi. “Polisi nggak boleh. Kita cuma ngejar Satpol PP saja,” ujarnya. Aksi brutal massa terus berlanjut. Seusai memukul mundur dan mengepung ratusan Satpol PP dan kepolisian, massa mulai menyisir setiap sudut lokasi bentrok untuk mencari aparat yang bersembunyi. Sekitar sejam melakukan penyisiran di Jalan Digul, area Petikemas Koja, massa menemukan dua petugas Satpol PP dan seorang anggota Brimob bersembunyi. Salah satu anggota Satpol PP Widodo, bernasib naas, karena ia diketahui massa saat bersembunyi di salah satu peti kemas. Massa yang tak terkendali langsung menghajar petugas Satpol PP tersebut. Bahkan, massa dengan beringas menghantam kepala Widodo dengan sebuah batu besar. Widodo pun langsung tumbang seketika. “Tadi, dia lagi ngumpet di dalam kontainer. Dia mungkin enggak bisa bernafas di dalam, dia buka sedikit pintunya, eh ketahuan sama massa,” ujar operator crane kontainer, Wawaet. Melihat Widodo tumbang dan berlumuran darah, ada sebagian massa yang mengevakuasi ke areal Petikemas Koja. Di tempat itu, sudah stand by lima petugas medis dari bulan sabit merah (Mer-C). Dalam keadaan tidak sadar, Widodo diberi pertolongan pertama. Terlihat dada Widodo masih bernafas. Petugas medis langsung membawaWidodo ke tepi laut dan evakuasi dilanjutkan menggunakan speedboat. Menurut petugas medis, Widodo akan dilarikan ke rumahsakit milik pelabuhan Tj Priok, Port Medical Center (PMC). Aparat dievakuasi lewat laut Sejumlah Satpol PP dan anggota kepolisian yang terjepit di lokasi kejadian bentrok makam Mbah Priok dievakuasi lewat laut. “Satpol PP dan polisi yang terjepit sudah dievakuasi dari Koja sejak sebelum pukul 18:00,” ujar Kepala Puskom Publik Bambang S Ervan, Rabu (14/4). Bambang mengatakan, evakuasi tersebut dilakukan dengan menggunakan kapal. Namun Bambang enggan menjelaskan kemana polisi dan Satpol PP tersebut dievakuasi. “Kalau masalah itu kita tidak bisa memberikan penjelasan,” ungkapnya. Tidak ada korban jiwa Kepala Kepolisian Daerah Metro Jaya Inspektur Jenderal Wahyono memastikan tidak ada korban jiwa dalam kerusuhan tersebut. “Perlu diklarifikasi agar tidak simpang siur, hingga saat ini tidak ada korban jiwa,” ujar kapolda dalam perbincangan di TVone. Sementara itu dari catatan polisi ada sekitar 144 orang

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. ........., Bxg3+. 2. GxB, MxM (Jika 2. Rh2, Bg2+. 3. Rh1, Bxf2+mat). Putih menyerah.

Jawaban TTS: TTS Topik








Jawaban Sudoku:

1 9 2 5 7 8 3 4 6

7 6 8 3 2 4 1 5 9

5 3 4 9 1 6 8 7 2

2 1 7 6 4 9 5 8 3

9 5 3 7 8 1 6 2 4

4 8 6 2 3 5 7 9 1

3 2 9 1 5 7 4 6 8

8 7 1 4 6 2 9 3 5

6 4 5 8 9 3 2 1 7

yang terluka, jumlah tersebut terdiri dari 10 anggota polisi, 69 anggota Satpol PP dan 53 orang dari warga. “Saat ini masih menjalani perawatan di RSUD Koja. Semua biaya perawatan ditanggung pemerintah,” ujarnya lagi. Kapolda kembali menegaskan bahwa tidak ada penindakan dalam eksekusi tersebut. Polisi menurut kapolda tetap melakukan upaya untuk menciptakan suasana yang aman. “Semuanya akan diselesaikan di meja perundingan,” ujar kapolda lagi. Polda Metro Jaya mengerahkan 15 kapal untuk mengevakuasi ratusan aparat Satpol PP dan polisi yang terjebak di dalam terminal peti kemas Pelindo II. Sebagian besar terpaksa dievakuasi dari jalur laut karena kondisi yang tidak memungkinkan. Hingga saat ini ratusan warga masih berjaga-jaga di sekitar kompleks makam Mbah Priok yang jadi sengketa. “Kami evakuasi melalui jalur laut, dan sebagian lagi jalur darat,” kata Kabid Humas Polda Metro Jaya Kombes Pol Boy Raffi Amar. Sementara Direktur Kepolisian Air Polda Metro Jaya AKBP Edion, mengatakan ada sekitar 15 kapal yang melakukan evakuasi Satpol PP dan polisi. Kapal yang digunakan antara lain kapal patroli, kapal LCT 3102, 3103, dan 3202, dan kapal milik bea cukai. “Kita juga minta bantuan dari keamanan pelabuhan laut lepas pantai sebanyak dua kapal,” kata Edion. Menurut, hingga pukul 19.00 WIB, sedikitnya ada 525 aparat Satpol PP dan polisi yang telah dievakusi. Mereka ditempatkan di kantor Direktorat Polisi Air. 20 Kendaraan rusak Hampir 20 kendaraan dibakar dan dirusak massa. Massa melanjutkan dengan melakukan sweeping di Terminal Peti Kemas Pelindo. Jaraknya sekitar 1 kilometer. Sisa-sisa bentrokan terlihat di depan gerbang utama makam dan Terminal Peti Kemas. Pantauan VIVAnews, sekitar 12 unit mobil dinas milik Satpol PP sudah tak berbentuk. Kerusakan parah dan sisasisa kebakaran juga terlihat pada tiga unit mobil karyawan. Tidak hanya itu, ada dua unit truk kontainer pengangkut alat berat rusak parah. Satu unit ‘bangkai’ mobil meriam air atau water cannon juga masih menyisakan kepulan asap. Belum lagi ada sekitar tiga unit motor yang dibakar massa. 640 Polisi & 4.000 Satpol PP Sedikitnya 640 personel polisi dan 4.000 aparat Satpol PP dikerahkan ke makam Mbah Priok di Koja, Jakarta Utara. Mereka berhadapan dengan ratusan warga yang dibantu sejumlah organisasi massa yang mempertahankan makam tersebut. Kepala Bidang Informasi dan Publikasi Pemprov DKI Cucu Ahmad Kurnia dalam jumpa pers di Pemprov DKI Jakarta mengatakan jumlah warga sekitar 400 orang. “Tapi bala bantuannya banyak, jumlahnya bisa dua kali lipat. Mereka dari ormas, termasuk FBR,” kata Cucu. (dtc/vivanews/m05)

Tak Ada Rencana ... kasus bermula dari sengketa antara PT Pelindo II dengan ahli waris Habib Hasan bin Muhammad Al Haddad atau Mbah Priok. Sengketa tersebut telah terjadi selama bertahun-tahun dan telah dibawa ke Pengadilan Negeri Jakarta Utara. Para ahli waris mengklaim kepemilikan tanah di lokasi tersebut dengan mendasarkan pada Eigendom Verponding no 4341 dan No 1780 di lahan seluas 5, 4 Ha. Namun PN Jakarta Utara pada tanggal 5 Juni 2002 telah memutuskan tanah tersebut secara sah adalah milik PT Pelindo II. Hal ini sesuai dengan hak pengelolaan lahan (HPL) Nomor 01/Koja dengan luas 145,2 hektar. Makam yang diyakini warga sebagai makam Mbah Priok pun sebenarnya sudah di pindahkan ke TPU Semper. “Makamnya sudah dipindahkan ke TPU Semper berdasarkan Surat Kepala Dinas Pertamanan dan Pemakaman Provinsi DKI Jakarta,” ujar Cucu. Makam Mbah Priok dipindahkan pada tanggal 21 Agustus 1997 dengan surat keputusan No 80/-177.11 dari Dinas Pertamanan dan Pemakaman DKI. Pemprov tidak pernah akan melakukan penggusuran di area petilasan Mbah Priok yang hanya berukuran 20 meter persegi. “Tidak ada rencana menggusur makam, justru akan kita renovasi, akan kita perluas menjadi 100 meter persegi. Setelah itu kita akan daftarkan sebagai cagar budaya,” tambah Cucu. Namun upaya eksekusi lahan dan bangunan liar di kawasan makam yang merupakan lahan milik Pelindo II telah dibelokkan isunya menjadi penggusuran makam mbah Priok. “Isu dibelokan, tapi eksekusi sendiri sudah ditunda. Petugas juga sudah ditarik agar hal-hal yang tidak diinginkan tidak terjadi kembali,” pungkas Cucu. (dtc)

Rahudman-Eldin ...

Waspada/Mursal AI

BEBERAPA korban pemilik kios yang terbakar sedang memilah barang-barang yang hangus terbakar, Rabu (14/4) dini hari. Para korban berharap masih ada barang yang bisa digunakan.

164 Kios Pasar ... mengaku mengalami kerugian hingga Rp100 juta. Semua barang pecah belah dan alat-alat dapur yang ada di tokonya musnah terbakar. ”Yang buka usaha di sini istri saya, kalau saya kerja di bengkel. Habislah tempat usaha istri saya ini, ini usaha dia satu-satunya. Dia saja sudah tak sanggup lagi berdiri, lemas dia melihat kejadian ini,” kata Sebayang menunjuk istrinya Rohmenda br Purba yang terduduk lesu melihat kiosnya yang terbakar. Sementara itu, Kapolsekta Delitua AKP Bahtiar Marpaung menjelaskan, penyebab kebakaran dan asal usul api masih dalam penyelidikan petugas Laboratorium Forensik. Namun, api diduga berasal dari dua kios yang digunakan untuk usaha warung kopi dan tukang jahit. “Berdasarkan keterangan dari sejumlah warga, api pertama kali terlihat dari kedua warung tersebut. Untuk mengetahui penyebab kebakaran, kita tunggu saja hasil penyelidikan Labfor,” ujar AKP Bahtiar.

D.L. Sitorus Tak ... mengetahui kapan panggilan itu akan dikirimkan. Pengusaha asal Sumatera Utara itu rencananya akan diperiksa sebagai saksi. Johan menjelaskan, D.L. Sitorus akan diperiksa dalam kapasitas sebagai klien Adner

Vonis Hengky Samuel ... vonis 15 tahun penjara di Pengadilan Tindak Pidana Korupsi. Majelis hakim pada tingkat banding juga menjatuhkan denda Rp500 juta subsider enam bulan penjara. Kemudian, Hengky yang juga pengusaha itu diwajibkan membayar uang pengganti

Susno Siap ... mereka yang terlibat di kasus itu sebagai makelar kasus. “Tapi Andi Kosasih orang Batam kok bersaksi. Apakah ada permainan atau tidak silahkan tanya ke penyidik,” tutupnya. (dtc)

Sjahril Djohan Tersangka, ... menyampaikan siapa saja nama-nama yang disebut oleh Sjahril terlibat dalam kasus ini. “Sementara hasil pemeriksaan belum bisa disampaikan karena banyak pihak yang terkait. Banyak hal yang harus kita kroscek,” tuturnya. Sjahril Djohan yang merupakan mantan diplomat dan

Mbah Priok Berasal ... sebagai penyiar agama Islam. Dia berasal dari Pulau Sumatera. Habib bisa sampai di tanah Batavia (Jakarta) awalnya karena perahu yang ditumpanginya dihajar badai ketika hendak melintas di dekat Batavia. Tetapi, pada waktu itu habib selamat dari amukan badai. Konon, dia selamat karena menemukan periuk. Dengan periuk itulah habib berhasil menepi ke Batavia. Sejak itu, Habib Hasan tinggal di Batavia dan menyiarkan agama Islam di sana. Tidak lama kemudian, kawasan tempat di mana habib pernah selamat dari badai itu dinamai Tanjung Priok. Habib Hasan meninggal di Batavia. Untuk mengenang perjuangan habib, pengikutnya membangun makam sekaligus masjid untuk mengadakan majelis taklim. Makam di Koja ini kemudian dikenal sebagai makam Mbah Priok. Tempat itu kemudian dikenal luas. Tiap akhir pekan, sampai sekarang, sedikitnya 1.500 orang mengikuti pengajian di sana. Sampai akhirnya timbul kasus. Bangunan pendopo makam Mbah Priok dinyatakan berdiri di atas lahan milik PT Pelindo II sehingga menyalahi aturan dan harus ditertibkan. Sebenarnya sudah beberapa tahun lalu, upaya pener-

Dimintai Keterangan Terkait peristiwa kebakaran tersebut, tambah Kapolsekta, lima orang saksi telah dimintai keterangannya. Mereka yang dimintai keterangannya merupakan penjaga malam di Pasar Inpres Simpang Kwala Bekala. Pantauan Waspada di lokasi kebakaran tersebut, petugas Identifikasi Poltabes Medan dan Labfor telah memeriksa satu komporminyaktanahdanarangarang sisa dari kayu yang terbakar. Setelah kompor tersebut diteliti, diketahui kompor dalam keadaan mati atau tidak digunakan saat kebakaran terjadi, karena posisi sumbu kompor berada di bawah. “Kalau sumbu kompor berada di atas, maka kompor tersebut hidup atau sedang digunakan. Jelasnya, kompor tersebut tidak berfungsi saat kebakaran terjadi,” sebut seorang petugas seraya menepis dugaan yang berkembang bahwa api berasal dari kompor minyak tanah. Sedangkan arang-arang sisa kayu yang terbakar tersebut, sebut petugas itu, untuk meSirait, seorang pengacara yang sudah ditetapkan sebagai tersangka dalam kasus suap itu. Hingga pukul 19.20, belum ada keterangan resmi tentang alasan ketidakhadiran D.L. Sitorus. Komisi Pemberantasan Korupsi telah menetapkan Ibrahim dan Adner Sirait sebagai tersangka kasus dugaan suap. sebesar Rp82 miliiar dikurangi nilai 10 unit mobil pemadam kebakaran jenis V80 ASM yang sudah disita. Jika uang pengganti itu tidak dibayarkan, Hengky diwajibkan menjalani pidana penjara selama lima tahun, atau dua tahun lebih lama daripada keputusan pengadilan tingkat pertama. Putusan itu dijatuhkan majelis hakim dengan pertimbangan nilai yang dikorupsi cukup besar sehingga mempengaruhi kemakmuran rakyat. Kemudian, perbuatan Hengky juga menyeret para pejabat penyelenggara negara, sehingga merusak citra penyelenggaraan negara.

mastikan apakah di dalam arang itu ada kandungan minyak bensin atau sejenisnya. Sehingga nantinya dari hasil penyelidikan bisa diketahui apakah peristiwa kebakaran itu disengaja atau tidak serta adanya motif-motif lain. Petugas Polsekta Delitua memasang garis police-line warna kuning di lokasi kebakaran. Kerugian Rp4 M Sementara itu Direktur Operasional PD Pasar, Martua Simanungkalit yang ditemui wartawan mengatakan, pihaknya telah melaporkan peristiwa tersebut kepada Walikota Medan dan Sekda. Menurut rencananya akan segera dibangun lokasi penampungan yang baru di pasar tersebut setelah tiga hari penyidikan polisi di lokasi kebakaran. Pembangunan dilakukan bekerjasama dengan pedagang dan pihak lainnya. “Pembangunan kios baru di lokasi kebakaran akan secepatnya dilaksanakan, menunggu arahan dari Walikota Medan, sedangkan jumlah kerugian PD Pasar masih dalam pendataan,” tuturnya. Pengurus Persatuan Pedagang Pasar Inpres Kwala Bekala (P3KB) J Ginting menuturkan, pihaknya telah melaku-kan pendataan para korban kebakaran untuk segera dilakukan penanggulangannya agar dapat beroperasi kembali. “Dari peristiwa itu, para pedagang diperkirakan mengalami kerugian sebanyak Rp3 miliar hingga Rp4 miliar,” katanya. (cmai/cat/m40)

Gempa Kuat ...

staf ahli jaksa agung era Marzuki Darusman ini telah ditetapkan sebagai tersangka oleh Mabes Polri pada hari ini sejak pukul 17.00 WIB. Sjahril ditengarai menjadi perantara antara polisi dan orang yang berkasus. Sjahril tiba di Indonesia pada Selasa, 13 April 2010. Kedatangan Sjahril ke Indonesia didampingi oleh pengacaranya Hotma Sitompul. (dtc)

rumah-rumah yang terbuat dari lumpur dan kayu, kata Karsum Nyima, wakil kepala berita stasiun televisi kawasan Yushu, yang berbicara lewat telepon dengan penyiar CCTV. “Dalam sekejap, rumahrumah rubuh. Gempa itu sangat mengerikan,” katanya. “Di satu taman kecil, ada satu menara Budha dan puncak menara itu jatuh..Semua berlari ke jalan, berdiri di depan rumah mereka, mencoba untuk mencari anggota keluarga mereka.” Gempa itu melanda kawasan Yushu, daerah Tibet di bagian selatan Qinghai, kata Pusat Jaringan Gempa China, yang mencatat kekuatan gempa 7,1 skala richter. Penyiar CCTV mengatakan jumlah korban tewas meningkat sampai 400, di tambah kira-kira 10.000 orang cedera. Tak ada alat berat Polisi paramiliter menggunakan skop untuk menggali reruntuhan di kota, demikian terlihat dari tayangan televisi.

tiban pendopo akan direalisasikan. Tetapi, ahli waris makam Mbah Priok menolak keras. Sampai akhirnya, Rabu 14 April 2010, pemerintah mengerahkan petugas untuk mengeksekusi. Pengikut Habib Ali Zaenal Abidin bin Abdulrahman Al Idrus dan Habib Abdullah Sting, ahli waris makam Mbah Priok, tidak tinggal diam. Mereka menghadang laju petugas hingga akhirnya bentrok fisik pecah dan korban berjatuhan. Usai bentrok sengit dengan pengikut habib, petugas Satpol PP mendapat pengalaman berbau mistis. Salah seorang petugas Satpol PP yang dari awal mengamati proses bentrokan fisik mengatakan kendati jumlah pengikut habib tidak ada setengahnya dari Satpol PP, mereka tidak ada yang takut terluka parah sama sekali. “Sepertinya mereka punya ilmu ghaib. Tidak ada yang terluka berat, saat terkena lemparan benda keras, bahkan maju terus,” kata petugas yang tidak mau disebut namanya itu. Sebaliknya, justru petugas yang banyak menderita luka. Padahal, petugas sudah mengenakan pakaian anti huru-hara. Petugas Satpol PP yang bernama Slamet menambahkan malahan ada helm petugas yang sampai pecah karena terkena lemparan dari salah

satu pengikut habib. Tetapi sebaliknya, ketika petugas melempar batu ke arah massa, seolah-olah bagi massa, batu itu tidak berarti apa-apa. Slamet sangat heran dengan pengalamannya. Dia mengaku merasakan ada kekuatan di luar akal sehatnya yang ikut membentengi lokasi sehingga petugas sangat sulit melaksanakan eksekusi. Bentrokan fisik yang memakan banyak korban luka di pihak Satpol PP itu akhirnya reda setelah pemerintah dan pengelola makam sepakat berunding. Mengenai kebijakan eksekusi, dalam berbagai kesempatan Wakil Walikota Atma Senjaya mengatakan bahwa penertiban gapura dan pendopo di makam Mbah Priok ini sudah sesuai dengan instruksi gubernur DKI nomor 132/2009 tentang penertiban bangunan. Sebab, kata dia, bangunan itu berdiri di atas lahan milik PT Pelindo II, sesuai dengan hak pengelolaan lahan (HPL) Nomor 01/Koja dengan luas 1.452.270 meter persegi. Sebaliknya, bagi ahli waris makam Mbah Priok rencana pembongkaran justru menyalahi aturan. Sebab, areal pemakaman dan masjid ini telah memiliki sertifikat resmi yang dikeluarkan pada jaman pendudukan Belanda dulu. (Vivanews/Arnes Ritonga)

Bumi Warta Harian Waspada Jalan Letjen Suprapto No 1. Selain visi misinya yang singkat, Rahudman hadir bersama wakilnya Dzulmi Eldin. Pasangan birokrat ini juga terkesan merakyat dari cara penyampaiannya yang gamblang, sederhana dan mengerti apa yang dibutuhkan masyarakat dan kelanjutan pembangunan kota ini. Menurut Rahudman, visi misi yang singkat itu adalah menjadikan kota ini aman tertib sejahtera madani dan religius. Konsep itu sudah termaktub skala prioritas program calon yang diusung dari Partai Demokrat dan Partai Golkar ini, seperti pembenahan dan peningkatan mutu pendidikan, kesehatan, lapangan pekerjaan, pembenahan infrastruktur, sanitasi lingkungan, UKM dan investasi. Rahudman merinci sekiranya dia terpilih akan membenahi seluruh jalan-jalan dan drainase. Selama dia menjadi Pj Walikota lima bulan, program pembenahan infrastruktur sudah dimulai dengan pengaspalan jalan-jalan yang rusak dan perawatan drainase. Sebelumnya, ada 74 titik genangan banjir kini 42 titik sudah bisa diatasi meski belum seratus persen. Begitu juga jalan-jalan yang kondisinya banyak tidak sesuai, perlahan mulai dibenahi. “Alhamdulillah, masyarakat sedikit banyaknya sudah merasakan pembenahan masa saya menjabat Pj Walikota,” katanya seraya menambahkan program itu akan kita lanjutkan. Kemudian, problem sampah sudah mulai diatasi dengan menambah berbagai jenis armada pengangkut sampah. Meski armada masih kurang, ujar Rahudman, pihaknya semasa menjabat Pj Walikota telah membuat 1 kelurahan satu truk sampah. Ini sudah berjalan, namun belum bisa mengangkut 1.400 ton sampah Medan setiap hari melainkan masih sekitar 600-700 ton. Ke depan, lanjutnya, program penanganan sampah akan terus ditingkatkan lagi, termasuk mengelola TPA tidak lagi open dumping. Selain itu, dengan penambahan armada sampah, lanjutnya, ke depan tidak ada lagi masyarakat leluasa membuang sampah ke sungai. Untuk UKM, Rahudman menegaskan program riil untuk memberdayakan seluruh potensi UKM seperti untuk pedagang kaki lima (PKL) akan membentuk Badan Pengelolaan PKL. Program ini meniru di Solo yang mampu menarik PAD Rp2,7 miliar per tahun dari PKL. “Program pemberdayaan PKL ini akan kami terapPara pejabat mengatakan alat berat tidak tersedia dan sebagian besar jalan menuju ke bandara terdekat rusak, peralatan dan regu-regu pertolongan akan sulit mencapai daerah bencana. Angka kematian meningkat kira-kira 400 menjelang sore, demikian menurut CCTV. Seorang pejabat darurat, Pubucairen, mengatakan jumlah korban cedera juga telah meningkat lebih 10.000 orang. Gempa bumi itu datang kurang sedikit dari dua tahun setelah satu gempa berkekuatan 7,9 skala Richter di provinsi Sichuan tetangganya yang mengakibatkan hampir 90.000 orang tewas dan hilang. Kantor darurat provinsi mengatakan kepada Xinhua bahwa 700 tentara berusaha untuk membersihkan reruntuhan dan regub pertolongan menguburkan para korban dan lebih dari 1.000 pasukan lagi segera dikerahkan. (m18/m07)

WASPADA Kamis 15 April 2010 kan di Medan untuk memberdayakan UKM,” kata Rahudman dalam acara yang dimoderatori Redaktur Ekonomi Waspada Armin R Nasution. Terkait pengembangan UKM, lanjutnya, dalam visi misinya akan membenahi pasarpasar tradisional, dimana program ini tidak sempat dijalankan ketika dirinya menjabat sebagai Pj Walikota. Rahudman prihatin dengan 52 pasar tradisional yang hancur. Kehancuran pasar sebagai tulang punggung masyarakat untuk berusaha telah memberi dampak dan menghilangkan ruang bagi masyarakat untuk berusaha. Penyebabnya, pasar tradisional dikelola dalam bentuk perusahaan, sehingga tidak bisa ditanggungjawabkan dalam APBD. Untuk itu, jika dirinya terpilih akan meninjau status PD Pasar untuk membangun pasar-pasar tradisional yang dibiayai APBD. Termasuk rencana dirinya akan membangun Pasar Induk di Tuntungan sebagai tempat PKL yang berjualan di kawasan Jalan Sutomo dan Pusat Pasar sekitarnya. “Tentunya status pengelola pasar tidak lagi dalam bentuk perusahaan daerah.” Untuk pemberdayaan UKM, Rahudman bertekad akan membuat dan menyediakan ruang pasar bazaar UKM di berbagai tempat untuk membuka peluang usaha dan memasarkan produk UKM. Selain itu membantu pengadaan alat teknologi bagi perajin dan usaha lainnya seperti bagi 100 KK di Kecamatan Medan Selayang yang menggantungkan hidupnya sebagai pemecah kemiri. “Ini salah satu contoh yang akan diperhatikan.” Menurut Rahudman, pihaknya akan memokuskan pendidikan di daerah pinggiran terutama di Belawan. “SMA saja di sana masih satu. Kita akan tambahlagidanmelakukanpembenahan fisik sekolah dan peralatan lainnya,” katanya. Menanggapi pembanding Ketua PWI Sumut Drs M Syahrir yang menguji program pem-

benahan kota seperti kemacetan lalu lintas, billboard yang semraut, Rahudman mengatakan persoalan lalu lintas terkait volume kendaraan. Dirinya bersama Dzulmi Eldin akan menertibkan izin angkot. Selama ini peremajaan 20 harus dikurangi 20, bukan peremajaan 20 bertahan 20. Rahudman mengatakan, persoalan ini harus dilakukan dengan tegas dan konsisten. Termasuk penataan billboard, dirinya akan tegas memangkas billboard yang semraut. “Jangan ada orang yang mengatur pemerintah di luar orang pemerintah,’’ katanya. Rahudman mengatakan, pemangkasan billboard dilakukan dengan cara duduk bersama dengan pengusaha billboarddanpersuntuksama-sama membuat kesepakatan menjaga kota ini. Dari situ dapat diputuskan mana daerah yang harus bebas dari papan reklame. “ Saya akan keluarkan Perwal soal pemangkasan billboard dan penertiban angkot,” katanya. Rahudman juga mengaku dirinya tetap menjaga relasi dengan wartawan dan komit memperlancar tugas wartawan yang membutuhkan konfirmasi dari dirinya. ‘’Jika saya terpilih, saya akan mengalokasikan bantuan untuk PWI dalam APBD. Insya Allah akan ditampung bantuan untuk PWI. Saya janji akan selalu terbuka kepada wartawan,’’ katanya. Menurut Rahudman, kebijakan pembangunan perlu sosialisasi kepada masyarakat sehingga pertingnya peran wartawan. Acara bedah visi misi ini dihadiri Wapemred Azwir Thahir, Sofyan Harahap dan para redaktur, seperti Edward Thahir yang juga Ketua Panitia Bedah Visi Misi Calon Walikota Medan, Muhammad Joni, Hendra DS, M. Zeini Zein, Jonni Silalahi, Erma Tarigan, Syarifuddin Elhayat, Akmal AZ, Dedi Sahputra, Zulkifli Harahap dan para tim sukses. Sementara hari Jumat (16/ 4) pk 14.30 panitia menghadirkan calon walikota Joko SusiloAmir Mirza Hutagalung. (m15)

Panas Berkepanjangan ...

ri transportasi. Ketika CO2 lebih mendominasi ruang di perkotaan, maka masyarakat akan mengalami gangguan pernafasan seperti penyakit Infeksi Saluran Pernafasan Akut (ISPA). Guna mengatasi permasalahan polusi udara ini, perlu dilakukan gerakan penanaman pohon di tengahtengah kota. “Jika banyak pohon di tengah kota, maka CO2 tersebut akan tersaring. Sebab, pohonpohon tersebut menghasilkan oksigen (O2) yang dibutuhkan manusia,” ujarnya. Selain itu, lanjut Candra, cuaca panas berpotensi menyebabkan dehidrasi (kekurangan cairan) sehingga terjadi head stroke (hilangnya kesadaran). Sebab, kekurangan cairan mengakibatkan tekanan darah menurun dan suplai oksigen ke seluruh jaringan tubuh berkurang. Sementara itu, praktisi kesehatan dr. M. Sakti Siregar berpendapat, tingginya tingkat pencemaran udara yang berasal dari transportasi menjadi salah satu pemicu naiknya temperatur di muka bumi. Guna mengatasi masalah polusi udara tersebut, sebaiknya pemerintah dan polisi lalu lintas mensosialisasikan gerakan mematikan mesin bagi kendaraan bermotor saat lampu merah dan saat menungu kereta api melintas. “Dengan gerakan mematikan mesin ini, maka akan mampu mengurangi tingkat pencemaran udara. Gerakan seperti ini sudah diberlakukan di salah satu kota di Pulau Jawa,” ujar Sakti. (m26)

dr. Irwan F. Rangkuti, SpKK kepada Waspada, Rabu (14/4). Menurut Irwan, penuaan dini pada kulit berpotensi dialami orang-orang yang sering melakukan aktivitas di luar ruangan dan terkena sinar matahari langsung. Hal ini terjadi karena radiasi sinar ultraviolet merusak DNA kulit. Bahkan, kerusakan kulit tersebut berpotensi menjadi kanker jika terus terpapar radiasi ultraviolet dalam jangka waktu relatif lama. “Kasus kanker kulit akibat radiasi ultraviolet ini sering ditemukan pada petani dan peladang yang bekerja di tempat terbuka tanpa menggunakan pelindung kulit,” ujarnya. Karena itu, Irwan mengimbau masyarakat agar mengurangi aktivitas di luar rumah saat cuaca panas. Jika hendak bepergian, sebaiknya menggunakan pelindung seperti payung, jaket dan topi. Selain itu, kelompok anakanak terutama bayi dan balita sangat rentan terhadap penyakit gatal-gatal pada kulit seperti biang keringat. “Cuaca panas menyebabkan keluarnya keringat secara berlebihan. Dalam kondisi ini, biang keringat mudah menyerang anakanak,” tambahnya. Polusi Di tempat terpisah, Kadis Kesehatan Sumut dr. Candra Syafei, SpOG mengatakan, cuaca panas yang terjadi saat ini tidak terlepas dari tingginya tingkat pencemaran (polusi) udara disebabkan gas karbon dioksida (CO2) bersumber da-


WASPADA Kamis 15 April 2010



BALAS LEMPARAN: Satuan Polisi Pamong Praja (Satpol PP) membalas lemparan batu oleh warga yang mempertahankan makam mbah Priuk di daerah Koja, Jakarta Utara, Rabu (14/4). Insiden tersebut menyebabkan tiga warga yang mempertahankan makam tewas, dan puluhan petugas Satpol PP dan polisi mengalami luka-luka.


MEMPERTAHAKAN MAKAM: Sejumlah warga mempertahankan makam mbah Priuk saat penggusuran oleh Satuan Polisi Pamong Praja (Satpol PP), di daerah Koja, Jakarta Utara, Rabu (14/4). Makam tersebut merupakan makam dan tempat ziarah keramat oleh warga sekitar, sehingga mereka mempertahankan keberadaannya.

Bentrok Makam Mbah Priok

DPRD Bentuk Pansus JAKARTA (Antara): Wakil Ketua DPRD DKI Triwisaksana mengatakan, dewan akan membentuk panitia khusus (pansus) atas bentrokan yang terjadi saat eksekusi bangunan disekitar lahan makam “Mbah Priok” Jakarta Utara. “Kami akan mengusulkan dibentuknya pansus atas kejadian jatuhnya korban saat upaya penggusuran tanah makam di kawasan Pelabuhan Peti Kemas Koja,” kata Triwisaksana di Jakarta, Rabu (14/4). Menurut Triwisaksana,

bentrok terjadi diduga karena Satpol PP mengedepankan pendekatan kekerasan dibandingkan dialog. Dia menyesalkan Satpol PP tidak segera meninggalkan lokasi kejadian begitu bentrokan terjadi. “Semestinya Satpol belajar dari institusi Polri

yang memiliki satuan negosiator lapangan dan juga intelijen,” ujarnya. Dengan adanya informasi intelijen lebih dini kata dia, maka tawuran massal antara Satpol PP dengan massa bisa dihindari. Ketua DPRD DKI Jakarta, Ferrial Sofyan juga menyatakan DPRD akan memanggil Gubernur DKI Jakarta Fauzi Bowo untuk meminta pertanggungjawaban paling lambat dua hari kedepan. “Kami sudah me-

manggil ketua komisi dan pimpinan DPRD. Gubernur akan diminta pertanggungjawabannya dalam waktu cepat, satu atau dua hari kedepan akan kami panggil,” katanya. Tim khusus juga akan dibentuk untuk mengetahui akar permasalahan itu, apakah eksekusi bangunan liar tersebut sudah sesuai prosedur dan apakah memang kurang sosialisasi. “Apapun pemicunya kita harus tahu persis permasalahannya,

dan ini perlu ditelusuri untuk memperjelas masalah,” kata Sofyan. Wakil Ketua DPRD Inggard Joshua menambahkan bahwa Dewan meminta agar kedepannya Satpol PP perlu mengedepankan upaya persuasif dan preventif dalam menyelesaikan berbagai persoalan. “Paling tidak, dilakukan sosialisasi kepada warga. Kita tidak menginginkan aparat kita selalu terlibat bentrok,” ujarnya.

Pemprov DKI Minta Maaf JAKARTA (Antara): Pemprov DKI Jakarta menyayangkan dan menyatakan keprihatinannya atas kerusuhan yang terjadi di sekitar lokasi makam Mbah Priok di Koja, Jakarta Utara, Rabu (14/4). “Kami menyampaikan permintaan maaf tentang kejadian ini dari Pemda, hari ini sudah berhenti, tidak ada yang dilanjutkan. Masyarakat jangan salah tafsir, bukan makam, tapi bangunan yang tanpa IMB (Izin Mendirikan Bangunan) yang ditertibkan,” kata Wakil Gubernur DKI Prijanto di kantor Walikota Jakarta Utara, Rabu sore.

Wagub sekali lagi menegaskan bahwa Pemprov DKI tidak akan menggusur bangunan monumen makam tokoh masyarakat Al Arif Billah Hasan bin Muhammad Al Haddad, atau biasa dikenal dengan nama “Mbah Priok” selain memang jasad Mbah Priok telah dipindahkan ke TPU Semper atas permintaan ahli waris seperti yang disebutkan dalam Surat Kepala Dinas Pertamanan dan Pemakaman Provinsi DKI Jakarta, 10 Februari 2009 Nomor 80/-1.711.11. Satpol PP disebut Prijanto, hanya akan menertibkan ba-

ngunan ilegal yang dibangun disekitar makam tersebut antara lain, gapura setinggi 5 meter, tembok dan beberapa bangunan yang digunakan untuk warga berziarah. Pemilik lahan yang sah, PT Pelabuhan Indonesia (Pelindo) II disebutWagub, telah memberikan uang kerohiman kepada ahli waris makam sebesar Rp2,5 miliar dan tanah seluas 5.000 meter persegi untuk majelis taklimsepertiyangdimintaahliwaris. “Ini bukan ganti rugi. Tanah yang disengketakan memang menurut sertifikat BPN milik Pelindo bukan milik ahli waris.

Ahli waris memang punya lahan dengan bukti eigendom itu tapi letaknya bukan di situ,” papar Prijanto. Para ahli waris lahan makam Mbah Priok mengklaim kepemilikan tanah di lokasi itu hingga 5,4 hektar dengan bukti kepemilikan Eigendom Verponding No.4341 dan No.1780. Kemudian, gugatan oleh ahli warisnya bernama Habib Muhammad bin Achmad kepada Pengadilan Jakarta Utara dengan nomor perkara 245/ Pdt.G/2011/PN.Jkt.Ut. Itu telah dikeluarkan putusan dari PN Jakarta Utara 5 Juni 2001 dengan

amar gugatan penggugat tidak dapat diterima dengan pertimbangan hukum yakni kuasa hukum penggugat tidak sah, gugatan penggugat tidak jelas dan kurang pihak. Penggugat pun tidak mengajukan banding. Jadi putusan PN Jakarta Utara tetap berlaku yakni secara sah merupakan milik PT Pelindo II sesuai hak pengelolaan lahan (HPL) nomor 01/Koja dengan luas 1.452.270 meter persegi. “Sudah ada keputusan pengadilan negeri itu tanah Pelindo, bukan ahli waris. Mereka juga tidak mengajukan banding,” katanya.

Kepengurusan PPRN Tetap Satu

Waspada/Muhammad Zairin

DIKUKUHKAN: Wakil Ketua Umum Korpri Pusat, Eko Sutrisno, menyerahkan pataka Korpri kepada Sekda Aceh Husni Bahri TOB yang dikukuhkan sebagai Ketua Umum Dewan Pengurus Korpri Aceh 2010-2015, Rabu (14/4) di gedung serba guna Setda Aceh, Banda Aceh.

Korpri Diarahkan Jadi Organisasi Profesi BANDA ACEH (Waspada): Wakil Ketua Umum Dewan Pengurus Korpri Nasional, Drs. Eko Sutrisno, M.Si mengatakan organisasi Korps Pegawai Negeri Sipil diarahkan menjadi organisasi profesi, sehingga anggotaanggota Korpri tersebut harus menjadi profesional-profesional yang mempunyai kompetensi dibidang tugas pokok dan fungsi masing-masing. “Semangat organisasinya kita arahkan menjadi organisasi profesi, baik dari sisi anggota maupun organisasinya,” ujar Drs. Eko Sutrisno, M.Si, Wakil Ketua Umum Korpri Pusat kepada pers usai mengukuhkan Sekda Aceh Husni Bahri TOB,

sebagai Ketua Dewan Pengurus Korpri Aceh 2010-2015, Rabu (14/4) di gedung serba guna Setda Aceh, Banda Aceh. Dikatakannya, untuk menjadi organisasi profesi setidaktidaknya anggota Korpri juga harus menjadi profesional sesuai bidang tugas profesi masing-masing. Apakah STPDN masih diperlukan? Eko menjawab bahwa sekolah itu disiapkan pemerintah untuk menyediakan tenaga-tenaga yang memiliki kompetensi dibidang pelayanan masyarakat dan pemerintahan. “Saya kira untuk menyiapkan kader perlu. Kalau nanti camat sudah terpenuhi, tantangan

pemerintah terbesar dilevel bawah seperti lurah juga perlu pendidikan.” Menurut Eko, gaji PNS memang belum memadai, bagi golongan rendah yakni golongan I dan II itu sudah lebih tinggi dari swasta dan UMR.“Tapi yang menengah ke atas belum bagus, jadi antara yang tertinggi seperti eselon I dengan yang terendah itu satu dibanding tiga, idealnya kan bisa dibanding 10,” sebutnya. Nanti, tambah Eko, sistim penggajian itu akan diperbaiki tapi komponen lain terkait kesejahteraan anggota Korpri sudah baik, seperti tunjangan kesehatan dengan program Askes dan sebagainya.(b04)

MEDAN (Waspada): Kepengurusan PPRN, mulai tingkat Dewan Pimpinan Pusat (DPP) sampai Dewan Pimpinan Wilayah (DPW), Dewan Pimpinan Daerah (DPD) serta Dewan Pimpinan Cabang (DPC) tetap satu. Tidak ada perpecahan dalam bentuk kubu-kubuan. Wakil Ketua DPW Partai Peduli Rakyat Nasional (PPRN) Sumut, mewakili DPP PPRN HA JumalaWijaya didampingiWakil Sekretaris Christian Panjaitan, Wakil Ketua Hj Siti Anden Harahap, Wakil Bendahara Nurmala Silaban, Sekesih, Ratnasari serta Indra Siregar menegaskan itu, menanggapi munculnya anggapan terdapat dua kubu dalam kepengurusan PPRN. “Tidak benar PPRN terpecah dalam dua kubu,” kata Jumala, membacakan SK kepengurusan DPW ditandatangani Ketua Umum Amelia A Yani dan Sekretaris HVTA Simanjuntak, 21 Juli 2008 dengan No. 019A/DPP/SK/VII/2008. Namun katanya, dikarenakan Amelia menjalankan roda organisasi di luar ketentuan AD/ART partai, termasuk menggelar musyawarah nasional (Munas) sebelum waktunya, serta mengangkat Sekjen yang bukan produk Munas sah, sehingga dia dibebastugaskan dari jabatan ketua umum. “Dengan pembebastugasan itu, semua surat-surat dikeluarkan dan ditandatangani Amelia bersama Sekjen bentukannya, Maludin Sitorus, dinyatakan

tidak sah, karena Maludin Sitorus bukan hasil pemilihan partai.” Begitu juga Munas 11 Maret 2010 di Bandung, selain tidak dihadiri 2/3 dari utusan DPW dan DPD. Jumala yang mengaku ditugasi DPP, berharap masyarakat memahami keberadaan partai ini, yang sampai sekarang tidak pernah pecah, juga tidak ada dua kubu. “Dengan dibebastugaskan Amelia, DPP memberikan hak untuk menandatangani surat menyurat kepada Ricky Sitorus dan Nageri Sirait sebagai Wakil Sekjen,” kata dia, atasnama DPP dan DPW menginstruksikan kepada DPD tetap menjalankan organisasi sesuai petunjuk DPP, serta berkoordinasi dengan DPW. (m23)

Satgas, Kejagung Bahas Sjahril Johan JAKARTA (Antara): Denny Indrayana dan Mas Achmad Santosa dari Satuan Tugas (Satgas) Pemberantasan Mafia Hukum, Rabu (14/4) menyambangi Kejaksaan Agung (Kejagung) untuk berkoordinasi masalah Sjahril Djohan dengan Wakil Jaksa Agung, Darmono yang juga anggota Satgas. “Tadi kita melakukan pembicaraan program-program satgas. Salah satunya membicarakan Sjahril Djohan,” kata anggota Satgas Pemberantasan Mafia Hukum, Darmono. Dia mengatakan, Satgas belum berencana memeriksa Sjahril Djohan. “Kita baru melakukan pertemuan dahulu,” katanya, melihat belum ada keterkaitan antara Sjahril Djohan dengan

orang-orang Kejagung. Sementara Denny Indrayana mengatakan kedatangannya hanya untuk koordinasi. “Pak Darmono kan anggota Satgas Pemberantasan Mafia Hukum juga,” kata dia. Sebelumnya, pengacara Sjahril Djohan (SJ), Hotma Sitompul mengatakan, penyidik sudah mengkonfrontasikan kliennya dengan Haposan Hutagalung dalam kasus korupsi dan pencucian uang pajak Rp25 miliar dengan tersangka Gayus Tambunan. Hotma menuturkan, ada beberapa keterangan yang berbeda antara Sjahril Djohan dengan Haposan, namun dia tidak menyebutkan perbedaan itu karena masuk materi pemeriksaan penyidik.

Sikap DPR Harus Dikritisi YOGYAKARTA (Antara): Pengamat politik dari Universitas Gadjah Mada, AAGN Ary Dwipayana menilai sikap Komisi XI DPR RI yang menunda rapat pembahasan APBN dengan Menteri Keuangan harus dikritisi. “Sikap itu justru kontraproduktif dengan upaya peningkatan kesejahteraan masyarakat terkait dengan pembahasan APBN,” katanya di Yogyakarta, kemarin. Seharusnya kata dia, akan lebih baik apabila DPR membentuk tim khusus untuk memantau dan mendorong pemerintah dalam menyelesaikan secara hukum terhadap kasus Bank Century. “DPR akan lebih efektif jika membentuk tim pemantau penyelesaian kasus Bank Century, dan dengan kewenangannya DPR dapat mendesak pemerintah untuk segera menindaklanjuti rekomendasi DPR terkait penanganan kasus ini,” katanya.

Dia menilai sikap Komisi XI DPR bisa dimaklumi, karena penyelesaian secara politik tidak ada perkembangan yang signifikan. “Sikap itu juga merupakan cara politik DPR untuk memperkuat posisi tawar dengan sasaran penyelesaian kasus Bank Century yang diduga melibatkan sejumlah pejabat.” Ary mengatakan, ketika rekomendasi DPR atas kasus Bank Century tidak mendapat tanggapan serius dari pemerintah, termasuk mendorong penyelesaian kasus ini melalui ranah hukum dan penonaktifan pejabat yang diduga terlibat, DPR kemudian menggunakan politik mereka untuk menekan pemerintah. Menurut dia, politik semacam ini akan menjadi wahana baru bagi DPR untuk menaikkan posisi tawarnya terhadap pemerintah. “Ini merupakan wahana baru yang mungkin juga akan diterapkan DPR dalam kasus-kasus lainnya,” jelasnya.

KPK Segera Kirim Tim Pemantau Nunun JAKARTA (Antara): Komisi Pemberan-tasan Korupsi (KPK) segera mengirim tim untuk memantau pengusaha Nunun Nurbaeti Daradjatun yang sedang dirawat di Singapura. “KPK memutuskan untuk segera mengirimkan tim memantau kondisi bu Nunun,” kata Juru Bicara KPK, Johan Budi di Jakarta, Rabu ( 4/4). Nunun Nurbaeti Daradjatun adalah pihak yang diduga terkait kasus dugaan suap pemilihan Deputi Gubernur Senior Bank Indonesia (BI) pada 2004. KPK kesulitan menghadirkan Nunun di pengadilan karena dia mengaku sakit, sehingga mengalami gangguan mengingat. Johan tidak mau menyebutkan kapan tim akan berangkat ke Singapura. Dia hanya menegaskan, KPK sedang melakukan pembahasan untuk menentukan komposisi tim yang akan berangkat. Dia juga tidak mau menjelaskan ketika ditanya apakah tim

itu terdiri dari penyidik dan dokter. “Yang jelas saat ini sedang dibahas,” kata Johan. Johan menegaskan, KPK juga telah mengirimkan panggilan kepada Nunun untuk memberikan kesaksian di Pengadilan Tindak Pidana Korupsi pada 19 April 2010. KPK menduga ada aliran 480 lembar cek bernilai Rp50 juta per lembar kepada sejumlah anggota DPR. Aliran cek itu diduga terkait dengan pemilihan Deputi Gubernur Senior BI pada 2004. Fakta persidangan menyebutkan, perintah aliran itu berasal dari pengusaha perempuan, Nunun Nurbaeti Darajatun.

Luar Negeri



Kamis 15 April 2010

Israel Minta Warganya Segera Keluar Dari Sinai JERUSALEM (AP): Israel mengeluarkan peringatan ‘penting’ bagi warganya agar segera meninggalkan Semenanjung Sinai, Mesir, dengan mengatakan ‘adanya bukti nyata tentang adanya usaha penculikan warga Israel di Sinai’. Pernyataan dari kantor anti-teror PM Israel Selasa (13/ 4) merupakan langkah tidak biasa dalam menyeru keluargakeluarga Israel yang berkunjung ke Sinai untuk terus menjalin kontak dengan mereka. Komandan anti-teror, Brigjen. Nitzan Nuriel, mengatakan ada isu bahwa banyak warga Israel diculik di Sinai. ”Kami bekerja bukan berdasar isu,” katanya kepada TV Israel. “Kami bekerja menurut informasi intelijen yang pasti.” Dia mengatakan ‘butuh waktu’ untuk membuktikan bahwa isu, yang beredar sepanjang hari Selasa itu, tidak benar. “Sangat mungkin pada saat ini, ada jaringan teror yang berniat dan punya rencana menculik seorang warga Israel dan membawanya ke Gaza,” katanya. Nuriel mengatakan, para penculik sepertinya akan melancarkan serangan di sepanjang pantai Laut Merah, tempat favorit warga Israel. “Sinai adalah tempat yang luas,” katanya, “dan bukan tidak mungkin menculik warga Israel dari pantai-pantai yang ada di sana saat ini.” Nuriel mengatakan, sekitar 1.200 warga Israel berada di Sinai saat ini.Polisi Mesir melakukan pemeriksaan di seluruh Sinai pada hari itu untuk mengetahui apakah ada warga Israel yang hilang namun tidak menemukan bukti ada yang hilang, menurut petugas keamanan Mesir. Kantor anti-teror Israel telah mengeluarkan peringatan perjalanan yang meminta warga Israel untuk keluar dari Sinai karena ancaman serangan teror. Namun, banyak warga Israel tidak memperdulikan peringatan itu dan tetap berlibur ke kawasan itu dan kawasan pantai Laut Merah. Israel menguasai Sinai sejak mencaploknya pada perang 1967 sampai mengembalikannya ke Mesir pada tahun 1982 dalam rangka kerja perjanjian damai antara kedua negara. Kawasan gurun Sinai itu tepat di seberang perbatasan, dan banyak warga Israrel menghabiskan waktu di resor-resor tepi pantai yang ada di sana.(m18)

Warga Jepang Tolak Pangkalan AS TOKYO, Jepang (Antara/AFP): Kepala daerah tiga kota di satu pulau Jepang dilaporkan memberitahukan kepada pangkalan militer Amerika Serikat, Rabu (14/4), bahwa mereka akan menulis surat kepada Presiden Barack Obama yang menyatakan penolakan mereka terhadap rencana pemerintah. Pusat sengketa adalah sekitar keputusan pemerintah mereka meninjau perjanjian 2006, untuk memindahkan Pangkalan Udara Korps Marinir di Funtenma, Okinawa, dari daerah pemukiman ke wilayah pantai yang lebih sepi, di pulau itu. Media melaporkan bahwa pemerintah Jepang berencana memindahkan pangkalan tersebut ke Tokunoshima, satu pulau di prefektur Kagoshima, di utara Okinawa. Pemerintah tidak mengkonfirmasikan laporan-laporan itu, namun penduduk Takunoshima telah menyuarakan penentangan terhadap rencana tersebut, dengan sekitar 4.000 orang melakukan unjukrasa memprotes rencana itu bulan lalu. Ketiga walikota di Tokunoshima, yang jika penduduknya dijumlahkan mencapai sekitar 27.000, kini sedang menyusun surat untuk dikirimkan kepada Presiden AS, Barack Obama, kata salah seorang dari tiga wali kota, Akira Okubo, kepada AFP. Rancangan surat itu mengatakan: “Kami, semua penduduk pulau, memprotes relokasi pangkalan udara ke Tokunoshima. “Pulaukamiadalahsubtropikadanmasihkayadenganlingkungan alam,” tulis para wali kota. “Kami tetap cinta untuk tinggal di Tokunoshima yang indah ini, sebagaimana sekarang, dan untuk generasi mendatang.” Pulau tersebut adalah bagian dari kepulauan Amami, yang dipandang berposisi strategis penting sebagai tempat terdekat ke Korea Utara dan Selat Taiwan - keduanya berpotensi rawan yang memerlukan penyebaran militer AS. Ketiga wali kota juga sedang mempersiapkan aksi protes lain, yakni unjukrasa pada Minggu, yang menurut mereka akan melibatkan sekitar 10.000 penduduk. “Kami juga akan mengirimkan foto-foto demonstrasi itu kepada Presiden Obama,” kata Okubo.

Karadzic: Saksimata Pertama Atas Kasusnya Berat Sebelah DENHAAG, Belanda (AP): Radovan Karadzic menuduh kesaksian yang diberikan saksimata pertama dalam peradilan kasus pemusnahan etnis atas dirinya dianggapnya ‘sangat berat sebelah dan tidak jujur.’ Mantan pemimpin Serbia-Bosnia Rabu (14/4) berusaha untuk mendiskreditkan kesaksian seorang Muslim pekerja tambang Ahmet Zulic. Sehari sebelumnya Zulic menyatakan pasukan Serbia telah melumpuhkannya dengan berulangkali memukulinya pada tahun 1992 pada saat menahannya dan Muslim lainnya diusir dari rumah-rumah mereka di fasilitas tahanan darurat di garasi dan kandang ternak yang penuh sesak. Karadzic mengatakan Rabu dia butuh untuk melawan klaim Zulic yang Muslim-Bosnia tidak dapat menggerakkan perlawanan bersenjata di desanya sebelum meletusnya perang. Karadzic menyatakan masyarakat Muslim berusaha mengubah Bosnia jadi republik Islam sebelum perang 1992. Ahmet Zulic juga mengatakan kepada hakim bahwa mertuanya, yang juga seorang tetua suku, telah dibakar hidup-hidup oleh pasukan Serbia. Dia juga memberitahu pengadilan bahwa para tahanan di kamp Manjaca dipukuli, disiksa dan dipaksa mengingkari agama mereka, sekalipun mereka adalah orang Muslim. Dia mengatakan tentara Serbia mematahkan tiga jari di tangan kanannya. “Mereka bahkan memaksa saya meminum air seni saya sendiri,” kata Zulic, yang bersaksi dalam tiga proses lain pengadilan, termasukpengadilanatasmantanpresidenSebriaSlobodanMilosevic, yang meninggal di sel tahanannya di Denhag pada 2006. (m07)

Topan Tewaskan 68 Orang Di India CALCUTTA, India (AP): Topan menghancurkan ribuan gubuk terbuat dari lumpur dan menyebabkan pohon-pohon tumbang di beberapa desa di bagian timru India, menewaskan sedikitnya 68 orang, kata seorang pejabat Rabu (14/4). Srikumar Mukherjee, Menteri Pertahanan Sipil, mengatakan topan itu melanda distrik North Dinajpur Selasa malam, yang menyebabkan terputusnya jaringan telepon dan listrik di daerah itu. Mukherjee juga mengatakan ratusan orang menderita cedera di daerah itu, 500 km sebelah timurlaut Calcutta, ibukota West Bengal. Desa-desa yang paling parah dihantam badai adalah Hematabad, Raiganj dan Kiran Dighi, di mana polisi dan petugas penyelamat telah menemukan 31 jenazah, kata Mukherjee kepada AP. Topan menghancurkan hampir 50.000 gubuk lumpur, katanya.(m18)

China Siap Bahas ‘Gagasan Baru’ Tentang Nuklir Iran



Para pekerja regu pertolongan berjalan dekat reruntuhan satu pesawat Airbus A-300 milik AeroUnion yang jatuh dekat bandara internasional Mariano Escobedo di Monterrey Selasa (13/4). Satu pesawat kargo jatuh Selasa malam dekat bandara di Monterrey, di utara Mexico, yang menewaskan lima orang, demikian menurut pihak berwenang Mexico. Sebab kecelakaan itu masih diselidiki.

Korut Pelatihan Besar Di Tengah Ketegangan SEOUL, Korea Selatan (Antara/AFP): Korea Utara menggelar pelatihan besar militer yang dihadiri oleh pemimpin Kim Jong-il, kata media negara komunis itu Rabu (14/4), di tengah meningkatnya ketegangan-ketegangan dengan Korea Selatan. Banyak pameran kekuatan senjata dirancang dalam bulan ini, kata kementerian pertahanan Korea Selatan (Korsel) dalam kesempatan terpisah, pada saat Pyongyang melaksanakan dua peringatan pentingnya. Kim dan para penjabat tinggi militer menyaksikan pelatihan Unit Gabungan Besar 567, kata kantor berita Korea Utara (Korut), KCNA. Namun kantor berita itu tidak menjelaskan kapan atau di mana pelatihan itu diadakan,

kecuali mencatat gelaran tersebut menandai ‘Hari Matahari’ - yang diperingati 15 April, kelahiran Kim Il-sung, ayah Kim yang juga presiden pendiri negara itu. Kim Jong-il menyatakan ‘sangat puas terhadap kenyataan bahwa semua petugas pada kesatuan itu sepenuhnya siap secara politik dan ideologi, serta dalam teknik militer dalam memukul kembali serangan mendadak musuh, pada saat mempertahankan negara sosialis itu’, kata kantor berita tersebut. Latihan juga disaksikan oleh para anggota parlemen, pemimpin partai dan kader-kader negara, sosial, pemerintah dan satuansatuan militer, ujarnya. Kim Rabu mempromosikan juga empat perwira militer menjadi jenderal, lima koloneljenderal, delapan letnan jenderal dan 83 mayor jenderal untuk menandai peringatan itu. Kementerian pertahanan Korsel mengatakan, persiapan-

persiapan sedang dilakukan Korut ‘untuk melakukan gelar gabungan besar-besaran kekuatan persenjataan pada angkatan udara dan angkatan darat.’ Dalam laporan kepada parlemen pihaknya mengatakan, kegiatan tersebut akan diselenggarakan untuk memperingari Hari Matahari, dan peringatan pembentukan militer Korut pada 25 April. Ketegangan-ketegangan lintas perbatasan makin meningkat setelah ledakan kapal perang karam Korsel di dekat perbatasan sengketa Laut Kuning, pada 26 Maret, belum terungkap, dan setelah Korut memutus kesepakatan pariwisata dengan Korsel. Korsel sejauh ini tidak menuduh Korut terlibat dalam ledakan itu. Namun, menteri pertahanannya mengemukakan kemungkinan sebuah ranjau atau torpedo meledakkan dan membelah kapal korvet berbobot 1.200 ton menjadi dua, dan me-

nyebabkan 46 awaknya hilang. Sekitar perbatasan sengketa itu adalah tempat kejadian pertempuran angkatan laut yang mematikan, antara Korut dan Selatan pada 1999 dan 2002, serta baku-tembak pada November lalu. Jika cuaca mengizinkan, kapal perang itu akan ditarik oleh kapal tongkang Kamis suatu operasi yang bisa memberikan beberapa petunjuk mengenai bencana itu. Kementerian pertahanan mengatakan, bagian buritan sebagiannya akan ditutupi dengan jaring, dan para fotografer akan dilarang untuk memotretnya, guna melindungi kerahasiaan militer. Sebagian besar sosok para awak kapal itu diduga terjebak di buritan. Para pelaut yang selamat dari bencana mengatakan, satu ledakan besar terjadi di luar bagian kapal, memutus teoriteori bahwa ledakan terjadi di dalam kapal, tenggelam dan karam.

Oposisi Kyrgyzstan Sedia Berunding Dengan Bakiyev BISHKEK, Kyrgyzstan (AP): Kepala penguasa sementara di Kyrgyzstan mengatakan Rabu (14/4) bahwa perundingan dapat dilakukan dengan presiden terguling Kurmanbek Bakiyev, yang sebelumnya menolak untuk melakukan hal itu. Meski Roza Otunbayeva tidak memberikan keterangan yang spesifik tentang apa yang akan dibicarakan, seperti perundingan akan difokuskan pada beberapa syarat bagi pengunduran diri Bakiyev. Presiden Bakiyev menyatakan dia masih menjadi penguasa sah, namun bersedia mengundurkan diri dengan imbalan jaminan keamanan baginya dan keluarganya. Bakiyev, yang mengungsi di desa asalnya yang jauh dari ibukota Bishkek, berulangkali menawarkan perundingan, namun pemerintahan sementara menolak. Bakiyev melarikan diri dari ibukota pada 7 April setelah satu rapat umum protes berubah menjadi bentrokan berdarah

dan para demonstran berhasil menduduki gedung pemerintah. Sekurang-kurangnya 83 orang tewas. Ditanya tentang prospek perundingan itu setelah bertemu dengan Asisten Menlu AS Robert Blake, Otunbayeva mengatakan, “Kami akan mempertimbangkan satu format untuk pertemuan semacam itu.” Bakiyev yang digulingkan mengatakan dia siap mengundurkan diri jika keamanannya dijamin, sementara Rusia memperingatkan negara Asia Tengah yang strategis itu berada di pinggir perang saudara. Ini adalah pernyataan pertama kali Bakiyev menawarkan pengunduran dirinya sejak dia digulingkan dalam protes berdarah pekan lalu. Pernyataannya menyusul satu peringatan pihak penguasa sementara bahwa pasukan khusus akan menangkap dia jika dia tidak menyerah dan melakukan aksi unjuk rasa di pangkalannya di daerah selatan negara itu tempat ia melarikan diri setelah pemberontakan tiu.

Tetapi dengan masih belum ada tanda kompromi dan pemerintah sementara berusaha memperkuat kekuasaannya di ibukota Bishkek setelah protesprotes yang menewaskan 83 orang, negara yang menampung sebuah pangkalan militer Amerika Serikat itu tetap berada dalam bahaya. Jurang perang saudara “Saya kira Kyrgyzstan berada di pinggir perang saudara,” kata Presiden Rusia Dmitry Medvedev, Selasa di Washington. Bakiyev mengeluarkan pernyataannya dalam jumpa wartawan di desa kelahirannya Teyit, persis dekat kota Jalalabad di selatan, dengan 25 pengawal bersenjata berseragam militer yang membawa senapan-senapan Kalashnikov berada dibelakangnya. “Apa syarat saya untuk mengundurkan diri? Jika keamanan saya dan keluarga saya dijamin,” katanya, sementara menekankan ia masih presiden yang sah. “Dan kedua,” tambah Bakiyev” Larang orang-orang bera-

da di jalan-jalan dengan membawa senjata-senjata.” Pembantu Menlu AS Robert Blake menjadi pejabat AS berpangkat paling tinggi yang berkunjung ke Kyrgyzstan sejak demonstrasi hebat yang menjatuhkan Presiden Bakiyev pada 7 April. Kedubes AS menyatakan Blake tiba di bekas republik Soviet itu semalam dan beberapa pejabat Kyrgyzstan mengatakan dia akan bertemu dengan pemimpim sementara Roza Otunbayeva untuk pembicaraan malam hari ini. Masa depan pangkalan udara Manas yang disewa AS pasti akan berada di puncak agenda pembicaraan di ibukota Bishkek itu, tempat jalanan masih dikotori dengan puing setelah pemberontakan pekan lalu yang membuat83orangtewas.Bakiyev melarikan diri ke kubu pertahanannya di Jalalabad di Kyrgyzstan selatan setelah tentara menembak demonstran 7 April danmenolakuntukmeninggalkan negara yang berbukit-bukit itu atau mundur.(m07)

Obama Ingatkan Risiko Serangan Nuklir Teroris

The Associated Press

Sejumlah peti mayat yang melambangkan kematian sejumlah organisasi diarak oleh para demonstran ketika mereka berpawai menuju Istana Kepresidenan di Manila, Filipina, Rabu (14/4), dalam satu aksi protes anti-presiden di Filipina. Para demonstran mencatat pemerintah Presiden Gloria Macapagal Arroyo menduga telah melanggar HAM, yang paling akhir berlanjutnya penahanan atas 43 pekerjan kesehatan yang ditangkap atas dugaan menjadi anggota gerakan komunis terlarang.

WASHINGTON, DC (Antara): Presiden AS Barack Obama membuka rangkaian sidang KTT Pengamanan Nuklir yang diikuti 47 negara, termasuk Indonesia, yang mengingatkan dunia makin berisiko mengalami serangan nuklir teroris. Dalam pidato singkatnya saat membuka pertemuan formal yang berlangsung di Walter E.Washington Convention Center, Presiden Obama mengatakan Selasa (13/4) bahwa pada masa sekarang, risiko serangan nuklir tidak lagi berasal dari kalangan negara. “Dua puluh tahun setelah berakhirnya Perang Dingin, kita menghadapi ironi sejarah — risiko konfrontasi nuklir antar negara telah menurun, tapi risiko serangan nuklir (oleh teroris) meningkat,” kata Obama Selasa

pagi dalam KTT yang juga dihadiri olehWakil Presiden Boediono sebagai ketua delegasi Indonesia. Presiden AS mengajak para pemimpin dunia yang hadir dalam KTT untuk bekerja sama mengamankan bahan-bahan nuklir untuk jangan sampai jatuh ke tangan para teroris. “Saya sangat yakin bahwa berbagai masalah di abad 21 ini tidak bisa diselesaikan oleh satu negara saja. Harus diselesaikan oleh kita semua,” ujarnya. Dalam kesempatan itu, Obama juga mengumumkan bahwa KTT berikutnya tentang pengamanan nuklir di akan dilangsungkan di Korea Selatan tahun 2012. Rangkaian KTT Pengamanan Nuklir yang berlangsung dua hari diWashington akan ber-

akhir pada Selasa sore dengan dikeluarkannya sebuah kesepakatan menyangkut pengamanan bahan nuklir yang disebut sebagai Inisiatif Global untuk Memberantas Terorisme Nuklir. Sebelumnya KTT telah dimulai pada Senin (12/4) malam melalui acara jamuan makan malam bagi para delegasi —termasukWapres Boediono— dan pembicaraan informal yang dipimpin oleh Presiden Obama. Obama mengatakan dia ingin melihat adanya sebuah komitmen baru untuk mengamankan bahan-bahan nuklir dari tangan para teroris. AS makin dekat Wakil Presiden Boediono ketika berbicara kepada wartawan Senin sore, menyampaikan apresiasi menyangkut kebijakan AS yang antara lain ingin mem-

bebaskan dunia dari senjata nuklir. “Kita memberikan apresiasi karena posisi AS ternyata makin dekat dengan posisi kita yaitu menuju kepada dunia baru yang bebas dari senjata nuklir,” kata Boediono. “Di Asia Tenggara kita sudah lama menyatakan diri sebagai kawasan bebas senjata nuklir, jauh lebih dulu sebelum Amerika sekarang menyatakan ingin menciptakan dunia yang bebas senjata nuklir,” kata Boediono. Boediono saat menghadiri jamuan makan siang pada Senin oleh Wakil Presiden AS Joe Biden menyampaikan bahwa Indonesia menyambut baik semua upaya pencegahan jatuhnya bahan-bahan material nuklir ke tangan pihak yang tidak bertanggung jawab.

WASHINGTON, AS (Antara/AFP): China bersedia membicarakan ‘gagasan-gagasan baru’ mengenai Iran, kata seorang pejabat China, di tengah-tengah tekanan internasional yang meningkat untuk mengenakan sanksi-sanksi babak keempat PBB terhadap Teheran. Wakil Menteri Luar Negeri Cui Tiankai mengatakan Selasa (14/4) Beijing masih tetap mendukung dilanjutkan perundingan untuk menyelesaikan sengketa menyangkut program nuklir Iran yang kontroversial, tetapi mengatakan pihaknya terbuka bagi diselenggarakan diskusi-diskusi. “Kami menyatakan bahwa pihak-pihak terkait telah mengajukan beberapa gagasan tentang bagaimana menyelesaikan secara pantas masalah nuklir Iran itu dan mereka juga mengajukan unsur-unsur dari usulan mereka dengan Dewan Keamanan PBB,” kata Cui sementara satu KTT keamanan nuklir di Washington segera ditutup. “Kami siap melakukan perundingan mengenai gagasan-gagasan dengan pihak-pihak terkait.” China, mitra dagang penting Iran, tetap membuat dunia menerka apakah negara itu mendukung sanksi-sanksi baru menyangkut progranm nuklir yang disengketakan itu semantara negara-negara Barat mengharapkan Beijing meningkatkan tekanan terhadap republik Islam itu. Pada hari Senin, seorang pejabat penting Gedung Putih mengatakan Presiden AS Barack Obama dan sejawatnya dari China Hu Jintao dalam satu perundingan sepakat untuk mendorong sanksi-sanksi nuklir baru terhadap Iran, yang menurut Barat berusaha membuat senjata-senjata nuklir dengan kedok satu program energi sipil. Tetapi China, anggota Dewan Keamanan PBB yang memiliki hak veto memudarkan harapan bagi satu konsensus ketika negara itu mengatakan sanksi-sanksi bukan satu solusi. “Sebenarnya tidak ada perbedaan antara sikap China sekarang dan sikap yang telah selalu kami ungkapkan,” kata Cui yang berbicara melalui seorang penerjemah. Ditanya apakah China akan mencabut keengganannya untuk menandatangani sanksi-sanksi yang ketat, Obama tidak menyatakan apakah Beijing telah memberikan jaminan-jaminan kepadanya.”Apa yang saya ketahui adalah China mengirim wakilwakil ke perundingan-perundingan di NewYork, untuk memulai proses penyusunan resolusi sanksi-sanksi,” kata Obama kepada wartawan. “Amerika Serikat tidak bergerak sendiri dalam proses ini,” tambahnya dan menyatakan Rusia setuju mendukung usaha sanksi-sanksi Dewan Keamanan itu. Sebelumnya , di sela-sela KTT keamanan nuklir yang diikuti 47 negara, Kanselir Jerman Angela Merkel mengatakan ia mengharapkan China akan mendukung sanksi-sanksi baru PBB terhadap Iran.

