Page 1

Kroasia Ancaman Italia Analisis Sarman Panggabean KROASIA adalah pecahan dari eks Yugoslavia, penduduknya terbilang kecil sekitar 4 juta. Tetapi negeri ini terkenal sebagai sumber pemain-pemain berbakat. Walau negara kecil, ranking FIFA Kroasia masuk 10 Besar. Setelah mengalahkan Irlandia 3-1, malam nanti Kroasia siap untuk mengancam Italia, yang sebelumnya mampu menahan juara bertahan Spanyol 1-1. Kedua tim berarti sangat menjanjikan. Pertarungan mereka di Grup C juga akan sangat menentukan nasib bagi kedua petarung. Pelatih Kroasia, Slaven Bilic, diperkirakan tetap menampilkan 4-4-2, tetapi dengan taktik mutasi pemain tengah yang terbilang prima sebagaimana layaknya tim-tim dari kawasan Balkan. Terbukti secara cepat, mereka bisa menggilas pertahanan kuat Irlandia dengan tiga gol. Lanjut ke hal A2 kol. 7

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

KAMIS, Wage, 14 Juni 2012/24 Rajab 1433 H

No: 23895 Tahun Ke-66

Terbit 24 Halaman (A1-12, B1-12)

Harga Eceran: Rp2.500,-

Meneer Angkat Koper KHARKIV, Ukraina (Waspada): Favorit juara Belanda harus menerima kenyataan pahit setelah dipaksa angkat koper lebih cepat dari ajang Euro 2012. Kekalahan 2-1 dari Jerman menutup peluang skuad Kincir Angin lolos dari Grup B. Bertarung di Stadion Metalist, Kharkiv, Kamis (14/6) dinihari, pelatih Bert van Marwijk tetap mengandalkan Robin van Persie di lini depan. Sebaliknya, Jerman tetap tampil dengan the winning team. Jerman lebih dulu memecahkan kebuntuan saat pertandingan melewati 24 menit. Diawali serangan balik cepat, Bastian Schweinsteiger mengirim umpan terobosan kepada Mario Gomez. Lolos jebakan offside, Gomez menaklukkan Maarten Stekelenburg. Gomez mencetak gol keduanya atau ketiganya sepanjang turnamen di menit 38. Tanpa ampun, striker Bayern Munich itu menembak dari sudut sempit dan memaksa pendukung Belanda gigit jari dengan ketinggalan dua gol. Belanda memperkecil selisih di menit 73 berkat Van Persie. Hingga pertandingan berakhir, keunggulan 2-1 Jerman tetap tak berubah. Dengan demikian, Jerman memastikan tiket perempatfinal dan Belanda menjadi tim pertama yang tersingkir. Sebelumnya, Portugal meraih poin penuh dengan mengalahkan Denmark 3-2. Portugal mencetak gol pertama hasil sundulan Pepe dan menggandakan keunggulannya melalui Helder Postiga. Denmark juga sempat menghadirkan ketakutan bagi Seleccao ketika Niklas Bendtner mencetak dua gol bagi skuad Dinamit. Namun, nasib Portugal diselamatkan Silvestre Varela di menit 84. Alhasil, Portugal menyamai tiga poin raihan Denmark dan sama-sama membuka peluang lolos ke fase knock out. (m33)

AKSI gemilang Mario Gomez (23) di Metalist Stadium menghadirkan mimpi buruk bagi Belanda yang harus tersingkir dari Euro 2012 , setelah tumbang 1-2 dari Jerman, Kamis (14/6) dinihari WIB. -Reuters-

Balon Walkot Bakar Kantor KPU P. SIDIMPUAN (Waspada): AAH, bakal calon wali kota (balon walkot) yang dinyatakan tidak memenuhi syarat untuk maju dari jalur independen, membakar dua ruangan berikut berkas-berkas di lantai dua kantor Komisi Pemilihan Umum (KPU) Kota Padangsidimpuan di Jl. Mawar, Kel. Ujung Padang, Kec. Sidimpuan Selatan, Rabu (13/6) siang.

Buron BLBI Masuk Bui


SHERNY Kojongian dikawal petugas kepolisian saat tiba di Bandara Soekarno Hatta, Tangerang, Rabu (13/6). JAKARTA (Antara): Buron Bantuan Likuiditas Bank Indonesia (BLBI) yang ditangkap di San Fransisco, Amerika Serikat, Sherny Kojongian Saroha, Rabu dijebloskan ke bui Lembaga Pemasyarakatan Klas IIB Anak Wanita Tangerang. “Sherny kita tempatkan di LP Tangerang,” kata Wakil Jaksa Agung Darmono yang juga menjadi Ketua Tim Pemburu Koruptor (TPK) di Jakarta, Rabu (13/6). Sherny mendarat di Bandara Soekarno-Hatta pukul 08:00 dengan menggunakan pesawat Garuda Indonesia GA 823 dari Singapura. Sherny dikawal pejabat imigrasi Amerika Serikat yang dipimpin Leon Jennifer didampingi seorang stafnya kemudian dilakukan serah terima dengan ke pejabat Imigrasi Indonesia dan selanjutnya diserahkan ke tim terpadu pemburu koruptor yang diketuai Darmono. Lanjut ke hal A2 kol. 4

kar, berserakan di tempat kejadian perkara. Informasi di lokasi, pelaku pembakaran diduga AAH, 47, warga Jl. Pelaksana, Dusun IV, Desa Bandar Setia, Kec. Percut Seituan, Kab. Deliserdang. Dia

2 Tersangka Penculik Dibekuk

MEDAN (Waspada): DPRD Sumatera Utara mengaku sudah memperkirakan masyarakat Batangtoru akan marah pada perusahaan pertambangan emas PT Agincourt Resources (AR). Dewan juga mengaku sudah memperingatkan perusahaan untuk tidak menganggap sepele masalah limbah yang dihasilkan dari proses penambangan. Wakil Ketua Komisi D DPRD Sumut H.Zulkifli Effendi Siregar dan anggota Komisi D, Marahalim Harahap, berbicara kepada Waspada di gedung dewan, Rabu (13/6). Mereka mengomentari aksi masyarakat enam desa di Kec. Muara Batangtoru, Kab,Tapanuli Selatan (Tapsel) untuk masalah limbah PT AR. Masyarakat protes karena perusahaan akan membuang limbahnya ke Sungai Batangtoru. Satu mobil double cabin dan pipa pembuangan limbah dibakar masyarakat. Zulkifli Effendi Siregar mengatakan, Komisi D sudah banyak menerima pengaduan masyarakat tentang keberadaan

MEDAN (Waspada): Tim Khusus Reskrim Polsek Sunggal menangkap dua orang diduga terlibat kasus penculikan, penyekapan dan penganiayaan terhadap Riski Andika, 21, di lokasi rumah kos Jl. Kemuning, Kel. Tanjungrejo Medan, Rabu (13/6). Kedua tersangka yakni MCA, 21, sesuai Kartu Tanda Penduduk (KTP) penduduk Jl. Besar Delitua, Desa Patumbak I, Kec. Patumbak, Kab. Deliserdang , dan MSM, 20, penduduk Jl. Karya Baru, Kel. Tanjungrejo Medan, kini ditahan di Mapolsek Sunggal. Informasi Waspada peroleh di lapangan, korban Riski yang bekerja sebagai penjaga malam di sekap tersangka di rumah kos sejak Senin malam sampai Rabu (11-13/6) dinihari. Akibat itu, korban yang menderita akibat penganiayaan di lokasi kos tempat kerjanya dibawa ke rumah sakit untuk visum. Menurut informasi, penculikan dan penyerkapan terjadi beberapa hari lalu, di mana teman tersangka MSM minta

Lanjut ke hal A2 kol. 6

Waspada/Sukri Falah Harahap

PERSONIL Polres Kota Padangsidimpuan melakukan olah TKP di dua ruangan kantor KPU yang dibakar, Rabu (13/6).

SNMPTN 2012 Berakhir, 2.911 Peserta Tak Hadir MEDAN (Waspada): Sebanyak 2.911 peserta ujian tulis Seleksi Nasional Masuk Perguruan Tinggi Negeri (SNMPTN) tahun 2012 di Universitas Sumatera Utara (USU) dan Universitas Negeri Medan (Unimed) tidak hadir tanpa alasan jelas. “Tidak hadir tanpa ketera-

ngan jelas, ya secara otomatis nama peserta tersebut didiskualifikasi,” kata Ketua Panitia Lokal (Panlok) USU Prof Zulkifli Nasution melalui Kabag Humas Bisru Hafi dan Ketua Panlok Unimed Prof Khairil Ansari, Rabu (13/6) secara terpisah. Lanjut ke hal A2 kol. 2

Neneng Ditangkap Bukan Menyerah

Lanjut ke hal A2 kol. 3

Wajar Warga Batangtoru Marah

Al Bayan


NENENG Sri Wahyuni dikawal petugas penyidik KPK saat tiba di Gedung KPK) di Jakarta , Rabu (13/6. JAKARTA (Waspada): Buronan Polisi Internasional (Interpol) yang sekaligus tersangka kasus korupsi pengadaan Pembangkit Listrik Tenaga Surya (PLTS) di Kementerian Tenaga Kerja dan Transmigrasi (Kemennakertrans), Neneng Sri Wahyuni tiba di Gedung Komisi Pemberantasan Korupsi (KPK) Rabu (13/6) pukul 17:05. Neneng yang merupakan istri dari terpidana kasusWisma Atlet SEA Games Muhammad Nazaruddin, tiba di Gedung KPK menggunakan kerudung cokelat motif garis merah dan hitam langsung memasuki gedung KPK tanpa memberikan komentar apapun. “Iya benar (ditangkap) di rumahnya di Pejaten,” kata Juru Bicara KPK Johan Budi di Jakarta, Rabu.

Lanjut ke hal A2 kol. 1

Lanjut ke hal A2 kol. 6

Ada-ada Saja

Edarkan Sabu, Pegawai Lapas Ditangkap

Gubernur Houmos Oleh Tgk H Ameer Hamzah DALAM kitab Hilyatul Aulia diceritakan; Khalifah Umar bin Khattab telah mengangkat Said Amir al-Jumahi untuk menjadi gubernur di negeri Houmos. Setiap gubernur mendapat pantauan dari Umar. Apakah gubernurnya berlaku adil atau menganiaya rakyat? Kadang-kadang Umar mengirim utusan rahasia untuk memantau gerak gerik gubernurnya, kadang-kadang ia datang sendiri ke negeri tersebut. Suatu ketika Umar diam-diam datang ke Houmos. Ia menemukan rakyat negeri itu sambil berdialog menanyakan prihal gubernur Said Amir al-Jumahi. Rakyat Houmos melapor kepada Umar sebagai berikut: Pertama, Gubernur tidak pernah keluar bersama kami mengimami shalat jamaah shubuh sampai hari telah menanjak. Kedua, Gubernur tidak pernah menerima tamu (rakyat) di malam hari. Ketiga, ada satu hari dalam sebulan tidak keluar-keluar kepada kami. Keempat Gubernur tak pernah mengantarkan orang mati sampai ke kubur karena sering pingsan. Lanjut ke hal A2 kol. 3

Pantauan Waspada, ruangan yang terbakar milik Ketua KPU, Arbanur Rasyid, dan Divisi Hukum, Ahmad Effendi Nasution. Tampak puing-puing kertas dokumen, kursi plastik, sofa, gorden, kipas angin, printer, komputer, dan kotak plastik berisi berkas yang sudah terba-

Waspada/Dede Basri Hasibuan

SEORANG warga memadamkan api dengan perlengkapan seadanya yang menghaguskan 42 hektare hutan, dan 8 hektar hutan lindung, di kaki gunung Sinabung, Kab. Karo pada Rabu (13/6) pagi.

50 Ha Hutan Di Gunung Sinabung Terbakar NAMAN TERAN (Waspada) : 50 Hektare hutan Gunung Sinabung di Kec. Naman Teran, Kab. Karo, terbakar, Rabu (13/6) pagi. Selain itu, alat deteksi gempa yang dipasang di kaki gung tersebut ikut terbakar. Informasi Waspada peroleh, api diduga dari warga yang membersihkan perladangan milikinya dengan cara membakar kemudianmerambat di empat titik. Dua unit mobil pemadam kebakaran milik Pemkab

Lanjut ke hal A2 kol. 1

MEDAN (Waspada): HMS, pegawai Medis Lembaga Pemasyarakatan Anak Tanjunggusta,Medan ditangkap petugas Direktorat Narkoba Polda Sumut saat mengedarkan sabu di Lapas tersebut, kemarin. Tersangka ditangkap bersama rekannya FS alias Acong dari sebuah warung di depan Lapas Tanjunggusta. Kepala Subdit II Narkoba Poldasu AKBP R Budiman Damanik kepada wartawan, Rabu (13/6) mengatakan, kedua tersangka ditangkap petugas yang melakukan undercover buy (menyamar sebagai pembeli), dan ditemukan barang bukti sabu seberat 40 gram. Dikatakan Damanik, setelah ditangkap, selanjutnya petugas melakukan penggeledahan di rumah kedua tersangka dan menemukan timbangan eletrik kapasitas 5 Kg, alat mengisap sabu dan puluhan lembar plastik

Lanjut ke hal A2 kol. 6

Denda Sumpah Serapah

Waspada/ME Ginting

WAKIL Wali Kota Medan Dzulmi Eldin membawa Sertifikat dan Piala yang diberikan Menteri Perdagangan didampingi Sekda Syaiful Bahri disambut para SKPD di Bandara Polonia Medan, Rabu (13/6).

Medan Kembali Terima Penghargaan MEDAN (Waspada): Pemerintah Kota Medan kembali menerima penghargaan tingkat nasional dari Menteri Perdagangan Gita Wirjawan di Hotel Mercure Jl. Pantai Ancol Jakarta Baycity, Jakarta Utara, Rabu (13/6). Wali Kota Medan Rahudman Harahap diwakili Wakil Wali Kota Dzulmi Eldin setibanya di Bandara Polonia Medan kepada Waspada mengatakan, penghargaan yang diterima adalah atas penilaian kinerja yang baik dalam rangka

Lanjut ke hal A2 kol. 3

ANDA yang selama ini suka mengucap sumpah serapah di depan publik sebaiknya berhati-hati jika melakukannya di Middleborough, Amerika Serikat (AS). Pasalnya, jika mengucapkan kata-kata kotor di depan publik maka mereka diharuskan membayar sejumlah denda. Ide menerapkan aturan ini muncul dalam pertemuan antara warga dan otoritas setempat. Sebagian besar warga yang hadir pada pertemuan itu

Lanjut ke hal A2 kol. 2

Serampang - Panen Award ya - He...he...he...

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) KAMIS, Wage, 14 Juni 2012/24 Rajab 1433 H z zNo: 23895 * Tahun Ke-66

Terbit 24 Halaman (A1-12, B1-12) z zHarga Eceran: Rp 2.500,-


SHERNY Kojongian dikawal petugas kepolisian saat tiba di Bandara Soekarno Hatta, Tangerang, Rabu (13/6).

Buron BLBI Masih 23 Orang Lagi JAKARTA (Antara): Kejaksaan Agung menyatakan saat ini tinggal 23 orang lagi buron kasus Bantuan Likuiditas Bank Indonesia (BLBI) yang belum ditangkap. “Target kita ada 24 orang buron BLBI, sekarang tinggal 23 buron,” kata Wakil Jaksa Agung, Darmono, yang juga Ketua Tim Pemburu Koruptor, di Jakarta, Rabu (13/6). Dari 24 buronan, baru satu orang yakni Sherny Kojongian Saroha berhasil dideportasi dari Amerika Serikat ke Indonesia. Ia menyebutkan, untuk kasus Sherny yang menjadi buron terkait kasus Bank Harapan Sentosa (BHS), pihaknya masih memfokuskan pada pencarian asetnya. “Menyusul adanya sisa kerugian negara pada kasus tersebut yang mencapai Rp1,1 triliun,” katanya. Sherny divonis 20 tahun penjara bersama rekannya di Bank BHS yakni Eko Hadi Putranto, dan Hendra Rahardja yang telah meninggal di lokasi pelariannya di Australia. Sherny melarikan diri ke AS pada 2002, setelah Pengadilan Negeri (PN) Jakarta Pusat menyatakan dirinya bersalah.

Waspada/Ahmad Cerem Meha

BAKAL calon (Balon) Wali kota Padangsidimpuan dari jalur independen, AAH (tengah) memberikan keterangan di ruangan Kapolresta, AKBP Andi S Taufik (Kiri) diapit Kasat Reskrim AKP Anjas Asmara Siregar (kanan) terkait aksi membakar satu ruangan Kantor Komisi Pemilihan Umum (KPU) setempat, Rabu (13/6) sore.

Waspada/Sukri Falah Harahap

Waspada/Sukri Falah Harahap

PERSONIL Polres Kota Padangsidimpuan melakukan olah TKP di dua ruangan kantor KPU yang dibakar oleh salah seorang balon wali kota dari jalur perseorangan karena dinyatakan tidak lolos verifikasi, Rabu (13/6).

POLISI memeriksa barang bukti berupa tas berisi berkas dan botol air mineral yang sebelumnya diisi bensin dan merupakan milik pelaku pembakaran, Rabu (13/6).

Balon Wali Kota P.Sidimpuan Bakar Kantor KPU SNMPTN 2012 Berakhir, 2 Ribu Peserta Tak Hadir MEDAN (Waspada): Sebanyak 2.911 peserta ujian tulis Seleksi Nasional Masuk Perguruan Tinggi Negeri (SNMPTN) tahun 2012 di Universitas Sumatera Utara (USU) dan Universits Negeri Medan (Unimed) tidak hadir tanpa alasan jelas. “Tidak hadir tanpa keterangan jelas, ya secara otomatis nama peserta tersebut didiskualifikasi,” kata Ketua Panitia Lokal (Panlok) USU Prof Zulkifli Nasution melalui Kabag Humas Bisru Hafi dan Ketua Panlok Unimed Prof Khairil Ansari kepada Waspada, Rabu (13/6) secara terpisah. Di USU, menurut Kabag Humas USU Bisru Hafi yang ditemui usai mendampingi Ketua Panlok USU Prof Zulkifli Nasution bersama sejumlah Pembantu Rektor meninjau

pelaksanaan hari kedua ujian SNMPTN di SMAN 4, Perguruan ST. Thomas Medan.Data sementara peserta tidak hadir ujian adalah 2.016 orang dari 35 ribu lebih pendaftar. “Rinciannya, IPA 892 orang, IPS 584 orang, dan IPC 540 orang. Hingga saat ini Panlok belum menerima alasa ketidakhadiran itu, “ tegas Bisru. Menurutnya, pelaksanaan ujian SNMPTN hari kedua berjalan lancar dan tidak ada kecurangan. Ketua Panlok Unimed Prof Khairil Ansari mengatakan jumlah sementara peserta tidak hadir mengikuti ujian tertulis SNMPTN di Unimed adalah 895 (4,68 persen) dari total 19.705. “Kemungkinan bertambah, setelah data hari kedua sudah selesai direkap,

P. SIDIMPUAN (Waspada): Seorang bakal calon wali kota yang dinyatakan tidak memenuhi syarat untuk maju dari jalur perseorangan (independen), Ali Anas Hasibuan, membakar dua ruangan berikut berkasberkas di lantai dua kantor Komisi Pemilihan Umum (KPU) Kota Padangsidimpuan di Jl. Mawar, Kel. Ujung Padang, Kec. Sidimpuan Selatan, Rabu (13/6) siang. Pantauan Waspada, ruangan yang terbakar itu adalah milik Ketua KPU, Arbanur Rasyid, dan Divisi Hukum, Ahmad Effendi Nasution. Tampak puing-puing kertas dokumen, kursi plastik,

sofa, gorden, kipas angin, printer, komputer, dan kotak plastik berisi berkas yang sudah terbakar, berserakan di tempat kejadian perkara. Informasi di lokasi, pelaku pembakaran diduga Ali Anas Hasibuan, 47, warga Jl. Pelaksana, Dusun IV, Desa Bandar Setia, Kec. Percut Seituan, Kab. Deliserdang. Dia seorang bakal calon wali kota dari jalur perseorangan dan hingga kini

tercatat sebagai PNS di Dinas Perkebunan Pemprov. Sumatera Utara. “Tersangka diamankan di Mapolres dan dikenakan Pasal 187 KUH Pidana tentang pembakaran, ancaman hukuman minimal 7 tahun penjara,” kata Kapolres Padangsidimpuan, AKBP Andi Syahriful Taufik SIK.MSi. Lanjut ke hal A2 kol 6

Lanjut ke hal A2 kol 5

Kasus Limbah PT AR

masalah limbah PT AR. Masyarakat protes karena perusahaan akan membuang limbahnya ke Sungai Batangtoru. Satu mobil double cabin dan pipa pembuangan limbah dibakar masyarakat. Zulkifli Effendi Siregar, mengatakan, Komisi D sudah banyak menerima pengaduan masyarakat tentang keberadaan PT AR, termasuk keluhan mereka tentang masalah limbah. Menurut Zulkifli Siregar, wajar kalau rakyat di sana khawatir dengan limbah yang akan dibuang perusahaan ke Sungai Batangtoru. Dari aksi masyarakat, menurut Ketua DPD Partai Hanura Sumut ini, dia yakin Lanjut ke hal A2 kol 3


BURONAN Komisi Pemberantasan Korupsi (KPK) kasus dugaan korupsi pengadaan listrik PLTS tahun 2008, Neneng Sri Wahyuni (kanan) dikawal petugas penyidik KPK saat tiba di Gedung Komisi Pemberantasan korupsi (KPK) di Jakarta , Rabu (13/6).