Para Pemrotes Thai Tunda ‘Ofensif’ BANGKOK, Thailand (AP): Para demonstran anti-pemerintah mengatakan mereka akan melakukan konsolidasi kekuatan di jantung distrik komersial di Bangkok, ibukota Thailand, setelah menunda satu pawai Rabu (14/4) di satu kemp militer. Di kemp tersebut PM berlindung selama kampanye sebulan untuk menggulingkannya. Satu usaha yang gagal oleh pasukan keamanan untuk menghambat gerakan ribuan pemrotes dari perkemahan mereka di Bangkok akhir pekan lalu yang berakhir dengan bentrokan maut yang menyebabkan 21 orang tewas dan ratusan lainnya cedera. Bentrokan itu merupakan kekerasan politik terburuk di Thailand dalam waktu hampir dua dasawarsa. Nattawut Saikua, salah seorang pemimpin pemrotes, mengatakan bahwa sebelum Kamis para pemrotes Baju Merah akan bergerak keluar dari perkemahan bersejarahnya di Bangkok ke satu perkemahan kedua, yang telah mereka duduki sejak 3 April di daerah perbelanjaan dan lokasi hotel-hotel berbintang lima. “Kami akan lebih efisien ketika kegiatan berkelompok dan memiliki satu pusat ketika akan melakukan mobilisasi,” katanya. Daerah perbelanjaan itu sebagian besar masih ditutup dan hotel-hotel terlihat sejumlah besar tamunya tampak checkout, yang menyebabkan kerugian jutaan dolar. Para pengunjuk rasa akan meninggalkan kota lama, tempat kejadian aksi kekerasan sipil terburuk di negara itu selama 18 tahun terakhir pada akhir pekan lalu, dan berpindah ke kawasan perbelanjaan dan hotel, kata salah seorang pemimpin mereka. “Kami akan memiliki pasukan yang kuat dan besar,” kata pemimpin kelompok tersebut, Nattawut Saikuar. “Hal itu akan membuat kami makin bersatu dan itu mempermudah untuk bergerak dari satu tempat protes ke tempattempat yang kami targetkan. Hal itu akan lebih mudah bagi kami untuk memelihara keamanan.” Ribuan pengunjuk rasa yang berbaju atau berkaos merah, banyak di antara mereka yang datang dari masyarakat perdesaan miskin di Thailand, telah menguasai dua tempat di pusat Bangkok, dalam upaya mereka menggulingkan pemerintah, yang mereka tuduh bersikap elitis dan tidak demokratis. Unjuk rasa di kawasan komersil telah memblokir lalu lintas di sana dan menyebabkan toko-toko tutup, namun tidak ada aksi kekerasan di kawasan itu, yang kontras dengan pertumpahan darah di perempatan bersejarah di ibu kota negara itu. (m07)

Militer Filipina Kepung Abu Sayyaf Di Basilan ISABELA, Filipina (Antara/AFP): Ibukota pulau Filipina Selatan Rabu (14/4) di bawah pengawasan polisi dan militer, setelah pengepungan oleh gerilyawan yang punya hubungan dengan al Qaida yang menyebabkan 15 orang tewas. Sedikitnya dua kendaraan lapis baja militer berpatroli di jalan-jalan kota Isabela, di pulau Basilan, sehari setelah gerilyawan Islam dari kelompok Abu Sayyaf meledakkan bom dan menyerang penduduk sipil. Perintang jalan juga didirikan di dan sekitar kota miskin berpenduduk 150.000 jiwa itu, di mana beberapa toko masih tutup sehari setelah aksi kekerasan. “Kami berusaha untuk mengembalikan situasi menjadi normal, namun kami melaksanakan pengetatan keamanan sejak sekarang,” kata kepala militer wilayah, Letjen Ben Dolorfino kepada AFP melalui telefon dari markasnya, di kota Zamboanga, dekat Basilan. Sedikitntya 25 gerilyawan Abu Sayyaf menyamar dengan seragam polisi dan militer Selasa meledakkan dua bom, yang menghancurkan sebuah mobil dan merusak satu gereja Katholik Roma. Ini adalah serangan terburuk oleh kelompok itu dalam beberapa bulan terakhir. Bom ketiga Bom ketiga diletakkan di dekat rumah seorang hakim dan satu terminal bus, namun berhasil dijinakkan oleh tentara. Pemboman-pemboman itu memicu bentrokan bersenjata di sekitar kota, dan gerilyawan menargetkan pada penduduk sipil yang tak berdaya yang berlari menyelamatkan diri. Wali kota tersebut, Cherry Akbar, mengatakan, 15 orang tewas dalam aksi kekerasan itu, termasuk lima gerilyawan yang tampaknya tewas dalam ledakan pertama. Korban tewas juga termasuk tiga marinir, seorang polisi dan enam penduduk sipil. Dolorfino mengatakan, serangan tampaknya telah direncanakan dengan baik, dengan catatan bahwa mereka menggunakan seragam polisi dan militer.


WASPADA Kamis 15 April 2010


Barca-Inter Siap Memacu Adrenalin Anda Oleh Sofyan Harahap BANYAK penggila bola kecewa dengan tumbangnya Manchester United (MU) di perempatfinal Liga Champions 2010 setelah disingkirkan Bayern Munich secara dramatis. Mereka berharap ‘Setan Merah’ bertemu Barcelona (Barca) sebagai klimaks final Liga Champions tahun ini. Tapi, rasa kecewa itu kini sudah berangsur lenyap dengan mendekatnya partai Barca melawan Inter Milan di partai semifinal. Partai BarcaVs Inter tak pelak lagi menjadi partai yang ditunggutunggu penggemar sepakbola sejagat. Leg pertama akan digelar di kandang Inter, Giuseppe Meazza, Italia, 20 April. Sedangkan leg kedua digelar di Nou Camp, Spanyol, sepekan kemudian. Nah, anda sebagai pecandu si kulit bundar tentu punya perkiraan seputar ‘’big match’’ tersebut. Sebagai bahan referensi buat pembaca dapat dilihat dari sisi materi pemain dan tim jelas Barca unggul atas Inter. Mayoritas pelatih dan pemain bola ternama mengakuinya. Apalagi penampilan Barca sedang bagus-bagusnya. Mereka punya megabintang Lionel Messi yang menjadi ‘ruh’’ dan penentu kemenangan dalam pertandingan penting. Media di Spanyol memuji habis-habisan kualitas wakilnya, Barca, yang selalu tampil meyakinkan lewat permainan sepakbola indahnya. Kerjasama antarblok tidak pincang. Umpan-umpan matang dari lapangan tengah selalu membahayakan gawang lawan. Arsenal pun dilumat 4-1. Kekuatan seperti itulah yang membuat Barca mampu menghasilkan banyak trofi kemenangan musim lalu, termasuk sebagai juara bertahan Liga Champions 2009. Dengan menampilkan sepakbola menyerang yang anggun dari kaki ke kaki bagaikan ruang terukur, terlalu sayang bila akhirnya Barca harus tersingkir di semifinal. Mereka telah menjadi pusat perhatian. Tak ayal lagi Barca banjir pujian, tapi bila skuad

calon juara Liga Spanyol itu tidak hati-hati, apalagi sampai ‘’mabok’’ pujian, bukan tidak mungkin partai melawan Inter bakal menjadi catatan sejarah buruk; Barca tersungkur di tengah euphoria kejayaannya. Sungguh menyakitkan! Apalagi partai puncak (final) Liga Champions diselenggarakan di Spanyol, tepatnya Stadion Bernabeu bulan depan. Tak pelak lagi, partai Barca versus Inter mejadi tontonan paling menarik pekan ini. Sangat sayang bila dilewatkan begitu saja. Barca dengan penampilannya yang sangat memikat, atraktif, menjadi tolok ukur dan jaminan kepuasaan jutaan penonton dan pantas diunggulkan karena memang tak ada tim lain yang mampu bermain sebagus Barca saat ini pasca terjungkalnya MU. Barcelona adalah tim terbaik dalam satu dasawarsa terakhir ini, baik dalam performa tim maupun gaya permainannya, tulis ESPN Star. Bagaimana dengan peluang Inter Milan? Hasil imbang tentu sangat merugikan pasukan Mourinho karena saat di kandang Barca sangat kecil kemungkinan Eto’o dkk bisa menuntut balas. Oleh karena itu pula arsitek inter harus mampu menyiapkan tim yang solid dipadukan dengan strategi permainan yang tepat untuk bisa merusak pola permainan Xavi dkk nanti. Di mata pengagum Inter partai semifinal menjadi fokus, tak boleh lengah, apalagi ceroboh. Meskipun perjalanan Inter terlihat agak tersendat, kurang mulus. Posisi pole position Liga Italia malah sudah diambil alih AS Roma, namun fakta menunjukkan tim asuhan Jose Mourinho ini menjadi satu-satunya wakil Italia yang masih mampu bertahan dan optimis meraih juara. OSKA Moskow ditekuk dua kali. Pasti membanggakan publik Italiano. Wajar saja kalau pelatih AC Milan, Leonardo, terang-terangan berharap Inter bisa menang. Mourinho juga yang membawa Porto juara Liga Champions 2004. Dia melihat dari dua sisi mengapa Inter patut diunggulkan lawan tim setangguh Barca. Pertama, para pemain Inter sudah banyak mengalami kemajuan sejak babak penyisihan grup. Grafiknya cenderung

51 : 49 meskipun dalam catatan rekor keduanya, Inter hanya sekali menang berbanding 4 (kalah) dari lawannya. Barcelona diperkirakan turun dengan materi terbaiknya, kecuali Abidal dan Zlatan Ibrahimovic yang mengalami cedera: Valdes, Dani Alves, Marquez, Milito, Busquets, Xavi, Keita, Pedro, Bojan, Messi, Pinto, Iniesta, Henry, Maxwell, Toure Yaya, Fontas, Jeffren. Sedangkan Inter Milan: Inter: Julio Cesar; Maicon, Lucio, Samuel, Zanetti; Cambiasso, Sneijder, Stankovic, Eto’o, Milito, Balotelli, Pandev.***

LONDON (Waspada): Chelsea makin dekat untuk menjuarai Liga Premier, ketika gebrakan pada babak pertama Nicolas Anelka memenangkan The Blues 1-0 atas Bolton Wanderers.


Striker Chelsea Didier Drogba (kiri) menunjukkan bakat main voli ketika menjamu Zat Knight cs di London. dadanya bukan tangannya. “Bolanya datang ke dada saya,” tepis Terry kepada ESPN. “Saya tidak tahu apa yang terlihat di televisi, namun saya merasakan bola benar-benar bagian atas dada saya,” tambah mantan kapten Inggris itu. Trotters menurutnya, telah merepotkan The Blues sepanjang pertandingan. “Duel ini tentu saja tidak mudah dengan adanya Kevin Davies di lini depan mereka dan Jack Wilshere di lini belakang,” tutur Terry. “Bolton telah menimbulkan masalah bagi kami. Tapi saya pikir kami telah melakukan dengan benar dan melakukan apa yang perlu kami lakukan,” jelasnya lagi. (h01/sl/espn)

Eto’o Lempangkan Final Inter ROMA (Waspada): Gol semata wayang striker Samuel Eto’o melempangkan langkah Inter Milan ke final Piala Italia dengan menaklukkan Fiorentina 1-0. Kemenangan satu bola pada leg kedua di Stadion Artemio Franchi, Selasa (Rabu WIB) tersebut, membuat I Nerazzurri melaju dengan keunggulan agregat 3-1. Karena pada semifinal pertama skuad Jose Mourinho itu sudah menang 2-1 di San Siro, Fiorentina pun coba menekan Inter sejak awal laga. Namun justru lini belakang La Viola yang meninggalkan celah. Menit 21, bomber belia Mario Balotelli hampir saja membawa La Beneamata memimpin. Saat sudah berhadapan dengan kiper Sebastian Frey, tendangan Balotelli sayangnya masih melambung. Empat menit kemudian giliran La Viola yang mengancam ketika Alberto Gilardino melakukan tendangan akrobatik. Namun bola yang gagal dibendung Julio Cesar, mampu disapu bek Lucio sebelum masuk ke gawang tim tamu. Sesaat setelah turun minum, Balotelli kembali mendapatkan peluang emas dengan melakukan aksi individu menawan, tapi tendangannya masih dapat digagalkan Frey. Petaka bagi Fiorentina terjadi menit 57. Mendapat umpan jauh dari Thiago Motta, Eto’o yang lepas dari jebakan off-side dengan tenang memperdaya Frey. Inter pun lempang ke final dan berharap


Lionel Messi ruh Barcelona.

Gelar Dalam Jangkauan Biru

Trotters Protes Sukses Blues LONDON (Waspada): Manajer Bolton Owen Coyle memprotes sukses Chelsea mengatasi anak asuhnya 1-0 dalam laga Liga Premier di Stamford Bridge, Selasa (Rabu WIB). Menurut Coyle, The Trotters mestinya mendapat dua penalti di masing-masing babak, karena striker Chelsea Didier Drogba dan kapten John Terry menyentuh bola dengan tangan di kotak terlarang. “Kami tidak beruntung malam ini. Kami hanya butuh petugas pertandingan mengambil keputusan tepat,” ucap Coyle, sebagaimana dikutip dari Burdanaces, Rabu (14/4). “Ada dua penalti yang layak kami dapatkan karena handsball (Drogba dan Terry),” protes Coyle. Handsball pertama menurutnya terjadi menit 27 oleh Drogba. Coyle sampai meledek Drogba dengan mengatakan yang bersangkutan bisa menjadi pemain voli kelas dunia. Coyle mensinyalir, posisi berdiri para pengadil yang membuat insiden tersebut tidak mendapat ganjaran. “Kemudian terjadi (handsball) kedua, ketika John Terry mengatasinya (bola). Asisten wasit bilang bahwa bola hanya mengenai bahu, tapi itu jelas penalti,” sesal Coyle. “Mereka (wasit) tidak mengklaim sebuah penalti. Mereka telah membentengi hukuman penalti, saya tahu itu,” katanya menambahkan. Terry sendiri membantah telah melakukan handsball, dus mengaku bola hanya mengenai

meningkat. “Saya pikir ini akan menjadi pertandingan sangat menarik. Inter telah banyak berubah sejak babak penyisihan grup dan terus menunjukkan performa terbaiknya,’’ kata Leonardo. Sisi kedua, Inter punya arsitek di luar lapangan berkelas jenius dan istimewa. Siapa dia? Tentu saja Jose Mourinho yang selalu beruntung menghadapi klub-klub tangguh dunia. Peranan Mourinho sangat menentukan dan menjadi ‘credit point’ bagi Inter saat menghadapi superioritas Barca. Sehingga pertarungan Barca vs Inter ini disebut juga pertarungan antarpelatih untuk saling adu strategi selama 90 menit di lapangan. Di sini akan kelihatan siapa yang terbaik di belakang layar. Apakah Jose ‘’Special One’’ Mourinho, atau sebaliknya Josep Guardiola, sang pelatih Barca yang sangat mengerti memadukan kelebihan para pemainnya karena ia adalah produk asli, mantan gelandang, dan kapten Barcelona yang sukses beralih menjadi pelatih di usia muda. Bigmatch Barca versus Inter ini pun bakal menjadi tontonan paling seru dan siap memacu adrenalin anda. Sebagai tuan rumah wajar kalau Inter diunggulkan meraih kemenangan dengan syarat tampil all out tanpa celah. Artinya, tidak boleh memainkan negative football atau fokus bertahan yang menjadi kebiasaan tim Italia selama ini. Inter harus berani menyerang dan menyerang tanpa putus asa, karena pertahanan terbaik itu adalah dengan menerapkan offensive. Masih ada ‘PR’ buat Inter, yaitu mengantisipasi serangan lawan dari lapangan tengah lewat umpan-umpan terukur kepada Messi Cs. Jangan sampai kecolongan. Messi perlu ditempel dua pemain untuk memotong long passing dan wall passing sehingga tidak bebas di areal gawang Julio Cesar. Sekali saja kebobolan Inter akan kedodoran. Sama halnya jika inter tampil tegang. Pasti membahayakan pasukannya Mourinho. Partai semifinal ini sungguh menarik sehingga sangat ditunggu penggila bola di mana saja di planet bumi, menjadikan partai Barca – Inter sangat fenomenal dan bergengsi; bertemunya dua klub elite kelas dunia dengan materi pemain dan pelatih terbaik di event bergengsi semifinal Liga Champions. Kans Inter

Kemenangan dalam duel di Stamford Bridge, Selasa (Rabu WIB) itu, membuat tim asuhan Carlo Ancelotti mengoleksi 77 poin dengan sisa empat laga. Si Biru empat angka di atas Manchester United yang harapannya untuk mengangkat piala itu keempat kali kain memudar. Ancelotti bahkan yakin, gelar sudah berada dalam jangkauan pasukannya. London Blues pun tak akan menemui masalah jika hanya kalah sekali dalam empat laga terakhirnya. “Liga Premier kini ada di tangan kami, tapi kami harus tetap fokus serta tenang. Kami masih harus menjalani laga demi laga dan tidak memikirkan tim lain,” ucap Ancelotti dalam Sportinglife, Rabu (14/4). “Kami terbebani untuk menang, sebab kami harus meningkatkan posisi. Namun para pemain sekarang punya motivasi bagus untuk menutup musim dengan baik. “Kami berada dalam posisi yang lebih baik untuk juara, tanpa menghilangkan rasa hormat pada MU dan Arsenal. Tapi itu belum dipastikan, jadi kami masih akan berjuang keras da-


Nicolas Anelka (tengah) menyundul bola yang menjadi gol penentu kemenangan Chelsea atas Bolton di Stamford Bridge, London, Selasa (Rabu WIB). lam empat laga sisa,” tekad Ancelotti. Skuadnya kini enam poin mengungguli Arsenal yang punya satu pertandingan sisa berkat kontribusi Anelka. Ancelotti yang sedang mengincar gelar ganda liga dan Piala FA untuk pertama kali, menempatkan Anelka dan Didier Drogba di lini depan untuk pertama kali dalam lima partai. Penyerang Perancis itu menyerbu jantung pertahanan bekas timnya dua menit sebelum turun minum. Anelka melewati beberapa pemain bertahan la-

wan dan akhirnya mampu memaksimalkan sentuhan Drogba. The Trotters yang sudah lima kali dalam enam pertandingan tidak mencetak satu pun gol, terpaut lima poin dari zona degradasi dan masih belum keluar dari titik berbahaya tersebut. Blues menciptakan peluang bagus pada laga di sebelah barat London itu. John Terry cs nyaris memimpin menit 30, ketika kiper Bolton Jussi Jaaskelainen menghalau bola dari tendangan bebas Drogba ke arah Salomon Kalou, tetapi bola mele-

Maazou Beri Tiket Final Monaco AP

Bek Fiorentina Lorenzo De Silvestri (kanan) kalah dalam duel melawan bomber Inter Milan Samuel Eto’o di Artemio Franchi, Florence, Selasa (Rabu WIB).

jumpa AS Roma pada partai puncak. Roma yang sudah menang 2-0 pada leg pertama, baru akan melawat ke markas Udinese untuk menjalani semifinal kedua pada 21 April. “Sangat penting bagi Inter untuk bertemu Roma pada final Coppa Italia. Dengan demikian, kami dapat menunjukkan supremasi yang sebenarnya kepada mereka,” ujar Manajer Umum Inter Ernesto Paolillo dalam Football Italia, Rabu (14/4). Il Lupo kini menduduki puncak klasemen Liga Seri A dengan 68 poin, menggeser Inter ke posisi dua dengan 67 poin. “Kami ingin membuktikan kalau Inter tidak pernah menyerah,” papar Paolillo. (h01/vvn/fi)

Problem Catur Hitam melangkah, dua langkah pertamanya membuat lawannya dipastikan kalah.

Jawaban di halaman A2.


PARIS (Waspada): Pemain pengganti Moussa Maazou (foto) menggebrak pada perpanjangan waktu untuk memenangkan AS Monaco 1-0 atas Racing Lens, Selasa (RabuWIB). Berkat aksi Maazou tersebut, Monaco pun maju ke final Piala Perancis. “Kini kami mesti memenangi pertandingan final,” tekad pelatih Monaco Guy Lacombe. Striker asal Nigeria, Maazou, menggetarkan gawang lawan 10 menit jelang berakhirnya perpanjangan waktu, setelah Lens mendominasi permainan yang diadakan di Stade Louis II. “Kami mengalami masalah pada babak pertama, tapi kami



sebenarnya memiliki peluang mencetak gol. Terutama Nene yang memberi peluang bagi saya untuk melahirkan gol,” ungkap Maazou. Monaco selanjutnya bertemu pemenang semifinal lainnya antara tim amatir Quevilly de-


1. Evander _________, mantan juara tinju kelas berat, mengalahkan Frans Botha pada 11 April. 5. Salah satu kabupaten di Sumut 8. Salah satu nama Sekolah Sepak Bola, stadion bola PSMS. 9. Nama perempuan; ______ Manning, quarterback New York Giants 10. Cabang olahraga populer yang mana tim SMA Angkasa I menjuarai Liga LP3I 2010 11. Adu cepat dengan sepedamotor, mobil 13. Singkatan Sekolah Tinggi Olahraga 15. ________ Munich, berada di puncak liga sepakbola Bundesliga. 17. Singkatan Ikatan Sport Sepeda Indonesia 18. Kota klub Mavericks, Texas, klub bola basket NBA, AS. 19. Nama stadion sepakbola di Roma, mengingatkan Olimpiade. 22. Perasaan seorang atlet dalam menghadapi lawan yang dapat membuat kalah 24. ________ Rossi, juara dunia balap sepedamotor MotoGP 2009. 25. Cabang olahraga Waspada Cup 2010 yang kepengurusan organisasinya diketuai

bar dari tiang gawang. Bolton yang kalah 0-2 atas Chelsea pada laga liga dan Piala Liga musim ini, sebelumnya dipanasi manajer Manchester United Sir Alex Ferguson dengan istilah bakal mudah ditaklukkan Blues. Tapi faktanya Chelsea tidak menjalaninya dengan mudah. Bolton berjuang amat keras dan sangat bersemangat mengejar, tapi inspirasi diperlihatkan bek Biru asal RusiaYuri Zhirkov yang amat agresif. Zhirkov bahkan harus dibalut ketika kepalanya beradu dengan striker Bolton Kevin Davies.(h01/sl/ant/rtr/ap)

Klasemen Liga Premier Chelsea Man United Arsenal Man City Tottenham Liverpool Aston Villa Everton Birmingham Stoke City Blackburn Fulham Sunderland Wolves Bolton West Ham Wigan Burnley Hull City Portsmouth*

34 24 5 5 85-30 34 23 4 7 77-27 33 22 5 6 75-34 33 17 11 5 69-41 32 17 7 8 58-32 34 16 8 10 54-33 32 14 12 6 44-32 33 13 11 9 52-44 34 12 10 12 33-43 33 10 13 10 32-35 34 11 10 13 35-50 33 11 9 13 35-37 34 9 11 14 44-52 34 8 9 17 28-51 34 8 8 18 36-62 34 7 10 17 41-57 33 8 7 18 30-64 34 7 6 21 36-72 33 6 9 18 32-70 33 6 5 22 28-60

77 73 71 62 58 56 54 50 46 43 43 42 38 33 32 31 31 27 27 14

ngan Paris St Germain, 1 Mei mendatang pada final di Stade de France. Itu merupakan final Piala Perancis ketiga bagi Monaco di bawah asuhan Lacombe, yang tahun lalu gagal merebut gelar pasca dikalahkan Stade Rennes. “Saya tidak pernah berkesempatan membawa kemenangan tim dalam laga liga, tetapi kompetisi piala merupakan hal penting,” jelas Lacombe, seperti dilansir Reuters, Rabu (14/4). Lens bermain agresif di lapangan tengah, tapi tidak mampu menyelesaikan dengan baik dua peluang emas yang tercipta, ketika Kanga Akale berada di dekat gawang tuan rumah pada babak pertama. (h01/ant/rtr) Parlindungan Purba. 26. Seri


1. Asisten wasit di lapangan bola, dikenal dengan sebutan _______ garis. 2. Singkatan Liga Basket Pelajar, finalnya di Medan 26-29 April. 3. Penggemar berat dari suatu tim, pemain (jamak) sampai membentuk klub 4. Garis 5. Permainan olahraga populer tempo dulu, mirip baseball. 6. Pemain sepakbola asal Brasil, kartunnya ada di halaman Sport. 7. Kabupaten menjuarai voli Porwildasu Wilayah II di Tebingtinggi, 8-10 April. 12. Pekan olahraga wilayah daerah Sumut 14. Negara tetangga, asal petinju Daud ‘Cino’ Jordan, kalah merebut gelar juara WBF 15. Cabang olahraga dijuarai Ivana Hie dalam master open Waspada Cup 2010. 16. Ya (Inggris), biasa disebut orang ketika atlet/tim yang didukungnya berhasil menang 20. Negara padat penduduk, penyelenggara balap mobil Grand Prix pada 18 April 2010. 21. Berbentuk bulat 23. International Olympic Commit tee

Sudoku Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di kotak 3x3 bergaris tebal. Tidak ada keterlibatan matematika, hanya perlu pertimbangan dan logika. Jawaban di halaman A2 kolom 1.

1 7 5 3 8 6 6 5 7 4 9 9 6 2 1 7 6 9 5 7 8 4 5 3 2 8 5 7 6 9 2



WASPADA Kamis 15 April 2010

Respon Positif PSMS Menuju Liga Super PUBLIK sepakbola Medan kini bisa sedikit menarik nafas lega. Pasalnya, hasrat untuk melihat PSMS Medan kembali berlaga di Indonesia Super Liga (ISL) mendapat respon positif dari manajemen tim berjuluk Ayam Kinantan itu. Tidak tanggung-tanggung, manajemen pun bakal menggelontorkan dana dalam jumlah yang melebihi alokasi musim lalu. Tidak saja untuk pembentukan tim dan perekrutan pemain, tapi juga buat pembenahan Stadion Teladan, home base PSMS yang selama ini dikenal angker bagi tim tamu. “Harus diakui, pembenahan fasilitas olahraga Medan dan StadionTeladan selama ini selalu terbentur kepada persoalan dana yang memang tidak dianggarkan. Namun ke depan, hal itu akan bisa kita atasi. “Secara pelan-pelan, kita juga sudah melakukan pembenahan. Jadi, kita tidak lagi membutuhkan dana besar untuk pembenahan menyeluruh,” jelas Ketua Umum PSMS Medan, Drs HT Dzulmi Eldin.

Eldin menyatakan demikian menjawab pertanyaan Redaktur Olahraga Waspada Jonny Ramadhan Silalahi SH saat tampil dalam acara Bedah Visi dan Misi CalonWalikota Medan periode 2010-2015 di Aula Gedung Bumi Warta Waspada, Rabu (14/4). Menurut Eldin, Teladan sebenarnya sudah memenuhi syarat Liga Super. Sebab, beberapa manual pembenahan yang diberikan oleh Badan Liga Indonesia (BLI) telah dipenuhi, di antaranya pembenahan lampu, tribun penonton, kamar ganti dan ruang pers. Namun CalonWakilWalikota Medan berpasangan dengan Rahudman Harahap itu mengakui, masih ada beberapa sisi lainnya yang perlu pembenahan lagi, yaitu tingkat kekerasan tanah di lapangan, penataan sentelban dan kamar mandi penonton. “Itu akan kita benahi dalam waktu dekat. Kemudian, saya akan mengajak pengurus BLI untuk meninjaunya dan mengkonsultasikan lebih jauh apabila

masih ada kekurangan. Intinya, saya tak ingin melihat PSMS gagal berlaga di Liga Super hanya karena persoalan stadion yang tidak memadai,” tekadnya. Ditambahkan, materi pemain pun akan lebih diperkuat dengan merekrut beberapa pemain asal Sumatera Utara yang sempat berkelana ke beberapa klub lain serta mempertahankan beberapa pemain PSMS musim lalu yang dianggap masih potensial dan prospektif. Dengan demikian, materi pemain PSMS musim depan akan diisi oleh perpaduan pemain asal Sumut yang berpengalaman dan beberapa pemain muda. Perpaduan skill, ketenangan bermain dan fighting spirit ala anak Medan bakal mewarnai penampilan PSMS di Divisi Utama musim depan untuk melangkah ke Liga Super musim berikutnya. Untuk memenuhi pola main tersebut, manajemen pun sudah mengambil ancangancang merekrut pemain asing, sasarannya dari Asia saja. Ala-

sannya, pemain asal Asia dianggap tidak neko-neko dan bisa memperagakan permainan yang gigih di tengah lapangan. “Hampir bisa dipastikan, kita akan memakai pemain asing dari Asia saja. Soal nama itu kita serahkan sepenuhnya kepada pelatih yang nantinya akan berkoordinasi dengan manajemen,” jelas putra Melayu kelahiran Medan, 4 Juli 1960 ini. Tergerak Demo PSIS Menyikapi kegagalan mengangkat PSMS ke Liga Super musim ini, Eldin mengaku itu dipengaruhi berbagai faktor. Awalnya, dia malah tidak menyangka akan mengemban jabatan sebagai Ketua Umum, mengingat jabatan tersebut biasanya diembanWalikota Medan. Saat itu, Eldin merupakan Sekretaris Daerah (Sekda) Kota Medan, sedangkan Walikota dijabat Afifuddin Lubis. “Pak Afif kemudian menyuruh saya untuk mengemban jabatan tersebut. Saya sempat menolak karena itu memang jabatan yang biasa diemban Walikota.

Pak Afif juga terus menolak dengan alasan dirinya sudah mendekati masa pensiun,” kenang Eldin. Tolak-menolak berlangsung cukup lama bahkan ada opsi bubarkan saja, mengingat masa persiapan PSMS untuk menghadapi Divisi Utama semakin dekat. Manajemen PSMS setelah ditinggalkan Sihar Sitorus saat itu seperti tanpa pemilik. “Lalu hati saya tiba-tiba tergerak melihat tayangan di televisi ketika suporter PSIS menggelar aksi demo ke kantor Walikota Semarang. Waktu itu mereka mendesak Walikota Semarang mundur saja jika tak mampu mengurus PSIS,” paparnya. Pihaknya tak ingin kejadian seperti itu menular ke Medan. Alhasil, dengan situasi terjepit akibat minimnya anggaran dan waktu persiapan yang singkat, Eldin pun memberanikan diri mengambil ‘tongkat panas’ memimpin kendali kepengurusan PSMS. Manajemen langsung mengangkat pelatih dan menyerahkan sepenuhnya kewenangan pemilihan pemain

Bulls Jaga Peluang CHICAGO, AS (Waspada): Chicago Bulls mendekati tiket babak playoff NBA musim ini. Peluang tercipta setelah Derrick Rose cs membekap Boston Celtics 101-93 dalam lanjutan kompetisi NBA, Rabu (14/4). Rose dan Kirk Hinrich menjadi bintang bagi Bulls dalam pertandingan ini. Rose mencatat angka tertinggi dalam karirnya dengan mengemas 39 poin, sedangkan Hinrich menambah 30 angka. Dengan hasil ini, Bulls mengungguli rekor Toronto Raptors dan menempati posisi delapan klasemen Wilayah Timur. Tiket playoff bisa diraih bila Bulls berhasil menumbangkan Charlotte Bobcats atau berharap Raptors kalah dari New York Knicks. Sementara itu, kekalahan ini membuat Boston Celtics harus melupakan posisi ketiga. Pasalnya, Kevin Garnett cs me-


Forward Boston Celtics Paul Pierce (kiri) berusaha menahan usaha andalan Chicago Bulls Luol Deng merebut bola dalam laga NBA di Chicago, Rabu (14/4). nelan enam kekalahan beruntun dalam sembilan laga terakhir. Paul Pierce memimpin Cel-

tics dengan 28 poin, Ray Allen mengumpulkan 25 poin. Kevin Garnett yang pada laga sebe-

10 Hari Batas Benitez ROMA (Waspada): Juventus membuktikan keseriusannya merekrut manajer Liverpool Rafael Benítez (foto), sehingga memberi deadline (batas waktu) kepada pelatih asal Spanyol itu untuk mengambil keputusan. Waktu yang diberikan I Bianconeri pada Benitez hanya 10 hari untuk menyatakan kesediaannya menggantikan posisi Alberto Zaccheroni di Stadion Olimpico, Turin. Manajer Liverpool itu masih menjadi pilihan utama Si Nyonya Tua yang belum menemukan figur cocok seusai pemecatan Ciro Ferrara. Benitez sebenarnya sudah hampir dibajak Juve pada Januari 2010, tapi yang bersangkutan tak mau memutus kontrak pada pertengahan musim. Menurut Daily Mail, Rabu (14/4), The Old Lady kini mengiming-imingi Benitez limpahan dana segar di bursa transfer musim panas serta pemba-

ngunan stadion baru berkapasitas 41.000 penonton. Media Italia ramai melansir bahwa agen Benítez, Manuel Garcia Quilon, segera bertemu Presiden Juventus Jean-Claude Blanc di Milan pekan ini. Mereka akan mendiskusikan kompensasi yang harus dibayar jika Benitez meninggalkan Anfield. Namun Quilon mengaku belum melakukan pembicaraan sekaligus membantah telah menemui petinggi Bianconerri. “Saya belum pernah bertemu pihak Juventus. Saya sebelumnya berada di Madrid,” dalihnya dalam TribalFootball. Quilon bahkan mengklaim, kontrak Benitez bersama The Reds berdurasi 4 tahun. “Saya kembali menegaskan kontrak Rafa bersama Liverpool 4 tahun. Namun saya tidak bisa memastikan apa yang akan terjadi beberapa bulan mendatang,” jelasnya. Penjelasan Quilon seperti-

Adjie Manajer Timnas U-23


nya tak akan mengubah pandangan media Italia, yang tetap percaya manajemen Juve sedang bekerja keras untuk memikat Benitez di awal musim depan. (h01/dm/tf)

Penurunan Lanjutan Sevilla


MADRID (Waspada): Sevilla kalah mengejutkan 1-2 di kandang tim yang sedang tertatih-tatih RealValladolid dalam laga La Liga Primera, Selasa (Rabu WIB). Ini merupakan penurunan lanjutan dari anak-anak Sevilla, sehingga mempengaruhi harapan mereka untuk maju ke Liga Champions musim mendatang. Diego Costa dan Manucho (foto) mencetak gol pada masing-masing babak, setelah serangan balasan lawan membuahkan hasil yang membe-

rikan semangat besar bagi tuan rumah. Tujuh menit sebelum laga usai, tendangan panjang yang dilancarkan Juan Cala mempertipis kekalahan Sevilla. Semangat tamu pun kembali menyala, tapi kiperValladolid Jacobo mampu menampik tendangan Jesus Navas dan Luis Fabiano pada momen mendebarkan di mulut gawangnya. Sevilla tetap berada di urutan keempat dengan simpanan 51 poin sebagai batas bawah jatah La Liga ke Liga Champions, tetapi posisinya rawan digeser tim urutan kelima Real Mallorca dan Athletic Bilbao. Valladolid memanggil mantan pelatih Spanyol Javier Clemente sebagai arsitek ketiganya musim ini dalam usaha keluar dari zona berbahaya. Setelah mengalami hasil imbang minggu lalu, kini mereka mampu memenangi pertandingan. Tim asuhan Celemente itu tetap berada di urutan 19, setelah tim urutan 18 Tenerife juga meraih kemenangan tandang pertamanya dengan skor 2-0 di Sporting Gijon.

lumnya diistirahatkan, menambah 14 poin dan sembilan rebound.

Sebelumnya, dikabarkan Wakil Presiden Chicago Bulls John Paxson geram dengan ulah pelatihnya, Vinny Del Negro. Malah keduanya terlibat perkelahian usai salah satu laga Bulls. Setelah takuk dari Phoenix Suns pada 30 Maret silam, Paxson mendatangi kantor Del Negro dan berkelahi dengannya. Menurut sumber yang didapat Yahoo Sports, Paxson lebih dulu mencengkeram dasi Del Negro dan melancarkan pukulan ke perutnya. Paxson kemudian dengan marah menantang Del Negro berkelahi. Saat kejadian tersebut, asisten pelatih Bernie Bickerstaff yang ada di lokasi langsung turun tangan dengan memisahkan keduanya. Masih menurut sumber, Del Negro tak melawan karena takut kontraknya diputus tanpa kompensasi dan mencoreng namanya plus menutup kesempatan berkarir di tempat lain. Hasil lainnya, , Phoenix Suns melumat Denver Nuggets 123101, Utah Jazz mengalahkan Golden State Warriors 103-94 dan LA Lakers mengungguli Sacramento Kings 106-100. (m33/ap)

Hasil Selasa (Rabu WIB) Getafe vs Villarreal Valladolid vs Sevilla S Gijon vs Tenerife

3-0 2-1 0-2

Klasemen Liga Primera Barcelona Real Madrid Valencia Sevilla Mallorca Ath Bilbao Getafe Villarreal Deportivo Atl Madrid Osasuna S Gijon Almeria Espanyol Santander Zaragoza Malaga Tenerife Valladolid Xerez

31 25 5 1 31 25 2 4 31 16 8 7 32 15 6 11 31 15 6 10 31 14 6 11 32 14 5 13 32 13 7 12 31 12 7 12 31 11 7 13 31 10 7 14 32 9 10 13 31 9 10 12 31 9 10 12 31 7 11 13 31 8 8 15 31 7 10 14 32 7 8 17 32 5 13 14 31 5 8 18

77-19 83-28 50-35 46-38 49-36 45-42 46-40 46-44 33-39 47-48 28-35 33-41 33-43 25-37 31-45 37-55 35-40 31-61 32-54 26-53

80 77 56 51 51 48 47 46 43 40 37 37 37 37 32 32 31 29 28 23

Alejandro Alfaro dan Roman Martinez melahirkan gol pada menit akhir di Molinon, sehinggaTenerife kini minus dua angka dari tim urutan 17 Malaga. (h01/ant/rtr/ap)

JAKARTA (Waspada): Adjie Massaid, anggota DPR dari Partai Demokrat yang juga berprofesi sebagai aktor, ditunjuk menjadi Manajer Timnas Indonesia U-23 yang dipersiapkan ke SEA Games 2011. Penunjukan didasari kompetensinya sebagai seorang manajer dan wawasannya tentang sepakbola. Sedangkan Manajer Timnas Senior tetap dipercayakan kepada Andi Darussalam Tabusalla yang tak lain adalah Presiden Direktur PT Liga Indonesia, asisten manajer kedua timnas dijabat Iwan Budianto, anggota Eksekutif Komite PSSI. Demikian Sekjen PSSI Nugraha Besoes kepada wartawan di Sekertariat PSSI, Senayan, Jakarta, Rabu (14/4). Nugraha juga mengungkapkan bahwa konglomerat Nirwan Dermawan Bakrie dipercaya sebagai Chef de Mission tim U-23 maupun tim senior. “Ini sudah diputuskan olah ketua umum. Sangat diharapkan, semua yang sudah ditunjuk tersebut bisa menjalankan tugasnya dengan baik. Maklum saja karena ke depan, banyak event besar yang akan dilakoni,” kata Nugraha. Kompetensi Ajie Massaid di dunia sepakbola, tambah Nugraha, memang tidak perlu dipertanyakan lagi. Maklum saja karena suami Angelina Sondakh itu hanya aktif di dunia futsal, antara lain memiliki tim futsal AMFC (Adjie Massaid Futsal Club). Sayangnya, penunjukan manajer kedua timnas Merah Putih tersebut tidak dibarengi dengan penunjukan pelatih kepalanya. Pelatih asal Austria, Alfred Riedl, sebelumnya disebut-sebut akan membesut timnas U-23, hingga kini belum sepakat. (yuslan)

Waspada/Hang Tuah J Said

Wapemred III Harian Waspada H Sofyan Harahap SSos memberikan cinderamata kepada Drs HT Dzulmi Eldin (kanan) disaksikan H Syaf Lubis (2 kanan) dan Ketua PWI Sumut Drs M Syahrir (2 kiri) di Aula Gedung Bumi Warta Waspada, Rabu (14/4). kepada pelatih. “Tapi apa boleh buat, upaya tersebut ternyata tidak cukup. Maka ke depan, sinkronisasi antara manajemen dan pelatih tetap harus terbangun. Itulah yang luput dari perhatian di awal-awal saya menjadi Ketua

Umum PSMS, sehingga tim ini sempat terseok-seok,” beber Eldin. Belajar dari kasus itu, musim depan Eldin menjanjikan akan lebih fokus mensinkronisasi antara manajemen dan pelatih. Keutuhan tim mesti

menjadi perhatian utama. “Jika itu sudah bisa kita lakukan, maka ambisi kita untuk melihat PSMS berlaga di Liga Super, Insya Allah akan bisa kita penuhi,” optimismenya. *Rahmad Nur Lubis

McLaren Tunda Pengerjaan Suspensi SHANGHAI, China (Waspada): McLaren menghentikan pekerjaan tentang sistem baru suspensi setelah badan otomotif Formula Satu (FIA) memperingatkan semua tim akan pengubahan berat kendaraan dari babak kualifikasi sampai balapan tidak sah. “Kami harus mengganti beberapa hal, pada dasarnya tentang sistem suspensi. Kami menunda pengerjaan itu,” kata Direktur Teknik Paddy Lowe kepada wartawan, Rabu (14/4). Ia mengatakan, mobil tipe MP4-25 yang digunakan juara dunia Jenson Button dan Lewis Hamilton pada perlombaan GP China akhir pekan nanti akan mengalami pengubaran aerodinamik, tetapi tidak ada pengubahan pada bagian lain. McLaren sementara berada di urutan kedua klasemen atau terpaut 10 poin dari Ferrari. FIA menulis surat kepada semua tim untuk menjelaskan peraturan menyangkut sistem suspensi kendaraan. Bos McLaren Martin Whitmarsh menyatakan ingin sistem baru pada kendaraan mereka pada perlombaan di Shanghai, setelah mempelajari beberapa kendaraan


Anggota staf McLaren ngobrol santai di garasi tim tersebut, Rabu (14/4), menjelang pagelaran GP China di Sirkuit Shanghai, akhir pekan ini. termasuk Red Bull, melaju lebih rendah di babak kualifikasi. Red Bull, juara satu-dua di GP Malaysia GP pada 4 April silam, menerima klarifikasi dari FIA itu dan mengatakan akan menggunakan kendaraan yang sama di Shanghai . (m33/auto)

Waspada/Armansyah Th

H Ajib Shah (4 kiri) pose bersama Ketua Harian dan Sekum KONI Sumut John Lubis (4 kanan) dan Chairul Azmi (2 kiri) serta Ketua Umum KONI Medan Zulhifzi Lubis (3 kanan).

Bangun OR Harus Rangkul Semua Elemen MEDAN (Waspada): Calon Walikota Medan periode 2010-2012 H Ajib Shah mengatakan, membangun kembali olahraga Kota Medan harus merangkul semua elemen. “Dengan merangkul semua elemen, mudahmudahan olahraga kita bisa bangkit,” jelasnya pada acara Dialog Terbuka Olahraga dengan tema “Medan Menuju Kota Atlet Bersama H Ajib Shah” di Garuda Plaza Hotel, Medan, Rabu (14/4). Elemen dimaksud, menurutnya, antara lain Pemko, pengurus cabang olahraga, masyarakat olahraga, pengusaha dan lainnya. Dialog olahraga yang digelar Masyarakat Peduli Olahraga (MPO) itu juga menghadirkan narasumber Dekan FIK Unimed Drs Basyaruddin Daulay MPd, dihadiri berbagai elemen dan masyarakat olahraga. Di antaranya Ketua Harian KONI Sumut John Lubis, Sekretaris KONI Sumut Drs Chairul Azmi MPd, Ketua KONI Medan Drs H Zulhifzi Lubis, beberapa Ketua Pengcab dan Pengprov Olahraga. Juga para Koordinator KONI Kecamatan serta anggota DPRD Sumut Brilian Moktar SE dan Isfan F Fachruddin, praktisi Rafriandi Nasution, atlet dan pelatih, mantan atlet serta klub-klub olahraga. “Di Medan ada banyak perusahaan. Jadi

jangan hanya bersandar kepada APBD semata,” harap Ajib seraya menambahkan dengan begitu peran Pemko nantinya diharapkan hanya sebagai motivator. Ditambahkan, dulu Medan dikenal punya atlet-atlet hebat seperti Mardi Lestari dari cabang atletik serta Sutiyono dari balap sepeda yang juga hadir. “Tetapi bagaimana sekarang dengan cabang tinju, renang, polo air dan juga PSMS? PSMS misalnya, kenapa tidak diberikan kepada mitra. Berikan kepada yang ahli, tetapi tetaplah dengan azas sportivitas,” saran Ajib Shah. Mantan Ketua PP Sumut itu terlihat lugas dalam memaparkan visi dan misi olahraganya di hadapan sekitar 500 undangan, begitu juga dalam menjawab pertanyaan yang diajukan. Sedangkan Basyaruddin Daulay dalam paparannya mengungkapkan, betapa masih minimnya jumlah atlet Kota Medan dibanding jumlah penduduk yang ada. “Dengan penduduk sekitar 2,8 juta jiwa, Medan hanya memiliki 1.723 atlet, dan 291 pelatih. Angka ini tidak sampai 0,01 persen dari jumlah penduduk. Sementara sarana lapangan atau lintasan yang tercatat, juga hanya belasan saja,” beber Basyaruddin. (h09)

25 April, Mennegpora Jalan Sehat Bersama Masyarakat Sumut MEDAN (Waspada): Dalam rangka memotivasi masyarakat untuk sehat, Menteri Negara Pemuda dan Olahraga Andi Malarangeng (foto) mengundang seluruh masyarakat Sumut untuk mengikuti jalan sehat bersama Mennegpora di Lapangan Benteng Medan, Minggu (25/4). Demikian Ketua Panitia Drs S Naibaho didampingi Wakil Ketua Togar Manurung SH serta unsur penasehat Guntur Manurung SE dan Jeremia S Tobing, SE di Hotel Polonia Medan, Rabu (14/4).

Naibaho menjelaskan, rencananya gerak jalan itu akan diikuti sekitar 8000 peserta. Kegiatan dimulai pkl 06:00 dengan rute Lapangan Benteng, Jalan Imam Bonjol, Jalan Sudirman, Jalan Diponegoro dan finish di Lapangan Benteng kembali. Bagi berminat mengikuti jalan santai itu, menurutnya, dapat mendaftarkan diri secara gratis di Kantor Gerakan Indonesia Bersatu Jl Gagak Hitam No.18 Medan. “Untuk memeriahkan acara, kami menyediakan lucky draw dengan hadiah utama sepeda motor dan

ratusan hadiah lainnya,” jelasnya. Ditambahkan Naibaho, pelaksanaan jalan sehat itu murni kegiatan olahraga dan hanya ingin mengenalkan Andi Malaranggeng secara lebih dekat kepada masyarakat Sumut. Karena itu dia melarang peserta untuk membawa bendera ataupun simbol-simbol partai, apalagi atribut pasangan calon Walikota/Wakil Walikota Medan. Dia juga menegaskan, tidak akan ada pidato politik dalam acara tersebut. Acara hanya

akan diisi dengan pidato pembukaan dari Mennegpora yang isinya memotivasi masyarakat untuk jalan sehat. “Perlu kami tegaskan ini tidak ada kaitannya dengan politik praktis, karena Medan akan melaksanakan Pilkada dalam waktu dekat,” tutur Naibaho. Guntur Manurung menambahkan, tujuan kegiatan murni mensukseskan program pemerintah bidang olahraga. “Apalagi sudah beberapa tahun terakhir, acara gerak jalan sudah jarang dilaksanakan di Medan,” papar anggota DPRD Sumut itu. (h11)

Sport A7 Putra Melaju, Maria Menyerah

WASPADA Kamis 15 April 2010

JAKARTA (Waspada): Tunggal putra Indonesia meraih kemenangan awal pada Kejuaraan Asia di New Delhi, India, Rabu (14/4).

Waspada/Dedi Riono

Pebiliar POBSI Sumut M Fadly (tengah) diabadikan bersama Ketua Umum POBSI Sumut (kiri) dan pelatih Fadil saat akan bertolak ke Malaysia mengikuti World Pool Master Nine Ball, Rabu (14/4).

POBSI Sumut Kirim Fadly

Unggulan pertama Taufik Hidayat menang mudah atas Indra Mehata 21-6, 21-9 pada babak pertama. Kemenangan atas pemain Vietnam Le Ha Anh 21-10, 21-16 membawa unggulan pertama itu melaju ke babak 16 besar. Keberhasilan Taufik diikuti Tommy Sugiarto yang menundukkan Kim Sa Rang asal Korea 21-12, 21-15 untuk membukukan pertemuan dengan Kashyap Parupalli. Pemain asal PB DJarum Ku-

dus Andre Kurniawan harus bermain satu jam 10 menit saat mengatasi pemain Taiwan Hsu Jen Hao dan memenangi pertandingan 21-18, 26-28, 21-10. Andre kemudian mengalahkan tunggal putra lapis kedua Pelatnas Nugroho Andi Saputro 21-18, 21-18. Nugroho sebelumnya membukukan kemenangan 21-15, 21-15 atas pemain tuan rumah Nandagopal K. Pada babak 16 besar, Andre asal PB Djarum Kudus, bertemu unggulan kelima asal

World Pool Master Nine Ball MEDAN (Waspada): Pengprov Persatuan Olahraga Biliar Seluruh Indonesia (POBSI) Sumut mengirim atlet terbaiknya, M Fadly, mengikuti kejuaraan dunia zona Asia di Kuala Lumpur pada 14-16 April mendatang. Kejuaraan bertajuk World Pool Master Nine Ball itu bakal diikuti juara-juara biliar tingkat Asia guna memperebutkan empat tiket menuju babak grand final di Las Vegas, Amerika Serikat. “Pengiriman Fadly merupakan upaya POBSI Sumut dalam meningkatkan jam tanding atlet. Kita menyadari untuk menjadi atlet handal, atlet harus

memiliki jam tanding yang cukup baik di tingkat nasional maupun internasional,” ujar Ketua Umum POBSI Sumut Salomo Pardede saat melepas Fadly menuju Malaysia, Rabu (14/4). Dikatakan, dipilihnya Fadly karena atlet yang bersangkutan merupakan penyumbang medali perunggu di PON 2008 Kaltim dan atlet prioritas Program Pembinaan Intensif (PPI) KONI Sumut. “Kita berharap Fadly mampu memperbaiki prestasinya di PON 2012 dengan meraih medali emas. Selain Fadly, POBSI Sumut juga memiliki lima atlet PPI yakni Jaka Kurniawan, Budi Tambunan, Rudi Alfian, Mar-

lando dan Stanza secara bergantian mengikuti berbagai event tingkat nasional,” jelas Salomo. Didampingi pelatih Fadil Nasution, Salomo mengaku tidak membebani target mulukmuluk kepada Fadly. Begitu pun, dirinya tetap berharap Fadly dapat membuat kejutan dengan meraih prestasi membanggakan. Fadly sendiri mengaku sangat beruntung dipercaya mewakili POBSI Sumut. “Saya akan berjuang maksimal untuk meraih prestasi membanggakan di kejuaraan itu, meski sadar persaingannya sangat ketat,” ucap Fadly. (m42)


Para juara diabadikan bersama Wakasek SMAN 3 Medan Drs Emiruddin Harahap MM (2 kiri).

Munculnya ‘Taufik Hidayat Cs’ Di SMANTig MATAHARI yang menjulang tinggi di atas kepala jelas membuat kita gerah. Namun tak sedikit pun menyurutkan semangatdanantusiaspesertayang bertanding dalam Turnamen “SMANTig Badminton Cup” di lapangan badminton sekolah tersebut pada 8-10 April lalu. Terpancar semangat dari wajah para peserta selama mengikuti pertandingan tersebut, khususnya pada laga SMAN 3A kontra SMK Sandy Putra B dan SMAN 3C melawan SMK Sandy Putra A di semifinal. Spontan timbul suasana menegangkan akibat aksi dan laga peserta layaknya ketika Taufik Hidayat cs sedang bertanding. Menurut Wakasek Bidang Kesiswaan Drs Emiruddin Harahap MM kepada Waspada di

ruang kerjanya baru-baru ini, kegiatan tersebut diadakan di SMAN 3 untuk kedua kali dan merupakan program bidang kesiswaan SMAN 3. “Kegiatan ini ditujukan untuk mengembangkan keolahragaan dalam rangka kesehatan jasmani seperti makna ‘men sana in corpore sano’ yang berarti di dalam tubuh yang sehat terdapat jiwa yang kuat, khususnya di kalangan pelajar SMA,” ujar Emir selaku penanggungjawab kegiatan. Emir berharap dari kegiatan sekolahnya tersebut, ajang kejuaraan bulutangkis itu akan memunculkan bibit-bibit baru yang berpotensial, hingga mengharumkan nama bulutangkis di kota Medan dan tanah air pada umumnya.

Di SMANTig Badminton Cup, digunakan sistem beregu dengan mempertandingkan dua tunggal (putra-putri) dan satu ganda putra. Peserta terdiri dari 15 tim dari SMAN 1, SMAN 3, SMAN 7, SMAN 9, MAN 1, SMK Sandy Putra, SMA Kartika I dan SMA Harapan I. Setelah berjuang selama tiga hari, SMAN 3 A akhirnya menjadi juara di kandang sendiri. Juara kedua pun masih ditempati tuan rumah, yakni SMAN 3 C yang mengungguli SMK Sandy Putra B (juara III) dan SMK Sandy Putra A (juara IV). Wow, ternyata polesan pelatih Erwin Effendi Polen SH memang terbukti mantap hingga SMAN 3 mendominasi untuk kedua kali pula. Selamat!!! *Hajrul Azhari Ritonga

Dispora Sergai Senam Sehat Bersama Askes MEDAN ( Waspada): PT Askes (Persero) Regional I bersama Dispora Serdang Bedagai dan Camat Perbaungan melaksanakan senam sehat bersama Askes baru-baru ini di lapangan Simpang Tiga Perbaungan, Sergai. Turut hadir Sekda Sergai Drs H Haris Fadillah MSi, Kadispora Drs Joni Walker Manik, Sekwan Suprin MM, Camat Perbaungan Aziz Siregar MS, Pimpinan Askes Kantor Cabang Medan Dr Andi Afdal didampingi Kasie Hubungan Pelanggan Thomas Harmonangan, unsur Muspida dan masyarakat Sergai. Demikian Pimpinan Askes Kantor Cabang Medan Dr Andi Afdal diwakili Organizer Nevada Enterprise Mr David di Medan, Rabu (14/4). Menurut David, senam sehat bersama Askes itu diikuti 2.000 peserta dengan tujuan menyahuti program pemerintah Indonesia Sehat 2010 yang saat ini dipercayakan kepada pihaknya. Hal itu, kata David, juga menyahuti visi misi dari Gubsu agar masyarakat tidak sakit sekaligus menanamkan kepada masyarakat tentang pentingnya kesehatan melalui kegiatan olahraga. “PT Askes juga akan melaksanakan event yang sama Jumat (16/4) di Dolok Masihul yang akan dibuka Bupati Sergai HT Erry Nuradi. Selanjutnya Minggu (18/4) di Lapangan Merdeka Medan dalam rangka HUT Provinsi Sumatera Utara ke-62,” jelas David. Sekda Sergai Haris Fadillah mengatakan, melalui senam sehat bersama Askes diharapkan dapat menumbuhkembangkan kegiatan olahraga di masyarakat Sergai. “Untuk itulah kita harapkan kepada PT Askes agar terus meningkatkan program tersebut sehingga budaya olahraga benar-benar tertanam dalam diri masyarakat Sergai,”

harap Haris. Senam dipandu instruktur David bersama kawan-kawan, selanjutnya diisi lucky draw

memperebutkan TV 21’, sepeda, handphone, kompor gas, dispenser, kipas angin, jam dinding, pakaianolahragadanlain-lain.(m43)


Masyarakat Sergai antusias mengikuti senam sehat bersama PT Askes di lapangan Simpang Tiga Perbaungan, Sergai.

Thailand Boonsak Ponsana yang menang atas pemain Pakistan Wajid Ali Chaudhry 21-16, 2114. Dionysius Hayom Rumbaka membutuhkan waktu 23 menit untuk menumbangkan pebulutangkisVietnam Nguyen Hoang Hai 21-9, 21-16 dan melawan Chou Tien Chen dari Taiwan pada babak berikutnya. Sukses putra gagal diikuti tunggal putri Maria Kristin. Unggul set pertama dan sempat memimpin 17-11 pada set kedua, Maria malah menyerah atas unggulan kedua asal Hongkong Zhou Mi. Maria terkejar sebelum akhirnya kalah 21-15, 18-21, 16-21. Pada ganda campuran, pasangan baru Tantowi Ahmad/ Greysia Polii meraih kemenangan dalam penampilan perdana dengan menumbangkan Sudket Prapakamol/Saralee Thoungthongkam 21-19, 21-14.

Selanjutnya, mereka menghadapi gandaVietnam Bao Duc Duong/Thi Hong Gam Thai yang mengalahkan rekan senegaranya Nguyen Khang Huynh/ Nhung Le Ngoc 21-17, 21-17. Pasangan Devin Lahardi/ Liliyana Natsir juga meraih kemenangan awal setelah unggulan kelima itu tanpa kesulitan menundukkan pasangan tuan rumah Tarun Kona/Shruti Kurian 21-9, 21-9. Pada putaran kedua, Devin/Liliyana akan menghadapi ganda Korea Han Sang Hoon/ Jang Ye Na yang menang 21-14, 21-9 atas pasangan India lainnya Jishnu Sanyal/Jyotsna P. Nasib berbeda dialami ganda campuran Muhammad Rijal/Debby Susanto yang dihentikan pasangan Taiwan Lee Sheng Mu/Chien Yu Chin 1821, 21-13, 11-21. Sirnas di Pekanbaru Beralih ke Sirkuit Nasional

Bulutangkis Djarum di Pekanbaru, Andriansyah Putra dari PB Rada Binjai melaju ke babak ketiga setelah menang dari Diki Irawan (PB Permata Perawang) 21-19, 21-15. Sayangnya, sukses Andriansyah gagal diikuti oleh atlet PB Rada Binjai lainnya, Mhd Bima. Melawan Aji Putra Perdana dari PB Malibu Medan, Bima dikalahkan 16-21, 15-21. Kini, Andriansyah harus berjuang sendiri dan di babak ketiga bakal bertemu lawan tangguh dari PB Jaya Raya DKI, Ryan Ivano. Pelatih Ihsan Izka Rawi mengakui, Ryan memang lawan tangguh namun dirinya akan mengatur strategi agar Andriansyah mampu meladeni permainan lawan. Di ganda remaja, Andriansyah yang berpasangan dengan Bima juga tersingkir usai kalah dari pasangan Djarum Kudus (Jawa Tengah). (h01/a03/ant)


Irene Berjaya, Susanto Tumbang JAKARTA (Antara): Pecatur putri Indonesia GMW Irene Kharisma Sukandar (elo rating 2316) berjaya membungkam lawannya dari India Tania Sachdev (2393) pada babak pertama Dwitarung Putri dalam Japfa Chess Festival 2010 di Jakarta, Rabu (14/4). Namun kesuksesan pecatur putri Indonesia itu tidak diikuti pecatur putra Indonesia GM Susanto Megaranto (2527), yang harus tunduk kepada pecatur Georgia GM Mikheil Mchedlishvili (2634) pada Dwitarung Putra. Irene yang bermain dengan buah putih pembukaan Hindia Menteri mampu menghentikan lawannya yang memiliki elo rating lebih tinggi darinya pada langkah ke-49. “Saya cukup lega bisa meraih satu poin melalui pertandingan babak pertama ini, padahal sebelumnya saya sempat perkirakan permainan akan sangat ketat,” kata pecatur terbaik putri Indonesia yang baru berusia 18 tahun itu. Sebaliknya, Susanto yang bermain dengan buah hitam pertahanan Bentoni terus terdesak dan menyerah pada langkah ke-39 saat melawan Mikheil. Dwitarung antara pecatur top Indonesia melawan pecatur papan atas Asia dan Eropa itu akan berlangsung enam babak. Sedangkan Japfa Chess Festival diikuti 750 pecatur lokal dalam berbagai kelompok umur. Ajang itu kini mempertandingkan 10 nomor pertandingan lebih banyak dua nomor dibandingkan dengan festival tahun 2009. Nomor pertandingan baru yang akan dimainkan, yaitu Kelompok Umur (KU) 10 putra dan putri.

Waspada/Abdul Khalik

TAK TERURUS: Sekretariat KONI Kota Tebingtinggi di kompleks perkantoran Jl Gn Leuser, Kel Tj Marulak, Kec Rambutan, sudah lima tahun belakangan tidak terurus. Terlihat halaman dipenuhi rumput ilalang, listrik putus dan telepon pun demikian. Bertahuntahun tak satu pun pengurus KONI mendatangi kantor itu, padahal dana di APBD kota Tebingtinggi untuk kegiatan olahraga setiap tahun tetap habis. Kantor itu seakan jadi potret betapa KONI tidak pernah diurus serius para pengurusnya. Wajar jika olahraga di kota itu seperti kerak tumbuh di batu, hidup segan mati pun tak mau. Foto direkam Rabu (14/4).

Puas Pikitring Suar Juara MEDAN (Waspada): Manajer PS PLN Pikitring Suar Rico Lido Ginting dan wakilnya Suharto, Rabu(14/4) mengaku puas, setelah timnya jadi kampiun turnamen sepakbola Belawan International Continer Terminal (BICT) Cup I 2010. “Saya puas dan terima kasih kepada seluruh pemain, pengurus maupun pelatih yang telah memberikan segenap kemampuan untuk membawa Pikitring Suar sebagai kampiun,” ujar Rico. Pada final Minggu (11/4) lalu, tim besutan pelatih Budiono itu membungkam tuan rumah PS BICT 1-0 di lapangan Pasar X Marelan. Final itu juga disaksikan General Manager BICT Syamsul Bahri Kansil. Satu-satunya gol kemenangan Pikitring Suar diciptakan melalui tendangan jarak jauh Hasan Ashari menit 22. Urutan juara 1, 2, 3 dan 4 adalah PS PLN Pikitring Suar memperoleh uang pembinaan Rp3 juta plus trofi dan piagam, BICT Rp2 juta plus trofi, BII Rp1 juta plus trofi dan Kantor Pusat Rp500 ribu. Pencetak gol terbanyak Jefnri dari Kantor Pusat dengan lima gol memperoleh Rp500 ribu. (m25)

Final Futsal HUT KPJKD Sumut MEDAN (Waspada): Tim futsal AKLI Sumut maju ke babak final Futsal HUT Lembaga Pengembangan Jasa Konstruksi Daerah (LPJKD) Sumut yang akan dimainkan Sabtu (17/4) mendatang di lapangan Futsal Universitas Dharma Agung. AKLI yang dipimpin Roland Siahaan jumpa APEI pada partai puncak, setelah pada semifinal berhasil mengalahkan tim Aksindo 6-3. Sedangkan APEI melaju setelah mengalahkan Gaskindo 4-2. Ir H Lilik Ismadi selaku

koordinator tim futsal AKLI Sumut yang juga merangkap pemain, Rabu (14/4) mengatakan, timnya siap bertanding habishabisan pada final melawan APEI untuk memboyong Piala LPJKD Sumut. Peluang menjuarai turnamen memeriahkan ulang tahun LPJKD itu menurut Lilik sangat besar, berdasarkan rangkaian kemenangan yang diraih AKLI sejak babak penyisihan sampai semifinal. “Tim kami belum penah kalah. Kita bukan meremehkan

tim lawan, tetapi mengamati kekuatan dan materi pemain, AKLI Sumut pantas juara,” tegas Lilik. “Apalagi skuad kami berasal dari mantan pemain PSMS, sehingga keyakinan cukup kuat untuk menang dalam perebutan Piala LPJKD Sumut nanti,” katanya lagi. Optimisme mantan pemain PSMS itu makin kuat, mengingat kiper Sudirman berada dalam kondisi fit untuk mengawal gawang AKLI pada final melawan APEI akhir pekan ini. (m23)

PSSI Medan Seleksi Tim U-15 MEDAN (Waspada): PSSI Medan menggelar seleksi pembentukan tim usia 15 tahun Sumatera Utara (Sumut) dalam persiapan menghadapi Piala Menteri Negara Pemuda dan Olahraga (Mennegpora), 24-30 Mei mendatang di Jakarta. Seleksi digelar selama dua hari Sabtu dan Minggu (17-18/ 4) di lapangan Dispora Sumut, Jl Pancing Medan. “Kepada sekolah sepakbola diharapkan mengirimkan pemain handalannya maksimal lima pemain,” kata Ketua Umum Pengcab PSSI Medan Drs HM Darwin Syamsul (foto) di Sekretariat PSSI Medan, Rabu (14/4). Untuk mengikuti seleksi, menurutnya, harus memenuhi persyaratan sesuai yang diterapkan pihak panitia pelaksana. Syarat dimaksud adalah pe-


lajar aktif, usia 14 sampai 15 tahun kelahiran 1995 dan seterusnya, memiliki tinggi badan minimal 168 cm dan memiliki bio data seperti akta kelahiran (asli dan fotokopi), kartu keluarga (asli dan fotokopi), rapor paling depan dan akhir (asli dan fotokopi), ijazah sekolah dasar (asli dan fotokopi), nomor induk siswa nasional/validasi format 8335 dan surat keterangan

yang ditandatangani oleh kepala sekolah bersangkutan. Pemain yang didaftarkan harus menjalani screening test dan dinyatakan lolos oleh panitia serta menyediakan foto ukuran 3x4 sebanyak dua lembar. “Kita harus segera melakukan seleksi karena persiapan tinggal empat minggu lagi,” terang Darwin. Piala Mennegpora akan diikuti 12 provinsi masing-masing DKI Jakarta, Jawa Barat, Jawa Tengah, DI Yogyakarta, Jawa Timur, Sumatera Selatan, Sumatera Utara, Aceh, Kalimantan Timur, Sulawesi Selatan, Maluku Utara dan Papua. Kegiatan yang berhadiah total Rp100 juta dimaksudkan sebagai seleksi tim sepakbola pelajar Indonesia U 15 untuk mengikuti “5th Asian Schools Football (U15) Championship 2010 di Indonesia”. (m20)

Kodam I/BB Rekrut Bibit Berbakat MEDAN (Waspada): Kodam I/BB akan membentuk tim sepakbola Kodam I/BB untuk mengikuti Piala Kasad, Desember mendatang di Jakarta. Untuk itu, Mei 2010 Kodam I/BB merekrut bibit berbakat mulai tingkat desa hingga kecamatan. ”Tujuannya untuk membentuk tim Kodam I/BB yang kuat dan tangguh serta mencapai prestasi terbaik,” kata Kapendam I/BB Letkol Caj Dr Asren Nasution MA (foto) di Medan, Rabu (14/4). Menurut Kapendam, pencarian bibit terbaik perlu dilakukan melalui pertandingan mulai tingkat Koramil. “Kemudian pemain-pemain tersebut akan membawa nama Koramil untuk mengikuti Piala Dandim,” jelasnya. Dari Piala Dandim akan dipilih pemain untuk mengikuti

tingkat Korem dilanjutkan perebutan Piala Pangdam I/BB sampai Piala Kasad 2010. “Tim Kodam I/BB merupakan gabungan prajurit dengan masyarakat umum (non TNI), karena TNI manunggal dengan rakyat,” ujarnya lagi. Bibit dari masyarakat umum itu suatu saat nanti juga direkrut menjadi TNI. “Bagi para remaja yang berbakat sepakbola dihimbau dapat bergabung dengan Koramil atau satuan jajaran Kodam I/BB terdekat untuk selanjutnya didaftar dan diseleksi,” harap Asren Nasution Syarat peserta adalah berbadan sehat, usia maksimal 21 tahun, tinggi badan minimal 167 cm, tidak buta warna, tidak punya penyakit menular, punya jiwa kebangsaan tinggi, dan bebas Narkoba. “Dalam talent scouting kita


akan libatkan Pengcab dan Pengda PSSI setempat serta menggunakan pelatih bersertifikat provinsi,” papar Kapendam. “Setiap tim terdiri dari 18 pemain, komposisinya 10 prajurit dan 8 masyarakat umum. Pada setiap pertandingan, pemain yang diturunkan 6 prajurit 5 masyarakat umun,” katanya menambahkan. (m24/cmai)



WASPADA Kamis 15 April 2010

Murray Menangis MONTE CARLO (Waspada): Petenis peringkat empat dunia, Andy Murray (foto), dipaksa langsung angkat koper dari ajang Monte Carlo Masters setelah kalah secara memalukan dari petenis Jerman Philipp Kohlschreiber, Rabu (14/4). Dalam pertandingan yang dimainkan di atas lapangan tanah liat itu, Murray dilibas Kohlschreiber 2-6, 1-6. Sepanjang permainan, petenis Skotlandia itu memang tidak pernah tampil dengan performa ter-

baiknya. Bahkan, tercatat beberapa kali terdengar sorakan kurang mengenakkan dari penonton bagi Murray. “Saya akui tidak tampil baik hari ini. Saya pun merasa lapangan tadi seolah-olah mengecil

untuk pertama kali. Bila sudah seperti itu, sulitnya rasanya untuk bermain lepas,” jelas Murray sportif. Atas kemenangan tersebut, Kohlschreiber selanjutnya akan melawan rekan senegaraanya, Philipp Petzschner, untuk memperebutkan tiket perempatfinal. Di lain pihak, unggulan utama Novak Djokovic (Serbia) mengalahkan petenis Perancis Florent Serra 6-2, 6-3 dan lolos ke babak ketiga. Petenis peringkat dua dunia

ini tahun lalu menjadi runnerup setelah dikalahkan petenis Spanyol Rafael Nadal di final. Di babak ketiga nanti, Djokovic akan menghadapi petenis Swiss Stanislas Wawrinka. Nadal sendiri relatif tak mengalami kesulitan berarti di partai pertamanya. Melawan petenis kualifikasi Thiemo De Bakker di babak kedua, Nadal yang ditempati sebagai unggulan ketiga itu dengan mudah mengungguli lawannya 6-1, 6-0.