KPK Agendakan Periksa Hary Tanoe JAKARTA (Antara): Komisi Pemberantasan Korupsi (KPK) mengagendakan pemeriksaan terhadap Chief Executive Officer (CEO) Bhakti Investama Tbk., Hary Tanoesoedibjo, terkait proses penyidikan suap berkaitan dengan restitusi pajak perusahaannya. “Iya, sebagai saksi,” kata juru bicara KPK, Johan Budi,

ketika dikonfirmasi wartawan di Jakarta, Rabu (13/6). Dalam kasus tersebut, KPK telah menetapkan dua tersangka, yakni Kepala Seksi Pengawasan dan Konsultasi Kantor Pelayanan Pajak Pratama Sidoarjo, Jawa Timur, Tommy Hindratno, dan pengusaha James Gunarjo. Pada Rabu (6/6), di sebuah

Al Bayan

rumah makan di kawasan Tebet, Jakarta Selatan, keduanya ditangkap ketika diduga akan melakukan transaksi suap senilai Rp280 juta. Kemudian, pada Jumat petang (8/6), KPK menggeledah kantor Bhakti Investama yang berada di lantai lima gedung MNC Tower, Jalan Kebon Sirih, Jakarta Pusat, dan

Polisi Tahan Pelaku Pemurtadan

Gubernur Houmos

juga rumah James di Jalan Tekukur No. 122 B, Bukit Duri, Tebet, Jakarta Selatan. Sejumlah dokumen terkait restitusi pajak PT Bhakti Investama Tbk telah disita KPK. Menur ut Johan Budi, pihak KPK pada Senin (11/6) juga telah menggeledah Lanjut ke hal A2 kol 5

JAKARTA (Waspada): Buronan Polisi Internasional (Interpol) yang sekaligus tersangka kasus korupsi pengadaan Pembangkit Listrik Tenaga Surya (PLTS) di Kementerian Tenaga Kerja dan Transmigrasi (Kemennakertrans), Neneng Sri Wahyuni tiba di Gedung Komisi Pemberantasan Korupsi (KPK) Rabu (13/6) pukul 17.05 WIB. Neneng yang merupakan istri dari terpidana kasus Wisma Atlet SEA Games Muhammad Nazaruddin, tiba di Gedung KPK menggunakan kerudung cokelat motif garis merah dan hitam langsung memasuki gedung KPK tanpa memberikan komentar apapun. Sebelumnya, KPK telah menangkap tersangka kasus dugaan korupsi proyek pengadaan PLTS di Kementerian Tenaga Kerja dan Trans-

Kroasia Ancaman Italia

JAKARTA (Antara): Ketua MUI Bidang Fatwa, Ma’ruf Amin, berharap silang sengketa terkait pencetakan dan peredaran buku berjudul 5 Kota Paling Berpengaruh di

BANDA ACEH (Waspada): Kepolisian Resort Kota Banda Aceh menetapkan RTK, 24, sebagai tersangka sekaligus menahan yang bersangkutan. RTK yang sempat dihajar massa karena usahanya memurtadkan seorang ibu rumah tangga di Kompleks Buddha Tzui Chi, Gampong Neuheun, Kecamatan Masjid Raya, Aceh Besar, itu dikenakan Pasal 156 a ayat (1) KUHP dengan ancaman hukuman lima tahun. “Yang bersangkutan sudah sejak seminggu lalu ditahan di Mapolres, karena dari hasil penyelidikan dan penyidikan sudah cukup unsur penahanannya,” kata Kapolresta Banda Aceh Kombes Pol Moffan Mudji Kanti, Selasa (12/6).

KROASIA adalah pecahan dari eks Yugoslavia, penduduknya terbilang kecil sekitar 4 juta. Tetapi negeri ini terkenal sebagai sumber pemain-pemain berbakat. Walau Negara kecil, ranking FIFA Kroasia masuk 10 Besar. Setelah mengalahkan Irlandia 3-1, malam nanti Kroasia siap untuk mengancam Italia, yang sebelumnya mampu menahan juara bertahan Spanyol 1-1. Kedua tim berarti sangat menjanjikan. Pertarungan mereka di Grup C juga akan sangat menentukan nasib bagi kedua petarung. Pelatih Kroasia, Slaven Bilic, diperkirakan tetap menampilkan 4-4-2, tetapi dengan taktik mutasi pemain tengah yang terbilang prima sebagaimana layaknya timtim dari kawasan Balkan. Terbukti secara cepat, mereka bisa menggilas pertahanan kuat Irlandia dengan tiga gol. Namun pencetak dua gol Mario Mandzukic dan penyerang Nikica Jelavic, saya kira tidak akan semudah itu melewati benteng catenaccio Italia. Luka Modric sebagai pemain yang mengorganisir penyerangan dan pertahanan

Lanjut ke hal A2 kol 5

Lanjut ke hal A2 kol 3

Lanjut ke hal A2 kol 6

Oleh: H. Ameer Hamzah DALAM kitab Hilyatul Aulia diceritakan; Khalifah Umar bin Khattab telah mengangkat Said Amir al-Jumahi untuk menjadi gubernur di negeri Houmos. Setiap gubernur mendapat pantauan dari Umar. Apakah gubernurnya berlaku adil atau menganiaya rakyat? Kadang-kadang Umar mengirim utusan rahasia untuk memantau gerak gerik gubernurnya, kadang-kadang ia datang sendiri ke negeri tersebut. Suatu ketika Umar diam-diam datang ke Houmos. Lanjut ke hal A2 kol 2

NAMAN TERAN (Waspada): 50 Ha hutan Gunung Sinabung di Kec. Naman Teran, Kab. Karo, terbakar, Rabu (13/6) pagi. Selain itu, alat deteksi gempa yang dipasang di kaki gung tersebut ikut terbakar. Informasi Waspada peroleh, Api diduga dari masyarakat yang membersihkan perladangan milikinya, dan merambat di empat titik. Dua unit mobil pemadam kebakaran milik Pemkab setempat tidak bisa memadamkan kebakaran, mengigat terjalnya medan jalan.Api dapat dipadamkan oleh masyarakat sekitar yang mendaki dengan ke tinggian sekira 8 Km. Kebakaran alat deteksi gempa dan hutan sekitar Gunung Sinabung karena ulah petani yang membersihkan ladang dengan cara membakar ladangnya. Api merambat

ke hutan Gunung Sinabung. Ilalang kering membantu kobaran api tepatnya di Ndokum Tunggal – Bantul, Desa Sukanalu, dan Pengkeh – Cingkem, Desa Simacem, Kec. Naman Teran. Pantauan Waspada di lokasi, kobaran api yang terjadi pukul 09.00 baru dapat dipadamkan sekira pukul 15.30, atas bantuan masyarakat sekitar. “Kami memadamkan api dengan cara seadanya, yaitu dengan pasir. Api padam dengan sendirinya karena sudah tidak ada lagi tumbuhan kering akibat kemarau,’’ kata warga kepada Waspada di lokasi. Pusat Vulkanologi, dan Mitigasi Bencana Geologi (PVMBG) yang bertugas Lanjut ke hal A2 kol 3

Neneng Sudah Di KPK

Wajar Masyarakat Batangtoru Marah M E D A N ( Wa s p a d a ) : DPRD Sumatera Utara mengaku sudah memperkirakan masyarakat Batangtoru akan marah pada perusahaan pertambangan emas PT Agincourt Resources (AR). Dewan juga mengaku sudah memperingatkan perusahaan untuk tidak menganggap sepele masalah limbah yang dihasilkan dari proses penambangan. Wakil Ketua Komisi D DPRD Sumut H.Zulkifli Effendi Siregar dan anggota Komisi D, Marahalim Harahap, berbicara kepada Waspada di gedung dewan, Rabu (13/6). Mereka mengomentari aksi masyarakat enam desa di Kec. Muara Batangtoru, Kab,Tapanuli Selatan (Tapsel) untuk

50 Ha Hutan Sinabung Terbakar, Termasuk Alat Deteksi Gempa


RATUSAN buku 5 Kota Paling Berpengaruh di Dunia karya Douglas Wilson dimusnahkan oleh penerbit Gramedia Pustaka Umum di halaman Bentara Budaya, Komplek Gramedia Pustaka Utama, Jakarta Barat, Rabu (13/6).

MUI: Buku 5 Kota Berpengaruh Nodai Islam

Analisis Sarman Panggabean

migrasi, Neneng Sri Wahyuni. “Iya benar (ditangkap) di rumahnya di Pejaten,” kata Juru Bicara KPK Johan Budi di Jakarta, Rabu. Neneng berstatus buron sejak 20 Agustus 2011 lalu dan sebelum menjadi tersangka kasus dugaan korupsi PLTS, dia dan Nazaruddin diduga menerima Rp2,2 miliar dari proyek tersebut. KPK sebelumnya mengatakan telah mengetahui keberadaan Neneng, dan penangkapan menunggu Interpol karena di luar negeri. Bukan Menyerahkan Diri Komisi Pemberantasan Korupsi menegaskan Neneng Sri Wahyuni tidak menyerahkan diri. KPK menangkap istri terdakwa suap wisma atlet Muhammad Nazaruddin itu di rumahnya. Lanjut ke hal A2 kol 2

Ada-ada Saja

Denda Sumpah Serapah

ANDA yang selama ini suka mengucap sumpah serapah di depan publik sebaiknya berhati-hati jika melakukannya di Middleborough, Amerika Serikat (AS). Pasalnya, jika mengucapkan kata-kata kotor di depan publik maka mereka Lanjut ke hal A2 kol 1

Serampang - Mungkin stres karena kalah taruhan bola - He.... he....he....

Berita Utama

A2 Citra Demokrat Terus Merosot JAKARTA (Antara): Ketua Forum Komunikasi Pendiri dan Deklarator Partai Demokr a t Ve n c e R u m a n g k a n g mengatakan citra Partai Demokrat semakin hari semakin menurun. Menurut salah seorang pendiri Partai Demokrat itu, penurunan itu dikarenakan kasus dugaan korupsi yang melibatkan politisi Partai Demokrat. “Kami jelas tersandera dengan kasus korupsi yang mendera partai. Ego beberapa anggota partai harus disingkirkan, partai harus diselamatkan bukan hanya dua atau tiga orang saja,” kata Vence di Jakarta, Rabu (13/6). “Karena itulah, Partai Demokrat harus diselamatkan sehingga tidak terus merosot di publik,” katanya dia. Menurut Vence, visi dan misi Partai Demokrat sekarang sudah menyimpang jauh dari cita-cita para pendiri. “Partai Demokrat ini jangan hanya eksis sampai 2014 tapi harus bisa berlanjut dalam setiap pemilu,” tegasnya. Sementara itu, Wakil Ketua Dewan Pembina Partai Demokrat Marzuki Alie menyatakan pertemuan antara Ketua Dewan Pembina Partai Demokrat Susilo Bambang Yudhoyono dengan Dewan

Pimpinan Daerah (DPD) PD semalam tidak mengundang Ketua Umum DPP PD, Anas Ur b a n i n g r u m d a n j u g a anggota Dewan Pembina PD. “Kemarin Pak SBY sudah berkomunikasi dengan saya, teman-teman DPP dan Anggota Dewan Pembina memang tidak diikutkan,” kata Marzuki kepada wartawan di DPR, Jakarta, Rabu (13/6). Dalam pertemuan semalan di Cikeas itu, Ketua Dewan Pembina meminta masukan sekaligus mendengarkan keluhan dari DPD-DPD terhadap isu-isu yang akhir-akhir ini melanda Partai Demokrat. “Pak SBY meminta pandangan dan keluh kesah yang dirasakan DPD untuk merespon kondisi sekarang ini yang dihadapi partai,” tambahnya. Ketika ditanya alasan tidak diundangnya Ketua Umum DPP PD dan anggota Dewan Pembina PD, Marzuki menyatakan, hal itu bertujuan agar semua DPD berani dan terbuka, tidak canggung dalam mengungkapkan aspirasinya. “Ya DPD supaya berani ngomong apa yang sebenarnya terjadi. Kalau ada DPP dan anggota dewan pembina kan ada rasa sungkan, kalau gak ada kan bisa lepas dan tak canggung dalam mengajukan usul,” pungkasnya.

Satu WNI Di Syria Selamat JAKARTA (Antara): Kementerian Luar Negeri (Kemlu) memastikan satu warga negara Indonesia (WNI) di Syria atas nama Aminah binti Osid, yang sebelumnya dikabarkan tewas, ternyata dalam keadaan selamat dan masih berada di Syria. “Kedutaan Besar Republik Indonesia (KBRI) di Damaskus, Rabu, telah berhasil menghubungi Aminah dan yang bersangkutan dalam keadaan baik dan sehat,” kata Menlu Marty Natalegawa dalam pernyataan pers , Rabu (13/6) sore. Menlu Marty mengatakan Aminah masih ingin bekerja dengan majikannya, Muhammad Badar Kadam, di Syria. Sebelumnya, sejumlah media nasional mengabarkan ada dua WNI yang tewas akibat kekerasan di Syria. Kedua orang itu bernama Aminah binti Osid, asal Sukabumi, dan Ani, asal Cianjur. Sri Dewi, TKI asal Tange-

rang yang masih berada di Syria mengaku kedua rekannya itu tewas akibat pemberontakan di Syria. Menurut Sri, Aminah tewas tertembak dan Ani tewas terkena ledakan bom. Sri mengaku menelepon kedua rekannya itu dua hari sebelum tewas dan setelahnya tidak ada kabar kejelasan lagi. Terkait beredarnya informasi tersebut, Kemlu menghargai perhatian masyarakat terhadap kondisi para WNI yang masih berada di Syria. Kemlu juga mengimbau semua pihak yang memiliki informasi terkait kondisi WNI di Syira untuk memverifikasi kepada Kemlu dan KBRI di Damaskus. Sesuai data yang didapat dari KBRI Damaskus, kata Marty, selama tahun 2012 ada lima WNI yang meninggal di Suriah namun penyebab kematian kelima orang tersebut bukan karena kekerasan, melainkan karena sakit dan kecelakaan kerja.

Ada-ada Saja ....

USD20 atau sekira Rp188 ribu. Otoritas setempat mengatakan aturan itu tidak dimaksudkan untuk menyensor percakapan sehari-hari. Namun untuk mencegah penggunaan bahasa yang tidak layak diucapkan oleh kalangan remaja. “Sa y a s a n g a t s e n a n g dengan adanya peraturan itu. Namun, Saya tahu ada beberapa yang tidak setuju. Hanya saja kita perlu melakukannya,” ujar seorang anggota dewan kota yang bertugas mempercantik tempat itu, Mimi DuPhilly seperti dikutip Associated Press, Selasa (12/6). Seperti yang dikatakan Duphily, sejumlah kalangan tidak setuju dengan aturan baru itu karena dinilai bertentangan dengan hukum yang sudah ada. (ok/rzl)

diharuskan membayar sejumlah denda. Ide menerapkan aturan ini muncul dalam pertemuan antara warga dan otoritas setempat. Sebagian besar warga yang hadir pada pertemuan itu menyatakan setuju untuk memberikan denda senilai

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. f6, Mf5 (mencegah Mh7+). 2. Me8+, Rh7. 3. GxM+, Rh6. 4. Mf8+mat atau Mh8+mat (Jika 3. Mxf7+, Rh6 atau Rh8. 4. Mg7+mat, Jangan 2. MxM karena 2. ..., Rf8, Hitam tidak mati empat langkah).

Jawaban TTS: TTS Topik

Olahraga Euro 2012

Neneng Sudah ....

“KPK menangkap Neneng di Pejaten,” kata Wakil Ketua KPK, Bambang Widjojanto, Rabu. Sebelumnya, pengacara Neneng, Junimart Girsang menyatakan kliennya itu tidak ditangkap. “Ini seperti permintaan kami dulu, kami siap koordinasi dengan KPK dan siap membantu,” kata Junimart. Informasi yang dikumpulkan, KPK sudah mengikuti Neneng yang sempat mendarat

Al Bayan ....

Jawaban Sudoku: 5 3 4 1 6 7 2 8 9

7 8 2 3 9 4 6 1 5

1 6 9 8 2 5 3 7 4

2 5 6 7 4 1 8 9 3

4 1 8 9 3 2 5 6 7

3 9 7 6 5 8 1 4 2

6 7 5 2 1 9 4 3 8

9 2 1 4 8 3 7 5 6

8 4 3 5 7 6 9 2 1

Ia menemukan rakyat negeri itu sambil berdialog menanyakan prihal gubernur Said Amir al-Jumahi. Rakyat Houmos melapor kepada Umar sebagai berikut: Pertama, Gubernur tidak pernah keluar bersama kami mengimami shalat jamaah shubuh sampai hari telah menanjak. Kedua, Gubernur tidak pernah menerima tamu (rakyat) di malam hari. Ketiga, ada satu hari dalam sebulan tidak keluarkeluar kepada kami. Keempat Gubernur tak pernah mengantarkan orang mati sampai ke kubur karena sering pingsan. Kem ud i a n Uma r me manggil Gubernur Al-Jumahi untuk mempertanggungjawabkan tingkahnya di depan rakyat. Sang Gubernur pun menjelaskan ke empat-empat masalah tersebut dengan

WASPADA Kamis 14 Juni 2012

PBNU: Hukum Mati Koruptor

Waspada/Dede Basri Hasibuan

SALAH satu warga tanpak memadamkan api, dengan perlengkapan seadanya dengan tanah, yang menghanguskan 42 hektare hutan, dan 8 hektare hutan lindung, tepatnya di kaki gunung Sinabung, Kab. Karo, Rabu (13/6) pagi.

50 Ha Hutan ....

yang diakibatkan gempa gunung. Sementara Seismik untuk perekam gempa. GPRS di Gunung Sinabung ada tiga titik, dipasang Maret 2011. Sementara untuk Seismik, ada empat titik, dibangun Agustus 2010,” terang staf PVMBG, Cahaya kepada Waspada. Meski mengalami kerusakan akibat kebakaran tersebut, sambung Cahaya, GPRS, dan

Wajar Masyarakat ....

perusahaan menggunakan zat sianida dan mercuri untuk memisahkan antara batuan dan emas. Dengan begitu dipastikan, zat yang dipakai adalah berbahaya dan beracun. Karenanya dibutuhkan cara khusus untuk menangani limbahnya. Dari pemaparan perusahaan, katanya, mereka menyebutkan akan menampung limbah dalam satu waduk. Tapi, lokasi yang dijadikan sebagai tempat penampungan tempatnya di atas bukit. Kata Marahalim, itu juga sangat beresiko. Tidak ada yang dapat menjamin waduk itu tidak jebol. Kalau itu yang terjadi, limbah akan tumpah ke perkampungan. Sama seper ti Zulkifli Effendi Siregar, Marahalim Harahap, menyebutkan masyarakat tidak berharap kehadiran perusahaan yang membuat sengsara masyarakat. Terlebih hasil yang diperoleh pemerintah Indonesia dari eksploitasi ini sangat kecil. Yakni hanya 5 persen. ‘’Bayangkan Rp7 triliun setiap tahun hasil tambang Batangtoru disedot, Indonesia hanya kebagian 5 persen. Itupun akibatnya harus diterima masyarakat. Sangat tidak adil,’’ kata Marahalim Harahap. (m12)

mengawas, dan meneteksi gempa Gunung Sinabung mengatakan, akibat terbakarnya perladangan masyarakat setempat, GPRS, dan Seismik mengalami kerusakan, sementara untuk Solar Panel, dan Receivers tidak rusak. “GPRS untuk mendeteksi gempa, berfungsi terhadap pergerakan atau pergeseran PT AR benar-benar akan membuang limbahnya ke sungai. ‘’Kalau tidak masyarakat tidak akan semarah itu,’’ kata Zulkifli Siregar dan menambahkan, dapat dipastikan limbah sisa pengolahan emas terdiri dari Bahan Berbahaya Beracun (BBB). Dia menjelaskan harusnya kehadiran perusahaan mensejahterakan masyarakat sekitar tambang. Jangan kemudian kehadirannya malah membuat masyarakat sengsara. Salahi kontrak Sementara itu, anggota Komisi D lainnya, Marahalim Harahap, menilai dengan melakukan pembuangan limbah ke sungai, PT AR telah menyalahi kontrak karya perusahaan dengan pemerintah Indonesia. Me n u r u t M ar a h a l i m Harahap, dalam kontrak karya jelas disebutkan perusahaan harus mempertimbangkan dampak lingkungan dengan melakukan studi kelayakan. Yakni yang menyangkut pencemaran sungai maupun limbah buangan. Saat melakukan kunjungan ke lapangan beberapa waktu lalu, Komisi D mendapat penjelasan bahwa

Polisi Tahan ....