Berikutnya, Nadal akan berhadapan dengan Michael Berrer setelah petenis Jerman tersebut menundukkan unggulan 14 Juan Monaco (Argentina) 6-4, 6-4. Selain Nadal dan Djokovic, petenis unggulan lain belum menemui kesulitan berarti. Petenis Perancis Jo Wilfried Tsonga, Fernando Verdasco (Spanyol) dan duo Spanyol, David Ferrer dan Juan Carlos Ferrero, melaju ke putaran ketiga. Tsonga, unggulan kelima, tak

kesulitan menundukkan petenis Spanyol Nicolas Almagro 7-6, 7-5. Di laga lain,Verdasco menaklukkan Julien Benneteau (Perancis) 6-2, 6-1. Finalis Miami Masters 2010, Tomas Berdych, juga tak mendapat perlawanan berarti dari Richard Gasquet. Berdych pun menang mudah 6-2, 6-0. Petenis Kroasia Marin Cilic juga melangkah usai unggul atas Igor Andreev (Rusia) 6-7, 6-1, 6-4. (m33/ap)

Jankovic Lamban Tapi Selamat AP

CHARLESTON, AS (Waspada): Petenis Serbia Jelena Jankovic (foto) mengatasi penampilannya yang lamban di awal pertandingan dalam Piala Family Circle, Rabu (14/4), untuk melangkah ke babak berikutnya dengan kemenangan 2-6, 6-4, 6-3 atas petenis Rumania Edina Gallovits. Jankovic, juara 2007 dan mantan peringkat satu dunia, membutuhkan waktu lebih dari dua jam untuk menyisihkan Gallovits dalam turnamen berhadiah 700.000 dolar AS itu. Unggulan kedua, yang memenangi gelar ke-12 sepanjang karir bulan lalu di Indian Wells,


Kuznetsova Absen Lawan AS MOSKOW ( Waspada): Svetlana Kuznetsova (foto) menarik diri dari pertandingan semifinal Piala Fed antara tim Rusia dengan Amerika Serikat (AS), 24-25 April mendatang. Kuznetsova yang kini menempati peringkat lima dunia baru saja pulih dari cedera bahu. Ia memutuskan absen dalam semifinal Piala Fed dan akan mengikuti turnamen di Stuttgart yang akan berlangsung 26 April nanti. “Saya akan absen dalam pertandingan semifinal menghadapi Amerika Serikat karena jadwal pribadi saya tahun ini sangat padat,” kata Kuznestova. “Sangat tidak mungkin saya langsung bermain di Stuttgart setelah bermain di AS,” lanjut petenis Rusia ini. (m33/ap)

bedaan signifikan antara depan dan tengah. Hal terpenting saat ini adalah kami harus tetap bertarungm,” ujar Mallya, Rabu (14/4). “Saat ini, Renault terlihat sangat kuat namun masih banyak balapan tahun ini dan kami memiliki tujuan yang jelas mengenai kemana arah kami yaitu menempel mereka atau bahkan melewatinya,” jelas Mallya. “Saya pikir peringkat lima adalah sesuatu yang realistis karena kepercayaan diri para pembalap dan tim kami juga bekerja dengan baik,” imbuhnya menambahkan bahwa dirinya

bangga dengan kerja keras yang telah dilakukan Force India. “Di awal musim saya katakan bahwa kami ingin poin regular dan kami mampu melakukannya di tiga balapan awal. Sangat menyenangkan melihat kemajuan yang kami capai hanya dalam satu tahun, setelah tiga balapan di 2009 kami berada di 10 besar,” tutur Mallya. “Perbedaannya, saya yakin, adalah tetap fokus pada apa yang kami inginkan. Kami telah menjaga kepala kami agar tetap menunduk, melakukan pekerjaan, fokus pada diri sendiri,” pungkasnya. (m33/ini)

bia) 6-2, 4-6, 6-4. Di putaran pertama, petenis Rusia Elena Vesnina dan Vera Dushevina serta Patty Schnyder dari Swiss meraih kemenangan. Unggulan keempat dari Australia, Samantha Stosur, pun mendampingi para unggulan usai mengalahkan petenis Slowakia Magdalena Rybarikova 6-3, 7-5. (m33/ap)

Pasang Iklan Telp. 4528431 HP. 081370328259 Email:

Force India Tekad Lampaui Renault SILVERSTONE, Inggris (Waspada): Merasa mengawali musim dengan baik, bos Force India Vajay Mallya berharap timnya mampu menandingi dan melewati Renault di klasemen konstruksi musim ini. Tim yang bermarkas di Silverstone, Inggris ini, mencatat 18 poin di tiga balapan awal dan berada di peringkat enam klasemen sementara konstruksi. Target mereka adalah melampaui Renault yang berada di peringkat lima dengan raihan 12 pon lebih banyak. Walaupun tim Renault melakukan sesuatu yang impresif, Mallya tetap optimistis kinerja Force India mampu membuat progres untuk mengejutkan Renault yang asal Perancis. “Persaingan sangat ketat seperti yang kami lihat di Malaysia dan Australia. Tak ada per-

empat kali dipatahkan servisnya oleh Gallovits tapi beruntung akhirnya lolos. Unggulan ketujuh asal Rusia, Vera Zvonareva, membukukan tempat di putaran ketiga dengan kemenangan 6-2, 6-0 atas petenis Paraguay Rossana de los Rios, sementara Aleksandra Wozniak (Kanada) menundukkan Catalina Castano (Kolom-

getty images

Adrian Sutil (bawah kiri) yakin mampu membawa Force India berbicara lebih banyak musim ini.


Medan Metropolitan

WASPADA Kamis 15 April 2010


Wagubsu: Ambilalih Inalum RI Harus Bayar Rp50 T MEDAN (Waspada): Untuk menguasai seluruh aset pabrik peleburan aluminium (PPA) Inalum di Kuala Tanjung, Batubara, Sumatera Utara, pemerintah harus membayar nilai buku pada tahun 2013 sebesar Rp50 triliun. Nilai buku ini merupakan kewajiban yang harus disetor kepada 12 investor Jepang yang tergabung dalam Nippon Asa-

han Aluminium (NAA) sebagai pemegang saham mayoritas. Soal nilai buku yang harus dibayar Pemerintah RI ke Je-

STAIS Medan Juara Umum MTQN Antar PT MEDAN (Waspada) : Sekolah Tinggi Agama Islam Sumatera (STAIS) berhasil meraih juara umum MTQ antar Perguruan Tinggi (PT), yang berlangsung di Universitas Muslim Nusantara (UMN) Jalan Haru 2 Medan, Sabtu (10/4). Ketua LPTQ STAIS Medan, HM Basri, MA yang juga sebagai official dari STAIS Medan, Rabu (14/4) mengatakan, suksesnya mereka meraih juara berkat kerjasama yang baik seluruh unsur pemimpin STAIS Medan didukung Drs. Khairuddin, MA dan pengurus lainnya Drs. H Anasri Hakim yang begitu ambisinya kepada pengembangan tilawah Al-Qur’an dan Ilmu-ilmu Al-Qur’an yang tergabung dalam LPTQ STAIS Medan. Sekretaris Yayasan Drs. H. Makmur Limbong mengatakan, sebelum peserta mengikuti perlombaan terlebih dahulu diadakan seleksi di kampus Jalan Sambu No 64 Medan, diikuti 40 peserta. Kegiatan interen ini digagas oleh panitia HM Basri, MA menyertakan dewan juri HM Basri, MA, HM Yusuf, MA, dan Zulfanuddin, SAg, Al Hafizh sekaligus memimpin do’a. Ketua yayasan, H Ansari Hakim menyambut baik kegiatan penyisihan di kampus ini, sebagai wujud kompetisi interen sebelum beranjak ke kompetisi selanjutnya yang mengutus peserta sebagai duta kampus. “Ini adalah perestasi yang luar biasa bagi STAIS Medan yang baru Pertama kali Juara Umum MTQN Antar Perguruan Tinggi se-Sumut yang selama ini selalu di pegang oleh IAIN SU,” kata Drs Khairuddin MA selaku ketua panitia. Para pemenang : Juara I Ilham Effendi (Remaja Putra),Yusriatus Sa’adah (Remaja Putri), Hendra Prasetya (1 Juz Tilawah Putra), Masyithah (5 Juz Tilawah Putri), Al-Rafiqa Maulida (10 Juz Putri), Sarmadhan Rambe (Tafsir B. Indonesia Putra), Deni Hamdani (Tafsir B. Arab Putra). Juara II Mahalli Mulia (Tilawah anak-anak Putra). Juara III HM Basri, MA (Tilawah Dewasa Putra), Azzahratul Mutia Hasim (Tilawah Anak-anak Putri), Ahmad Fadli (5 Juz Tilawah Putra), Agung Pribadi (Hafzh 30 Juz Putra), Sekar Sari, Sakinah dan Adlin Syafrizal (Fahmil Qur’an). Harapan I Iskandar (Hafizh 20 Juz Putra), Nur Hamida Pohan, Ade Irma Suriani dan Eko Prastiono (Syahril Qur’an).Harapan II Fikriatul Hasanah (Hafizh 1 Juz Putri), Ahmad Mahmudi (Kaligrafi Hiasan Mushaf Putra), Surya Ningsih (Kaligrafi Hiasan Mushaf Putri). Harapan III Fachri Anshari (Hafizh 20 Juz Putra). (m36)

pang pada 2013 nanti, menurut Wakil Gubernur Sumut, Gatot Pujo Nugroho, menjawab wartawan kemarin di ruang kerjanya, bukan menjadi persoalan utama terhadap upaya mengambil alih seluruh aset Inalum. “Masalah utamanya ada pada keinginan pemerintah

sendiri. Apakah benar-benar berniat menguasai seluruh aset Inalum atau hanya sekedar menambah persentase saham lebih besar dari 41,12 persen setelah berakhirnya Master Agreement pembangunan PPA dan PLTA Asahan II pada 2013 nanti,” ucap Gatot. Kader PKS Sumut ini mengaku, kalau Pemprov Sumut ditanya apakah ingin menguasai Inalum secara total? Jawabnya sudah pasti.“Kita ingin mentake over seluruh aset Inalum itu. Namun di sisi lain, pihak Jepang juga sepertinya masih berminat untuk melanjutkan kerja sama. Makanya, kepastian untuk bisa menguasai total aset tersebut tergantung kegigihan pemerintah sendiri,” tukasnya.

Beban nilai buku sekitar Rp50 triliun itu, diakui Gatot tidak sepenuhnya harus ditanggung APBN (pemerintah pusat). Sebab, dari 41,12 persen saham Pemerintah RI di Inalum (saham Jepang 58,88 persen), sekitar 40 persen menjadi beban Pemprov Sumut bersama sembilan kabupaten dan kota di sekitar kawasan Danau Toba. “Jadi, saya kira tidak ada masalah soal beban nilai buku Inalum itu. Kalau toh uangnya tidak cukup, kan kita bisa meminjam dari luar negeri (loan). Yang penting, aset Inalum itu bisa secara total dikuasai pemerintah dan digunakan sepenuhnya untuk pembangunan kerakyatan,” tegasnya.(m19)

WN RRC Tewas Mencurigakan Di Hotel JW Marriott Polisi Dilarang Cek TKP MEDAN (Waspada): Seorang Warga Negara ( WN) Republik Rakyat China (RRC) Jhong Cupin, 51, ditemukan tewas mencurigakan di kawasan kolam renang lantai 17 Hotel JW Marriott Jalan Putri Hijau Medan, Selasa (13/4) malam. Korban yang diketahui mantan guru agama di RRC itu tewas usai berenang. Diduga Warga Negara Asing ini tewas karena penyakit jantung karena di bagian dadanya membiru. Namun mayat korban langsung dibawa ke RSU Pirngadi Medan oleh karyawan hotel tanpa didampingi pihak kepolisian. Kanit Jahtanras Poltabes Medan Ajun Komisaris Polisi (AKP) Faidir Chan ketika dikonfirmasi wartawan menga-

takan, dari hasil pemeriksaan sementara, tidak ditemukan adanya bekas penganiayaan. “Diduga korban tewas karena sakit. Sekarang ini kasusnya ditangani pihak kepolisian,” jelasnya. Namun Kanit Reskrim Polsekta Medan Barat Iptu Hasian Panggabean ketika dikonfirmasi menuturkan pihaknya belum dapat melakukan olah tempat kejadian perkara (TKP), disebabkan pihaknya tidak diperkenankan oleh pihak manajemen hotel tersebut. “Belum bisa masuk ke TKP, karena nggak dikasih masuk sama pihak hotel,” ungkapnya. Namun pihaknya menambahkan telah memeriksa empat saksi dalam peristiwa tersebut. “Baru empat saksi yang diperiksa,” tukasnya.

Informasi yang dihimpun di lapangan dan kepolisian, kejadiannya berawal korban sedang berenang. tidak berselang lama, pria RRC itu keluar dari dalam kolam dan langsung terjatuh serta tewas seketika. Karyawan hotel yang belum diketahui identitasnya mengetahui korban tergeletak tak sadarkan diri dipinggir kolam langsung menghubungi pimpinan hotel. Kemudian dilakukan pemeriksaan dan ternyata korban telah tewas. Setelah itu, pihak hotel membawa jenazah korban ke RSU Pirngadi Medan untuk dilakukannya visum, lalu menghubungi pihak kepolisian. Sampai saat ini, jenazah korban masih berada di kamar mayat RSU Pirngadi Medan. (m39)

Waspada/Surya Efendi

DEMO BURUH SAMBUT MAY DAY: Ratusan buruh dari berbagai organisasi buruh duduk di aspal Jl. Imam Bonjol depan gedung DPRDSU, Rabu (14/4). Mereka menyuarakan berbagai masalah dan penindasan terhadap buruh. Aksi ini juga menyambut Hari Buruh se-Dunia (May Day) pada 1 Mei mendatang.

Ribuan Buruh Dan Petani Berunjukrasa MEDAN (Waspada): Seribuan massa dari berbagai kelompok buruh, petani dan mahasiswa berunjukrasa secara bersamaan di gedung DPRD Sumut, Rabu (14/4). Mereka meminta penuntasan berbagai persoalan buruh dan petani di Sumut yang tidak terselesaikan. Massa pengunjukrasa tumpah ruah di halaman gedung dewan. Sekelompok massa bahkan menutup sebagian badan Jalan Imam Bonjol Medan. Mereka duduk berbaris dan melakukan aksi teatrikal di badan jalan hingga sempat memacatkan arus lalulintas. Sekelompok massa lainnya mengaku dari kelompok petani sawit dalam pernyataan sikapnya mengaku resah karena 35 juta buruh tani sawit terancam menganggur. Kondisi tersebut terjadi karena harga minyak sawit saat ini masih sangat tergantung dengan harga dollar. Akibatnya petani sawit tidak mampu mandiri. Ditambah lagi pemutusan kontrak pembelian CPO (crude palm oil) dari SMART oleh Unilever dan Nestle juga tengarai akan mengakibatkan dampak sistematik. “Pasalnya, kontrak kedua perusahaan itu berimbas

pada kepentingan petani sawit. Apalagi dengan turunnya harga Tandan Buah Segar ( TBS) sawit,” kata Koordinator Aksi Solidaritas Petani Sawit Indonesia, Yosef Rizal. SPSI juga mempertanyakan kehadiran Greenpeace di Indonesia yang terkesan menyalahkan petani sawit atas maraknya kasus pembalakan hutan. Padahal menurut penelitian, penyebab utama adanya pembalakan hutan bukanlah karena perluasan lahan sawit, tetapi karena kemiskinan masyarakat. “Faktanya 2/3 pembukaaan hutan dilakukan oleh masyarakat yang memiliki pendapatan rendah, karena mereka mencari makanan dan lahan untuk tempat tinggal,” jelasnya. Ditambahkannya, kelapa sawit sebenarnya justru menguntungkan karena bisa dijadikan sebagai sandaran hidup. “Kelapa sawit adalah industri minyak nabati yang paling ramah lingkungan dan berkelanjutan. Karena hanya membutuhkan sepersepuluh lahan yang dibutuhkan oleh tumbuhan lain untuk memproduksi jumlah minyak yang sama. Kelapa sawit juga hanya menggunakan sepertiga energi

sebagai masukan (pupuk) dan juga mampu menyerap CO2,” papar Yosef. Gelombang lainnya dari Gerakan Pro Demokrasi Sumatera Utara yang menuntut penuntasan berbagai persoalan buruh seperti PHK sepihak terhadap ratusan buruh PTWRP Buana Multi Corpora, buruh PT Mahakarya Inti Buana (MIB), pekerja Hotel Soechi, Buruh PT CGGC dan PT Siohydro yang sudah terjadi hingga berbulanbulan. Selanjutnya Perhimpunan Solidaritas Buruh PT Mahakarya Inti Buana juga mendatangi gedung dewan menuntut agar perusahaan tersebut kembali mempekerjakan seluruh buruh yang di PHK. Aksi terkait persoalan buruh itu diterima Ketua Komisi E DPRD Sumut, Brilian Moktar yang berjanji akan membantu penuntasan persoalan tersebut sesuai aturan perundang-undangan yang berlaku. “Kita akan tanya kesanggupan kepada masing-masing DPRD kabupaten/ kota untuk menyelesaikan persoalan buruh ini. Kalau memang tidak sanggup tinggal bilang saja, biar DPRD Sumut yang mengambilalih,” katanya. (h11)

62 Tahun Provinsi Sumut

Bangkit Bersatu Membangun Dengan Kebersamaan MEMBANGUN Sumatera Utara (Sumut) perlu kebersamaan dan kerja keras semua pihak, tidak hanya pemerintah, baik eksekutif, legislatif maupun yudikatif, melainkan peran seluruh komponen masyarakat perlu dilibatkan secara aktif, baik yang berdomisili di Sumut maupun para putra-putri asal Sumut yang kini berada di perantauan di seluruh persada nusantara. Berbagai pihak telah mengakui, “Sumut Luar Biasa”, baik sumberdaya alam maupun sumberdaya manusianya, semua ada di Sumut. Bahkan Presiden RI H Susilo Bambang Yudhoyono (SBY ) dalam beberapa kesempatan sengaja mengacungkan jempol tangan kanannya sembari berujar, “Sumut Luar Biasa”. Gubernur Sumut H Syamsul Arifin, SE maupun Wakil Gubsu H Gatot Pujo Nugroho, ST kepada wartawan kemarin dengan serius kembali mengajak seluruh masyarakat Sumut untuk terus memperkokoh kebersamaan serta menjaga persatuan dan kesatuan, karena dengan kebersamaan, persatuan dan kesatuanlah provinsi ini akan bisa dibangun dengan baik. ‘’Mari kita membangun Sumut ini dengan kebersamaan, tanpa kebersamaan mustahil rasanya pemerintah akan bisa membangun. Sekarang kita harus fokus meningkatkan kebersamaan menuju iklim kondusif dengan berbagai peningkatan pembangunan di segala bidang,” ujar Gubsu didampingi Sekdaprovsu DR RE Nainggolan, MM sehubungan masuknya hari ulang tahun (HUT) ke62 Provinsi Sumut 15 April 2010. Ketua DPRD Sumut H Saleh Bangun dalam beberapa kesempatan juga menegaskan sinergisitas antarpihak sangat diperlukan dan harus senantiasa diperkokoh untuk membangun Sumut untuk bangkit bersatu membangun Sumut lebih maju dengan kebersamaan di segala bidang. Saleh Bangun meyakini bahwa sinergisitas itu akan melahirkan kekuatan baru untuk membangun Sumut. “Kita perlu kebersamaan untuk membangun Sumut dan saya yakin bahwa seluruh stakeholders di Sumut mengetahui hal itu,” ujarnya. Sekdaprovsu DR RE Nainggolan didampingi Kadis Kominfo Sumut Drs H Eddy Syofian,

MAP belum lama ini juga mengemukakan tanpa kebersamaan sangat sulit membangun daerah yang kuat. “Berbagai pengalaman sudah membuktikan bahwa kebersamaan merupakan kunci penting untuk membawa perubahan ke arah lebih baik di atas landasan iklim kondusif demi suksesnya visi misi Pemprovsu, rakyat bertakwa ke hadirat Tuhan Yang Maha Kuasa, rakyat jangan lapar, rakyat jangan bodoh, rakyat jangan sakit dan rakyat punya masa depan,” ujarnya. Terbaik Pertama Nasional Pada usia 62 tahun ini kebersamaan dalam membangun Sumut ternyata membuahkan banyak prestasi. Kerja-kerja yang bertujuan meningkatkan kesejahteraan rakyat ternyata dinilai oleh pemerintah pusat cukup positip. Tidak heran kalau kemudian Sumut memperoleh banyak penghargaan. Setidaknya tercatat 9 penghargaan menonjol dan bergengsi yang diperoleh Sumut pada periode 15 April 2009 – 15 April 2010. Pada periode ini Pemprovsu memperoleh Prestasi Terbaik Tingkat Nasional di Bidang Pengelolaan Keuangan Daerah, Ekonomi dan Kesejahteraan Tahun 2009. Selain memperoleh piagam penghargaan yang diterima Gubsu H Syamsul Arifin, SE dari Menteri Keuangan Sri Mulyani Indrawati di Gedung Djuanda I Departemen Keuangan RI Jakarta pada 2 November 2009 lalu, Sumut juga memperoleh dana insentif Rp38,8 miliar dari Departemen Keuangan RI atas prestasi yang dinilai oleh tim independent melibatkan pakar serta tim Depkeu dan Depdagri. Menteri Keuangan pada kesempatan mengakui Provinsi Sumut unggul dalam banyak indikator prestasi ekonomi di antara seluruh provinsi di Indonesia sehingga menempatkan Provinsi Sumut pada urutan teratas daerah berkinerja baik di bidang pengelolaan keuangan, ekonomi dan kesejahteraan tahun tersebut. Kriteria yang digunakan dalam penentuan daerah yang berprestasi adalah kriteria kinerja keuangan antara lain prestasi daerah dalam upayanya (effort) meningkatkan dan mempertahankan kualitas La-


Menteri Keuangan Sri Mulyani Indrawati foto bersama Gubsu H Syamsul Arifin, SE, Sekdaprovsu DR RE Nainggolan, MM, Assisten Ketataprajaan Hasiholan Silaen, Kepala Biro Keuangan Setdaprovsu Drs HM Syafe’i, MSi usai penyerahan penghargaan atas prestasi Sumut pada urutan teratas provinsi berkinerja baik di bidang pengelolaan keuangan, ekonomi dan kesejahteraan pada November 2009 lalu. Pemprovsu juga mendapat dana insentif Rp38,8 miliar dari Departemen Keuangan RI. poran Keuangan Pemerintah Daerah (LKPD) agar dapat memperoleh opini WTP (Wajar Tanpa Pengecualian) atau WDP (Wajar Dengan Pengecualian) dari BPK, upaya dalam menyampaikan perda APBD secara tepat waktu setiap tahunnya, upaya dalam memacu kenaikan PAD (Pendapatan Asli Daerah) di atas rata-rata kenaikan PAD nasional, serta daerah dengan kapasitas fiskal di bawah ratarata nasional namun IPM (Indeks Pembangunan Manusia) nya di atas rata-rata nasional. Sedangkan kriteria kinerja ekonomi dan kesejahteraan didasari penilaian atas prestasi daerah yang mampu meningkatkan pertumbuhan ekonominya di atas rata-rata pertumbuhan nasional, daerah yang dapat mengurangi tingkat kemiskinan di atas rata-rata pengurangan kemiskinan nasional, daerah yang dapat mengurangi pengangguran di atas rata-rata pengurangan pengangguran nasional, serta memiliki inflasi di bawah rata-rata inflasi nasional. Atas kriteria tersebut Sumut pada saat itu berada pada capaian pendapatan asli daerah (PAD) naik rata-rata di atas nasional dalam tiga tahun terakhir masing-masing tahun 2006 naik

12,87 persen, 2007 naik 9,80 persen dan 2008 naik 32,19 persen. Selanjutnya proses penetapan Perda APBD diterima oleh pemerintah pusat mulai APBD 2009, P-APBD 2009 dan APBD 2010 tepat waktu sesuai Permendagri Nomor 13 tahun 2006. Bahkan. Sedangkan hasil audit Badan Pemeriksa Keuangan (BPK) terhadap penilaian Laporan Keuangan Pemerintah Daerah tahun 2008 naik dua tingkat menjadi memperoleh Opini Wajar dengan Pengecualian (OWP) dari tiga tahun sebelumnya pada peringkat terendah (disclaimer). Dalam kriteria ekonomi dan kesejahteraan pertumbuhan ekonomi Sumut tahun 2009 sebesar 6,39 persen sementara nasional 5,9 persen, indeks pembangunan manusia (IPM) urutan ke-8 nasional sebesar 72,8 sedangkan nasional 70,59, inflasi 10,72 tahun 2008 di bawah rata-rata nasional 11,06 persen, tingkat pengangguran 8,25 persen atau 51.000 pengangguran sedangkan nasional 10,20 persen, tingkat kemiskinan 12,56 persen sedangkan nasional 15,42 persen. Patut Disyukuri Provinsi Sumut kini berusia

62 tahun. Setiap kali kita memperingati hari jadi yang bersejarah seperti saat ini, hati kita selalu diliputi rasa syukur, sehingga kita akan termotivasi untuk memberikan pengabdian terbaik di segala bidang atau peran kita masing-masing. Pemerintahan provinsi di sumatera, yang diawali dengan sidang pertama komite nasional daerah, yang menetapkan pembentukan Provinsi Sumatera yang dibagi menjadi sub Provinsi Sumatera Utara, sub Provinsi Sumatera Tengah dan sub Provinsi Sumatera Selatan pada awalnya dulu kini telah berkembang menjadi potensi kemajuan Indonesia di wilayah Barat. Tahun 1948 melalui penetapan Undang-undang Nomor 10 sub provinsi dimaksud ditetapkan menjadi daerah otonom dan wilayah Sumatera Utara meliputi eks Keresidenan Aceh, Sumatera Timur dan Tapanuli. Perkembangan di tahun 1956 Aceh menjadi daerah otonom setingkat provinsi sehingga konsekwensinya wilayah Sumatera Utara ditata ulang kembali dengan mengurangi wilayah Aceh sehingga wilayahnya tinggal eks Keresidenan Sumatera Timur dan Tapanuli dan sampai saat ini masih eksis dan utuh

sebagai satu wilayah provinsi, yakni Provinsi Sumatera Utara yang kondusif, harmonis dan masyarakatnya yang heterogan hidup secara rukun penuh persaudaraan. Dalam tataran penyelenggaraan pemerintahan tingkat kabupaten di Sumatera Utara, tahun 1956 dibentuk daerah otonom setingkat kabupaten yang meliputi Kabupaten Tapanuli Tengah, Tapanuli Utara, Tapanuli Selatan, Nias, Langkat, Karo, Deliserdang, Simalungun, Asahan dan Labuhanbatu, dengan undang-undang nomor 7 tahun 1956. Sedangkan pemerintahan setingkat kota dibentuk daerah otonom, Kota Medan, Pematangsiantar dan Sibolga, yang dibentuk dengan undang-undang nomor 8 tahun 1956, yang kemudian pada tahun yang sama dibentuk kota kecil yang meliputi Kota Tanjungbalai, Binjai dan Tebingtinggi yang dibentuk dengan Undang-undang Nomor 9 tahun 1956. Seiring dengan perkembangan dan kemajuan daerah maka untuk pertama sekali dilakukan pemekaran Kabupaten Tapanuli Utara menjadi Kabupaten Dairi yang dibentuk dengan Undang-undang nomor 4 tahun 1964 dan disusul kemudian tahun 1998 dengan pembentukan kabupaten Mandailing Natal dan Kabupaten Toba Samosir. Keinginan untuk mewujudkan pemekaran daerah khususnya pemekaran kabupaten terus berkembang dari tahun 2003 hingga tahun 2008 yang akhirnya menjadi 33 yakni seluruh kabupaten berjumlah 25 (dua puluh lima) dan 8 (delapan) kota. Melalui renungan terhadap sejarah pembentukan dan pendewasaan pemerintahan, kita akan dapat memahami betapa gigihnya para pendahulu dan penggagas yang berjuang untuk membentuk Provinsi Sumatera Utara dan kabupaten/kota. Kita sangat memahami bahwa apa yang telah kita miliki sekarang adalah hasil dari perjuangan di masa lalu. Oleh sebab itu sepantasnya kita bersyukur sekaligus menyampaikan terimakasih kepada seluruh pendahulu kita sehingga Sumatera Utara masih tetap utuh dalam satu kesatuan sebagai satu provinsi yang masyarakatnya hidup rukun dan harmonis,

dalam keberagaman. Terus Bangkit Gubsu H Syamsul Arifin mengemukakan untuk selanjutnya ke depan apa yang kita perbuat sekarang, bahkan setiap gerak langkah kita dalam menyelenggarakan pemerintahan di Provinsi Sumatera Utara saat ini, akan mewarnai dan menentukan suasana keberhasilan Pemerintahan Provinsi Sumatera Utara pada masa yang akan datang. “Oleh karena itu, marilah kita jadikan peringatan hari jadi ke-62 ini sebagai momentum untuk memacu pembangunan dan meningkatkan kesejahteraan masyarakat dengan rasa kesatuan dan persatuan, sehingga kita dapat menggagas kreativitas dan inovasi. Memang masih banyak yang kita butuhkan termasuk dukungan bantuan dana lebih signifikan diharapkan dari pemerintah pusat untuk proyek besar seperti penyelesaian Bandara Kualanamu, kelistrikan, irigasi, jalan tol maupun prasarana jalan lainnya,” ujar Gubsu. Dalam rangka mencapai efektifitas pelaksanaan program, pemerintah provinsi bersama DPRD Sumut telah mengalokasikan Anggaran Pendapatan dan Belanja Daerah Provinsi Sumut tahun 2009 sebesar Rp 3.896.535.918.353,-. Untuk penanganan urusan pendidikan, diprioritaskan dalam pemberian bantuan pendidikan siswa SD, SMP, SMA/ MA/SMK yang berjumlah 83.056 siswa dari keluarga miskin. Capaian kinerja urusan pendidikan antara lain pendidikan dasar meningkat dari 97,68 persen menjadi 98,79 persen, tingkat sekolah menengah meningkat dari 70,25 persen menjadi 73,67 persen, peningkatan kualifikasi guru menjadi S-1 dan penurunan persentase buta aksara penduduk. Urusan kesehatan beberapa indikator memperlihatkan peningkatan dan dipersepsikan sebagai peningkatan derajat kesehatan masyarakat antara lain terjadinya penurunan angka kematian bayi (AKB) dan angka kematian ibu (AKI) tahun 2008 dari 290/100.000 menurun menjadi 260/100.000 kelahiran hidup tahun 2009, terjadinya peningkatan umur harapan hidup, prevalensi gizi kurang dan gizi buruk masih menjadi

prioritas, karena kasus prevalensi balita gizi buruk masih ditemukan di sumatera utara. Penanganan infrastruktur, khususnya jalan provinsi, bahwa tahun 2008 kriteria sebesar 30 persen meningkat menjadi 35 persen pada tahun 2009, kriteria sedang 42,98 persen menjadi 38,71 persen pada tahun 2009. Sedangkan kriteria rusak 27,02 persen menurun menjadi 26,29 persen pada tahun 2009. Gubsu memahami bahwa pembangunan adalah upaya untuk meningkatkan perekonomian melalui pemanfaatan sumber daya yang ada, dalam proses itu investasi merupakan salah satu variabel yang sangat penting, karena merupakan faktor yang signifikan dalam menggerakkan perekonomian. Tahun 2009 penanaman modal dalam negeri (PMDN) mampu direalisasikan sebesar Rp2.644.965.260 dan penanaman modal asing (PMA) terealisasi sebesar 90,854.90 dollar AS. Pengembangan koperasi usaha kecil dan menengah mengalami peningkatan sebesar 12,25persen,usaha koperasidari Rp2.913.674.000.000 tahun 2008 menjadi Rp4.042.918.681.000. Urusan ketahanan pangan terus mengalami peningkatan produktivitas yang menunjukkan kondisi swasembada dengan angka ketersediaan pangan mencapai 130,10 persen. Anggaran tugas pembantuan yang diterima oleh satuan kerja perangkat daerah Provinsi Sumatera Utara dari departemen tekhnis berjumlah Rp36.476.683.000 yang dialokasikan ke beberapa dinas, antara lain dinas peternakan, dinas pengelolaan sumber daya air, dinas perkebunan, dinas tenaga kerja dan transmigrasi, dinas pertanian, dinas kehutanan dan dinas sosial. Gubsu juga mengemukakan penyelenggaraan pemerintahan umum yang dilaksanakan melalui koordinasi kemuspidaan, koordinasi instansi vertikal, koordinasi dengan DPRD provinsi Sumut maupun koordinasi dengan muspida kabupaten/kota terus dilanjutkan dan lebih diefektifkan dengan harapan melalui koordinasi akan tercipta penanganan pemerintahan dan iklim yang kondusif di Sumatera Utara. (m19)

Medan Metropolitan

B2 Baperjakat Saling Lempar Tanggung Jawab

WASPADA Kamis 15 April 2010

Kasus Pengangkatan Direktur RSPM Memanas MEDAN (Waspada): Kasus pengangkatan Pegawai Negeri Sipil (PNS) non eselon menjadi pejabat eselon II-B dengan jabatan Direktur RSU Dr. Pirngadi memanas. Badan Pertimbangan Jabatan dan Kepangkatan (Baperjakat) Pemprov Sumut dan Baperjakat Pemko Medan saling lempar tanggung jawab. Sekretaris Baperjakat Pemprov Sumut Drs. H Suherman, MSP yang dihubungi Waspada, Selasa (13/4), mengatakan, pihaknya hanya memproses nama-nama calon Direktur RSU Dr. Pirngadi yang diusulkan Baperjakat Pemko Medan. Jika Baperjakat Pemko Medan tidak mengusulkan nama dr. Dewi Fauziah, maka tidak mungkin Baperjakat Pemprovsu merekomendasikannya sebagai Direktur RSU Dr. Pirngadi. “Jadi, mereka yang mengusulkannya ke Baperjakat Pemprov Sumut,” ujar Suherman. Sebelumnya, Kepala Badan Kepegawaian Daerah (BKD) Pemko Medan Lahum mengatakan, Baperjakat Pemko Medan hanya sebatas mengajukan nama-nama calon Direktur RSU Dr. Pirngadi ke Baperjakat Pemprov Sumut. Sedangkan yang mengangkat Direktur RSU Dr. Pirngadi adalah kewenangan Baperjakat Pemprov Sumut. Menurut Lahum, ada tiga nama calon Direktur RSU Dr. Pirngadi yang diusulkan kepada Baperjakat Pemprovsu. Namun Lahum hanya menyebutkan nama dr. Dewi dan tetap menolak memberitahukan dua nama calon lainnya. “Saya hanya sebagai anggota Baperjakat. Kalau memang Sekda mengizinkan membuka berkas, maka akan kita buka,” ujarnya.

Sikap Lahum yang menutupi nama tiga calon Direktur RSU Dr. Pirngadi sangat bertolak belakang dengan Suherman. Dari Suherman diketahui ada tiga nama yang diajukan Baperjakat Pemko Medan sebagai calon Direktur RSU Dr Pirngadiyaknidr.DewiFauziah(golongan IV-C), dr. Zulhelmi Bustami (golonganVI-B) dan dr. Feraluna Nasution (golongan IV-B). Menurut Suherman, mekanisme pengangkatan dr. Dewi Fauziah sebagai Direktur Utama RSU Dr Pirngadi Medan, sudah sesuai ketentuan yang berlaku. “Pangkatnya sudah IV C, sehingga memenuhi syarat untuk jabatan eselon II B. Selama ini dr. Dewi sebagai pejabat fungsional yakni dokter. Sesuai PP Nomor 100 Tahun 2000 dan PP Nomor 16 Tahun 1994, diperbolehkan beralih dari jabatan fungsional ke struktural atau sebaliknya sesuai kompetensinya,” tambah Suherman. Dari tiga calon itu, lanjutnya, maka dipilihlah dr Dewi, karena golongan dan pangkatnya lebih tinggi dari dua calon lain, sehingga Baperjakat Pemprovsu merekomendasikan usulan Baperjakat Pemko Medan tersebut untuk menetapkan dr. Dewi sebagai Direktur RSU Dr Pirngadi. Namun Suherman tidak menjelaskan tentang riwayat

Wartawan Radio Deklarasikan ALWARI MEDAN (Waspada): Para wartawan radio mendeklarasikan AliansiWartawan Radio Indonesia (ALWARI), dalam rangka Jambore Wartawan Radio di Provinsi Gorontalo belum lama ini. Fauzi Usman selaku Ketua Pengurus Daerah (PD) Persatuan Radio Siaran Swasta Nasional Indonesia (PRSSNI) Sumut mengatakan hal itu kepada wartawan, di kediamannya Jalan Babura Medan, Rabu (14/4). “Sekarang sedang disusun AD/ART dan setelah itu akan diumumkan susunan pengurus pusat maupun membentuk kepengurusan di daerah-daerah,” katanya. Acara yang dipusatkan di kota Gorontalo itu sekaligus dilakukan penghijauan dan lomba membuat berita maupun siaran. Turut hadir pada acara JamboreWartawan Radio (JWR) ratusan pengurus PRSSNI pusat maupun daerah antara lain Parni Hadi, dirut RRI, Ketua PRSSNI Pusat Sidki Wahab, Malek Syafie dari radio jaringan Prambos Grup dan dari masyarakat radio diwakili Dias Anggara. Tujuan dari pembentukan aliansi ini, menampung aspirasi wartawan kemungkinan selama ini mereka tidak bergabung dalam wadah Persatuan Wartawan Indonesia (PWI), khusus untuk radio swasta dan RRI, kata Fauzi Usman yang juga Ketua Dewan Pengawas PRSSNI Pusat. Bahkan, katanya, Kamis (15/4), puluhan pengurus PRSSNI Sumut akan mengadakan rapat koordinasi dengan Ketua Dewan Pers Bagir Manan di Hotel Danau Toba Hotel Medan. (m32)

Agussani Raih SuaraTerbanyak Penjaringan Balon Rektor UMSU MEDAN (Waspada): Wakil Rektor III Universtas Muhammadiyah Sumatera Utara Agussani meraih 33 suara disusul Dekan Fakultas Pertanian Alridiwirsyah dengan 23 suara danWakil Dekan I FKIP Elfrianto dengan 18 suara pada penjaringan yang dilakukan terhadap 11 bakal calon (Balon) rektor yang diajukan Senat. Demikian disampaikan Ketua Tim Penjaringan Balon Rektor UMSU Periode 2010-2014 Suhrawardi yang juga adalah Wakil Rektor II UMSU didampingi Sekretaris Tim HM Effendi Pakpahan dan Anggota Tim Faisal kepada wartawan melalui Kahumas UMSU Anwar Bakti di Kampus Utama UMSU Jl Kapten Mukhtar Basri, Selasa (13/4). Menurut Suhrawardi, nama-nama ke 11 Balon Rektor UMSU dalam tahap penjaringan tersebut, yakni Agussani (33 suara), Alridiwirsyah (23), Elfrianto (18), Masita Pohan (7), Syafrizal (7), Armansyah (3), Zulaspan Tupti (3), Suhrawardi K Lubis (2), Dalail Ahmad (1), Ade Taufiq (1) dan Surya Perdana (1). Penjaringan dilakukan oleh anggota tim yang berhak memilih sebanyak 34 orang dan setiap anggota memiliki 3 suara terdiri dari para dekanat UMSU, mewakili PW Muhammadiyah Sumut dan Badan Pelaksana Harian (BPH) UMSU, dimana 1 orang anggota menyatakan abstain. Sekretaris Tim HM Effendi Pakpahan menyebutkan tim menetapkan ketiga Balon yang meraih suara teratas tersebut sebagai calon rektor UMSU dan selanjutnya memohon kepada PW Muhammadiyah Sumut mengeluarkan rekomendasi agar secepatnya Senat UMSU menggelar pemilihan rektor dan siapa yang terpilih namanya akan dikirimkan ke PP Muhammadiyah untuk ditetapkan sebagai rektor UMSU definitif. (m29)

jabatan dan penjenjangan karir ketiga calon Direktur RSU Dr. Pirngadi yang diusulkan Baperjakat Pemko Medan tersebut. Banyak Kejanggalan Di tempat terpisah, sumber Waspada di lingkungan RSU Dr. Pirngadi, Rabu (14/4), menyebutkan, banyak kejanggalan yang terungkap sejak proses pengusulan calon direktur di Baperjakat Pemko Medan hingga pengangkatan direktur yang dilakukan Baperjakat Pemprov Sumut. Dari ketiga calon yang diusulkan Baperjakat Pemko Medan itu, tidak ada yang berasal dari pejabat struktural eselon III-A atau III-B setingkat Wakil Direktur dan Kepala Bidang/ Kepala Bagian yang masih aktif. Saat proses pengusulan tersebut, dr. Dewi Fauziah, SpTHT adalah PNS non eselon dengan jabatan Kepala Satuan Medis Fungsional (SMF) Telinga, Hidung dan Tenggorokan (THT). Kemudian dr. Zulhelmi Bustami, SpPD (non eselon, jabatan Kepala SMF Penyakit Dalam) serta dr. Feraluna Nasution, SpA (non eselon, jabatan Staf SMF Anak). Anehnya, pejabat struktural aktif yang tidak diusulkan Baperjakat Pemko Medan di antaranya Wakil Direktur Bidang

Pelayanan Medis RSU Dr. Pirngadi dr. Amran Lubis, SpJP (eselon III-A, golongan IV-C) dan Kepala Bidang Pelayanan Medis RSU Dr. Pirngadi dr. Risma Sinaga (eselon III-B, golongan IV-B). Kecurigaan adanya indikasi kolusi semakin menguat ketika Baperjakat Pemprov Sumut memproses berkas ketiga calon Direktur RSU Dr. Pirngadi itu. “Sebab, Baperjakat Pemprov Sumut hanya menilai pangkat/golongan tanpa mempertimbangkan riwayat jabatan dan penjenjangan karir calon direktur RSU Dr. Pirngadi. Padahal, pangkat/golongan bukan satu-satunya bahan pertimbangan untuk menempatkan seorang PNS menjadi Kepala Satuan Kerja Perangkat Daerah (SKPD),” ujar sumber. Informasi yang diperoleh Waspada di RSU Dr. Pirngadi, dari ketiga nama yang diusulkan menjadi calon direktur diduga hanya dr. Dewi yang minim riwayat jabatan dan penjenjangan karir selama menjadi PNS di lingkungan rumah sakit milik Pemko Medan itu. Riwayat jabatan dr. Feraluna Nasution, SpA yakni pernah menjadi pejabat struktural eselon III-B dengan Kepala Bidang Pelayanan Medis semasa Di-

rektur RSU Dr. Pirngadi dijabat dr. Alogo Siregar, SpA. Bahkan, dr. Feraluna telah mengikuti Pendidikan dan Pelatihan (Diklat) Penjenjangan PNS tingkat Spama dan pendidikan manajemen rumah sakit di Australia selama enam bulan. Pendidikan manajemen rumah sakit di Australia ini, merupakan program Departemen Kesehatan untuk rekrutmen calon top management rumah sakit yang diikuti sejumlah dokter pilihan dari seluruh Indonesia. Sementara, dr. Zulhelmi Bustami pernah menjabat sebagai Ketua Tim Pelayanan Pasien Miskin RSU Dr. Pirngadi tahun 2001 – 2002 dan saat ini masih menjabat sebagai Kepala SMF Penyakit Dalam. Sedangkan dr. Dewi Fauziah diduga hanya menjabat sebagai Kepala SMF THT dan langsung diangkat menjadi Direktur RSU Dr. Pirngadi. Atas dasar inilah Ketua Komisi E DPRDSU Brilian Moktar, SE bermaksud menguji kebenaran informasi tersebut dengan cara memanggil Baperjakat Sumut dan Baperjakat Medan guna membuka berkas riwayat jabatan serta penjenjangan karir ketiga calon Direktur RSU Dr. Pirngadi termasuk dr. Dewi. (m19/m26/h10)

Disbudpar Sumut Gelar Food And Fashion 2010 MEDAN (Waspada): Untuk meningkatkan pertumbuhan wisata manca negara, Dinas Budaya dan Pariwisata Sumatera menggelar Food and Fashion 2010. Tujuannya selain mempromosikan Medan sebagai kota kuliner dan fashion etnis, juga menarik jumlah wisatawan mancanegara. Kabid Pemasaran Disbudpar Sumut Muchlis seusai rapat persiapan kegiatan itu di Medan, Selasa (13/4), menyatakan Kota Medan sudah terkenal sebagai wisata kuliner, namun keberadaannya perlu dipromosikan secara luas. “Dengan demikian berbagai jenis makanan khas tradisional maupun jajanan pasar tradisional dari berbagai daerah yang bervariasi dengan cita rasa yang sangat lezat ini, dapat menarik minat wisatawan manca negara,” ujarnya. Festival ini, lanjutnya, akan digelar selama tiga hari mulai Jumat (16/4) hingga Minggu (18/4) di Centre Piece Merdeka Walk Jalan Balai Kota, sehingga masyarakat lokal dapat melihat keberagaman makanan tradisional yang dimiliki kota Medan.

“Kita berharap hotel seperti Grand Aston, Grand Antares, Grand Angkasa, JW Marriott, Asean, dan lainnya dapat menyediakan makanan tradisional atau jajanan pasar tradisional kepada para tamu yang berkunjung di penginapannya,” lanjutnya. Hadir pada persiapan acara itu Direktur Trans Kreasindo Didit Mahadi Kadar, Pembina APPMI Sumut Saurma MGP Siahaan, Wakil APPMI Sumut Hartono Gan, Femmy dari Akpar Medan. Dalam acara itu, Disbudpar juga menggelar festival fashion dengan menggandeng Asosiasi Perancang Pengusaha Mode Indonesia (APPMI) Sumatera Utara bekerjasama dengan Dekranasda Sumut. “Melalui festival fashion ini kita ingin mengangkat sekaligus memberi apresiasi kepada para perancang di Sumut yang sudah berkreasi dengan hasil rancangan yang mereka buat,” ujar Muchlis didampingi staf Disbudpar Sumut Jimmy, Saleh dan lainnya. Direktur Trans Kreasindo Didit Mahadi Kadar yang tetap dipercaya menghelat even akbar yang baru pertama kalinya

digelar di Sumut ini mengungkapkan, festival itu diikuti para peserta di antaranya lima hotel berbintang, termasuk perusahaan makanan, majalah pariwisata, Dekranasda Sumut, Rumah Gorga dan APPMI Sumut. “Kita berharap, festival ini bisa lebih meningkatkan kepariwisataan di daerah ini,” ujar Didit sembari menyebutkan, festival yang dibuka Jumat (16/ 4) malam itu terbuka untuk umum dan masyarakat luas. Dewan Kehormatan APPMI Saurma MGP Siahaan didampingiWakil Ketua APPMI Sumut Hartono Gan mengemukakan, pada peragaan busana tenun ulos, songket dan batik motif Sumut, APPMI menampilkan puluhan busana dengan berbagai tema. “Di hari pertama, APPMI mengusung Sumut Night, menyajikan busana etnis Sumut. Hari kedua Urban Life in Medan, yakni, koleksi busana siap pakai. Hari ketiga celeberation, berupa gaun pesta. “APPMI juga menggelar pertemuan dengan desainer mulai pukul 17.00 hingga 18.00 di stand APPMI dan Dekranasda Sumut,” ujarnya. (m38)

Delegasi Pendidikan Sumut Ke Guangzhou MEDAN (Waspada) : Delegasi pendidikan Sumatera Utara yang dipimpin Sekda Provsu RE Nainggolan bertolak ke Guangzhou, China, dari Bandara Polonia via Singapura, Selasa (13/4) malam. Kunjungan ke negara tirai bambu itu dalam kaitan pertukaran dosen maupun mahasiswa. “Antara kota bersaudara Medan-Guangzhou (Sister City) di bidang pendidikan khususnya jurusan bahasa mandarin dari Sekolah Tinggi Bahasa Asing Persahabatan Internasional Asia (STBA-PIA) Medan dengan South Normal University (SCNU) yang baru pertama menjalin kerjasama,” kata Kadis Pendidikan Sumut Bahrumsyah didampingi Kadis Pendi-

dikan Medan Hasan Basri dan KopertisWilayah I Sumut/Aceh Zainuddin. Menurut Bahrumsyah, kerjasama ini dimaksudkan dalam kaitan STBA-PIA akan memperoleh serifikat double, baik dari SCNU maupun STBA-PIA. Ke depan, lanjut Bahrumsyah, sebaiknya mahasiswa program sarjana (S-1) dapat menguasai tiga bahasa seperti Mandarin, Jepang dan Inggris, bahasa persatuan Asia. “Kerjasama perguruan tinggi di Sumut dengan SCNU akan lebih banyak bermanfaat, apalagi terkait China Asean Free Trade Area (CA-FTA),” timpal KopertisWilayah I Sumut/Aceh Zainuddin. Sementara itu, Kadis Pendi-

dikan Medan Hasan Basri menyatakan dengan ditandatanganinya memorandum of understanding (MoU) STBAPIA dengan SCNU Guangzhuo lebih banyak peluang mengirim tim kesenian ke sana. “Ini juga berpeluang memperdalam penguasaan sastra bahasa Mandarin, lebih dari itu dapat memacu meningkatkan arus wisatawan dari RRC berkunjung ke Sumatera Utara,” katanya. Bahkan Suherman, kepala Badan Kepegawaian Daerah (BKD) Sumut ikut dalam rombongan itu menyatakan, ke depan pendidikan di Sumut harus berorientasi pendidikan globalisasi menguasai bahasa terutama Mandari, Jepang dan Inggeris.(m32)

Tuntutan Sopir Truk Pelabuhan Dikabulkan BELAWAN (Waspada): Tuntutan ratusan sopir yang tergabung dalam Persatuan Sopir Truk Pelabuhan (PSTP) Belawan untuk sementara dikabulkan pengusaha melalui rapat antara kedua belah pihak di Mapolres KP3 Belawan, Senin (12/4). Ketua DPP PSTP Belawan, Setia Budi Silalahi, membenarkan hal itu dan rencannya, Kamis (15/4), akan diadakan pertemuan lanjutan guna membahas besaran kenaikan upah sopir dan kernet serta sanksi yang akan dikenakan terhadap pengusaha yang tidak mendaftarkan pekerjanya ke Jamsostek. “Pertemuan semalam belum final dan kita berharap pengusaha tidak ingkar seperti yang lalu-lalu,” katanya saat dihubungi Waspada, Selasa (13/4). Dengan adanya kesepakatan itu, untuk sementara PSTP tidak melanjutkan aksi unjukrasa, namun aksi akan kembali digelar jika masih ada pengusaha yang ingkar. “Kita mendapat jaminan dari Kapolres dan Adpel. Untuk menghargai itu unjukrasa ditunda sambil menunggu hasil pertemuan dengan DPU Organda,” ucap Budi. Satu hari pasca unjukrasa anggota PSTP itu, aktivitas Pelabuhan Belawan kembali normal. Buruh maupun kalangan sopir sudah membongkar maupun memuat barang yang keluar masuk pelabuhan. Mungkin hal itu terjadi karena tuntutan pengujukrasa dikabulkan pengusaha. (cre)

Waspada/Abdullah Dadeh

Kadis Pendidikan Sumut Bahrumsyah (tengah) didampingi Kadis Pendidikan Medan Hasan Basri, Kopertis Wil-I Sumut/Aceh Dr Zainuddin (kiri) dan rombongan lainnya menjelang bertolak ke Guangzhou.


Menteri Wakaf (Menteri Agama - red) Kerajaan Yordania Abdul Sallam Al Abbady foto bersama para Pemuka Agama Sumut di Kementerian Wakaf di Kota Amman, Rabu (7/4). .

Dari Kunjungan Pemuka Agama Sumut

Yordania-Indonesia Punya Misi Memulihkan Citra Islam MEDAN (Waspada): Sumatera Utara yang berposisi di wilayah bagian barat Indonesia dan berhubungan langsung dengan dunia luar seperti Malaysia, Thailand dan Singapura sangat strategis untuk memberi pemahaman kepada dunia luar bahwa kehidupan kerukunan umat beragama di Indonesia sangat baik. Dalam hal ini Sumatera Utara sebagai salah satu daerah di Indonesia berperan mempromosikan atau menjadi model daerah di Indonesia yang kehidupan keseharian dan kehidupan umat beragamanya sangat harmoni dan damai walau dalam perbedaan agama dan etnik. Hal ini dinyatakan Menteri Wakaf (Menteri Agama - red) Kerajaan Yordania Abdul Sallam Al Abbady saat berdialog dengan para Pemuka Agama Sumut dalam kunjungan silaturrahmi ke KementerianWakaf, Rabu (7/ 4) di kota Amman. Didampingi Duta Besar RI untuk Kerajaan Yordania, Palestina dan Irak Zainulbahar Noor, Menteri Wakaf menyatakan apalagi Indonesia yang mayoritas umat Islam yang saat ini seolaholah ada yang mencitrakan Islam identik dengan teroris maka Sumut bisa memulihkan image tersebut karena adanya kedamaian di Indonesia dan umat Islamnya tidak radikal seperti yang diidentikkan sementara pihak di dunia. “Saya yakin dari dialog ini

Kerajaan Yordania memandang Sumut punya peran yang amat strategis dan seirama dengan komitmen Yordania sesuai pesan Raja Yordania II Amman Massage,” ujar Menteri wakaf tersebut. Kunjungan Tokoh Agama yang difasilitasi Dubes Zainulbahar Noor Menteri dengan antusias mendengarkan penjelasan dari Ketua FKUB Sumut H Maratua Simanjuntak didampingi unsur lintas Agama Ketua Umum MUI Sumut Prof DR H Abdullah Syah, MA, Elim Simanjuntak, Nangkasi Kiliat (unsur Protestan), Pastor Benno Ola (Khatolik), dr IndraWahidin (Buddha), Naransami (Hindu), Basri Yusuf (Konghucu) didampingi juga Ka Kanwil Kementerian Agama Sumut H Syaiful Mahya Bandar, Kadis Kominfo H Eddy Syofian dan Ass II Pemko Medan Farid Wajedi. MenteriWakaf juga menguraikan Kerajaan Amman dibawah Raja Abdullah II, saat ini dengan gigih mengimbau segenap umat Islam dunia kembali pada kemurnian Ajaran Islam tanpa perbedaan pelaksanaan ibadah dalam mazhab dan Islam bagi kesejahteraan seluruh umat. Menurutnya meski dirinya belum mengenal lebih dekat Sumut tetapi kunjungan tokoh berbagai lintas Agama yang difasilitasi pemerintah menunjukkan bahwa Sumut yang plural sangat baik menerapkan prinsip kedamaian dan kerukunan. Seminar Dalam pertemuan yang berlangsung lebih 30 menit juga

muncul gagasan yang difasilitasi Dubes kepada Menteri Wakaf Yordania tentang perluasan seruan perdamaian sekaligus upaya perdamaian antar umat Islam global dan dalam negeri melalui berbagai kegiatan yang selama ini telah dilakukan oleh KerajaanYordania melalui Amman Massage seperti seminar, pemberian beasiswa, pengembangan kerjasama perdagangan. Khusus untuk pengembangan pesan Islam yang anti kekerasan dan Indonesia yang berbeda suku dan Agama hidup dalam satu kesatuan akan menggelar seminar di Medan sekitar September 2010 dengan tema The Jordanian Amman Massage and The Indonesian Diversity in Unity-Unity in Diversity the Utmost media in realizing the global Peace Efforts”. Melalui seminar ini Sumut akan ambil andil yang besar ikut memulihkan citra Islam yang anti kekerasan dan sekaligus menggambarkan Indonesia yang harmoni dalam keberagaman agama dan etnik. Menteri wakaf berjanji akan hadir. Dalam pertemuan ini juga MenteriWakaf menginformasikan bahwa Mimbar Masjid Al Aqsa diYerussalem telah direhab dan hasil sayembara dunia pembuatan mimbar tersebut dimenangkan pemahat dari Jepara Indonesia. (m19)

F. SPTI -K. SPSI Sumut Batalkan SK Pimpinan Ari Susilo Amri Abeng Lubis Diangkat Jadi Pelaksana MEDAN (Waspada) : Dewan Pimpinan Daerah Federasi Serikat Pekerja Transport Indonesia dan Konfederasi Serikat Pekerja Seluruh Indonesia (DPD F.SPTI-K.SPI)Sumut,secararesmi membatalkan SK DPC Kepimpinan Ir. Ari Susilo Polopo Siregar. SK pencabutan dan pembatalan secara resmi dikeluarkan DPD K. SPTI-K SPSI di Medan tanggal 01 April 2010 Nomor 029/DPD-F.SPTI-K.SPSI/SU/ IV/2010 tentang pembatalan SK DPD F.SPTI-K.SPSI Sumateta Utara. tentang Komposisi dan Personalia Pimpinan Ir Ari Susilo Palopo Siregar Cabang Kabupaten Labura. Selanjutnya DPD F.SPTIK.SPTI Sumut mengangkat Amri Abeng Lubis sebagai pelaksana tugas pimpinan Kabupaten

Labura. Pimpinan DPD K.SPTIK.SPSI Sumut H. Rizaldimavi, MBA dan Sekretaris Hendra Mika Siahaan, Rabu (14/04) menyatakan, bahwa SK pembatalan DPD Sumut terhadap DPC Pimpinan Ari Palopo selama ini dianggap tidak mampu menjaga solidaritas terhadap anggota dalam rangka menjaga dan mengamankan visi dan misi organisasi sesuai AD/ART. Selain itu, DPD Sumut juga menilai K.SPTI-K.SPSI Pimpinan Ari Palopo, tidak mampu melakukan pengembangan organisasi, sehingga diperlukan kepiwaian seorang pimpinan dalam menjalankan roda organisasi dan betanggung jawab dalam meningkatkan aktifitas organisasi.

Dengan dikeluarkannya SK Pembatalan Pimpinan Ari Palopo tersebut, DPD K.SPTI-K.SPSI Sumut selanjutnya memerintahkan Amri Abeng Lubis yang diangkat jadi pelaksana tugas di Labura, agar melakukan segala sesuatu yang menyangkut hak dan kewajiban organisasi di tingkat DPC F.SPTI-K.SPSI Kota Labura. Maka seluruh kewajiban organisasi DPC K.SPTIK.SPSI Kabupaten Labura adalah tanggung jawab Amri Abeng Lubis. Amri Abeng kepada wartawan mengatakan, akan melaksanakan perintah dan amanah yang dipercayakan DPD Sumut kepadanya. “Saya siap mengemban tugas dan menjaga kepercayaan dari DPD K.SPTIK.SPSI Sumut,” ujarnya. (m08)

LSP-SN Gelar Musda Ke-5 Dan Seminar Kesehatan MEDAN (Waspada): Lembaga Seni Pernapasan Satria Nusantara (LSP-SN) Medan, Sumatera Utara akan menggelar Musyawarah Daerah ke-5 dan diisi seminar tentang kesehatan dengan narasumber dari Ikatan Dokter Indonesia Sumut. Ketua Panitia, H. Sugih Arto Yusuf didampingi penasehat SN, H. Adhan Gusti, SH kepada Waspada mengatakan, seminar dan Musda LSP-SN Sumut tersebut akan dilaksanakan di Aula Kampus Sari Mutiara, Jalan Kapten Muslim No.79 Medan, Minggu (18/4) pukul 8:30 -15:30. Dalam acara tersebut, lanjut Sugih Arto, diawali dengan sambutan Ketua LSP-SN Sumut dan pembukaan Musda secara resmi yang direncanakan akan dibuka oleh Gubsu H. Syamsul Arifin, SE selaku Pembina LSPSN Sumut. Kemudian dilanjutkan dengan seminar tentang kesehatan yang akan diikuti 300 anggota LSP SN di Sumut. “Setelah itu, kita akan melaksanakan sidang pleno pemilihan pimpinan sidang yang akan membahas tentang pengesahan tata tertib Musda dan

penyampaian laporan pertanggungjawaban pengurus LSP-SN Sumut periode 2008-2010. Dilanjutkan dengan evaluasi laporan pertanggungjawaban pengurus LSP-SN,” jelasnya. Kemudian, lanjut Dosen Fakultas Teknik ini, acara puncak yaitu sidang pleno pemaparan hasil sidang komisi oleh masing-masing ketua komisi, sidang pleno pemilihan calon ketua LSP-SN periode 20102012 dan diakhiri dengan sidang paripurna pembacaan hasil keputusan Musda. Sugih Arto menyampaikan harapannya kepada para anggota LSP-SN di Sumut seperti cabang Medan, Stabat, Binjai, Kisaran, Tanjungbalai dan Tanjungmorawa, untuk dapat hadir dan turut berpartisipasi dalam terlaksananya Musda tersebut. Sementara itu, Ketua LSPSN Sumut, Sahabudin Duha pada kesempatan itu mengucapkan terimakasih kepada seluruh penasehat, pengurus dan anggota SN se-Sumut atas kepercayaan yang diberikan kepadanya selama memimpin organisasi tersebut. Karena,

katanya, tanpa ada partisipasi dari mereka semua, SN di Medan tidak akan dapat berjalan dengan baik. Sahabudin Duha menyebutkan, setelah pelaksanaan Musda tersebut, LSP-SN juga akan mempersiapkan diri dalam pelaksanaan Musyawarah Nasional (Munas) LSP-SN di Jogjakarta pada Mei 2010, sekaligus mempersiapkan diri mengikuti pertandingan jurus di tingkat nasional tersebut. “Sebanyak 441 anggota LSP-SN Sumut akan ikut menghadiri Munas di Jogjakarta dalam pemilihan Ketua Umum yang dilaksanakan empat tahun sekali tersebut,” ujarnya. Penasehat LSP-SN Sumut, Adhan Gusti, SH menambahkan, Satria Nusantara memiliki motto Sehat, Sembuh dan Saudara, artinya, latihan seni pernapasan SN merupakan olahraga yang sangat bermanfaat bagi kesehatan dan penyembuhan berbagai penyakit yang ada dalam tubuh, selain itu juga sebagai tempat berkumpul, silaturrahmi dan menjalin persaudaraan antar sesama. (m41)

Medan Metropolitan

WASPADA Kamis 15 April 2010


Kesadaran HAM Masih Rendah 427 Kasus Sengketa Tanah Belum Diselesaikan MEDAN (Waspada): Komisi Nasional Hak Asasi Manusia (Komnas HAM) RI menilai, kesadaran hukum khususnya dalam penerapan pembangunan berwawasan HAM di Sumatera Utara masih rendah, sehingga perlu ditingkatkan. Karena itu Komnas HAM merasa perlu menjalin kerjasama dengan Pemprovsu untuk implementasi hal dimaksud.