Dalam pemeriksaan kepolisian, kata Kapolresta, meski percobaan pemurtadan yang dilakukan RTK dan temannya RM (seorang perempuan) keburu diketahui warga, namun di Kecamatan Ingin Jaya yang bersangkutan telah membaptis seorang warga. “Kasus ini tidak ditangani Mahkamah Syariah karena pelakunya beragama nonmuslim. Jadi, yang bersangkutan diproses sesuai hukum nasional,” kata Kombes Pol Moffan. Dijelaskan, keberhasilan polisi mengungkap kasus ini, selain adanya laporan masya-

rakat, juga berkat pengembangan dari seorang warga yang telah dibaptis oleh RTK di rumah kontrakannya sebulan sebelum upaya pembaptisan terhadap RTK. “Setelah di-BAP (Berita Acara Pemeriksaan) nanti, kasus tersebut segera kita limpahkan ke kejaksaan untuk diajukan ke pengadilan,” jelasnya lagi. Selain RTK, penduduk Kecamatan Kuta Alam, Banda Aceh, aparat Polresta juga menahan RM, 32, warga Gampong Tanjong, Kecamatan Ingin Jaya, Aceh Besar, yang juga menjalankan misi yang sama dengan RTK. (b05)

di Batam dari Kuala Lumpur, Malaysia. Dari Batam, Neneng kemudian menuju Bandara Soekarno Hatta, Cengkareng. Dari bandara, tim KPK terus membuntuti Neneng yang akhirnya ditangkap di rumahnya di Pejaten. Neneng adalah tersangka kasus korupsi proyek PLTS di Kementerian Tenaga Kerja dan Transmigrasi tahun 2008. Neneng dinilai melanggar ketentuan dalam Pasal 2 ayat (1) UU Peberantasan Tindak

Pidana Korupsi. Neneng pergi ke luar negeri bersama dengan suaminya, Muhammad Nazaruddin, sejak 23 Mei 2011. Dan sejak saat itu, Neneng tidak kembali ke Indonesia. Bahkan saat Nazaruddin ditangkap di Kolombia, Neneng tidak terlihat. Nazar kemudian menjadi buronan interpol. Nazaruddin sempat melayangkan surat kepada Presiden SBY agar istrinya tidak ‘disentuh’. (ant/j02)

tenang. “Pertama, saya tidak keluar menjadi imam shalat shubuh karena saya tidak punya khadam untuk keluarga. Saya sendiri yang membuat adonan roti, kemudian saya duduk menunggu sampai timbul maragi (fermantasi), kemudian saya bakar roti itu sampai masak. Kedua, saya tidak menerima tamu di malam hari karena, saya telah menghabiskan siang untuk mereka (rakyat) dan malam saya gunakan untuk Allah (beribadah). Ketiga, saya tidak keluar satu hari dalam sebulan karena saya tidak punya khadam untuk mencuci pakaianku, dan akupun tidak punya pakaian selain yang saya pakai. Hari itu saya gunakan untuk mencuci pakaian dan menggosoknya. Bila sudah kering di sore hari, langsung saya keluar menemui rakyat di

masjid. Keempat, saya tidak mampu menyaksikan orang mati karena demi Allah aku telah menyaksikan peristiwa penyiksaan terhadap Khabib al-Anshari di Mekkah. Khabib dibanting dan dicencang oleh orang Musyrikin Quraisy, kemudian diusungnya di atas pelepah kurma, mereka berkata: Apakah kamu senang wahai Khabib, Muhammad berada seperti posisimu sekarang? Khabib menjawab, Demi Allah, aku dalam keluargaku dan anak-anakku tidak merasa senang kalau Muhammad SAW tertusuk satu duripun. Kemudian Khabib dibunuh. Mengingat kematian Khabib saya tidak bisa melihat orang mati. Lalu Umar memaafkan gubernurnya serta memberi hadiah 1.000 dinar untuk dipergunakan kepada kepentingan urusannya.

Seismik yang lain tetap berfungsi, meski satu diantara alat deteksi gunung berapi mengalami kerusakan. Secepatnya kita akan memperbaiki GPRS, yang selama ini bekerjasama dengan Jepang. Kepala Kesbang, Pol dan Linmas, Drs Suang Karo – karo, didampinggi Kadis Kehutanan, Drs Sucipto, Camat Naman Teran, Terang Ukur br Surbakti, dan Kapolsek Simpang Empat, AKP Kandar yang terjun ke lokasi mengatakan, menyesalkan kejadian tersebut. Kadis Kehutanan mengatakan, 50 Ha hutan, 8 Ha hutan lindung ikut terbakar. Sementara Kapolsek Simpang Empat mengatakan, kebakaran ini masih dalam tahap penyelidikan. (c19)


tegasnya dan menambahkan, mereka yang tidak hadir tanpa keterangan jelas, dipastikan gugur Prof Khairil Ansari menjawab Waspada disel-sela meninjau pelaksanaan ujian terakhir di Unimed, UMSU, dan IAIN, Rabu (1/6) mengatakan, sejauh ini peserta absen tidak memberikan keterangan jelas. Jumlah total tidak hadir total 895 orang dengan rincian 297 peserta IPA, 317 IPS, dan 281 IPC. Prof Khairil mengatakan, pelaksanaan ujian tertulis SNMPTN pada hari terakhir di Unimed, juga berjalan lancar dan tidak diwarnai kecurangan. Materi ujian yang diujikan pada hari kedua adalah IPA dan IPS. ‘’Hari ini (14/6) berkas jawaban hasil SNMPTN diterbangkan ke Pantia Pusat di Jakarta melalui cargo lewat jalur udara,” tegas Prof Khairil. Sedangkan lima orang peserta ujian tertulis SNMPTN Unimed penyandang tuna netra diberikan perhatian khusus. Kelima mahasiswa tersebut Roma Siska T ujian, Timson Aritonang, Ririn Sianipar, Tetty Uli Resti ,dan Landes Soaloon. (m49)

KPK Agendakan ....

rumah Tomy dan kantor pajak di Sidoarjo, Jawa Timur. Dia juga membenarkan bahwa penyidik KPK meminta agar Komisaris Independen PT Bhakti Investama, Antonius Tonbeng, dan seseorang lagi bernama Hendy Anuranto, dicegah ke luar negeri. “Terkait penyidikan dugaan pemberian dan penerimaan uang oleh pegawai pajak TH dari Wajib Pajak JGD sejak tanggal 8 Juni 2012 sampai enam bulan ke depan,” demikian Johan.

MUI: Buku ....

Dunia, yang dianggap menodai kesucian Nabi Muhammad SAW, dapat segera selesai. “Tidak ada kegaduhan lagi, kita harapkan,” katanya, seusai pembakaran 216 eksemplar buku tersebut di halaman Komplek Kompas Gramedia, di Jakarta, kemarin. Buku terjemahan 5 Kota Paling Berpengaruh di Dunia karya Douglas Wilson, seorang rohaniwan di Idaho, Amer ika Serikat. Ia menyatakan ada tiga hal yang diminta, yaitu menarik buku dari peredaran, dimusnahkan, dan minta maaf kepada masyarakat. “Sudah dilakukan Gramedia, ketiga-tiganya. Kami minta pihak Gramedia mengambil langkah dan direspons. Responnya cepat,” katanya. Buku terjemahan 5 Kota Paling Berpengaruh di Dunia menuai protes dari masyarakat karena dianggap menodai agama Islam. Buku itu sudah ditarik dari peredaran dan dimusnahkan di beberapa kota, antara lain Surabaya, Pekanbaru, dan Jakarta.

LEBAK (Antara): Rais Syuriah Pengurus Besar Nahdlatul Ulama (PBNU) KH Masdar Farid Mas‘udi mengatakan, pelaku korupsi yang merugikan uang negara dan menyengsarakan rakyat harus dihukum mati. “Undang-undang kita dibenarkan pelaku korupsi dihukum mati untuk rasa keadilan jika mereka keterlaluan,” kata Masdar usai meletakan batu pertama di Kampus Nahdlatul Ulama Desa Aweh Kecamatan Kalanganyar, Kabupaten Lebak, Rabu (13/6). Menurut dia, pihaknya sangat mendukung hukuman mati bagi kejahatan korupsi tanpa pandang bulu dengan idealisme Indonesia yang makmur dan adil bagi semua rakyat. Saat ini, korupsi sudah menggurita dan terjadi di mana-mana dengan melibat-

kan pejabat negara, kepala daerah, wakil rakyat, dan politisi. Bahkan, hasil survei Soegeng Sarjadi Syndicate (SSS) yang menyatakan DPR adalah lembaga terkorup di negeri ini. “Kami sebagai masyarakat sipil mendorong pemerintah agar pelaku korupsi dihukum mati untuk memberikan efek jera,” katanya. Menurut dia, aparat penegak hukum harus bekerja keras untuk membongkar dan mencegah kasus korupsi hingga menyeret pelaku ke Pengadilan tanpa pandang bulu. Selama ini, penegakan hukuman di Tanah Air tidak konsisten sehingga pemberantasan korupsi belum maksimal. Meskipun, kata dia, kita sudah memiliki UU tentang Pemberantasan Tindak Pidana

Korupsi (Tipikor) dan telah dibentuk Komisi Pemberantasan Korupsi (KPK). “Semestinya, kita komitmen untuk melaksanakan UU tentang tipikor yang sudah dibuat dan harus dilaksanakan,” ujarnya. Ia juga menjelaskan, penyebab merebaknya kasus korupsi karena penegakan hukum belum maksimal, meskipun sudah terbentuk lembaga KPK. Selain itu juga mereka lemahnya keimanan kepada Allah SWT, sehingga mereka hanya mengejar kekayaan dengan cara melanggar hukum negara dan agama. “Agama Islam melarang keras perbuatan korupsi karena disamakan dengan kejahatan membunuh. Dalam hukum Islam pembunuh itu harus dibunuh atau lebih dikenal qisas,” ujarnya.

Balon Wali Kota ....

ruangan itu terkunci dari dalam dan kepulan asap mulai keluar dari ventilasi di atas pintu ruangan. Sesaat kemudian pintu terbuka dan keluarlah Ali Anas dari dalam sambil menyiramkan bensin yang dikemasnya dalam bekas botol air mineral ukuran 1,5 liter dan 0,10 liter. “Sambil menyiram-nyiramkan bensin, dia menyuruh kami semua yang ada di lantai dua untuk turun ke bawah. Saya tidak mau dan berusaha menghalanginya, tapi kobaran api sudah berhasil dinyalakannya di ruangan saya dan Divisi Hukum,” kisah Arbanur. Usai melakukan aksinya, pelaku turun ke bawah dan hendak pulang, tapi dihalanghalangi Ketua KPU bersama anggota dan pegawai. Begitu di teras depan kantor KPU, tiba-tiba personil Polres Padangsidimpuan dipimpin Kabag Ops, Kompol Edison Sitepu, sudah berada di pintu gerbang dan mengamankan Ali Anas. Diduga aksi anarki itu akibat pelaku tidak terima karena KPU menyatakannya tidak lolos verifikasi administrasi untuk mancalon wali kota dari jalur perseorangan. ‘’B esar kemungkinan itulah yang menjadi penyebab utamanya,’’ kata Arbanur Rasyid. “Sebelum ini ada enam pasangan balon kepala daerah dari jalur perseorangan yang

sudah menyerahkan berkas dukungan ke KPU. Setelah dilakukan verifikasi administrasi, dua pasangan dinyatakan tidak lolos, Ali Anas Hasibuan/Alfian Sontang Siregar, dan dr.Sori Monang Harahap SpB/Kompol Chairul Muklis SH,” jelasnya. Kepada Waspada, Arbanur Rasyid mengaku tidak menyangka hal ini bisa terjadi. Pasalnya, sebelum kejadian, dia masih sempat berbincang dengan Alfian Sontang Siregar yang merupakan balon wakil wali kota pasangan Ali Anas Hasibuan. Mereka membincangkan tentang tidak lolosnya pasangan itu karena baru menyerahkan 8.000 copy KTP, sementara syarat untuk jalur perseorangan minimal harus 14.798 copy KTP. Saat itu mereka minta perpanjangan waktu untuk mencukupi, tapi ditolak KPU karena tahapan sudah berakhir Minggu (10/6) pukul 00:00 kemarin. Sedangkan Sekretaris Daerah Pemko Padangsidimpuan, Sarmadhan Hasibuan, yang b a r u t i b a d i l o k a s i mengatakan, bersama Kapolres akan segera menghadap Wali Kota, Zulkarnaen Nasution untuk melaporkan kejadian itu.Dia meminta Wali Kota agar mengizinkan KPU berkantor kembali di kantor lama di samping kantor wali kota. (a27/c13)

Kroasia ....

hanya saja wibawa pasukan Cesare Prandelli masih lebih tinggi. Pengalaman yang dimiliki pemain-pemain kunci Italia, seperti Andrea Pirlo, Daniel de Rossi, dan Cassano, tetap merupakan ancaman kepada pertahanan Kroasia. Dengan wibawa lebih besar, Azzurri akan lebih banyak bermain terbuka. Mereka bakal lebih nekad, sebab secara taktis Kroasia tidaklah seperti Spanyol yang begitu menakutkan. Bagaimanapun, Kroasia bagi Italia bukan seseram menghadapi serangan sejenis ala Spanyol. Azzurri bisa bermain lebih terbuka dan lebih agresif, tapi Prandelli harus berhitung untuk memainkan Balotelli sejak awal bersama Di Natale. Dengan dua ujung tombak lebih besar, kemungkinan mencetak gol lebih banyak. Mengingat kepentingan besar untuk lolos dari penyisihan Grup C, baik Kroasia mau-

pun Italia berusaha untuk menang. Kroasia kini lebih beruntung dengan poin tiga setelah mengalahkan Irlandia, sehingga bermain seri saja sudah strategi tersendiri. Sebaliknya, Italia harus menyerang dan ngotot menang, sehingga pertarungan terasa akan sangat menegangkan bagi mereka. Siapakah yang memenangkan duel lapangan tengah, Modric atau Pirlo? Itu yang paling penting, karena pertarungan akan dimulai dari penguasaan barisan tengah. Italia dipaksa lebih terbuka, karena tuntutan harus menang dan dengan demikian harus pula bermain lebih agresif, lebih berani menyerang. Kita sangat gregetan, karena jarang sekali bisa menyaksikan Italia main dengan terbuka, agresif serta mengandalkan serangan beruntun. Itu yang bakal terjadi, karena sekali lagi mereka mesti menang. *****

Menurut Kapolres, pihaknya tidak kecolongan dalam kejadian ini. Jauh hari sebelum ini dia selalu melakukan pengamanan terbuka dan tertutup di KPU. Hanya saja tidak ada yang menyangka kalau pelaku pembakaran itu justru seorang bakal calon wali kota. Pantauan Waspada, tangga menuju lantai dua kantar KPU yang terbakar itu telah dipasangi garis polisi. Dari lokasi polisi mengamankan barang bukti berupa sebuah tas milik pelaku berisi berkas dan bekas botol air mineral yang sebelumnya diisi bensin dan sejumlah benda yang terbakar. Sementara Ketua KPU Kota Padangsidimpuan, Arbanur Rasyid, menuturkan, saat kejadian , dia dan tiga anggota KPU lainnya sedang rapat di ruangan Divisi Hukum. Tiba-tiba terdengar suara hentakan pintu dari ruangannya yang berada di depan tempat rapat digelar. “Awalnya saya pikir pintu kamar saya terhentak akibat tiupan angin. Namun angota KPU yang mengikuti rapat, Mohot Lubis, Muzakkir Khotib, dan Ahmad Effendi Nasution, mengatakan dari kerasnya hentakan pintu, itu bukan karena angin. Merekapun meminta saya untuk memeriksanya,” kata Arbanur Rasyid. Setelah diperiksa, ternyata pasukan Kroasia, malam nanti kembali akan membuktikan sebagai pemain kunci. Kepada Modric, pemainpemain Italia harus super hatihati. Modric termasuk luar biasa dalam menciptakan ruang, dia kunci produktivitas Hrvatska ketika menyarangkan tiga gol ke gawang Si Bocah Hijau. Sebaliknya, Gli Azzurri dalam posisi sangat sulit untuk mencetak gol. Satu-satunya gol Italia ke gawang Spanyol, diciptakan Antonio Di Natale, penyerang cadangan yang masuk di babak kedua menggantikan bomber bengal Mario Balotelli. Kita ramalkan untuk mengamankan peluang menuju babak kedua, Kroasia akan tetap memainkan pola lebih berat, mengincar penguasaan garis tengah dan pada saatsaat tertentu menciptakan peluang. Tipe permainan Kroasia seperti ini adalah ciri khas strategi Slaven Bilic. Italia juga seperti itu,

Berita Utama


SBY Minta Kader Demokrat Terlibat Korupsi Mundur JAKARTA (Antara): Presiden Susilo Bambang Yudhoyono (SBY) selaku Ketua Dewan Pembina Partai Demokrat meminta kader partai tersebut yang terlibat kasus korupsi agar mundur secara sportif. “Daripada memalukan seluruh kader di kemudian hari, lebih baik mundur saat ini juga. Tinggalkan partai ini,” kata Susilo Bambang BambangYudhoyono ketika memberikan sambutan pada acara “Silaturrahim Para Tokoh Pendiri dan Deklarator Partai Demokrat”, di Jakarta, Rabu ( 13/6) malam. Acara tersebut dihadiri para pendiri dan deklarator, dewan pembina,dewanpimpinanpusat

(DPP), serta para ketua dewan pimpinan daerah (DPD) Partai DemokratdariSeluruhIndonesia. Sedangkan Ketua Umum dan Sekretaris Jenderal DPP Partai Demokrat yakni Anas Urbaningrum dan Edhie BaskoroYudhoyono tidak hadir. PresidenYudhoyono mengakui, Partai Demokrat saat ini masih sering diserang sehingga popularitas dan elektabilitasnya terus menurun. Hal ini, kata dia, ada sebagian kecil kader Partai Demokrat yang melakukan perbuatan tidak terpuji. “Ini sangat melukai hati kita semua,” katanya. Presiden Yudhoyono juga mengingatkan, seluruh kader

50 Ha Hutan ...

bakarnya perladangan masyarakat setempat, GPRS, dan Seismik mengalami kerusakan, sementara untuk Solar Panel, dan Receivers tidak rusak. “GPRS untuk mendeteksi gempa, berfungsi terhadap pergerakan atau pergeseran yang diakibatkan gempa gunung. GPRS di Gunung Sinabung ada tiga titik, dipasang Maret 2011. Sementara untuk Seismik, ada empat titik, dibangun Agustus 2010,” terang staf PVMBG, Cahaya kepada Waspada. Kepala Kesbang, Pol dan Linmas, Drs Suang Karo – karo, didampinggi Kadis Kehutanan, Drs Sucipto, Camat Naman Teran, Terang Ukur br Surbakti, dan Kapolsek Simpang Empat, AKP Kandar yang terjun ke lokasi mengatakan, menyesalkan kejadian tersebut. Kadis Kehutanan mengatakan, 50 Ha hutan, 8 Ha hutan lindung ikut terbakar. Sementara Kapolsek Simpang Empat mengatakan, kebakaran ini masih dalam tahap penyelidikan. (c19)

setempat tidak bisa memadamkan kebakaran, mengigat terjalnya medan jalan. Ilalang kering membantu kobaran api tepatnya di Ndokum Tunggal – Bantul, Desa Sukanalu, dan Pengkeh – Cingkem, Desa Simacem, Kec. Naman Teran. Api dapat dipadamkan oleh masyarakat sekitar yang mendaki dengan ke tinggian sekira 8 Km. Pantauan Waspada di lokasi, kobaran api yang terjadi pukul 09:00 baru dapat dipadamkan sekira pukul 15:30, atas bantuan masyarakat sekitar. “Kami memadamkan api dengan cara seadanya, yaitu dengan pasir.Api padam dengan sendirinya karena sudah tidak ada lagi tumbuhan kering akibat kemarau,’’ kata warga kepada Waspada di lokasi. PusatVulkanologi, dan Mitigasi Bencana Geologi (PVMBG) yang bertugas mengawas, dan meneteksi gempa Gunung Sinabung mengatakan, akibat ter-

Neneng Ditangkap ... KPKmenegaskan Neneng SriWahyuni tidak menyerahkan diri. KPK menangkap istri terdakwa suap wisma atlet Muhammad Nazaruddin itu di rumahnya. “KPK menangkap Neneng di Pejaten,” kataWakil Ketua KPK, Bambang Widjojanto, Rabu. Sebelumnya, pengacara Neneng, Junimart Girsang menyatakan kliennya itu tidak ditangkap. “Ini seperti permintaan kami dulu, kami siap koordinasi dengan KPK dan siap membantu,” kata Junimart. Informasi yang dikumpulkan, KPK sudah mengikuti Neneng yang sempat mendarat di Batam dari Kuala Lumpur, Malaysia. Dari Batam, Neneng kemudianmenujuBandaraSoekarno Hatta, Cengkareng. Dari bandara, tim KPK terus membuntuti Neneng yang akhirnya ditangkap di rumahnya di Pejaten. Neneng adalah tersangka kasus korupsi proyek PLTS di Kementerian Tenaga Kerja dan Transmigrasi tahun 2008. Neneng dinilai melanggar ketentuan dalam Pasal 2 ayat (1) UU Peberantasan Tindak Pidana Korupsi. Neneng pergi ke luar negeri bersama dengan suaminya, Muhammad Nazaruddin, sejak

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. f6, Mf5 (mencegah Mh7+). 2. Me8+, Rh7. 3. GxM+, Rh6. 4. Mf8+mat atau Mh8+mat (Jika 3. Mxf7+, Rh6 atau Rh8. 4. Mg7+mat, Jangan 2. MxM karena 2. ..., Rf8, Hitam tidak mati empat langkah).

Jawaban TTS: TTS Topik

Olahraga Euro 2012

23 Mei 2011. Dan sejak saat itu, Neneng tidak kembali ke Indonesia. Bahkan saat Nazaruddin ditangkap di Kolombia, Neneng tidak terlihat. Nazar kemudian menjadi buronan interpol. Tangkap 2 WN Malaysia Tim penyidik Komisi Pemberantasan Korupsi tidak hanya menangkap buronan korupsi Neneng Sri Wahyuni. Penyidik juga mengamankan 2 warga negara Malaysia. “Diduga ikut membantu pelarian Neneng,” kata Juru Bicara KPK, Johan Budi. (ant/j02)

SNMPTN 2012 ... Di USU, menurut Kabag Humas USU Bisru Hafi yang ditemui usai mendampingi Ketua Panlok USU Prof Zulkifli Nasution bersama sejumlah Pembantu Rektor meninjau pelaksanaan hari kedua ujian SNMPTN di SMAN 4, Perguruan ST. Thomas Medan, data sementara peserta tidak hadir ujian adalah 2.016 orang dari 35 ribu lebih pendaftar. “Rinciannya, IPA 892 orang, IPS 584 orang, dan IPC 540 orang. Hingga saat ini Panlok belum menerima alasan ketikdahadiran itu, “ tegas Bisru. Menurutnya, pelaksanaan ujian SNMPTN hari kedua berjalan lancar dan tidak ada kecurangan. Ketua Panlok Unimed Prof Khairil Ansari mengatakan jumlah sementara peserta tidak hadir mengikuti ujian tertulis SNMPTN di Unimed adalah 895 (4,68 persen) dari total 19.705. “Kemungkinan bertambah, setelah data hari kedua sudah selesai direkap, “ tegasnya dan menambahkan, mereka yang tidak hadir tanpa keterangan jelas, dipastikan gugur Prof Khairil Ansari menjawab Waspada disela-sela meninjau pelaksanaan ujian terakhir di Unimed, UMSU, dan IAIN, Rabu (13/6) mengatakan, sejauh ini peserta absen tidak memberikan keterangan jelas. Jumlah total tidak hadir total 895 orang dengan rincian 297 peserta IPA, 317 IPS, dan 281 IPC. Prof Khairil mengatakan, pelaksanaan ujian tertulis SNMPTN pada hari terakhir di Unimed, juga berjalan lancar dan tidak diwarnai kecurangan. Materi ujian yang diujikan pada hari kedua adalah IPA dan IPS. ‘’Hari ini (14/6) berkas jawaban hasil SNMPTN diterbangkan ke Pantia Pusat di Jakarta melalui cargo lewat jalur udara,” tegas Prof Khairil. Sedangkan lima orang peserta ujian tertulis SNMPTN Unimed penyandang tuna netra diberikan perhatian khusus. Kelima mahasiswa tersebut Roma Siska T, Timson Aritonang, Ririn Sianipar, Tetty Uli Resti dan Landes Soaloon. (m49)

Ada-ada Saja ...