Kasus Kawin Paksa Gadis ABG

Saksi Diperiksa Hari Ini MEDAN (Waspada): Poltabes Medan rencananya, Kamis (15/ 4) hari ini, memintai keterangan MIB alias HB, 60, warga Jalan Yos Sudarso, terkait pernikahan di bawah umur dan perbuatan cabul yang dilakukannya terhadap AA, 13, beberapa waktu lalu. “Besok Kamis (hari ini) IB atau HB kita periksa sebagai saksi korban, tapi kalau dalam pemanggilan itu dia (HB) tidak datang, akan dijemput paksa,” tegas Kasat Reskrim Poltabes Medan Kompol Jukiman Situmorang, Rabu (14/4). Jukiman menjelaskan, pemanggilan yang dilakukan terhadap HB itu untuk melengkapi bukti-bukti yang terlampir dalam berkas acara pemeriksaan (BAP) nya. “Untuk melengkapi bukti-bukti selama ini,” terangnya. Pemanggilan yang dilakukan UPPA Poltabes, lanjutnya, tidak terlepas dari status MIB sebagai tersangka, sehingga pihaknya akan mengumpulkan bukti-bukti yang lengkap untuk melakukan penahanan. Hal senada juga dikatakan Kanit Pelayanan Perempuan dan Anak (PPA) Poltabes Medan Iptu Hariyani saat dikonfirmasi menjelaskan, pihaknya masih melakukan pemeriksaan dengan mengkomfrontir keterangan dari saksi-saksi yang telah diambil keterangannya. “Masih akan kita mintai keteranganya untuk komfrontir keterangan dari saksi-saksi lainnya,” jelasnya. Pihaknya juga pernah mengatakan, akan menghadirkan saksi ahli dari pakar kesehatan atau pakar hukum USU untuk melengkapi bukti dengan komfrontir keterangan dari saksi-saksi yang telah diperiksa. Sebelumnya, pihak penyidik UPPA Poltabes Medan telah mengambil keterangan sejumlah saksi yakni korban AA dan Rismawati (kakak AA), selanjutnya Rupatma (ibu AA) bersama Jamaludin (kakek AA) dan Sutrisno (tuan kadih/adik angkat ayah AA), kemudian Wagimin (ayah AA) dan bidannya, Suhesti. (m39)

Pejabat Pemko JadiTersangka Dugaan Korupsi RURTK MEDAN (Waspada): Sat III Tipikor Poldasu segera menetapkan seorang pejabat Pemko Medan menjadi tersangka dalam kasus Rancangan Umum Tata Ruang Kota (RUTRK). “Pejabat Pemko yang akan dijadikan tersangka ini merupakan tokoh utama dalam kasus dugaan korupsi RUTRK,” jelas Dir Reskrim Poldasu Kombes Pol Agus Andriyanto melalui Kasat Tipikor AKBP H. Prastiono, Selasa (13/4). Menurutnya, untuk melengkapi berkas dalam pemeriksaan, dalam waktu dekat penyidik memanggil saksi dari Bank Sumut guna dimintai keterangan, terkait aliran dana dalam kasus tersebut. “Mungkin beberapa hari lagi, penyidik memanggil pegawai Bank Sumut untuk dimintai keterangannya, supaya diketahui aliran dana dalam kasus ini,” jelasnya. Dia juga menyatakan, sampai saat ini mereka telah memeriksa lebih dari 10 orang saksi guna melengkapi berkas kasus ini. Dijelaskan Prastiono, saat ini mereka masih menetapkan seorang tersangka, namun ke depan tidak tertutup kemungkinan tersangka bakal bertambah seiring penyelidikan kepolisian. “Kasus tata ruang ini merupakan salah satu target dugaan korupsi yang harus diselesaikan. Karena itu, ditargetkan bulan depan berkasnya sudah selesai dan segera diajukan ke pengadilan,” katanya. Didesak wartawan siapa nama oknum tersebut, mantan Kapolsekta Percut Seituan ini belum mau menjelaskan. “Nanti saja ya,” katanya. Kasus yang merugikan Negara ini berawal dari laporan Ir. Filiyanti Bangun, Grad Dipl.PM, M Eng, 26 Februari 2008 ke Komisi Pemberantasan Korupsi. (m39)

Jadwal Penerbangan Di Bandara Polonia No. Penerbangan Ke Flight


Tiba Dari



GARUDA INDONESIA 1 Jakarta GA-181 2 Jakarta GA-183 3 Jakarta GA-185 4 Jakarta GA-187 5 Jakarta GA-189 6 Jakarta GA-191 7 Jakarta GA-193 8 Jakarta GA-147 9 Jakarta GA-195 10 Banda Aceh GA-146

06.25 09.05 10.55 12.25 13.45 15.45 17.10 18.10 19.10 14.45

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Banda Aceh

GA-180 GA-182 GA-184 GA-186 GA-148 GA-188 GA-190 GA-192 GA-196 GA-147

06.10 08.00 09:30 10.50 11.50 12.50 14.10 16.15 19.35 18.10

AIR ASIA 1 Kuala Lumpur AK- 937 2 Kuala Lumpur QZ- 8054 3 Kuala Lumpur AK- 457 4 Kuala Lumpur AK-939 5 Penang QZ-8074 6 Jakarta QZ-7497 7 Jakarta QZ-7503 8 Jakarta QZ-7505 9 Phuket (3,5,7) FD-3991

08.50 09.40 18.00 20.10 16.05 12.20 13.30 18.40 17.45

Kuala Lumpur Kuala Lumpur Kuala Lumpur Kuala Lumpur Penang Jakarta Jakarta Jakarta Phuket (3,5,7)

AK-936 QZ-8055 AK-456 AK-938 QZ-8075 QZ-7496 QZ-7502 QZ-7504 FD-3990

08.25 11.55 17.40 19.40 18.05 19.15 13.05 15.40 17.15






LION AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Jakarta 5 Jakarta 6 Jakarta 7 Jakarta 8 Jakarta 9 Jakarta 10 Jakarta 11 Jakarta 12 Batam/S.baya 13 Banda Aceh 14 Penang 15 Penang

06.30 09.00 10.00 11.00 12.00 13.45 15.35 17.05 18.35 21.15 22.25 12.55 19.35 09.10 12.30

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Batam/S.baya Banda Aceh Penang Penang

JT-380 JT-398 JT-394 JT-302 JT-398 JT-382 JT-384 JT-396 JT-306 JT-386 JT-308 JT-971 JT-397 JT- 8289 JT-8287

08.20 09.20 10.20 11.20 10.45 13.05 14.55 16.25 19.35 21.35 23.20 12.20 08.20 11.35 15.00

MALAYSIA 1 Kuala Lumpur MH-861 2 Kuala Lumpur MH-865

09.05 15.25

Kuala Lumpur MH-860 08.25 Kuala Lumpur MH-864 14.45

SILK AIR 1 Singapura 2 Singapura

MI-233 MI-237

08.40 20.35

Singapura Singapura

MI-232 MI-238

07.50 19.50

VALUAIR 1 Singapura (4,7) VF-582 2 Singapura (1,3,6) VF-584

08.30 20.45

Singapura (4.7) VF-581 Singapura (1,3,6) VF-583

07.50 20.00

BATAVIA AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Jakarta 5 Batam

7P-592 7P-598 7P-594 7P-596 7P-568

10.10 12.50 15.50 19.10 13.00

Jakarta Jakarta Jakarta Jakarta Batam

7P-591 7P-597 7P-593 7P-595 7P-567

09.35 12.15 15.15 18.25 11.05

SRIWIJAYA AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Batam 5 Pekanbaru 6 Banda Aceh 7 Penang 8 Padang

SJ-015 SJ-011 SJ-017 SJ-035 SJ-041 SJ-010 SJ-102 SJ-021

10.20 15.30 19.10 15.05 15.20 11.30 07.20 16.00

Jakarta Jakarta Jakarta Jakarta Pekanbaru Banda Aceh Penang Padang

SJ-010 SJ-016 SJ-014 SJ-034 SJ-140 SJ-140 SJ-103 SJ-020

11.50 18.35 20.15 14.30 15.25 14.20 09.35 14.45

JT- 381 JT- 397 JT- 301 JT- 395 JT- 303 JT- 399 JT- 383 JT- 385 JT- 387 JT- 305 JT-309 JT-972 JT-396 JT-8288 JT-8286

Ketua Komnas HAM RI Ifdal Kasim, Selasa (13/4), di sela-sela penandatanganan kerjasama pembangunan berwawasan HAM dengan Pemprovsu di Kantor Gubernur, mengatakan, kerjasama ini dilatarbelakangi kebutuhan untuk menciptakan suasana kondusif lebih terjamin pelaksanaannya.“Semoga kerjasama ini bisa memberikan arah kebijakan pembangunan yang lebih berpihak kepada rakyat, namun tidak mengabaikan kepentingan pemerintah di satu sisi,” ujarnya. Ifdal mengaku dari sudut pandang pihaknya, selama ini masih kerap terjadi gesekan kepentingan yang lebih condong mengutamakan kepentingan pemerintah dan sebaliknya mengabaikan kepentingan warga sebagai rakyat Sumut. Dari banyak permasalahan pelanggaran HAM, kasus sengketa tanah paling dominan. Sampai tahun 2007, sedikitnya ada 427 kasus pertanahan yang hingga kini belum terselesaikan, yakni di Kabupaten Deliserdang 210 kasus, Langkat 89 kasus, Simalungun 38 kasus, Labuhan Batu 28 kasus, Kota

Medan 15 kasus, Kabupaten Tapanuli Selatan 12 kasus, Asahan 10 kasus, Dairi 6 kasus, Binjai 3 kasus dan Kota Pematang Siantar 1 kasus. Di luar itu, masih ada kasus lain menyangkut berakhirnya jangka waktu Hak Guna Usaha (HGU) perkebunan PTPN 2 dengan jumlah 173 kasus. Namun PTPN 2 mengajukan permohonan perpanjangan HGU tersebut ke Meneg BUMN. Rinciannya, di Kabupaten Deliserdang 25 kasus, meliputi PTPN 3 tujuh kasus, PTPN 4 enam kasus dan swasta 12 kasus. Di Langkat 30 kasus meliputi PTPN 2 12 kasus, PTPN 4 satu kasus dan swasta 17 kasus. Di Simalungun 15 kasus meliputi PTPN 3 tiga kasus, PTPN 4 delapan kasus dan swasta empat kasus. Kemudian di Kabupaten Labuhan Batu 45 kasus, meliputi PTPN 3 enam kasus, PTPN 4 satu kasus dan swasta 34 kasus. Di Asahan 38 kasus, meliputi PTPN 3 dua kasus, PTPN 4 dua kasus dan swasta 34 kasus, Di Tapsel 11 kasus, meliputi PTPN 3 tiga kasus dan swasta delapan kasus. Karo satu kasus

(swasta). Berikutnya di Kabupaten Madina dua kasus (swasta), Tapteng dua kasus (swasta), Taput dua kasus (swasta), Toba Samosir satu kasus (swasta) dan Kota Pematang Siantar satu kasus (PTPN 3) Karena persoalan ini, Ifdal mengaku pihaknya sangat berharap Pemprovsu bisa mengintegrasikan pendekatan HAM dalam aspek atau kebijakan pembangunan. “Harapan itu kami minta bisa direalisasikan, seperti Pemprov Sumatera Selatan misalnya, yang kini sudah memberikan advokasi secara gratis kepada warganya dalam kerangka kebijakan pembangunan daerah. Demikian pula Pemprov Bali, juga melakukan hal serupa,” katanya. Sementara, Kepala Biro Hukum Setdaprovsu Abdul Jalil yang merupakan panitia penandatanganan MoU tentang peningkatan jejaring HAM itu melaporkan, hasil kerja sama yang berlaku hingga 31 Desember 2010 ini diyakini bisa memaksimalkan pelayanan perlindungan HAM warga melalui penyediaan payung hukum yang lebih komprehensif. (m19)

Tersangka Penikaman Dan Narkoba Masuk Sel MEDAN (Waspada) : Petugas Reskrim Polsekta Percut Seituan meringkus seorang tersangka kasus penikaman dan empat pemakai narkoba dari lokasi yang berbeda. Menurut Kapolsekta Percut Seituan AKP Jhosua Tampubolon melalui Kanit Reskrim Iptu Yon Edi kepada Waspada, Rabu (14/4), tersangka SAT, 21, ditangkap berdasarkan pengaduan orang tua korban penikaman Nelson Purba, 59, warga Jalan Tempua Perumnas Mandala. Penikaman dilakukan tersangka SAT, warga Jalan Seriti II Perumnas Mandala, Senin (12/4) sekira pk 01.00. Saat itu, korban Daniel Purba sedang nongkrong bersama temannya Izul dan Atas di kawasan Jalan Seriti II tak jauh dari rumah tersangka. Berawal dari tersangka minta tolong kepada Izul untuk membelikan rokok mengendarai sepeda motor milik korban. Melihat pelaku ada menitipkan uang kepada Izul untuk membeli rokoknya, korban Danie Purba marah-marah

sembari mengeluarkan katakata kotor kepada tersangka hingga keduanya terlibat adu mulut. Diduga sakit hati karena dimaki oleh korban, tersangka SAT merasa dendam. Kemudian tersangka mengambil pisau dapur dari rumahnya dan menikamkan ke rusuk kiri korban. Melihat korban terkapar, tersangka SAT pergi, sedangkan korban dibawa teman-temannya ke rumah sakit. Tak berapa lama kemudian tersangka SAT diringkus petugas Polsekta Percut Seituan di kawasan Perumnas Mandala. Menurut Iptu Yon Edi, saat diperiksa tersangka SAT mengaku perbuatannya karena dimaki dengan kalimat kotor oleh korban. Guna pengusutan selanjutnya, tersangka SAT dijebloskan ke dalam sel. Pemakai Narkoba Pada kesempatan lain, petugas Polsekta Percut Seituan meringkus empat pecandu narkoba di kawasan Jalan Bersama Titi SewaTembung dan Jalan Pelikan Raya Perumnas Mandala.

Keempat pecandu sabusabu tersebut masing-masing IP alias Wawan, 23, warga Jalan KenariVIII Perumnas Mandala, NC, 28, warga Jalan Ampera Desa Sekip, Lubukpakam, HRAD, 35, warga Jalan Jati III Gg Nasional, Kel. Teladan Timur, Medan Kota dan AS, 26, warga Jalan KH Achmad Dahlan, Lubukpakam. Kapolsekta Percut Sei Tuan, AKP Jhosua Tampubolon mengatakan, tersangka IP alias Wawan ditangkap ketika sedang mengisap sabu-sabu di salah satu rumah di Jalan Pelikan Raya dekat rel kereta api. Dari tersangkaWawan, disita satu paket sabu-sabu sebagai barang bukti. Tiga tersangka lagi, masingmasing NC, HRAD dan AS ditangkap polisi usai membeli sabu-sabu di kawasan Jalan Bersama dekat Titi sewa Tembung. “Dari ketiga tersangka disita barang bukti 2 gram shabu-shabu senilai Rp2,5 juta sebagai barang buktinya,” jelas AKP Jhosua Tampubolon sembari menuturkan, rencananya sabu-sabu tersebut akan dibawa ke Lubukpakam untuk dikonsumsi. (cat)

Tiga Personel Polsekta Medan Kota Bagaikan Selebritis MEDAN (Waspada): Tiga personel Unit Patroli Polsekta Medan Kota bagaikan selebritis yang terus silih berganti dikerumuni wartawan untuk mewawancarai mereka seputar tertangkapnya enam tersangka teroris. Ketiga personel yakni Briptu Sartono Sihombing, Bripda Hendrianto Turnip dan Brigadir Horas Hutauruk didampingi Kapolsekta Medan Kota AKP Amri Z, SH, kepada Waspada, Selasa (13/4) sore mengatakan, kami persis selebritis karena setiap saat diincar wartawan untuk diwawancarai tentang cara menangkap teroris yang merupakan buronan nomor wahid tersebut. Menurut ketiganya, keberhasilan mereka tidak terlepas dari Kapolsekta Medan Kota yang tidak bosan-bosannya menginstruksikan agar patroli ditingkatkan baik pagi, siang, sore, malam bahkan dinihari, agar situasi kawasan hukum Poltabes Medan khususnya Polsekta Medan Kota tetap kondusif. Dijelaskan Sihombing, pada Minggu (11/4) dinihari, dia bersama dua rekannya melakukan patroli mengitari beberapa ruas jalan yang dianggap rawan aksi kejahatan jalanan. Memasuki Jalan SM Raja simpang Jalan HM Joni, pukul 00.30, mereka melihat mobil Kijang plat BL berhenti di pinggir jalan kearah persis trafic light dekat Makam Pahlawan. Selanjutnya, personel Patroli mematikan lampu rotator karena mobil Kijang plat BL itu agak mencurigakan karena body kendaraan agak kotor berdebu dan kaca mobil dibuka. Jarak setengah meter dari mobil Kijang parkir, dia bersama dua rekannya turun mendekati kendaraan tersebut. Seterusnya Sihombing menuju ke arah sopir mobil plat BL itu dan memberi hormat kemudian bertanya apa maksud dan tujuan parkir di tempat tersebut. Mendapat pertanyaan petugas kepolisian, pengemudi mobil kelihatan gugup. “Kami menunggu teman membeli makanan dan minuman ringan di salah satu kedai,” tutur sopir

mobil itu ditirukan Sihombing. “Awalnya kami curiga mereka ini membawa ganja atau mau transaksi narkoba, sekaligus mencurigainya sebagai teroris karena mobil yang ditumpangi plat BL dan berdebu diduga keras dari perjalanan jauh,” ujar Sihombing. Disebutkan Sihombing, sewaktu mereka bertanya lagi kenapa tangan salah satu teroris yang dalam keadaan dibalut, terlihat penumpang lainnya mulai gelisah. “Pak polisi, tangan saya luka akibat terkena kayu dan batu,” ungkap Sihombing meniru ucapan tersangka. Selanjutnya, karena mencurigakan, Sihombing langsung mengambil kunci kotak mobil Kijang itu. Bersamaan itulah para penumpang mobil langsung berkeluaran melarikan diri secara berpencar. Melihat hal itu, ketiga personel Unit Patroli lalu dengan sigap menangkap tiga tersangka dan satu diantaranya salah satu tangannya terluka. Ketika diinterogasi, ketiga tersangka mengaku bersama lima rekannya naik mobil Kijang dari Aceh dan tidak tahu entah kemana tujuannya. Kapolsekta Medan Kota AKP Amri Z, SH, bersama Kanit Reskrim Iptu Sangkot Simaremare melihat personel ada me-

nangkap tiga tersangka diduga teroris langsung mengumpulkan anggota Unit Reskrim. Setengah jam pengarahan, para personel dipimpin AKP Amri langsung memburu para tersangka dan tempo tiga setengah jam, tiga tersangka lagi dibekuk secara terpisah. Sementara dua pelaku lagi kini masih diburon. Seputartertangkapnyaenam tersangka teroris itu, 20 personel Polsekta Medan Kota diantaranya AKP Amri dan Iptu Sangkot Simare-mare mendapat perhargaan dari Kapoltabes Medan Kombes Pol Drs Imam Margono. Dipanggil Kapoldasu Seputar tertangkapnya teroris tersebut, tiga personel Unit Patroli Polsekta Medan Kota dipanggil Kapoldasu Irjen Pol Drs Oegroseno. Didampingi Kapoltabes Medan, Kombes Pol Drs Imam Margono dan Kapolsekta Medan Kota AKP Amri Z,SH, dan Kanit Reskrim Iptu Sangkot Simare-mare SH ketiga personel itu menghadap Kapoldasu di ruang kerja Kapoltabes. Dalam pertemuan itu, Kapoldasu menawarkan kepada Briptu Sartono Sihombing untuk ikut Secapa Reguler atau Secapa Khusus (Kilat). Sedangkan kedua personel lainnya diusulkan naik pangkat setingkat. (m31)

Waspada/Ismanto Ismail

BERI SEMANGAT TERUS: Kapolsekta Medan Kota AKP Amri Z, SH, terus memberikan semangat buat tiga personel Unit Patroli yang dibantu Tim Khusus Reskrim dalam penangkap enam tersangka teroris, Rabu (13/4) sore.

Waspada/M. Ferdinan Sembiring

Puluhan eks karyawan Hotel Soechi Internasional Medan tergabung dalam SPM (Serikat Pekerja Mandiri) menggelar ritual bakar kemenyan, tabur bunga, dan membawa keranda mayat ke gedung PN Medan, Selasa (13/4). Aksi itu bentuk perotes atas putusan hakim PN Medan.

Protes Putusan Hakim

Eks Karyawan Hotel Soechi Gelar Ritual MEDAN (Waspada): Eks karyawan Hotel Soechi Internasional Medan tergabung dalam SPM (Serikat Pekerja Mandiri) mendatangi gedung Pengadilan Negeri Medan, Selasa (13/4). Dalam aksi itu, mereka menggelar ritual tabur bunga dengan membawa keranda mayat sambil membakar kemenyan dan menyiram air kembang tujuh rupa. Mereka menyiram air keseliling gedung PN Medan, sambil membaca mantera melengkapi ritual itu. Keranda mayat yang diusung bertuliskan nama Herimanto, Ibnu Afan, Karto Sirait. “Kami akan memperjuangkan hak kami, sampai titik darah penghabisan,” teriak mereka serentak. Aksi karyawan itu mengundang perhatian pengunjung

sidang PN Medan. Namun, tidak seorangpun yang memberikan reaksi atas ritual itu, semuanya hanya menonton. Sementara sejumlah personel kepolisian terus mengawal segala kegiatan buruh dalam menyampaikan orasi. “Keranda mayat ini bukti matinya keadilan di negeri ini,” teriak Purwanto mengawali orasinya dalam aksi itu. Purwanto mengatakan, putusan yang dikeluarkan oleh Hakim Karto Sirait SH sangat tidak adil dan terkesan berpihak kepada pengusaha. Di mana dalam putusannya, lanjutnya, para buruh Soechi yang telah bekerja 10 tahun lebih hanya mendapatkan jatah pesangon sekira satu juta rupiah lebih atau 15 persen sedangkan tuntutan mereka 100 persen. “Ritual ini kami lakukan

untuk mengeluarkan setan dari tubuh Karto Sirait. Hakim Ketua keluarkan dan copot Karto Sirait dari pengadilan ini,” ucap Purwanto. Mereka juga menuntut sekaligus mengancam akan mengepung PN Medan jika hakim Karto Sirait tidak dikeluarkan. “Kami akan melakukan pengepungan terhadap PN Medan jika kami tetap melihat Karto Sirait ada di Pengadilan ini, “ teriak mereka. Aksi buruh yang berlangsung beberapa saat itu, tidak mendapat tanggapan dari pihak PN Medan. Meski demikian, tidak menurukan semangat karyawan melakukan orasi, malahan semakin bersemangat meneriakkan bagaimana keadilan itu telah mati. Puas dengan orasinya, mereka membubarkan diri dengan tertib. (h05)

Poldasu SP3 Kasus CPNS Gate RE Siahaan MEDAN (Waspada): Penyidik Satuan III Tipikor Direktorat (Dit) Reskrim Polda Sumut, akhirnya mengeluarkan Surat Pemberitahuan Penghentian Penyidikan (SP3) kasus CPNS Gate RE Siahaan. Sebelum dikeluarkannya SP3, Poldasu telah enam kali menerima pengembalian berkas berita acara pemeriksaan (BAP) kasus ‘CPNS gate’ Walikota Pematang Siantar, Ir RE Siahaan karena dianggap tidak lengkap (P19). ”Ada enam kali BAP yang bersangkutan dikembalikan jaksa penuntut umum karena P19,” ungkap Kasat III Tipikor AKBP Prastiono kepada wartawan, Selasa (13/4). Dijelaskan Prastiono, pihaknya tidak mampu memenuhi petunjuk jaksa untuk melengkapi BAP RE Siahaan. “Pertama karena sudah meninggalnya saksi mahkota mantan Sekda Pemko Pematang Siantar,” jelasnya. Selain itu, Polda Sumut juga tidak memperoleh dokumen asli yang dimintakan ke Badan Administrasi Kepegawaian Negara (BAKN). “Jadi, dua permintaan jaksa penuntut itulah yang tidak mampu kita lengkapi,” jelas mantan Kapolsekta Percut Sei Tuan tersebut. Dia tidak menampik kasus ‘CPNS gate’ RE Siahaan akan diSP3. Saat ini, berkas pengajuan SP3 tersebut telah di tangan Direktur Reskrim Polda Sumut, Kombes Pol Agus Andryanto untuk diteruskan ke Kapolda Sumut Irjen Pol Drs Oegroseno.

“Benar memang mau diSP3 dan sekarang berkas pengajuannya sedang di tangan Pak Dir (direktur reskrim-red),” ujarnya. Sesalkan Direktur Eksekutif Lembaga Informasi Indonesia (LII), Parlin Sinaga, Selasa (13/4) mengatakan, sangat menyesalkan tindakan hukum yang menghentikan penyidikan kasus ‘CPNS gate’Walikota Pematang Siantar, Ir RE Siahaan. Sebab, sebut Sinaga, untuk menjadi seorang tersangka dalam kasus dugaan tindak pidana korupsi, kolusi dan nepotisme, penyidik Tipikor Polda Sumut sudah memiliki awal yang cukup. Namun, setelah sekitar tiga tahun ditangani, kasus tersebut kemudian akan di SP-3 sehingga menimbulkan kecurigaan terhadap penyidik. Padahal, setahu Sinaga, setiap pergantian Kapolda Sumut, kasus itu selalu ditindaklanjuti. “Jangan karena sudah ditangani bertahun-tahun, kalau memang sulit melengkapi BAP-nya, kenapa penyidik menetapkan tersangka, itukan berarti harus maju ke pengadilan,” kata Sinaga. Sebelumnya, Kabid Humas Polda Sumut Kombes Pol Drs Baharudin Djafar melalui Pelaksana Harian (Lakhar) AKBP MP Nainggolan menyatakan, kasus ‘CPNS gate’ walikota Pematang Siantar, Ir RE Siahaan akan di-SP3, karena BAP-nya tidak mampu dilengkapi. Jaksa meminta agar penyidik kepolisian menyertakan dokumen asli dari BAKN dalam

BAP. Sementara Polda Sumut hanya memiliki dokumen fotocopy, sehingga tidak sesuai dengan petunjuk/permintaan jaksa penuntut. “Ada surat asli dari BAKN yang diminta oleh penuntut, tapi kita hanya punya foto copy. Aslinya sudah kita cari, tapi tidak ada,” ujar Nainggolan. Laporan tersebut bermula dari pengadaan CPNS Tahun 2005 sebanyak 707 orang terdiri dari 451 tenaga honorer dan 256 orang pelamar umum. Dari pelamar umum dinyatakan lulus sebanyak 240 orang dan tiga orang mengundurkan diri sehingga yang berhak melengkapi Administrasi untuk pengangkatan sebanyak 237 orang. Namun kenyataannya, dalam pengajuan NIP diusulkan sebayak 256 bertambah 19 orang, terdiri dari 11 orang tidak lulus seleksi tahun 2005 dan 8 orang tidak mengikuti test tahun 2005 namun ikut test pada tahun 2004 dan dinyatakan tidak lulus seleksi. Di antara 19 orang tersebut merupakan keluarga pejabat Pemko Siantar, yaitu keluarga Ir RE Siahaan, Tagor Batu Bara, SH (almarhum), Drs Morris Silalahi (Kepala BKD) dan Drs Tanjung Sijabat (mantan Kepala BKD). Kuat dugaan, pengangkatan ke 19 CPNS itu telah memenuhi unsur kolusi dan nepotisme dan bertentangan dengan peraturan Kepala BKN No 22 Tahun 2005 tentang pedoman pelaksanaan pengadaan CPNS tahun 2005. (m39)

Sumut Targetkan Guru S-1 MEDAN (Waspada): Dinas Pendidikan Provinsi Sumatera Utara menargetkan seluruh guru SD, SMP dan SMA di Sumut berijazah S-1 pada 2013. Saat ini terdapat 189.713 guru yang terdiri atas 90.749 PNS dan 98.964 guru bukan PNS “Pada 2013 seluruh guru di Sumut harus S-1,” kata Kepala Dinas Pendidikan Sumut, Bahrumsyah di Aula Transparansi Dinas Kominfo Provsu, Selasa (13/4). Menurut Bahrumsyah, dari jumlah itu 108.116 guru masih belum memiliki jenjang pendidikan S-1 dengan perincian berpendidikan SLTA 63.168 orang, Diploma-1 sebanyak 4.781 orang, Diploma-2 28.574 orang dan Diploma-3 11.593 orang. Katanya, jumlah guru yang belum berijazah S-1 itu telah berkurang karena 16.199 orang sudah mengikuti program pendidikan kesarjanaan pada 2008-2009. Untuk membangkit-

kan motivasi kalangan guru di Sumut meraih ijazah kesarjanaan, lanjutnya, Dinas Pendidikan Sumut akan menanggung seluruh biaya perkuliahan, termasuk biaya-biaya yang akan dikeluarkan terkait proses pendidikan. Selain berijazah S-1, Dinas Pendidikan juga merencanakan program pengoptimalan teknologi informasi dan komunikasi bagi tenaga kependidikan di daerah itu. Salah satu cara untuk meralisasikan program itu adalah menyediakan laptop bagi tenaga kependidkan di Sumut. “Konsepnya one teacher one laptop,” katanya. Kebocoran soal Bahrumsyah juga mengatakan, kebocoran soal Ujian Nasional (UN) di daerah ini telah terjadi selama enam tahun. Untuk UN 2010, katanya, pihaknya menemukan kebocoran soal UN di SMA Negeri 2 dan SMA Teladan Medan. Dari

pemantauan sementara, hampir semua hasil UN siswa di dua sekolah mendapatkan nilai yang sama karena sebelumnya diduga telah mengetahui soal. Pihaknya telah mengoordinasikan temuan itu dengan Badan Standar Pendidikan Nasional (BSPN) untuk mengambil kebijakan yang dibutuhkan. “BSPN menganjurkan UN di dua sekolah itu diulang,” katanya. Bahrumsyah menambahkan, berdasarkan informasi dari pihak kepolisian, pihaknya belum mendapatkan informasi mengenai dugaan keterlibatan kalangan guru dalam kebocoran soal UN tersebut. Namun dari perkembangan sementara, kebocoran itu diketahui berasal dari CV BU yang menjadi rekanan Dinas Pendidikan Sumut dalam mencetak soal UN.“Jika ada penetapan dari penegak hukum, kami akan mem-black list (memasukkan daftar hitam) perusahaan itu,” katanya.(m19)

B4 1 CM 2 CM


Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000


AUTOMOTIVE Informasi Pembaca


Bursa Automotive

: Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower


: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

BMW 318I THN ‘90 WARNA BIRU H rg 2 0 J t / n e g o H u b . ( 0 6 1 ) 7742.4248 - 0813.61111.555

BMW 530i A/T. Thn. 95. Hitam, jok kulit, Electric Seat, Sisa 12 bulan x 2.056.000. Hub. 0812 6500200

5 CM 6 CM

Rp. 65.000 Rp. 78.000

MITSUBISHI L300 MB Star Wagon AC DBL, Warna putih thn. 2005. Hub. 0816 3317 75

MITSUBISHI L300 Thn. 07. Harga 115 Jt. Power Steering, Mbl sehat. Kembar Mobil. Jl. Tritura No. 9 HP. 0812 6058 6666

TOYOTA Kijang Super G Thn. 95. AC, Tape, VR, BR, PS, Mulus. Siap pakai. Harga 65 Jt. Hub. 0812 650 8819

DAIHATSU PAKET MERIAH - New Xenia VVT-I....DP Dimulai 12 Jutaan - New Pick Up Granmax....DP Dimulai 5 Jutaan - Terios TS Ekstra....DP Dimulai 15 Jutaan DP Min. 10%. Proses Cepat & Data Dijemput. Hub. Teddy Capella 77884663 / 0812 6325 656

L300. Angs. 3Jt-an. Pajero Sport (Ready Stock). T120 SS, Cold Diesel 110 PS, 125 PS, Triton. Serius Hub. (061) 76728071 / 0812 653 3319

PROMO DAIHATSU HADIAH & DISKON Xenia DP 11 Jt-an, Angs. 2,9 Jt Terios DP 13 Jt-an, Angs. 4 Jt-an Luxio DP 12 Jt-an, Angs. 3,9 Jt Gran Max. Pick Up & MB DP 5 Jt-an, Angs. 2,5Jt. Hub. Ger y 0813 76941988 / 77722561

MITSUBISHI L300 Starwagon AC DB. Thn. 2007. Pwr. Steering. Pjk br. Perpanjang. a/n. Sendiri. Hub. 0813 607 46112

DAIHATSU Taruna Th. 2000. Jual CEpat. Warna abu2 tua metalic, AC, Tape, lengkap. BK Mdn asli, mesin sehat, body sangat mulus. Tinggal pakai. Harga 76 Jt. Hub. (061) 777 313 99

MERCY C-180 ‘95 W/Hitam. BK Medan Asli. Mulus, VR, BR, RT. Komplit. AC Dingin. Harga 75Jt/Nego. Hub. 0812 655 6417

DAIHATSU ROCKY TH. ‘90 Warna Hitam 4x4 Cantik, mulus, AC, VR, BR, Hub. 0813 9745 2719

MERCEDES Benz E230 Hitam met. Thn. 91 A/n. Sendiri, sgt orisinil, mulus dan mewah. Velg 18. Sound Sistem. Hrg. 49Jt. Nego. Hub. 0813 7550 1012

# ASTRA DAIHATSU BARU # * Xenia DP: 12 Jt. Terios DP: 16 Jt * Pick-Up DP: 6 Jt Luxio DP: 9Jt Proses cepat. Data dijemput + Hadiah Hub. Kalpin 0852 7041 9000

NISSAN READY STOCK Grand Livina, Livina X-Gear, Livina XR. New X-Trail. Bunga Ringan + Discount Menarik. Hub. 0852 6132 3479

DAIHATSU Charade CS ‘87. Merah, VR, BR, 4 Ban Baru, AC, RDO TP. Body mesin, mulus, BK Asli Mdn. Hrg. 22 Jt/Nego. Hub. 0852 61020 516 T. Perantara.

DAIHATSU Rocky 4x4 Thn. 94. BK Medan, AC, Tape, VR, BR, PS, Mulus. Siap pakai. Harga 68Jt. Damai. Hub. 0812 650 8819 DAIHATSU Taft GTS (4x2). W. Hitam. Th. ‘91. AC/Tape, CL, PS, Siap pakai. Harga damai. Hub. Jl. Alfalah I No. 14. Glugur Darat. Telp. 061.77230319 TP. DAIHATSU Xenia Xi VVTi 1.3 Thn. 2007. Warna Hitam, BK Medan Asli, satu nama dari baru, mulus. Pajak Full 1 Thn. Hub. 0813 96101 939 DAIHATSU Feroza Spesial Edition 95/ 96. W. Hijau Silver, Paket BK Medan. Mobil orisinil. Balik DP 17 Jt. Sisa 1.600.000 x 29 Bulan. Hub. 0812 6477 946 HONDA CIVIC GENIO THN. 92 W. Merah met. AC, Tape, VR, BR, BK Medan (Full 1 thn). Mesin sehat, Body sgt mulus, originil, jarang pakai. Harga: 55 Jt/damai. Hub. 0813 7618 8118

TOYOTA Kijang Capsul Model LGX New. Bensin 1.8. Thn. 2003. Wrn. Hitam, BPKB 1 nama, Asli Mdn, VR, BR, PS, PW, CL, RMT, E. Miror, DVD Sound Power, AC DB, Hrg. 128Jt. Nego. Hub. 0813 7644 7297

TOYOTA Innova G Bensin A/T Thn. 04. Hitam met, Plat B. Rp. 145 Jt. Hub. 77756768

MITSUBISHI L300 Thn. 08. Harga 120Jt. Power Steering. Mobil sehat, cantik, siap pakai. Kembar Mobil. Jl. Tritura No. 9 HP. 0812 6058 6666

Terios (Tape + AC), DP 14 Jt-an + Hadiah Xenia (Tape + AC) DP 13 Jt-an + Hadiah Proses cepat Hub. Jaya 0813.6177.3589

Rp. 91.000 Rp. 104.000

MITSUBISHI V6-24 Thn. 98. Warna silver, Velg 17. Ban 90%. Mobil siap pakai. Harga Nego. Hub. 0812 6422 7771 - 061.7637 0666

NEW Xenia DLX................DP 12 Jt-an New Terios........................DP 14 Jt-an New PU Grand Max...........DP 5 Jt-an Luxio M & MB Grand Max...DP 14 Jt-an Hub. Tian 0813 6121 3567 / 77399677


7 CM 8 CM


OPEL Blazer Montera 2001. Mulus, Orisinil, BK Medan. Lengkap. Siap pakai. H. 70Jt. Lanjut Kredit Balik DP 30 Juta. Sisa 2.600.000. A 14 Bulan. Hub. 0812 6477 946



Thn. 97/98. Abu-abu Silver AC, Tape, PS, PW, CL, VR. BR. Mobil sangat mulus. Hrg. 65,5 Jt Damai. Hub. Rumah Makan Surya Baru. Jl. Karya No. 90 Sei Agul 20 Mtr. Dari Simpang (4) Lampu Merah. SENSASI SUZUKI 100% BARU Carry PU DP Hanya 5 Jt-an Splash ST DP Hanya 15 Jt-an APV GL DP Hanya 14 Jt-an Ready Stock Swift, SX4, G. Vitara 2.4. Hub. 0812 654 0809 - (061) 77722121

SUZUKI Sidekick Thn. 96. Warna ungu. BK Medan, mulus, PW, PR, AC, Tape, Hrg. 72 Jt/Nego. Pajak baru. Hub. 69912366 - 0812 6377 9410. Jl. Bajak V No. 80 A Medan Amplas. SUZUKI Baleno 97. W. Hitam, lengkap. H. 71 Jt/Nego. 1 Tangan. Velg 18. Sound System. Mobil seperti baru. Hub. 061-3031 3617

SUZUKI Side Kick Thn. 1996. Warna Hijau Met. Lengkap. Hub. 061.7344771. HP. 0813 7007 5355. Harga: 71 Jt damai.

SUZUKI Katana thn. 95 GX, warna hijau. Harga 47 Jt. Mobil Sht. Mulus, Kembar Mobil. Jl. Tritura No. 9 HP. 0812 6058 6666

HYUNDAI Avega SG Matic Thn.08. Abu met, BK Mdn Rp. 103Jt. Hub. 0816 3113 953 ISUZU Panther Grand Deluxe Th. ‘95. AC, VR, BR, CL. Rp. 55 Jt/Nego. Ban 90% Baru. 0852 6231 3425 ISUZU PANTHER ‘97 Hi Grade 2500cc. Merah Metalic. Complete. Hub. 0813 9700 3086

AVANZA, RUSH, INNOVA, FORTUNER, YARIS, VIOS, ALTIS, CAMRY, HILUX. DP + Bunga Ringan. Hub. 0813 7512 7297 - (061) 7795 1428

KIA Carens II Thn. 2005. Hitam Km. 33 Ribu. BK Mdn Asli Rp. 97Jt. Hub. Jl. Gatsu Km. 5,5 Gg. Banteng. Komp. Taman Impian Indah Blok. A 10. 77471599.

TOYOTA Kijang Super Standard 93, Warna merah, BK Medan, AC, RT, VR, BR. Kondisi sehat, siap pakai. Harga 52 Juta Nego. Hub. 0812 7600 2475

KIA Sportage 4x4 2000 Bensin. Mulus, originil. W. biru, BK Medan, cantik. siap pakai. Lengkap. H. 70Jt. Nego. Hub. 0812 6477 446

TOYOTA GREAD COROLLA SEG ‘96 Wrn Biru met, VR, Ban Baru, Tape, CD, Luar dalam, Original. BPKB 1 nama BK Asli Medan. Mulus, siap pakai. Khusus pemakai. Hrg. Nego. Hub. 0813 9770 0119.

TOYOTA SE Salon ‘87. Warna merah, mobil cantik, mulus, AC, Tape, VR, BR, Hub. 0813 7530 1722 TOYOTA BARU

TOYOTA Kijang LGX Silver Bensin Dijual. Thn. 2004. Kondisi 90%. Km. 34 Rban. BK Medan. Hrg. 150 Jt. Nego. Hub. 0813 7683 3186 TOYOTA Kijang LGX Th. 2001 Akhir. Warna biru Mika. AC DB. CD Velg Rac. Ban Radial C. Lock. P. Window. Mulus sekali. Lihat duluh baru Tawar. Hub. 7754 7323 - 0816 3124 358

TOYOTA Kijang Kapsul SSX Thn. 2002. Warna biru mica. 1.8 Efi. Plat BA. Buku 1 nama, Luar dalam orisinil. Cat masih asli. Harga 105Juta Nego (BU). HP. 0813 6195 3558 - 0815 3064 145 TOYOTA Kijang Capsul LGX Solar Thn. 2000. BK Medan, Gold Metalik, VR, BR, AC, DB, CL, PS, PW, Remot, lengkap. Telp. 7863182 HP. 0812 63000077

NEW CRV 2003, Matic. W. Hitam, Tgn. I. Hub. 0811 64 7679 MOBIL KIOS JUALAN Thn. 85. Hi Jet. 1000. Cantik, Sama Isi. H. 8 Jt. Hub. 0812 6545 5204



NINJA (RR) Thn. 2008. W. Merah. Mulus. Hrg. 26,7Jt Nego. Hub. 77449989 - 0812 6081 8019

HONDA Supra X 100 Thn. 2002 Dijual. 1 Tangan. Hub. 0813 9754 5203 VESPA 2000 Dijual Ekslusif. Cat Asli BK Medan. Mulus. W. Biru, siap pakai. H. 4Jt. Hub. 0812 6472 6918

9 CM Rp. 126.000 10 CM Rp. 140.000


11 CM Rp. 165.000 12 CM Rp. 180.000

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000






Jaminan Apa Saja, Sertifikat Tanah. Proses Cepat, Syarat Mudah. Hub. 061-8222774, HP. 0816 314 1807

BUTUH DANA CEPAT Jaminan BPKB Mobil. Thn. 93 Up. Proses Cepat. Hub. Mr. Yans. 061-77631725 - 0812 6357 6669


BPKB Mobil / Truk Sertifikat / SK Camat 0813 9702 6263 / 7706 0718


1 Hari Cair Bunga Rendah, Dan Terjamin (Dlm/Luar Kota). Spesialis Leasing BPKB Mobil, Truk, Spd. Mtr. Terima Mobil yang masih kredit, over leasing. Dan Bantu Pelunasan BPKB. Hub. S8F Finance 061-8445716 - 0813 7044 6633 ANDA BUTUH DANA Pinjaman 1,5 s/d 10 Jt. Jaminan Khusus BPKB Sepedamotor bunga 1,5%, disc ansuran 1x. Hub. PT. Sinarmas Multifinance. 061-7634 4221, 0812 6010 3321



Rp. 5 Jutaan



ELEKTRONIK JUAL KOMPOR GAS & Elpiji, Tungku Masak, Regulator, Sparepart, kompor 2 tungku mulai 100rb an. (Grosir & Eceran). Hub. Alpha Omega Trade. Jl. Ayahanda 2F Mdn. Telp. 061-4562282, 76562900

Fax. 600rb Laptop Pentium IV 2 Jt, Printer Epson 450 Rb. Hub. Senang Hati: 4517509 - 7707 3637

Jl. Sekip 67 A (Bisa T.T. Baru/Bekas)


TV, PS 1, 2, 3. Handycam, Camera, LCD Projector, Laptop, Kulkas, M. Cuci, Tape Compo, Sound, dll. Hub. MARKET ELECTRONIK Telp. 8210097 - 66900693 Jl. Setia Budi No. 424B Dkt. Simp. Psr. III T. Sari.


Tel. 7718-8318 JL. RANTANG 20 S - Sony 8 Gb=198rb Sales - servis -spart - LCD Baru = 893 Rb -LATOP BARU acer=2 Jt-an “LCD Baru=893Rb LATOP Core3?-acer 4732-4736-4720-4520? P4 + Tv17”+Princolor+camera=2Jt Mb-Latop core2.Acer=1.8Jt. LCD latop acer=1 Jt PROJECTOR BARU=4 Jt-an -camera pulpen 449rb -Paket:Warnet Fesbuk-Poker=Jamin-mura Modem=299rb-HSPA+k.indosat=379rb. XI-simpati? CCTV / Prin baru color 399rb -Pusat Serba mura Grosir: Hd40ide-LCD-LATOP - BATRE-dvd -Adator Latop 99Rb. - Servis Latop / LCD Proyektor Garansi BARANG BARU & BERGARANSI


P4 INTEL 3.2 Ghz P4 Core Duo 1.8 PIV Core Duo 2.2 P4 Core Duo 2.6 P4 Core2 Duo 2,93

=> RP. 2.350.000 => Rp. 2.400.000 => Rp. 2.425.000 => Rp. 2.450.000 => Rp. 2.925.000

ACESSORIES: - Menjual Printer Canon - Printer Epson - Meja Computer * Modem HSDPA GSM / CDMA, Dll... * Menerima Servisan Computer & Printer

Monitor, Dll. Bersedia Dipanggil. JUAL KOMPUTER BARU DAN BEKAS Hub. 4562282, 76562900



Harga Pameran TERMURAH!!!

Bonus: Coolpad, Bag, Bluetooth, Mouse, dll.

Kunjungi Segera Pameran Kami

Medan Mall 0812 6455 7274 Binjai Super Mall 0813 6125 4113 Plaza 0813 9742 2213 Mil enium 0813 9693 0390 Aksara Carrefour Garden 0812 6534 4059 Medan Plaza 0852 6109 4014 Siantar Plaza 0813 9650 7030




Merk terkenal, tidak diragukan lagi kualitasnya Lagi Diskon besar-besaran Kini kami berada lebih dekat dengan anda


HUB. 061 77972065 HP. 0812 6566 7521


Telp. 77677220 HP. 0813 7536 4412





RIDWAN, 77621674,



0812 6303 4400

REPARASI AC, KULKAS, MESIN CUCI Kompor Gas, Dispenser H & C TV, M. Pompa Air Sanyo

Hub. SURYA TEKNIK SERVICE Telp. 66482216 - 0813 7589 8757 Siap Ketempat




TERCECER Surat Akte Pelepasan Hak/Ganti Rugi No. 5922 / 546/1987. Atas nama: Ir. Rosman Ali Nst. Terletak: Kecamatan Percut Sei Tuan. Luas: +/- 412,50M2. HILANG Akte Jual Beli rumah dan pengoperan hak dengan ganti rugi No. 44. Tgl. 11 Juni 1988. a/n. Muhammad Gultur. Yang terletak di Karya Lingkungan 17 No. 3.


1 Buah BPKB Mobil asli BK 1713 DK. a/n. Pompar Jhon Trayessa Sitorus. No. BPKB 8669086. Tercecer di Medan dansekitarnya. Trims.


BPKB Sepeda motor RX King BK 3424 FO tahun 2001. atas nama SAFI’I Alamat Desa Limau Manis Kec. Tanjung Morawa, Tercecer pada hari Selasa 13 April 2010 di sekitar simpang timbangan Lubuk Pakam.

LASITECH COMPUTER Jl. Prof. HM. Yamin SH. No. 41-V Telp. 061 455 3023 - Medan





WC TUMP AT, Sal. AIR, K. Mandi TUMPA Tel. 081361718158, 77008458 NARO SERVICE Jl. Sisingamangaraja





Jl. Brayan Medan

8442246 WC 08126427 1725

Tumpat Sedot




Keterangan lebih lengkap silahkan hubungi:

Ada Garansi



Jl. Gatot Subroto Medan Ada Garansi


TELPON : 061 - 4576602 FAX : 061 - 4561347

Hub. 8219951 Jl. Setia Budi No. 2

* Format: JPG - TIFF (Photoshop)







Keterangan lebih lengkap silahkan hubungi:

TELPON : 061 - 4576602 FAX : 061 - 4561347

Jl. Zainul Arifin No. 3 - Stabat Telp. (061) 8912503

* Format: JPG - TIFF (Photoshop)

CV. RAFFISINDO EXPRESS, bergerak dibidang industri dan perdagangan membuka devisi baru. MEMBUTUHKAN SEGERA !!! Karyawan/ karyawati untuk menempati posisi: A. Staff: Gudang, ADM dan Sekretaris B. Management Trainner: Manager, Ass. Manager dan Supervisor Bagi yang memenuhi, syarat: - Lulusan min. SLTA, D1 sederajat - P/W Single, Usia max. 25 tahun, Tidak sedang kuliah dan bekerja - Pengalaman tidak diutamakan Antar lamaran surat lamaran ke: Jl. Bambuan arah Pajak Baru No. 9A Paya Mabar Stabat, Kabupaten Langkat Sumatera Utara


Perusahaan Electronic terkemuka di Selangor, Membutuhkan Tenaga Kerja Wanita sebanyak 1000 orang untuk dipekerjakan di kilang:

WESTERN DIGITAL M SDN. BHD DI SELANGOR (BUKAN PERUSAHAAN OUTSOURCING/ CONTRACT) A. SYARAT PENDAFTARAN: 1. Wanita umur 18 s/d 30 tahun 2. Pendidikan minimal SMP/ SLTA, sederajat 3. Membawa foto copy Ijazah, KTP, Kartu keluarga (asli dibawa sewaktu interview) 4. Membawa pas photo warna 3x4: 3 lbr B. GAJI: - Gaji kasar sebulan RM 1.286 (untuk bagian Cleanroom) - Gaji kasar sebulan RM 1.150 (untuk bagian non cleanroom) - Bonus tahunan C. FASILITAS - Levy subsidy 100% - Asrama tiket pulang, kemudahan, kesehatan, asuransi, berangkat naik pesawat terbang - Biaya proses pemberangkatan dapat dicicil setelah TKI bekerja di Malaysia besarnya ccilan/ potongan adalah sebesar RM 75/ bulan selama 2 tahun D. JADWAL PENDAFTARAN/ JADWAL SELEKSI: - Setiap hari kerja Segera daftarkan diri anda sekarang juga ke:


SIUP NO: 629/MEN/2006 JL. KAPTEN MUSLIM NO. 89C MEDAN TELP: (061) 845.2956 / 847.1840/ 846.8759 (DEKAT RSU SARI MUTIARA) Contact Person: Mega 0812.6408.0074 - 0813.6764.67222 0878.6827.7444 (Ibu Veronika)





Hari Sabtu & Minggu Tetap Buka



HONDA Revo Absolute Thn. ‘09. Bln. 10. Hitam. Mulus spt. baru Rp. 9.5Jt. Maaf TP. Hub. 0811 65 1368

Jl. A.R. Hakim No. 70 D/E Medan Telp. (061) 7333213

Dibthkan Helper 10, Surveyor 15, Teknisi 5, Supervisor 4, Ass. Manager2, Syarat: Tmtn min SMU, tdk terkt kerja/ kuliah. Penghasilan tinggi, antar lmrn anda ke: Jl. Tritura/ A.H. Nasution No. 15A Simpang Titi Kuning Medan Selatan

Spesifikasi: Motherboard - HDD 160 GB Seagate - DVD Room. DDR2 512 MB - Casing ATX / Monitor 17” Flat - KB + MS Optical. Bonus: Speaker - Cover - M. Pad - X.Fan



Beberapa orang Tukang cetak dan Cor ancuran yang berpengalaman Hub. 0811.604.5612




Jl. SM. Raja Km. 2,7 No. 67-B Telp. (0624) 327997



JL. HOS. COKROAMINOTO NO. 64/74 CALL... MEDAN - 061.4577043 / 0813 6172 1034

Tel: 4525462 - Fax. 4151359

Jl. Besar Medan - Batang Kuis Pasar X samping SPBU Telp. (061) 7385347

Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput




TV mobil 1,7 Jt. LCD LG 19”=2.5 Jt. 43” Sony= 8,5Jt. 34” Sony=2,5Jt, 32” 29”Baru/Bekas =900rb s/d =2.3 Jt. 14”/21” = 300rb s/d= 975rb, DVD=260rb, TV DVD - Vortabel = 1,2Jt. PS 1 - 400rb. PS2= 800rb. PSP = 1,8Jt. Camera, Mini DV, DVD Hi 8 = 500 rb s/d=2,3 Jt. P.Yejtor =3,5Jt. Ampli, Spk Power, Mixer, BMB, Peavey, ADC, dll.




Spesialis Surat Tanah, SHM/SK Camat Khusus Kotamadya Medan Bunga Rendah, 1 hari Cair Terima Take Over Bank, Kredit macet dan Bantu Kredit Bank. Terpercaya, Aman dan Terjamin Hub. Jono. 0812 6095 5531, 061-7685 4885


Kamis, 15 April 2010


Dicari Guru Private (Byr Tinggi), TK, SD, SMP, SMA semua pljrn penglmn/ tdk SMS data: 0852.6210.3287 LOWONGAN KERJA Wanita (Gadis/ janda) dididik mjd: - Prwt anak (gaji 600 Rb - 1 Jt) - Prwt org tua (Gaji 650 - 1,2 Jt) Bersih/ ditambah uang kerajinan/ bln Hub. “Cahaya” (061) 453.1124/ 0852.7552.3457 Jl. Ayahanda 73C Medan



Model dorong dan engsel dilengkapi 4 bh remote control, 2 bh kunci release manual (listrik mati), Harga terjamin Hub. 7766.4096


Sebuah Perusahaan Meuble PMA di KIM I Medan, menawarkan penjualan dead stock material ex import & lokal. Calon Pembeli yang berminat dapat menghubungi Perusahaan dalam jam kerja ke:

Telp. (061) 685.1418


Tukang pangkas (Muslim), di Jl. Karya Hub. Pangkas Barona HP. 0813.7031.3881


Pakaian wanita yang berminat hubungi: 0852.7016.6065 0812.6306.2313


Min. SLTA, cpt krj Usia max. 35 thn Hub: Jl. KH. Wahid Hasyim 92 Medan Telp. 7623.5314 91583487, 453.3875, 456.9269 Jl. Karya Wisata No. 23 A Johor, TP. 786.1690 Medan


mencari Agen/ Sales Freelance Pglmn Slrh Indo Kunci Jwbn + Pmbhsn + Silabus + RPP Hub. Widodo (021) 7431418 085885680505



Tenaga kerja wanita yg mahir menjahit dibidang konveksi yg berpengalaman Bagi berminat hub. 0816.331.416 Herman Tanjung Jl. Rajawali 2 No. 8A P. Mandala


Peluang Kerja Langsung (COMPANY) dengan sistem penggajian tertinggi saat ini untuk 40 orang di Perusahaan termuka: FAIRCHILD SEMICONDUCTOR (M) SDN. BHD di Bayan Lepas Penang dengan persyaratan sebagai berikut: ˆ Wanita, umur: 18 s/d 30 tahun ˆ Tamat SMU/ sederajat Fasilitas: - Gaji pokok: RM 570/ bulan (belum termasuk lembur) - Tunjangan shift : RM 138/bulan - Tunjangan kehadiran : RM 40/ bulan - Tunjangan makan : RM 20/ bulan - Kenaikan gaji pokok : RM 20 (setelah 3 bulan) - Kenaikan Gaji RM 20 sampai RM 30 setiap 6 bulan pada bulan Februari dan Agustus - Kesempatan lembur - Diberikan Bonus Tahunan dan Bonus Keuntungan (tergantung kemajuan perusahaan) - Asrama dan perlengkapannya, transportasi dan asuransi - Diberangkatkan dengan pesawat terbang ˆ Testing dilaksanakan pada hari Rabu & Kamis, 14 & 15 April 2010 dimulai jam 08.00 pagi Pendaftaran dilakukan setiap hari dengan membawa: Copy KTP, Pasphoto 3x4: 2 lembar, Copy ijazah, Copy KTP orang tua/ yang memberi izin, Copy kartu rumah tangga Untuk pendaftaran datang langsung ke:

PT. AL WIHDAH JAYA SENTOSA Jl. Setia Budi No. 74-C (Sebelah Showroom Yamaha, dekat Jl. Simpang Sei Serayu) Medan 20122 Telp. (061) 821.5444 (Hunting)









Jl. Sutomo No. 436 Medan 20231 (samping Bank Maspion) Telp. (061) 452.2588 - 415.7504 - 455.7204 - 455.71494 Fax. (061) 415.7504 SUMUT - INDONESIA

Agenda Oprah Winfrey Aseksual?

WASPADA Kamis 15 April 2010

Penulis khusus biografi kaum pesohor, Kitty Kelley, mengatakan pembawa acara terkenal Oprah Winfrey telah menumpahkan banyak energinya untuk karir sehingga perempuan paling berpengaruh di dunia pada bidang media dan bisnis itu tidak punya waktu untuk kehidupan pribadinya. Kelley lalu menyebut Oprah aseksual.

Oprah Winfrey/

07.30 Si Doel Anak Sekolah 09.00 Musik : Dahsyat 11.00 Silet 12.00 Seputar Indonesia Siang 12.30 Sergap 13.00 Parade Film Keluarga 15.00 Piala Indonesia 32 Besar Persija vs Persikab 17.00 Seputar Indonesia 17.30 Hannah Montana 18.00 Kemilau Cinta Kamila 19.00 Safa Dan Marwah 20.30 Dia Bukan Anakku 22.00 Master Joe Limbat In Action 23.30 The World Cup Final 01.30 Seputar Indonesia Malam 02.00 Piala Indonesia 32 Besar Persela vs Pesiba Bantul


07.30 Musik : Inbox 09.30 Halo Selebriti 10.00 FTV Pagi 12.00 Liputan 6 Siang 12.30 FTV Siang 14.30 Status Selebritis 15.00 FTV Sore 17.00 Liputan 6 Petang 17.30 Cinta Juga Kuya 18.00 Buku Harian Baim 19.00 Mawar Melati 20.00 Cinta Fitri 21.30 Kesetiaan Cinta 22.30 FTV 00.30 Liputan 6 Malam 01.00 Buser

07.00 Casper 07.30 Disney Club 08.00 Tom & Jerry 10.30 Di Antara Kita 11.00 Sidik 12.00 Layar Kemilau 13.30 Cerita Sore 14.30 Go Show 15.00 Tom & Jerry 15.30 Disney Club 17.00 TV Champion 18.00 Gatot Kaca 19.00 Upin & IPin 20.00 Viva Dangdut Mania 23.30 Cerita Malam 01.00 Cerita Malam

RUMAH Dijual LB. 6x16m, Mdl minimalis 1½ Lantai, SHM, PLN, PAM, Keramik + Pagar, 2 KT, 1 KM Jl. Platina VII sblm Kplx Bank Titi Papan - Medan 0813.7676.1076

Informasi Pembaca Bursa Property

RUMAH Dijual Jl. Perwira III No. 145 (depan Kodam Jalan Binjai), SK Camat, Luas Tanah 405² (27x15), TP Hub. 0813.7003.1597


07.00 Pororo The Little Penguin 07.30 Animal Mechanicals 08.30 Espresso 09.30 Sinema Religi 11.30 Topik Siang 12.00 Musik : Klik 13.00 Tawa Sutra XL 14.00 Amor Heroes 15.00 The Serpents Embrace 17.30 Topik PEtang 18.00 Seleb Ngamen 18.30 Super Family 19.30 OMG 20.30 Tawa Sutra 23.30 Mata Rantai 00.00 Topik Malam 00.30 Lensa Olah Raga

07.30 FTV Pagi 09.30 FTV Drama 11.30 Patroli 12.00 Fokus Siang 12.30 Happy Song 14.30 KiSS Sore 15.30 FS My Fair Lady 17.00 Nurhaliza 18.00 Sinetron Jangan Ambil Anakku 19.00 Take A Celebrity Out 22.00 Sinema Asia 00.00 Fokus Malam 00.30 Film Seri The Sword and The Chess

sementara keuntungan keuangan yang dia peroleh amat lebih dari cukup untuk menopangnya,” kata Kelley. Oprah menolak diwawancarai berkenaan dengan bukunya yang ditulis Kelley itu, dimana juru bicaranya, Angela DePaul, mengatakan bahwa pengasuh acara bincang-bincang itu tidak mau mengomentari buku itu atau apapun yang disebutkan Kelly. Di masa lalu, Oprah berulangkali membantah hubungan lesbiannya dengan sang karib, Gayle King. Kini, Oprah: A Biography menjadi salah satu buku paling ditunggu di AS, khususnya karena keberhasilan Kelly menjual jutaan cerita gosip. Crown Publishing Group yang dikuasai pemilik Random House, Bertelsmann, telah men-

07.05 Bedah Editorial Media Indonesia 08.05 Healthy Life 09.05 Indonesia This Morning 09.30 Markiet Review 10.05 The Interview 10.30 Metro Xin Wen 11.05 Expedition 11.30 Megapolitan 12.05 Metro Siang 13.30 Mata Najwa 15.05 Bisnis Hari Ini 16.05 Discover Indonesia 16.30 Metro Realitas 19.05 Suara Anda 20.30 Genta Demokrasi 21.05 Top Nine News 21.30 Welcome To BCA 22.05 Save Our Nation 23.05 Inside 23.30 Metro Sports 00.05 Metro Malam

cetak buku itu sebanyak 550.000 untuk edisi perdananya saja. Namun reaksi publik beraneka di mana sejumlah kritik menyebut Oprah: A Biography tidak cukup mengungkapkan informasi baru mengenai Oprah Winfrey atau kehidupan pribadinya. “Para pemuja Oprah sangat mungkin terlalu loyal untuk menikmati roman picisannya Nona Kelly ini,” demikian The New York Times, Senin, yang kemudian menyampaikan kalimat merujuk Stedman Graham dan Gayle King:“Tanpa informasi yang baru, dia berlindung di balik kolom-kolom gosip murahan yang menyebut dia lesbian.” Tak puas-puasnya Oprah menjadi pembawa

07.30 Respon 08.00 Pagi Asri 09.00 Musik Derings 11.00 Insert 12.00 Reportase Siang 13.00 Bingkai Berita 13.30 Online 15.00 Missing Lyrics 16.00 Kejar Tayang 16.30 Orang Ketiga 17.00 Reportase Sore 17.30 Insert Sore 18.15 Angel’s Diary 19.00 The Promotor 20.00 Bioskop Trans TV 22.00 Bioskop Trans TV 01.15 Reportase Malam

pengaruh kebudayaan terbesar di Amerika Serikat setelah selama 25 tahun mengubah acara asuhannya The Oprah Winfrey Show menjadi mesin uang dan mengalirkan kekayaan senilai 2,3 miliar dolar AS (Rp21,1 triliun) seperti pernah disebut majalah Forbes. Biografi setebal 525 halaman itu mendedah kisah hidup Oprah yang besar di pedusunan di Mississippi, termasuk melahirkan bayi di usia 15. Kelley, yang mengaku tak pernah berhasil dikalahkan karena tuduhan menyampaikan informasi yang salah dan menulis mengenai aspek-aspek tokoh publik yang tidak pernah disentuh para pewarta berita, menyebut ciri terbesar Oprah adalah ambisinya yang besar. “Oprah memiliki dorongan yang kuat sekali, sungguh sebuah dorongan yang tidak puaspuasnya. Dia tak pernah berhenti bekerja, sedangkan karir dan imperium bisnisnya adalah prioritas utama hidupnya,” kata

Kelly. Bertolak belakang dengan penampilannya sebagai wanita yang hangat, mempesona, tak membeda-bedakan dan spontan ketika tampil di acara bincangbincangnya, di balik panggung justru dia menceritakan kisah lain dari kepribadian seorang Oprah Winfrey, ujarnya lagi. “Di luar sorotan kamera, dia sangat pendiam, sangat amat penyendiri, dia bisa sedingin es, dia adalah seorang perempuan pengusaha yang ahli, dan dia kini melihat dirinya benar-benar sebuah merek,” kata Kelley. “Dan itulah perbedaan ketika melihat-nya sebagai orang biasa atau bahkan sebagai seorang pesohor.” Kerena begitu berpengaruhnya Oprah, Kelly yang mengatakan menerima ancaman pem-bunuhan setelah menulis biografi Nancy Reagan, mengaku sulit menemukan penerbit untuk bukunya itu karena para penerbit itu begitu tergantung kepada Oprah. (ant/rtr)

08.00 Eyeshield 09.00 Monchows 09.45 Obsesi 10.30 Bukan Sinetron 11.30 Barang Bekas Selebritis 12.00 Abdel Dan Temon 13.00 Global Siang 14.00 Banzuke 15.30 MTV Sob 16.30 Berita Globall 17.30 Kapten Tsubasa 18.00 Naruto 19.00 Awas Ada Sule 20.00 Big Movies 22.30 Big Movies 00.00 Global Malam 01.30 MTV Insomnia

06.30 Apa Kabar Indonesia 10.00 Nuansa 1000 Pulau 10.30 Keliling Indonesia 11.00 Opini 12.00 Kabar Siang 13.00 Kabar Keadilan 13.30 Expose 14.00 Debat 15.00 Kabar 15 16.00 Menyingkap Tabir 17.30 Kabar Petang 20.00 Satu Jam Lebih Dekat 20.30 Titik Rawan 21.00 Apa Kabar Indonesia 22.30 Local Documentary 23.30 Kabar Arena

07.30 I Gosip Pagi 08.00 DUAAR 09.00 Dorce 10.00 Dengarlah Aku 10.30 60 Minutes 11.30 Redaksi Siang 12.00 I Gosip Siang 12.30 Bocah Petualang 13.00 Laptop Si Unyil 14.00 Cita Citaku 14.30 Dunia Air 15.00 Koki Cilik 16.00 Jejak Petualang 17.30 Shocking Day 18.00 Gara Gara Magic 19.00 OKB 20.00 Opera Van Java 21.00 Mariam Mikrolet 22.00 Bukan Empat Mata 23.30 Begadang 00.30 Sport 7 Malam **m30/B

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

Bursa PROPERTY GR : Garasi KM : Kamar Mandi KP : Kamar Pembantu KT : Kamar Tidur SHM: Sertifikat Hak Milik

Karya baru Kelley berjudul “Oprah: A Biography,” membanjiri toko buku-toko buku di AS, Selasa ini, dan telah menge-

cewakan para pengamat media yang selama ini berharap bisa mengakhiri spekulasi apakah Winfrey seorang lesbian dan menjawab pertanyaan mengenai hubungan Oprah dengan tunangannya, Stedman Graham, serta dengan karibnya, Gayle King, editor “O, the Oprah Magazine”. Namun setelah melakukan tak kurang dari 850 wawancara, Kelley yang pernah menulis keluarga Bush, Frank Sinatra dan Nancy Reagan, menyimpulkan bahwa Oprah yang bertunangan dengan Graham sejak 1992, sebenarnya tidak tertarik kepada siapapun. “Dia berusia 56 tahun, dia hampir bisa digambarkan ‘aseksual’ karena dia menarik semua energi seksualnya untuk kerja, karir, dan membangun imperium,


: Luas Bangunan : Luas Tanah : Ruang Makan : Ruang Tamu

RUMAH Dijual cepat Uk. 8,5x21mtr Jl. Stasiun 57 Desa Lalang HP. (061) 6963.0485/ 0813.7675.0305 RUKO MURAH DIJUAL

4x21meter, Lokasi Strategis, Jl. Sei Mencirim No. 88 Medan Krio, Cocok buat usaha, Pinggir Jl. Besar, Pasaran Sewa, 7 Jt/Tahun, Harga 155 Jt/ nego Hub. (061) 7727.6988 Ali Solihin



Jl. Selam VII No. 42 Luas 13x27m², 2 Tkt/ Genteng, Full keramik, 4 K. Tidur, 3 K. Mandi, Dapur, RT, RK, Garasi, Rp. 700 Jt/ damai hub. An. 0813.6169.8711


Di Jl. Murni III No. 16 Tj. Rejo - Mdn, LB. 200m LT. 360 (20x18), SHM, 2 LT, 4 KT, 3 KM Hub. 0812.609.6655 / 0813.6215.8444

Jl. Sempurna Gg. Anggrek No. 16A Psr. II Setia Budi, Fasilitas: Air PAM, Listrik, Telepon, 1 RT, 1 RK, 4 K, 2 KM, Full keramik Yg berminat hub. 0811.654.125 / 7774.1125



Di Jl. Lidang masuk Jl. Irigasi Panyabungan Madina, Strategis untuk perumahan/ Usaha, Luas ± 3500m² Berminat hubungi (0636) 41314 / 62812.6589.8373 (TP)

DIJUAL CEPAT Tanah Luas ± 2000m SHM Letak Jl. Thamrin (Dlm kota) Lubuk Pakam Cocok utk hotel Swalayan gudang Hub. 0812.600.1268 KAPLING MURAH

Jl. Kenanga Raya Gg. Sosial No. 8A Tanjung Sari, Luas Tnh 535m², SHM, Hrg Rp. 850 Jt/ nego Hub. 0812.6060.6559 0819.7203.858

Khusus Muslim Rp. 10.500.000 10x26m - 10x22m


Rumah (Kios) sgt strategis, Buat usaha apa saja, L: 5m², P: 46m², Jl. Karya Wisata No. 93A (Pas seberang Mesjid Baiturahman JIP I), PAM, PLN, Telp Hub. 7793.6610 - 0813.7696.2999


Harga murah meriah, Sertifikat Hak Milik, IMB, Samping Perumahan MENTENG, Rumah cantik model villa, Dua lantai, Siap huni, 800 meter dari Amplas, terletak di Jl. Selambo (100m dari Jl. Menteng), Type 110, L. Tanah 7x25 (175m), Cash/ kredit. Ayo buruan beli... HP. 0813.6201.1919 - 0812.609.0919


Uk. ± 1.566m², Lks Jl. Jermal 7, Tembus Jermal 5, Hub HP. 0813.6131.7931


(Terima Akte Camat) Lokasi Pasar I dan Pasar II Desa Sei Mencirim Kec. Sunggal, Tanah tinggi, rata, bebas banjir bukan tanah garapan. 8 km dari Simpang Diski (Jl. Medan Binjai), Truk/ Mobil sampai ke lokasi Gratis Bibit duku, durian, rambutan, coklat, mahoni, dll Hub. H. SALIMIK 0812.601.8160 JL. BINJAI KM. 15,4 NO. 7AB DISKI





TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - 1 Set Sofa Kain/ Kulit Rp. 1 Jt-an Hub Telp. (061) 6616802 - (061) 661.8116

KONVEKSI KAOS Menerima Tempahan:

SPRING BED DIJUAL MURAH Spring Bed 6 kaki 2 lapis Spring Bed 5 kaki 2 lapis Spring Bed 4 kaki 2 lapis Spring Bed 3 kaki 2 lapis Spring Bed 3 kaki Dorong


Rp. 1.100.000 Rp. 1.075.000 Rp. 1.000.000 Rp. 900.000 Rp. 1.000.000



Garansi Per 10 tahun Hub. 061- 6616802 - (061) 661.8116



Jl. Amal Luhur Gg. Kuini No. 129J (061) 847.5648/ 0811.659.235 Mdn



Dijual Ex kantor, Faximile, Filing Cabinet, Lemari, Kursi, Msn tik electric/ manual, Printer, Cash register Hub. 0813.9785.9320.






Untuk keluarga di Sibolangit Fas: Swimming Pool, Club house, dll. 100m dr Hillpark Hub. 0815.300.1814 - 7636.9807



Mengamati penyakit secara menyeluruh. Yang dianggap penting. Bukan hanya simtom-sintom yang dikeluhkan. Melainkan juga keseimbangan Yin-yang dan keseimbangan jiwa raga. Ramuan Extract Herbal ini sangat efektif dalam pengobatan penyakit kronis karena ternyata hasilnya sangat memuaskan. - Gagal ginjal - Nyeri berlebih - Stroke - Maag/ lambung - Parkinson - Kanker/ Tumor - Gondok, struma - Diabetes - Impotensi - Sindrom Usus dll Praktek : Jl. SM. Raja/ Yuki Simp. Raya masuk Jl. Amaliun No. 42 (Samping INDOMARET) MEDAN Telp/ Fax. (061) 736.6292 HP. 0852.333.80800


Buka Praktek: Senin - Sabtu Pagi 08.00-12.00 (Istirahat) Sore 14.00-20.00 Minggu 16.00-21.00 Izin Dinkes No. 503/TRD-02/dkk/I/2010 NB. Ikuti dialog interaktif di: Deli TV, Tgl. 7/4-2010 Jam 20.00 s/d 21.00 WIB TVRI Medan Tgl. 10/4-2010, Jam 20 s/d 21 WIB

Ingin Promosikan Produk Anda Harian Media yang Tepat untuk Iklan Anda

TELP. 0813.6127.2455 (061) 844.1045

Uk. 16x81m: 1.296m², SK Camat Jl. Titi Pahlawan Paya Pasir (dpn Simp. PLN), Kec. Medan Marelan Harga Rp. 1.500.000/mtr (nego) Hub HP. 0812.6452.6218 (Tanpa perantara)

JL. VETERAN PSR. X (DPN MESJID AL HIDAYAH) HELVETIA TELP. (061) 7640.1678 0813.7580.8866

Pasang Iklan Mini

“WASPADA” Telp: 061 - 4576602

Daftar langsung belajar, Waktu Bebas, Tanpa batas usia Jl. Sei Batang Hari Ujung 170 Medan Telp. 844.2158 - 844.2159 Website:




0812.6066.7136 (SELLY) 0812.65400.190 (RANI) KUSUK DAN LULUR SALON SILVA

30 Tahun berkiprah di Jakarta kini buka Praktek Menetap di Kota Medan Langsung beraksi di tempat, untuk semua agama, 1x datang hasil permanen KHUSUS PRIA WANITA - Tambah ukuran - Panjang 13cm, 15cm, 18cm, 20cm - Ingin mempunyai keturunan - Memperbesar payudara - Diameter 4cm, 6cm - Vagina seperti perawan kembali, - Tahan lama hasil bisa dicek ke dokter - Mani encer - Mati rasa, infeksi rahim, - Lemah syahwat/ impotensi senggugut Konsultasi umum:

SPECIALIST MATA TANPA OPERASI Dapat disembuhkan sampai tuntas Segala jenis mata seperti mata: - Katarak, Plus, Minus, Glaucoma - Mata Merah, Berair, Bengkak, dll

Khusus yg mau masuk angkatan minus jarak pandang +/- 7 Meter B/W (buta warna), juga dapat di sembuhkan sampai tuntas, Insya Allah Hub. IBU FARIDA AKRAM Jl. Prof. H.M. Yamin S.H (Serdang) No. 251 A Tel.(061) - 4563067 Mdn Izin Depkes R.I Terdaftar web: ffaridar aridar aridara








KEJATI B. 109/DSP4.3/11/2009



Gelar terapi alat vital paling spektakuler langsung besar dan panjang di tempat no suntik/ silicon, terapi aman tanpa efek samping, asli tradisional, bebas pantangan, untuk semua usia, ras dan agama. Cukup satu kali pengobatan khasiatnya luar biasa dijamin...!!! Puas, paten dan permanen untuk selamanya Terapinya aman serta bebas pantangan, metode terapi dan teknik dasar pengurutan untuk membetulkan simpul syaraf kejantanannya disempurnakan dengan sarana supra natural/ do’a, yang sudah di pandukan melalui ramuan khusus untuk menambah keperkasaan dan juga ukuran yang diinginkan. Cukup satu kali pengobatan khasiatnya luar biasa. Dijamin joss!!! Dan keahliannya luar biasa... Langsung besar dan panjang ditempat, disesuaikan dengan ukuran yang di inginkan: panjang 15 cm diameter 3 cm, panjang 17 cm diameternya 4 cm, panjang 20 cm diameternya 5,5 cm. Sanggup melakukan hubungan secara berulang-ulang tanpa obat kuat/ doping, dijamin faten..!!!