Jawaban Sudoku: 5 3 4 1 6 7 2 8 9

7 8 2 3 9 4 6 1 5

1 6 9 8 2 5 3 7 4

2 5 6 7 4 1 8 9 3

4 1 8 9 3 2 5 6 7

3 9 7 6 5 8 1 4 2

6 7 5 2 1 9 4 3 8

9 2 1 4 8 3 7 5 6

8 4 3 5 7 6 9 2 1

menyatakan setuju untuk memberikan denda senilai USD20 atau sekira Rp188 ribu. Otoritas setempat mengatakan aturan itu tidak dimaksudkan untuk menyensor percakapan sehari-hari. Namun untuk mencegah penggunaan bahasa yang tidak layak diucapkan oleh kalangan remaja. “Saya sangat senang dengan adanya peraturan itu. Namun, Saya tahu ada beberapa yang tidak setuju. Hanya saja kita perlu melakukannya,” ujar seorang anggota dewan kota yang bertugas mempercantik tempat itu, Mimi DuPhilly seperti dikutip Associated Press, Selasa (12/6). Seperti yang dikatakan Duphily, sejumlah kalangan tidak setuju dengan aturan baru itu karena dinilai bertentangan dengan hukum yang sudah ada. (ok/rzl)

Partai Demokrat agar jangan mencoba main-main, apalagi korupsi. Kader Partai Demokrat, kata dia, jangan mau dijebak dan dibujuk untuk melakukan perbuatan tidak terpuji. “Jangan main-main dengan APBN dan APBD. Saya masih mendengar niatan untuk main-main dengan APBN dan APBD dari banyak kalangan. Cegah itu, jangan sampai terjadi,” katanya. Presiden Yudhoyono juga menegaskan, garis politik Partai Demokrat tetap tegas dan konsisten meskipun menghadapi tantanganluarbiasa,yaknitetapmenjalani garis politik cerdas, bersih, dan santun.


RATUSAN buku 5 Kota Paling Berpengaruh di Dunia karya Douglas Wilson dimusnahkan oleh penerbit Gramedia Pustaka Umum di halaman Bentara Budaya, Komplek Gramedia Pustaka Utama, Jakarta Barat, Rabu (13/6). Pemusnahan tersebut dilatarbelakangi dugaan penistaan terhadap agama yang dinilai menghina nabi Muhammad SAW.

MUI: Buku 5 Kota Berpengaruh Nodai Islam JAKARTA (Antara): Ketua MUI Bidang Fatwa, Ma’ruf Amin, berharap silang sengketa terkait pencetakan dan peredaran buku berjudul 5 Kota Paling Berpengaruh di Dunia, yang dianggap menodai kesucian Nabi Muhammad SAW, segera selesai. “Kita harapkan tidak ada kegaduhan lagi,” katanya, seusai pembakaran 216 eksemplar buku tersebut di halaman

Komplek Kompas Gramedia, di Jakarta, kemarin. Buku terjemahan 5 Kota Paling Berpengaruh di Dunia karya Douglas Wilson, seorang rohaniwan di Idaho, Amerika Serikat. Ia menyatakan ada tiga hal yang diminta, yaitu menarik buku dari peredaran, dimusnahkan, dan minta maaf kepada masyarakat. “Sudah dilakukan Grame-

dia, ketiga-tiganya. Kami minta pihak Gramedia mengambil langkah dan direspons. Responnya cepat,” katanya. Buku terjemahan 5 Kota Paling Berpengaruh di Dunia menuai protes dari masyarakat karena dianggap menodai agama Islam. Buku itu sudah ditarik dari peredaran dan dimusnahkan di beberapa kota, antara lain Surabaya, Pekanbaru dan Jakarta.

Balon Walkot Bakar ... seorang bakal calon wali kota dari jalur perseorangan dan hingga kini tercatat sebagai PNS di Dinas Perkebunan Pemprov. Sumatera Utara. “Tersangka sudah diamankan di Mapolres dan dikenakan Pasal 187 KUH Pidana tentang pembakaran, ancaman hukuman minimal 7 tahun penjara,” kata Kapolres Padangsidimpuan, AKBP Andi Syahriful Taufik SIK.MSi. Menurut Kapolres, pihaknya tidak kecolongan dalam kejadian ini. Jauh hari sebelum ini dia selalu melakukan pengamanan terbuka dan tertutup di KPU. Hanya saja tidak ada yang menyangka kalau pelaku pembakaran itu justru seorang bakal calon wali kota. Pantauan Waspada, tangga menuju lantai dua kantar KPU yang terbakar itu telah dipasangi garis polisi. Dari lokasi polisi mengamankan barang bukti berupa sebuah tas milik pelaku berisi berkas dan bekas botol air mineral yang sebelumnya diisi bensin dan sejumlah benda yang terbakar. Sementara Ketua KPU Kota Padangsidimpuan, Arbanur Rasyid, menuturkan, saat kejadian , dia dan tiga anggota KPU lainnya sedang rapat di ruangan Divisi Hukum. Tiba-tiba terdengar suara hentakan pintu dari ruangannya yang berada di depan tempat rapat digelar. “Awalnya saya pikir pintu kamar saya terhentak akibat tiupan angin. Namun anggota KPU yang mengikuti rapat, Mohot Lubis, Muzakkir Khotib, dan Ahmad Effendi Nasution, mengatakan dari kerasnya hentakan pintu, itu bukan karena angin. Merekapun meminta saya untuk memeriksanya,” kata Arbanur Rasyid. Setelah diperiksa, ternyata ruangan itu terkunci dari dalam dan kepulan asap mulai keluar dari ventilasi di atas pintu ruangan. Sesaat kemudian pintu terbuka dan keluarlah AAH dari dalam sambil menyiramkan bensin yang dikemasnya dalam bekas botol air mineral ukuran 1,5 liter dan 0,10 liter. “Sambil menyiram-nyiramkan bensin, dia menyuruh kami semua yang ada di lantai dua untuk turun ke bawah. Saya tidak mau dan berusaha menghalanginya, tapi kobaran api

Medan Kembali ... penyelesaian sengketa konsumen melalui Badan Penyelesaian Sengketa Konsumen (BPSK) Kota Medan. “Artinya, seluruh persoalan konsumen di Kota Medan dapat diselesaikan dengan baik,” kata Eldin. Dalam melakukan penyelesaian sengketa konsumen, tambahnya, Kota Medan tidak hanya menyelesaikan sengketa yang dialami warga Kota Medan, tetapi juga warga dari daerah lain karena belum memiliki lembaga seperti BPSK. “Insya Allah semua sengketa dan persoalan hukum yang dialami warga dari daerah lain bisa diselesaikan. Inilah yang menjadi salah satu faktor penilaian kementerian perdagangan,” ungkapnya. Dipaparkannya, dari penilaian yang dilakukan terhadap 45 kota di Indonesia, ada 15 kota terpilih untuk mendapatkan

Tim Poldasu Tangkap 4 Tersangka Judi Togel MEDAN (Waspada): Tim Khusus Judi Reskrimum Poldasu menangkap 4 orang terkait kasus judi togel beromset ratusan juta rupiah di dua lokasi wilayah hukum Simalungun dan Pematangsiantar, Rabu (13/6) malam. Empat orang yang ditangkap yakni sub agen, LS,42, ditangkap di rumahnya Jl. Prapat Tigabalata, Kab. Simalungun, YRS, 56, penduduk Jl. Pakis, Kel. Kebun Sayur, Kec. Pematangsiantar Timur ditangkap di Jl. Nurumda Bawah, HP, 49, PNS pen-

duduk Jl. Aman, Kel. Kebun Sayur, Kec. Pematangsiantar Timur dan RT, 29, penduduk Saribudolok, Desa Simpang Pane, Kab. Simalungun ditangkap di warung Tiga Balata. Polisi menyita barang bukti ratusan lembar kertas rekap togel, enam handphone, uang dan lainnya. Direktur Reskrimum Poldasu Kombes Pol Drs Bambang S Heryanto, SH, didampingi Kasubdit III Rekrimum AKBP Andre Setiawan, SIK, SH, MH, ketika dikonfirmasi mengatakan,

penangkapan dilakukan atas informasi dari masyarakat tentang maraknya judi togel di kawasan Simalungun dan Pematangsiantar. Kehadiran Tim dipimpin Kanit Judi Reskrimum Poldasu Kompol Saptono, SIK, SH, MH dibantu Panit Reskrimum Iptu R Sembiring, SH, MH membuat para tersangka kalang kabut dan coba melarikan diri.Namun, polisi lebih sigap dan para tersangka bersama barang bukti berhasil diamankan. (m36/m27)

Wajar Warga ...

misi D lainnya, Marahalim Harahap menilai dengan melakukan pembuangan limbah ke sungai, PT AR telah menyalahi kontrak karya perusahaan dengan pemerintah Indonesia. Menurut Marahalim Harahap, dalam kontrak karya jelas disebutkan perusahaan harus mempertimbangkan dampak lingkungan dengan melakukan studi kelayakan.Yakni yang menyangkut pencemaran sungai maupun limbah buangan. Saat melakukan kunjungan ke lapangan beberapa waktu lalu, Komisi D mendapat penjelasan bahwa perusahaan menggunakan zat sianida dan mercuri untuk memisahkan antara batuan dan emas. Dengan begitu dipastikan, zat yang dipakai adalah berbahaya dan beracun. Karenanya dibutuhkan cara khususuntukmenanganilimbahnya. Dari pemaparan perusahaan, katanya, mereka menyebut-

kan akan menampung limbah dalam satu waduk. Tapi, lokasi yang dijadikan sebagai tempat penampungan tempatnya di atas bukit. Kata Marahalim, itu juga sangat berisiko. Tidak ada yang dapat menjamin waduk itu tidak jebol. Kalau itu yang terjadi, limbah akan tumpah ke perkampungan. Sama seperti Zulkifli Effendi Siregar, Marahalim Harahap, menyebutkan masyarakat tidak berharap kehadiran perusahaan yang membuat sengsara masyarakat. Terlebih hasil yang diperoleh pemerintah Indonesia dari eksploitasi ini sangat kecil. Yakni hanya 5 persen. ‘’Bayangkan Rp7 triliun setiap tahun hasil tambang Batangtoru disedot, Indonesia hanya kebagian 5 persen. Itupun akibatnya harus diterima masyarakat. Sangat tidak adil,’’ kata Marahalim Harahap. (m12)

cari korban. Minggu (10/6), keduanya bertemu korban di rumah tetangganya. Setelah itu, MSM bersama Y membawa korban ke rumah kos tersebut. Di sana, korban diintrogasi, dipukul dan disulut api rokok di lengannya.Selain itu, korban disekap di salah satu kamar kos tersebut. Selanjutnya, tersangka menghubungi keluarga korban. Minggu (11/6) malam pukul 22:00, pihak keluarga datang ke rumah kos dan minta kasusnya didamaikan saja. Pihak korban bersedia mengganti sepedamotor yang hilang senilai Rp20 juta. Tetapi tersangka tidak mau dan pihak keluarga pulang ke rumah. Malam itu juga, pihak keluarga

menerima SMS dari tersangka yang tidak mau dibayar Rp20 juta, tetapi sebanyak Rp40 juta. Malam itu juga pihak keluarga datang lagi dan menginap bersama korban, lalu pintu kamar kos dikunci dari luar. Selasa (12/6), pihak keluarga menemui adiknya di Binjai untuk membicarakan masalah tersebut. Kasus itu kemudian diteruskan ke polisi. Kapolsek Sunggal Kompol M Budi Hendrawan, SH, SIK, menindaklanjuti kasus tersebut dengan menurunkan tim dipimpin Kanit Reskrim AKP Vcitor Ziliwu, SH, SIK. Rabu dinihari, korban berhasil diselamatkan dan sekaligus menciduk dua tersangka. (m36)

PT AR, termasuk keluhan mereka tentang masalah limbah. Menurut Zulkifli Siregar, wajar kalau rakyat di sana khawatir dengan limbah yang akan dibuang perusahaan ke Sungai Batangtoru. Dari aksi masyarakat, menurut Ketua DPD Partai Hanura Sumut ini, dia yakin PT AR benar-benar akan membuang limbahnya ke sungai. ‘’Kalau tidak masyarakat tidak akan semarah itu,’’ kata Zulkifli Siregar dan menambahkan, dapat dipastikan limbah sisa pengolahan emas terdiri dari Bahan Berbahaya Beracun (BBB). Dia menjelaskan harusnya kehadiran perusahaan mensejahterakan masyarakat sekitar tambang. Jangan kemudian kehadirannya malah membuat masyarakat sengsara. Salahi kontrak Sementara itu, anggota Ko-

2 Tersangka ...

Waspada/Ahmad Cerem Meha

BALON Wali kota Padangsidimpuan dari jalur independen, AAH memberikan keterangan di ruangan Kapolresta, Rabu (13/6) sore. sudah berhasil dinyalakannya di ruangan saya dan Divisi Hukum,” kata Arbanur. Usai melakukan aksinya, pelaku turun ke bawah dan hendak pulang, tapi dihalanghalangi Ketua KPU bersama anggota dan pegawai. Begitu di teras depan kantor KPU, tibatiba personil Polres Padangsidimpuan dipimpin Kabag Ops, Kompol Edison Sitepu, sudah berada di pintu gerbang dan mengamankan AAH. Diduga aksi anarki itu akibat pelaku tidak terima karena KPU menyatakannya tidak lolos verifikasi administrasi untuk mancalon wali kota dari jalur perseorangan. ‘’Besar kemungkinan itulah yang menjadi penyebab utamanya,’’ kata Arbanur Rasyid. “Sebelum ini ada enam pasangan balon kepala daerah dari jalur perseorangan yang sudah menyerahkan berkas dukungan ke KPU. Setelah dilakukan verifikasi administrasi, dua pasangan dinyatakan tidak lolos, AAH dan pasangannya Alfian Sontang Siregar, dan dr.Sori Monang Harahap SpB/Kompol Chairul

Muklis SH,” jelasnya. Kepada Waspada, Arbanur Rasyid mengaku tidak menyangka hal ini bisa terjadi. Pasalnya, sebelum kejadian, dia masih sempat berbincang dengan Alfian Sontang Siregar yang merupakan balon wakil wali kota pasangan AAH. Mereka membincangkan tentang tidak lolosnya pasangan itu karena baru menyerahkan 8.000 copy KTP, sementara syarat untuk jalur perseorangan minimal harus 14.798 copy KTP. Saat itu mereka minta perpanjangan waktu untuk mencukupi, tapi ditolak KPU karena tahapan sudah berakhir Minggu (10/6) pukul 00:00 kemarin. Sedangkan Sekretaris Daerah Pemko Padangsidimpuan, Sarmadhan Hasibuan, yang baru tiba di lokasi mengatakan, bersama Kapolres akan segera menghadap Wali Kota, Zulkarnaen Nasution untuk melaporkan kejadian itu.Dia meminta Wali Kota agar mengizinkan KPU berkantor kembali di kantor lama di samping kantor wali kota.(a27/c13)

Buron BLBI ... Sebelumnya, petugas dinas imigrasi dan bea cukai Amerika Serikat (ICE), Rabu menyerahkan Sherny Kojongian Saroha, mantan direktur eksekutif bank swasta di Indonesia yang menjadi buronan kasus Bantuan Likuiditas Bank Indonesia (BLBI) kepada Kepolisian Negara Republik Indonesia. Tiga tahun Sherny ditetapkan sebagai terpidana dalam sebuah pengadilan in absentia untuk kasus korupsi besar yang mengakibatkan kerugian lebih dari 260 juta dollar AS bagi Pemerintah RI.

Penyerahan ini merupakan buah dari hasil penyelidikan selama tiga tahun yang dilakukan oleh ICE sehingga berhasil mengirimkan Sherny dari AS. Sherny divonis 20 tahun penjara bersama rekannya di Bank Bank Harapan Sentosa atau BHS, Eko Hadi Putranto dan Hendra Rahardja yang meninggal di lokasi pelariannya di Australia. 23 Orang Lagi Buron Kejaksaan Agung menyatakan saat ini tinggal 23 orang lagi buron kasus BLBI yang belum ditangkap. “Target kita ada 24 orang buron BLBI, sekarang tinggal 23 buron,” kata, Darmono.

penghargaan. Namun, yang berhasil mendapatkan piala dan sertifikat hanya lima kota, salah satunya Kota Medan. Sedangkan, 10 kota lagi hanya mendapatkan sertifikat. “Ini tentunya sangat membanggakan bagi kita. Apalagi penghargaan seperti ini merupakan yang pertama kali diraih Pemko Medan,” paparnya. Untuk itulah, mantan Sekda Kota Medan ini mengajak masyarakat Kota Medan untuk mensyukuri atas keberhasilan yang diraih. Penghargaan ini diraih berkat pembinaan yang dilakukan Wali Kota Medan Rahudman Harahap terhadap BPSK Kota Medan. “Kita harapkan BPSK Kota Medan harus terus melayani dan menyahuti keluhan-keluhan dari konsumen. Seluruh keluhan maupun sengketa yang disampaikan konsumen harus dapat diselesaikan lebih baik lagi ke depannya. Untuk mendukung kinerja itu, kita harus me-

nyiapkan sarana dan prasarananya sehingga mereka merasa tenang dan nyaman dalam memberikan pelayanan kepada konsumen,” terangnya. Terkait dengan kriteria penilaian yang dilakukan, Eldin mengungkapkan menyangkut masalah administrasi, kondusivitas lembaga serta bagaimana pelayanan yang diberikan kepada konsumen dan menyelesaikan keluhan-keluhan yang disampaikan. Dari kriteria itu, Kota Medan memiliki bukti tertulis yang ada sama dewan juri. Adapun dewan juri berasal dari pihak independen, artinya tidak hanya berasal dari kalangan Departemen Perdagangan tetapi juga dari kalangan akademisi. Wakil Wali Kota Medan Dzulmi Eldin setibanya di Vip Room Bandara Polonia Medan disambut Sekda Kota Medan Syaiful Bahri dan sejumlah Satuan Kerja Perangkat Daerah (SKPD) jajaran Pemerintah Kota Medan. (m50)

Al Bayan ... Kemudian Umar memanggil Gubernur AlJumahi untuk mempertanggungjawabkan tingkahnya di depan rakyat. Sang Gubernur pun menjelaskan ke empat-empat masalah tersebut dengan tenang. “Pertama, saya tidak keluar menjadi imam shalat shubuh karena saya tidak punya khadam untuk keluarga. Saya sendiri yang membuat adonan roti, kemudian saya duduk menunggu sampai timbul maragi (fermantasi), kemudian saya bakar roti itu sampai masak. Kedua, saya tidak menerima tamu di malam hari karena, saya telah menghabiskan siang untuk mereka (rakyat) dan malam saya gunakan untuk Allah (beribadah). Ketiga, saya tidak keluar satu hari dalam sebulan karena saya tidak punya khadam untuk mencuci pakaianku, dan akupun tidak punya pakaian selain yang saya pakai. Hari

itu saya gunakan untuk mencuci pakaian dan menggosoknya. Bila sudah kering di sore hari, langsung saya keluar menemui rakyat di masjid. Keempat, saya tidak mampu menyaksikan orang mati karena demi Allah aku telah menyaksikan peristiwa penyiksaan terhadap Khabib al-Anshari di Makkah. Khabib dibanting dan dicencang oleh orang Musyrikin Quraisy, kemudian diusungnya di atas pelepah kurma, mereka berkata: Apakah kamu senang wahai Khabib, Muhammad berada seperti posisimu sekarang? Khabib menjawab, demi Allah, aku dalam keluargaku dan anak-anakku tidak merasa senang kalau Muhammad SAW tertusuk satu duripun. Kemudian Khabib dibunuh. Mengingat kematian Khabib saya tidak bisa melihat orang mati. Lalu Umar memaafkan gubernurnya serta memberi hadiah 1.000 dinar untuk dipergunakan kepada kepentingan urusannya.

WASPADA Kamis 14 Juni 2012

diantarkan ke stasiun bus KUPJ di Jl. Sisingamangaraja. Selanjutnya, Riski menemui MSM untuk meminjam sepedamotornya.Karena sama-sama penjaga malamdikos,MSMmemberikan sepedamotornya. Usai mengantar teman ke stasiun bus KUPJ, korban pulang ke tempat kos. Setiba di Jl. Sisingamangaraja depanTaman Makam Pahlawan (TMP) Medan, korban distop dua orang bersepedamotor dan merampas sepedamotor yang dikendarainya. Setelah itu, korban kembali ke rumah kos dan memberitahukan kepada MSM, sepedamotornya dirampok. Spontan MSM minta ganti kepada Riski, hingga membuat korban takut dan tidak masuk bekerja.Karena sulit ditemui, MSM bersama temannyaY men-

Edarkan Sabu, ... kecil menyimpan sabu. Tetapi dari rumah pegawai Lapas itu petugas tidak menemukan sabu. Berdasarkan keterangan tersangka,kepada polisi, sabu diperoleh dari rekan Acong yang berdomisili di Aceh. Karena itu polisi masih melakukan pengembangan kasus itu guna menangkap bandar besarnya. Kata Damanik, kedua pengedar tersebut sudah ditahan di tahanan Dit Narkoba Poldasu. Sementara,HMS mengaku baru pertama itu mengedarkan sabu. “Baru ini aja saya begini,” katanya, dan menyebutkan sudah 5 tahun bekerja di Lapas. Dia mengenal Acong ketika sedang diperiksa petugas medis. “Saya kenalnya ketika dia (Acong) diperiksa kesehatannya,” ujar HMS. Bandar bola Sementara, bandar judi bola Piala EURO 2012,Yu ditangkap tim Subdit III Reskrimum Poldasu dari sebuah rumah di Jl. Gaharu, kemarin malam. Kepala Subdit III Reskrimum Poldasu AKBP Andry Setiawan mengatakan, dari bandar judi bola itu diamankan handphone berisi pesan singkat (SMS) mengenai pesanan tebakan bola, uang tunai Rp950 ribu, satu Kartu ATM dan setengah butir pil ekstasi. Saat ini polisi melakukan pengembangan untuk menangkap jaringan lainnya. (m27)

Kroasia Ancaman Italia ... Namun pencetak dua gol Mario Mandzukic dan penyerang Nikica Jelavic, saya kira tidak akan semudah itu melewati benteng catenaccio Italia. Luka Modric sebagai pemain yang mengorganisir penyerangan dan pertahanan pasukan Kroasia, malam nanti kembali akan membuktikan sebagai pemain kunci. Kepada Modric, pemain-pemain Italia harus super hati-hati. Modric termasuk luar biasa dalam menciptakan ruang, dia kunci produktivitas Hrvatska ketika menyarangkan tiga gol ke gawang Si Bocah Hijau. Sebaliknya, Gli Azzurri dalam posisi sangat sulit untuk mencetak gol. Satu-satunya gol Italia ke gawang Spanyol, diciptakan Antonio Di Natale, penyerang cadangan yang masuk di babak kedua menggantikan bomber bengal Mario Balotelli. Kita ramalkan untuk mengamankan peluang menuju babak kedua, Kroasia akan tetap memainkan pola lebih berat, mengincar penguasaan garis tengah dan pada saat-saat tertentu menciptakan peluang. Tipe permainan Kroasia seperti ini adalah ciri khas strategi Slaven Bilic. Italia juga seperti itu, hanya saja wibawa pasukan Cesare Prandelli masih lebih tinggi. Pengalaman yang dimiliki pemainpemain kunci Italia, seperti Andrea Pirlo, Daniel de Rossi, dan Cassano, tetap merupakan ancaman kepada pertahanan Kroasia. Dengan wibawa lebih besar, Azzurri akan lebih banyak bermain terbuka. Mereka bakal lebih nekad, sebab secara taktis Kroasia tidaklah seperti Spanyol yang begitu menakutkan. Bagaimanapun, Kroasia bagi Italia bukan seseram menghadapi serangan sejenis ala Spanyol. Azzurri bisa bermain lebih terbuka dan lebih agresif, tapi Prandelli harus berhitung untuk memainkan Balotelli sejak awal bersama Di Natale. Dengan dua ujung tombak lebih besar, kemungkinan mencetak gol lebih banyak. Mengingat kepentingan besar untuk lolos dari penyisihan Grup C, baik Kroasia maupun Italia berusaha untuk menang. Kroasia kini lebih beruntung dengan poin tiga setelah mengalahkan Irlandia, sehingga bermain seri saja sudah strategi tersendiri. Sebaliknya, Italia harus menyerang dan ngotot menang, sehingga pertarungan terasa akan sangat menegangkan bagi mereka. Siapakah yang memenangkan duel lapangan tengah, Modric atau Pirlo? Itu yang paling penting, karena pertarungan akan dimulai dari penguasaan barisan tengah. Italia dipaksa lebih terbuka, karena tuntutan harus menang dan dengan demikian harus pula bermain lebih agresif, lebih berani menyerang. Kita sangat gregetan, karena jarang sekali bisa menyaksikan Italia main dengan terbuka, agresif serta mengandalkan serangan beruntun. Itu yang bakal terjadi, karena sekali lagi mereka mesti menang. *****

Medan Metropolitan

WASPADA Kamis 14 Juni 2012

Hari Ini, RUPS Bank Sumut

Pemegang Saham Jangan Terjebak Masalah Politik MEDAN (Waspada): DPRDSU berharap para pemegang saham jangan terjebak pada masalah politik dalam pengangkatan Direktur Utara (Dirut) PT Bank Sumut. Isu politisasi pada pergantian Dirut PT Bank Sumut sangat santer terdengar pada Rapat Umum Pemegang Saham (RUPS) lembaga keuangan itu, pada hari ini (Kamis 14/6). Rencananya, PT Bank Sumut akan melaksanakan RUPS, yang salah satu angendanya adalah pemberhentian Dirut PT Bank Sumut Gus Irawan Pasaribu, yang telah berakhir periodesasinya. Kemudian, mengangkat kareteker Dirut menunggu proses pengangkatan Dirut baru. Pada proses pergantian Dirut PT Bank Sumut ini, Komisi C mengakui sangat kental masalah politiknya. Meski RUPS ini

masih merupakan langkah awal pergantian Dirut, tapi sudah santer terdengar momen itu akan dijadikan ajang balas dendam kepada Dirut sebelumnya, karena masalah rivalitas Pilgubsu. Figur pengganti Gus Irawan, kabarnya juga sudah disiapkan. Ke depan proses yang dilakukan hanya bersifat prosedural saja. Pimpinan Komisi C mulai dari Marasal Hutasoit, Pasiruddin Daulay dan Effendi

Minggu Depan PSB Mulai Dibuka MEDAN (Waspada): Kepala Dinas Pendidikan Kota Medan Muhammad Rajab Lubis (foto) mengatakan, penerimaan siswa baru tahun ajaran 2012 mulai dibuka minggu depan. Waktu pendaftaran diperkirakan tujuh hingga sepuluh hari. “Sistem penerimaan siswa baru tahun ini menggunakan 80 persen nilai Ujian Nasional (UN) murni dan 20 persen tes tertulis/ bina lingkungan. Pendaftaran mulai dibuka minggu depan,” kata Rajab kepada Waspada di sela-sela penyambutanWakilWali Kota Medan Dzulmi Eldin membawa penghargaan dari Jakarta yang diberikan Menteri Perdagangan, di Bandara Polonia Medan, Rabu (13/6). Dijelaskan Rajab, sistem pendaftaran dilakukan secara manual dengan mengisi formulir. Namun, setelah itu siswa tersebut bisa melihatnya melalui website. “Untuk tahap awal secara manual yakni mengisi formulir. Namun, data siswa yang sudah diisi akan kita upload ke website, sehingga untuk selanjutnya siswa cukup mengupdate informasi melalui internet nantinya. Itulah yang kita lakukan sistem online bagi PSB tahun ini,” sebutnya. Rajab mengatakan, sistem penerimaan siswa baru yang diputuskan Pemerintah Kota (Pemko) Medan dengan menggunakan 80 persen nilai Ujian Nasional (UN) murni dan 20 persen tes tertulis/bina lingkungan, sangat berpeluang untuk memberikan kesempatan kepada siswa yang berprestasi non akademik, seperti di bidang olahraga dan seni budaya. “Kita memang sudah sepakati sistemnya 80 persen nilai UN dan 20 persen bina lingkungan. Artinya, bina lingkungan ini kita berikan kesempatan untuk siswa yang berprestasi tidak di bidang akademik melainkan berprestasi di bidang olahraga dan seni budaya. Makanya mereka berpeluang untuk masuk sekolah negeri. Di bina lingkungan ini juga kita berikan peluang kepada siswa yang secara ekonomi kurang mampu untuk masuk ke sekolah negeri,” ujarnya. Ditegaskan Rajab, untuk memutuskan siapa saja siswa yang dapat diberikan peluang itu, bukanlah ditentukan oleh Disdik Medan. “Keputusannya itu bukan di Disdik, tapi ada di kepala-kepala sekolahnya masing-masing. Sebab, merekalah yang mengetahui bagaimana siswa tersebut, juga berapa daya tampung dan kapasitas sekolahnya,” tuturnya. Kata dia, sistem PSB ini akan disosialisasikan ke sekolahsekolah pada Jumat (15/6). “Sosialisasinya akan kita lakukan besok (hari ini-red) ke sekolahsekolah agar masyarakat tahu bagaimana sistem PSB tahun ini,” kata Rajab. (m50)

Napitupulu, sampai kepada anggota, seperti Mulkan Ritonga, Muslim Simbolon, Ramli, Taufan Ginting dan lainnya, Rabu (13/6), berharap RUPS PT Bank Sumut berjalan baik. Para pemegang saham nantinya diharapkan murni menetapkan Dirut karena profesinalisme. Bukan karena kepentingan politik. Terus terang, kata personel Komisi C, dewan sangat gusar dengan rumor yang terjadi selama ini. Kalau itu, benar terjadi maka akan merugikan Sumut. Selama ini prestasi Bank Sumut sudah sangat baik. Lembaga keuangan milik Pemprovsu itu telah menjadi pilot project Regional Champion. Anggota Komisi C Muslim Simbolon mengatakan, sesuai agendanya, RUPS hari ini hanya untuk merumuskan prosedur

dan mekanisme penjaringan Direksi PT Bank Sumut. Dalam konteks ini, diharapkan penjarigan yang dilakukan benar-benar menganut asas profesionalisme. Pa ra pemegang saham diharapkan benar-benar memasukkan figur yang mampu meneruskan progam Bank Sumut untuk mengikuti proses selanjutnya. ‘’Dengan begitu, siapapun nantinya yang dipilih menjadi Dirut, sudah tidak ada masalah lagi,’’ kata Muslim. Personel Komisi C lainnya, Mulkan Ritonga juga mengatakan hal yang sama. Katanya, calon pengganti Gus Irawan Pasaribu, haruslah orang yang mampu melanjutkan program Sumut Sejahtera. Yakni yang menitikberatkan pada pembinaan usaha kecil. Wakil Ketua Komisi C Pasi-

ruddin Daulay berharap rumor tentang politisasi di PT Bank Sumut akan dapat terbantahkan dengan RUPS yang dilakukan hari ini. Yakni dengan memasukkan orang-orang profesional sebagai calon-calon pengganti Gus Irawan. Yang sangat tidak diinginkan adalah RUPS dijadikan sebagai forum untuk memperkeruh suasana. Komisi C sebagai mitra PT Bank Sumut, tambah Sekretaris Komisi C Effendi Napitupulu, akan mengawal proses pergantian direksi lembaga keuangan itu. Menurutnya, dewan akan bereaksi bila ternyata RUPS itu dimuati dengan masalah-masalah politis. ‘’Prestasi Bank Sumut sekarang ini sudah sangat baik. Tahun 2011 saja, mereka menghasilkan deviden Rp261,5 miliar lebih,’’ katanya. (m12)

AY Nasution Hadiri Reuni Alumni SMAN 1 Panyabungan MEDAN (Waspada): Mantan Pangkostrad Letjen Purn (TNI) AminYusri Nasution hadir sebagai tamu kehormatan menyemarakkan reuni SMA Negeri 1 Panyabungan, Madina di Hotel Inna Dharma Deli Medan, Minggu (10/6). Kedatangan tokoh nasional yang menghabiskan masa kecil di Padangsidimpuan ini, disambut hangat sekira 200-an alumni yang hadir, diantaranya Rektor UISU Prof Dr. H. Zulkarnain Lubis alumni angkatan tahun 1980, Prof Usman Nasution (mantan rektor UISU) alumni tahun 1962 dan para guru yang pernah mengajar di sekolah itu. AY Nasution hadir bukan sekadar memenuhi undangan, namun dia memiliki ikatan sejarah dengan sekolah yang berdiri pada 1958 itu. Ayahnya, Kolonel HM Nurdin, mantan Bupati Tapanuli Selatan, berjasa sebagai pendiri sekolah tersebut. Penasehat Panitia Reuni Prof Dr Ir H Zulkarnain Lubis

mengatakan, reuni ini memiliki multi tujuan. Yakni mengenang masa-masa SMA dulu, serta merajut rasa persaudaraan dan kebersamaan diantara sesama alumni. Reuni ini juga dapat dijadikan sebagai ajang untuk membantu mencapai tujuan yang baik. Dia berharap alumni bisa saling membantu untuk membangun kampung halaman atau mendukung kegiatan alumni dalam kegiatan positif, termasuk AY Nasu-tion yang orangtuanya sangat banyak berperan dalam pembangunan sekolah itu. ”Jika secara pribadi ingin mendukung beliau sebagai putra derah, silakan saja. Namun saya tegaskan pertemuan kita ini tidak bernuansa politis,” ucapnya. Dia juga menegaskan reuni ini untuk meningkatkan rasa persaudaraan dan persatuan untuk membangun Madina yang madani. Sementara itu, AY Nasution di hadapan para

alumni dan guru SMA Negeri 1 Panyabungan memohon dukungan dan doa terhadap dirinya yang akan maju sebagai calon Gubernur Sumatera Utara periode mendatang. ”Kita semua bertanggungjawab untuk memiih pemimpin berkarakter dan jujur. Sebab, kejujuran merupakan modal utama untuk jadi seorang pemimpin,” ujarnya. Ketua Panitia Drs. H. Ahmad Raja Nasution MSP didampingi Sekretaris Sri Maphilindo mengatakan, reuni ini diadakan untuk lulusan tahun 1961 hingga 2012. (m49)


JDA Hibur Dan Edukasi Masyarakat MEDAN (Waspada): Setelah sukses menggelar kegiatan Jelajahi Dunia Astra (JDA) di Jakarta, kini JDA hadir di Medan guna memberi hiburan dan mengedukasi masyarakat dengan berbagai kegiatan menarik untuk segala usia. Kegiatan ini digelar di Medan International Convention Center (MICC) Hotel Santika, pada 15-17 Juni 2012. “Jelajahi Dunia Astra ini diadakan sebagai bentuk rasa syukur terhadap pencapaian yang telah diraih oleh Grup Astra selama 55 tahun dan apresiasi terhadap semua stakeholders yang telah memberikan kontribusinya. Sehingga Grup Astra dapat mewujudkan salah satu filosofi dalam Catur Dharma Astra, yaitu menjadi milik yang bermanfaat bagi bangsa dan negara,” kata Head of Public Relation PT Astra Internasional Divisi Medan Yu l i a n Wa r m a n k e p a d a wartawan di Swissbell Hotel Medan, Rabu (13/6). Yulian Warman menyebutkan, tujuan utama dari JDA untuk memberi gambaran yang lebih akurat mengenai kiprah Grup Astra di berbagai bidang usaha mulai dari otomotif, jasa keuangan, alat berat dan pertambangan, agribisnis, infrastruktur dan logistik serta teknologi informasi. Di samping itu, juga memperkenalkan kiprah Astra di bidang sosial yang dilakukan oleh perusahaan bersama anak usaha dan delapan yayasan yang ada di dalamnya. “Jelajahi Dunia Astra terdiri dari berbagai acara yang dikemas secara menarik yang bukan hanya menghibur, tapi juga edukatif,” kata Yulian didampingi Deputi Chief Corporate Human Capital Development Aloysius Budi Santoso, Head of Environment & Social Responsibility Riza Deliansyah dan Koordinator Wilayah AFFCO Medan Gusyandri. Di area Pameran Grup Astra, para pengunjung bisa lebih mengenal tentang bisnis Astra yang hadir dengan produk terkini, mengetahui kiprah Astra dalam membangun bangsa


YULIAN Warman (dua kiri) didampingi Deputi Chief Corporate Human Capital Development Aloysius Budi Santoso (dua kanan), Head of Environment & Social Responsibility Riza Deliansyah (kanan) dan KoordinatorWilayah AFFCO Medan Gusyandri dalam acara Media Gathering di Swissbell Hotel Medan, Rabu (13/6). lewat berbagai program tanggung jawab sosial (Corporate Social Responsibility-CSR) serta produk menarik dari usaha kecil menengah (UKM) binaan Astra. Perjalanan Astra sejak kelahirannya tahun 1957, terangkum dalam Galeri Foto 55 Tahun Astra. Sementara itu, Aloysius Budi Santoso mengatakan, kegiatan ini dilakukan untuk mengembalikan apa yang telah diberikan kepada Grup Astra selama ini. Di usia 55 tahun, Astra ingin memberikan sesuatu kepada masyarakat. “Kegiatan ini merupakan rangkaian acara selama satu tahun yang dimulai pada HUT Astra, 20 Februari, dengan branding Jelajahi Dunia Astra yang dilaksanakan di lima kota yaitu Jakarta, Medan, Balikpapan, Makassar dan Surabaya,” ujarnya. Sepanjang tahun, even yang dilakukan bersifat CSR seperti untuk pilar lingkungan menanam 550.000 pohon, pilar kesehatan mengumpulkan 55.000 kantong darah, pilar pendidikan 55.000 jam Astra Berbagi Ilmu dan pilar pemberdayaan usaha kecil dan menengah dengan 55.000 jam Astra berbagi ilmu dengan UKM. Kegiatan JDA di Medan akan menggelar Pameran Grup Astra, Alun-alun Astra yang akan diisi dengan berbagai kegiatan bersifat edukasi, hiburan dan

permainan. Alun-alun Astra menampilkan bintangbintang favorit seperti Alexa, De Tradisi, Horizon, Modern Dance, komunitas shuffle dance. Kemudian Aksi Kreasi Astra yaitu penampilan karyawan Astra yang berbakat di bidang seni. “Jelajahi Dunia Astra dihadirkan untuk segala usia, bagi anak-anak bisa bermain di Zona Anak Astra dengan beragam wahana permainan dan kegiatan di antaranya face painting, hand painting, funny balloons, mewarnai gambargambar produk Astra dan belajar mengenal produk Astra di Astrazania. Selain itu terdapat Kedai Astra dengan aneka kuliner khas Sumatera, Lomba Foto Momen Terbaik Jelajahi Dunia Astra, serta aneka games seru,” papar Aloysius Budi Santoso. Bagi mahasiswa yang tertarik mengetahui tentang bagaimana dunia kerja dan bagaimana menjadi pimimpin, bisa bergabung di ‘Astra Berbagi Ilmu’ pada Jumat (15/6) pukul 13:00-17:00 dengan pembicara A l oy s i u s B u d i S a n t o s o. Sedangkan bagi yang baru lulus kuliah atau sedang mencari kerja dan ingin bergabung dengan Grup Astra bisa memasukkan CV di drop box area Pameran Grup Astra yang terbuka untuk semua jurusan dari berbagai universitas. (m41)