Jangan Lewatkan Interaktif langsung dengan PASAK BUMI di DELI TV Setiap Sabtu Malam Pkl. 22.30 Wib (Live)

Call Center: 0818 090 73481 Menyembuhkan impotent, lemah syahwat, kencing manis, raja singa, loyo, ejakulasi dini, cepat keluar, siplis, lemah syahwat, dll, dijamin normal kembali !!! batas usia 80 thn. Terapi alat vital Bapak Haryono sudah puluhan tahun menangani keluhan pria, terapinya nyata, hasilnya luar biasa, tidak disuntik/ silicon aman tanpa efek samping, beliau pakar kenjantanan asli asal Banten. Yang paling pertama menemukan cara terapi tradisional dan hasil ditempat. Ilmunya sudah dipatenkan. Menangani bekas suntik, silicon, ingin cepat dapat keturunan, sperma encer adn menangani yang gagal dari tempat lain. ditangni secara tuntas untuk penanganan serahkan pada ahlinya bergaransi dan sudah teruji dan terbukti Khusus Umum, menangani masalah seperti menaklukkan hati melalui senyuman dan kerlingan, membuat orang yg diinginkan simpatik dan jatuh hati, membuka aura pesona kecantikan/ ketampanan anda, juga masalah rumah tangga lainnya, cepat dapat jodoh PIL/ WIL, mengembalikan keharmonisan suami istri Alamat Praktek tetap: Jl. SM. Raja/ Yuki Simp. Raya masuk Jl. Amaliun Gg. Kesatuan No. 4 HP. 0813.7660.6663 NB. MOBIL BISA MASUK/ GARASI PAKEM. B-346/DSP.5/11/2008

Ciri2 Ambeyen: Disekeliling Dubur Ada Benjolan Seperti Daging Tumbuh/Jerawat, Gatal, B.A.B Keras, Keluar Darah Segar. Susah Duduk Seperti Ada Yang Mengganjal. Duduk Serba Salah. Nyeri (Ngilu). Dubur Seperti Luka, Solusinya Datang dan Berobatlah ke

Jl. Bunga Harum (Benteng) No. 26 Suka Jadi Telp. 0761-45368 -HP. 0812 6568 700 Pekan Baru Telp. (0761) 45368 HP. 0812.656.8700 Cabang II: Komp. Perhub. Laut Jl. Baruna II/II Telp. 0765 36906 HP. 0852 6201 0594, 0812 60311 695 Dumai

KI TUBAGUS ROHMAN TOHA Mengatasi Penyakit & Problem antara lain: ˆ ˆ ˆ ˆ


Jl. Prof. H.M. Yamin S.H No. 251 A Simpang Pahlawan Tel.(061) 4563067 Cabang I





IKUTI SEGERA....!!! PROGRAM INTENSIVE 2010 (SETELAH UN/ UAS 2010) UNTUK SISWA/I KELAS 3 SMA/ SMK & ALUMNI Agar lebih pasti lulus testing ke PTN melalui UMB PTN, SNMPTN, STIS, STAN, STT TELKOM, dll Mulai Belajar: Senin, 19 April 2010 (Belajar setiap hari, dari Senin s/d Sabtu, boleh pilih belajar pagi atau sore hari) Daftarkan sekarang juga di BT/ BS MEDICA Lokasi Belajar: - Jl. Setia Budi No. 7C Komplex MCC Telp. 0813.7035.5060 Medan - Jl. Bantam No. 12 Medan Telp. (061) 457.8058 Medan - Jl. Darat No. 74 Medan Telp. (061) 415.2616 Medan - Jl. Prof. HM. Yamin, SH No. 374/ 526 Telp. (061) 415.9016 Medan - Jl. Sentosa Baru No. 17A Telp. (061) 453.8450 Medan - Jl. Iskandar Muda No. 38B Telp. (061) 451.1786 Medan - Jl. Muda No. 53 Telp. (061) 453.1048 Medan - Jl. Iskandar Muda No. 19B Telp. (061) 415.9280 Medan - Jl. Abdullah Lubis No. 8 Telp. (061) 453.6029 Medan - Jl. Jamin Ginting No. 241 Telp. (061) 822.4543 Medan - Jl. Bakti No. 189C Telp. (061) 7715.0802 Medan - Jl. Yos Sudarso No. 175B Telp. (061) 661.5504 Medan - Jl. AR. Hakim No. 134 Telp. 732.6266 Medan - Jl. SM. Raja No. 348 Telp. 786.0808 Medan - Jl. SM. Raja No. 251/ 252 Telp. (061) 786.2184 Medan - Jl. Brigjend. Zein Hamid No. 24D Telp. (061) 7715.0800 Medan









Aplikasi Window XP/ Internet................ 200 Rb (2 minggu) Komputer Aplikasi Perkantoran Lengkap 350 Rb (1 bulan) Autocad 2D/ 3D/ 3D Max......................... 300 Rb (10 hari) SAP/ EBTAB (Tehnik Sipil)....................... 400 Rb (10 hari) Merakit Komputer/ Lengkap................... 400 Rb (6 hari) Autocad 2D + 3D + 3D Max/ SAP............. 1,2 Jt (4 bulan) Desain Grafis + iNTERNET....................... 600 Rb (1 bulan) Aplikasi kantor + Internet....................... 450 Rb (1 bulan)

Jl. SM. Raja Yuki Simpang Raya masuk dr Jl. Amalaiun masuk lagi Jl. Cemara No. 49 Medan HP. 0812.6337.5477 Izin Kejaksaan: B.18/DPS.5/01/2008: izin Dinkes: 448/347





Menghadirkan pewaris, Ilmu sapu masalah, R. tangga, jodoh, karir, bisnis, pelaris, PIL/ WIL, susuk jual tanah, buka aura Alamat praktek:












NO. POM. TR. 873635522

Kelainan sex, bysex (homo/ lesbi) Gangguan jiwa/ mental, kegelisahan, gila Kurang percaya diri, stres berat Buka setiap hari jam 08.00 s/d 21.00 WIB Dendam, marah, cemas, dll hari libur tetap buka

Penyakit yang dapat disembuhkan secara langsung ditempat seperti: Lumpuh/ struk (komplikasi) bisa kembali normal, gondok, liver, amandel, hernia, ginjal, rematik, tumor, impoten, diabetes, spilis, singa, dll


ˆKENALILAH HATI NURANI (fitroh dirimu) karena disitulah kunci kebahagiaan, ketentraman, kesuksesan yang hakiki, abadi dan pasti PRAKTEK: Jl. SM. Raja, samping UISU masuk Jl. Sempurna, 300m No. 49 Medan HP. 0812.682.77999

Dpt Diperoleh di Sumatera - Aceh Hub: (061) 7365429 - 7362887




Bila Anda ingin perkasa jangan salah masuk. Disini tempatnya, carilah yang benar-benar asli. Perwira yang sempurnya ya disini tempatnya yang lebih joss. Bergaransi seuur hidup tanpa efek samping. Pastikan anda menjadi laki-laki yang luar biasa.. Kalau anda penasaran, ikut terapi ini berlaku untuk semua Agama, ras dll. Legenda pengobatan Mak erot sudah tidak diragukan lagi, ribuan, pasien bahkan sampai kemancanegara dari keluhan laki-laki seperti gangguan ereksi, peyakit kelamin secara medis susah disembuhkan Terapi Mak Erot ini mengutamakan ramuan. Doa-doa, pemijatan dan minyak poles. Tanpa bahan kimia dan tanpa perbedaan, tanpa efek samping. Jangan biarkan masalah anda berlarut-larut. Bagi wanita yang ingin punya keturunan, mau memperkencang dan memperbesar payudara, disinilah tempatnya Menangani Keluhan Pria & Wanita

KHUSUS WANITA KHUSUS PRIA - Ingin punya keturunan - Ejakulasi dini - Memperkencang dan memperbesar payudara - Impotensi - Mengembalikan keperawanan - Memperbesar, panjang - Mengobati keputihan - Keras, tahan lama HP. 0812.4038.333 Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041 Jl. Laksana No. 55j Masuk dari Jl. Amaliun YUKI SImpang Raya Medan (Praktek Tetap


Mengatasi keluhan solusi penyembuhan yang paling tepat paten dan permanen asli terapi nampak hasil ditempat ±30 menit langsung besar dan panjang bisa di rasaka nkhasiatnya KHUSUS PRIA: PRIA/ WANITA - Pengasi kecantikan/ ketampanan TERAPI M. SULAEMAN - Memperbesar TDK MENEBAR JANJI2 - Memperpanjang - Pelaris dagang Tapi bukti yg nyata - Impotensi total - Memperlancar dapat rizki - Mempercepat dapat jodoh mampu mmberikan - Ejakulasi dini solusi penyembuhan - Ritual nikah batin - Kurang keras keluhan alat vital, - Ritual pengikat suarat - Kurang ereksi sekaligus perubahan - Lemah syahwat - Ruwatan samber lili ukuran otot vital anda - Ilmu pelet cakra buana - Mani encer - Diabetes

- Buka aura dan buang sial

Ukuran yang dapat dipilih: - Panjang 15xm Diameter 3 - Panjang 17cm Diameter 4 - Panjang 20cm Diameter 5 Alamat Praktek: HOTEL AMPLAS No. 507 Jl. Panglima Denai No. 1 depan Terminal Amplas Medan Hub. M. SULAEMAN 0813.7703.7772 DINKES-503/04BATRI/KPPT/2008

Ekonomi & Bisnis

B6 Sisi Negatif Apresiasi Rupiah ASOSIASI Pengusaha Indonesia (Apindo) menilai jika penguatan nilai tukar rupiah terhadap dolar AS terus terjadi secara berkesinambungan secara cepat akan membawa dampak negatif bagi eksportir bahan baku. Hal ini tidak hanya berdampak terhadap besaran keuntungan yang diperoleh pengusaha melainkan mempengaruhi persaingan pengusaha lokal terhadap luar negeri di pasaran global. Bahkan berimplikasi terhadap efesiensi tenaga kerja. Sekretaris Apindo Sumut Laksamana Adhyaksa di Medan, Rabu (14/4), menyatakan menguatnya nilai tukar rupiah terhadap dolar AS berdampak negatif terhadap industri yang melakukan ekspor khususnya bahan baku. “Kurs rupiah terhadap dolar AS di pasar spot antar bank Jakarta memang cenderung stabil sekitar Rp9.018 s/d Rp9.028 bahkan diprediksi akan semakin membaik mencapai Rp9.000 bahkan lebih dari rendah dari itu,” ujarnya. Dengan kenaikan yang terlalu cepat, lanjutnya, hal ini kurang menguntungkan bagi eksportir khususnya pemasok bahan baku. “Pemerintah harus tanggap melalui bank sentralnya untuk melakukan intervensi pasar agar jangan sampai terlalu jauh penguatan tersebut,” ujarnya. “Rupiah idealnya berada di posisi Rp9.000 sampai Rp9.300 per dollar AS sehingga pengusaha eksportir telah mempersiapkan daya saing komoditas ekspor tetap tinggi,” lanjutnya. Jika tidak, hal ini berakibat terhadap volume ekspor dan tenaga kerja. “Mengapa karena dengan menguatnya rupiah terhadap dolar, pengusaha akan berusaha mengurangi jumlah volume ekspor begitupula dengan efesiensi produksi dan ini berdampak terhadap pengurangan lembur atau karyawan sendiri,” ujarnya. Laksamana melanjutkan walau hal itu tidak mungkin dilakukan oleh eksportir bahan baku khususnya sumber daya alam (SDA) karena kebun juga terus menghasilkan. Namun terhadap efesiensi produksi kemungkinan tetap terjadi. “Kita mengetahui tanaman tidak mungkin dapat dipercepat atau diperlambat produksinya, namun untuk pengolahan atau penurunan jam kerja pasti akan dilakukan pengusaha untuk menutupi minimnya margin yang didapatkannya,” lanjutnya kembali. Dia mencontohkan, pengusaha eksportir CPO akan membeli TBS (tandan buah segar) kepada petani dengan memakai mata uang rupiah, sedangkan di jual dengan pengusaha di luar negeri memakai dolar. “Artinya dengan kondisi dolar yang melemah terhadap rupiah, pengusaha akan mendapatkan keuntungan kecil, sementara mereka juga didesak untuk

Rupiah Menguat Tajam, Ekspor-Impor Wait And See ANTISIPASI para eksportir terhadap penguatan rupiah terhadap dolar AS sepertinya jauhjauh hari telah dilakukan. Bentuk antisipasi tersebut

dapat bersaing dengan eksportir CPO yang ada di luar negeri seperti Malaysia,” ujarnya. Begitupun, lanjutnya, hal ini berdampak terbalik dengan importir dimana pengusaha memanfaatkan kondisi seperti ini untuk meningkatkan daya beli dari masyarakat. Seperti importir barang elektronik seperti komputer, televise, dan lainnya. “Dengan kondisi daya beli masyarakat yang minim, hal ini justru dapat menjadi peluang bagi importir barang elektronik untuk memberikan harga murah terhadap konsumen atau masyarakat,” lanjutnya kembali. Wakil Ketua Kadin Medan Putrama Alkhairi menyatakan kenaikan kurs rupiah terhadap dolar hanya bersifat sementara yang kemungkinan bisa saja naik ataupun turun. “Dengan kenaikan yang berlangsung cepat, hal ini memungkinkan pengusaha belum berani memanfaatkan atau wait and see karena risiko yang ditimbulkan bisa saja besar atau sebaliknya mendapatkan keuntungan yang besar,” ujarnya. Namun, lanjutnya, jika hal ini terjadi berkepanjangan maka yang terjadi ada dua yang pertama importir untuk produk-produk yang dijual ke pasar dalam negeri akan mengalami peningkatan daya beli, dan kedua importir bahan baku dan kembali melakukan eksportir tidak begitu bermasalah. “Sedangkan eksportir tentunya hal ini berdampak terhadap keuntungan atau margin yang diterima dan kemungkinan akan mengurangi jumlah volume ekspor atau melakukan perjanjian ulang sesuai dengan kondisi dilapangan,” lanjutnya. Bagi pemerintah sendiri, lanjutnya kembali, hal ini dapat dimanfaatkan untuk mengurangi jumlah hutang di luar negeri dengan melakukan pencicilan pembayaran sehingga ke depan hutang Indonesia tidak terlalu tinggi. “Begitupun, hal ini harus diperhatikan oleh bank central untuk menstabilkan kondisi kurs dalam negeri sehingga tidak membuat panik antara eksportir maupun importir,” lanjutnya kembali. ● Hamzah

Emas Tak Kunjung Diam, Pedagang Pasrah Menunggu DALAM sepekan, rata-rata terjadi fluktuasi harga emas sampai tiga kali di pasaran internasional. Terkadang naik tajam, turun sedikit lalu diam di level tertentu dan kembali naik lagi. Hal ini selalu terjadi sehingga pedagang hanya pasrah menunggu. Menunggu harga kembali normal sehingga berada dalam jangkauan daya beli masyarakat sepertinya terlalu lama, omset pedagang selalu dalam kondisi tak stabil dan cenderung menurun. Harga emas terlalu berat untuk turun di bawah Rp300 ribu per gram. Senin lalu harga emas di pasaran internasional kembali naik hingga menembus level 1.160 dolar AS per ounce membuat pedagang kebingungan, karena walaupun harga di pasaran lokal tetap stabil tetapi telah berada diposisi Rp330 ribu per gram. Rabu (14/4), harga emas di pasar internasional kembali turun menjadi 1.151 dolar AS per ounce, tetapi harga dipasar lokal belum juga bergeming dan masih berada di posisi tetap Rp330 ribu per gram. Fluktuasi harga di pasaran internasional yang tinggi, walupun sejauh ini belum mempengaruhi harga di perdagangan lokal, namun ada kekhawatiran harga bisa saja tiba-tiba melonjak karena situasi pasar terus bergerak. Perkiraan beberapa pedagang di Pusat Pasar, bertahannya harga emas di pasaran lokal di level Rp330 ribu per gram didukung menguatnya nilai tukar rupiah di bawah level Rp9.100 per dolar AS. Tetapi kondisi rupiah yang sudah sangat menguat dikhawatirkan akan segera mencapai titik jenuh sehingga kembali melemah bergerak ke atas level tersebut. Jika rupiah melemah ditengah tingginya harga emas dunia, dikhawatirkan harga emas di perdagangan lokal akan terdongkrak, kata Rizal, pedagang emas Singgalang Indah Pasar Petisah. Sementara itu harga emas di pasaran lokal Rp330 ribu per gram saat ini sudah cukup tinggi untuk ukuran daya beli masyarakat yang rata-rata di bawah Rp300 ribu per gram, sebutnya. Namun lanjut Rizal, untuk kembali ke harga di bawah rata-rata Rp300 ribu per gram tentu saja sudah sulit, untuk ke depan pedagang masih bingung memperkirakan pergerakan emas, sehingga lebih banyak bersikap menunggu kondisi lebih jelas. Harga emas di pasaran lokal belum dapat diprediksi apakah akan bertambah naik atau

WASPADA Kamis 15 April 2010

turun di bawah Rp330 ribu per gram, bisa saja harga emas di pasaran internasional kembali melemah walaupun nilai tukar rupiah melemah, sebutnya. Kondisi harga emas di level seperti ini, sudah sangat mempengaruhi transaksi perdagangan di tingkat lokal sehingga banyak usaha pedagang emas sepi, jika harga bertambah naik akan membuat usaaha kian anjlok, ujarnya. Harga emas kualitas 99,99 persen di perdagangan lokal saat iniRp330 ribu per gram, emas 24 A kualitas 97 persen Rp.320 ribu per gram, emas 24 K kualitas 90 persen Rp.285 ribu per gram, emas putih kualitas 75 persen Rp.255 ribu per gram dan emas 22K kualitas 70 persen Rp.220 ribu per gram. Investasi Dalam kondisi harga di pasar internasional yang tinggi, sebagian kecil masyarakat Medan yang memiliki dana simpanan di deposito dan lainnya malah membaca hal tersebut sebagai peluang investasi. Menurut Hendra, salah seorang karyawan bank swasta di Medan ketika ditemui di Pasar Petisah, membeli emas dalam bentuk batangan saat ini lebih memiliki prospek yang lumayan cerah. Harga emas dalam negeri diperkirakan naik ketika pemulihan ekonomi di sebagian besar negara maju pada dua hingga tiga tahun mendatang terwujud, sehingga inflasi juga naik dan peluang melemahnya nilai tukar rupiah terbuka lebar, sebutnya. Saah satu faktor utama menyebabkan naiknya harga emas di dalam negeri adalah melemahnya nilai tukar rupiah akibat sebagian besar arus modal asing terseret keluar negeri karena investasi di pasar uang negara maju dianggap lebih menarik, katanya. Beberapa pedagang di Pasar Petisah yang menyediakan emas batangan mengatakan peminat emas jenis itu sudah meningkat dibanding tahun sebelumnya, namun secara keseluruhan jumlahnya masih jauh dibawah peminat emas jenis perhiasan. Suranta pengusaha emas di Jalan Iskandar Muda, kawasan Pasar Pringgan membenarkan peminat emas batangan saat ini sudah meningkat dibanding sebelumnya karena sebagian masyarakat sudah banyak yang mengerti membaca peluang itu, katanya. ● Sahrizal

layaknya seperti bisnis di bursa atau pasar valas dengan model currency forward market. Nilai tukar rupiah dalam perdagangan sepekan terakhir mengalami penguatan signifikan. Bahkan sudah mencapai level Rp8.950 per dolar AS. Bayang-bayang kalau rupiah akan mencapai level Rp8.000 memang sulit diraih namun optimisme ke arah yang menguntungkan importir itu mulai dikalkulasi. Dengan sistem currency forward dilakukan transaksi penjualan dan pembelian dengan kurs forward atau kurs yang ditetapkan sekarang atau pada saat ini, tetapi diberlakukan untuk waktu yang akan datang (future period) antara 2 x 24 jam lebih sampai dengan satu tahun atau dua belas bulan. Kasi Perdagangan Luar Negeri Disperindagsu Fitrah Kurnia di Medan, Rabu (14/4) menyatakan penguatan rupiah sepertinya telah diantisipasi oleh eksportir meski hal tersebut jelas akan mengurangi laba namun tetap dikirim. “Antisipasi yang dilakukan pengusaha atau eksportir adalah dengan melakukan sistem forward money exchange dimana perjanjian yang sesuai dengan kontrak tidak harus satu tahun melainkan tiga, enam, atau dua belas bulan sesuai keinginan masing-masing pengusaha,” ujarnya. Sistem tersebut dilakukan, lanjutnya, karena adanya ketidak pastian dan fluktuasi kurs yang terjadi semenjak diberlakukannya sistem kurs mengambang (floating rate system). Semenjak itu, banyak perusahaan dan perbankan menggunakan forward market untuk mengadakan forward contract. “Tujuannya adalah melindungi transaksi perdagangan

Waspada/Armin Nasution

TUKAR DOLAR: Seorang warga Medan terlihat akan menukar uangnya ke dolar AS. Nilai tukar rupiah terhadap dolar AS dalam sepekan perdagangan terakhir terlihat menguat hingga di bawah Rp9.000. dan keuangan internasional dari risiko kerugian dan dari para pedagang valas yang melakukan spekulasi untuk mencari keuntungan dari fluktuasi forward rate,” lanjutnya. Begitupun, lanjutnya, tetap saja hal ini juga mempengaruhi margin yang diperoleh eksportir ketika melakukan penjualan ke pasar global. “Akan tetapi soal apakah ada peningkatan atau penurunan ekspor paska naiknya rupiah terhadap dolar AS, hal itu belum diprediksi,” ujarnya. Fitrah mengungkapkan dengan kondisi yang belum stabil untuk kurs mata uang sepertinya para pengusaha wait and see tentang hal ini karena hal tersebut juga telah diantasipasi oleh mereka jauh-jauh hari. “Jadi tidak bisa serta merta para eksportir melakukan penyetopan atau pengurangan

volume ekspor terkait dengan menguatnya rupiah terhadap dolar AS karena antara keduanya baik pengusaha lokal dengan luar negeri telah melakukan kontrak kerjasama,” ujarnya. Namun keamanan berbisnis, lanjutnya, telah diatur oleh sistem forward money exchange atau perjanjian yang mereka lakukan. Sehingga seandainya rupiah menguat, importir yang mendapatkan keuntungan tidak mendapatkan waktu yang lama, begitu pula dengan dolar menguat, sebaliknya. “Ada timbal balik antara keduanya dengan memakai sistem tersebut baik importir maupun eksportir dan hal ini yang telah diterapkan para pengusaha baik paska diberlakukannya kurs mengambang,” ujarnya kembali.

Kasi Perdagangan Dalam Negeri Disperindagsu Parlindungan Lubis menyatakan importir belum melakukan tindakan apapun baik menambah volume impor maupun mengurangi jumlahnya sehingga belum berdampak terhadap data di disperindagsu. “Dengan kondisi kurs yang sedang berfluktuasi hal ini tidak dapat dijadikan acuan bagi importir untuk melakukan penambahan volume produk impor. Mereka juga melihat kondisi di lapangan baik daya beli maupun pemesanan,” lanjutnya. Tidak adanya peningkatan impor, lanjutnya, hal ini dikhawatirkan oleh importir akan terjadi lonjakan harga jika ketika mereka melakukan pemesanan, kurs dolar mengalami penguatan sehingga menam-

bah cost pengusaha. “ Un t u k m e n j a g a h a l tersebut, pengusaha khususnya importir dalam hal ini berhatihati menyikapi kondisi dilapangan terkait penguatan kurs rupiah terhadap dolar begitu cepat,” ujarnya kembali. Sepertinya, lanjutnya, tidak ada alasan bagi pengusaha untuk melakukan penambahan volume produk jika dua hal yang dikhawatirkan belum stabil baik kurs yang berfluktuatif juga daya beli masyarakat yang masih rendah. “Jadi sampai saat ini, belum ada laporan secara tertulis dari importir untuk melakukan penambahan ataupun pengurangan volume produk yang masuk ke dinas perindustrian dan perdagangan Sumatera Utara,” lanjutnya kembali. ● Hamzah

Daya Beli Lemah Pengaruhi Volume Impor SEJUMLAH importir sepertinya belum memanfaatkan kondisi penurunan mata uang dolar AS terhadap rupiah. Hal itu, selain kondisi kurs yang masih berfluktuatif juga ditambah masih rendahnya daya beli masyarakat terhadap produk impor. Importir makanan dan minuman Ahui di Medan, Rabu (14/4) menyatakan penguatan rupiah terhadap dolar AS tidak mempengaruhi peningkatan volume impor yang dilakukan pengusaha untuk mememuhi kebutuhan pasar. “Jadi tidak ada pengaruhnya bagi pengusaha, selagi kurs yang terus berfluktuatif ditambah rendahnya daya beli masyarakat terhadap produk-produk impor maupun lokal,” ujarnya. Dalam hal ini, lanjutnya, pengusaha hanya wait and see untuk melihat perkembangan lebih lanjut baik dalam hal kurs maupun upaya peningkatan daya beli masyarakat terhadap produk. “Sekarang ini masalahnya bukan di cost, melainkan daya beli yang rendah.” “Seandainya kalau kita melakukan pembelian yang cukup besar terhadap produkproduk impor sementara daya beli kurang mau dikemanakan barang-barang ini. Sementara waktu masa produk telah ditentukan dari masing-masing produk,” ujarnya. Jika tidak laku, lanjutnya, otomatis pengusaha atau importir akan mengalami kerugian cukup besar dan mengakibatkan tidak beroperasinya usaha dan melakukan pemutusan hubungan kerja (PHK) kepada karyawan. “Mengapa daya beli kurang? Hal inilah yang perlu ditanyakan dan tentunya akibat tidak ada

Waspada/Armin Nasution

WAIT AND SEE: Warga memang bergairah menukarkan uangnya ke dolar AS. Tapi eksportir dan importir masih wait and see (tunggu dan lihat) ke level berapa mata uang itu akan bergerak. regulasi dari pemerintah dalam menempatkan izin lokasi usaha makanan dan minuman. Bahkan untuk supermarket yang menjual prodak sama hanya berjarak 20 meter saja,” ujarnya. Apalagi, lanjutnya, untuk pedagang-pedagang asongan atau kaki lima. Sementara pangsa pasarnya masih tetap daerah sekitarnya. “Alhasil di salah satu tempat ramai, di salah satu tempat lainnya mengalami sunyi,” lanjutnya kembali. “Sepertinya pengusaha saat ini sudah mati-matian untuk mencari strategi dalam menyiasati daya beli yang turun.

Sayangnya hal ini tidak ditunjang kebijakan pemerintah daerah untuk melakukan pemenuhan tersebut,” ujarnya. Tidak mungkin, lanjutnya, strategi tersebut dengan melakukan penurunan literan, gram, atau mengubah bahan kemasan karena hal tersebut sesuai dengan daerah asalnya sehingga akan berdampak terhadap tuntutan oleh produsen luar negeri jika dilakukan. “Meski tujuannya agar bisa membuat produk yang lebih terjangkau konsumen, namun hal tersebut bertentangan dengan hokum perdagangan,” lanjutnya..

Ahui, menyatakan, dengan pihaknya sampai saat ini belum melakukan pembelian ekstra terhadap produk-produk impor terkait dengan menguatnya rupiah terhadap dolar AS. Bahkan produknya telah mengalami penurunan sejak tahun sebelumnya. “Dengan menurunnya permintaan produk-produk impor dari pedagang membuat kita telah melakukan penurunan impor terhadap produk makanan dan minuman yang berasal dari negara tetangga,” ujarnya kembali. Sekretaris Forum Komunikasi Pengusaha Komputer

(Fomikom) Hery S menyatakan masih menunggu kurs tetap stabil baru melakukan pembelian barang. Karena dikhawatirkan pada saat melakukan pemesanan rupiah kembali anjlok. “Jangan sampai dengan cepat naiknya rupiah terhadap dolar ini membawa dampak yang serius, dimana tiba-tiba rupiah anjlok. Hal ini akan memberikan kerugian yang cukup besar terhadap pengusaha komputer,” ujarnya. Dia melanjutkan, kerugian tersebut bukan masalah harga yang ditawarkan kepada pelanggan melainkan daya beli ataupun minat beli mengalami penurunan sehingga barang tidak dapat terjual dalam waktu yang cukup panjang. “Artinya, perputaran uang atau bisnis kita tidak jalan seperti yang diharapkan, padahal dari sana adalah sumber untuk menjalankan roda perekonomian usaha komputer baik didalam hal penyewaan toko, gaji pegawai, dan lain sebagainya,” lanjutnya. Pengusaha berharap, lanjutnya, kondisi seperti ini segera berakhir dan kembali normal baik penguatan yang cukup panjang ataupun seandainya mengalami penurunan jangan sampai diatas Rp9.500 per dolar AS. “Sehingga hal ini dapat memberikan kesempatan kepada pelanggan untuk meningkatkan kembali daya beli mereka terhadap produk-produk impor baik elektronik maupun makanan dan minuman yang beredar di pasar,” lanjutnya kembali. ●


WASPADA Kamis 15 April 2010

Mahasiswa Dukung Kejatisu Usut Tuntas Dugaan Korupsi Di Tabagsel P.SIDIMPUAN (Waspada): Seluruh mahasiswa di wilayahTapanuli Bagian Selatan (Tabagsel) mendukung Kejaksaan Tinggi Sumatera Utara (Kejatisu) mengusut tuntas berbagai dugaan korupsi di daerah itu. Koordinator Aliansi Mahasiswa Peduli Birokrasi Bersih (AMPBB), Andi Lumalo Harhap, dan Koordinator KAM Pembaharuan USU, Halomoan Rasoki, mengungkapkannya kepada Waspada di Padangsidimpuan, Rabu (14/4). Hal ini sekaitan dengan giat-giatnya Kejatisu sat ini memeriksa perkara dugaan korupsi di Pemko Padangsidimpuan dan Pemkab Mandailing Natal. Bahkan mahasiswa mensyukuri sikap Kejatisu yang jemput bola menangani perkara ini. Pemanggilan dan pemeriksaan pejabat yang diduga korup, menurut mereka, merupakan suatu anugerah bagi seluruh rakyat Tabagsel. Apresiasi setinggi-tingginya disampaikan kepada Kejatisu dalam penanganan kasus dugaan korupsi di wilayah Tabagsel. “Di Kota Padangsidimpuan Kejatisu mengusut persoalan DAK 2009 dan sekretraita daerah. Di Madina mengenai persoalan dana pemekaran Kabupaten Pantai Barat Mandailing sekira Rp 2 miliar,” kata Malo dan Lomo. Diakui mereka, untuk penuntasan kasus ini, mahasiswaTabagsel sudah 5 kali melakukan aksi damai ke Kejatisu di Medan. Pada aksi itu, mereka menuntut penuntasan kedua kasus dugaan korupsi. “Alhamdulillah, Kejatisu mau turun tangan dan jemput bola ke daerah untuk menyelesaikan kasus-kasus itu. Kita akan terus menyuarakan kasus lainnya dan bila perlu kita berangkat ke Kejagung di Jakarta untuk menindak lanjuti hal itu,” sebut Lomo. Sementara Malo menyatakan, pemeriksaan pejabat dari kedua daerah tersebut adalah salah satu bentuk keseriusan Kejatisu dalam penanganan persoalaan korupsi. “Kita tidak harap kejaksaan lebih serius dalam menangani kasus dugaan korupsi dan tidak terpengaruh makelar kasus (Markus). Kita akan terus memantau dan mengawalnya, sehingga terjadi penegakkan hukum yang adil di Tabagsel,” sebut Malo. (a20)

DPRD Tapteng Akan Tampung Anggaran Pengorekan Parit Losung Aek Sorkam Kanan SORKAM BARAT,Tapteng (Waspada) : Para petani di Kec. Sorkam Barat lega karena pengorekan parit persawahan di Losung Aek Sorkam Kanan anggarannya akan ditampung P-APBD 2011. Pengorekan parit harus diprioritaskan mengingat para petani yang bercocok tanam di areal persawahan tersebut sering gagal panen. Apabila curah hujan cukup tinggi mengakibatkan banjir disebabkan parit dangkal termasuk adanya penyumbatan digoronggorong badan jalan. Demikian dikatakan Camat Sorkam Barat Rais Kari, AP di hadapan Ketua DPRD Tapteng Sintong Gultom dan anggota DPRD Parmulan Saruksuk, Lelliana Sarumpaet, Rusli Simanjuntak dan Mangatur Marpaung, Selasa (13/4) saat meninjau lokasi areal persawahan masyarakatdiSorkamKananusaimelakukankunjungandiKecamatan Sorga. Ketua DPRD Tapteng Sintong Gultom mengakui, areal lahan persawahan di Kecamatan Sorkam Barat potensial dan mendukung, diharapkan Pemkab Tapteng dapat mengusulkan pengorekan parit Losung Aek Sorkam Kanan di RAPBD 2011. (a34)

Sekwan Berkantor Di Kantor Bupati Palas SIBUHUAN (Waspada): Buntut pemalangan pintu ruangan Sekretaris DPRD Padanglawas, sejak Senin (12/4) seluruh pegawai dan staf sekretariat berkantor di Kantor Bupati Padanglawas di Jalan Ki Hajar Dewantara Sibuhuan. Sekwan Palas Drs Aritonang Siregar saat ditemui sejumlah wartawan, Rabu ( 14/4) mengatakan hal itu dilakukan agar tugas sekretariatbisaberjalansebagaimanamestinya.SebelumnyaAritonang menyatakan terkejut setelah mengetahui kantor dipalang. Kondisi pintu ruangan kerjanya dipalang itu diketahui Sabtu (11/4) malam atas informasi dari stafnya. Menyikapi adanya laporan kepada kepolisian terkait hilangnya empat unit laptop dari kantor DPRD Palas, Aritonang merasa heran terhadap adanya laporan itu. (a32)

Sumatera Utara


3.167 KK Di Madina Belum Nikmati Aliran Listrik PANYABUNGAN(Waspada): Sungguh memprihatinkan nasib 3.167 kepala keluarga (KK) di 20 desa di Kabupaten Mandailing Natal. Hingga kini belum teraliri listrik baik jaringan PT PLN maupun Pembangkit Tenaga Diesel (PLTD). Warga terpaksa menggunakan lampu minyak dan bagi yang warga yang mampu membeli mesin genset untuk menerangi rumahnya. Berdasarkan data diperoleh Waspada di Pemkab Madina Rabu (14/4), ke-20 desa yang belum tersentuh aliran listrik ini, meliputi Desa Sopo Batu, Kecamatan Panyabungan Kota,Aek Nabara di Kecamatan Panyabu-

nganTimur, Aek Marian dan Gunungtua di Kec. Kotanopan. Desa Aek Manggis, Aek Holbung, Lubuk Bondar,Banjar Melayu, Guo Batu dan Lubuk Samboa di Kecamatan Batang Natal. Kemudian Desa Pulau Tamang di Kecamatan Batahan dan sembilan desa lainnya terdapat di Kecamatan Muara Batang Gadis,yakni Desa Manuncang, Hutarimbaru, Ranto Panjang, Lubuk Kapundung I, Lubuk Kapundung II, Panunggulan, Tagilang Julu, Sale Baru dan Suka Makmur. Desa-desa yang belum teraliri listrik ini, rata-rata memiliki jarak sekitar 5 hingga 40 kilometer

Warga Desa Janji Raja Tuntut Kembali Lahan MEDAN(Waspada):Lembaga Swadaya Masyarakat (LSM) TERAPI menilai PTPN II menambahkekecewaanmasyarakatJanji Raja dengan tidak diterimanya audiensinya oleh Direksi perusahaan BUMN itu. Hal ini tidak hanya menambah ketidakharmonisan antara keduanya, namun lebih buruk dimanakebunseluas102Hatidak dapat dilakukan pemanenan sehingga tidak memberikan kontribusi baik kepada masyarakat maupun perkebunan. KetuaDewanPenasehatLSM TERAPI, H GM Siregar di Medan, Rabu (14/4) menyatakan lebih satu dasawarsa perjanjian pembangunanplasmayangdijanjikan PTPN II kepada masyarakat desa Janji Raja, namun belum ada realisasi dari hal itu. “Padahal lahan yang diserahkanolehmasyarakatpadaperjanjian tersebut telah dimanfaatkan oleh perusahaan tersebut. Hal ini tidak hanya memberikan rasa kecewa melainkan masyarakat merasa dibodohi,” ujarnya. Selain itu, lanjutnya, perwakilan masyarakat yang mendatangi kantor PTPN II di Tanjungmorawa pada Selasa (13/4) juga tidak diterima pimpinan PTPN II. “Hal ini telah menambah kekecewaan mereka kepada perusahaan BUMN itu, yang seharusnya sebagai pengayom malah sebaliknya,” lanjutnya kembali. Perwakilan masyarakat Janji Raja, Tongku Adam Siregar menyatakan,awalperjanjian‘Janji Raja pada tahun 1998 dimana

surat PTPN II tertanggal 30 April menyatakanperusahaantersebut berjanji dapat membangun plasma (PIR) kepada masyarakat seluas2HaperKKdenganjumlah KK pada saat ini sebanyak 51. “Yang berarti, PTPN II membangun areal plasma seluas 102 ha,sebagaikontribusimasyarakat terhadap PTPN II adalah dengan menyerahkan lahan kebun Inti kepada PTPN II seluas 238 Ha,” ujarnya. Pada saat pembangunan plasma tersebut, lanjutnya, masyarakat menyerahkan lahan 102 Ha tersebut kepada PTPN II sehingga total keseluruhannya mencapai340Ha.“Namunsetelah ditunggu beberapa tahun hal ini juga tidak terealisasi dan mereka menyatakan ada kekurangan lahan dari penyerahan tersebut,” lanjutnya. “Warga meminta kepada tim teknis Pemkab Tapanuli Selatan untuk melakukan pengukuran. Ternyata, berdasarkan hasil ukur di lapangan tanggal 11 Desember 2006 bahwa tanah tersebut 381 ha bukan 340 ha, berarti ada kelebihan lahan yang seharusnya,” ujarnya. Tentu, lanjutnya, hal ini harus dikembalikan kemasyarakat. “SeharusnyaPTPNIIjanganmencari persoalan untuk mengelabui masyarakat,akantetapisebaliknya menjadi pengayom dan memberikan kontribusi sesuai dengan corporate social responsibility (CSR) yang dilalukan perusahaan BUMN lainnya,” lanjutnya kembali.(m38)

dari desa yang sudah memiliki jaringan PLN. Kemudian jalan kedesa-desaitubelumbisadilalui kendaraan roda empat, sehingga PT PLN sangat sulit mengangkut bahan menuju lokasi. Menurut Sekretaris Fraksi Partai Golkar DPRDSU dari daerah pemilihan Sumatera Utara 6 Mulkan Ritonga, masih banyaknya desa yang belum terjangkau aliran listrik ini, tentunya dapat kita bayangkan bagaimana kehidupan warga yang umumnya terpencil ini, karena mereka sudah puluhan tahun mengeluh akibat tidak ada listrik di tempat tinggalnya.Akibatnyamasyarakat umumnya terganggu ketika melaksanakan kegiatan dan aktivitassetiapharidansetiapmalamnya. Yang paling menyedihkan, anak-anak sekolah di desa-desa terpencilini hanyamenggunakan

lampu minyak tanah untuk belajar di rumah dan jika tidur digantungkan di dinding rumah. Setiap hari, beginilah keadaan warga di 20 desa itu, apalagi bagi warga miskinyangtidaksanggupbeligenset.Derita ini terpaksa ditanggung yang entah kapan berakhirnya. ‘’Mengingat hal itu, untuk memudahkan jaringan listrik masuk ke desa-desa terpencil itu, sudahsepantasnyaDinasPertambangan Provinsi Sumatera Utara membuka mata lebar yakni dengan memprogramkan langkah prioritas ke depan yaitu dengan melakukan pendistribusian jaringan penerangan PLTS ( Perusahaan ListrikTenaga Surya),’’ ungkap Mulkan Ritonga. Karena bisa diyakini, manfaat PLTS tidak memerlukan bahan bakar minyak (BBM), hanya menggunakan sinar matahari yang gratis, sehingga dapat diman-

faatkan didaerah terpencil untuk kepentingan sarana penerangan warga dan keperluan rumah tangga lainnya. KemudianprogramPLTSbisa dipasang secara individual (satu rumah satu system) sehingga jika rumah berjauhan sekalipun tidak memerlukanjaringankabeldistribusi, dan gangguan pada satu system tidak mengganggu sistem lainnya. Kemudian Pemprovsu dan pemerintah pusat perlu mengalokasikandanauntukmembantu Pemkab Madina untuk memprioritaskan pembukaan, perbaikan dan peningkatan sarana jalan menuju desa-desa terisolir tersebut,dengan demikian desadesabelumterjangkaualiranlistrik ini bisa dilalui kenderaan roda empat. Menurutnya, warga di desadesaterpencilini sangatberharap

dalam waktu dekat listrik sudah masuk ke desa mereka, sehingga warga tidak perlu lagi mengeluarkan biaya untuk membeli mesin genset atu lampu templok. Pengakuan warga yang memiliki mesin genset, setiap hari mereka harus menyediakan solar sebanyak 5 hingga 10 liter untuk menghidupkan mesin gensetnya selama semalaman Bagi yang banyak uang keadaan seperti ini tidak masalah, tetapi untuk warga hidupnya paspasan terpaksa harus tidur dengan lampu teplok, karenanya pihak pemerintah sudah sepantasnya membangun aliran listrik ke desa-desa tersebut, sehingga warga bisa menikmati berbagai hiburan melalui tayangan di layar televisitanpaharusmengeluarkan biayabesaruntukmembelimesin genset, solar dan lampu teplok. (m10/a24)


Sumatera Utara

WASPADA Kamis 15 April 2010

Sepeda Motor Dibawa Lari Teman Sendiri

Ibu RT Dikeroyok Gara-gara Anak P. SIANTAR (Waspada): Seorang ibu rumah tangga Mindo br Sitompul, 28, warga Jalan Rakutta Sembiring, Gang Silindung, Kel. Pondok Sayur, Kec.Siantar Martoba, Kota Pematangsiantar dikeroyok dua wanita hanya gara-gara anak berkelahi. Pengeroyokan terhadap korban diduga dilakukan MG br S, 32, tetangga korban dan semarga korban, MM br S, 32, alias Tina, warga Jalan Tangki, Kel. Nagapita, Kec.Siantar Martoba, di halaman rumah di Jalan Rakutta Sembiring, Gang Silindung, Kel. Pondok Sayur, Selasa (13/4) pukul 17:00. MG br S dan MM br S diduga mengeroyok korban ketika anak korban berada di halaman rumah dan menangis dilempar anak MM br S pakai batu. Melihat itu, korban mendatangi anak MM br S dan bertanya dimana ibunya. Tiba-tiba, MM br S mendatangi korban dan berteriak agar korban diam saja disertai dengan kata-kata kotor. Korban membalas anaknya yang salah, tapi mulutnya pula yang ribut. Saat MG br S berbicara, MM br S melempar korban pakai batu dan mengenai mata kaki kanannya hingga berdarah. MG br S turut bertindak menjambak rambut korban dan MM br S memukul tengkuk korban menggunakan batu satu kali hingga kepala dan tengkuk korban terasa sakit. “MG br S dan MM br S diduga melakukan tindak pidana penganiayaan secara bersama-sama menurut Pasal 170 subsider Pasal 351 (1) KUH Pidana,” kata Kapolresta AKBP Fatori, SIK saat dikonfirmasi melalui Pabungpen AKP Muslim dan Kasat Reskrim AKP AY. Harahap di Mapolres, Rabu (14/4). (a14)

P. SIANTAR (Waspada): Beginilah jadinya, seorang korban pencurian mabuk dan sampai tertidur di kios penjual minuman hingga sepeda motor dan HP miliknya dibawa lari teman sendiri tidak diketahui lagi. Kejadian itu menimpa korban Jaka Setiawan, 22, wiraswasta, warga Dusun I Semangat Baris, Kecamatan Siantar, Kabupaten Simalungun sesuai pengaduannya di Polresta, Pematangsiantar, Senin (12/4) menyebutkan temannya, JN, 26, wiraswasta, warga perumahan kereta api, Kelurahan Proklamasi, Kecamatan Siantar Barat, Kota Pematangsiantar diduga mencuri sepeda motor dan HP milik korban di kios minuman milik Kiki di Jalan Perinis Kemerdekaan, Kelurahan Proklamasi, Kecamatan Siantar Barat, Pematangsiantar, Sabtu (10/4) pukul 03:00. Kapolresta AKBP Fatori, SIK saat dikonfirmasi melalui Pabungpen AKP Muslim dan Kasat Reskrim AKP AY. Harahap di Mapolresta, Selasa (13/4) membenarkan .(a14)

Curi Sayur Genjer Dan Ikan Nila Diadukan P. SIANTAR (Waspada): Seorang perempuan, LS, 34, warga Jalan Rondahaim, Kel. Tanjung Pinggir, Kec. Siantar Martoba, Kota Pematangsiantar diduga mencuri sayur genjer dan ikan nila hingga diadukan seorang perempuan tetangganya ke Polsek Siantar Martoba, Polresta Pematangsiantar. Korban Mariana Purba, 47, warga Jalan Rondahaim, Kel.Tanjung Pinggir, Kec. Siantar Martoba, Pematangsiantar dalam pengaduannya, Senin (12/4) menyebutkan LS mencuri sayur genjer dan ikan nila dari kolam miliknya di Jalan Rondahaim, Kel. Tanjung Pinggir, Selasa (9/3). Menurut korban, saat pergi ke ladang, dia melihat LS di kolam ikan sedang memetik sayur genjer. Korban menghampiri LS dan bertanya mengapa berada di kolam miliknya. Namun, LS menjawab bukan urusan korban. Padasaatitu,korbanmenarikkarungplastikyangsedangdipegang LS dan ketika dibuka ternyata berisi sayur genjer dan ikan nila 20 ekor. Korban yakin, sayur genjer dan ikan nila itu baru diambil LS dari kolam miliknya tanpa izin. Kapolresta AKBP Fatori, SIK saat dikonfirmasi melalui Pabungpen AKP Muslim, Kasat Reskrim AKP AY. Harahap dan Kapolsek Siantar Martoba AKP A. Sitanggang di Mapolresta, Selasa (13/4) membenarkan pengaduan korban. (a14)

Lantas Polres Samosir Amankan Mobil PT TPL SAMOSIR (Waspada): Operasi Patuh 2010, pihak Lantas Polres Samosir menggelar razia kendaraan bermotor terhitung 10 April hingga 24 April 2010. Kasat Lantas Polres Samosir AKP B Sitohang kepada Waspada, Selasa (13/4) mengatakan, dalam razia, pihaknya tidak pandang bulu bagi kendaraan yang tidak dilengkapi surat-surat, baik milik masyarakat maupun kendaraan Dinas milik Pemkab Samosir, dan tanpa terkecuali kendaraan yang digunakan untuk operasional PT TPL. Kasat Lantas Sitohang menambahkan, bukti keseriusan Lantas Samosir, pihaknya menahan sebuah colt diesel BB 8309 LD yang digunakanPTTPLmengangkutkaryawanPTTPLdanmobilditangkap di lokasi Jalinsum Tele, Selasa (13/4). Penangkapan ini didasari, mobil itu digunakan tidak sesuai peruntukkannya dan tidak memiliki Surat Tanda Nomor Kendaraan (STNK). (c10)

Usaha Biliar Untung Sedikit, Nyambi Jual Shabu P. SIANTAR (Waspada): Tidak puas hanya membuka usaha biliar dengan keuntungan sedikit, Is, 32, alias Anto, warga Jalan Sederhana, Kel. Perdagangan II, Kec.Bandar, Kab.Simalungun menyambi dengan menjual narkotika jenis shabu-shabu (SS). “Sebelumnya, Is sebagai pemakai dan sudah sempat bertobat. Namun, kembali melakukan tindak pidana menyalahgunakan narkotikajenisSSdanmalahdidugasebagaipengedarhinggaditangkap personil Sat Narkoba,” sebut Kapolresta AKBP Rudi Hartono, SH. SIK saat dikonfirmasi melalui Pahumas Kompol Ramli Sirait dan Kasat Narkoba AKP Nelson Situmorang, SH, Rabu (14/3). NelsonSitumorangmenyebutkan,Isditangkapditempatusahanya di Jalan Sederhana, Kel. Perdagangan I, Kec.Bandar, Selasa (13/ 4) pukul 19:30. Dari Is disita 11 bungkus bubuk putih shabu 4 gram. (a14)

Pencanangan Bulan Bhakti Sosial IBI-KB Kes Di P. Siantar P.SIANTAR (Waspada): Kegiatan pencanangan gelar Bulan Bhakti Sosial IBI-KB-Kesehatan Kota Pematangsiantar di Rumah Sakit Tentara (RST) Pematangsiantar disambut kaum wanita khususnya ibu-ibu dengan sangat antusias. Kegiatan sosial yang bertautan dengan masalah keluarga berencana, apalagi dilakukan pemberian alat-alat kontrasepsi gratis seperti itu bagi masyarakat semakin langka diadakan. Komandan Detasemen Kesehatan Daerah Militer I/BB,Wilayah 01.04.01 Pematangsiantar, Letkol.Ckm dr Listiono Pranoto, SpB dalam pidato tertulis yang dibacakan Mayor Ckm P Purba menyebutkan, dasar MoU 12 April 2009 tentang Revitalisasi program kerja keluarga berencana antara jajaran TNI dengan BKKBN pusat, maka bulan bhakti sosial dicanangkan secara priodik yang tujuannnya mempererat hubungan kerjasama konsolidasi TNI dan BKKBN dalam mensukseskan program KB secara umum. (a16)

Keluarga Miskin Tidak Ber-KB Cukup Tinggi P.SIANTAR (Waspada): Kepala Badan Koordinasi Keluarga Berencana Nasional (BKKBN) Provinsi Sumataera Utara mengungkapkan, persentase pasangan usia subur (PUS) dari kalangan keluarga miskin di Sumut yang tidak tersentuh program keluarga berencana (KB) masih cukup tinggi. “Ada 12,3 persen tidak ber-KB dari keluarga miskin pasangan usia subur di Sumut,” kata Ka BKKBN Sumut, Indra Wirdhana, SH, MM didampingi HA Sofian Rangkuti, Kabid KS/PK BKKBN Sumut, menjawab Waspada, di sela-sela acara pencanangan gelar Bulan Bhakti Sosial IBI-KB Kesehatan di halaman Rumah Sakit Tentara Pematangsiantar, Rabu (14/4). Persentase itu, lanjut dia, dari 14 persen jumlah penduduk keluarga miskin di daerah ini dan mereka tesebar hampir di seluruh kabupaten kota. (a16)

Ancam Bunuh Mantan Istri Diadukan P. SIANTAR (Waspada): IS, 28, warga Jalan Jawa, Kel. Bantan, Kec. Siantar Barat, Kota Pematangsiantar mengancam bunuh terhadap mantan istrinya hingga mengadu ke Polres Simalungun. Keterangan dihimpun menyebutkan IS diduga mengancam mantan istrinya, Feni Aprilliza, 28, warga Nagori Talun Kondot, Kec. Panombean Pane, Kab. Simalungun di kantor Pengulu Talun Kondot pada Senin (12/4) pukul 10:00. Ancaman bunuh itu diduga dilakukan IS ketika korban berada di kantor panghulu dan IS muncul menemui korban. Dia mengancam membunuh korban sambil mengacung-acungkan sebilah pisau ke arah korban. Sikap IS itu terhenti ketika semakin banyak orang yang mengerumuni dan meminta IS tidak melakukan niatnya. Menurut informasi, kehadiran IS di NagoriTalun Kondot hendak menemui anak satu-satunya hasil parkawinannya dengan korban sebelum bercerai. Namun, korban melarang anaknya bertemu bapaknya hingga IS diduga emosi dan mengeluarkan ancaman. Kapolres Simalungun AKBP Rudi Hartono, SH, SIK saat dikonfirmasi melalui Pahumas Kompol Ramli Sirait dan Kasat Reskrim AKP Tito Travolta Hutauruk, SH, SIK di Mapolres, Selasa (13/4) menyebutkan IS diduga melakukan tindak pidana membuat perasaan tidak menyenangkan sesuai Pasal 335 KUH Pidana. (a14)

Waspada/Edoard Sinaga

KORBAN BRUTAL: Pedagang korban kebrutalan petugas Pasar Horas dari kantor Kecamatan Siantar Barat, Pemko Pematangsiantar, Nurmala br Manurung, 68, warga Jalan Tongkol, Kelurahan Pardomuan, Kecamatan Siantar Timur tergeletak tak sadarkan diri sesudah ditunjang petugas Pasar Horas saat terjadi penggusuran terhadap para pedagang itu di pasar terbuka Pasar Horas, Rabu (14/4) pagi.

Petugas Pasar Horas Brutal, Pedagang Dianiaya Hingga Pingsan P. SIANTAR (Waspada): Petugas Pasar Horas dari kantor Kecamatan Siantar Barat, Pemko Pematangsiantar bertindak brutal terhadap para pedagang kaki lima yang mempertahankan lokasi mereka di balairung pasar terbuka Pasar Horas, Rabu (14/4) pagi. Seorang perempuan pedagang berusia lanjut ditunjang hingga jatuh pingsan.

Tindakan brutal petugas Pasar Horas itu nyaris mengaki-

batkan bentrok, karena puluhan pedagang yang mayoritas ibuibu itu menuntut petugas Pasar Horas membawa pedagang yang jatuh pingsan itu berobat, namun para petugas itu tidak mau hingga para pedagang menjadi marah. Melihat para pedagang mulai menunjukkan sikap melawan, puluhan petugas Pasar Horas itu memilih kabur. Para pedagang sempat mengejar mereka yang melarikan diri berpencar ke arah gedung III dan gedung IV sampai ke rel kereta api di belakang gedung IV. Kejar-kejaran itu sempat memacetkan Jalan Merdeka, karena pengendara berhenti menonton kejar-kejaran itu. Para ibu itu akhirnya kem-

bali ke lokasi pasar terbuka dan bersama-sama dengan Ketua Persatuan Pedagang Pasar Terbuka Pasar Horas (P3TPH) Larham Simaremare menggotong korban Nurmala br Manurung, 68, warga Jalan Tongkol, Kel. Pardomuan, Kec. Siantar Timur, Pematangsiantar dan membawanya berobat ke RSU Vita Insani. Tindakan brutal petugas Pasar Horas itu terjadi ketika mereka dengan menaiki mobil patroli mendatangi pasar terbuka Pasar Horas dan langsung memarkirkan mobil di dekat barang dagangan para pedagang. Para petugas memerintahkan pedagang mengangkat barang dagangan mereka dan menyatakan tidak boleh berdagang

di tempat itu. Korban yang barang dagangannya persis di depan mobil patroli dan hampir tergilas bersama pedagang lainnya tidak mau menuruti perintah petugas Pasar Horas itu. Saat itulah seorang petugas menunjang seorang pedagang yang mempertahankan barang dagangannya. Pedagang sepakat bersama Ketua P3TPH mengadukan tindakan brutal petugas Pasar Horas itu ke Polresta Pematangsiantar. Kapolresta AKBP Fatori SIK saat dikonfirmasi melalui Pabungpen AKP Muslim dan Kasat Reskrim AKP AY. Harahap menyebutkan laporan pengaduan penganiayaan itu baru mereka terima. (a14)

Ketua DPRD Tapteng Sesalkan Tanah Bersengketa Masih Dikelola SOSORGADONG,Tapteng (Waspada): Ketua DPRD Tapteng menyesalkan Rantinus Manalu Cs, karena tanah yang masih bersengketa sekitar 40 Ha di Siantar CA Sosorgadong masih tetap dikerjakan karena belum mempunyai kekuatan hukum tetap. Demikian dikatakan Ketua DPRD Tapteng Sintong Gultom saat meninjau lahan sengketa antara pihak Rantinus Manalu dan Banjir Tarihoran, Selasa (13/ 4) di Kec.Sosorgadong Tapteng. Turut mendampingi Ketua DPRD Taptenga anggota komisi A membidangi Pemerintahan dan Pertanahan Parmulaan Saruksuk, Lelliana Sarumpaet,

Krismatua Panjaitan, Mangatur Marpaung, Rusli Simanjuntak dan Ariono Nainggolan. Turut hadir Kasat Intelkam Polres Tapteng AKP P Pandiangan, Kapolsek Barus AKP JG Siburian, mewakili Sekretariat DPRD M Tambunan, Camat Sosorgadong Hotlan Simanulang, Camat Sorkam Barat Rais Kari, Ka UPT Sorkam Barat Birman Sinambela, Satgas Kehutanan dan Perkebunan Sorga TH Panggabean. “Tanah ini sekarang masih bersengketa dan kasusnya sudah ditangani Poldasu, sementara kita secara kelembagaan hanya memfasilitasi untuk mendamaikan kedua belah

pihak, tetapi kita sangat kesalkan belum ada status hukum tetap Rantinus Manalu dan kawankawan masih beraktivitas mengolah lahan,” kata Sintong Gultom. Sementara beberapa orang pekerja di antaranya Marga Situmeang dan Rusman Tarihoran kepada anggota DPRD mengakui masih tetap bekerja di lahan tersebut. Ketua DPRD Tapteng Sintong Gultom meminta kedua belah pihak tidak mengerjakan lahan yang masih bersengketa sebelum mempunyai kekuatan hukum tetap. Kapolsek Barus AKP JG Siburian mengakui memper-

temukan kedua belah pihak, namun tidak ada titik temu. Banjir Tarihoran mengklaim bahwa lahannya yang saat ini digarap pihak Rantinus Manalu 27,5 hektare termasuk yang dikuasakan padanya lahan milik Samen Matondang 2,5 hektare, Lospin Sihombing 2,5 hektare, Pinda Sinaga 2,5 hektare dan Jita Bondar 5 hektare dengan total keseluruhan 40 hektare. Dikatakan Banjir, sejak 1977 pihaknya sudah mengelola lahan tersebut, namun tahun 2006 terjadi sengketa dan tidak tahu siapa yang menjual tanah miliknya kepada Rantinus Manalu. (a34)

Tiga Truk Fuso Berisi Kayu Diamankan KABANJAHE (Waspada) : Diduga tidak memiliki dokumen yang lengkap, tiga truk tronton bermuatan kayu yang telah dipotong-potong dengan ukuran panjang sekira 2 meter dan berkualitas ekspor, ditangkap Reserse Polda Sumut dari kawasan Kabupaten Dairi, Senin (12/4). Ketiga unit truk Fuso Mitsubishi yang diamankan masing-masing BK 9596 LO, D 9408 VA dan D 9409 VA, serta di kaca depan bertuliskan Suka Dame,selanjutnya para sopir dan kernet truk diboyong ke

Mapoldasu untuk pemeriksaan lebih lanjut setelah terlebih dahulu menjalani pemeriksaan di ruangan Tipiter Polres Karo. Sejumlah wartawan yang mencoba menkonfirmasi, tidak seorangpun dapat memberi jawaban dan menyarankan wartawan menghubungi Poldasu. “Sebaiknya tanyakan saja kepada Kanit Tipiter Poldasu. Truk bermuatan kayu itu hanya titipan Poldasu di Mapolres Karo,” ucapnya sumber di Polres Tanah karo Sedang di tempat terpisah,

sumber lain Mapolres Karo, ketika ditanyai wartawan di ruang kerjanya, mengungkapkan kasusnya hasil tangkapan Reserse Polda Sumut yang langsung diketuai Kompol A Siahaan. Begitu pula saat dikonfirmasi wartawan kepada Kapolres Karo AKBP Drs Ignatius Agung Prasetyo tidak berhasil. Menurut, sejumlah petugas di Mapolres Karo, sedang menerima tamu alasannya karena sebentar lagi akan mengadakan rapat dengan para perwira

Polres Karo. Beberapa warg sekitar mulai merasa resah dengan lokasi penitipan truk yang ditempatkan di pinggir jalan protokol kota. Menurut masyarakat sekitarnya, kehadiran ketiga truk bermuatan kayu di pinggir jalan. Selain mengganggu kelancaran lalu lintas terlebih lagi lokasi itu merupakan tempat penyeberangan pelajar SD, juga dapat menganggu keindahan Taman Makam Pahlawan, karena tertutup badan truk, kata warga. (a17)

Jalan Antar Kecamatan Di Simalungun Berlubang SIMALUNGUN (Waspada): Setelah beberapa bulan selesai diperbaiki, sejumlah ruas jalan antar kecamatan di Kab. Simalungun kembali berlubang sehingga sangat mengganggu pengguna jalan. Pantauan Waspada di lapangan, Rabu (14/4), beberapa badan jalan antar kecamatan yang mengalami kerusakan antara lain ruas jalan sepanjang 10 kilometer menghubungkan Simpang Pajak Negeri, Kec. Bandar menuju Pematangbandar, Kec. Pematangbandar. Kemudian ruas jalan Pematangbandar menuju Laras, Kec. Bandar Huluan sepanjang tujuh kilometer juga sudah dihiasi lubang. Selanjutnya, ruas jalan dari Bah Gunung, Kec. Bandar Huluan menuju Serbelawan, Kec. Dolok Batunanggar sekitar 12 kilometer juga mengalami kerusakan parah. Selain itu, ruas jalan dari Kerasaan menuju Pematangbandar sepanjang 7 kilometer juga sudah mulai

keriting. Kerusakan jalan tersebut sangat mengganggu kelancaran transportasi kenderaan angkutan di kawasan yang dikenal sebagai daerah penghasil padi dan kelapa sawit tersebut. Beberapa warga setempat secara terpisah mengemukakan, ruas jalan Pajak NegeriPematangbandar, ruas jalan Pematangbandar-Laras, ruas jalan Bah Gunung-Serbelawan dan ruas jalan Kerasaan-Pematangbandar pada akhir t2009 mendapat perbaikan oleh Pemkab Simalungun melalui Dinas Binamarga. Namun, baru beberapa bulan selesai diperbaiki, permukaan badan jalan yang sudah berasapal hotmix tersebut kembali terkelupas. “ Beginilah kondisinya. Padahal baru sekitar bebrapa bulan selesai dikerjakan, sudah rusak lagi,” beber Ramli. Menurut warga, kerusakan badan jalan bukan semata-mata

Waspada/Hasuna Damanik

RUSAK: Salah satu ruas jalan antar kecamatan yang mengalami kerusakan, yakini jurusan Pajak Negeri -Pematangbandar. akibat dilalui kenderaan angkutan yang melebihi daya tahan badan jalan. Tetapi, kerusakan itu juga disebabkan tidak berfungsinya drainase (parit) di sisi kiri-kanan jalan. “ Kalau hujan deras, badan

jalan tergenang air. Ini salah satu yang mempercepat kerusakan jalan ini,” terang warga lainnya. Warga mengharapkan, Dinas Bina Marga segera memperbaiki jalan yang rusak agar pemakai jalan tidak terganggu. (a15)

Babak Belurkan Istri Diadukan Ke Polisi P. SIANTAR (Waspada): Seorang pemulung, JS, 24, warga Jalan Sentosa Bawah, Pasar 4, Kelurahan Asuhan, Kecamatan Siantar Timur, Kota Pematangsiantar diduga membabakbelurkan isterinya hingga diadukan ke Polresta. Tindak kekerasan dalam rumah tangga (KDRT) dan penganiayaan itu diduga dilakukan JS terhadap istrinya, Ayu Wulandari Lumbantobing, 20, ibu rumah tangga di dalam rumah mereka sendiri pada Senin (13/4) pukul 19:30 hanya gara-gara tilam anak. Saat korban sedang berada di rumah dan berencana hendak mandi, suaminya JS menyebutkan adiknya baru melahirkan dan mereka akan berangkat ke sana dan menyuruh korban membawa serta tilam anak mereka ke rumah adik JS. Korban langsung menjawab, tilam itu pemberian orang atau hadiah dan berharga bagi mereka dan kalau mau memberikan tilam kepada adik JS agar besok saja dibeli. JS tidak mau menerima pendapat korban dan langsung marahmarah dengan kata-kata kotor dan tanpa menunggu lama, JS memukul korban di bagian mata kirinya hingga bengkak dan lembam. JS tidak berhenti di situ saja, namun masih mendorong korban ke dinding rumah hingga terjatuh dan menginjak-injak badan korban dua kali hingga terasa sakit. Akibat penganiayaan itu, seluruh tubuh korban terasa sakit. “JS diduga melakukan tindak pidana KDRT dan penganiayaan sesuai Pasal 44 (1) Undang-undang nomor 23 tahun 2004 tentang penghapusan KDRT dan Pasal 351 KUH Pidana tentang penganiayaan,” sebut Kapolresta AKBP Fatori saat dikonfirmasi melalui Pabungpen AKP Muslim dan Kasat Reskrim AKP AY. Harahap di Mapolresta, Rabu (14/4). (a14)

Warga Sibolga Resah Dipaksa Beli Obat Nyamuk SIBOLGA (Waspada): Warga Sibolga belakangan ini resah munculnya para penjual obat pembasmi nyamuk mengatasnamakan pemerintah yang memaksa para konsumen membeli dengan harga bervariasi. Salah satu ibu rumah tangga Rida, warga Jalan Cenderawasih, Kec.Sibolga Sambas, Rabu (14/4) kepada Waspada mengatakan, salah seorang pedagang menawarkan obat nyamuk merk Abate memberantas aedes mencegah penyebaran penyakit demam berdarah buatan American Cynamid Company-Usa terdaftar di Dep Pertanian nomor 279/04/79 dan dep Kesehatan no KD 8015098. Dia sempat menolak, namun tetap dipaksa untuk membeli dengan alasan untuk pendataan saja minimal 4 bungkus dengan harga Rp 10.000. Dengan terpaksa obat tersebut dibeli walaupun tidak dipergunakan. Warga meminta pihak Dinas Kesehatan Kota Sibolga untuk menertibkan penjulan tersebut yang mengatasnamakan pemerintah karena hal ini dapat memperburuk citra dengan perilaku oknum-oknum yang tidak bertanggung jawab. Kadis Kesehatan Pemko Sibolga Yusuf Batubara saat dikonfirmasi melalui telefon selularnya tidak aktif. (a34)

Sekretaris Golkar Karo Meninggal Mendadak KABANJAHE (Waspada): Amanat Sembiring, SE, SH, Sekretaris DPD Partai Golkar Karo meninggal dunia mendadak ketika mengikuti sidang Sinode GBKP di retreat center Komplek Taman Jubelium GBKP, Desa Sukamakmur, Kec. Sibolangit, Deliserdang, Selasa (13/4). Ketua DPD Partai Golkar Karo Drs Paulus Sitepu yang dihubungi Waspada membenarkan hal itu. Disebutkan, mantan anggota DPRD Karo periode 2004-2009 itu meninggal dunia akibat penyakit yang diderita. Paulus Sitepu terperanjat atas meninggalnya Amanat Sembiring karena sebelumnya tidak ada mengatakan keluhan apa-apa. Atas kejadian itu Paulus Sitepu merasa sangat kehilangan salah seorang sahabatnya yang selama ini dia percayakan sebagai sekretarisnya. “Secara pribadi dan atas nama keluarga besar DPD Partai Golkar Karo kami menyatakan duka cita yang sedalam-dalamnya atas meninggalnya saudara kami Amanat Sembiring,” ujar Paulus. Sementara pengakuan dari seorang teman satu kelompoknya dalam sidang Sinode, Fredi Bangun utusan kelasis Berastagi mengutarakan keterkejutan mereka atas meninggalnya Amanat sembiring yang dalam Sinode merupakan utusan kelasis Kabanjahe. (c06)

Mitra Bank Mandiri Gelapkan Uang Korbannya Rp125 Juta PEMATANGSIANTAR (Waspada): Seorang perempuan karyawan Mitra Bank Mandiri, MCP, 28, warga komplek Bumi Asih, Blok C, Kota Medan diduga menggelapkan dan melakukan penipuan terhadap korbannya mencapai Rp 125 juta. Keterangan dari korban Ismael, 35, warga Jalan Kiyai, Kel. Bantan, Kec. Siantar Barat, Kota Pematangsiantar di Polresta Pematangsiantar, Senin (12/4) menyebutkan MCP diduga melakukan penggelapan dan penipuan terhadap uang korban di rumah korban di Jalan Kiyai pada Mei 2009. Korban menyebutkan, Mei 2009, MCP bersama Elydatania, 25, sama sebagai Mitra Bank Mandiri mendatangi korban ke rumahnya. Kepada korban, MCP menyebutkan agar korban bisa mengatasi utangnya dengan menggadaikan sertifikat tanah dan rumah korban di Bank Danamon. Korban saat itu percaya kepada MCP dan berangkat bersama MCP, istri korban, Siti Rohani Saragih, 34, dan Elydatania menuju Bank Danamon di Jalan Merdeka, Pematangsiantar. Di sana korban bersama istrinya menandatangani surat perjanjian yang dibuat Bank Danamon. Saat menunggu proses pinjaman itu, MCP meminta korban agar menunggu di rumah saja, karena uang dari Bank Danamon cair sekitar pukul 14:00 dan kalau sudah ada uangnya diantar MCP ke rumah korban. Selanjutnya, korban bersama isterinya pulang ke rumah dan menunggu di rumah, namun MCP tidak kunjung datang sampai waktu yang disebutkannya hingga saat ini. “MCP diduga melakukan tindak pidana penggelapan dan penipuan menurut Pasal 372 subsider Pasal 378 KUH Pidana,” tutur Kapolresta Siantar AKBP Fatori, SIK saat dikonfirmasi melalui Pabungpen AKP Muslim dan Kasat Reskrim AKP AY. Harahap di Mapolresta, Selasa (13/4). (a14)

Sumatera Utara

WASPADA Kamis 15 April 2010

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane

Zhuhur 12:28 12:41 12:28 12:35 12:35 12:32 12:28 12:24 12:31

‘Ashar 15:38 15:49 15:39 15:44 15:44 15:45 15:39 15:35 15:41

Magrib 18:34 18:48 18:35 18:43 18:42 18:37 18:34 18:30 18:37



Shubuh Syuruq


19:43 19:58 19:44 19:52 19:51 19:46 19:43 19:39 19:46

04:53 05:05 04:54 05:00 05:00 04:59 04:55 04:50 04:57

05:03 05:15 05:04 05:10 05:10 05:09 05:05 05:00 05:07

Langsa 12:30 L.Seumawe 12:34 L. Pakam 12:27 Sei Rampah12:26 Meulaboh 12:38 P.Sidimpuan12:25 P. Siantar 12:26 Balige 12:26 R. Prapat 12:23

06:19 06:31 06:20 06:26 06:25 06:25 06:20 06:16 06:22

Zhuhur ‘Ashar 15:39 15:42 15:37 15:36 15:47 15:38 15:37 15:38 15:35





Shubuh Syuruq


Zhuhur ‘Ashar




Shubuh Syuruq


18:37 18:41 18:33 18:32 18:44 18:30 18:32 18:32 18:28

19:46 19:50 19:42 19:42 19:54 19:39 19:41 19:41 19:37

04:55 04:58 04:53 04:52 05:03 04:53 04:52 04:53 04:50

05:05 05:08 05:03 05:02 05:13 05:03 05:02 05:03 05:00

Sabang Pandan Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan

12:41 12:27 12:27 12:29 12:38 12:31 12:28 12:35 12:23 12:33

18:49 18:32 18:32 18:34 18:46 18:37 18:35 18:42 18:29 18:40

19:58 19:41 19:41 19:43 19:55 19:46 19:44 19:51 19:38 19:49

05:05 04:54 04:54 04:55 05:03 04:58 04:54 05:00 04:50 05:00

05:15 04:04 05:04 05:05 05:13 05:08 05:04 05:10 05:00 05:10

Tarutung 12:26 T.Tinggi 12:26 Panyabungan 12:24 Teluk Dalam12:31 Salak 12:29 Limapuluh 12:25 Parapat 12:26 GunungTua 12:24 Sibuhuan 12:23 Lhoksukon 12:33

06:21 06:24 06:18 06:17 06:29 06:18 06:18 06:18 06:15

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

15:48 15:40 15:40 15:40 15:46 15:43 15:38 15:44 15:34 15:44

06:30 06:20 06:20 06:20 06:28 06:23 06:19 06:25 06:15 06:25

Zhuhur ‘Ashar 15:39 15:36 15:37 15:45 15:41 15:35 15:38 15:36 15:37 15:42




Shubuh Syuruq

18:32 18:32 18:29 18:35 18:35 18:31 18:32 18:29 18:28 18:40

19:41 19:41 19:37 19:44 19:44 19:40 19:41 19:38 19:37 19:50

04:54 04:52 04:52 04:59 04:56 04:51 04:53 04:51 04:51 04:58

05:04 05:02 05:02 05:09 05:06 05:01 05:03 05:01 05:01 05:08

Pemko Binjai Jangan Pilih Kasih Bangunan Tanpa IMB

Penipuan Dengan HP, Ratusan Ribu Rupiah Raib

BINJAI (Waspada): Pemko Binjai diminta jangan pilih kasih menegakkan peraturan. Lembaga Swadaya Masyarakat (LSM) P3H Kota Binjai mengirimkan laporan kepada Walikota, Dinas Tarukim, Ketua DPRD dan Ka Kakan Satpol PP tentang bangunan permanen di Jalan Imam Bonjol. Ketua LSM P3H Syamsuddin Damanik didampingi Sekretaris Mhd. Jaspen Pardede menjelaskan, Rabu (14/4), bangunan permanen di Jalan Imam Bonjol, persis di sisi Gang Balai diketahui tanpa memiliki Izin Mendirikan Bangunan (IMB). Staf Dinas Tarukim ketika dihubungi, Rabu (14/4) mengakui bangunan itu tak ada dikeluarkan IMB. Pihak Dinas Tarukim sudah mengetahui bangunan dan lokasi bangunan juga belum diketahui, sebab surat-suratnya tak jelas. Lurah Setia Kec. Binjai Kota juga tidak mengetahui status tanah dan bangunan, apalagi bangunan sudah ada sebelum Lurah Setia Pontas. LSM P3H melalui surat No. 119/LSM-P3H/SU/KB/IV/2010 dikirimkan kepada Dinas Tarukim Binjai meminta usut bangunan tanpa izin. (a03)

Seleksi Calon Paskibra Binjai Tidak Murni BINJAI (Waspada): Seleksi calon pasukan pengibar bendera (Paskibra) Kota Binjai di GOR Jalan Jambi, Selasa (13/4) oleh Dinas pemuda dan Olahraga (Dispora) dinilai tidak murni. Setiap SMA dan SMK di Binjai mengirimkan siswa guna ikut seleksi paskibraka di GOR ternyata kecewa. Seperti diakui seorang siswa, ketidaklulusannya tidak murni. Jika ukuran tingginya mencukupi syarat ditentukan, namun ada anggota Paskibra lulus tingginya lebih rendah. Malahan ada peserta seleksi tidak melaksanakan tugas panitia secara penuh, bisa lulus. Penyeleksian tidak murni itu akhirnya mengundang protes. Sehingga panitia pada seleksi kedua, Rabu (14/4) mengulang pengukuran. Sebab banyak siswa ikut seleksi dikalahkan dengan ukuran tinggi tidak dipenuhi. Pihak panitia menyebutkan, Rabu (14/4), ada beberapa siswa calon paskibra terpaksa diukur ulang, ternyata tingginya cocok. (a03)

Cabuli Pacar Di Losmen, Meringkuk Di LP TEBINGTINGGI (Waspada): Mencabuli pacar di dalam kamar sebuah losmen, seorang pemuda harus meringkuk di tahanan Lembaga Permasyarakatan (LP) Jalan Pusara Pejuang Tebingtinggi. Kasus tersebut kini digelar di Pengadilan Negeri Tebingtinggi Deli. Dalam sidang dakwaan yang berlangsung tertutup, Selasa (13/4) Majelis Hakim dipimpin Silvianingsih, SH dibantu hakim anggota, Cipto HP Nababan SH.MH, M Nuzullah, SH, dan Panitera Pengganti Jadirman Purba,SH. Jaksa Penuntut Umum (JPU) Fitriayani, SH, menyebutkan kejadian tersebut, Senin 30 November 2009 sekira pukul 22:00. Ketika itu terdakwa MS, 30, warga Jalan Bakti, Ling. I, Kel. Satria, Kec. Padang Hilir Tebingtinggi men-jemput pacarnya Bunga, 16, (bukan nama sebenarnya) pulang bekerja dari toko di Jalan Sutoyo Tebingtinggi. Dalam perjalanan pulang, terdakwa menghentikan kenderaannnya di depan Losmen Srikandi yang tak jauh dari tempat sang pacar bekerja. Lalu terdakwa masuk ke dalam losmen sambil menarik tangan korban. Akhirnya karena terpaksa, Bunga menuruti masuk ke dalam losmen. Setelah di dalam kamar, terdakwa mengunci pintu kamar dari dalam. Di dalam kamar losmen, korban menolak diajak berhubungan intim, terdakwa terus memaksa sambil merayu mengatakan akan bertanggung jawab. Karena rayuan tersebut akhirnya Bungapun pasrah dan merelakan kesuciannya direnggut terdakwa. (a09)

Hamdani Jambak Pimpin DPC F.SPTI-K.SPSI T. Tinggi TEBINGTINGGI (Waspada): Federasi Serikat Pekerja Transport Indonesia Sumut menunjuk Hamdani Jambak alias Am Mogeng sebagai Ketua F.SPTI-K.SPSI Kota Tebingtinggi. Penunjukan itu termaktub dalam SK organisasi pekerja itu No.015/DPD F.STIK.SPSI/SU/II/2010 tertanggal 12 Maret 2010. Dalam SK penunjukan yang ditandatangani Ketua H Rizal Mavi, MBA dan Sekretaris Hendra Mika Siahaan, SE, menetapkan 10 nama sebagai pelaksana tugas organisasi DPC F.SPTI-K.SPSI Kota Tebingtinggi. Adapun susunan kepengurusan, yakni Ketua Hamdani Jambak, Sekretaris M Hatta, S.Ag dengan anggota Ahmad Adlan, SE, Iswan Effendi, Drs Imran Nst, Erwin Tanjung, Kasrol Efendi, Ismanto, Bahrum Harianja dan Asnawi Mangkualam. Dalam SK penghunjukan itu juga, kepengurusan yang ada diminta untuk segera melakukan koordinasi, pembinaan dan pengawasan terhadap seluruh PUK, juga dapat membentuk kelompok kerja. Ketua F.SPTI Hamdani Jambak, Rabu (14/4) mengatakan, kepengurusan ini secara de jure dan de facto telah sesuai dengan ketentuan organisasi. (a08)

DPRD DS Sahkan Perda Penyertaan Modal Pemkab LUBUK PAKAM (Waspada) : Pengesahan Rancangan Peraturan Daerah (Ranperda) menjadi Peraturan Daerah (Perda) tentang penyertaan modal Pemkab Deliserdang di Bank Sumut pada sidang paripurna DPRD daerah itu, Selasa (13/4) akhirnya disahkan melalui voting. Hal itu dilakukan karena sejumlah anggota dewan menilai materi yang menjadi acuan Ranperda penyertaan modal tersebut terkesan acak-acakan dan belum berdasarkan penelitian tim ahli atas manfaatnya terhadap masyarakat Deliserdang. Selain itu, muatan rancangan yang terdiri dari enam bab dan tujuh pasal itu hanya difokuskan kepada satu bank saja yakni Bank Sumut. Selain tidak memiliki batasan besaran modal yang ditanamkan di BUMD tersebut, batasan waktu penyertaan modal juga tidak dibatasi. Rapat paripurna dipimpin Ketua DPRD Hj Fatmawaty Tarkim dihadiri Wabup Deliserdang H Zainuddin Mars, diikuti 44 dari 50 anggota dewan. Keputusan melalui voting dilakukan karena sidang nyaris ricuh akibat gencarnya interupsi anggota dewan dari fraksi Hagrib, PDIP, dan PKS. Mereka meminta agar pimpinan dewan menunda paripurna untuk lebih menyempunakan muatan Ranperda. Bupati Deliserdang Drs H Amri Tambunan dalam sambutan disampaikanWabup H Zainuddin Mars menyampaikan terimakasih kepada seluruh anggota dewan yang memberikan persetujuan dan penetapan Ranperda tentang penyertaan modal pada Bank Sumut. (a05)

06:19 06:17 06:17 06:24 06:21 06:16 06:18 06:16 06:16 06:23

Waspada/Abdul Hakim

DIBAKAR: Kanit Reskrim Polsek Padangtualang, Iptu Febby Arianto (berdiri) didampingi anggotanya memperlihatkan kerangka tiga sepeda motor yang dibakar massa, Rabu (14/4).

Soal Pencuri Lembu Tewas

Sepeda Motor Yang Dibakar, Warga Diimbau Hormati Penyidikan STABAT (Waspada): Tiga warga Kecamatan Kwala Sawit diduga maling lembu dikeroyok massa hingga dua di antaranya tewas di lokasi, dan tiga sepeda motor mereka dibakar, Senin (13/ 4) malam. Kanit Reskrim Polsek Pa-

dangtualang Iptu Febby Arianto, menjelaskan, Rabu (14/4), polisi tidak sempat mengamankan ketiga sepeda motor karena telah dibakar massa sebelum petugas datang ke lokasi. ‘’Massa meluapkan emosi mereka dengan menyeret tiga warga itu, memukul dengan batu dan kayu. Jika jika petugas tidak cepat ke lokasi, massa diduga akan membakar ketiganya meskipun dua di antaranya telah

tewas,’’ kata Febby. Menurut Kanit, memang awal laporan diterima di Polsek, ketiga warga telah dibakar, tetapi kemudian setelah di cek hanya tiga sepeda motor yang dibakar. Kini polisi terus memeriksa sejumlah warga terkait penganiayaan yang mengakibatkan tewasnya dua warga itu. Dia juga mengimbau masyarakat Alur Gadung agar menghormati penyidikan menyang-

kut pemanggilan sejumlah warga sebagai saksi. ‘’Tidak harus berkumpul ratusan orang di Mapolsek seperti kemarin karena khawatir saksi yang dipanggil akan ditetapkan sebagai tersangka. Kita menanganinya secara profesional,’’ ujarnya. Sementara suasana Desa Alur Gadung lengang dan sepi. ‘’Masyarakat awalnya memang menaruh curiga dengan ketiga orang yang diduga selama ini

sering mencuri hewan ternak warga, apalagi waktu Maghrib mereka lalulalang seperti ada maksud tertentu. Kemudian setelah ditanyai, mereka tidak dapat menjawab dengan jelas hingga massa bertindak,’’ kata salah seorang warga Dusun I seraya menambahkan, aksi itu bukan hanya dilakukan warga Alur Gadung, tetapi juga massa dari Kec. Padangtualang maupun Babalan. (a38)

Mafia Perizinan DS Sudah Lama Beroperasi LUBUKPAKAM (Waspada): Masalah mafia perizinan di lingkunganDinasCiptaKaryadan Pertambangan Deliserdang disinyalir sudah lama beroperasi. Seperti halnya izin yang diterbitkan Dinas Cipta Karya dengan nomor 555/1564/DEPK/ DS/2009/ yang ditandatangani Ir Donald Pangondioan Lumban Tobing, untuk pembangunan menara tower atas nama Genta Buana yang terletak di Dusun I, Desa Pagar Merbau, ternyata menara yang dimaksud belum berdiri di lokasi yang dimaksud. Sebagaimana menurut warga Pagar Merbau, mengakui kalau pernah mendengar akan ada pihak hendak mendirikan menara tower. “Namun hingga saat ini pembangunan menara towertidakadadisini,”katawarga Pagar Merbau, Rabu (14/4). Menyikapi ini, tokoh pemuda Deliserdang, HM Dahril ‘Mak Utop’ Siregar, mengatakan

keja-nggalan semakin terlihat, dimana izin telah terbit sejak 9 September2009,tetapibangunan menara tower hingga kini belum ada berdiri di lokasi yang dimaksud. “Ini luar biasa, ini membuktikan kalau pihak Dinas Cipta Karya dan Pertambangan Deliserdang terlalu memaksakan menerbitkan izin asal kan pihak perusahaan berkenan membayar sejumlah uang yang diajukan dinas terkait.” Selain masalah menara tower,MakUtop padaRabusiang (14/4) juga memantau keberadaan lokasi pemecahan batu di Desa Medan Estate, Kecamatan Percut Sei Tuan. Disinyalir lahan seluas 64 Ha diperuntukan untuk pemukiman, namun sebaliknya untuk lokasi pemecahan batu di lahanyangdisewaolehpihakperusahaan dengan pemilik lahan itu. “Yangkitapertanyakanmana surat izin pemecehan batu tersebut,” kata Mak Utop. Ini bukti di

lapangan yang mungkin selama ini tidak diketahui Pemerintah KabupatenDeliserdangyangpada dasarnya mendudukkan para SKPD di dinas-dinas dinilai mampu memberikan fungsi pengawasan,namunnyatanyatidak seperti yang diharpakan untuk menjaga pencitraan Pemkab Deliserdang. Yang paling mencolok, kata Mak Utop yang juga Ketua MPC Pemuda Pancasila Deliserdang, sepertihalnyapembangunanStar Plaza di Desa Bintang Meriah, Kecamatan Batangkuis, yang sudah nyata kalau masyarakat sekitartidakadamenandatangani untuk keperluan izin gangguan, tapi kenapa pihak Cipta Karya dan Pertambangan Deliserdang berani berspekulasi tidak mengambil tindakan padahal izinnya saja masih dipertanyakan. “Ini satu lagi bukti kuatnya jaringan mafia perizinan di lingkungan Dinas Cipta Karya dan

PertambanganDeliserdang,”kata Mak Utop. Pihak Star Plaza merasayakinkekuatanuangyang sudah dikoor-dinir oknumoknum tertentu di Dinas Cipta Karya dan Pertam-bangan. Sementara itu,Wakil Komisi D DPRD Deli Serdang, H. Syarifuddin Rosha, mengatakan terima kasihnya kepada masyarakat, termasuk Dahril Siregar yang mau peduli dengan situasi lingkungan, terutama dalam membongkar mafia perizinan. “Terkait masalah Star Plaza, kita secara lembaga sudah menyampaikan surat kepada Pemerintah Daerah untuk membongkar bangunan Star Plaza yang syarat dengan manipulasi perizinan,” kata Rosha meminta hal ini segera disikapi guna menumbuhkan lebih rasa percaya kepadakinerjaPemerintahKabupaten Deliserdang. Mengecek Sementara itu Wakil Bupati

Deliserdang H Zainuddin Mars meminta seluruh SKPD (Satuan Kerja Perangkat Daerah) dan unit kerja pengelola perizinan untuk mengecek izin palsu yang telah keluar dari masing-masing unit kerjanya. Hal itu dikemukakan H Zainuddin Mars, berkaitan terbongkarnya sejumlah izin palsu yang dikeluarkanPemerintahKabupaten Deliserdang untuk badan usaha yang dilakukan oknumoknum yang tidak bertanggungjawab. “Jika ada segera laporkan kepada pihak berwajib, Pemkab Deliserdang tidak mentolerir dan tindakansepertiituharusdibersihkan melalui jalur hukum,” tegas Zainuddin saat ditemui di ruang kerjanya, Selasa (14/4). Menyinggung tentang beredarnya izin palsu, Zainuddin mengatakan hingga kini baru terdeteksi terjadi di dua SKPD di Dinas Perindustrian dan Perdagangan serta Dinas PU Cipta Karya.(a06/a05)

Pembangunan Di Tanjungmorawa Terus Menggeliat BERBICARA tentang sebuah kota di Kabupaten Deliserdang bernama Tanjungmorawa tidak terlepas dari peristiwa Tanjung Morawa berdarah yang cukup terkenal di Indonesia. Peristiwa ini terjadi pada tanggal 16 Maret 1953. Pada tahun 1953 Pemerintah RI Karesidenan Sumatera Timur merencanakan untuk mencetak sawahpercontohandibekasareal perkebunan tembakau di Desa Perdamaian, Tanjungmorawa. Akan tetapi areal perkebunan itu sudah ditempati oleh penggarap liar. Usaha pemerintah untuk memindahkan para penggarap dengan memberi ganti rugi dan menyediakan lahan pertanian, dihalang-halangi oleh Barisan Tani Indonesia (BTI), organisasi massa PKI. Karena cara musyawarah gagal, maka pada 16 Maret 1953 pemerintah terpaksa mentraktor areal yang dikawal kepolisian. Untuk menggagalkan usaha pentraktoran, BTI mengerahkan massa yang sudah mereka pengaruhi dari berbagai tempat di sekitarTanjungmorawa. Mereka bertindak brutal. Polisi melepaskantembakanperingatankeatas, tetapi tidak dihiraukan, bahkan merekaberusahamerebutsenjata polisi.Dalamsuasanakacau,jatuh korban meninggal dan luka-luka. Setelah 57 tahun berlalu kini

Tanjungmorawa menggeliat menjadi salah satu kecamatan besar di Kabupaten Deliserdang. KecamatanTanjungmorawa ini terletak pada 030-300 dan 110600 Lintang Utara. 980-460 dan 1.030-830 Bujur Timur dengan luas wilayah + 13.175 Ha dan ketinggian dari permukaan laut 30 M. Wilayahinisendiriberbatasan dengan Kec. Batangkuis dan Kec. Beringin di sebelah Utara, di sebelah Selatan berbatasan dengan Kec. STM Hilir, di sebelah Barat berbatasan dengan Kec. Patumbak, Kec. Percut Seituan dan Kota Medan dan di sebelah Timur berbatasan dengan Kec. Lubukpakam dan Kec. Pagar Merbau. Kecamatan dengan jumlah penduduk 181.128 jiwa dengan mayoritas agama Islam ini terdiri dari 25 desa, satu kelurahan, 181 dusun dan lima lingkungan yang berjarak 12 Km dari ibukota Kab. Deliserdang yakni Lubukpakam dengan potensi wilayah industri dan pertanian. Camat Tanjungmorawa Drs H Hasbi mengatakan, rencana strategis untuk pembangunan Tanjungmorawa sendiri sudah ada tercantum dalam visi misi pemerintah Kab. Deliserdang. “Tapi yang menjadi prioritas saat ini bidang pendidikan, kesehatan dan pembangunan infrastruktur tanpa mengabaikan sektor-sektor lainnya,” ujarnya. Dikatakan, pendidikan ini kembali pada konsep Cerdas Bupati Delisedang H Amri Tambunan yang sudah menggema bahkan sampai ke pusat dan ter-

bukti dengan diberikannya penghargaan Satya Lencana Pembangunan kepada Bupati Deliserdang oleh Presiden RI. “Untuk konsep Cerdas ini Kecamatan Tanjungmorawa melaksanakan dengan pola tiga kekuatanyaknimasyarakat,pengusahadanpemerintah,”ucapnya. Disamping itu dikatakannya Puskemas Tanjungmorawa sudahmenjadiPuskesmasterbaik dansudahmendapatpenghargaan terbaik kedua dari Gubernur Sumut. “Di sektor-sektor lain juga seperti infrastruktur di Kec. Tanjungmorawa terus melakukan pengecoran jalan dan parit, pengorekansaluranirigasipertanian, pembangunan taman penghijauan dan penanaman pohon. Saat ini program yang sedang dilaksanakanyaitugerakanbedah rumah,” katanya. Menurutnya, gerakan bedah rumah ini diharapkan tuntas di akhir tahun 2010. “Contoh di satu dusun di Desa Wonosari, Kec. Tanjungmorawa ada 18 rumah yang tidak layak huni dan itu akan dikerjakan secara gotongroyong bersama masyarakat, pengusaha dan pemerintah,” jelasnya. Disebutkan, gerakan bedah rumah ini diharapkan dapat meningkatkan kualitas hidup masyarakat yang tidak mampu. Dengan program GDSM Bupati Deliserdangpemerintahkecamatan setempat bekerjasama dengan masyarakat dan pengusaha membantu warga yang tidak mampu. “Gerakan bedah rumah ini


BEDAH RUMAH: Camat Tanjungmorawa Hasbi serta rombongan sedang meninjau pelaksanaan gerakan bedah rumah di Desa Wonosari, Kec. Tanjungmorawa, Kab. Deliserdang. Foto direkam belum lama ini. membutuhkan dukungan baik dari Pemkab Deliserdang, pemerintah kecamatan, masyarakat dan pengusaha. Bedah rumah ini diharapkan dapat menular ke semua desa sehingga satu tahun kedepan tidak ada lagi rumah yang tidak layak huni diTanjungmorawa,” sebutnya. Menurutnya, selain gerakan bedah rumah juga ada kegiatan penyediaan sarana air bersih bagi masyarakat dan rehabilitasi kantor Desa Wonosari. Kegiatan ini dikarenakan kualitas air sumur yang mengkhawatirkan untuk dikonsumsi masyarakat. “Saat ini sarana air bersih sedang dalam pengerjaan dan dalam waktu dekat akan rampung.Pemerintahkecamatandan masyarakat terus mendukung

program GDSM dan konsep Cerdas Bupati,” tegasnya. Kepala DesaWonosari Suparman mengatakan untuk menggalang program GDSM dan konsep Cerdas ini membentuk suatu kepanitiaan untuk terus ditindaklanjuti ke wilayah desa-desa yang lain. “Saya merasa bersyukur dan berterimakasih dengan program GDSMdankonsepCerdasBupati karenadenganprogramdankonsep ini banyak warga DesaWonosari yang terbantu. Saya juga berterimakasihdengankinerjaCamat Hasbi yang mengadakan gerakan bedah rumah dan yang lainnya,” jelasnya. Andi Nasution/ HM Husni Siregar

T. TINGGI (Waspada): Aksi penipuan mengunakan telefon selular masih saja terjadi. Kali ini korbannya seorang ibu rumah tangga, warga Kelurahan Bandar Sono, Tebingtinggi yang mengakibatkan ratusan ribu rupiah uangnya raib. Dalam penuturannya, Senin (12/4) Ros br Hasibuan alias Butet, warga Jalan Asahan-Pematangsiantar ini mengaku kejadian berawal dia dihubungi seseorang mengaku petugas Polresta Tebingtinggi menggunakan handphone nomor HP 0812 63238675. Penelefon mengatakan, seorang keluarga Ros, yakniYudha bersama temannya tertangkap membawa ganja di Simpang Empat Jalan Jenderal Sudirman, Kota Tebingtinggi, dan saat ini sedang diinterogasi. Semula korban ragu informasi tersebut, apalagi Yudha dikenal baik. Korban menganggap hal seperti itu sudah sering terjadi dengan maksud yang berujung meminta sejumlah uang. Tidak berapa lama kemudian korban penasaran atas kebenaran infomarasi itu, dihubungi kembali oleh seseorang melalui nomor HP 08126323106 mengaku atasan dari penelefon sebelumnya. Dia mengatakan kasus Yudha bisa diurus. Korban diminta mentransfer uang Rp 5 juta, maka Yudha dilepaskan. Mendengar permintaan itu korban terkejut dengan mengatakan tidak memiliki uang sebanyak itu. Setelah terjadi dialog dan negosiasi akhirnya si penelefon hanya minta agar diisikan pulsa Rp 250.000. Korban memenuhi saja permintaan si penelefon dengan berusaha mencari pinjaman uang melalui tetangga untuk mengisikan pulsa yang diminta si penelefon. Setelah kejadian korban menghubungi keluarganya, Yudha yang ternyata tidak mengalami apapun, bahkan saat itu sedang bekerja di pabrik Penggalangan Desa Binjai, Sergai. Didampingi keluarganya, Ros mengimbau masyarakat untuk waspada terhadap penipuan menggunakan handphone. (a09)

Korban Perampokan Kritis Terjatuh BESITANG (Waspada): Pandu br Simamora, warga Jalan Nurul Huda, Kel. Bukit Jengkol, Kec. Pangkalansusu, Selasa (13/4) sore menjadi korban perampokan di Jalinsum Bukitmas, Besitang. Korban kepada Waspada di sela pengaduannya ke Mapolsek Besitang, Rabu (14/4) menjelaskan, saat itu sepeda motor Yamaha Jupiter BK 5269 IP yang dikendarainya dipepet dua pria. Ketika mendekat, pelaku yang mengendarai Shogum merampas tas sandang yang tergantung di depan. Dalam keadaan gugup, wanita yang berprofesi sebagai guru SMK itu terjatuh. Korban tidak dapat berbuat banyak ketika tas sandang miliknya yang berisikan gelang emas, sejumlah uang, handphone dan STNK dibawa kabur kedua pelaku ke arah P. Brandan. Warga yang tak jauh dari lokasi kejadian berupaya membantu korban yang menderita luka lecet di bagian lutur sebelah kanan dan luka memar di kaki kiri akibat terseret ke aspal. Kapolsek P.Brandan AKP HM Kosim Sihombing dikonfirmasi Waspada membenarkan pihaknya ada menerima pengaduan terkait kasus ini. (a02)

C2 Kadisdik Batubara Raih Pasca Sarjana Unimed LIMAPULUH (Waspada) : Kepala Dinas Pendidikan Kab Batubara mengucapkanterimakasihkepadaBupatiOKAryaZulkarnain,SH.MM beserta jajarannya yang telah memberikan dukungan spritual dan partisipasi kepada dirinya atas mengikuti yudisium program pasca sarjana Unimed Prodi Administrasi Pendidikan di Unimed Medan. ‘’Disinisayaucapanterimakasihatasdukungan,spiritual,partisipasi atas ucapan selamat papan bunga yang diberikan,’’ sebut Kepala Dinas Pendidikan Kab Batubara DrsTM Syafi’i, MPd kepada Waspada, Selasa (13/4). Terimakasih juga diucapkan kepada Sekdakab Drs H Sofyan MM, Darwinson, Suharto, Muswardi, Riyadi,Yahya, Ishak, dr Surya Darma, Ir Aguslan, SE ,Drs Aladin, Kurnia, CV Widya Puspita, dan seluruh staf pendidikan. Ir. Irwansyah, dan Zulhidayat S.Sos.(a11)

Indra Yaman Terpilih Sebagai Ketua PAC PP Aek Natas RANTAUPRAPAT (Waspada): Indra Yaman Pasaribu terpilih sebagai Ketua PAC Pemuda Pancasila (PP) Kec.Aek Natas, Kab. Labuhanbatu Utara pada Musyawarah Anak Cabang (Musancab) organisasi kepemudaan, Minggu (11/4). Musancab itu dihadiri Ketua MPC PP Labura Sugianto SM, Sekretaris Selamat Riadi, caretaker ErwinWijaya dan Lusianto, Muspika Aek Natas, Pengurus PAC PP Aek Natas, Ranting PP se-Kec. Aek Natas, dan lainnya. Kandidat pada Musancab PP itu terdiri dari Yaman Pasaribu dan Ir Susilo Palopo. Dari 12 suara yang diperebutkan, IndraYaman unggul 9 suara, sedangkan rivalnya Ir Susilo Palopa mengantongi 3 suara. Ketua MPC PP Labura Sugianto SM dalam arahannya meminta ketua terpilih untuk dapat bekerjasama dengan para pengurus dan ranting-ranting PP di Aek Natas demi membesarkan ormas ini di mata masyarakat. Ketua terpilih IndraYaman Pasaribu mengatakan, akan berupaya sekuat tenaga membesarkan nama PP di Aek Natas. Dia juga berjanji tidak akan menyia-nyiakan tugasnya karena telah dipercaya pengurus dan ranting-ranting untuk menjabat Ketua PP di wilayah itu. Usai Musancab, Ketua Ranting PP Desa Kp.Yaman P Sipahutar mengatakan, terpilihya Indra Yaman sebagai Ketua PP Aek Natas tentu akan membawa perubahan di daerah ini. (a27)

Sumatera Utara

109 CPNS Tenaga Medis Formasi 2009 Ditempatkan Di RSUD R. Prapat RANTAUPRAPAT(Waspada): 109 CPNS tenaga medis formasi 2009 yang mendapat pelatihan dua hari oleh Badan Kepegawai Daerah (BKD) Labuhanbatu untuk ditempatkan di RSUD Rantauprapat. Penempatan mereka diharapkan dapat meningkatkan pelayanan pasien yang dirawat di RSUD itu, dan ini sudah diprogramkan Pemkab Labuhanbatu. Demikian Direktur RSUD Rantauprapat Dr.H.Rusman Lubis, Senin (12/4) di ruang kerjanya didampingi Kepala Tata Usaha Drs. Zainuddin Harahap. Rusmanmemaparkan, RSUDsudahlamamemintapenambahan tenaga medis, karena sangat berperan melancarkan pelayanan masyarakat. “Jadi, untuk mendapatkan standar RSU tipe B harus bisa menempatkan tenaga medis sesuai dengan kriteria, “ujarnya. Menurut Rusman yang juga pimpinan KONI Labuhambatu ini, dengan penempatan tenaga medis di RSUD sangat membantu menuju rakyat sehat 2020. Sementara, Ka. BKD Kabupaten Labuhanbatu Nasrullah, SH, M.Ap mengatakan, pembengkalan tenaga medis yang ditempatkan di RSUD Rantauprapat, dilatih ketrampilan terlebih dulu. Tenaga medis itu, dokter spesialis anak 1, THT 1, dokter umum 6, Akper 78, Akbid 14, D III Bagian Gizi 2, D III Bagian Analis Farmasi 3, D III Bagian Analis Kesehatan 4.(c01)

Tiga Pria Bawa Sajam Diamankan BINJAI (Waspada): Polresta Binjai dalam Razia Pekat Toba 2010 mengamankan tiga pria membawa senjata tajam yang ditangkap Unit Jahtanras di Simpang Padang Cermin, Kec.Selesai, Selasa (13/4). Kini ketiga pemuda Ap, 21, Ura, 24, keduanya warga Simpang Durian Molo, Kec.Kuala Langkat dan Ar, 24, warga Pasar I, Padang Cermin, Kec. Selesai, Langkat bermama barang bukti tiga bilah pisau panjang 30 cm diamankan di Polresta Binjai. Keterangan diperoleh di kepolisian, ditangkapnya ketiga tersangka saat Unit Jahtanras melakukan razia pekat, melihat ketiga pemuda di Simpang Padang Cermin. Ketika didatangi ketiga pemuda terlihat gugup dan diperiksa akhirnya polisi menemukan pisau. (a04)

Pengantar Rekap Judi Togel Dibui BINJAI (Waspada): Pengantar rekap yang juga penulis judi Togel Ls, 41, warga Pasar V Tandam, Kec. Binjai Utara, Rabu (14/4) diringkus anggota Reskrim Polresta Binjai di jalan TA Hamzah, Kec.Binjai Utara. Kini tersangka bersama barang buktinya berupa kupon judi togel dan rekap judi serta uang Rp 52.000, satu batang pulpen, HP dan becak mesin BK6571 RQ diamankan di Mapolresta Binjai guna pengusutan selanjutnya. Keterangan yang diperoleh menyebutkan, Polresta Binjai mendapat informasi dari masyarakat tersangka adalah penulis judi tegel serta pengatar rekap judi. Petugas kemudian mengadakan pemantauan dan ketika melintas di Jalan TA Hamzah, tersangka yang mengemudi becak mesin dihentikan petugas. Saat diperiksa ternyata petugas mengamankan kupon togel. (a04)

Penderita Malaria Bertambah Dapat Penanganan LIMAPULUH (Waspada): Penderita malaria bertambah sebelumnya 13 orang 5 di antaranya meninggal dunia di Desa Gambus Laut Kec . Limapuluh menjadi 31.Mereka kebanyakan anak-anak. ‘’Dari jumlah 87 yang diperiksa 31 dinyatakan positif terjangkit malaria melalui tes RDD. Mereka kebanyakan anak-anak ,’’sebut Kadis Kesehatan Kabupaten Batubara dr Surya Darma melalui Kepala Puskesmas Desa Gambus Laut dr Sarbaini yang dihubungi Waspada melalui telefon selular Rabu (14/4). Dari 31 terindikasi malaria rincian Pf,11, Pv,10, mix=10.’’Ini khusus di bulan April,’’ ujarnya. Bagi penderita katanya segera ditangani dengan memberikan pengobatan secara masal melalui petugas Posko di Puskesmas maupun pengobatan jalan. Selain melakukan penyemprotan insektisida dengan sasaran dinding rumah penduduk mematikan nyamuk yang hinggap atau menempel.’’Sampai hari ini sudah 327 rumah warga yang disemprot dari 1123 yang ditargetkan sebagaimana permintaan desa,’’ ujarnya. (a11)

Kamis 15 April 2010

Mantan Anggota TNI Terlibat Pembunuhan Agen TKI TANJUNGBALAI (Waspada): Pembunuhan agen TKI di Kota Tanjungbalai yang terjadi pada 2001, akhirnya terbongkar setelah polisi menangkap satu dari dua pelakunya, yakni mantan anggota TNI AD, Mus alias Ian, 44, warga Titi Papan, Mabar, Kec. Belawan atau warga Kapias Titi Gantung, Kec Seitualang Raso, Kota Tanjungbalai.

Tersangka Mus diciduk berdasarkan pengembangan dari penangkapan narkoba dan senjata api dengan tersangka RR alias Izal Bayang, 39, warga Kapias Titi Gantung dan WBPS alias Wira, 27, warga Jalan Kra-

Pemerintah Pusat Tanggulangi Abrasi Pantai Kuala Sipare LIMAPULUH(Waspada): Pasca bencana abrasi yang meluluhlantakkan pemukiman penduduk dan fasilitas umum di sepanjang pantai Desa Kuala Sipare, Desa Medang, Kec. Medang Deras segera ditanggulangi melalui bantuan APBN diperkirakanterealisasidalamtahun2010. ‘’Ini sesuai hasil pertemuan Bupati Batubara OK Arya Zulkarnain dengan Menkokesra RI Agung Laksono di Jakarta, Senin

(12/4),’’ sebut Kabag Humas melalui Kasubbag Pemberitaan Sori Muda Siregar didampingi Kepala Badan Penanggulangan Bencana Daerah Hasan Muda kepada Waspada, Rabu (14/4). Menurutnya,Pemkabmengusulkan bantuan kepada pemerintah pusat dengan harapan untukdirealisasikanRp48,6miliar sebagai langkah menanggulangi bencana abrasi yang melululantakan Pantai Kuala Sipare dan

143 rumah penduduk beserta fasilitas umum berupa tanah lapang dan pekuburan. Anggaran pasca bencana bersumber dari APBN ini nantinya difokuskan untuk membangun turap maupun beronjong di sepanjang pantai yang abrasi mencapai ke darat 1.500 m. Bencana abrasi terjadi sejak 2005 dan mengancam pemukiman penduduk jika tidak segera ditanggulangi. (a11)

Tim SAR Security PT MNA Siap Bantu Atasi Bencana INDRAPURA (Waspada):Tim SAR Satuan pengamanan (Security) PT MNA KualaTanjung siap membantu menanggulangi bila terjadinya bencana alam. Apalagi dari 75 jumlah security di lingkungan perusahaan yang bergerak mengolah minyak makan ini, 25 diantaranya mempunyai pengalaman dan ilmu pengetahuan tentang SAR melalui pelatihan dasar menengah hingga kejuruan. ‘’Security kita telah terlatih di bidang SAR mengikuti pendidikan di Statement Brimob Tebingtinggi dan kepiawaiannya tidak perlu diragukan, siap diterjunkan membantu penanggulangan bencana alam,’’ tutur Bagian Humas PT MNA (Multi Nabati Asahan) Kuala Tanjung Agus Suyoto, Rabu (14/4). Dalam kaitan ini pihaknya segera memberitahukan ke Pemkab Batubara c/q Badan Penanggulangan Bencana Alam atas kesetiaan tim SAR perusahaan dalam membantu bila terjadinya bencana alam dan siap untuk diarahkan. (a11)



TERANCAM PUNAH: Bangunan yang dipercayai sebagai makam Raja Kesultanan Asahan, Sultan Abdul Jalil Rahmatsyah, tidak terawat, bangunannya sudah mulai retak dan di sekitarnya dipenuhi rumput liar, bahkan makam ini terancam punah karena abrasi di Sungai Asahan yang sudah mendekati bangunan. Foto direkam, Rabu (14/4).

Menguak Sejarah Kesultanan Asahan Yang Terancam Punah KESULTANAN pertama di Asahan dimulai pada abad XVI, dengan Raja Sultan Abdul Jalil Rahmatsyah yang ditabalkan pada tahun 1630, anak dari Sultan Alaiddin Mahkota Alam Johan Berdaulat, Sultan Aceh ke XIII, dan ibunya adalah Putri Siti Ungu Selendang Bulan alias Siti Unai, anak dari Raja Pinang Awan di Kabupaten Labuhanbatu Selatan. Kerajaan dimulai Di Desa Tualang, Kecamatan Telukdalam, Kabupaten Asahan, kemudian berpindah ke Desa Tangkahan Sitarak yang kini telah berubah nama menjadi Desa Pulauraja Pekan. Kesultanan merupakan kerajaan kedua setelah Dinasti Margolang yang menguasai Asahan sebelumnya. Namun saat ini, kerajaan itu hanya tinggal kenangan, yang mulai hilang bersama berjalannya waktu, dan yang ditemukan hanyalah bangunan yang dipercayai makam Sultan Abdul Jalil Rahmatsyah, berdampingan dengan makam ibunya, Siti Una yang berjarak sekitar 20 meter dari makam sultan, yang berlokasi di belakang Mesjid Lama, Desa Pulauraja Pekan, Asahan. Pantauan Waspada, makam sultan tidak terawat dengan baik, bangunannya sudah mulai retak, ditambah lagi di sekitarnya banyak tumbuh rumput serta jalan menuju lokasi itu tertutup. Berbeda dengan makam ibunya, Siti Unai, telah dipugar istri Walikota Tanjungbalai, Ny Sutrisno Hadi pada tahun 2001, namun semak belukar tetap tumpuh mengelilingi bangunan itu. Dan, paling dikhawatirkan kedua makam itu, terancam punah, karena lokasinya berada sekitar 2 meter di pinggiran Sungai Asahan, sehingga diperkirakan dalam jangka waktu 35 tahun, situs bersejarah ini akan punah bersama hilangnya dataran yang terkikis air disebabkan abrasi. “Kerajaan Sultan Abdul Jalil Rahmatsyah, adalah kerajaan pertama yang menyebarkan Islam di Asahan, namun kedua situs bersejarah tidak dirawat,” ujar Sejarahwan Asahan, Jasnis Sulung saat ditemui Waspada. Menurutnya, tidak terawatnya kedua makam itu disebabkan, karena ahli waris Sultan Abdul Jalil Rahmatsyah, kurang peduli dengan makan itu, ditambah lagi dengan pemerintah setempat tidak terlalu memperhatikan kedua

bangunan tersebut, sehingga, terancam hilang karena abrasi sungai. “Asahan tidak bisa dipisahkan dari Kerajaan Sultan Abdul Jalil Rahmatsyah, oleh sebab itu, benda sejarah peninggalannya harus dirawat, meskipun hanya sekedar makamnya yang tersisa,” ujar Jasnis. Tidak ada pilihan lainnya, jelasnya, makam itu harus dipindahakan ketempat yang lebih layak, dan yang paling berperan dalan hal itu adalah ahli waris dan pemerintah setempat, karena menurut Jasnis, makam Ayah Siti Unai, raja Pinang Awan ditempatkan tidak jauh dari lokasi itu, namun sekarang telah hilang karena abrasi. “Kedua makam itu harus segera diselamatkan, bila tidak, banguanan itu akan punah,” ungkap Jasnis. Diragukan Berbeda dengan penjelasan dihimpun Waspada dari warga setempat di lokasi makam, mengatakan, kedua bagunan itu diragukan sebagai makam Sultan Abdul Jalil Rahmatsyah, dan Siti Unai, karena tidak ada bukti yang jelas menyatakan, kedua tokoh dimakamkan di tempat itu. “Menurut cerita nenek dari nenek saya, bangunan itu diragukan sebagai makam raja, namun makam itu adalah kuburan dari anggota kerajaan,” ujar AB Efendi Siagian,75, kepada Waspada. Berdasarakan cerita bapaknya, kedua makam itu dibagun sekitar tahun 1907-an, dan tidak ada nama atau tulisan nama nisan kedua makam tersebut. Namun certia itu, katanaya, hanya sekedar cerita yang diceritakan turun menurun, dan tidak ada pembuktian nyata kebenarannya. “Semua kembali kepada kita, mau percaya atau tidak, saksi sejarah yang hidup pada masa itu sudah banyak yang meninggal, dan saya hanya sekedar mendengar cerita dari orang tua saya, yang diapat dari orang tua mereka,” jelas Efendi. Dengan demikian, katanya, hanya para sejarahwan yang bisa membuktikan kebenaran itu, berdasarkan catatan raja yang masih tersisa, atau melakukan penelitian bangunan makam, sudah berapa lama berdiri, atau meneliti kerangka yang tertanam di dalamnya. “Bila itu terbukti makam raja, maka harus kita jaga dan kita rawat, namun bila bukan, kita pun harus menjaganya, karena makam itu adalah makam anggota kerajaan yang merupakan situs sejarah di Asahan,” ujar Efendi. Sapriadi

mat Agis, Kel. Keramat Kubah, Kota Tanjungbalai, Kamis (1/ 4). “Saat penangkapan senpi dan narkoba itu, tersangka Mus turut diamankan karena berada di lokasi, dari situlah awal terbongkarnya pembunuhan 9 tahun lalu itu,” kata Kapolres Tanjungbalai AKBP Puja Laksana melalui Perwira Humas AKP Lukman Sirait didampingi KapolsekTeluk Nibung AKP Burhanuddin Sinulingga dan Kanit Reskrim Iptu H Edi Sidauruk, Rabu (14/4). Dijelaskan Sirait, hasil pemeriksaan sementara, tersangka Mus mengakui perbuatannya. Pembunuhan terhadap Mak-

sum Gurning, warga Jalan Besar Teluknibung, Kota Tanjungbalai di Jalan Komodor Yos Sudarso, pada 6 Januari 2001, bermotif sakit hati akibat rebutan TKI. Lebih jauh dijelaskan Sirait, teman tersangka Mus alias Ian, DS (DPO), sakit hati terhadap korban karena persaingan mengangkut TKI. Oleh sebab itu, lanjut Sirait, DS pun meminta bantuan tersangka untuk menyerang korban. “DS dan tersangka Mus mendatangi korban sambil membawa celurit, dan terjadilah perkelahian, sehingga korban melarikan diri ke rumah warga di Jalan Komodor Yos Sudarso.

Saat itulah tersangka Mus dan DS menghabisi nyawa korban,” ungkap Sirait. Bekerja Keras Sirait menambahkan, selama 9 tahun ini, polisi telah bekerja keras mengungkap pembunuhan Maksum Gurning. Menurut Sirait, selama ini belum cukup bukti keterlibatan tersangka Mus alias Ian, sehingga polisi tidak bisa menciduknya. Untuk mempertanggungjawabkan perbuatannya, tersangka mendekam di ruang tahanan Mapolsekta Teluk Nibung. (a37)

Bupati Didesak Tindak Dalang Pungli SK CPNS SIMALUNGUN (Waspada): Bupati Simalungun, HT Zulkarnain Damanik, didesak bertindak tegas terhadap oknum yang mendalangi pungutan liar (pungli) biaya tebus Surat Keputusan (SK) Calon Pegawai Negeri Sipil (CPNS) dari formasi tenaga honorer 2009. “ Kalau terbukti, bupati harus menindak tegas oknum PNS yang melakukan pungli dengan dalih biaya tebus SK pengangkatan CPNS di Pemkab Simalungun,” ungkap anggota DPRD Simalungun, Johalim Purba, kepada Waspada, Rabu (14/4). Menurut Johalim, bupati harus berani bertindak atas oknum PNS yang melanggar hukum atau pungli. Hal ini untuk memberikan efek jera bagi oknum PNS dimaksud, sekaligus peringatan bagi lainnya. Selain itu, Johalim Purba, juga mengharapkan Kepolisian dan Kejari mengusut kasus

dugaan pungli terhadap ratusan CPNS dari tenaga honorer. Dia berharap, selain mendapat hukuman sesuai dengan disiplin PNS, oknum yang terlibat juga mendapat hukuman sesuai undang-undang yang berlaku. “ Dugaan pungli terhadap ratusan CPNS dengan dalih biaya tebus SK pengangkatan CPNS harus diusut hingga tuntas. Jika hal itu benar-benar terjadi dan terbukti, maka setiap oknum yang terlibat harus ditindak tegas, baik secara disiplin PNS maupun dengan pidana umum. Kita berharap instansi terkait seperti Kejari dan Kepolisian segera tanggap,” harap Johalim. Sebelumnya, dugaan pungli berdalih biaya tebus SK CPNS tersebut yang sudah berlangsung sejak 2007 dan praktek pungli terakhir terjadi lagi terhadap ratusan CPNS dari tenaga honor formasi 2009 lalu. Setiap tenaga honor yang diangkat

menjadi CPNS dikenakan kutipan Rp 6 juta per orang. Pengutipan liar itu terkesan dipaksakan bagi CPNS yang akan mengambil SK. Modusnya cukup rapi, pengutipan dilakukan melalui SKPD dimana CPNS tersebut ditugaskan. Setelah itu, orang yang telah ditentukan mengutip uang tebus SK tersebut menyetorkannya ke Badan Kepegawaian Daerah (BKD) melalui orang yang juga telah dihunjuk. Sekaitan dengan kasus dugaan pungli tersebut, Bupati Simalungun telah menginstruksikan inspektorat mengusutnya. Namun hingga saat ini, inspektorat belum melaporkan hasilnya. Sedangkan, Kepala BKD Simalungun, Jamasdin Purba yang coba dihubungi di kantornya tidak berada di tempat. Menurut salah seorang staf di kantor itu, kepala BKD sedang tugas luar. (a15)

Dibawa Pergi, Gadis Desa Diperkosa PANTAI CERMIN (Waspada): Seorang perempuan berusia 19 tahun warga Kec. Pantai Cermin, Kab.Serdang Bedagai mendapat nasib sial. Baru saja mengenal seorang pria yang mengaku bernama Iwan, gadis yang tak pernah mengecap pendidikan formal ini diperkosa di rumah seorang oknum aparat yang berdomisili di Kota Perbaungan,Kab.Serdang Bedagai. Menurut pengakuan orang tuanya di Sat Reskrim Polres Sergai, Rabu (14/4) mengatakan, peristiwa itu terjadi Kamis (31/3). Ketika itu korban yang sedang berada di rumah dijemput pria yang mengaku bernama

Iwan. “Sekira pukul 15:00, tersangka pelaku dan korban pergi dari rumah dengan mengendarai sepeda motor dan kembali pulang pukul 18:00,” kata orang tua korban. Namun, ketika korban pulang kedua orang tuanya tidak merasa curiga dan menganggap hal yang biasa. Kecurigaan mulai timbul, ketika korban tanpa sebab musabab menyatakan ingin bunuh diri, sehingga menimbulkan kecurigaan apa penyebabnya. Karena selama ini korban tidak pernah mengatakan seperti itu. Setelah dibujuk kakak korban dan orang tuanya dia mengatakan sewaktu dibawa Iwan ke rumah oknum

aparat di Perbaungan dia disuguhi minuman teh manis, setelah itu dia tidak sadarkan diri. “Saat dia sadar, tubuhnya sudah bugil dan sudah ditutupi kain sarung bagian atasnya,” ujar Eli ditimpali korban. Mengetahui hal itu, Eli mencari keberadaan pelaku ke rumah oknum aparat, namun tidak bertemu. Akan tetapi, oknum aparat meminta agar persoalan ini diselesaikan secara kekeluargaan saja. Setelah ditunggu, sesuai dengan janji yang diucapkan oknum itu ternyata pelaku tidak datang ke rumah korban, sampai akhirnya kasus dilaporkan ke Polres Sergai, katanya.(a07)

Sei Balai Realisasi PBB Di Atas 100 Persen LIMAPULUH (Waspada): Realisasi PBB sektor pedesaan/ perkotaan 2009 hanya di Kec. Sei Balai dari tujuh kecamatan di Batubara yang melebihi target mencapai 100,15 persen. Sedangkan lainnya terealisasi dari 98,88 persen ke bawah. Hal itu terungkap pada acara penyerahan Surat Pemberitahuan Pajak Terhutang Pajak Bumi dan Bangunan (SPPTPBB) dan Daftar Himpunan Ketetapan Pajak (DHKP) 2010 di aula Kantor Bupati Batubara, Rabu (14/4). ‘’Saya tekankan bagi camat serta Kades/lurah yang belum mencapai target agar kinerjanya ditingkatkan,’’ tutur Bupati OK Arya Zulkarnain, SH.MM dalam sambutannya di acara tersebut. Sebagaimana gambaran tahun 2009, target PBB pedesaan dan perkotaan sesuai SKB ditetapkan Direktorad Jenderal Pajak untuk Pemkab Batubara

sebesar Rp 2.228.855.000 dan terealisasi Rp1.933.862.99 atau sekitar 86,76 persen. ‘’Ini menunjukan kita belum dapat mencapai target dan kedepannya dapat terpenuhi sekaligus menunjukan jatidiri kita juga pernah menjabat Kadispenda dengan dibarengi merahi prestasi tunggul PBB,’’ kata OK Arya. PBB juga, katanya, merupakan sumber pendapatan pemerintah pusat dan Pemkab merupakan terpenting dalam rangka menunjang penyelenggaraan pemerintah maupun pembangunan. Bupati mengakui, meskipun pada 2010 tantangan dihadapi bersama memenuhi target pendapatan daerah tidak ringan, karena SKB PBB pedesaan/perkotaan ditetapkan sebagaimana surat Direktorat Pajak No.SE15/PJ/2010 tanggal 4 Februari untuk Kab Batubara sebesar

Rp2.200.000.000. Menurut laporan yang disampaikan Kepala Dispenda Batubara Yosrauke, SE, Ak.MM realisasi PBB Kec Sei Balai, 100,15 persen, Medang Deras, 98,88 persen, Talawi, 97,41persen, Tanjungtiram, 94,24 persen, Seisuka, 83.83 persen, Air Putih, 77,43 persen dan Limapuluh 73,30 persen. Dasar pelaksanaan penagihan PBB selain UU No 12 Tahun 1994 tentang perubahan atas UU No.12 Tahun 1985 tentang PBB, UU No 32 Tahun 2004 tentang pemerintah daerah, UU No.33 Tahun 2004 tentang perimbangan keuangan antara pusat dan daerah, beserta peraturan pemerintah, Permendagri dan surat Dirjen Pajak. Camat Sei Balai Aulia Gani Manurung, S.Sos, menyatakan syukur realisasi PBB di atas 100 persen dan tak terlepas dukungan masyarakat dalam kesadaran wajib pajak. (a11)

rungi laut dan sungai itu, Asnan nyaris tumbang. Di perairan Kuala Percut, dua kali Asnan muntah, karena harus berjalan kaki di aliran sungai tersebut. “ Kapal kandas, jadi kami terpaksa berjalan 2 kilometer di tengah arus Sungai Kuala Percut,” ujar Asnan. Di Tambak Udang Sesampainya di tujuan, Asnan dan Sangkot langsung disekap dalam kamar. “ Kami disandera di rumah penjaga tambak udang, mungkin rumah itu sudah lama ditinggalkan pemiliknya,” tutur Asnan. Selain disandera, mereka sempat diancam para perompak. “Jangan coba-coba melarikan diri, nanti kami bunuh ka-

mu,” ujar Asnan menirukan ucapan perompak itu. Kendati diancam, Asnan memberanikan diri bersilaturahmi dengan para perompak, dan berhasil. “Alhamdulillah, selama disandera, kami diizinkan beribadah, meskipun hanya makan nasi bungkus sehari sekali,” kenang Asnan. Selama dalam penyanderaan perompak, Asnan kian meningkatkan ibadahnya, termasuk tahajud di tengah malam. “ Syukur Alhamdulillah, Allah menyelamatkan kami, 4 hari disandera, kami akhirnya bebas setelah polisi berhasil menggerebek dan menangkap para perompak itu,” ujar Asnan. Perompak atau bajak laut

penyandera Asnan dan Sangkot, ditangkap petugas Ditpolairdasu di tiga tempat berbeda. Tersangka DS alias Deni, 33, warga Pajak Baru Belawan, ditangkap di Simpang Lombok, Kec. Percut Sei. Tuan, Senin (13/ 4). Pengembangan kasusnya, polisi kemudian menangkap tersangka MN alias Wak Nuh aliasWak Geng, 34, warga Dusun 13, Desa Percut Sei Tuan, ketika melintas di Jalan Lolom, Desa Cinta Rakyat, Percut Sei Tuan. Sementara, tersangka SA alias Jumbo, 24, warga Jalan Indosat, Kampung Agas, Kec. Seikupang, Kota Batam, ditangkap di tempat penyanderaan Asnan dan Sangkot. Rahmad F Siregar

Kisah Nelayan Asahan Disandera Perompak

Allah Menyelamatkan Kami…….. HAJI Asnan Matondang tampak letih. Masih terlihat jelas kecemasan di raut wajah nakhoda kapal ikan KM Cahaya Mitra Laut ini. Tegasnya, dia masih sangat trauma. Selama 4 hari, Asnan bersama nakhoda KM Prima Jaya, Sangkot Manurung, warga Kel. Siporipori, Kec. Teluk Nibung, Kota Tanjungbalai, disandera di rumah kosong di Desa Bagan Percut Sei.Tuan, Kab Deliserdang. “Selama disandera, kami hanya makan sehari sekali,” ujar Asnan kepada Waspada di

rumahnya Desa Seinangka, Kec. Seikepayang, Kab Asahan, Rabu (14/4). Ayah lima anak ini menuturkan awal terjadinya penyanderaan itu. Malam itu, Kamis (8/ 4) sekira pukul 19:30, tiba-tiba mereka dikejutkan oleh kehadiran 4 pria bersenjata api yang menggunakan perahu nelayan. “Tanpa basa-basi, mereka langsung menodongkan pistol ke tubuhku, dan membawaku ke kapal mereka. Jika tak kuturuti, mereka mengancam akan menembak kepalaku,” ujar Asnan. Setelah berpesan kepada ABK untuk membawa pulang kapal mereka, Asnan pun menuruti permintaan perompak

itu. “ Peralatan kapal, termasuk komputer dan radio, ludes diangkut perompak itu,” papar Asnan. Selain Asnan, ternyata di kapal perompak itu sudah ada nakhoda KM Prima Lestari yang bernasib sama, Sangkot Manurung. Semula, perompak itu berencana membawa Asnan dan Sangkot ke Nanggroe Aceh Darussalam. Akan tetapi, tuturnya lanjut, ketika memasuki perairan Belawan, perompak itu membatalkan niatnya. “Ada patroli keamanan laut, sehingga perompak mengalihkan rencananya, dan memutar kapal ke arah Kuala Percut,” ujar Asnan. Selama perjalanan menga-

Pentas Pilkada

WASPADA Kamis 15 April 2010

Bachtiar Djafar Nasihati BK-4 MEDAN (Waspada): Mantan walikota Medan dua periode, Bachtiar Djafar menasihati calon pasangan walikota Medan nomor urut 4, Bahdin Nur Tanjung dan Kasim Siyo (BK-4) agar menggunakan hati nurani jika memimpin daerah ini kelak. “Masyarakat butuh pemimpin pintar, tapi pintar saja tidak cukup, karena memimpin masyarakat sesungguhnya didorong hati nurani. Pemimpin harus punya kecerdasan spiritual dan sosial,” katanya saat menerima kunjungan BK-4 di kediamannya, kemarin. Menurut dia, banyak pemimpin pintar termasuk di Medan yang bahkan diakui lebih pintar dibanding dirinya saat memimpin Medan. Namun akhirnya terbukti, pemimpin yang hanya mengandalkan kecerdasan otak tanpa mendengar hati nurani, tidak memberikan manfaat banyak kepada masyarakat. Dia kemudian menjelaskan filosofi talang air yang harusnya dijadikan dasar bagi seorang yang dipercaya menjadi pemimpin atau kepala daerah. “Jika talang air berfungsi baik, akan mengalir sampai ke tempat seharusnya. Persoalannya setelah dialiri air, talang air menjadi basah merupakan konsekuensi yang sudah seharusnya diterima. Tapi menjadi berbeda jika talang air bocor yang kemudian merusak bangunan.” Sederhananya, jika seorang kepala daerah mendapat kebaikan dari program kerja yang dijalankan dalam melayani masyarakat, maka merupakan ke-


DINASEHATI: Bachtiar Djafar (memegang buku) menasihati Bahdin dan Kasim yang maju jadi calon walikota dan wakil walikota mendatang. wajaran. Bachtiar juga berbagi pengalaman, bagaimana dia menjalankan tugas sebagai walikota dua priode. Banyak tantangan dan godaan dihadapi, termasuk menyangkut pembangunan di kawasan strategis yang terpaksa ditolak karena menyalahi peruntukkan. “Saya menolak memberikan izin pembangunan di lahan samping kantor walikota karena menyalahi peruntukan. Ketika itu saya sempat diiming-imingi uang tapi saya tolak,” katanya menyebutkan sejumlah tempat strategis yang juga diminta untuk dibangun menjadi kawasan bisnis tapi ditolak. Dia juga menyayangkan rusaknya konsep tata ruang yang dibuatnya, sehingga Medan sekarang tampak kehilangan visi. “Kawasan selatan sebagai da-

erah resapan kini terancam kehilangan fungsinya, sehingga saya khawatir bagaimana Medan ke depannya,“ katanya. Untuk itu, dia mengharapkan Bahdin dan Kasim bisa mengembalikan kembali konsep tata ruang yang pernah dijalankannya jika kelak terpilih sebagai walikota. Bahdin dan Kasim Siyo mengatakatan siap menjalankan nasihat diberikan, dan berharap terus mendapat masukan guna berbuat lebih baik. “Kami sudah komit memberikan yang terbaik bagi warga Medan, sehingga ke depan menjadi daerah yang modern, sejahtera dan berbu-daya,” kata Bahdin, ditemani mantan anggota DPR RI HM Yusuf Pardamean, mantan anggota DPRDSumutHjWardatiNasution dan sejumlah ormas Islam dan tokoh masyarakat lainnya. (rel)

Diskusi Publik Di STIK-P

Pendidikan Pemilih Pemula Hindari Golput MEDAN (Waspada): Memberi pendidikan pemilih dan simulasi pemilihan kepala daerah kota Medan 2010 kepada pemilih pemula dinilai sangat penting. Sebab pada remaja yang baru memasuki usia 17, belum mempunyai sikap politik atau pilihan, sehingga untuk memobilisasi suara pemilih pemula sangat mudah dilakukan salah satu kandidat. “Selain itu, pada usia-usia ini sangat rawan terjadi black campaign dan money politics, karena pada usia seperti itu mereka memilih tidak dengan pikiran rasional, melainkan emosional,” ujar Ketua Lembaga Pengabdian Pada Masyarakat (LPPM) Sekolah Tinggi Ilmu ‘Komunikasi’ Pembangunan (STIK-P) Medan, Dra. T. Syahriani, M,Si saat membuka diskusi publik tentang Pendidikan Pemilih dan Simulasi Pemilihan Kepala Daerah Kota Medan 2010 Kepada Pemilih Pemula di Aula Kampus STIK-P, Rabu (14/4). Syahriani menjelaskan, memberi pendidikan pemilih kepada pemilih pemula adalah kewajiban Komisi Pemilihan Umum, yang tujuannya mengantisipasi banyaknya pemilih yang golput, atau yang tidak memberikan suara pada pemilu.

Narasumber yang hadir pada diskusi publik itu, Kepala Divisi Teknis KPUD Medan Bakhrul Khair Amal serta Ketua Konsentrasi Jurnalistik STIKP Dedi Sahputra. Bakhrul menjelaskan, baik dan buruknya pemimpin sangat bergantung pada tingkat partisipasi pemilih yang tinggi. Dalam hal ini, pemilih hanya butuh waktu dua menit menentukan pilihannya. “Peran kita sangat diperlukan sekali untuk memilih nanti. Sebab golput belum tentu bisa menyelesaikan masalah,” kata Bakhrul. Pada pemilihan legislatif lalu, tingkat partisipasi pemilih hanya mencapai 43 persen. Begitu juga pada pemilihan presiden, tingkat partisipasi pemilih hanya 53 persen. “Untuk itu kita harapkan pada pemilihan kepala daerah ini targetnya 100 persen.” Kepada sejumlah siswa SMK dan SMU Eria serta mahasiswa STIK-P, dia juga menjelaskan syarat-syarat menjadi pemilih. Untuk menjadi pemilih, pemilih harus terdaftar pada pemilih tetap, umur 17 tahun atau yang sudah pernah nikah dan harus mempunyai KTP. “Pada pemungutan suara yang dilaksanakan Rabu, 12 Mei 2010 nanti, terdapat 10 pasangan

yang bertarung. Pemilihan nanti kita tidak lagi mencontreng seperti pemilu legislatif dan presiden. Pemilihan kepala daerah kota Medan 2010 ini kita sudah mencoblos. Jadi, kalau dicontreng surat suaranya tidak sah,” imbuhnya. Ketua Konsentrasi Jurnalistik, Dedi Sahputra, menambah-

Maulana diakui sebagai sosok yang tidak pernah menjadikan persoalan suku dan agama sebagai dasar dalam membangun sebuah persahabatan. Termasuk menempatkan orang sebagai kepercayaannya. Di tengah persoalan diskriminasi dihadapi kota Medan, hanya segilintir pihak yang mampu melakukan pembangunan dengan menyatukan berbagai kekuatan yang berbeda kepentingan tersebut. ”Tak sedikit orang yang saya temui mengakui kalau Maulana itu orang yang berpihak kepada pemikiran yang jernih dan sehat,” kata Pdt Karmen Simorangkir Berangkat dari pengetahuannya soal Maulana, Pdt Karmen Simorangkir senang dengan kembali majunya Maulana dalam pencalonan walikota periode 2010-2015. Sebab pemimpin Medan ke depan harus-

lah yang dapat berpikir positif di tengah kemajemukan masyarakat, sehingga memiliki komitmen membangun keharmonisan masyarakat. Sementara, Maulana mengakui dari kunjungan yang dilakukan ke berbagai pihak, keluhan terbesar yang disampaikan berupa persoalan diskriminasi. Berupa sulitnya mengurus perizinan maupun persoalan peluang menduduki posisi penting di pemerintahan. ”Begitu banyak keluhan terkait diskriminasi ini yang saya dengar dari berbagai pihak. Mestinya, Medan dikelola oleh orang-orang yang mampu. Soal latar belakang seperti suku, agama dan lainnya adalah soal lain. Medan itu hanya butuh orang yang mampu serta memiliki komitmen dan konsisten,” kata dia berharap Pemko Medan ke depan dapat memperbaiki persoalan ini.(rel)

Syahrul Pasaribu-Rapolo Siregar Warga Kehormatan Darul Mursyid SIMANOSOR (Waspada): Pasangan calon bupati dan wakil bupati Tapanuli Selatan annamru arrobi’ah (nomor 4), H Syahrul M Pasaribu-H Aldinz Rapolo Siregar (SARASI) diangkat menjadi warga kehormatan Pesantren Modern Unggulan Terpadu Darul Mursyid (PDM). Ketua Umum Yayasan Haji Ihutan Ritonga (Yaspenhir), H Jafar Syahbuddin Ritonga, SE.MBA, mengumumkan itu pada festival nasid antar wirid yasin kaum ibu Darul Mursyid Cup IV se- Tapsel di Simanosor Julu, Kec. Saipar Dolok Hole, Minggu (11/4).