Medan Metropolitan


WASPADA Kamis 14 Juni 2012

SPM PTPN 2 Minta Pemprovsu Sikapi Perampasan Lahan HGU Rakyat Berada Pada Posisi Tertindas MEDAN (Waspada): Masalah pertanahan di Sumatera Utara masih merupakan problema, hal itu ditandai dengan dua gelombang massa melakukan unjukrasa ke Kantor Gubsu Jln. Diponegoro dan Gedung DPRD Sumut, Rabu (13/6). Ribuan anggota Serikat Pekerja Merdeka (SPM) PT Perkebunan Nusantara (PTPN) 2 berunjukrasa di Kantor Gubsu. Mereka meminta dukungan Pemerintah Provinsi Sumut (Pemprovsu) melalui Plt Gubsu untuk menyikapi perampasan sekitar 8.000 ha lahan hak guna usaha (HGU) oleh para penggarap di Deliserdang dan Langkat. Pasalnya, kata Ketua Serikat Pekerja Merdeka PTPN 2 Josem Ginting, perampasan oleh penggarap itu mengganggu produksi PTPN 2 yang berimbas pada terganggunya kesejahteraan hidup sekitar 20.000 pekerja. “Terus terang kami menggantungkan hidup di PTPN 2, kalau kami tidak kerja produksi mandek, jelas hidup kami terancam,” sebutnya. Secara bergantian perwakilan serikat pekerja PTPN 2 menyampaikan orasi yang meminta Pemprovsu tegas dalam penetapan areal HGU. Ketegasan tersebut dibutuhkan agar karyawan PTPN 2 dapat bekerja dengan nyaman sehingga bisa produktif untuk meningkatkan penghasilan. “Kami tidak mempermasalahkan kalau eks HGU dibagikan gubernur sesuai kewenangannya berdasarkan persetujuan Menteri BUMN, namun kami tidak setuju jika HGU menjadi terbagi-bagi, sebab lahan HGU adalah milik negara,” kata Josem. Serikat pekerja mendesak Pemprovsu selaku perpanja-

ngan tangan pemerintah pusat di daerah untuk turut menjaga aset PTPN 2 yang juga merupakan aset negara. Menurut serikat pekerja, Plt Gubsu wajib melindunginya dari tangan-tangan perampas, sebagaimana yang terjadi hingga saat ini. Pemprovsu harus berpihak pada PTPN 2 yang dilindungi berbagai aturan dalam operasionalnya. Selain berorasi, pengunjuk rasa juga membawa beberapa brosur di antaranya bertuliskan “Usir penggarap dari tanah PTPN 2” dan “Lebih baik mati mempertahankan HGU dari pada mati kelaparan karena hilang pekerjaan”. Sedangkan spanduknya bertuliskan “Pak gubernur, berikan kami kenyamanan bekerja untuk meningkatkan produksi dan kesejahteraan pekerja”. Selain penetapan areal HGU, serikat pekerja PTPN 2 juga meminta Pemprovsu mendorong penegakan hukum atas penganiayaan yang dialami kar yawan BUMN tersebut. Plt Gubsu H H Gatot Pujo Nugroho melalui Asisten Bidang Pemerintahan Setdaprovsu Hasiholan Silaen dan Kepala Biro Pemerintahan Umum Setdaprovsu Nouval Mahyar menemui dan berdialog dengan serikat pekerja. Hasiholan menyampaikan dukungannya atas keberadaan PTPN 2 sebagai pemilik sah areal HGU yang digarap sejumlah kelompok masyarakat. Soal

kepastian areal HGU itu, menurut dia, agar serikat pekerja PTPN 2 mempertanyakannya ke Badan Pertanahan Nasional (BPN). Terhadap aksi perampasan itu, Hasiholan meminta serikat pekerja PTPN 2 membuat laporan ke pihak kepolisian jika mengalami gangguan atau mendapatkan perlakuan kasar dari kelompok lain yang menggarap lahan HGU. “Silahkan tempuh jalur hukum,” ujarnya. Posisi tertindas Sementara itu, Sekretariat Bersama Reforma Agraria (SekBer-RA) berunjukrasa ke gedung DPRD Sumut. Mereka mengangkat kembali masalah sengketa lahan di enam daerah di Sumut. Yakni Sei Mencirim Deliserdang, Padang Habalan Labuhan Batu Utara, Padang Lawas, Dagang Kerawang Deliserdang, Tanjung Jati Langkat, Percut Deliserdang dan Pulo Raja Asahan. Menurut Koordinator Aksi Rahmat Panjaitan, dalam kasus sengketa agrarian ini, rakyat pasti berada pada posisi yang tertindas. Kenyataannya, rakyat harus merasakan intimidasi, kekerasan dan penangkap oleh aparat di lahan yang sedang dalam sengketa. Padahal, kaum tani, dengan alas hak yang dimilikinya telah berusaha meminta dengan cara-cara yang damai kepada perusahaan perkebunan, baik milik pemerintah maupun swasta. Namun yang terjadi mereka diperlakukan secara kasar. Kaum tani harus berhadapan dengan prilaku intimidasi, bahkan ancaman. Karena banyak peristiwa agraria yang memposisikan

rakyat sebagai pihak yang tersakiti, SekBer-RA, minta kepada DPRD Sumut untuk memperjuangkan nasib mereka. Yakni meminta pemerintah menghentikan kekerasan, penangkapan, teror, intimidasi dan penembakan terhadap kaum tani, yang terjadi di enam daerah di Sumut. Pada aksi di kantor DPRD Sumut itu, pengunjukrasa tidak dapat bertemu dengan anggota Komisi A, yang membidangi masalah pertanahan. Mereka menolak berdialog dengan anggota Komisi C, Hidayatullah, yang menemui pengunjukrasa. Hari itu, tidak satupun perwakilan Komisi A ada di gedung dewan. Mereka seluruhnya sedang berada di Jakarta. Tidak ada perwakilan mereka yang melaksanakan piket di gedung dewan. Kepada wartawan, Hidayatullah, mengatakan dia harus menemui pengunjukrasa karena hari itu dapat giliran piket. Dia menilai wajar, pengunjukrasa menolak berdialog dengannya karena masalah pertanahan bukan bidang tugasnya. Hidayatullah, sehari-hari bertugas di Komisi C yang membidangi masalah keuangan. Dia juga mengakui, idealnya, anggota dewan yang bertugas piket merupakan perwakilan dari seluruh komisi yang ada. Dengan begitu dapat menampung aspirasi masyarakat bila sewaktu-waktu datang berdelegasi ke kantor dewan dan berdialog dengan massa. “Kalau sekarang kan gak nyambung. Paling saya hanya menampung aspirasi massa untuk disampaikan ke Komisi A,” kata Hidayatullah. (m28/m12)

Hasil Survei Februari - Juni 2012

Masyarakat Puas Dengan Layanan Pengurusan Paspor


SATGAS Pengajian Tasawuf Babur Ridho Rahmatullah Ahli Thariqat Naqsyabandi Jabal Hindi foto bersama usai menggelar upacara peringatan HUT ke2.

Satgas Babur Ridho Rayakan HUT Ke-2 MEDAN (Waspada): Mursyid/Guru Besar/Mujaddid Syekh Muhammad Hirfi Nuzlan bin Haji Muhammad Thahir bin Muhammad Isa Bin Malan bertindak sebagai pimpinan upacara Dirgahayu ke-2 Satgas Pengajian Tasawuf Babur Ridho Rahmatullah Ahli Thariqat Naqsyabandi Jabal Hindi, di Jalan Asam Lorong Sekolah, Kel. Medan Martubung, Kec. Medan Labuhan, Minggu (10/6). Dalam sambutannya, Guru Besar Muhammad Hirfi Nuzlan menjelaskan mengenai maksud lirik lagu kebangsaan Indonesia yaitu lagu Indonesia Raya dari sisi pemahaman ilmu Tasawuf. “Bangunlah dahulu jiwa kita dengan hati yang selalu berdzikir mengingat Allah, kemudian baru bangunlah badan jasmani diatas jiwa yang terlebih dahulu dibersihkan, sebab didalam hati yang bersih atau jiwa yang sehat terdapat tubuh yang kuat dan pikiran yang sehat pula, sehingga merdekalah jiwa atau hati itu dari belenggu hawa nafsu yang selalu membawa kepada kemalasan atau perbuatan-perbuatan yang buruk,” katanya. Selain itu Guru Besar menyematkan tanda kehormatan dan memberikan piagam penghargaan bagi Satgas terbaik priode 2011-2012 kepada Edi Suwito (Komandan Regu DPP), Julpian (Komandan Regu DPP), Surip (anggota DPW), Muhammad Syukur (anggota DPC), dan Firdaus (Komandan Regu DPW). Upacara tersebut dihadiri ratusan anggota Satgas dari DPP, DPW dan DPC, Satgas Masyarakat Solidaritas Babur Ridho Rahmatullah (MSBRR), Arman Tanjung (Ketua Umum), dan seluruh pengurus serta ikhwan-ikhwani dan para khalifah Pengajian Tasawuf Babur Ridho Rahmatullah Ahli Thariqat Naqsyabandi Jabal Hindi.(cwan)

MEDAN (Waspada): Upaya peningkatan kualitas pelayanan pengurusan paspor yang sudah dan sedang dilaksanakan di Kantor Imigrasi Kelas I Khusus Medan, kini membuahkan hasil. Dari survei yang dilakukan 1 Februari - 11 Juni 2012, menunjukkan masyarakat puas dengan pelayanan yang mereka terima. Berdasarkan evaluasi kepuasan masyarakat yang dilakukan Kantor Imigrasi Kelas I Khusus Medan, Rabu (13/6), diperoleh data dari 3.109 formulir survei yang dimasukkan pemohon (masyarakat) ke kotak yang disediakan, sebanyak 2.939 menyatakan puas atau 98,02 persen, sedangkan yang tidak puas 161 orang atau 1,08 persen dan puas sebagian sebanyak 9 orang. 161 Orang yang menyatakan tidak puas tersebut, mengeluhkan pelayanan di loketloket antrean. Kepala Kantor Imigrasi Kelas I Khusus Medan Friement FS Aruan mengaku cukup puas dengan hasil survei tersebut. Hasil ini menunjukkan upaya peningkatan kualitas pelayanan yang mereka lakukan relatif berhasil. “Hasil survei ini riil dan tidak ada dimanipulasi. Setiap orang yang mengajukan permohonan, kita minta mengisi formulir yang ada di map dan memasukkannya ke kotakkotak yang telah disediakan di ruang wawancara,” katanya. Beberapa upaya yang dilakukan, menurut Aruan, menyediakan costumer care/servis yang siap melayani masyarakat, menerapkan sistem antrean pelayanan elektronik, menyediakan perangkat sistem pengecekan status permohonan,

menyediakan perangkat sistem dan televisi display pemberitahuan paspor yang telah selesai, menyediakan papan persyaratan, biaya dan prosedur pengurusan paspor serta menyediakan brosur jenis, persyaratan, biaya dan lama penyelesaian. “Bahkan kami juga menyiapkan fasilitas SMS paspor selesai. Pemohon akan kami SMS jika paspornya telah selesai dan dapat diambil hanya dengan menunjukkan SMS tersebut,” katanya. Menurut Aruan, paspor selesai dalam waktu empat hari sejak permohonan dimasukkan. Biayanya Rp255 ribu untuk paspor 48 lembar. Sedangkan syarat-syarat yang diperlukan, yakni fotokopi KTP, Kartu Keluarga (KK), akta lahir atau ijazah atau surat kawin dengan menunjukkan aslinya. “Jika dalam empat hari paspor belum selesai, pemohon dapat melaporkannya melalui layanan SMS yang kita sediakan untuk segera kita cari tahu kendalanya,” ujar Aruan. Dia menambahkan, Kantor Imigrasi Kelas I Khusus Medan melayani 800 pemohon paspor setiap minggu atau sekitar 3.500 orang per bulan. “Kebanyakan pemohon berusia 40 tahun ke atas dengan alasan berobat ke luar negeri,” pungkasnya. Pembukaan kotak survei dan evaluasi kepuasan masyarakat tersebut disaksikan tokoh masyarakat H. Amhar Nasution MA, Bripka R Sembiring dari kepolisian dan Rayendra Ginting dari Dinas Informasi dan Komunikasi (Infokom) Provinsi Sumatera Utara. (m38)

Waspada/Surya Efendi

TIDUR DI BADAN JALAN: Tiga warga tertidur di badan Jln. Imam Bonjol depan gedung DPRDSU, Rabu (13/6). Ruas jalan itu lengang karena ditutup untuk sementara setelah terjadi aksi unjukrasa.

Tipu Rekan Bisnis Rp278 Juta

Pengusaha Bungkil Sawit Ditangkap MEDAN (Waspada): Seorang pengusaha bungkil sawit asal Surabaya ditangkap petugas Reskrim Unit Resum Polresta Medan, Selasa (12/6) malam, dengan tuduhan melakukan penipuan dan penggelapan senilai Rp278 juta terhadap rekan bisnisnya. Tersangka Herijanto Kurniawan, 34, yang bermukim di Perumahan Jasmin Mas Blok B16, Jln. Pertahanan, Desa Patumbak, Deliserdang ini, selanjutnya diboyong ke Polresta Medan. Menurut korban Mulia, 38, warga Jln. Mojopahit Medan kepada wartawan, Rabu (13/6), peristiwa berawal ketika dirinya berkenalan dengan tersangka pada Juni 2011. Setelah itu, pada Agustus 2011, tersangka mengirimkan pemberitahuan melalui e-mail kepada korban tentang permintaan order bungkil sawit di PT Great Griant Pine Apple Company di Lampung. Tersangka menjanjikan kepada korban akan mendapat keuntungan Rp50-100 per kg dari 230 ton bungkil sawit yang dijual seharga Rp1.200 per kg. Tersangka menyediakan bungkil sawit itu dari Pulau Jawa. Korban hanya disuruh membayar kalau kiriman bungkil sawit

sudah sampai ke perusahaan di Lampung. Korban yang tertarik dengan tawaran itu kemudian membayar kepada tersangka setelah bukti penerimaan barang dari perusahaan di Lampung diterimanya melalui e-mail. “Ada beberapa kali kita transfer uang kepada tersangka

yang seluruhnya berjumlah Rp278 juta,” jelas korban kepada wartawan saat melihat tersangka di Polresta Medan. Tapi setelah dua bulan lebih ketika korban menagih uang yang sudah dikirim kepada tersangka berikut keuntungannya, tersangka berdalih kalau di PT Great Griant Pine Apple Com-

Waspada/Rudi Arman

PENYIDIK Resum Polresta Medan ketika melakukan pemeriksaan terhadap tersangka Herijanto Kurniawan sebelum dijebloskan dalam tahanan Polresta Medan, Rabu (13/6).

pany di Lampung ada masalah. Sebab, bungkil yang dikirim belum mencapai target yakni 300 ton. Korban yang mulai curigai kemudian menghubungi temannya yang pernah bekerjasama dengan perushaan tersebut. “Setelah dicek ternyata tidak ada kiriman bungkil sawit masuk dari pulau Jawa atas nama tersangka ke perusahaan tersebut,” jelas korban seraya menambahkan ada delapan orang lagi yang menjadi korban penipuan yang dilakukan tersangka. Merasa telah menjadi korban penipuan dan penggelapan, korban membuat laporan polisi ke Polresta Medan sesuai LP/546/II/2012/Resta Medan tanggal 27 Februari 2012. Berdasarkan laporan tersebut, Unit Resum Polresta Medan melakukan penangkapan terhadap tersangka dari kediamannya. “Tersangka ditangkap karena sejak pemanggilan I hingga II tidak datang,” jelas petugas di Polresta Medan Tersangka dikenakan pasal 378-372 KUHPidana dengan ancaman hukuman lima tahun. Saat menjalani pemeriksaan, tersangka mengaku tidak sanggup membayar karena menjadi korban penipuan. (m39)

Alumni Daar Uluum Dukung Fadly Nurzal Jadi Gubsu MEDAN (Waspada): Alumni Pondok Pesantren (Ponpes) Daar Uluum Kisaran menyampaikan kebulatan tekad dan komitmen memenangkan H. Fadly Nurzal, SAg menjadi Gubernur Sumatera Utara periode 2013-2018. Komitmen dan kesepakatan itu disampaikan saat reuni alumni Ponpes Daar Uluum Kisaran, di Bagan Asahan, baru-baru ini. Hadir para alumni Ponpes Daar Uluum Asahan dari seluruh daerah di Sumatera Utara. Bahkan ada yang datang dari Jakarta, Malaysia, Singapura serta daerah lainnya. Menandai dukungan itu, para alumni Ponpes Daar Uluum Kisaran menepungtawari H Fadly Nurzal, SAg dan istri Hj. Liliawidia Astuti. Setelah itu, dilanjutkan dengan doa bersama untuk kemenangan Fadly Nurzal pada Pilgubsu mendatang. Menyikapi dukungan itu, H. Fadly Nurzal mengaku sangat terharu dan berterima kasih. Kata dia , dukungan alumni tersebut merupakan motivasi dan dorongan yang kuat untuk terus bersemangat melaksanakan berbagai aktivitas dalam rangka melayani umat. Bahkan, Fadly tidak menyangka bahwa reuni ini dihadiri seluruh alumni dari berbagai daerah. Karena itu, Fadly berharap kebersamaan dan kekompakan alumni Daar

Uluum Kisaran tetap terjaga. “Dengan reuni ini, mudahmudahan silaturahmi di antara kita tetap terpelihara sehingga menjadi satu kekuatan untuk melakukan kerja-kerja keumatan,” ujarnya. Sebagai orang yang pernah mengikuti pendidikan di Ponpes, Fadly yakin alumni Daar Uluum Kisaran adalah orang-orang yang berkualitas, mandiri dan memiliki akhlak

mulia. Saat ini, alumni Ponpes Daar Uluum Kisaran, ada di segala lini kehidupann dengan kapasitas masing-masing. Karena itu, Fadly berharap seluruh alumni tidak meninggalkan tradisi baik selama di Ponpes, yakni persaudaraan yang sangat kuat. “Suka duka dan dinamika kehidupan di Ponpes telah menempa kita semua menjadi satu keluarga,” ucapnya. Reuni itu diakhiri dengan

foto bersama seluruh alumni dengan Cagubsu H Fadly Nurzal, SAg didampingi istri Hj. Liliawidia Astuti. Turut hadir H. Yulizar P Lubis Sekretaris DPW PPP Sumut yang juga Sekretaris PW Al Washliyah Sumut, H Bustami HS (anggota DPRDSU), Faisal Hutabarat, M Soleh Tanjung, Mursal Harahap dan pengurus DPC PPP Kota Tanjungbalai dan DPC PPP Kabupaten Asahan.(m48)

Dua Tahun Buron, Pencuri Diciduk MEDAN (Waspada): Setelah dua tahun diburon, seorang pelaku pencurian di Pajak Palapa, Kec. Medan Barat, diringkus petugas Polsek Medan Barat, di kawasan Jln.Yos Sudarso Medan, Rabu (13/6) sekira pukul 05:00. Tersangka Rif alias Iban, 32, warga Jln. Mayor, Kec. Medan Barat, diringkus petugas berdasarkan laporan dari korban Heriati br Butar-butar, 53, warga Jln. Veteran, Desa Helvetia, Kec. Labuhandeli, pada 18 November 2010 lalu. Sedangkan teman tersangka Rif bernama Syafrizal Natuion, sudah keluar dari Lembaga Pemasyarakatan Tanjunggusta usai menjalani masa hukumannya 1 tahun 2 bulan penjara.

Informasi yang diperoleh di kepolisian, pada 18 Nopember 2010, tersangka Rif alias Iban dan temannya Syafrizal Nasution membongkar kios milik korban di Pajak Palapa. Dari dalam kios, pelaku menggondol beberapa pakaian dan disimpannya di suatu tempat, tak jauh dari kios itu. Aksi pencurian tersebut akhirnya diketahui oleh pedagang lainnya dan dilaporkan kepada korban yang meneruskan ke Polsek Medan Barat. Berdasarkan laporan itu, polisi meringkus Syafrizal Nasution, sedangkan tersangka Rif melarikan diri ke Pulau Batam. Selama hampir dua tahun bersembunyi di Pulau Batam,

dia kembali ke Medan. Petugas Polsek Medan Barat mendapat informasi buronannya kembali ke rumahnya, langsung meringkus tersangka Rif saat berada di Jalan Yos Sudarso. Kanit Reskrim Polsek Medan Barat AKP Anthoni Simamora saat dikonfirmasi menjelaskan, hingga saat ini tersangka Rif alias Iban tidak mengaku kalau dirinya turut terlibat dalam aksi pencurian tersebut. “Tersangka sudah kita amankan, tapi sampai saat ini dia tidak mengaku melakukan pencurian tersebut dengan alasan saat kejadian itu berada di Batam. Tersangka akan segera dikonfrontir dengan korban,” kata Anthoni. (h04)

Medan Metropolitan

WASPADA Kamis 14 Juni 2012


Tujuh Truk Masuk Inti Kota Ditilang MEDAN (Waspada): Diduga banyaknya truk yang memasuki inti Kota Medan karena dibacking oleh oknum-oknum tertentu, sehingga para sopir truk berani melintasi jalan raya di inti kota.Walau sudah banyak sopir truk yang telah diberi surat tilang oleh petugas Sat Lantas Polresta Medan, namun para sopir sepertinya membandal. Pantauan Waspada, Rabu (13/6), tujuh truk yang masuk inti kota termasuk truk molen yang membawa semen curah ditilang petugas Operasi Simpatik Toba 2012 Sat Lantas Polresta Medan, saat melintas di Jalan Imam Bonjol, Diponegoro, Kapten Maulana Lubis dan Jalan Gaharu. Sehari sebelumnya, di lokasi yang sama, juga telah ditilang enam truk termasuk truk molen.

Satu truk molen yang melintas di Jalan Kapten Maulana Lubis persis depan kantor Wali Kota Medan, terpaksa dihentikan petugas. Begitu truk molen berhenti dan sopirnya turun dari truk, petugas langsung memberikan surat tilang. Namun, sebelum menandatangani surat tilang tersebut, sopir truk langsung menghubungi seseorang via telepon seluler yang diduga sebagai backing. Selanjutnya, oknum yang diduga sebagai backing tersebut berbicara kepada petugas Sat Lantas. Namun, keinginan oknumyangdidugasebagaibacking truk molen tersebut ternyata tidak digubris dan petugas Operasi Simpatik Toba 2012 tetap memberikan surat tilang. Kasat Lantas Polresta Medan Kompol M Risya Mustario

menjelaskan, pihaknya tidak mentolerir truk-truk yang masuk inti kota, meskipun truktruk diduga dibacking oleh oknum tertentu. Bila ditemukan, sopir truk akan ditilang. “Saya hanya menjalankan perintah pimpinan. Kalau ada urusan oknum yang membacking, semuanya saya serahkan kepada pimpinan. Jelasnya truk masuk inti kota tetap ditindak dan ditilang,” kata Risya. Sementara itu, Operasi Simpatik Toba 2012 yang digelar Rabu (13/6), petugas menilang 565 pengendara kendaraan bermotor, termasuk di antaranya tujuh truk yang masuk inti kota dan dua mobil plat hitam. Mobil plat hitam tersebut ditilang ketika melintas di Jln. Letda Sujono dan Jln. Sisingamangaraja membawa penumpang.