Tidak hanya SARASI, dihadapan ribuan warga dan santri, H Bomer Pasaribu, H Panusunan Pasaribu, H Gus Irawan, dan Ketua DPC PPP Tapsel Abdur Rasyid Lubis, juga diangkat menjadi warga kehormatan Darul Mursyid. Pada kesempatan itu, H Syahrul Pasaribu mengucapkan terima kasih atas penghargaan yang diberikan pimpinan, manajemen dan seluruh keluarga besar Darul Mursyid. Dijelaskannya, keluarga besar almarhum H Hasan Pinayungan Pasaribu memiliki hubungan kekerabatan yang erat

dengan keluarga alm. H Ihutan Ritonga, pendiri Darul Mursyid dan ayah H Jafar Syahbuddin Ritonga. Selain hubungan kerabat, anak alm. H Hasan Pinayungan Pasaribu, yakni H Panusunan Pasaribu, merupakan kawan satu sekolah Hj Riani Siregar (ibunda Jafar Syahbuddin Ritonga). Selama hidupnya, alm. H Ihutan Ritonga yang pernah menjabat Dirut Bank Sumut, merupakan guru bagi H Panusunan Pasaribu, Syahrul Pasaribu dan Gus Irawan Pasaribu yang kini menjabat Dirut Bank Sumut. (a20)

Simulasi PAM Pilkada

MEDAN (Waspada): Tim pemenangan pasangan (TPP) calon walikota dan calon wakil walikota Medan, Ajib Shah-Binsar Situmorang mendesak Poltabes Medan mengusut pelaku perusakan tanda gambar (alat peraga) pasangan calon itu. Ketua TPP Kodrat Shah didampingi Sekretaris Yance Aswin mengatakan, Poltabes dan Polsekta setempat agar mengusut pelaku perusakan tanda gambar yang berada di lima titik sepanjang Jl. Gatot Subroto. “Jika tidak ditindaklanjuti, dikhawatirkan relawan, simpatisan maupun masyarakat lainnya yang mendukung pasangan ini akan bertindak gegabah,” kata dia. Namun pihaknya meminta kepada simpatisan ataupun relawan pasangan calon tidak terprovokasi, dan dapat menahan diri, karena ini merupakan bagian dari kepedulian kepada masyarakat kota Medan. Selain itu, pihaknya mengimbau masyarakat dan simpatisan yang menemukan pelaku peru-

sakan untuk segera diamankan ke Polsekta setempat. “Langsung diamankan saja ke polsek, jangan main hakim sendiri,” tegasnya. Tim pemenangan Ajib-Binsar juga akan memberikan hadiah bagi simpatisan, relawan maupun masyarakat yang menemukan pelaku perusakan tanda gambar itu. Kepada masyarakat yang merasa terganggu dengan tanda gambar yang dipasang tim, diharapkan menghubungi nomor tim pemenangan 0811600200 (ketua) atau 08126393779 (sekretaris). “Mungkin masyarakat ada yang merasa terganggu karena berada di depan rumah atau depan usahanya, agar menghubungi nomor tim pemenangan, sehingga kami bisa memindahkannya,” imbuhnya. Kapoltabes Medan Kombes Pol. Imam Margono dikonfirmasi menuturkan, pihaknya akan menindaklanjuti jika adanya pengaduan. “Ya, kalau sudah buat pengaduan kan tidak mungkin didiamkan, kita tindaklanjuti dan akan diusut pelakunya,” kata Kapoltabes.(rel)

cabutan nomor urut calon bupati dan wakil bupati berjalan aman, sebagaimana kita harapkan bersama,” ujarnya. Berdasarkan nomor urut, pasangan Amir SyarufuddinRahmad Affandi mendapat nomor 1, Bambang WahyudiAnas Fauzi Lubis nomor 2 dan Taufan Gama Simatupang-Surya nomor 3. Pasangan Irwan Zeini-Muhammad Ritho nomor 4, Syamsul Bahri Batubara-Adi Mulyono nomor 5, Helmiati-Dahrun Hutagaol nomor 6 dan Syahlan Idris-Mansyur Marpaung nomor 7. Ketujuh pasangan yang telah ditetapkan dan sudah mendapat nomor urut diminta menandatangani berita acara pe-

Massa Bentrok Dengan Polres Tapsel

Pendeta se-Sergai Dukung Erry-Soekirman

P. SIDIMPUAN (Waspada): Ratusan massa pendukung calon bupati Tapanuli Selatan unjukrasa ke kantor KPUD Tapsel, Jl. Sutan Soripada Mulia, Senin (12/4). Mereka memaksa bertemu pimpinan KPU, menuntut dibatalkannya pemilihan, karena terjadi penggelembungan suara salah satu calon di TPS. Pihak kepolisian telah siaga, mencoba negoisasi, namun tidak ada titik temu, sehingga kondisi memanas. Pengunjukrasa bahkan melempari aparat dengan benda keras. Aksi berlangsung hampir 1 jam. Semprotan air dari mobil

PANTAI CERMIN (Waspada): Hampir seratus pendeta dari berbagai Persekutuan Agama Nasrani berkumpul di aula Pantai Cermin, Theme Park, Selasa (13/4), menyatakan dukungan kepada HT Erry Nuradi dan H Soekirman kembali memimpin Serdangbedagai. Penggagas acara itu, Pdt Gultom dan Pdt Situmorang mengatakan bahwa visi misi Erry Nuradi dan Soekirman selaras dengan keinginan masyarakat. “Juga belum ada keluhan dari para penggembala dalam menunaikan tugasnya kepada masyarakat,” kata mereka. Perhatian Pemkab Sergai terhadap perkembangan umat dan kesejahteraan umat beragama di Sergai cukup baik. “Ini membuktikan pasangan Erry Nuradi dan Soekirman pantas didukung kembali,” kata Pdt Situmorang Sebelumnya, Erry Nuradi dan Soekirman memaparkan perkembangan pemerintahan sejak 2005–2009, mulai masalah sosial,ekonomi hingga masalah keuangan yang tertuang dalam APBD Sergai.(a07)

pemadam tidak mampu membubarkan massa, malah semakin berutal, membakar ban-ban bekas serta mencoba menerobos brikade polisi. Karena semakin tidak terkendali, polisi terpaksa membubarkan massa dengan menembakkan gas air mata. Polisi juga melumpuhkan dua pengunjuk rasa, diduga provokator. Demikian simulasi pengamanan Pilkada Tapsel di Lapangan Bola PTPN III Desa Hapesong, Kec. Batangtoru, Senin (12/4). Simulasi dihadiri Kapolres Tapsel AKBP Subandriya,

Bupati Ongku P Hasibuan, Koramil Batangtoru, unsur Muspida plus dan Muspika. Kegiatan itu melibatkan personil Polres dari kesatuan Dalmas, Brimob Detasemen C, Kesbanglinmas dan masyarakat. Kapolres berharap simulasi PAM Pilkada menjadi motivasi bagi personil, baik kepolisian maupun Kesbanglinmas dalam menyukseskan pilkada 12 Mei mendatang. Diperkirakan 600 petugas kepolisian dan 1.244 Linmas akan melakukan pengamanan dan pengawalan di TPS seluruh wilayah Tapsel yang berjumlah 622. (csh)

“Waktu untuk memilih lebih kurang lima menit, tetapi dampaknya yang harus dirasakan lima tahun lamanya,” jelasnya. Dilihat secara filosofis, pilkada merupakan wujud kedaulatan rakyat, serta penyadaran hak rakyat dan penyampaian aspirasi secara konstitusional. (cmai)

Waspada/Mursal AI

7 Pasangan Calon Bertarung Menuju Asahan 1 KISARAN (Waspada): Tujuh pasangan calon bupati dan wakil bupati Asahan secara resmi ditetapkan KPUD Asahan, Rabu (14/4) di Gedung Serbaguna Jl. Akasia, Kisaran. Acara penetapan dimulai pukul 10:00, dihadiri seluruh calon bupati/wakil bupati, Muspida Plus serta massa dari partai pendukung maupun tim sukses dari masing-masing calon. Pukul 11:00, KPUD melakukan pencabutan nomor urut bagi semua pasangan yang telah ditetapkan. Ketua KPUD Asahan Edi Prayitno mengatakan, penetapan ketujuh pasangan calon sudah sesuai peraturan dan hasil verifikasi berkas para calon. “Alhamdullilah acara pen-

kan, secara teoritis perlu dijelaskan hakikat pilkada tidak sebagai ritual demokrasi, tetapi menyangkut hubungan antara hak asasi manusia dan hak memilih. Pilkada, lanjutnya, mempunyai implikasi terhadap kualitas penyelenggaraan Negara dan terciptanya good governance di masa depan.

SOSIALISASI: Kepala Divisi Teknis KPUD Medan Bakhrul Khair Amal melakukan sosialisasi di Aula Kampus STIK-P Medan, Rabu (14/4) di Jl. SM Raja Medan.

Praeses HKI: Maulana Pohan Tim Ajib-Binsar Minta Perusak Tokoh Kemajemukan Tanda Gambar Diusut MEDAN (Waspada): Calon Walikota Medan 2010-2015 H Maulana Pohan bersilaturahmi dengan Praeses Huria Kristen Indonesia (HKI) Daerah VI Sumatera Timur II. Maulana Pohan diyakini sebagai tokoh keberagaman yang mampu menyatukan perbedaan sebagai kekuatan pembangunan Kota Medan. Praeses HKI Daerah VI Sumatera Timur II, Pdt Karmen Simorangkir mengatakan itu, di Gereja HKI Resort Khusus Medan Kota Jl. Dahlia, Medan Maimun Senin (12/4). Menurutnya, berdasarkan informasi didengar dari berbagai pihak tentang jejak rekam Maulana Pohan selama di pemerintahan, merupakan tokoh yang mampu menyatukan perbedaan sebagai kekuatan dengan sebuah kedamaian. Maka dia dianggap paling layak diantara calon walikota lainnya.


netapan. Setelah penetapan, para calon bisa bersosialisasi ke masyarakat. Namun untuk kampanye, harus menunggu peraturan KPUD Asahan. Sementara, Divisi Hukum dan Humas KPUD Asahan Linda Sari mengatakan, pembekalan tentang rekening dana kampanye akan dilakukan akuntan publik dari Provsu. (a10)

Panwaslu Kecamatan Pakpak Bharat Dilantik SALAK (Waspada): 24 Orang anggota Panwaslu (panitia pengawas pemilu) tingkat kecamatan se-Kabupaten Pakpak Bharat dilantik dan diambil sumpahnya, Selasa (13/4) di Gedung Serba Guna Salak. Acara dihadiri Bupati, H Makmur Berasa, Kapolres, AKBP Suriadi Bahar, Ketua KPUD, Nazir Salim Manik, Ketua Panwaslu, Floren Berutu, Asisten I, Tikki Angkat, dan seluruh anggota Panwaslu se- Pak-pak Bharat. Ketua Panwaslu, Floren Berutu mengatakan, perekrutan tenaga panwas merupakan pemenuhan kebutuhan dan amanah UU No. 22/2007. Sebagai perpanjangan tangan Panwaslu di kecamatan, anggota Panwas harusmampumenjalankantugas monitoring secara efektif dan maksimal. Sementara Kapolres AKBP Suriadi Bahar menyebutkan, Panwaslu merupakan garda terdepan. Diharapkan selalu berkerja sama. (c08)

PNS Tanjungbalai Harus Netral TANJUNGBALAI (Waspada): Walikota Sutrisno Hadi mengimbau seluruh PNS di jajaran Pemko Tanjungbalai bersikap netral pada pilkada, Agustus mendatang. “Para pimpinan SKPD maupun staf, agar menyikapi pilkada dengan memedomi surat edaran menpan nomor SE/08.A/M.PAN/ 5/2005 tentang netralitas PNS,” kata dia, melalui Ka. Humas Darul Yana Siregar, Senin (12/4). Dikatakan, jika PNS menjadi calon kepala daerah atau wakil kepala daerah, wajib membuat surat pernyataan mengundurkan diri dari jabatannya. Kemudian, dilarang menggunakan anggaran pemerintah atau pemerintah daerah, serta dilarang menggunakan fasilitas yang terkait jabatannya. Juga dilarang melibatkan PNS lainnya untuk memberi dukungan dalam kampanye. Bagi PNS yang bukan calon kepala daerah atau wakil kelada daerah, dilarang terlibat kampanye. Pelanggaran terhadap ketentuan itu akan dikenakan sanksi disiplin sebagaimana diatur PP No. 30/1980 tentang peraturan disiplin PNS.(a37)

RAFI Tebingtinggi Netral TEBING TINGGI (Waspada): Organisasi Radio Antar Penduduk Indonesia (RAPI) menyatakan tidak memihak kepada salah satu organisasi sosial politik, dan lebih memilih bersikap netral pada pilkada Tebingtinggi, Mei 2010. Ketua RAPI terpilih, Nanang Fitra Aulia (JZ 02 LAB) menegaskan itu, usai dilantik pada pengukuhan pengurus wilayah 02.05 RAPI Tebingtinggi periode 2010-2013 di Balai Pertemuan Kartini, Minggu (11/4). Nanang meminta kader RAPI tidak sekali-kali membawa nama organisasi dalam ajang pemilihan kepala daerah. Komunikasi radio antar penduduk kata dia, mendukung kegiatan pemerintah, namun tidak terlibat dalam dukung-mendukung calon walikota. Sementara, Ketua Daerah Rapi 02 Sumut, H Zulhifzi Lubis (JZ 02OP)mengajakanggotabekerjasama,sertameningkatkanhubungan persahabatan antar sesama anggota dan masyarakat.(a09)

Massa Desak KPUD L.batu Verifikasi Ijazah Hj Adlina RANTAUPRAPAT (Waspada): Ratusan kader Masyarakat Pancasila Indonesia (MPI) Labuhanbatu mendatangi kantor KPUD, Senin (12/3), mempertanyakan keabsahan ijazah bakal calon bupati, Hj Adlina, yang terindikasi palsu. Massa dipimpin Ketua MPI Labuhanbatu, Ramli Siagian, bergerak dari Hotel Rantauprapat menuju KPUD berjalan kaki, diiringi pengeras suara serta membawa sejumlah spanduk. Ramli Siagian mengatakan, dari fotocopy ijazah Hj Adlina yang mereka terima, dan beredar di masyarakat, ditemukan beberapa kejanggalan. “Hj Adlina pernah kehilangan ijazah SD, lalu dikeluarkan surat kehilangan 23 Maret 2010, sementara pendaftaran calon ditutup 24 Maret 2010,” katanya. Ijazah SMPN 88 Jakarta Barat miliknya juga ada kejanggalan. Hj Adlina, lahir 31 Desember 1959 di Padang, dalam ijazah disebutkan menamatkan sekolah 8 Desember 1975 ditandatangani kepala dekolah Safril BA. “Namun dalam ijazah itu, kepala sekolah tidak mencantumkan nomor induk pegawai,” ujar Ramli. Untuk mengetahui kebenaran ijazah itu, telah dilakukan penelusuran ke SMPN 88 Jakarta. Kejanggalan ditemukan karena ijazah SMPN 88 yang dilampirkan Hj Adlina dikeluarkan 1975. “Dia tamat ketika sekolah itu belum ada. Apa mungkin,” tanyanya, memperlihatkan fotocopy ijazah yang beredar kepada anggota KPUD. (c01)

Kepling, RW, RT Jangan Dilibatkan Dalam KPPS PEMATANGSIANTAR (Waspada): KPUD Kota Pematangsiantar diminta tidak mengikutsertakan kepling atau kadus, ketua RW dan RT dalam merekrut Kelompok Penyelenggara Pemungutan Suara (KPPS) di tingkatan TPS. “Kepling, kadus, ketua RT dan RW merupakan organ pemerintahan, atau perpanjangan tangan lurah di tingkatan paling bawah. Bila menjadi KPPS dikhawatirkan memihak kepada pasangan calon walikota tertentu,” kata Koordinator Komite Pemantau Independen (TePI) Pematangsiantar, Armada Purba, Senin (12/4). “Guna menjaga netralitas dan kondusifitas selama proses pilkada, kami mengharapkan KPUD tidak merekrut mereka menjadi KPPS,” harapnya.(a14)



WASPADA Kamis 15 April 2010

Terkait Penanganan Teroris Di Aceh

Fashion Show Meriahkan Maulid

Komisi III Dan Komnas HAM Diminta Pantau Aceh

PANTONLABU, Aceh Utara (Waspada): Keluarga besar Madrasah Ibtidayah Negeri (MIN) Pantonlabu, Tanah Jambo Aye, Aceh Utara, Selasa (13/4) memperingati Maulid Nabi Besar Muhammad SAW, di halaman Madrasah. Selain diisi tausyiah dan menjamu puluhan yatim, Maulid juga diiringi fashion show busana muslim anak-anak. “Fashion show diikuti para murid dari madrasah. Begitu pula seni rebana. Di samping memeriahkan Maulid, aneka kegiatan tersebut sengaja kita gelar dalam rangka persiapan mengikuti Porseni tingkat kabupaten dan provinsi,” kata Kepala MIN Pantonlabu, Drs. Hamdani A. Jalil. Pantauan Waspada, meski di bawah cuaca yang relatif panas, peringatan Maulid di MIN Pantonlabu berjalan khidmat dan lancar.(cmus)

Guru Sertifikasi Pertanyakan Haknya BIREUEN (Waspada): Sejumlah guru sertifikasi di Bireuen yang mengaku telah dinyatakan lulus sertifikasinya beberapa waktu lalu mempertanyakan jatah gaji sertifikasinya. Pasalnya, sampai sekarang belum diterimananya. Sedangkan haknya itu seharusnya diterima setelah dinyatakan lulus. Menurut sejumlah guru yang lulus sertifikasi 2006 dan 2007 mulai Januari sampai April 2010, yaitu empat bulan jatah hak belum dibayar, sehingga mereka mempertanyakan kenapa belum disalurkan sampai sekarang. “Empat bulan gaji sertivikasi sampai sekarang belum kami terima,” kata seorang guru sertivikasi yang dibenarkan sejumlah guru yang juga lulus sertifikasi lainnya, seraya berharap hak mereka itu segera disalurkan. Sementara Kepala Dinas Kabupaten Bireuen, Asnawi, MPd melalui pemegang nota dinas, Iskandar menjelaskan gaji sertifikasi guru itu langsung ditangani Lembaga Penjamin Mutu Pendidikan (LPMD) Banda Aceh, pembayarannya langsung dikirim melalui kantor Pos dan Giro di masing-masing kabupaten/kota. “Dinas Pendidikan Bireuen tidak menangani masalah pembayaran gaji sertifikasi guru dan hanya sebatas mengirim berkas kegiatan mereka selaku guru lulus sertifikasi, realisasi pembayaran ditangani LPMD di Provinsi,” jelasnya. (amh)

Kades Se-Aceh Utara Tuntut Gaji LHOKSUKON, Aceh Utara (Waspada): Ratusan keuchik yang tergabung dalam Asosiasi Geuchik Aceh Utara (Asgara) menuntut pemerintah membayar gaji mareka. Pasalnya, gaji para keuchiek di Aceh Utara sudah tiga bulan menunggak. Bahkan, sebagian keuchik disebut-sebut sudah lima bulan tidak menerima gaji. “Kita sangat kecewa dengan kondisi ini. Pemerintah seharusnya memperhatikan nasib para keuchiek. Jangan dielu-elukan saja sebagai ujung tombak pemerintahan, tapi kesejahteraannya terabaikan. Sudah gajinya kecil, pembayarannya molor,” kata Ketua Asgara, Muksalmina, kepada Waspada, Selasa (13/4). Muksalmina mendesak Pemkab Aceh Utara responsif menyikapi masalah ini. “Jangan biarkan masalah ini berlarut-larut. Bila memungkinkan, bulan ini langsung di transfer. Jangan sampai para keuchik meluapkan kekecewaannya dengan berunjukrasa secara massal ke kantor bupati,” tandas Muksalmina. Seperti diketahui, gaji keuchik di Aceh Utara Rp700.000 per bulan. Gaji ini dibayar setiap tiga bulan sekali ke rekening masing-masing. Menyusul keterlambatan pembayaran gaji, mayoritas keuchik mulai mengeluh. Kalangan DPRK Aceh Utara pun sudah mendesak pemerintah daerah supaya membayar gaji mareka. Namun sampai kemarin gaji para keuchik tak juga cair.(cmus)

7.457 Pelajar SD/MI Kabupaten Bireuen Akan Ikuti UASBN BIREUEN (Waspada): 7.457 Pelajar SD/MI Kabupaten Bireuen yang sudah terdaftar akan mengikuti UASBN pada 4, 5 dan 6 Mei mendatang. Kadis P dan K Bireuen, Drs. Asnawi, MPd melalui Kabid Dikmenjur Drs. Abd. Fatah menjelaskan hal itu menjawab Waspada di kantornya, Selasa (13/4). Dikatakan, jumlah peserta UASBN SD/MI Kabupaten Bireuen berasal dari 279 SD/MI dalam Kabupaten Bireuen yang akan mengikuti UAS di masing-masing sekolah, Rayon Kota Bireuen dan 11 Sub Rayon Kecamatan. Saat ini para guru SD/MI terus membekali para peserta UAS agar memperoleh hasil kelulusan yang maksimal.(b16)

Hasil Musrenbang, Pembangunan Fokus Pada Infrastuktur BANDA ACEH (Waspada): Melalui pelaksanaan Musyawarah Perencanaan Pembangunan (Musrenbang) Aceh Tahun 2010, Pemerintah Aceh akan lebih memfokuskan pada pembangunan infrastruktur dasar, seperti jalan, irigasi dan listrik dalam mendukung pengembangan kawasan dan sentra industri dengan tetap pada pelayanan utama pada bidang pendidikan dan kesehatan. Demikian ditegaskan Gubernur Aceh Irwandi Yusuf saat membuka Musrenbang Aceh 2010, di Gedung Dewan Perwakilan Rakyat Aceh (DPRA), Selasa (13/4). Menurut Gubernur, pembangunan infrastuktur saat ini sangat dibutuhkan oleh masyarakat dan pihak investor, salah satu hambatan dalam investasi merupakan adanya kendala dari listrik dan jalan, jika permasalahan tersebut dapat teratasi, maka investasi akan mudah masuk ke Aceh. “Pada 2010 ini kita akan berupaya menyelesaikan krisis listrik dan mengutamakan pembangunan jalan, irigasi serta mengedepankan sentra industri,” kata Irwandi. Gubernur menambahkan, sesuai amanat Perpres No. 5 TAhun 2010, Badan Perencanaan Pembangunan Daerah (Bappeda) Aceh diminta menyelesaikan sejumlah agenda strategis antara lain terkait kesinambungan rekonstruksi dan percepatan pembangunan Aceh 2010-2012, penyelesaian RTRW Aceh, penyelesaian dokumen RPJM Aceh 2007-2012, penyelesaian dokumen RPJA serta rencana aksi ‘Aceh Green”. “Melalui Musrenbang, saya meminta ada integrasi perencanaan dan pelaksanaan pembangunan yang saling bertanggungjawab, baik yang bersumber dari APBA, APBN maupun sumber lain menuju visi Aceh 2025 untuk kemakmuran Aceh yang lebih baik,” ujar Irwandi.(gto)

Ketibaan (flight, asal, waktu):

Garuda Indonesia GA 146 Jakarta/Medan

Lion Air

JT 304 Jakarta JT 398 Jakarta/Medan JT 396 Jakarta/Medan

Sriwijaya Air

SJ 010 Jakarta/Medan

Air Asia

AK 305 Kuala Lumpur *


Keberangkatan (flight, tujuan, waktu):

15:45 GA 147 Medan/Jakarta


11:15 JT 397 Medan/Jakarta 16:00 JT 307 Jakarta 19:50 JT 399 Medan/Jakarta

07:20 11:55 16:35

12:50 SJ011 Medan/Jakarta


12:20 AK 306 Kuala Lumpur *


FY 3401 Penang 13:50 FY 3400 Penang * Setiap Senin, Rabu, Jumat dan Sabtu.


Maimun Asnawi, SH.I

Kasat Lantas, AKP Herry, Selasa (13/4) pagi di depan taman Riyatdhah Kota Lhokseumawe, dalam kegiatan Simpatik Rencong 2010, membagi-bagikan kunci pengaman sepeda motor kepada para pengguna jalan raya. Para pengemudi juga diingatkan menghidupkan lampu utama di siang hari, guna menghindari terjadinya laka lantas. Bagi pengguna sepedamotor yang tidak mematuhi aturan akan didenda Rp150 ribu berupa Tilang di pengadilan. Ini dilakukan untuk menjalankan UU No. 22 tahun 2009 tentang angkutan jalan raya. UU ini telah disosialisasikan lima bulan lalu.

Unsyiah Akan Tampung 1.228 Mahasiswa BANDA ACEH (Waspada): Universitas Syiah Kuala pada tahun ini akan menampung 1.228 mahasiswa baru yang masuk melalui jalur Ujian Masuk Bersama (UMB) di 12 Perguruan Tinggi Negeri. Kecuali itu, ada empat jalur lain yang bisa dipakai calon mahasiswa untuk belajar di Unsyiah. Rektor Unsyiah, Prof Dr Darni M. Daud yang didampingi Pembantu Rektor Unsyiah bidang Akademik, Prof Dr Samsul Rizal M.Eng kepada wartawan, Rabu (14/4) tahun kedua menerima mahasiswa melalui UMB, berharap para calon mahasiswa lebih antusias. Dia mengatakan, awalnya hanya ada tiga jalur calon mahasiswa masuk Unsyiah. Ketiganya melalui SNMPTN (seleksi nasional masuk perguruan tinggi negeri), Ujian Seleksi Masuk Universitas (USMU) dan Jalur Mandiri Unsyiah (JMU). Kata dia, dua jalur lainnya yakni, UMB dan Jalur Pemerintah Daerah (JPD). “Tahun ini ada 12 PTN di Indonesia yang

bergabung di UMB,” kata Darni yang juga didampingi Kepala Biro Administrasi Akademik, Dra Adjrun Ahmad, MM dan Kabag Humas Unsyiah, Drs A. Wahab Abdi, M.Si. Dia mengatakan, jalur masuk melalui USM akan memudahkan calon untuk memilih PTN favoritnya di seluruh Indonesia. Ke-12 PTN itu adalah Unsyiah, Universitas Malikussaleh, Universitas Sumatera Utara, Universitas Negeri Padang. Lalu, tambah dia, Universitas Andalas, Universitas Jambi, Universitas Indonesia, Universitas Negeri Jakarta, Universitas Islam Negeri Jakarta, Universitas Negeri Semarang, Universitas Palangka Raya dan Universitas Islam Negeri Makassar. Darni menjelaskan, pendaftaraan UMB dibuka 12 April sampai 19 Mei nanti secara online. Sedangkan ujian pada digelar satu hari saja yakni pada 22 Mei. Sementara pengumuman hasil ujian pada 8 Juni. “Pendaftaraan online ini bisa dilakukan dengan lebih dulu membayar biaya ujian terdekat di BNI tedekat, dengan menggunakan PIN dari BNI,” urai dia. Sedangkan jalur baru lainnya yak-

ni SNMPTN tetap seperti tahun sebelumnya.Tahun ini, lewat jalur SNMPTN, Unsyiah akan menampung 1.430 mahasiswa.JalurUSMUmendapatporsi 847 mahasiswa. Disusul JMU sebanyak 1.482 orang dan jalur JPD 65 mahasiswa. Untuk tahun ini, sambung Samsul, dari lima jalur masuk itu, Unsyiah menampung lebih kurang 6.052 mahasiswa. “Yang mendaftar itu mereka yang punya ijazah dalam tiga tahun terakhir, bagi yang belum UAN bisa menunjukkan saat daftar ulang,” papar Samsul. Kepala Humas Unsyiah, A Wahab Abdi menambahkan, tahun lalu Unsyiah menerima 3.224 mahasiswa. Sedangkan di Universitas Malikul Saleh (Unimal) sebanyak 1.241 mahasiswa. Sedangkan peminatnya tahun lalu berjumlah 12.668 calon peserta. “Itu belum masuk Unimal. Kalau seluruhnya berjumlah 15.214 orang,” sebut dia. Khusus UMB, tahun lalu rencana penerimaan sebanyak 1.506 orang, sedangkan peminatnya 6.049, sementara yang lulus seleksi 1.491 mahasiswa. Dari jumlah tersebut hanya 744 orang yang mendaftar ulang. (b05)

Proyek Jalan Miliaran ‘Dikebunkan’ Warga PANTONLABU, Aceh Utara (Waspada): Proyek jalan multiyears yang bernilai miliaran rupiah di Desa Meunasah Panton, Kecamatan Tanah Jambo Aye, Aceh Utara, sejak Selasa (13/4) petang ‘dikebunkan’ warga. Masyarakat setempat menanam berbagai tanaman di badan jalan tersebut sebagai bentuk protes karena tak tahan terus-terusan menghirup

debu. “Sesuai perjanjian awal, pihak kontraktor seharusnya menyiram jalan tiga kali sehari—pagi, siang dan sore. Nyatanya, pihak kontraktor malah menyiram jalan sesukanya. Kadang hanya disiram pagi dan lebih sering tak disiram sama sekali. Alhasil, para pelintas dan warga yang rumah-


DIKEBUNKAN: Proyek jalan multiyears di Desa Meunasah Panton, Kecamatan Tanah Jambo Aye, Aceh Utara, sejak Selasa (13/4) petang ‘dikebunkan’ warga. Masyarakat menanam berbagai tanaman di badan jalan tersebut sebagai bentuk protes karena tak tahan terus-terusan menghirup debu.

nya dekat jalan, saban waktu mesti hirup debu,” kata Mukhtar, Ketua Pemuda Meunasah Panton. Menurut Mukhtar, debu yang beterbangan tak hanya mengganggu para pelintas biasa dan warga sekitar. Ratusan siswa SMAN 1 Tanah Jambo Aye yang gedung sekolahnya terletak di desa itu juga mesti menghirup debu setiap pulang pergi sekolah. Begitu pula para pedagang warung kopi, di seputaran Desa Meunasah Panton, sangat terganggu dengan kondisi itu. Barang dagangan mereka, terutama kue basah, banyak tidak laku karena terkena debu. “Dalam konteks kesehatan, belakangan ini juga banyak warga — termasuk anak-anak— cukup mudah terkena flu, batuk-batuk dan sakit mata. Minimal warga sulit bernafas karena saluran hidung dan tenggorokan sering kemasukan debu. Pokoknya ketika bangun pagi, cairan dari hidung dan mulut, rata-rata berwarna abu-abu,” imbuh Mukhtar dibenarkan sejumlah warga lainnya. Pantauan Waspada, sampai Selasa petang, sejumlah tanaman- termasuk sawit, pinang dan pisang masih menancap di badan jalan. Bahkan, warga juga membuat blokade zig-zag dari ban mobil bekas. Panjang jalan yang disulap menjadi kebun kurang lebih mencapai 800 meter. Selain ditanami sejumlah tanaman, warga juga turut menempelkan beberapa poster protes terhadap kontraktor.(cmus)

BANDA ACEH (Waspada): Terkait penegakan hukum di Provinsi Aceh, dengan menguber sejumlah nama yang diklaim terkait jaringan terorisme, Komisi III DPR-RI dan Komisi Nasional Hak Azazi Manusia (Komnas HAM) diminta untuk melakukan pemantauan. “Hal ini kita minta agar dalam penegakan hukum di Aceh, tidak terjadi pelanggaran hukum,” kata Ketua Tim Pengacara Muslim (TPM) Aceh, Safaruddin, SH kepada Waspada, Selasa (13/4). Kata dia, melihat tindakan petugas kepolisian dalam menangani masalah terorisme di Aceh, saat ini sangat tidak manusiawi, seperti perlakuan tembak mati, mengikat dan menutup kepala tersangka, “seolah-olah mereka terpidana dengan vonis mati, padahal belum tentu yang ditangkap itu bersalah. Ini pelanggaran terhadap HAM,” sebut Safaruddin. Lebih lanjut dia mengatakan, hukum di negara Indonesia , menganut sistem praduga tak bersalah. Artinya, seseorang tak dapat dikatakan bersalah kecuali sudah ada keputusan pengadilan. Realita di lapangan, lanjut Safaruddin, perlakuan yang selama terjadi sangat tidak sebanding dengan per-

lakuan penegakan hukum terhadap pelaku koruptor, dimana mereka (koruptor—red) masih dapat hidup mewah dalam proses hukum. Dia menyebutkan, jika merujuk pada UUD 1945, bahwa setiap manusia bersamaan kedudukannya dalam hukum seperti dalam pasal 27 UUD 1945. menurut Safaruddin, perlakuan terhadap tersangka yang diklaim melakukan tindak pidana terorisme sangat tidak sesuai dengan UUD 1945, HAM dan peraturan perundangan lainnya. Untuk itu, TPM Aceh, akan melaporkan tindakan penegakan hukum terkait masalah terorisme tersebut kepada Komisi III dan Komnas HAM, agar segera memantau secara khusus proses penanganan masalah terorisme di Aceh. “Jangan sampai ada pelanggaran hukum dalam penegakan hukum, ini juga untuk menjaga negara dalam konteks HAM dan demokrasi,” seru Kuasa HukumWakil Gubernur Aceh, itu, seraya menandaskan, hal itu juga sekaligus menegur Kapolri dan Kapolda Aceh, terkait dengan berbagai tindakan petugas kepolisian yang telah diluar peraturan perundangan. (cmad/b09)

Teumpok Teungoh Gampong Percontohan Provinsi Aceh KOTA LHOKSEUMAWE (Waspada): Gampong Tumpok Teungoh Kecamatan Banda Sakti, Kota Lhokseumawe mewakili desa percontohan terbaik satu-satunya di Provinsi Aceh, dalam menjalankan Program Nasional Pemberdayaan Masyarakat (PNPM) Mandiri Perkotaan. Dekian Amri, ST, Asisten Konsultan (Askot) Neighborhood Development (ND) PNPM usai acara lokakarya orintasi kepada wartawan Senin (12/4) sore di kantor PNPM Tumpok Teungoh Lhokseumawe, menyebutkan, dari ribuan gampong di Aceh hanya Gampong Teumpok Teungoh yang memperoleh rangking terbaik se-Provinsi Aceh. “Ini hasil survei dan auditing dari tim PNPM Mandiri periode sebelumnya, tentang keberhasilan melaksanakan program yang digagas pemerintah pusat. Teumpok Teungoh layak menuju gampong yang mandiri dan madani,” sebut Dekian. Karena itu, Teumpok Teungoh layak mendapatkan pasokan dana segar senilai Rp1 miliar, sumber dana dari bantuan Bank Dunia (World Bank) pada tahun 2010, ini karena

prestasi kerja terbaik mereka. Dana sebanyak itu diperoleh berkat keberhasilan menjalankan program Neighborhood Development (ND) artinya Pengembangan Lingkungan atau Penata Lingkungan Pemukiman Berbasis Komunitas (PLP-BK). Dalam kesempatan itu, Ketua PNPM Tumpok Teungoh, Rostina mengatakan, tewujudnya program yang dirumuskan pemerintah pusat di desa ini tidak lepas dari peran masyarakat setempat sekaligus memberi kepercayaan penuh kepada saya baik dalam menjalankan program maupun mengelola keuangan dari berbagai sumber dana. Justru itu, harapan dan keinginan ribuan penduduk Tumpok Teungoh dari program yang menyentuh langsung kepentingan masyarakat sekarang sudah tercapaik, bahkan kini dijadikan sebagai Desa percontohan di Prov. Aceh. Acara lokakarya orientasi yang dimulai pukul 14.00 s.d pukul 17.00, dihadiri Camat Banda Sakti, Bappeda serta BPM Kota Lhokseumawe dan Saker, Korkot dari PNPM Mandiri beserta tokoh masyarakat setempat.(cmun)

PANTONLABU, Aceh Utara (Waspada): Video adegan mesum yang direkam dengan telefon selular kembali menodai Kabupaten Aceh Utara. Pelaku kali ini disebut-sebut seorang janda berinisial AN, 25, asal Dusun Lampoeh U Pantonlabu, Kecamatan Tanah Jambo Aye. Sedangkan identitas pasangan lelakinya belum terdeteksi. Informasi dihimpun Waspada, Rabu (14/4), video berdurasi 3 menit 20 detik yang berjudul ‘Lar Panton’ itu mulai mencuat sejak sebulan lalu, namun baru merebak dalam dua pekan terakhir. Bahkan video ini kini mulai beredar luas dari handphone (HP) ke HP hingga ke Kecamatan Lhoksukon dan Matangkuli. Dari gambar yang ditampilkan, diyakini perekam adegan panas itu adalah pelaku yang laki-laki. Sayangnya, identitas lelaki sulit terdeteksi karena kamera tidak pernah diarahkan kepadanya. Dalam video tersebut

juga terlihat mereka melakukan aksinya dalam sebuah kamar bercat putih, akan tetapi belum bisa dipastikan apakah lokasinya di dusun Lampoh U atau di kawasan lain. Keterangan terbaru menyebutkan, janda AN kini telah kabur ke luar kota. Selama ini kehidupan AN disinyalir tak jelas. Malah, dia juga disebut-sebut sebagai pekerja seks komersil terselubung. “Dia mulai ‘rusak’ semasa konflik. Ketika itu dia sering berkunjung ke pos salah satu pihak yang bertikai,” ungkap salah seorang warga Pantonlabu. Ketua Majelis Permusyawaratan Ulama (MPU) Kecamatan Tanah Jambo Aye, Tgk Ramli Syam, yang dikonfirmasi secara terpisah membenarkan peredaran video mesum itu. Atas nama ulama Tanah Jambo Aye, Ramli mengecam aksi itu dan mendesak pihak terkait menangkap para pelaku serta mengusut kasus itu sampai tuntas.(cmus)

Video Mesum Kembali Nodai Aceh Utara

APBK Bireuen Disahkan BIREUEN (Waspada): Akhirnya palu Anggaran Pendapatan Belanja Kabupaten (APBK) Bireuen, yang sekian lama dinanti-nantikan masyarakat, Selasa (13/4) menjelang magrib diketuk atau disahkan setelah beberapa hari dibahas. Ketua DPRK Bireuen, Ridwan Muhammad kepada Waspada usai acara mengatakan, palu anggota dewan yang membahas KUA PPAS selama beberapa pekan ini siang dan malam. Akhirnya selesai dibahas dan diputuskan melalui ketuk palu, dan akan diserahkan kepada Dinas Pe-

ngelolaan Keuangan dan Kekayaan Aceh (DPKKA) di Banda Aceh. Setelah mendapat pengesahan dari Pemerintah Aceh, Jumat (16/4) langsung diparipurnakan di DPRK setempat. “Setelah paripurna, APBK akan kita antar langsung ke Menteri Keuangan di Jakarta, sesuai janji kita atau dispensasi yang telah diberikan pemerintah pusat atas keterlambatan pembahasan atau penyerahan APBK itu. Dengan harapan semua yang kita rencanakan dapat berjalan sesuai dengan yang kita harapkan,” katanya.(amh)

Pasca SK Bupati Aceh Utara, Kuasa Hukum Perintah Petani Petik Sawit ‘SUDAH cukup petani tradisionil mengurai air mata, melihat hasil kebun sawitnya dinikmati orang lain. Sekarang saya perintahkan, agar mereka memetik sendiri TBS di kebunnya,’ kata kuasa hukum Tgk Asnawi, BA. Kuasa hukum petani Gampong Matang Serdang, Kec Tanah Jambo Aye, Aceh Utara, mengatakan hal itu kepada Waspada.“Perintah itu saya keluarkan, dasar SK Bupati Aceh Utara, Ilyas A Hamid No 146/51/2010, 12 April 2010 yang menetapkan tapal batas antara lahan eks trans Bola Mas Kec Langkahan – Kec Tanah Jambo Aye,” ujarnya Rabu (14/4). Tgk Asnawi, BA menunjukkan ketua kelompok tani (Poktan) tradisionil, M Amin Cut Amat, agar mengerahkan 25 anggotanya, untuk memetik tandan buah sawit segar (TBS) di atas lahan (kebun) sawit Gampong Matang Serdang, untuk tahap pertama seluas 50 hektar. “Dengan jelasnya tapal batas, sesuai Surat

Keputusan (SK) Bupati Aceh Utara, berarti seluas lebih kurang 178 hektar kebun sawit di Gampong Matang Serdang dan Gampong Buket Jrat Manyang (Jambo Aye), jelas bukan milik petani intensif peserta PIR/ plasma,” katanya. 50 hektar kebun sawit yang diperintahkan untuk memetik hasil itu, mulai Kamis (15/4) berada dalam kawasan lahan yang lebih kurang 178 hektar tadi, berlokasi di luar konsesi lahan Perusahaan Inti Rakyat (PIR) plasma Bola Mas (Kec Langkahan), di bawah naungan bapak angkat PTP NusantaraIkebunCotGirek,AcehUtara. Kawasan ini, kata Tgk Asnawi, BA (kuasa hukum petani tradisionil), disinyalir diserobot oknum-oknum tertentu tahun 80 an. Di atas lahan seluas 178 hektar ini, sawit ditanami secara paksa, berikut ketika tanaman sawit mulai rimbun, PIR/plasma tadi mem-

buat sertifikat atas nama para petani intensif, tanpa sepengetahuan Geuchik/Kepala Desa (Kades) Matang Serdang, almarhum A Rahman Umar, ketika itu. Kisah ironi ini berlangsung selama 22 tahun, sampai usia tanaman sawit sekarang sudah memasuki masa repelanting (penanaman kembali). Petani tradisionil memberi kuasa kepada Tgk Asnawi, dengan akte notaries Nilarufaida,SH No 651/I/VI/2009,15 Juni 2009. “Sejak itu saya bergerak bersama Kapoktan, M Amin Cut Amat, sampai keluarnya SK Bupati Aceh Utara, Senin (12/4),” ungkapnya. Dalam perjalanan membela nasib petani tradisionil, hampir selama satu tahun terakhir luntang lantung berkordinasi dengan berbagai pihak di tingkat Kec Tanah Jambo Aye dan Muspida Aceh Utara.“Berbagai prahara terjadi, terutama dari oknum-oknum yang

punya kepentingan pribadi yang belum saatnya saya beberkan indentitasnya di media massa,” papar Tgk Asnawi. Di sisi lain persoalan internal juga terjadi sampai menjelang Bupati Aceh Utara, Ilyas A Hamid menanda tangani SK tapal batas. Ada pihak-pihak yang coba menembus biorokrat Pemerintah Kabupaten (Pemkab) Aceh Utara, agar masalah tapal batas tidak jadi ditetapkan. Di lapangan juga ada oknumoknum yang mempengaruhi petani lemah, agar mencabut kuasa dari kuasa hukum.“Mereka saya duga telah berkolusi dengan iming-iming tertentu, untuk merebut kembali lahan dari petani lemah.Nah,dengan keluarnya SK Bupati Aceh Utara, penegasan batas tersebut, sekarang oknum-oknum itu sudah mulai ciut nyalinya dan kalaupun mereka masih ngotot taka pa-apa, karena pada gilirannya akan ber-

hadapan dengan pihak berwajib,” lanjut Tgk Asnawi. Rabu (14/4) kuasa hukum petani lemah, melalui surat resmi telah member wewenang kepada Kapoktan M Amin Cut Amat, 48, untuk menjaga, merawat dan mengambil hasilnya (TBS) di lahan seluas 50 hektar tahap awal dan membagibagikan sisa hasil perkebunan (SHP) TBS itu kepada anggota kelompok tani yang berhak menerimanya. “Sementara saya sekarang tidak sempat mengurus kebun, karena sedang menyusun rencana bersama pengacara ‘Ali & Pertners’ Bireuen, Ali Ahmad, SH untuk menggugat hasil kebun yang sudah dinikmati orang lain selama 22 tahun terakhir, agar dikembalikan kepada petani tradisionil Gampong Matang Serdang,” tandas Tgk Asnawi, BA. M. Jakfar Achmad


WASPADA Kamis 15 April 2010

C5 Aceh Timur Gelar Bimtek Perpustakaan Masjid

Lima Bandar Dan Pemakai Sabu Ditangkap LANGSA (Waspada): Sedikitnya lima tersangka bandar dan pemakai sabu-sabu yang selama ini beroperasi di Kota Langsa, berhasil ditangkap aparat kepolisian jajaran Polres Langsa. Bahkan dari kelima tersangka polisi juga ikut mengamankan belasan paket kecil narkoba jenis sabu-sabu siap pakai dan siap edar dengan harga mencapai jutaan rupiah, sebagai barang bukti. Kini para tersangka dan barang bukti masih diamankan di Mapolres Langsa guna pemeriksaan lebih lanjut. Kapolres Langsa AKBP.Drs. Yosi Muhamartha melalui KBO Reskrim, Ipda. Budi Nasuha.W, SH kepada wartawan, Rabu (14/ 4), mengatakan kelima tersangka bandar dan pemakai narkoba sabu-sabu itu ditangkap secara terpisah pada waktu yang berbeda. Ipda Budi mengungkapkan, awalnya polisi berhasil menangkap tersangka IM, 40, warga Banda Aceh, di kawasan Gampong Jawa Tengah Kecamatan Langsa Kota pada Rabu (7/4) lalu sekira pukul 07.30Wib pagi. Dari tersangka disita barang bukti satu paket kecil sabu-sabu siap

pakai. Dari pengembangan IM, selang setengah jam sekira pukul 08.00 Wib petugas kembali mengamankan tersangka lainnya Ap, 40, warga Geudeubang Jawa Kecamatan Langsa Kota di kediamannya. Namun dari tersangka petugas gagal menemukan barang bukti sabu. Meski demikian, dari Ap, petugas berhasil mengendus tersangka lainnya Rudi, 30, warga PB. Bujok Langsa Barat. Darinya disita empat paket kecil sabu-sabu sebagai barang bukti. “Dari ketiga tersangka ini kita terus melakukan pengembangan dan berhasil mengetahui salah satu bandarnya yaitu Thalib, 32, bersama rekannya Isa, 25, warga Kp.Teungoh, Langsa Kota. Dari kedua tersangka ini kita berhasil mengamankan barang bukti 13 paket kecil sabu-sabu siap edar,” Kata Ipda Budi. Kini kelima tersangka pemakai dan Bandar sabu-sabu tersebut masih mendekam di ruang tahanan Mapolres Langsa guna diproses secara hukum untuk mempertanggungjawabkan perbuatan masing-masing.(ts)

Soal Togel, MPU Surati Walikota Subulussalam SUBULUSSALAM (Waspada): Dipastikan praktek judi, terutama ala toto gelap (togel) maupun indikasi sejumlah praktek maksiat kian mengkristal di Subulussalam dan sekitarnya, Majelis Permusyawaratan Ulama (MPU) Subulussalam surati Wali Kota Subulussalam dan minta mengambil langkah pembersihan. Tak cuma itu, Wali Kota dan seluruh instansi terkait juga diingatkan untuk mengambil langkah pencegahan segala bentuk kemaksiatan yang ada di Subulussalam. Ketua MPU Kota Subulussalam H. Qaharuddin Kombih, S.Ag melalui ponselnya, Selasa (13/4) kepada Waspada mengatakan, pihaknya bahkan sudah banyak menerima laporan baik melalui lisan maupun pesan singkat (baca: SMS) dari masyarakat tentang fakta merebaknya kemaksiatan di bumi Sada Kata ini. Selain judi togel yang sudah menjalar ke kampong-kampong (baca: desa), aku Qaharuddin Kombih, pihaknya juga menerima laporan kalau kehadiran Penjaja Seks Komersil (PSK) dan minuman keras (miras) masih mewarnai sejumlah titik di daerah ini. Melalui suratnya No. 224.4/15/2010 tanggal 8 April 2010 tentang penyakit masyarakat (pekat), Qaharuddin berharap adanya keseriusan Wali Kota Subulussalam dan pihak berwenang untuk membersihkan praktek-praktek maksiat yang terus terjadi di sana. Menyusul tindakan pihak Sub Denpom Subulussalam yang pekan silam menangkap

enam orang juru tulis atau agen togel di daerah ini, Qaharuddin menyampaikan ucapan terima kasih. Disebutkan, pihaknya bersama Sekretaris Dinas Syariat Islam Subulussalam bahkan diundang pihak Sub Denpom Subulussalam untuk memberikan tausiyah kepada mereka yang ditangkap sebelum dilepas kembali. “Setelah diberi tausiyah, mereka berjanji tidak akan mengulangi perbuatannya dan jika dilanggar siap menerima hukuman sesuai aturan yang berlaku,” tandas Qaharuddin menjawab realisasi penangkapan itu. Kepada segenap masyarakat yang dinilai telah melakukan tindakan amar ma’ruf nahi mungkar selama ini, Qaharuddin pun menyampaikan apresiasi. “Upaya pencegahan dari perbuatan keji dan mungkar tugas kita semua,” tandas Qaharuddin, berulang menyampaikan harapan kepada Wali Kota Subulussalam Merah Sakti, SH untuk menindak dan membersihkan praktek-praktek maksiat itu. Catatan Waspada, pekan pertama Maret silam, Pj. Kepala Kantor Satpol PP dan WH Subulussalam Sahidin B, SH telah menggelar razia ke sejumlah titik yang diduga menjadi lokasi praktek maksiat di Subulussalam yang melibatkan Muspika Penanggalan dan Simpang Kiri, Ketua MPU, Sekretaris Dinas Syariat Islam H. Salmudin dan sejumlah personil Satpol PP dan WH setempat. (b33)

Anggaran Pendidikan Masih Berkurang BANDA ACEH (Waspada): Pengalokasian dana pendidikan Aceh untuk tahun ini semakin menipis. Akibat minimnya anggaran untuk perguruan tinggi ini dampak buruk akan terjadi pada dunia pendidikan Aceh pada masa depan. Demikian di sampaikan rektor IAIN ArRaniry Prof DR H FaridWadji Ibrahim, MA, usai melakukan penandatangan MoU kerjasama IAIN Ar-Raniry dengan Universitas Serambi Mekkah kampus IAIN Ar-Raniry Darussalam Banda Aceh, Senin (12/4) FaridWajdi mengatakan, pihaknya khawatir dengan kondisi keuangan pendidikan Aceh tahun ini, terutama dana perguruan tinggi. Kata dia, itu bukan langkah maju dunia pendidikan di Aceh, melainkan kelabu. “Secara jujur saya sangat prihatin kondisi pendidikan di Aceh secara menyeluruh, terutama bagi perguruan tinggi negeri,” ujar dia. Kata dia, minimnya anggaran untuk perguruan tinggi, akan membawa dampak negatif bagi perguruan tinggi swasta lainnya yang ada di Aceh. Farid Wajdi didampingi ketua umum Yayasan Pembangunan Serambi Mekkah, T.HM Sulaiman Shah, dan Rektor Universitas Serambi Mekkah, DR.H Abdul Gani Asyek, MA, menyebutkan, kondisi ini dapat memperburuk situasi pendidikan Aceh terutama dilevel perguruan tinggi. Maka dari itu, lanjut dia, menjalin kerjasama dengan universitas baik negeri maupun swasta perlu di tingkatkan, “sehingga kondisi pendidikan di Aceh stabil, tidak lagi jatuh pada rangking terpuruk di dunia pendidikan Indonesia,” tambah Farid. “Seharusnya panitia anggaran harus benar-

benar peka terhadap dunia pendidikan di Aceh, bagaimanapun Aceh harus di bangun melalui pendidikan yang baik, termasuk dalam peningkatan sumber daya manusia Aceh secara khusus,” sebutnya. Sementara itu ketua umum Yayasan Pembangunan Serambi Mekkah, T.HM Sulaiman Shah, menyebutkan kerjasama yang dibangun dengan IAIN Ar-Raniry mengingat di USM akan dibuka fakultas baru yang bernuasa nilai-nilai Islami sesuai dengan kondisi masyarakat Aceh saat ini. Dia menambahkan, pembukaan fakultas baru di USM di antaranya Fakultas Sariah yang meliputi prodi SMI, SJS dan diploma pendidikan, fakultas dakwah dan komunikasi yang meliputi prodi KPI, BPI dan jurnalistik. Kedua pihak, menyambut positif dengan pengembangan sayap-sayap fakultas yang bernuasa Islami di kembangkan di Aceh, meningat kondisi masyarakat Aceh saat ini telah menerapkan hukum syariat Islam. “Kita tidak perlu bangga dengan kejayaan masa lalu, kalau kita tidak peduli tentang dunia pendidikan di Aceh, maka sudah seyogyanya pemerintah berpikir untuk kemajuan anak negerinya, apalagi kondisi Aceh masa sekarang sudah jauh berbeda dengan masa konflik,” tukas Sulaiman Shah. Dia mengajak baik pemerintah, DPRA maupun seluruh elemen berpikir tentang kemajuan pendidikan di Aceh, karena yang kami didik bukanlah anak siapa-siapa akan tetapi anak masyarakat Aceh, siapa tahu nantinya mereka juga akan mengantikan kita mengendali pemerintahan, kampus maupun parlemen. (b05)

Kontraktor Mulai Angkut Kayu Hasil Lelang KUTACANE (Waspada): Setelah menunggu selama beberapa bulan lamanya, CV. Eka Jaya selaku kontraktor pemenang lelang kayu hasil temuan, akhirnya bisa bernafas lega menyusul terbitnya Surat Angkutan Lelang (SAL) dari Dinas Kehutanan dan Perkebunan (Dishutbun) Aceh. Kadis Kehutanan dan Perkebunan Agara Ir. Muhammad Sragafa MPd melalui Kasi Kehutanan Ir. Ramli Desky kepada Waspada di ruang kerjanya, Rabu (14/4) membenarkan, telah terbitnya surat angkutan lelang (SAL) dari Dinas Kehutanan dan Perkebunan Aceh tersebut. Surat Angkutan Lelang pertama kepada CV. Eka Jaya untuk mengangkut kayu hasil lelang dari lokasi kayu temuan itu, diberikan sejak bulan maret lalu, karena itu itu phak kontraktor sudah diperbolehkan mengolah kayu temuan tersebut. Untuk tahap pertama, kata Ramli Desky, kayu hasil lelang yang telah dibawa ke kilang pengolahan di kawasan Desa Pante Raja Biakmuli itu, berasal dari kawasan Pegunungan Lembah Alas Kecamatan Deleng Pokisen, sedangkan jumlahnya diperkirakan 5 M3. Sedangkan tahap kedua, pihak Dishutbun Agara kembali memberikan SAL kepada Kontraktor untuk mengangku 5 M3 lagi kayu olahan dari lokasi pegunungan lembah Alas Kecamatan yang sama. Jauhnya rentang waktu pemberian SAL pertama dengan kedua kepada kontraktor karena belum normalnya mesin pengolah kayu milik rekanan, namun setelah diperbaiki, mesin pengolah itu kembali stabil dan SAL pun akhirnya diterbitkan lagi. Berdasarkan hasil lelang tahun 2009 lalu, kayu temuan yang dilelangkan sebanyak 576

batang atau 445,16 M3, kayu itu berasal dari empat lokasi, diantaranya dari pegunungan Lawe Sembekan Desa Lawe Gerger, pegunungan lembah Alas Kecamatan Deleng Pokisen, pegunungan Jambur Damar Kecamatan Babil Rahmah dan kawasan pegunungan Desa Mutiara Damai Kecamatan Babul Rahmah. Untuk menghindari satu Surat Angkutan Lelang (SAL) digunakan lebih dari dua kali, papar Ramli, selain menempatkan petugas di lokasi pengangkutan kayu temuan, pihak Dishutbun juga menempatkan petugas di kilang pengolahan kayu. ”Begitu kayu sampai, SAL yang dimiliki kontraktor langsung kita matikan, tujuannya agar satu SAL digunakan untuk satu kali saja,” ujar Kasi Kehutanan tersebut. Disinggung soal kekhawatiran berbagai pihak, jika kayu yang diangkut dan tanpa SAL akan marak terjadi, Ramli berdalih, sejak awal pihaknya sudah melakukan antisipasi. ”Kami sudah sampaikan pada pihak kepolisian kalau ada kayu gelondongan lewat, silahkan periksa SAL, jika tidak ada berarti kayu itu bukan hasil lelang melainkan kayu illegal,” kata Ramli. Selain jumlah kubikasi kayu, pada SAL rekanan pemanang tender, juga dijelaskan lokasi pengambilan kayu yang diangkut, jadi tidak boleh SAL disebutkan dari Deleng Pokisen, tetapi kayunya diangkut dari kecamatan lain, apalagi bila diangkut dari lokasi yang tidak termasuk lokasi kayu temuan yang telah dilelangkan, pungkas Ramli sembari mengaku belum bisa menunjukkan SAL yang telah dimatikan, karena belum menerima laporan dari bawahannya.(b27)

Waspada/Agusni AH

Sekdakab Aceh Timur, Syaifannur, SH, MM (paling kiri) saat pembukaan Bimtek Perpustakaan Masjid di Aula SMK 3 Langsa, Rabu (14/4).

Diiming-Imingi Jadi PNS Uang Puluhan Juta Raib BLANGKEJEREN (Waspada): Diiming-imingi bakal diangkat jadi Pegawai Negeri Sipil (PNS) senilai Rp20 juta uang sembilan anggota THL-TB Penyuluhan Pertanian Gayo Lues, raib dibawa orang yang mengaku sebagai kepala Badan Sumber Daya Manusia (SDM) Pusat, Dr. Ato Suprapto. Kamarudin, ketua Koordinator THL-TB yang ditemui Waspada di kediamannya menjelaskan, raibnya uang mereka bermula dari telefon yang dilakukan Dr. Ato Suprapto yang memakai nomor handphone Handoko, pegawai badan SDM Pusat kepada Gaga Saputra, Kakan Penyuluhan Gayo Lues, Desember tahun lalu. Dari hasil percakapan itu, Dr. Ato Suprapto mengatakan kepada Gaga, ke sembilan anggota THL-TB angkatan I akan diangkat jadi PNS dalam waktu dekat. Namun untuk melanggengkan kelulusan itu diperlukan sejumlah dana kepengurusan. Pertama Rp1,5 juta/orang untuk

BKNdansenilaiRp750ribu/orang untuk Depmenpan. Lantas Gaga Saputra datang menemui Kamarudin dan menceritakan perihal itu. Karena yakin, kesembilan anggota THLTB itupun mengumpulkan sejumlah uang guna biaya kepengurusan seperti yang dikatakan Dr. Ato Suprapto tersebut. “Anehnya, satu bulan usai peristiwa itu muncul surat edaran dari Departemen Pertanian (Deptan) dengan No.111/TU. 210/A2/II/2010, di internet yang mengatakan agar masyarakat jangan percaya isu soal bakal pengangkatan itu. Karena Deptan sama sekali tidak berencana akan melakukan pengangkatan THL-TB jadi PNS,” ungkap Kamarudin, didampingi rekannya Kayani, Rabu (14/4). Dijelaskannya, pengiriman uang dikirim lewat bank BRI cabang Daan Mogot, atas nama Agung Suhardi. Sedangkan nama dalam pengiriman itu atas nama GagaSaputra(KakanPenyuluhan PertanianGayoLues-red).Mereka (anggota THL-TB-red) berharap uang mereka kembali. Karena sebahagian uang itu bersumber dari hasil uang pinjaman. Kendati Gaga Saputra telah melaporkan penipuan itu bulan

lalu kepada Mapolres Gayo Lues, beberapa kalangan menilai, tindakan yang dilakukan Gaga Saputra itu ceroboh. Karena selaku pimpinan, hendaknya Gaga Saputra terlebih dahulu menelusuri kebenaran informasi itu ke Deptan Pusat. “Kita sangat menyayangkan kejadian ini dan kecerobohan Gaga Saputra. Seharusnya setiap orang yang meminta sejumlah uang dengan imingiming bisa meloloskan seorang jadi PNS perlu dipertanyakan. Soalnya, jika hal itu kita lakukan sama halnya kita dengan makelar kelulusan CPNS,” kata Ibrahim alias Panji, ketua Komisi Peralihan Aceh (KPA) Gayo Lues di Mapolres setempat. Sementara Kapolres Gayo Lues,AKBP.Armia Fahmi, melalui Kanit Tipikor,Aipda Jhon Beruh mengatakan, pihaknya akan menelusuri Dr. Ato Suprapto dan Handoko tersebut. Informasi yang dihimpun Waspada dari Selamat, anggota Badan Penyuluh Pertanian (BPP) setempat mengatakan, Handoko tercatat sebagai pegawai Deptan pusat, sedangkan Dr. Ato Suprapto, dia mengaku tidak diketahui bekerja di instansi mana.(cb01)

Dua Bulan Mangkir, Seorang Anggota Dewan Tetap Terima Gaji KUALASIMPANG (Waspada): Salah satu anggota DPRK Aceh Tamiang berinisial S sudah dua bulan mangkir tak masuk kantor. Anehnya, S tetap menerima gaji setiap bulannya. Buntutnya, lembaga wakil rakyat daerah itu diduga jadi backing wakil rakyat tersebut. Dugaan itu bukan tak beralasan. Anggota Dewan dari Fraksi Muda Sedia di Komisi A ini orang nomor dua di Badan Kehormatan Dewan (BKD) setempat. Tapi apa lacur, kepercayaan itu disalahgunakan. Malah gajinya sudah dijadikan jaminan salah satu bank selama 4 tahun. Lagi-lagi, proses ini mendapat rekom dari dewan setempat, sehingga bank mencairkan kredit kepada S. Soal rekom ini dibantah Slamet, bagian keuangan Sekretariat DPRK Aceh Tamiang. Kepada Waspada, Selasa (13/4) Slamet membenarkan gaji S dipotong pihak bank karena ada pinjaman, namun bukan karena ada surat rekomendasi dari DPRK Aceh Tamiang, tetapi mungkin ada agunannya. ”Masih ada juga sisa gajinya setelah potong kredit bank,” kata Slamet yang menolak menyebutkan angka sisa gaji oknum anggota dewan yang mangkir itu. Menurut Slamet, nomor handphone S juga sudah tidak bisa dihubungi lagi dan hingga

kini tidak diketahui keberadaannya. Sementara anggota BKD DPRK setempat, H. Saiful Sofyan ketika ditanya seputar kasus itu mengatakan, pihaknya sudah menyurati pimpinan kolektif DPRK Aceh Tamiang agar menyikapi persoalan tersebut. Harapannya, pimpinan kolektif dewan agar menyampaikan persoalan itu kepada Fraksi Muda Sedia untuk mempertimbangkan keberadaan S sebagai wakil ketua BKD. Ketua DPRK Aceh Tamiang, Ir Rusman membantah tudingan DPRK Aceh Tamiang telah ‘membacking’ S. “Malahan saya sebagai ketua DPRK Aceh Tamiang sudah menerbitkan surat yang ditujukan kepada Fraksi Muda Sedia untuk menyikapi kasus ini dan diproses sesuai mekanisme peraturan yang berlaku,” tegas Rusman. Rusman juga mengakui oknum S sudah lama tidak masuk kerja menjalankan tugasnya sebagai anggota DPRK Aceh Tamiang. Ketua Fraksi Muda Sedia, Hermanto didampingi Sekretaris Fraksi Muda Sedia, Mustafa MY pada hari yang sama mengakui persoalan S yang sudah dua bulan mangkir tersebut. Menurut keduanya, pimpinan kolektif dewan sudah menerbitkan surat yang ditujukan kepada

Fraksi Muda Sedia untuk menindaklanjuti kasus tersebut. “Nanti kami akan kirim surat kepada partainya agar S segera masuk kerja,” kata Mustafa. Hermanto mengatakan, S sudah lama absen karena banyak masalah, tetapi bukan dengan DPRK Aceh Tamiang, melainkan masalah di luar. “Saya dengar informasi dia itu banyak kali kasusnya, tetapi itu persoalan pribadi, bukan dengan DPRK Aceh Tamiang. Namun yang jelas apapun alasannya sebagai anggota dewan harus menjalankan kewajibannya,” tegas Hermanto. Soal S banyak masalah ini diperkuat Kapolres Aceh Tamiang. “Kami juga sudah pernah memanggil anggota DPRK Aceh Tamiang berinisial S itu untuk dimintai keterangannya sebagai saksi dalam kasus proyek drainase di Kecamatan Bendahara yang dikerjakan asal jadi. Tetapi kapasitasnya baru sebagai saksi dan uang proyek Rp280 juta sudah kami amankan. Kami juga sudah menurunkan tim teknis ke lokasi proyek tersebut. Sampai saat ini kasus proyek ini masih diproses Polres Aceh Tamiang,” ungkap Kapolres Aceh Tamiang, AKBP Drs Hariyanta ketika dikonfirmasi Waspada di ruang kerjanya, Selasa (13/4).(b24)

LANGSA (Waspada): Pemerintah Kabupaten aceh Timur menggelar Bimbingan Teknik (Bimtek) pengelolaan Perpustakaan Masjid. Kegiatan ini sebagai upaya membangun kemasjidan tepat guna, sehingga pihak pelaksana rumah ibadah memiliki pemahaman dan pendidikan serta ilmu pengetahuan. “Kegiatan ini juga bertujuan untuk memberikan pemahaman dan pengetahuan tentang tata cara pengelolaan perpustakaan masjid yang baik dan sesuai dengan ketentuan yang ada,” tegas Sekretaris Daerah Kabupaten Aceh Timur, Syaifannur, SH, MM. Dalam kesempatan membuka kegiatan dimaksud, Rabu (14/ 4), Syaifannur mengatakan, Pembinaan Pengelola Perpustakaan Masjid merupakan bentuk tanggung jawab Pemerintah Daerah guna mencerdaskan kehidupan bangsa sebagaimana tertuang dalam Undang–undang Dasar Negara Republik Indonesia tahun 1945. Karenanya Pemkab Aceh Timur melakukan Bimtek Pengelolaan Perpustakaan Masjid ini sedianya memberikan dampak positif bagi perkembangan kemasjidan di daerah ini. Kegiatan yang dipusatkan di Aula SMK 3 Langsa dan berlangsung selama tiga hari, ini turut dihadiri sedikitnya 150 peserta yang terdiri atas pengurus masjid, Pengelolaan Perpustakaan Masjid, Remaja Masjid yang mana mereka telah memiliki Badan Kemakmuran Masjid. Para pengajar didatangkan dari pustakawan berpengalaman dari Badan Arsip dan Perpustakaan Aceh, dan Dinas Syariat Aceh Timur. (b23)

12 Qariah Langsa Ikuti TC Di Banda Aceh LANGSA (Waspada): Sedikitnya 12 qari dan qariah asal Kota Langsa menjalani seleksi berupa Training Centre (TC) Musabaqah Tilawatil Quran (MTQ) di Banda Aceh. Seleksi akan dimulai 1622 April mendatang di Hotel Landing Banda Aceh. Rencananya kegiatan itu akan dibuka langsung oleh Gubernur Provinsi Aceh Drh. Irwandi Jusuf. Kasubbag Agama dan Peran Ulama bagian Keistimewaan Aceh Sekretariat Kota Langsa Basri S.Ag kepada wartawan, Rabu (14/ 4) mengatakan, tujuan diselenggarakannya Tranning Center (TC) itu adalah untuk menjaring qari dan qariah yang akan menjadi duta Provinsi Aceh pada ajang MTQ Nasional ke XXIII tahun 2010 yang rencananya akan berlangsung di Provinsi Bengkulu. Dikatakan Basri, pengiriman nama qari dan qariah asal Kota Langsa ke ajang seleksi itu sesuai surat Gubernur Aceh nomor 451.15/13239 tanggal 07 April 2010 perihal undangan seleksi peserta TC MTQ XXIII. Sementara para qari dan qariah yang diikutkan pada TD itu antara lain Syahida dari cabang atau golongan Tilawa’a Remaja, Nur Raihani Hafizh golongan 10 juz, Nurul Husna Hafizh 20 juz, Rohaya Syahkubat Qira’ah Sab’ah, Yenni Ratna Tafsir Bahasa Arab, Nur Suraiya Tafsir bahasa Inggris, Mahfud Fahmil Qur’an, Wali Ramdhani Fahmil Qur’an, TuankuMuhammad Fahmil Qur’an. Sementara itu Desi Ratna Sari, Raudhatul Jannah, Nurul Huda masing-masing mengikuti perlombaan golongan Syarhil Qur’an.“Qari dan qariah kita ini rencananya akan berangkat dan dilepaskan kepergian mereka oleh Pemerintah Kota Kota Langsa,” demikian kata Basri.(ts)

Petani Abdya Siap Kembangkan Tanaman Melon BLANGPIDIE (Waspada): Melon (Cucumis Melo L) yang saat ini masih dianggap jenis tanaman yang asing di Kabupaten Aceh Barat Daya (Abdya) kini mulai dilirik sejumlah petani di daerah tersebut. Alasannya, selain memiliki prospek cerah dan nilai jual yang ekonomis, jenis tanaman buah ini juga diperkirakan bakal bisa berkembang dengan baik untuk daerah Abdya yang dianggap memiliki iklim yang cocok untuk jenis tanaman yang memiliki rasa manis tersebut. “Kami sudah pernah mencoba mengembangkan tanaman ini (Melon) di beberapa lokasi seperti daerah Kec. Lembah Sabil dan Manggeng, ternyata hasilnya lumayan, bahkan per tiang tanaman bisa menghasilkan 5 hingga 7 buah dengan berat 4 hingga 5 kilogram,” ujar Said Ridha, 39, petani Lembah Sabil kepada Waspada, Rabu (14/4). Begitupun menurut Said, kendala pengembangan buah ini selain modal juga bibit yang sulit diperoleh di pasaran. Terkait hal itu, Kepala Dinas Pertanian dan Peternakan Abdya, H. Zainuddin, SP menyatakan dukungannya terhadap potensi pengembangan tanaman buah Melon yang kini mulai dilirik petani di sana. Namun pihaknya belum memiliki persiapan yang khusus seperti penyediaan bibit dan dukungan teknis lainnya. (sdp)

Usman Majid Imum Mukim Seuneubok Antara LANGSA (Waspada): Tgk. Usman Majid, SE akhirnya terpilih secara sebagai ketua Imum Mukim Seuneubok Antara Kecamatan Langsa Timur setelah menyisihkan dua saingannya, masing-masing Tgk. Ilyas Arby dan Tgk.Syafruddin pada pemilihan Ketua Imum Mukim Seuneubok Antara yang berlangsung, Senin (12/4) di Aula Kantor Camat Langsa Timur. Tgk. Usman Majid, SE terpilih sebagai Imum Mukim setelah berhasil meraih dukungan suara sejumlah 46 suara, sementara dua saingannya terpaksa mundur setelah dukungan yang didapatkan tidak mampu mengalahkan Usman Majid. Di mana hasil penghitungan, Tgk. Ilyas Arby hanya memperoleh delapan (8) suara dukungan dan Tgk. Syafruddin yang merupakan mantan Ketua Imum Mukim hanya memperoleh 27 suara dukungan. Ketua Panitia Pelaksana Pemilihan Ketua Imum Mukim Seuneubok Antara, Tgk.Usman Ali kepada wartawan menerangkan, pemilihan ketua imum mukim itu berlangsung selama satu hari penuh. Dalam pelaksanaannya hanya ada tiga calon imum mukim yang mendaftarkan diri pada panitia. “Pendaftaran calon imum mukim sudah dilakukan sejak Maret lalu, dimana hingga batas akhir pendaftaran hanya tiga calon yang mendaftar. Dan setelah kita lakukan pemilihan oleh 81 pemilih yang ikut dari 83 yang terdaftar ternyata Tgk.Usman Majid meraih suara dukungan tertinggi dan dialah sebagai ketua Imum Mukim Seuneubok Antara periode 2010-2015,” ungkap Usman.(ts)