Pengendara sepedamotor yang tidak menyalakan lampu utama sebanyak 206 orang diberikan surat tilang, disusul pelanggaran tidak memakai helm 102 orang, melanggar lampu merah 139 orang, dan tidak melengkapi perlengkapan sepedamotor 156 orang. (h04)

TULIS SURAT TILANG: Petugas Sat Lantas Polresta Medan menulis surat tilang usai menghentikan satu truk pengangkut semen curah di depan Kantor Wali Kota Medan, Rabu (13/6). Waspada/Surya Efendi

38 Perwira Poldasu Dimutasi Mantan Lurah Tanjungsari DPO Polresta Kompol Dony Alexander Jadi Kasat Narkoba Polresta Medan MEDAN (Waspada): “38 Perwira di lingkungan Polda Sumut dimutasi sebagai langkah penyegaran organisasi di tubuh Polri,” kata Kabid Humas Poldasu Kombes Pol. Heru Prakoso kepada wartawan di Mapolda Sumut, Rabu (13/6). Menurutnya, mutasi serta promosi jabatan dalam organisasi kepolisian merupakan hal yang biasa. Tujuannya, sebagai penyegaran dan meningkatkan pelayanan kepada masyarakat. Berdasarkan Telegram (TR) Kapoldasu Irjen Pol. Wisjnu Amat Sastro No: 483/VI/2012 dan Referensi Keputusan Kapoldasu No: Kep/364/VI/2012 tanggal 11 Juni 2012, terdapat 38 perwira menengah (Pamen) dan perwira pertama (Pama) yang mengalami re-organisasi. Mereka diantaranya, AKBP Yusmeri Ginting Kabag Bin Opsnal Dit Binmas Poldasu diangkat dalam jabatan baru sebagai

Kasubdit Bin Satpam/Polsus Dit Binmas Poldasu. Jabatan ditinggalkan Yusmeri diisi AKBP Arsenius Purba, yang sebelumnya Kabag Faskon Rosarpras Poldasu Kemudian AKBP J. Lingga sebelumnya Kasubdit Bin Polmas Dit Binmas Poldasu menggantikan AKBP Arsenius Purba. Jabatan yang ditinggalkan J. Lingga akan diisi AKBP Hartini sebelumnya bertugas di Analis Kebijakan Muda Bidang Pidum Dit Reskrimum Poldasu. “Dari seluruh perwira yang menjalani rotasi tugas, satu Pamen merupakan pindahan dari Polda Aceh ke Poldasu, yakni

Rusak Gembok Pagar Diadukan Ke Polisi MEDAN (Waspada): Tuty Rotua Br Panggabean, 37, mengadukan seorang warga berinisial GTP dalam kasus pengerusakan dan perasaan tidak senang, ke Polsek Sunggal, Rabu (13/6) sore. Saksi mata kepada Waspada di lapangan mengatakan, Tuty, penduduk Jln. Iskandarmuda No.9, Kel. Merdeka, Kec. Medan Baru, sebelumnya pergi melihat sebidang tanah miliknya di Jln. Binjai Km 11,5 Desa Pujimulio, Kec. Sunggal, Deliserdang. Setiba di lokasi, korban bersama stafnya melihat dinding tembok batas tanah miliknya telah bercoretan, sedangkan di atas lahan milik korban ada plang bertuliskan tanah ini milik Charles Sihombing. Selain itu juga korban mendapati gembok pintu pagar telah dirusak dan diganti dengan gembok yang baru. Selanjutnya, Tuty mencari informasi dari warga setempat seputarpelaku yang mencorat-coret tembok dan merusak gembok pagar tersebut. Kemudian korban Tuty membuat laporan pengaduan ke Polsek Sunggal. Kapolsek Sunggal Kompol M Budi Hendrawan SH, SIK ketika dikonfirmasi membenarkan adanya pengaduan Tuty Rotua Br Panggabean itu. “Kita telah menurunkan personel ke Tempat Kejadian Perkara (TKP) melakukan penyelidikan,” ujarnya. Menurut Budi, dalam kasus tersebut, korban dan sejumlah saksi lainnya sudah diambil keterangannya. Sedangkan pelakunya masih dalam penyelidikan. (m36)

Penganiaya Pegawai PD Pasar Dibekuk MEDAN (Waspada): Pelaku penganiayaan terhadap pegawai PD Pasar ditangkap petugas Polsek Medan Area dari Pasar Sukaramai, Selasa (12/6). Tersangka M yang juga Ketua P3TM Sukaramai masih menjalani pemeriksaan polisi. Kapolsek Medan Area Kompol Sony W Siregar didampingi Kanit Reskrim AKP J Banjarnahor membenarkan penangkapan tersebut. “Sudah kita amankan. Saat ini yang bersangkutan masih menjalani pemeriksaan di ruang juru periksa,” katanya. Tersangka ditangkap polisi berdasarkan pengaduan pegawai PD Pasar Sukaramai Makmur Dalimunthe, 38, warga Jln. Gatot Subroto Medan. Korban dianiaya tersangka sehingga harus dirawat di rumah sakit Permata Bunda Jln. SM Raja Medan. Peristiwa pemukulan itu terjadi Jumat (1/6) malam. Saat itu, korban melarang Mardi yang akan mendirikan lapak dagangan miliknya di atas trotoar kawasan Sukaramai. “Setelah memeriksa sejumlah saksi serta memperoleh hasil visum, polisi menangkap tersangka,” ujar Kapolsek. (m39)

Kultur Masyarakat Minang Sudah Jauh Bergeser MEDAN (Waspada): Ketua Ikatan Keluarga Kamang Mudiak (IKKM) Sumut, Ir Revolkhair SH Pk.Mancayo mengatakan, saat ini kultur masyarakat khususnya yang berasal dari Minang sudah jauh bergeser dibanding beberapa puluh tahun sebelumnya. “Sekarang masyarakat lebih mengedepankan kepentingan individu dibanding kepentingan sosial atau orang banyak. Berbeda zaman dulu yang lebih mengedepankan sosial,” kata Ir Revolkhair pada acara peringatan Perang Kamang 1908 ke-104 di Rumah Gadang BM 3, Jln. Adinegoro, Minggu (10/6). Kegiatan tersebut dirangkai dengan bakti sosial berupa pengobatan gratis mata katarak dan penyakit umum untuk 500 pasien, serta pembagian sembako kepada 300 warga yang membutuhkan. Menurut dia, sifat atau kepentingan sosial seperti bergotongroyong jauh lebih penting dibanding individu. Karena itu, peringatan kegiatan ini sebagai salahsatu upaya mengembalikan kultur tersebut. Untuk mengembalikan kultur tersebut, lanjutnya, dilaksanakan makan serempak menggunakan daun pisang. “Ini untuk merekatkan kembali persaudaraan dan jiwa kebersamaan,” ujarnya sembari menyampaikan terima kasih atas dukungan berbagai pihak. Sedangkan Koordinator Bakti Sosial Sadikin Lie menuturkan, pengobatan gratis dilakukan Lions Club Medan Garuda, pembagian sembako diprakarsai Bankom Sriti Polda Sumut, Pemuda Mitra Kamtibmas (PMK) Sumut dihadiri Ketua Rajamin Sirait SE, serta Paguyuban Sosial Marga Tionghoa Indonesia (PSMTI) Sumut, Eddy Djuandi dan beberapa lainnya serta peluncuran majalah IKKM Sumut ‘Tabuah Rang Kamang’ juga kesenian tradisional Saluang. (m39)

AKBP M. Harun Hasyim, akan menduduki jabatan Kasubbid Dalkeu Bidkeu Poldasu,” kata Heru. Perwira lainnya yang menjalani penyegaran, kata Heru, yakni AKP Darwin Sitepu Panit Unit III Subdit II Dit Intelkam Poldasu diangkat sebagai Kapolsek Pancurbatu. Lalu, Kapolsek Medan Baru Kompol Dony Alexander dipromosikan sebagai Kasat Narkoba Polresta Medan. Jabatan yang ditinggalkan Dony diisi Kompol Muchamad Budi Hendrawan, sebelumnya Kapolsek Sunggal. Kabag Ops Polres Nias Selatan Kompol Edward Nauman Saragih diangkat sebagai Kabag Ops Polres Tanah Karo, penggatinya AKP Zonni Aroma, me-

rupakan lulusan Sespimma 2011. Sedangkan Kabag Ops Polres Tanah Karo Kompol Zul-kifli menjabat Kasi Bintibmas Subdit Bintibluh Dit Binmas Poldasu. Kasubbag Kermalatops Bagbinlatops Roops Poldasu Kompol TA Manaf diangkat sebagai Kasubbag Renmin Poldasu menggantikan Kompol Jasri yang diangkat sebagai Analis Kebijakan Pertama Bidang TI Bid TI Poldasu. Sedangkan jabatan TA Manaf, diisi AKP Henri Riston Sibarani, lulusan Sespimma Polri 2011. 6 Sespimmen Dalam TR Kapoldasu itu terdapat enam perwira yang mengikuti Sespimmen Polri Dikreg ke-52, yaitu AKBP Budi Satrio (Kaden A Sat Brimob Pol-

dasu), Kompol Jukiman Situmorang (Kanit II Subdit I Dit Reskrimum Poldasu), Kompol Fadillah Zulkarnaen (Kanit II Subdit III Dit Reskrimum Poldasu), Kompol Marsdianto (Kasubbag Mutjab Bagbinkar RO SDM Poldasu), Kompol Juli Agung Pramono (Kasat Narkoba Polresta Medan) serta Kompol M Anggi Naulifar Siregar (Wakapolres Pematangsiantar). Kombes Heru Prakoso mengatakan, jadwal serah terima jabatan (sertijab) tergantung kepada masing-masing Polres. Sedangkan untuk Poldasu tergantung kepada Satker masingmasing. “Tetapi paling lama 14 hari setelah TR terbit, sudah harus dilaksanakan sertijab,” demikian Heru. (m27)

Dua Kelompok Pemuda Bentrok Satu Rumah, Sepedamotor Dirusak MEDAN (Waspada): Dua kelompok pemuda bentrok di Gang Lestari, Jln. Pintu Air IV, Kel. Kwala Bekala, Kec. Medan Johor, Rabu (13/6) sekira pukul 02:00 dini hari. Dalam kejadian itu tidak ada korban jiwa, namun satu unit sepedamotor dan satu rumah warga sekitar mengalami kerusakan setelah diserang kelompok pemuda yang diduga berasal dari daerah Simalingkar. Akibat bentrokan tersebut, suasana di kawasan Jln. Pintu Air IV mencekam dan menim-

bulkan keresahan warga. Informasi yang dihimpun di lapangan menyebutkan, dini hari itu salah satu kelompok pemuda melintas di daerah tersebut. Secara bersamaan kelompok pemuda lainnya datang dari arah berlawanan. Diduga selama ini kedua kelompok itu telah mempunyai permasalahan, mereka langsung terlibat perang batu, sehingga satu unit sepedamotor milik salah seorang kelompok pemuda itu yang tertinggal di lokasi dirusak kelompok pe-

muda lawannya. Kapolsek Delitua Kompol SP Sinulingga didampingi Kabag Ops Polresta Medan Kompol SF Napitupulu saat dikonfirmasi mengatakan, hingga saat ini motif perselisihan kedua kubu pemuda tersebut belum diketahui secara pasti. Namun dugaan sementara karena masalah selisih di jalan dan perebutan lahan. “Kita masih mencari orang-orang kedua kelompok itu,” ujar Sinulingga.(m40)

Yayasan RS Rusdi Dituding Tidak Berbadan Hukum MEDAN (Waspada): Ketua Yayasan Rumah Sakit Dr. Rusdi berinisial MRN dituding telah lalai menjalankan tugasnya karena tidak pernah mengadakan rapat pengurus yayasan. Bahkan, dia juga lalai mendaftarkan yayasan tersebut pada Kementerian Hukum dan Hak Azasi Manusia RI cq Direktorat Jenderal Adsminitrasi Hukum Umum sesuai dengan UU No 16 dan Perubahan UU No 28 tentang yayasan. “Akibat kelalaiannya itu, maka Yayasan Rumah Sakit Dr. Rusdi Medan tidak terdaftar di Kementerian Hukum dan HAM RI-Direktorat Jenderal Administrasi Hukum Umum dan tidak berbadan hukum,” sebut Lisa Yulina Nasution, SPd selaku Sekretaris Yayasan Rumah Sakit Dr Rusdi didampingi kuasa hukumnya Daud S, SH, MH, Jumat(8/6)diMapolrestaMedan. Menurut Lisa, sesuai surat keterangan dari Kemenkum dan HAM-Ditjen AHU No AHU. 2.AH.01.01-7440 tanggal 24 Mei 2011, disebutkan bahwa yayasan yang dipimpin MRN tidak berbadan hukum dan belum terdaftar. Sebab, yayasan tersebut tidak tercatat dalam daftar yayasan sebagai Badan Hukum. Selain itu, lanjut Lisa, saat MRN memohon surat keputusan No 71/D/O/2009 tanggal 7 Juni 2009 dan memohon perpanjangan izin Politekes kepada Mendiknas RI dan Kopertis Wilayah I Sumut-Aceh, diduga juga cacat hukum. Alasannya? Surat permohonan MRN yang mengatasnamakan dirinya sebagai Ketua Yayasan RS Dr. Rusdi (d/h Glugur) diduga tidak sah/melanggar hukum. Sebab, Yayasan RS Dr Rusdi tersebut tidak berhak lagi menggunakan nama yayasan di depannya karena tidak terdaftar sebagai badan hukum di Ditjen AHU. Akibat perbuatannya itu dan diduga telah memberi keterangan palsu sehubungan dengan permohonan kepada Menteri Pendidikan Nasional

RI melalui suratnya No.024/ YRSU/ DR.RUSDI/VII/2008 tertanggal 25 Juli 2008, Ketua Yayasan RS Dr. Rusdi berinisial MRN dilaporkan ke Polresta Medan. Lisa menambahkan, pengaduan itu juga berkaitan dengan perbuatan Ketua Yayasan RS Dr Rusdi yang telah mengajukan /mengusulkan kepada Menteri Pendidikan Nasional melalui Direktur Jenderal Pendidik Tinggi tentang pengalihan pembinaan Akademi Fisioterapi, Akademi Keperawatan dan Akademi Analis Kesehatan YRSU Dr Rusdi dari Departemen Kesehatan ke Departemen Pendidikan Nasional sekaligus mengubah bentuk menjadi Politeknik Kesehatan (Politekes) YRSU Dr Rusdi dengan empat program studi yaitu Fisioterapi D-IV, Fisioterapi D-II, Keperawatan D-III melalui surat No.024/ YRSU/VII/2008 tertanggal 25 Juli 2008. Pengajuan/usulan tersebut tanpa melalui rapat pengurus yayasan dan tanpa persetujuandarisenatdosenserta direktur akademi terlebih dahulu. Selama ini, kata Lisa, Yayasan RS Dr. Rusdi Medan mengelola dua akademi yaitu Akademi Analis Kesehatan dan Akademi Keperawatan yang izin operasinya dikeluarkan oleh Menteri Kesehatan RI. Dengan terbitnya surat keputusan Menteri Pendidikan Nasional RI No.71/ D/O/2009 tanggal 17 Juni 2009, maka pada tahun 2009/2011 MRN telah membuat pengumuman penerimaan mahasiswa/i Politekes Dr. Rusdi dengan empat program studi di kampus baru Jln. H Adam Malik (Glugur By Pass), Kelurahan Silalas Kecamatan Medan Barat. Menurutnya, penerimaan mahasiswa/i di Politekes Yayasan RS Dr Rusdi adalah cacat hukum karena tidak berbadan hukum dan tidak terdaftar di Kementerian Hukum dan Hak Asasi Manusia Republik Indonesia cq Direktorat Administrasi Hukum Umum. Hal itu dibukti-

kan dengan surat keterangan Kementerian Hukum dan Hak Asasi Manusia Republik Indonesia-Direktorat Jenderal Administrasi Hukum Umum No.AHU.2.AH.01.01-7440,tanggal 24 Mei 2011 yang menyebutkan yayasan tersebut belum terdaftar sehingga tidak tercatat dalam daftar yayasan sebagai badan hukum. Sementara itu, Ketua Yayasan RS Dr Rusdi Medan, MRN yang hendak dikonfirmasi di kantor Yayasan di Jln. H. Adam Malik Medan, Sabtu (9/6), tidak berada di tempat. Salah seorang stafnya mengatakan, MRN tidak ada di kantor.”Ibu tidak ada di kantor bang, ibu jarang ke kantor,” ujar salah seorang stafnya. Ketika Waspada mendatangi kediamannya di Jln. H Adam Malik No 134, salah seorang pekerja mengatakan MRN tidak ada di rumah. Saat dikonfirmasi via telefon seluler, MRN juga tidak mau mengangkat handphone-nya. Begitu juga saat diberikan sejumlah pertanyaan via pesan singkat (SMS), MRN belum juga membe-rikan jawaban. (h04)

MEDAN (Waspada): Kapolresta Medan diminta menindaklanjuti perkara tindak pidana menyuruh menempatkan keterangan palsu ke dalam suatu akta autentik, atau penggelapan hak atas barang tidak bergerak dilakukan mantan Lurah Tanjungsari berinisial DD, yang kini masuk dalam Daftar Pencarian Orang (DPO). “Laporan ke Polresta Medan disampakan Juli 2006, dan pada Desember 2011 DD masuk dalam DPO Polresta Medan,” kata pelapor Dulang Martopo melalui kuasa hukumnya Erfin Jamal Lubis SH, Rabu (13/6).

Dijelaskannya, DD, 57, penduduk Jln. KelambirV, Desa Tanjung Gusta, Helvetia Medan, dilaporkan atas dugaan melakukan pemalsuan surat tanah seluas 1.800 meter di Jln. Pasar I AsamKumbang,Medan Sunggal, dengan maksud menguasainya. Laporan polisi tertuang dalam LP/2184/VII/2006/Ops/ Tabes 19 Juli 2006, diproses Aiptu Jhonson Unit Reskrim Polresta Medan, dan dinyatakan DD telah melanggar pasal 266 (1) dan (2) atau 385 KUH Pidana. Namun setelah 6 tahun lebih kasus itu berjalan, hingga kini masih mengambang.

Dia mengatakan, 30 Desember 2011 Polresta Medan mengeluarkan surat DPO terhadap DD dengan nomor surat No. DPO/870/XII/2011/Reskrim ditandatanganiWakapolresta Medan AKBP Pranyoto. Karenanya, Erfin berharap Kapolresta Medan dapat segera menindaklanjuti proses hukum terhadap DD. Menurut dia, DD masih terlihat di seputaran Tanjung Gusta dan kawasan Binjai. DD juga selalu mengumbar kata tidak bisa ditangkap meskipun sudah masuk DPO karena mengaku dekat dengan oknum aparat di Polresta Medan. (m27)

PRT Curi Uang Majikan Ditangkap MEDAN (Waspada): Seorang pembantu rumah tangga (PRT) bersama dua komplotannya ditangkap Polsek Percut Seituan dalam penyergapan terpisah di Nusa Tenggara Timur (NTT) dan Medan. Tersangka MG, 31, warga Tugu Huhe NTT, ditangkap dari kediamannya di NTT bersama pacarnya JS, 26, warga Simpang Pelita, Riau, dan penarik betor berinisial A, warga Medan. Kapolsek Percut Seituan Kompol Maringan Simanjuntak melalui Kanit Reskrim AKP Faidir Chaniago kepada wartawan, Selasa (12/6) mengatakan, tersangka MG dan JS ditangkap dari NTT, Jumat (8/6). Sedangkan tersangka A, penarik betor ditangkap terlebih dahulu di Medan. “Tersangka A ditangkap karena terlibat atau ikut mengantarkan kedua tersangka ke terminal Amplas untuk berangkat melarikan diri usai mencuri di rumah ma-

jikannya. A mendapatkan bagian Rp4 juta,” katanya. Dar i penangkapan A, lanjutnya, polisi melakukan pengembangan dan mengetahui tempat pelarian MG dan JS di NTT. “Polisi kemudian menuju ke kediaman MG dan menangkap keduanya,” sebut Faidir. Dari kedua tersangka disita barang bukti uang Rp12,9 juta, perhiasan emas seperti kalung, anting-anting, dua handphone dan pakaian yang dibeli dari uang hasil kejahatan. Pencurian itu terjadi 28 Mei 2012. Tersangka MG yang sudah dua tahun bekerja di tempat majikannya Minar Siahaan, 40, warga Jalan Masjid Pasar II, Bandar Klippa, diajak pacarnya JS mencuri di rumah majikannya. Padahal, korban Minar Siahaan masih mempunyai hubungan saudara dengan tersangka JS. “Keduanya mencuri perhiasan emas, uang Rp70 juta

milik korban. Rencananya uang hasil curiannya akan digunakan keduanya untuk biaya menikah,” jelas Faidir. Kata Faidir, tersangka MG dititipkan di tahanan Polresta Medan, sedangkan tersangka JS dibantarkan ke RS Bhayangkara karena sakit. Sedangkan A sudah dikirim ke RutanTg. Gusta. Togel Selain itu, Polsek Percut Seituan menangkap dua penulis judi togel dalam penyergapan terpisah tidak jauh dari kediaman masing-masing. Dari tersangka M alias Lelo, 47, warga Jalan Bestaman Pasar X, Bandar Klippa, dan Suhartadi Santoso, 39, warga Tembung, disita barang bukti 2 kertas rekapan nomor togel, uang Rp500 ribu, handphone berisikan nomor tebakan togel. “Kedua tersangka ditangkap Senin (11/6) dan saat ini sudah dijebloskan dalam sel tahanan,” tutur Faidir. (m39)

PN Medan Kabulkan Gugatan Hardi Mulyono

Wali Kota Diminta Lunasi Pinjaman MEDAN (Waspada): Ketua Fraksi Partai Golkar (FPG) DPRDSU Hardi Mulyono, mengaku gembira. Sebab, Pengadilan Negeri (PN) Medan mengabulkan gugatannya terhadap Wali Kota Medan Rahudman Harahap. Selasa (12/6), Hardi Mulyono menjelaskan putusan hakim PN Medan tentang gugatannya terhadap Wali Kota Medan. Yakni tentang pelunasan pinjaman sejumlah Rp350 juta dari total Rp2 miliar. Saat memberi keterangan, Hardi Mulyono, didampingi kuasa hukumnya Warinson Sinaga, Halomoan Situmorang dan Ady Girsang. Kuasa Hukum Hardi Mulyono, Warinson Sinaga mengatakan, hakim PN Medan yang diketuai Surya Perdamaian lewat putusannya No. 597/Pdt.G/ 2011/PN Mdn pada 1 Juni 2012, memerintahkan Rahudman segera mengembalikan kerugian material Rp350 juta ditambah bunga 3,5 persen selama setahun kepada Hardi Mulyono. Salinan putusan PN Medan itu baru mereka terima 12 Juni 2012. Dalam gugatannya, Hardi Muly ono meny ebutkan, Rahudman menerima uang Rp2 miliar pada 10 Juni 2010 di Hotel Polonia. Uang tersebut

akan digunakan untuk membayar saksi-saksi di Tempat Pemungutan Suara (TPS) pada Pilkada Medan tahap kedua. ‘’Janjinya, begitu terpilih menjadi wali kota, uang itu dipulangkan,’’ kata Hardi. Namun, janji Rahudman tidak pernah ditepati. Berkalikali Hardi Mulyono, meminta kepastian agar segera melunasi pinjaman tersebut. Somasi yang dilayangkan Hardi, hanya disikapi Rahudman dengan cara mencicil pembayaran. Pembayaran pertama dilakukan Rahudman pada 17 Juli 2010 sebesar Rp1 miliar. Pembayaran kedua 12 Januari 2011 Rp300 juta. Selanjutnya 11 Maret 2011 Rp100 juta, 15 April 2011 Rp50 juta, 28 Juni 2011 Rp50 juta dan 20 Agustus 2011 Rp150 juta. Namun, sisa pinjaman sebesar Rp350 juta tidak pernah dibayar, meski Hardi Mulyono melakukan somasi kedua pada 2 November 2011. ‘’Karena somasi itu tidak ditanggapi akhirnya saya menggugatnya ke pe-

ngadilan, melalui kuasa hukum saya ini,’’ kata Hardi. Saat masalah ini ditangani pengacara, sikap Rahudman juga tidak berubah. Tiga kali kuasa hukum Hardi Mulyono melakukan somasi, tapi tidak pernah ditanggapi. Yakni pada 14 November 2011, 18 November 2011 dan 21 November 2011. Karena merasa menemui jalan buntu, akhirnya pada 1 Desember, masalah ini diteruskan ke pengadilan. Sekarang, setelah kuasa hukum menerima salinan putusan dari PN Medan, Rahudman diberi waktu 14 hari untuk bersikap. Menerima putusan atau melakukan banding. ‘’Kalau pak Rahudman menerima putusan ini, maka dia harus segera membayar sisa pinjaman berikut bunganya,’’ kata Warinson. Sementara itu, Wali Kota Medan Rahudman Harahap yang hendak dikonfirmasi Waspada, tidak berada di tempat. Menurut stafnya, wali kota sedang bertugas ke luar kota. (m12/m50)



Waspada Yuslan Kisra

DARI kiri Aditya Pramono, Abdul Muin Pulungan, Djohar Arifin Husin, Hendrik Gunawan dan Salim.