Tanggul Penahan Tebing Puskiyai Runtuh BLANGPIDIE (Waspada): Hujan deras yang mengguyur Kabupaten Aceh Barat Daya (Abdya) dari Selasa sore (13/4) kemarin, mengakibatkan sepanjang lebih kurang 35 meter tanggul penahan tebing gunung di Kompleks Pusat Komuniti Islam Yayasan Al-Insaniyah (Puskiyai) runtuh dan menutupi badan jalan, Rabu (14/4). Selain itu, tiang listrik di komplek Puskiyai yang terletak di Krueng Baru Desa Meunasah Sukon Kecamatan Lembah Sabil itu tumbang dan listrik di komplek yang luasnya diperkirakan tidak kurang dari 5 hektar tersebut padam total. Pimpinan Puskiyai Aceh Tgk. Farmadi ZA, M.Sc kepada Waspada Rabu (14/4) menjelaskan, kejadian naas itu terjadi sekira pukul 21.11 WIB Selasa (13/ 4) malam, di saat para santri sedang melaksanakan kegiatan rutin mereka, yakni pengajian

malam di dayah dan kabilahkabilah (tempat pengajian) yang tersedia di kompleks Puskiyai Aceh. “Kami semua kaget karena bunyi yang ditimbulkan saat tanggul itu runtuh sangat kuat,” jelasnya seraya mengatakan, tidak ada korban jiwa dalam kejadian itu karena para ratusan santri Puskiyai Aceh sedang belajar di kabilah masing-masing yang diasuh oleh dewan guru dari berbagai daerah. “Tidak ada korban jiwa, hanya saja kita menderita kerugian bangunan yang tidak sedikit,” sebutnya. Pasca runtuhnya tebing itu, jalan umum menuju ke Komplek Puskiyai Aceh tertimbun tanah sehingga tidak bisa dilalui, demikian juga arus listrik ke kompleks itu terputus dan sangat mengganggu aktifitas belajar mengajar para santri yang kebanyakan dilaksanakan pada

malam hari, kerugian material dari kejadian tersebut diperkirakan senilai Rp90 juta. “Kita minta perhatian dari Pemerintah Daerah untuk menanggulangi masalah ini,” harap Tgk Farmadi ZA. Camat Lembah Sabil, Drs. T. Miswar Ali yang dihubungi Waspada terpisah mengaku sudah mengecek ke lokasi kejadian dan pihaknya juga sudah melaporkan kejadian naas itu ke kabupaten melalui Asisten1 Setdakab Abdya. Menurutnya, pihak terkait akan segera menanggulangi masalah tersebut. Untuk sementara, kata camat, Muspika Lembah Sabil akan mengadakan gotong royong memindahkan reruntuhan tanah dan tanggul yang menutupi badan jalan sehingga jalan kembali bisa dilewati. “Kita akan adakan gotong royong sebagai langkah awal menanggulangi bencana ini,” ujarnya.(sdp)


0651-22385 0645-42109



WASPADA Kamis 15 April 2010

Provinsi Sumut Dilahirkan Di Siantar Oleh Muhammad TWH Rencananya kedudukan Gubernur Sumatera Utara di Medan, tetapi karena dikuasai Belanda maka dipindahkan ke Siantar


Menyelamatkan Lingkungan, Itu Yang Paling Penting


uhu panas di Kota Medan dan sekitarnya memperlihatkan tandatanda kenaikan dalam beberapa hari terakhir. Dampaknya, kasus Infeksi Saluran Pernafasan Akut (ISPA) mengalami peningkatan. Seperti yang terjadi pada Selasa (13/4), teriknya sinar matahari telah menaikkan temperatur udara pada angka 36 derajat Celcius. Selain memicu terjadinya ISPA, suhu panas juga berpotensi menimbulkan cuaca ekstrem berupa angin kencang dan petir. Tentu saja panasnya udara di daerah ini mengganggu bahkan memicu datangnya gangguan ISPA (Infeksi Saluran Pernapasan Akut). Panasnya suhu tentu juga dipicu kerusakan lingkungan yang sudah sedemikian parah. Belum lagi pembangunan dan pertumbuhan membutuhkan energi sebagai penggeraknya. Dunia yang datar tentu lebih banyak membutuhkan energi. Kita tidak dapat melakukan aktivitas dalam dunia yang seperti ini tanpa sokongan energi. Meski hukum kekekalan energi mengatakan, energi terbatas, namun pada kenyataannya energi yang dapat dikonsumsi oleh manusia secara efektif dan efisien adalah terbatas. Dengan murahnya harga bahan bakar fosil, maka tidak ada insentif dan kreatifitas untuk menciptakan alternatif energi baru bagi peradaban manusia. Akhirnya, pada titik tertentu dunia mengalami apa yang disebut dengan istilah energy poverty yang gejalanya sudah dirasakan saat ini. Pertemuan antara crowded dan flat pun ternyata menjadi bencana bagi makhluk-makhluk lain yang hidup di bumi selain manusia. Tidak usah jauh-jauh, Indonesia yang menjadi rumah bagi keanekaragaman hayati (biodiversity) lambat-laun menjadi tergadaikan oleh kepentingan ekoIntisari nomi. Di wilayah kita ratusan ribu hektare hutan dikonversi menjadi perkePenyelamatan ling- bunan kelapa sawit yang menciptakan dalam lingkungan. kungan tentunya akan ketidakseimbangan Alhasil, ratusan spesies kehilangan mengurangi pemanasan habitat alaminya. Semakin padatnya populasi bumi, yang lebih kuat. semakin menciutnya dunia, dan semakin panasnya planet yang kita diami ini merupakan sebuah perubahan besar yang tidak pernah dirasakan oleh para generasi yang telah lalu. Pertanyaannya adalah apakah tatkala dunia berubah kita akan membangun benteng yang mencegah kita dari hembusan angin yang bertiup dan kita dapat menjalankan kehidupan seperti tidak ada yang pernah berubah (bussines as usual); atau kita termasuk orang yang membangun kincir angin untuk memanfatkan segi positif dari angin. Apakah dunia yang semakin memanas dan manusia yang semakin sesak tidak menyadarkan kita bahwa kita harus mengubah gaya hidup kita juga. Rakyat di wilayah ini sudah saatnya memiliki kekuatan kolektif dalam upaya penyelamatan kehidupan di masa datang. Tidak lagi tergantung pada sebuah kelompok kepentingan yang hanya akan datang sesaat. Pembentukan sebuah kelembagaan di tingkat lokal, harus dilakukan berdasarkan sebuah analisis yang kuat atas kebutuhan kolektif rakyat. Tentunya di sini dibutuhkan pemerintahan daerah merupakan pengelola kewilayahan yang menerima mandat dari rakyat untuk memampukan rakyat dalam pengelolaan dan keamanan sumbersumber kehidupannya. Eksternalitas menjadi sebuah hal yang dapat menjadi tambahan, bilamana memang diperlukan. Sistem pengelolaan lingkungan hidup daerah harus menjadi bangunan yang kuat, yang dibangun berbasiskan kondisi kelokalan dengan membaca gerakan lingkungan skala global. Paling tidak bagi kita di Sumatera Utara perlu adanya penyelamatan lingkungan yang lebih komprehensif. Tentunya banyak wilayah yang sudah rusak khususnya wilayah-wilayah yang kemudian dijadikan lahan sawit dan kemudian ditinggalkan. Perlunya juga sebuah aturan yang lebih jelas dalam menyelamatkan tata lingkungan wilayah tangkapan air seperti di kawasan Medan Johor. Oleh karena itu selamatkanlah lingkungan demi masa depan anak cucu. Diperlukan sebuah keberanian dan ketegasan yang nyata bukan sekedar slogan saat kampanye semata.****

Hubungi kami KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN � Bumi Warta Jaya Jalan Kebon Sirih Timur Dalam No. 3 Jakarta 10340 Tel: (021) 31922216, Faks: (021) 3140817. � Jalan Ratu Syafiatuddin No. 21 C Banda Aceh 23122 Tel & Faks: (0651) 22385 � Jalan Iskandar Muda No. 65 Lhokseumawe Tel: (0645) 42109 � Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412

Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 Percetakan: PT Prakarsa Abadi Press Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 6612681 Isi di luar tanggung jawab percetakan Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan hitam-putih Rp. 33.000,Halaman depan berwarna Rp. 90.000,Ukuran kolom: 40,5 mm E-mail Iklan:


ungkin di antara kita tidak percaya kalau kami katakan bahwa Provinsi SumeteraUtara dilahirkan di P.Siantar. Apalagi pada Saat itu sedang berkecamuk perang kemerdekaan. Pertanyaan lain tentu akan timbul apa dasar hukum dan apa buktinya kalau Sumut dilahirkan di P. Siantar. Paling-paling masyarakat hanya tahu Sumut yang tadinya ibu kotanya di Medan kemudian diungsikan ke P.Siantar (1946—1947). Untuk memberi jawaban terhadap ketidakpercayaanrasanyaperlukitatelusuri peristiwa-peristiwa penting di hari-hari pertama di awal kemerdekaan. Seperti diketahui Mr. Teuku Mohd. Hasan salah seorang wakil Sumatera yang menghadiri sidang Panitia Persiapan Kemerdekaan di Jakarta. Beliau sebagai salah seorang ahli hukum merupakan tokoh yang merumuskan“Pembukaan Undang-Undang Dasar 1945. Pada tanggal 22 Agustus 1945 Ir. Soekarno selaku Pemimpin Besar Bangsa Indonesia mengeluarkan Keputusan kepada tokoh-tokoh daerah sebagai wakilnya di seluruh daerah ; Yaitu untuk SumateraMr.TeukuMoehdHasan,Borneo (Kalimantan) Ir. Pangeran Mohd Nur. Celebes (Sulawesi) Dr. GSSJ Ratulangi. SundaKecilMr.J.GustiKetutPudja.Maluku, Mr. J.Latuharhani. Kepada tokoh-tokoh ini Ir. Sukarno memberi kuasa untuk melaksanakan keputusan yang diambil dalam sidang Panitia Persiapan Kemerdekaan dan untuk mewujudkan cita-cita yang lain yang telah dilahirkan dalam sidang tersebut. Mr.TeukuMoehd.Hasanbersamadua orang anggota Panitia Persiapan Kemerdekaan Indonesia lainnya Dr. Mohd Amir dan Mr. Abbas Manoppo (ayahanda Dimardi Abbas) kembali ke Sumatera melalui jalan darat. Mr. Abbas Manoppo yang berdomisili di Lampung, tinggal di Lampung sedangkan Mr.Teuku M. Hasan dan Dr. M.Amir meneruskan perjalanan Sumatera Tengah kemudian baru ke Me-

dan setelah bertemu dengan Adinegoro di Bukit Tinggi. Adinegoro yang memberitahukan kemerdekaan Indonesia telah diproklamirkankeberbagaidaerahdengan menggunakan telegram. Praktis seluruh Sumatera menyambut gegap gempita kemerdekaanIndonesia telah diproklamirkan. Masing-masing daerah mempersiapkan diri seperti membentuk KomiteNasional daerah dan sebagainya. Kecuali Sumatera Timur yang sedikit terkendala yang menyebabkanproklamasi kemerdekaan di daerah ini baru diumumkan secara resmi oleh Mr. Teuku Mohd Hasan tanggal 6 Oktober 1945, baik sebagai Gubernur Sumatera maupun sebagai Wakil Pemerintah Pusat untuk Sumatera. Perlawanan terhadap Inggris 9 Oktober 1945 pasukan Inggris yang diwakili Sekutu telah menduduki kota Medan. Berbagai insiden terjadi di Medan karena diketahui Inggris membantu Belanda untuk mengembalikan penjajahannyadiSumateraTimur.Insidenterjadi siang maupun malam, menyebabkan banyak penduduk Medan mengungsi keluar kota. Pemerintahan Provinsi Sumatera harus mengungsi ke P. Siantar. Mr. Teuku Mohd. Hasan sejak zaman Belanda(1938)menjadiwargakotaMedan. Sebagai ahli HukumTata Negara Mr.Teuku HasanbekerjadiKantorGubernurBelanda Jalan Sukamulia Medan (sekarang jalan Palang Merah) Mr.Teuku Hasan mulanya tinggaldiJalanMultatuli,kemudianpindah ke Jalan Sei Kerah. Di masa kemerdekaan

beliau tinggal di Jalan Bulan No. 15 Medan dari jalan ini beliau bersama keluarga dan perangkat pemerintahan Provinsi Sumatera mengungsi ke P. Siantar. Karena kondisi Medan tidak mengizinkan lagi. Pemerintahan Sumatera pindah ke P. Siantar 13 Maret 1946. Mr.Teuku Moehd Hasan sebagai wakil Pemerintah pusat di Sumatera berhak mengambil semua tindakan atas nama pemerintahPusat.Beliaumenetapkanperaturan yang seharusnya dikeluarkan oleh Pemerintah pusat. Tidak kurang dari 16 peraturan di antaranya peraturan melaksanakan Pemerintahan untuk Gubernur-gubernurMuda di Provinsi Sumatera. Ketetapan itu bertanggal 17 Desember 1947. Sesuai ketetapan peraturan yang telah dikeluarkan, maka ProvinsiSumatera “dimekarkan” menjadi tiga provinsi, yaitu SumateraSelatan,Sumatera TengahdanSumateraUtara. Setelah terbentuk daerah Administrasi Pemerintah Sumatera Utara yang menjadi pertanyaan siapakah yang akan diangkat menjadi Gubernur Muda Sumatera Utara. Gubernur Keliling Mr. Harmani mengusulkan T.T. Hanafiah. Tetapi Mr. Teuku Moehd. Hasan menjatuhkan pilihannya kepada Mr. S.M. Amin yang memenuhi persyaratan psikologis. Lahir di Aceh, dibesarkan di Aceh kawin dengan puteri Aceh, ayahnya Batak ibunya Melayu. Gubernur Muda Sumatera Utara 14 April 1947 Mr. S.M. Amin yang tadinyaKepalaJabatanKehakimanDaerah Aceh merangkap Wakil Ketua Dewan Perwakilan Kepresidenan Aceh dilantik menjadi Gubernur Muda Sumatera Utara, membawahi Keresidenan Tapanuli, Sumatera Timur dan Keresidenan Aceh. Pelantikan di Gedung Divisi Gajah II Pematang Siantar yang waktu itu telah menjadi ibukota Provinsi Sumatera. Adapun yang menghadiri upacara pelantikan itu adalah : Residenan Aceh Teuku Daudsyah, ResidenanTapanuli Dr.

F.L. Tobing, Residen Sumatera Timur Mr. Abubakar Djaar,Walikota P. Siantar/Bupati Simalungun Madja Purba. KomandanTRI Komandemen Sumatera Letjen Suhardjo Hardjowardoyo, Kepala Staf TRI Komandemen Sumatera Kolonel Achmad Tahir. Semula direncakan kedudukan Gubernur Sumatera Utara di Medan, tetapi karenaMedantelahdikuasaiBelandamaka dipindahkan ke P.Siantar. Karena P. Siantar juga direbut Belanda dalam Agresi ke II, tanggal 29 Juli 1947 maka roda pemerintahan pindah ke Kutaraja (Banda Aceh). Dengan dilantiknya Mr. S.M. Amin sebagai Gubernur oleh wakil Pemerintah Pusat Mr.Teuku Mohd. Hasan maka dapat dikatakan Provinsi Sumatera Utara lahir di P.Siantar. Acara pelantikan ini disaksikan tidak kurang dari 30 orang pejabat teras sipil dan militer yang ada di provinsi Sumatera dan ratusan masyarakat serta para undangan. Dilantik Presiden Dalam situasi genting, 15 Juni 1948 Presiden Soekarno bersama rombongan berkunjung ke Keresidenan Aceh provinsi Sumatera Utara. Presiden terbang dari Jogyakarta dengan pesawat Dakota RI 002 yang kemudian oleh pilot Robert Earl Freeberg berkebangsaan Amerika. Rakyat menyambut Presiden di Lapangan Terbang Lhok Nga dengan gegap gempita. Selain bertemu rakyat Aceh Presiden juga berkunjungkeMarkasDivisiXdiBireuen,yang paling banyak mengalirkan pasukan ke Medan Area di perang kemerdekaan itu. Presiden Soekarno melantik Mr.S.M. Amin sebagai Gubernur Sumatera di Pendopo Keresidenan Aceh. Menteri dalam Negeri Sukiman Wirsanjoyo dalam kata pengantarnya ketika melantik Gubernur pertama Sumatera Utara mengatakan pelantikan tersebut sebagai realisasi UU No.10 tahun 1948. Kelahiran Provinsi Sumatera Utara sedikit unik karena lahir dibawahdesinganpelurupadasaatsedang me-muncaknya perang kemerdekaan. ProvinsiSUlahirdisebuahkotaKabupaten P. Siantar kemudian direbut oleh Belanda. Paling istimewanya lagi dan belum pernah terjadi,Gubernuryangjugadikenaldengan Krueng Raba Nasution dilantik oleh Presiden pertama RI. Penulis adalah Wartawan Senior Pemerhati Sejarah

Evaluasi Peran Perguruan Tinggi Oleh Jhon Tafbu Ritonga 15 April 2010 Provinsi Sumatera Utara genap 62 tahun (1948-2010). Provinsi ini tercatat sebagai daerah yang amat sadar pembangunan SDM berkualitas tinggi


esadaran membangun SDM itu ditunjukkan dengan kesungguhan mendirikan Universitas Sumatera Utara (USU) empat tahun provinsi ini berdiri (20 Agustus 1952). Ulang tahun ialah momentum bagi semuaelemenuntukmeningkatkanperan dalam pembangunan peradaban bangsa. Dalam rangka perayaan hari jadi Sumatera Utara tahun ini, sebagai agent of developmentdanagentofchangespadatempatnya Perguruan Tinggi mengevaluasi diri. Sejak didirikan hingga sekarang USU telah menjadi ikon Sumatera Utara karena perkembangannya yang pesat dan merupakan satu-satunya PT BHMN di luar Jawa dengan 14 fakultas dan pascasarjana. Mengasuh seratusan program diploma, S1, profesi, spesialis, S2, dan S3 serta beberapa lembaga. USU telah melahirkan tidak kurang dari 120.000 orang alumni yang tersebar di seluruh nusantara dan manca negara. Di samping itu, ada dua fakultas, yakni ekonomi dan kedokteran hewan menjadi bagian dari Unsyiah Aceh. Fakultas Keguruan dan Pendidikan menjadi IKIP Negeri Medan (Unimed) dan Politeknik menjadi Politeknik Negeri Medan. Sumatera Utara juga memiliki IAINSU dan 323 perguruan tinggi swasta. Dengan 326 perguruan tinggi negeri dan swasta yang ada, BPS Sumut mencatat jumlah dosen di Sumatera Utara tahun 2008 sebanyak 11.069 orang dan mahasiswa 1.752.641 orang atau 13,4 persen dari total penduduk Sumatera Utara. Angkaangka yang seyogianya membuat perguruan tinggi berperan besar dalam pembangunan dan kemajuan daerah Sumatera Utara. Dibanding dengan perguruan tinggi AmerikaSerikatdanEropa,PerguruanTinggi Indonesia memang“malu” melihat perannya dalam pembangunan peradaban dunia. Sungguhpun demikian dalam reformasi 1966 atau selama Orde Baru, perguruan tinggi telah mencatat peran yang nyata dalam perubahan dan pembangunan nasional. Setelah menurunkan Orde Lama, perguruan tinggi proaktif merancang dan mengisireformasi.SepertiUImenawarkan konseppembangunan“poleksosbud”yang mendasari Strategi Pembangunan Jangka

Panjang (PJP) 1969-1994. Selama PJP I perguruan tinggi lain, seperti IPB proaktif dalam pembangunan pertanian dan ITB dalam bidang teknologi. PerguruanTinggi di daerah juga memberi peran signifikan dalam PJP I, seperti USUdanUnsyiahmemainkanperanbesar melalui Badan Perencanaan PembangunanDaerah(Bappeda).Dalampembangunanbidangpendidikandankesehatan,USU dan IKIP Negeri Medan cukup dominan dalam menyediakan sumber daya manusia. Peran langsung dan tidak langsung itulah kemudian yang membuat hari ini bangsa Indonesia menikmati kehidupan yang lebih nyaman. Tapi, pasca reformasi 1998, peran perguruan tinggi dalam mempersiapkan dan mengisi reformasi sangat minim. PerguruanTinggi cenderung menjadi penonton. Reformasi menjadi pentas politik berkuasa dan kesempatan berkorupsi. Pada masa Orde Baru seseorang perlu waktu puluhan tahunmenjadimilyarder.Selamareformasi dalam dua tahun bisa menjadi milyarder, danbahkandalamlimatahunanbisamenjadi triliuner. Karenakesadaranatasperannyadalam pembangunan peradaban bangsa yang sangatminimitu,sejumlahperguruantinggi negeri sangat mendorong lahirnya Undang-undang No 9 tahun 2009 tentang Badan Hukum Pendidikan (UU BHP). Tapi sebelum UU BHP berjalan Mahkamah Konstitusi yang merupakan bagian reformasi telah membatalkannya atas tuntutan dari antara lain perguruan tinggi swasta. Sejarah peradaban manusia ditandai oleh invensi perguruan tinggi yang telah mengubah dunia. Dalam 47 daftar University Invention (1889-2000) yang direlis melalui internet, tak satu pun perguruan tinggi Indonesia. Oleh karena itu saya pinjam analisis Julian R. Betts dan Carolyn WB Lee (2005). Ada lima peran “drivers of regional” yang dapat disumbangkan perguruan tinggi. Pertama sebagai pelatih. Perguruan tinggi di Sumatera Utara sudah melahirkan ratusan ribu alumni. Sekarang jumlah mahasiswa tercatat 1,7 juta orang. Artinya peran sebagai pusat pendidikan tinggi sudah memuaskan. Keduasebagaiinovator.Secaranasional pun peran perguruan tinggi Indonesia

dalam pembangunan nasional masih minim. Survei LIPI menunjukkan, pada tahun 2007 dari 295 institusi pergu-ruan tinggi Indonesia hanya 40 paten yang sudah terkomerisialiasi. Saya belum mendengar ada paten perguruan tinggi Sumatera Utara yang sudah terkomersialisasi. Ketiga sebagai mitra lembaga pemerintah dan swasta. Untuk beberapa perguruan tinggi, seperti USU, Unimed dan IAINSU sudah berperan meskipun belum inovatif dan optimal. Namun kebanyakan perguruan tinggi belum punya kapasitas sebagai mitra. Sebagian malahan cenderung menempatkan diri tangan di bawah. Keempat sebagai magnit bagi orang berbakat. Dengan total mahasiswa 1,7 juta orang, perguruan tinggi di Sumatera Utara sudah bisa menegakkan kepala. Apalagi sudah ribuan mahasiswa di USU berasal dari luar Sumatera Utara dan bahkan ada ratusan orang berasal dari luar negeri. Kelima sebagai fasilitator. Dalam hal ini perguruan tinggi di Sumatera Utara belum banyak berperan. Syukur USU sudah bisa menjadi“best practice” dengan beberapakegiatan.Dalamduniaakademis, USUkerapkalimemfasilitasihadirnyanara sumber berskala nasional dan internasional bagi masyarakat dan pemerintah melaluiceramah,seminar,simposiumdan kegiatan ilmiah lainnya. Dengan kerja keras bertahun-tahun USU berhasil mengadakan 300 hektar kampus di Kwala Bekala, Pancur Batu, Deli Serdang. Kampus USU yang baru ini telah mendorong nilai tambah wilayah bagi kawasan itu. Apalagi di Kampus yang diresmikan oleh Gubsu Syamsul Arifin dan Rektor USU Chairuddin P. Lubis itu sudah dibangun Arboretum seluas 55 hektar. Di Sciences Park yang akan menjadi ikon baru Sumatera Utara itu kini terdapat 57 jenis tanaman dengan 6.500-an pohon.Tahun depan akan siap Rumah Sakit Pendidikan USU dengan mutu pelayanan internasional. Dengan lima indikator tadi peran perguruan tinggi dalam pembangunan Sumatera Utara dapat dikatakan sudah agaklumayanataunotbad.Perkembangan peran memang masih minim, lambat dan didominasi sedikit dari 326 perguruan tinggi yang ada.Tapi sebagian besar check list-nya sudah tersisi. Sayangnya check list indikator peran inovator belum ada yang bisa diketengahkan. Kurangnyaperantersebutmerupakan buah kebijakan negara dalam pembangunan sistem pendidikan nasional. Kesadaran perguruan tinggi memperbaiki keterlambatan perkembangan peran dimaksud telah mendorong sejumlah perguruantinggimendukunglahirnyaUU

BHP. Ironisnya, harapan melakukan akselerasi peran perguruan tinggi itu sudah sirna bersamaan dengan pembatalan UU BHP oleh Mahkamah Konsitusi. Sementara itu Pemerintah Provinsi Sumatera Utara yang berulang tahun ke62 telah terus mendorong perkembangan dan pertumbuhan perguruan tinggi di daerah ini. Dorongan makin besar sejak otonomi yang luas diberikan ke daerah dengan cara semakin banyak menyediakan anggaran dalam APBD. Akhir kalam, tanpa dan dengan anggaranyanglebihbesardaripemerintah, perguruan tinggi di Sumatera Utara selayaknya menyampaikan ucapan selamat ulang tahun dan berjanji pada diri sendiri akan lebih sungguh-sungguh meningkatkan peran dalam pembangunan daerah dan nasional. Penulis adalah Dekan Fakultas Ekonomi USU dan Regional Chief Economist Bank BNI 46

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Rahudman nyaman bersama masyarakat kecil - Masyarakat kecil tak banyak permintaan * Mafia perizinan di DS kian terkuak - Pingin tau awak pelakunya * Kota Medan terancam krisis air - Padahal kalau hujan banjir


D Wak


Dewan Redaksi: H. Prabudi Said, H. Teruna Jasa Said, H. Azwir Thahir, H. Sofyan Harahap, H. Akmal Ali Zaini, H. Muhammad Joni, Edward Thahir, M. Zeini Zen, Hendra DS. Redaktur Berita: H. Akmal Ali Zaini. Redaktur Kota: Edward Thahir. Redaktur Sumatera Utara: M. Zeini Zen. Redaktur Aceh: Rizaldi Anwar. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara & Features: Gito Agus Pramono. Plt. Redaktur Opini: Dedi Sahputra. Redaktur Ekonomi: Armin Rahmansyah Nasution. Redaktur Olahraga: Johnny Ramadhan Silalahi. Redaktur Minggu/Humas: Hendra DS, Redaktur Agama: H. Syarifuddin Elhayat. Asisten Redaktur: Rudi Faliskan (Berita) Zulkifli Harahap, Muhammad Thariq (Kota Medan), Feirizal Purba, H. Halim Hasan, Diurna Wantana (Sumatera Utara), T. Donny Paridi (Aceh), Armansyah Thahir (Aceh, Otomotif), Austin Antariksa (Olahraga, Kreasi), Syafriwani Harahap (Luar Negeri, Popular, Pariwisata), Hj. Hoyriah Siregar (Ekonomi), T. Junaidi (Hiburan), Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zein (Remaja), Anum Purba (Keluarga)), Hj. Ayu Kesumaningtyas (Kesehatan). Sekretaris Redaksi: Hj. Hartati Zein. Iklan: Hj. Hilda Mulina, Rumondang Siagian (Medan), Lulu (Jakarta). Pemasaran: H. Subagio PN (Medan), Zultamsir (Sumut), Aji Wahyudi (NAD). Wartawan Kota Medan (Umum): H. Erwan Effendi, Muhammad Thariq, Zulkifli Harahap, David Swayana, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Feirizal Purba, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, M. Ferdinan Sembiring, M. Edison Ginting, Surya Effendi, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Hasanul Hidayat, Aidi Yursal, Rustam Effendi. Wartawan Kota Medan (bidang khusus): H. Syahputra MS, Setia Budi Siregar, Austin Antariksa, Dedi Riono (Olahraga), Muhammad Faisal, Hang Tuah Jasa Said (Foto), Armansyah Thahir (Otomotif), Dedi Sahputra (Penugasan Khusus). Dedek Juliadi, Handaya Wirayuga, Hajrul Azhari, Syahrial Siregar, Khairil Umri (Koran Masuk Sekolah/KMS). Wartawan Jakarta: Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian W, Aji K. Wartawan Sumatera Utara: H. Riswan Rika, Nazelian Tanjung (Binjai), H.M. Husni Siregar, Hotma Darwis Pasaribu (Deli Serdang), Eddi Gultom (Serdang Bedagai), H. Ibnu Kasir, Abdul Hakim (Stabat), Chairil Rusli, Asri Rais (Pangkalan Brandan), Dickson Pelawi (Berastagi), Muhammad Idris, Abdul Khalik (Tebing Tinggi), Mulia Siregar, Edoard Sinaga (Pematang Siantar), Ali Bey, Hasuna Damanik, Balas Sirait (Simalungun), Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan (Batubara), H. Abu Bakar Nasution, Nurkarim Nehe, Bustami Chie Pit (Asahan), Rahmad Fansur Siregar (Tanjung Balai), Indra Muheri Simatupang (Aek Kanopan), H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan (Rantau Prapat), Hasanuddin (Kota Pinang) Edison Samosir (Pangururan), Jimmy Sitinjak (Balige), Natar Manalu (Sidikalang), Arlius Tumanggor (Pakpak Bharat)Parlindungan Hutasoit, Marolop Panggabean (Tarutung), Zulfan Nasution, Alam Satriwal Tanjung (Sibolga/Tapanuli Tengah), H. Syarifuddin Nasution, Mohot Lubis, Sukri Falah Harahap, Balyan Kadir Nasution (Padang Sidimpuan), Idaham Butarbutar (Gunung Tua), Iskandar Hasibuan, Munir Lubis (Panyabungan), Bothaniman Jaya Telaumbanua (Gunung Sitoli). Wartawan Aceh: H. Adnan NS, Aldin Nainggolan, Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid (Banda Aceh), Iskandarsyah (Aceh Besar), Bustami Saleh, M. Jakfar Ahmad, Jamali Sulaiman, Arafat Nur, M. Nasir Age, Fakhrurazi Araly, Zainal Abidin, Zainuddin Abdullah, Maimun (Lhokseumawe), Muhammad Hanafiah (Kuala Simpang), H. Syahrul Karim, H. Ibnu Sa’dan, Agusni AH, H. Samsuar (Langsa), Musyawir (Lhoksukon), Muhammad H. Ishak (Idi), HAR Djuli, Amiruddin (Bireuen), Bahtiar Gayo, Irwandi (Takengon), Muhammad Riza, H. Rusli Ismail (Sigli), T. Zakaria Al-Bahri (Sabang), Khairul Boang Manalu (Subulussalam), Zamzamy Surya (Tapak Tuan), Ali Amran, Mahadi Pinem (Kutacane), Bustanuddin , Wintoni (Blangkejeren), Khairul Akhyar, Irham Hakim (Bener Meriah), Tarmizi Ripan, Mansurdin (Singkil), Muhammad Rapyan (Sinabang).

� Semua wartawan Waspada dilengkapi dengan kartu pers. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �


WASPADA Kamis 15 April 2010

Melindungi The Whistleblower

Gempa-Gempa Sadar Tobat Di kala itu penduduk Indonesia berjumlah 90 Juta Jiwa, penduduk kota Medan baru 600 Ribu Jiwa. Anak-anak dimasa kini tentu tidak akan mengetahui tentang hal-hal yang seperti itu dan bertanya-tanya “Tahun berapa ya?” Atok katakan : “Itu di Tahun 60-an, sekarang Tahun 2010 berarti baru 50 Thn saja. Penduduk Indonesia meledak menjadi ± 300 Juta Jiwa, penduduk kota Medan ± 3 Juta Jiwa, dari faktor-faktor Tranmigrasi, Urbanisasi, di tambah dengan penduduk lokal”. Bandingkan berapa tahun sudah usia Bumi Nusantara, supaya jangan repot sampai dengan kita Memproklamirkan Kemerdekaan NKRI di Thn 1945 di kenang. 350 Thn di jajah Bangsa Belanda, 3 + Tahun di Jajah Bangsa Jepang. Ledakan penduduk yang sangat menyolok, bandingkan dengan Negara-negara lain di Dunia. Di masa itu boleh di katakan jarang terjadi gempa-gempa (Getaran Bumi) tidak seperti di masa kini, selalu. Kalau terjadi getaran-getaran dimasa itu hampir tidak ketahuan, ketahuannya terdengar Adzan di manamana. “Umpama seekor lembu di ketap nyamuk di tepis dengan ekornya.” Kata Mak yang meng-umpamakan derita Bumi seperti itu kepada anak-anak. Sekarang ini terjadinya goncangan bukan sebentar lagi, dua bentar, tiga bentar, hitungan sudah modern Slaka Richter metode orang Barat. Kita haqqul yakin kiamat-kiamat kecil yang telah terjadi, yang akan terjadi di muka Bumi di sebabkan oleh perangai manusia yang sudah lari dari jalur-jalur. Tidak salah bila di katakan “Dunia bergolak, manusia bertingkah. Manusia bergolak, dunia bertingkah.” Kiamat besar? Allah Swt menentukan, dunia tidak perlu lagi, Tamat, tunggu di sana akhirat. Kalau dikaji-kaji, benar jugakan di tahun 60-an itu belum terasa lama. Di masa itu masyarakat kita Indonesia masih kental dengan suasana Adatistiasat tradisi, masing-masing kaum mencerminkan budaya leluhur, salah satunya adalah menyadari diri dan tau malu. Sekarang ini hal-hal yang seperti itusudah calus (lepas) karena mengikuti gaya-gaya yang sekarang, modern dan modern. Faktor pertama kita membenci Bangsa penjajah adalah menjajah memperkosa hak azazi, selain dari pada itu adalah faktor-faktor akidah (Islam) sehingga terjadi perlawanan-perlawanan Dimana-mana. Perpaduan itulah Bangsa Imprialis, kita benci bangsa Imprialis. Sekarang ini sudah tidak ada lagi bangsa Imprialis (menduduki langsung) seperti di masa-masa yang lewat. Yang tinggal adalah Bangsa-bangsa lain di Dunia se Aqidah maupun lain Aqidah. Terbalik pula kita sudah bangga (merasa modern) bila sudah berkunjung ke Negara-negara yang berlainan Aqidah, apalagi kalau sudah dapat menjadi warga Negaranya, apa lagi kalau dapat menggaet warganya menjadi suami atau istri, yang sakitnya walau bagai mana dan status bagai mana. Tidaklah salah kita bersahabat, berkawan dengan siapa saja, bagai manapun Aqidahnya asal jangan terpengaruh dan mengikutinya, disisni, sisana, dimana saja. Kalau sudah begini, bukan alam yang bosan bersahabat dengan kita, tapi, Allah Swt, karena sudah berani mengkali-kalikan ketentuannya. Tobatlah.

Oleh Arfanda Siregar UU di AS bukan saja melindungi whistleblower tapi dia juga berhak atas 30% dari ganti rugi yang dijatuhkan oleh pengadilan untuk si pelaku


eniup peluit (whistleblower) bukan lagi profesi para wasit yang mengawal pertandingan olah raga agar fair,juga bukan senjata para polisi lalu lintas (polantas) yang sering menjadikan peluitnya sebagai senjata mempercepat detak jantung pengendara kendaraan bermotor . Peniup peluit sudah menjadi istilah baru di khazanah pemerintahan kita, dilekatkan kepada orang yang berani ”bernyanyi” membongkar tindak kecurangan seseorang atas kekayaan negara. Peniup peluit membuat para koruptor dan pelaku kriminal atas harta rakyat merana karena dapat membawanya tersuruk ke dalam terali besi yang pengap. Karena keberaniannya, nasib peniup peluit terancam lahir dan batin di negeri ini. Dari Khairiansyah hingga Susno Adalah Komjen Susno Duadji yang belakangan ini memopulerkan kembali istilah peniup peluit. Mantan Kabreskim yang sempat dituduh sebagai dalang lakon Cicak melawan Buaya itu bernyanyi tentang makelar kasus di Ditjen Pajak. Susno membeber tentang kekayaan luar biasa seorang pegawai pajak bernama Gayus Tambunan. Konon kekayaan pegawai golongan III A itu didapat secara tidak wajar dan melibatkan banyak pihak . Sempritan peluit Susno tidak saja mampu mengonjang-ganjingkan praktik mafia pajak yang selama ini dijadikan sarana memerkaya para pegawai pajak, namun juga membongkar keterlibatan petinggi kepolisian dan kejaksaan. Paling tidak beberapa perwira polisi berpangkat jenderal telah diperiksa dan jadi tersangka. Selain itu, sepuluh atasan Gayus dinonatifkan dan 121 rekannya di Direktorat Ke-

Dedi Sahputra

Tembus Pandang Kita sudah memahami bahwa persepsi atas kebenaran atau citra tertentu selalu berwajah banyak (baca foliopini; multy faced). Apa yang Anda anggap benar, belum tentu orang lain juga menganggapnya sama. Ada keterbatasan yang alamiah dalam diri manusia dalam mendekati kebenaran. Anda boleh membenarkan kalau ada yang bilang lontong sayur itu nikmat. Apalagi kalau dimakan pagi hari ditemani segelas kopi atau teh manis panas. Tapi jangan paksakan ini sama orang Jerman yang biasa sarapan roti bakar dan jus jeruk. Mereka bakal pulang-pergi (PP) kamar mandi karena kena tauco pedas. Tetapi pada titik tertentu orang bakal meyakini juga bahwa makanan yang baik itu harus sesuai dengan perut seseorang dan pada kebiasaannya. Bukan pada lontong-nya, pada roti bakarnya, pada jusnya atau pada tauco-nya apalagi pada kamar mandinya. Maka Michael Foucault merumuskan bahwa pengetahuan juga punya konsekuensi terhadap konsepsi tentang kebenaran. Katanya, tidak mungkin mendapatkan akses ke kebe-naran universal karena mustahil membicara-kannya dari posisi di luar wacana. Karena dalam wacana akan tercipta efek kebenaran. Dalam analisis wacananya Foucault, adalah sia-sia mempertanyakan apakah sesuatu itu benar atau salah. Tapi fokusnya adalah bagaimana efek-efek kebenaran itu diciptakan dalam wacana. Kira-kira dia bilang begini, kebenaran itu adalah hasil dari sebuah proses wa-cana dari kebenaran-kebenaran yang banyak yang kemudian menghasilkan efek kebenaran. Dan efek ini hanya satu. Maka terang sudah, bahwa kebenaran itu akan selalu berwajah banyak pada prosesnya, tetapi pada akhirnya dia akan menyempit pada satu kesimpulan. *** Lelaki separuh baya itu adalah saudara saya, walaupun dia tidak benar-benar mengenal saya. Wajahnya begitu sangat khawatir. Anak gadis kecilnya datang berlari sambil menangis kepadanya. ’’Kenapa sayang..?” ’’Dipukul sama Wani,’’ seru si anak dengan suara isakan yang imut-imut. Sang bapak diam sejenak. Dia perhatikan wajah anaknya sambil mengusapusap tubuhnya dan memeluk dalam dekapannya. ’’Tapi kakak gak membalas kan,’’ tanyanya. Sambil sesungukkan anaknya itu menggelengkan kepala. Seketika wajah sang ayah berurai senyum, kemudian berujar,’’Itu baru anak ayah. Kamu harus tetap sabar ya sayang,’’

katanya sambil mencium pipi anaknya itu. Saudara saya ini memang sangat sabar. Pernah ketika sepedamotornya ditabrak orang di jalanan, tapi kemudian yang menabrak itu yang terkapar. Sau-dara saya ini bukan saja menghabiskan gaji yang baru diambilnya itu untuk mengobati si penabrak, tetapi juga dengan sukarela, tanpa paksaan mengganti keru-sakan sepedamotor orang itu. Dia tak pernah berpikir dua kali untuk membantu orang yang datang kepadanya. Walaupun kondisinya gak jauh beda memprihatinkannya dengan orang yang ditolong itu. Waktu ditanya mengapa dia bisa begitu sabar, dia bilang begini, ’’Saya ini orang yang tidak punya kebanggaan. Ibadah saya tidak pernah sempurna, sementara dosa saya banyak, bertam-bah terus setiap hari. Saya tidak punya apa-apa yang bisa dibanggakan ketika menghadap Tuhan nanti.’’ *** Betapa nikmatnya bila kita punya kemampuan tembus pandang. Kalau ada seorang gadis atau perjaka rupawan yang dibalut pakaian indah melenggang di hadapan Anda. Pandangan mata Anda bisa menembus sampai ke balik pakaian itu. Tentu nikmat. Tapi Anda jangan ngeres dulu. Bukan itu maksud saya. Bayangkan kalau ada sebuah peristiwa yang menarik perhatian orang. Banyak yang kemudian mereka-reka sesuai dengan kemampuan, akses dan pengetahuan yang dimilikinya. Mereka semua menduga, tapi kalau Anda tentang-tenang saja karena tahu persis apa yang sedang terjadi. Dan ini sebuah kenikmatan. Ketika melihat bulan, Anda tahu bagaimana sejatinya bulan itu dan bagaimana kesamaannya dengan para Rasul yang bertugas memantulkan sinar ke semua mahluk. Ketika menginjak bumi, Anda tahu persis bagaimana bentuknya dan tahu persis suatu saat dia akan meledak. Hancur. Ketika terlibat konflik, Anda tahu persis apa yang sedang terjadi, bahwa Tuhanlah yang sedang mengatur konflik dan melibatkan Anda di dalamnya. Jadi, ya harus tahu diri. Bahwa sebenarnya Tuhan mau melihat bagaimana reaksi kita menghadapi masalah. Maka betapa nikmatnya memiliki kemampuan tembus pandang itu. Seperti saudara saya ini, sejatinya dia sudah tembus pandang. Mengetahui secara persis bahwa hidayah dari Tuhan melalui usaha yang dilakukannya, jauh lebih berharga dari dunia beserta isinya.

beratan dan Banding segera dimutasi. Namun, mengutip pernyataan Susno, hingga saat ini mereka itu baru para “aktor” lapangan. Sang sutradaranya belum terungkap. Seberapa kuatkah energi Susno terus meniupkan peluit? Banyak yang pesimis Susno akan konsisten menuntaskan tiupan peluitnya membongkar gurita mafia di negeri ini. Bukan saja karena Susno sendiri. Tapi juga lembaga resmi yang telah disyahkan presiden membongkar mafia di seluruh lini birokrasi Indonesia, yaitu Satgas pun seakan tidak bergigi membongkar praktik mafia di negeri ini. Banyak orang berceletuk, sesungguhnya yang Satgas itu Susno. Pengalaman pun bercerita miring tentang nasib para peniup peluit di negeri ini, apes. Bukannya mendapatkan penghargaan, malah karir mereka tamat, dan nasib mereka di ujung tanduk. Kita teringat kepada Khairiansyah Salman, auditor BPK yang mampu membongkar mega skandal

korupsi di KPU (Komisi Pemilihan Umum). Dia menjebak Mulyana W.Kusumah (anggota KPU) melakukan penyuapan agar temuan BPK tidak dimasukkan dalam laporan. Bukannya penghargaan yang didapat, justru beliau ditetapkan sebagai tersangka oleh Kejaksaan Agung dalam kasus lain. JugaVincentius Amin Sutanto, seorang mantan controller keuangan di Raja Garuda Mas milik mantan orang terkaya di Indonesia, Sukanto Tanoto. Tuduhan melakukan penggelapan, membuat Vincent melarikan diri dan melaporkan kondisi tersebut kepada KPK. Karena kasus tersebut terkait dengan tindak pidana perpajakan, KPK segera bekerjasama dengan Dirjen Pajak untuk membongkar akrobat pajak di perusahaan milik SukantoTanoto tersebut. Keberaniannya membongkar penggelapan pajak di perusahaannya yang bernilai triliunan rupiah juga membuatnya harus mendekam di penjara dengan tuduhan melakukan money laundering dan penggelapan. Peran pemerintah Efek balik yang menampar muka peniup peluit sendiri membuat pemberantasan mafia dan korupsi di negeri ini tidak akan pernah tuntas. Orang takut “bernyanyi” karena tidak ada jaminan perlindungan dari pemerintah. Pemberantasan korupsi terhambat karena negara tidak serius melindungi orang-orang yang mau pasang badan memberantas korupsi. Di negara yang peringkat korupsinya termasuk tertinggi di dunia seharusnya banyak melahirkan peniup peluit, bukan hanya beberapa orang.

Berbeda dengan Amerika Serikat yang tingkat korupsinya sangat rendah. Pemerintahnya benar-benar melindungi para peniup peluit. Di bawah UU False Claim Act, warga negara AS memang diberi hak untuk mewakili negara mengajukan tuntutan hukum pada kejahatan fraud yang merugikan negara. Yang lebih hebat dari UU itu adalah jaminan hukum bahwa si whistleblower itu bukan saja dilindungi tapi juga berhak atas 30% dari ganti rugi yang dijatuhkan oleh pengadilan untuk si pelaku fraud. Satu lagi (yang ini lebih hebat) jika fraud itu terbukti, nilai ganti rugi yang dapat dijatuhkan pengadilan adalah tiga kali lipat nilai kerugian pemerintah. Dengan perlindungan dan komisi yang demikian mewah bagi para peniup peluit di Amerika Serikat bukan berarti menjadi lahan subur lahirnya para peniup peluit. Tetap saja yang berani membongkar skandal hanya segelintir orang. Jika di negara demokratis seperti Amerika Serikat saja orang masih takut mengungkap skandal, apalagi di negara seperti Indonesia, keberanian untuk menjadi peniup peluit merupakan sesuatu yang amat langka dan amat berharga bagi upaya percepatan pelembagaan politik yang sedang berlangsung. Kita tidak bisa memaksa munculnya para peniup peluit. Tetapi, kita harus selalu siap memberi respons positif dan protektif setiap kali lahir para peniup peluit. Para peniup peluit harus dilindungi dan skandal yang dibongkarnya harus ditindaklanjuti dengan tuntas guna mereformasi seluruh lini birokrasi yang tidak kunjung bersih dari mental korupsi dan kolusi. Pemerintah, dalam hal ini presiden seharusnya bertindak aktif dan reaktif melindungi para peniup peluit dari sergapan atasan, komandan dan teman sejawat yang terlibat. Kita tidak ingin nasib peniup peluit di negeri ini akhirnya seperti wasit sepak bola yang kadang remuk redam dikeroyok pemain karena tiupan peluitnya merugikan kesebelasan yang bertarung. Penulis adalah Dosen Politeknik Negeri Medan

Cost of Politic Suksesi Walikota

Syahruddin Mantan Atlet Tri Lomba Nasional



Oleh Mahruzar Efendi,SE Dalam hitungan kasar,setiap calon harus menyediakan paling tidak Rp53,72 miliar


erkait pemilihan kepala daerah (walikota) Medan12 Mei mendatang, 10 calon dari jalur partai dan independen sudah menyiapkan diri. Otomatis mereka menyiapkan pula biaya politik (cost of politic). Biaya tersebut belum jelas berapa jumlahnya, masing-masing calon tampaknya masih sungkan dan malu-malu kucing untuk menyebutkan angka. Namun dapat ditebak, cost of politic yang dipersiapkan pasti berbeda antara satu calon dengan calon lainnya. Sekilas, besaran atau kekuatan cost of politic masing-masing calon dapat dinilai dari kemampuan mereka mengeluarkan biaya pada pemasangan iklan, brosur, billboard ataupun spanduk pada titik-titik yang dianggap strategis. Termasuk juga biaya sablon untuk baju kaos, biaya kegiatan sosialisasi dan biaya persiapan kampanye lain. Timbul pertanyaan, untuk apa mereka mengeluarkan cost of politic yang lumayan besar ini? Jawabannya tidak lain adalah untuk mendulang suara sebanyak mungkin. Bukankah sama kita ketahui, untuk mendominasi perolehan suara calon walikota perlu 30 persen dari total suara yang sah. Komisi Pemilihan Umum(KPU) kota Medan menetapkan jumlah daftar pemilih tetap 1.961.155 pemilih dengan 3.897 tempat pemungutan suara (TPS). Penetapan jumlah DPT tersebut sesuai dengan peraturan KPU No. 67 Tahun 2009 dan Keputusan KPU Medan No.6 Tahun 2010. Suara ini tersebar pada 21 kecamatan, 151 kelurahan dan lebih kurang 2005 lingkungan. Memperoleh suara sebanyak itu tentu harus dibarengi dengan biaya. Untuk tidak menyebutnya money politics dalam tulisan ini penulis sebut cost of politic.

Bukan rahasia lagi, kekuatan finansial seorang calon dalam pemilihan pemimpin apapun, selalu berefek pada suara yang didulang. Tidak cukup pada sekedar mengandalkan isi visi dan misi yang dilantunkan. Karena itu sudah sangat acap kita lihat, di setiap pemilihan ada saja bantuan-bantuan dadakan yang digulirkan sang calon kepada para konstituen. Bentuknya dikemas dengan sangat rapi dan menarik. Misalnya dalam bentuk memberi bantuan biaya operasi pasien miskin, bantuan pada pelantikan pengurus organisasi dan lain sebagainya. Adapula yang mengunjungi pasar tradisional, minum kopi bareng masyarakat yang katanya agar lebih akrab. Padahal bantuan atau kunjungan itu sebenarnya bermuara pada satu maksud, yakni menarik perhatian agar masyarakat memilihnya. Semua calon pasti menyadari, persaingan untuk memenangkan pemilihan kali ini amatlah berat. Peluang untuk meraih suara mayoritas sungguh kecil, mengingat banyaknya jumlah calon hingga suara pemilih terpecah-pecah. Raihan suara 30 persen untuk seorang calon hanyalah isapan jempol. Jauh panggang dari api. Sebab itu terjadinya kemungkinan putaran kedua tak dapat ditampik. Nah, untuk masuk ke putaran kedua, setiap calon tentu harus kerja ekstra keras. Empat kegiatan Untuk mendulang suara di Pilkada walikota Medan, secara umum paling tidak harus dilakukan empat kegiatan besar yang bersinggungan dengan cost of politic. Keempat kegiatan tersebut adalah cost of politic untuk jumpa masyarakat (konstituen), jumpa tokoh, biaya rapat dan biaya in-

fokom (informasi dan komunikasi). Jumpa masyarakat (konstituen) bisa dalam bentuk kegiatan yang dibungkus silaturrahmi, festival seni budaya maupun bentuk lain yang umumnya dihadiri masyarakat luas. Sementara kegiatan jumpa tokoh merupakan pertemuan khusus yang sengaja dibangun sang calon pada tokoh tertentu untuk melihat aspirasi dan dinamika masyarakat ditempat tokoh tersebut.Tokoh yang lazim menjadi sasaran adalah tokoh yang memiliki pengaruh kuat dan basis massa lumayan besar untuk digiring sebagai dulangan suara. Di sini, antara calon dan tokoh acap ada imbalan menarik atau perjanjian-perjanjian tertentu andai sang tokoh berhasil menggiring basis massanya memenangkan si calon. Cost of politic berikutnya adalah biaya penyelenggaraan rapat-rapat serta biaya informasi dan komunikasi intensif dengan Parpol pendukung. Jumlah cost of politic yang keluar dari kocek si calon pada kegiatan ini juga lumayan besar. Belum lagi biaya kampanye nantinya. Memang, dari beberapa pengalaman, seorang calon kepala daerah hanya dibebankan sebesar 50 persen dari biaya kampanye, 30 persen untuk wakil dan 20 persen untuk koalisi partai. Partai menanggung biaya kampanye yang lebih sedikit karena dianggap telah memiliki mesin politik yang akan bekerja untuk memenangkan calon. Hitungan kasar Sebelum melakukan perkiraan cost of politic para calon walkot 2010-2015, langkah awal kita adalah menyusun beberapa hitungan kasar. Di antaranya jumlah pemilih dan tingkat partisipasi pemilih. Jumlah pemilih menurut DPT telah kita ketahui yakni sebesar 1.961.155 pemilih. Andai kita asumsi 10 persen tingkat Golput maka suara yang akan diperebutkan oleh 10 calon adalah 1.765.040 suara. Suara ini tersebar pada 21 kecamatan dan 3.897 TPS. Untuk menjadi pemenang, seorang

calon harus mengantongi 30 persen suara dari 1.765.040 pemilih. Ini berarti harus diraupnya 529.512 suara. Hitungan 1.765.040 jika dikaitkan dengan kertas suara rusak nantinya, katakanlah lima persen saja, maka seorang calon yang menang harus mendapat 503.037 suara (1.765.040-1.765.040x0,05x0,3). Dengan demikian pemilih potensial yang harus dipengaruhi sebelum hari pemilihan adalah sebesar itu juga. Kalau saja nilai satu suara simpatisan itu Rp100.000 (untuk baju kaos, konsumsi, transfortasi dan lain-lain) maka sang calon harus menyediakan cost of politicnya kurang lebih Rp 50,3 miliar. Ini belum lagi untuk cost of politic jumpa tokoh, penyelenggaraan rapat serta biaya informasi dan komunikasi. Andai kegiatan jumpa tokoh satu kali saja per kecamatan dengan biaya Rp20 juta (sewa tempat, konsumsi, hiburan dan lainlain), maka cost of politicnya adalah Rp420 juta. Dari wacana yang beredar, biaya rapat-rapat komite dan biaya komunikasi intensif dengan partai politik pendukung bisa sekitar dua atau tiga miliar. Dengan menjumlahkan semua komponen cost of politic hitungan kasar di atas, berarti setiap calon harus menyediakan paling tidak Rp53,72 miliar. Nah, dengan pengeluaran yang seperti itu, apakah nantinya setelah terpilih tidak tergoda untuk melakukan korupsi? Penutup Meraih dukungan politik dalam demokrasi yang jujur sesungguhnya tidak memerlukan biaya yang bernilai miliaran rupiah. Apalagi bila calon tersebut adalah kader terbaik yang bervisi dan misi membangun masyarakat berbasis prestasi. Karena itu kita berharap masyarakat Medan cerdas menentukan pilihan, mana emas mana loyang. Penulis adalah dosen USBM pemerhati masalah sosial-ekonomi

Harapan Kepada STAIN P.Sidimpuan Oleh Balyan Kadir Nasution Ke depan harus lebih membuka diri atau terbuka menerima kritik, saran konstruktif dari masyarakat


um’at, 19 Februari 2010 merupakan hari bersejarah bagi kalangan Civitas Akademika Sekolah Tinggi Agama Islam Negeri (STAIN) Padang Sidimpuan. Pasalnya hari itu STAIN Padang Sidimpuan menggelar pesta demokrasi dalam rangka Pemilihan Calon Ketua yang baru karena periode 2006-2010 akan berakhir pada 5 Mei 2010 mendatang. Hasilnya Dr H. Ibrahim Siregar, MCL terpilih sebagai calon peraih suara terbanyak yakni 10 suara dari 14 suara dibandingkan dengan Baharuddin (incumbent) dan Dr H. Nurfin Sihotang, MH, Ph.D yang masing-masing meraih hanya 1 suara, sementara seorang anggota senat tidak hadir dan satu suara lagi abstein. Namun sesuai mekanisme pemilihan Calon Ketua STAIN, Ibrahim Siregar belum resmi menjadi Ketua STAIN Padang Sidimpuan sebelum Menteri

Agama menetapkannya menjadi Ketua terpilih menggantikan Baharuddin. Setelah menetapkan hasil pemilihan Calon Ketua STAIN, tahapan selanjutnya adalah Senat STAIN Padang Sidimpuan mengirim tiga nama kandidat yakni Ibrahim Siregar, Nurfin Sihotang dan Baharuddin kepada Menteri Agama untuk ditetapkan menjadi ketua terpilih dan memulai bertugas memimpin STAIN Padang Sidimpuan untuk masa bakti 2010-2014. Gantungkan harapan Terpilihnya Ibrahim Siregar sebagai Calon Ketua STAIN Padang Sidimpuan sebenarnya banyak pihak yang menggantungkan harapan akan kembalinya STAIN Padang Sidimpuan menjadi milik umat. Karena, empat tahun (dari 2006 sampai 2010 ini) terkesan menutup diri dengan

akses eksternal bahkan internal. Empat tahun lamanya STAIN Padang Sidimpuan terkesan sepi dari pemberitaan pers secara positif dibandingkan dengan pemberitaan miring akibat manajemen yang tidak transparan. Dengan terpilihnya Ibrahim Siregar, figur ustadz yang dikenal luas sebagai Calon Ketua STAIN Padang Sidimpuan, masyarakat (umat Islam) di Sumatera Tenggara atau Tapanuli Bagian Selatan kini merasa lega sekaligus menaruh harapan kepada Ibrahim. Kiranya putraputri mereka yang menjadi mahasiswa STAIN Padang Sidimpuan konsisten dengan pelaksanaan sosial kontrol. Perguruan tinggi Islam satu-satunya berstatus Negeri di Tapanuli Bagian Selatan dari selama ini harus dibesarkan, dari hanya sekedar Sekolah Tinggi Agama Islam Negeri (STAIN) menjadi Institut Agama Islam Negeri (IAIN) Padang Sidimpuan. STAIN Padang Sidimpuan ke depan harus lebih membuka diri atau terbuka menerima kritik, saran konstruktif dari masyarakat, khususnya Civitas Akademika itu sendiri. Karena tanpa pola pikir demikian STAIN Padang Sidimpuan mustahil bisa memperluas jaringan kerjasama de-

ngan berbagai lembaga lokal, nasional dan internasional. Hasil Pemilihan Calon Ketua STAIN Padang Sidimpuan merupakan bukti konkrit betapa kalangan Civitas Akademika STAIN Padang Sidimpuan berupaya menyelamatkan STAIN Padang Sidimpuan. Keinginan masyarakat Berhasilnya STAIN Padang Sidimpuan memilih calon Ketua baru juga telah mengakomodir keinginan masyarakat. Maka STAINPadangSidimpuanharusbenar-benar mengutamakan kualitas lulusan, menjadi pusat pendidikan keIslaman yang handal. Dan itu tidak akan tercapai tanpa kepemimpinanSTAINyangberkualitasdanbenarbenarberaksesdalamtetapijugalebihpenting berakses keluar. Umat Islam di Tapanuli Bagian Selatan mungkin sependapat, bahwa tanpa manajemen STAIN Padang Sidimpuan yang benar-benar terbuka dan menerima pendapat orang lain, mustahil bisa mewujudkan lulusan yang benar-benar berilmu. Mustahil juga bagi STAIN bisa meningkat menjadi IAIN. Penulis adalah Wartawan Harian Waspada




Kamis 15 April 2010

Raihlah Cita-Citamu Setinggi Langit… PELAJAR SLTA udah selesai ngadepin Ujian Nasional dan Ujian Akhir Sekolah. Kini, mereka tinggal nunggu hasil aja yang beropsi hanya dua, yakni lulus dan tidak lulus. Apapun hasilnya nanti, Anda harus siap mental karena memang itulah hasil maksimal kalian selama tiga tahun menghangatkan bangku sekolah. Akhir pendidikan di bangku sekolah memang selalu menyisakan berbagai kisah suka dan duka. Banyak orang bilang masa sekolah adalah masa yang sulit dilupakan. Ada saja kenangan yang mungkin masih membekas di ingatan kalian. Mulai dari pengalaman bersama guru, teman, penjaga kantin sampai kenangan bersama doi. Tapi mau tak mau kalian harus meninggalkan semua kenangan itu. Kini saatnya kalian menatap ke depan untuk meraih cita-cita. Lanjut ke bangku kuliah atau milih kerja memang menjadi dua alternatif setelah tamat SLTA. Mungkin yang kalian rasakan adalah menentukan lanjut studi ke perguruan tinggi mana dan ngambil jurusan apa, karena belum tahu profesi yang nantinya akan digeluti sesuai kemampuan dan minat kamu. Untuk itu, kalian terlebih dahulu harus menjawab pertanyaan, aku mau jadi apa nanti? Banyak sekali pilihan profesi yang bisa ditekuni, nggak terbatas hanya pada dokter, pengacara atau pengusaha aja. Perlu juga rasanya bertanya kepada orangtua, guru sampai cari-cari informasi di media massa apa kira-kira profesi dan lokasi menuntut ilmu yang pas. Satu hal yang perlu diingat bahwa yang terbaik bagi kita belum tentu sama dengan orang lain bahkan sahabat kita. Jangan sampai kalian memaksakan diri untuk memilih jurusan hanya biar bisa bareng mereka. Sekarang saatnya memikirkan kembali dan merevisi impian masa depan.

Selain intelektual, kemampuan finansial dan materil juga harus diperhatikan. Biaya pendidikan di Indonesia memang termasuk tinggi, karenanya jangan terlalu memaksakan orangtua agar kalian bisa melanjutkan ke perguruan tinggi. Walau terbentur biaya, jangan sampai hal ini menghalangi cita-cita kalian. Banyak pula perguruan tinggi yang menawarkan program beasiswa, so cari tahu dong di mana aja. Ada pula program beasiswa dengan cara mendanai biaya kuliah siswa berprestasi untuk kemudian direkrut bekerja di perusahaan tersebut pasca tamat. Salah satunya adalah Sekolah Tinggi Ilmu Komunikasi “Pembangunan” (STIKP) Medan. Kampus yang terletak di Jl SM Raja ini hanya memiliki dua jurusan, yakni Public Relations dan Jurnalistik, tapi jangan sepele karena mayoritas jurnalis di Sumatera Utara ini merupakan alumni maupun mahasiswa dari STIK-P lho… Intinya, belajarlah kalian demi alasan dan tujuan yang benar, bukan karena orang lain. Memang ada yang kuliah demi meraih gelar sarjana untuk meringankan beban orangtua di masa mendatang, tapi ingat juga kalo kalianlah yang menjalani proses belajar itu. So, pilihlah kampus yang memang sesuai dengan hati kamu biar dalam tiga-empat tahun ke depan udah bisa membanggakan orang-orang di sekitar kamu. *Syahrial Siregar

Waspada/Khairil Umri Batubara

Ayunda Syahputri

Milih Kerja Demi Kebahagiaan Ayah

Waspada/Syahrial Siregar

UJIAN Nasional dan Ujian Akhir Sekolah udah tuntas. Setelah lulus, mungkin sebagian pelajar akan melanjutkan studi ke perguruan tinggi dan ngambil jurusan yang diminati. Tapi tidak sama halnya dengan apa yang dirasakan oleh Ayunda Syahputri (18). Siswi SMA Madrasah Aliyah Laboraturium jurusan IPS ini mengaku lulus UN aja udah syukur Alhamdulillah. “Aku lebih memilih untuk bekerja daripada harus melanjutkan ke perguruan tinggi, karena nggak mau nyusahin orang tuaku lagi,” ungkapnya. Anak bungsu dari lima bersaudara ini sebenarnya memiliki cita-cita menjadi seorang desainer handal. Namun apalah

daya,semenjakibunyameninggal dunia beberapa tahun silam, Ayu pun harus mengubur impiannya dalam-dalam… Cita-cita yang ditanamkannya sejak kecil itupun harus pupus di tengah jalan. Hal itu dia pilih karena tak mau lagi membebaniayahnyayangkinimenjadi tulang punggung keluarga.“Ayah hanya bekerja sebagai pemasok barang ke warung-warung, tentunya tidak cukup dan tak tega jika harus menuntut biaya kuliah lagi,” ungkapnya sedih. Kepada Kreasi, cewek yang hobimembacainitakterlaluyakin lulus UN. Hal itu disebabkan karena terkadang kurang percaya diri dengan kemampuannya dan tidak mau berharap terlalu tinggi.

Dari enam mata pelajaran yang diuji, ia merasa takut pada pelajaran Bahasa Inggrislah dan yakin dengan Geografi. Apapun ceritanya, kamu harus yakin bisa mendapatkan hasil yang positif dan bisa lulus. Memilih untuk lanjut ke perguruan tinggi atau bekerja adalah hal yang sama. Kamu harus buktiin kalo tanpa kuliah, kamu bisa ngebahagiain orangtua. Tunjukin juga kepada teman dan orang-orang sekitar walaupun tidak mengenyam pendidikandibangkukuliah,setidaknya kamu bisa membantu ekonomi keluarga dan tidak membebani orangtua. Oke deh, semangat ya…!! *Syahrial Siregar

Aku Ingin Menjadi.... Anggie Imaniah S,

Fathimah Irfaniarti,

SMA Harapan

SMA Islam AL-ULUM Terpadu

Intan Aisyah,

“Dari kecil, aku bercita“Setelah lulus SMA nanti, aku cita ingin menjadi seorang akan melanjutkan pendidikan ke dokter, Selain perguruan tinggi dan bercita-cita SMA Harapan orangtuaku juga menjadi seorang dosen. Karena dokter, profesi itu “Aku akan dengan berprofesi seorang dosen, termasuk mulia melanjutkan aku dapat mengabdikan diriku karena pendidikan ke kepada negara. Keinginan bertanggung perguruan tinggi itu juga didorong oleh jawab demi pengalaman aku saat memberikan mewujudkan mengikuti pertukaran pertolongan keinginan pelajar di Amerika. Di situ aku terhadap menjadi seorang sadar bahwa pendidikan itu sangat penting buat bekal masyarakat. Karena itu, setelah dokter karena masa depan kita.” lulus dari bangku SMA nanti aku pendidikan itu akan menekuni ilmu Kedokteran.” penting dan, zaman sekarang persaingan semakin ketat. Bagiku, profesi seorang dokter merupakan pekerjaan mulia sebab mempunyai tanggung jawab besar terhadap pasiennya.”

Zailani Ray,

T. Fajri Maulana,

SMA Dharmawangsa “Begitu lulus SMA, aku akan meneruskan studi dengan mengambil jurusan Fisika. Dari dulu, aku SMA Dharmawangsa mempunyai keinginan “Untuk mewujudkan citamenjadi seorang dosen citaku bekerja di Departemen karena profesi itu Kelautan, aku akan lanjut termasuk pekerjaan belajar pendidikan dengan yang mulia dan mengambil jurusan menyenangkan. Tak Oceanografi. Buatku, bekerja hanya itu, sebagai di Departemen Kelautan dosen juga nantinya menjadikan kita bisa membagi ilmu mengetahui fenomena kepada orang apa saja yang terjadi di banyak.” bawah laut serta lebih mengenal laut lepas.”

Ahmad Agung Raditya,

Teks: Arianda Tanjung Foto: Khairil Umri Batubara

SMA Islam AL-ULUM Terpadu “Pendidikan itu sangat penting, sebab itu aku akan lanjut ke perguruan tinggi dengan mengambil jurusan Desain Komunikasi Visual pasca lulus SMA. Aku sendiri bercita-cita ingin menjadi seseorang yang kreatif di bidang multimedia pada salah satu media ternama di Indonesia karena memang profesi tersebut menarik dan masih jarang diminati.”

Waspada/Khairil Umri Batubara

Aldila Indryati

Ingin Studi & Prestasi Seimbang SEJUMLAH prestasi telah dicatat Aldila Indryati (15), namun peboling remaja putri ini masih punya keinginan kuat menjadi atlet nasional dan bahkan juara dunia di cabang olahraga yang ditekuninya itu. Pekan lalu, Indri (sapaan akrabnya) menjadi juara ladies open di Kejuaraan Waspada Cup yang digelar di Lintasan Perisai SuperBowl Medan. Kepada Kreasi, Indri memaparkan kunci suksesnya adalah berkat latihan rutin dan disiplin tinggi. “Sejak kecil atau tepatnya di bangku SMP,

saya sudah main boling mengikuti hobi orangtua. Boling pun makin aku minati hingga meraih sejumlah prestasi gemilang,” jelas siswa kelas X di SMAN I Medan tersebut. Kendati sarat gelar, putri bungsu dari pasangan Herwi Rusli Dainiri dan Popy Sunaryati itu juga ingin berprestasi di dalam kelas. Ke depan, Indri berujar bahwa akan terus berlatih boling hingga perguruan tinggi sembari menuntut ilmu. “Jadi jasmani, prestasi dan pendidikan berjalan seimbang,” tutur dara pemilik senyum manis itu. “Saya akan terus

mengasah kemampuan agar menjadi atlet berprestasi, tapi tak lupa dibarengi belajar karena aku nggak mau sampai tinggal kelas. Selain jasmani, pendidikan pun harus sehat biar seimbang,” tutur Indri yang lahir pada 23 Februari 1995 itu. Seiring ambisi Indri yang ingin terus berprestasi di dunia olahraga dengan harapan nantinya mengharumkan nama bangsa, tak lupa Kreasi mendoakan citacitanya tercapai. Keep up the good work… *Hajrul Azhari Ritonga

Waspada, Kamis 15 April 2010  
Waspada, Kamis 15 April 2010  

waspada daily