4 Mahasiswa UISU Temui Djohar JAKARTA (Waspada): Polemik berkepanjang yang terjadi seputar pengelolaan kampus membuat empat mahasiswa Universitas Islam Sumatera Utara (UISU) menyambangi Ketua Umum PSSI, Djohar Arifin Husin. Tujuannya, adalah meminta arahan Djohar selaku mantan rektor perguruan tinggi pertama yang didirikan di luar Pulau Jawa, yakni pada 7 Januari 1951, dalam penyelesaian polemic yang terjadi saat ini. Keempat mahasiswa tersebut adalahAbdul Muin Pulungan, Salim, Hendrik Gunawan, Aditya Pramono. “Secara kebetulan, kami ada kegiatan di Bogor, sehingga menyempatkan diri menemui Pak Djohar. Sebab beliau adalah mantan rektor kami,” ujar Pulungan mewakili rekan-rekannya kepada Waspada usai menemui Djohar di PSSI, Senayan, Jakarta, Selasa (12/6). Sebagai mahasiswa, lanjut mahasiswa yang saat ini duduk di semester IV FAI UISU, ia bersama teman-temannya sangat khawatir atas kondisi yang terjadi saat ini. Hal tersebut menyangkut keberadaan mereka di kampus yang menurutnya saat ini telah memiliki dua rektor. Karena itulah, ia bersama tiga rekannya berharap mendapat arahan dari sang mantan rektor. “Kami mendapat pencerahan yang sangat baik dari Pak Djohar. Sebab beliu meminta agar semua pihak bisa berpikir bersih dan kembali ke qitoh. Maklum saja, karena sebagai kampus yang bernafaskan Islam, sudah sepatutnya penyelesaian masalah dilakukan secara islami, sehingga tidak merugikan mahasiswa,” tutup Pulungan yang diamini tiga rekannya. Djohar sendiri mengaku prihatin atas masalah yang menimpa kampus yang pernah ia pimpin. Diakuinya, meski tidak lama karena ditarik kembali ke Kopertis, akan tetapi dirinya cukup menikmati jabatan sebagai rektor UISU. Ia pun mengaku cukup senang bisa memipin kampus bernafaskan islam tersebut. “Semua pihak saya imbau agar menahan diri. Silakan duduk bersama , karena keributan ini tidak akan membuat kondisi UISU membaik. Tidak ada yang untung dari kondisi seperti ini, karena itu jangan sampai berlarut-larut,” pinta Djohar sembari mengatakan beberapa fakultas jumlah mahasiswanya semakin menurun. “Jika tidak segera diselesaikan, UISU bisa gulung tikar. Ini sudah pasti akan merugikan semua pihak,” tandas Djohar. (yuslan)

Bupati Diminta Pindahkan Ibukota Tapsel Ke Sipirok JAKARTA (Waspada): Anggota DPR-RI dari Farksi Partai Amanat Nasional (FPAN) Yahdil Abdi Harahap meminta Bupati Tapanuli Selatan (Tapsel) Syahrul Pasaribu segera memindahkan ibukota Tapsel dari Padangsidimpuan ke Sipirok. “Langkah-langkah pemindahan ibukota Tapsel ke Sipirok harus segera diambil, sebab penetapan Sipirok sebagai ibukota Tapsel, diamanatkan UU Nomor 37 Tahun 2007 tentang pembentukan Kabupaten Padang Lawas Utara, “ ujar wakil rakyat dari daerah pemilihan Sumut II ini, menjawab Waspada, Rabu (13/6) di Gedung DPR-RI Jakarta. Menurut Yahdil, jika belum ada kantor permanen sebagai alasannya, maka bisa digunakan kantor sementara, misalnya kantor Camat sebagaimana dilakukan daerah pemekaran lainnya. Sementara Ikatan Keluarga Alumni Pelajar Sipirok dan Sekitarnya (IKAPSI) di antaranya Ir. Siddik Siregar, Ir. M Yamin Siregar, MM , Bangun Siregar,SH, Drs Parsaulian Tambunan, Shohibul Anshor Siregar dosen sosiologi politik FISIP UMSU, saat memberikan keterangan pers di gedung DPR menyatakan keheranan atas langkah bupati Tapsel tidak mau melaksanakan amanat UU untuk memindahkan ibukota Tapsel ke Sipirok. “ Ini pembangkangan ,” ujar Bangun Siregar Sedangkan Shohibul Anshor Siregar mengatakan masalah pemindahan IbukotaTapsel ini seharusnya tidak menjadi berlarut— larut jika Bupati melaksanakan amanat UU Nomor 37 Tahun 2007 tentang pembentukan Kabupaten Padang Lawas Utara. “ Jika terus berlarut-larut, masalah pemindahan ibukota akan menjadi kuburan politik bupati, “ ujarnya Menyangkut desakan masyarakat untuk ibukota Tapsel segera dipindahkan ke Sipirok, juga sudah menjadi agenda rapat kerja Komisi II DPR yang membidangi pemerintahan dan otonomi daerah. “Kita saat ini tinggal menunggu undangan Komisi II DPR, ujar Siddik Siregar. Ketua IKAPSI Sumut M. Yamin Siregar menambahkan, Komisi A DPRDSU juga sudah mengagendakan kunjungan kerja keTapsel19 Juni mendatang. Direktur Jenderal Otonomi Daerah (Dirjen Otda) Kementerian Dalam Negeri (Kemendagri) Djohermansyah Djohan yang menerima sejumlah pengurus IKAPSI didampingi anggota DPR Sutan Bathoegana Siregar di gedung Kemendagri, Selasa (12/6), mendesak pemindahan ibukota Tapsel dari Padangsidimpuan ke Sipirok. “Kita dorong pindah dulu ke Sipirok. Soal dimana lokasinya, nanti kita bicarakan lagi,” tegas Djohermansyah. Untuk itu, Kemendagri akan menjadwalkan pengiriman tim khusus melakukan peninjauan lapangan. Sutan dalam pertemuan tersebut berulang kali mengingatkan Kemendagri agar serius menyelesaikan masalah pemindahan Ibukota Tapsel ini. “Tolong Pak masalah ini diselesaikan. “Tujuan kita adalah membangun Sipirok,” ujar Sutan Bathoegana Siregar. (aya)

19 Usulan Daerah Pemekaran Baru JAKARTA (Waspada): Walaupun DPR RI sudah mengajukan19 daerah yang akan dimekarkan, namun Pemerintah belum bisa memutuskan sikap, sebab Pemerintah belum menyelesaikan kajian dan persiapan untuk membahas lebih lanjut soal rencana pemekaran wilayah itu. “Pemerintah tidak keberatan dengan pemekaran, cuma ingin memakai ukuran yang lebih jelas untuk tiap rencana pemekaran,”ujar Menteri Dalam Negeri Gamawan Fauzi sebelum mengikuti rapat kerja dengan Komisi II di Gedung DPR, Jakarta, Rabu (13/6). Dia menegaskan Pemerintah bersedia membahas usulan pemekaran dengan ukuran yang jelas untuk menghindari munculnya masalah besar setelah pemekaran dilaksanakan. “Sebagai contoh, dari daerah yang sudah dimekarkan, soal batas wilayah saja ada 800 batas yang belum selesai. Kita hindari yang seperti itu,” jelas Gamawan. Sebelumnya, Pemerintah melaksanakan moratorium (penghentian sementara) pemekaran daerah tahun lalu. Namun DPR kemudian meminta Pemerintah memperjelas sikap akhir soal isu itu. Saat ini setidaknya ada 19 usulan daerah pemekaran baru. Di antaranya adalah pemekaran Provinsi Sumatera Utara dan Provinsi Kalimantan Utara.(aya)

WASPADA Kamis 14 Juni 2012

KPK: Tersangka Baru PPID Politisi JAKARTA (Waspada): Komisi Pemberantasan Korupsi (KPK) sudah mendatangi ruang Banggar dan ruang mantan anggota Banggar DPR FPAN Wa Ode Nurhayati untuk menyita sejumlah barang bukti. KPK memastikan bakal ada tersangka baru dari kalangan politisi dalam kasus dana PPID (Penyesuaian Percepatan Infrastruktur Daerah) di mana Wa Ode Nurhayati sudah dijadikan sebagai terdakwa tersebut. “Memang ada tersangka baru dan dia bukan pejabat negara, tapi politisi,” tandas Ketua KPK Abraham Samad pada wartawan di Gedung DPR RI Jakarta, Rabu (13/6). Kasus Century Sebelumnya Abraham Samad menjelaskan, hasil perkembangan penyelidikan kasus Century sejauh ini mencapai beberapa tahap. Di antaranya, KPK telah memeriksa 153 orang dalam kasus Century ini hingga 12 Juni 2012. “Sepuluh orang yang diperiksa di antaranya adalah saksi baru,” ujarnya. Menurut Abraham, pihakpihak yang diperiksa itu di antaranya berasal dari Bank Indonesia (BI) 33 orang, dari Bank Century 60 orang, dari Lembaga Penjamin Simpanan (LPS) 11 orang, dari Komite Stabilitas

Sistem Keuangan (KSSK) tiga orang, dari Bapepam satu orang, praktisi perbankan tiga orang dan pihak-pihak lain sebanyak 30 orang, serta saksi ahli12 orang. Abraham menjelaskan, fokus pemeriksaan penyidik KPK dalam kasus ini per 12 Februari 2012 diprioritaskan pada analisis dan evaluasi hasil penyelidikan kasus Century oleh tim penyelidik bersama pimpinan dan jajaran pejabat struktural dan fungsional dan penasihat KPK. KPK juga telah meminta keterangan saksi ahli, ahli hukum pidana tiga orang, ahli hukum tata negara tiga orang, ahli hukum administrasi negara dua orang, dan ahli hukum perdata satu orang serta ahli ekonomi makro satu orang. “Sebagian ahli yang sudah dimintai keterangan itu sebagaimana yang diharapkan Timwas Century, meski tidak disampaikan secara tertulis,” ujarnya. Dia mengatakan, dari para ahli yang telah dimintai pandangannya itu, sejauh ini baru menyampaikan pandangan secara lisan, kecuali Prof. DR. Edwar Umar. Sehingga KPK meminta para ahli tersebut dapat menyampaikan pandangan opininya secara tertulis, sebagai legal formal. Karena itu KPK akan menjadikan pandangan para ahli itu untuk menentukan langkah KPK selanjutnya dalam

menentukan status kasus tersebut. “Jadi masalahnya di situ, para ahli yang memberikan keterangan itu baru sebatas keterangan lisan dan mereka meminta waktu untuk menyusun pendapatnya secara tertulis tersebut dalam legal opinion,” tambah Samad. Dari hasil keterangan-keterangan dalam bentuk legal opinion itu kemudian ditelaah lebih jauh untuk disandingkan dengan keterangan-keterangan ahli lainnya yang sudah diperiksa KPK sebelumnya. “Maka pada suatu ketika tim penyelidik kasus Century bisa menentukan mengambil suatu kesimpulan bahwa kasus ini bisa tidak ditingkatkan tetap penyidikan,” tegasnya. Namun demikian anggota Timwas Century Bambang Soesatyo mengatakan meski tidak diakui oleh KPK, publik dan Timwas Century menilai adanya tangan-tangan yang tidak terlihat yang turut campur dalam proses hukum bailout Bank Century ini. Karena hal itu akan menyeret keabsahan pemilihan presiden tahun 2009, kasus ini juga melibatkan orang-orang yang dekat dengan kekuasaan. “Jika ada terbukti aliran dana masuk ke pasangan calon presiden tertentu, maka akan dipertanyakan keabsahan presiden saat ini,” tandas Bambang. (j07)

Wa Ode Didakwa Menerima Suap JAKARTA (Waspada): Mantan anggota Badan Anggaran Dewan Perwakilan Rakyat, Wa Ode Nurhayati didakwa telah menerima suap dalam alokasi Dana Penyesuaian Infrastruktur Daerah (DPID) untuk tiga kabupaten di Aceh. Dalam dakwaan Jaksa Penuntut Umum (JPU) di Pengadilan Tipikor, Jakarta, Wa Ode didakwa telah menerima uang sejumlah Rp6,250 miliar dari beberapa pengusaha.Yaitu, Fahd El Fouz alias Fahd A Rafiq, Saul Paulus David Nelwan alias Paul Nelwan dan Abraham Noch Mambu melalui Haris Surahman. “Dengan tujuan memasukkan Kabupaten Pidie Jaya, Aceh Besar, Bener Meriah dan Minahasa sebagai penerima alokasi DPID tahun 2011 sebesar Rp 7,7 triliun,” kata Jaksa Kadek Wiradana, Rabu (13/6). Pada tanggal 13 Oktober 2010 sampai 1 Nopember 2010 di restoran Pulau Dua Senayan, di Gedung DPR RI, di Bank Mandiri KCP Jakarta DPR RI, terdakwa menerima uang tunai Rp6,250 miliar. Dari Haris Surahman sebesar Rp5,250 miliar, Saul Paulus David Nelwan Rp350 juta dan Abraham Noach Mambu sebesar Rp400 juta. Padahal, lanjut Kadek, patut diduga pemberian uang itu


TERDAKWA Kasus suap pembahasan alokasi Dana Penyesuaian Infrastruktur Daerah (DPID),Wa Ode Nurhayati, saat menjalani Sidang Pembacaan dakwaan oleh Jaksa Penuntut Umum (JPU) di Pengadilan Tipikor, Jakarta, Rabu (13/6). bertentangan dengan jabatannya. Karena maksud dan tujuan pemberian uang tersebut untuk mengusahakan Kabupaten Pidie Jaya, Bener Meriah, Aceh Besar dan Minahasa mendapatkan alokasi DPID. “Perbuatan terdakwa diancam pidana sebagaimana Pasal 12 huruf a, Pasal 5 ayat 2 jo pasal 5 ayat 1 atau Pasal 11 UU Tipikor untuk dakwaan kesatu,” ujarnya. Terkait kepemilikan uang sebesar Rp50,5 miliar di rekening Bank Mandiri KCP

Jakarta DPR RI, politikus Partai Amanat Nasional ini dijerat dengan Pasal 4 atau Pasal 5 UU No.8 tahun 2010 tentang Tindak Pidana Pencucian Uang (TPPU). Sebab, diduga berasal dari tindak pidana korupsi. Salah satunya berasal dari uang yang diberikan oleh Haris Surahman sebesar Rp6,250 miliar. Atas perbuatannya Wa Ode Nurhayati terancam pidana penjara selama 20 tahun dan denda maksimal Rp1 miliar.(vvn)

garan (Banggar). Tuduhan Wa Ode menurutnya tidak berdasar sama sekali. Sebaliknya, Wa Ode, kata Marzuki, bahkan pernah mendatangai rumah dinasnya tanpa ada sebab dan undangan yang jelas. “Sudah pasti, sangat yakin itu tidak benar, semoga yang bersangkutan diberikan hidayah,” kata Marzuki, saat dihubungi wartawan, di Jakarta, Rabu, (13/6). Marzuki meminta agar Wa

Ode berkata jujur termasuk adanya indikasi Wa Ode menerima uang dari sejumlah daerah. Marzuki sendiri menegaskan tidak pernah membahas dan menandatangani apapun terkait Banggar. “Wa Ode harus minta maaf sama rakyat Indonesia dan kembalikan uangnya ke negara sehingga rakyat percaya. Saya tidak pernah bersentuhan dengan Banggar,” tandas politikus Demokrat itu. (aya)

Nurdin Tampubolon: OJK Harus Independen Dan Kredibilitas JAKARTA (Waspada): Anggota Komisi XI DPR RI dari Fraksi Partai Hati Nurani Rakyat (F Hanura) Ir Nurdin Tampubolon (foto) menegaskan bahwa DPR akan mencari dan merekrut calon Otoritas Jasa Keuangan (OJK) yang harus bisa menjaga kredibilitas dan tetap independen, bebas dari kepentingan politik. “ Nanti kita lihat semuanya apa calon yang kita pilih bisa independen apa tidak, baik itu calon dari pemerintah, kalangan profesional ataupun pengusahanya,”ujar Nurdin Tampubolon menjawab Waspada di gedung DPRRI, Jakarta, Selasa (12/6). Nurdin berharap, nantinya OJK diharapkan tidak hanya mampu berperan dalam mengawasi dan memperbaiki industri jasa keuangan, tetapi juga memberdayakan masyarakat. Dia menegaskan pentingnya

Nafsiah Mboi Jadi Menkes Dan Hendarman Supanji Kepala BPN BOGOR (Antara): Presiden Susilo Bambang Yudhoyono mengumumkan Nafsiah Mboi sebagai Menteri Kesehatan menggantikan almarhumah Endang Rahayu Sedyaningsih di Istana Bogor, Rabu (13/6). “Saya melihat kemampuan pengalaman dan pengabdian beliau waktu lalu termasuk komitmen untuk menjaga kesehatan masyarakat,” kata Presiden. Presiden juga mengumumkan Guru Besar ITB bidang Teknik Minyak dan Gas Rudi Rubiandini sebagaiWakil Menteri ESDM menggantikan almarhum Widjajono Partowidagdo. “Saya nilai Rudi juga memiliki kecakapan pengetahuan pengalaman, sekaligus komitmen untuk memajukan sumber energi dan mineral kita,” kata Presiden. Sementara untuk jabatan Kepala Badan Koordinasi Penanaman Modal akan diisi Muhammad Chatib Basri, menggantikan Gita Wiryawan yang selama ini merangkap sebagai Menteri Perdagangan. “Yang bersangkutan saya pandang cakap untuk menjabat Kepala BKPM dalam mengha-

dapi krisis ekonomi yang baru, maka untuk menjaga pertumbuhan ekonomi kita, investasi dan perdagangan sangat penting,” kata Presiden. Presiden juga menunjuk mantan Jaksa Agung Hendarman Supandji sebagai Kepala Badan Pertanahan Nasional (BPN) yang baru menggantikan Joyo Winoto. Presiden memandang, masalah hukum dalam pertanahan saat ini menjadi fokus yang perlu untuk dibenahi, sehingga penempatan Hendarman dinilai tepat. Presiden mengatakan, dirinya akan melantik para menteri dan pejabat baru tersebut besok. “Insya Allah akan saya lantik besok dan setelah itu akan memulai segera tugas-tugasnya,” ujar Presiden. Nafsiah lahir di Sengkang, Sulawesi Selatan, 14 Juli 1940. Dokter spesialis anak yang mendapat gelar MPH di Belgia ini aktif di bidang HAM dan pernah menjadi ketua komite hak-hak anak untuk PBB. Di bidang pemerintahan, ia pernah menjadi anggota MPR RI (1982-1987). Juga pernah menjabat sebagai wakil ketua komnas perempuan.

Syahganda: Kalau Dibilang Papua Sudah Kondusif Jelas ‘Ngawur’

Ketua DPR Bantah Dapat Rp300 M Dari Dana PPID JAKARTA (Waspada): Ketua Dewan Perwakilan Rakyat (DPR) Marzuki Alie membantah mendapatkan uang sebesar Rp300 miliar dari proyek Dana Percepatan Pembangunan Infrastruktur Daerah (PPID) sebagaimana tuduhan terdakwa kasus PPID Wa Ode Nurhayati yang dikemukakan dalam persidangan Tipikor. Marzuki menegaskan dia tidak pernah main-main soal proyek yang ada di Badan Ang-


PRESIDEN Susilo Bambang Yudhoyono didampingi Wapres Boediono dan sejumlah Menteri KIB II mengumumkan sejumlah nama yang ditunjuk sebagai Menteri Kesehatan,Wamen ESDM, Kepala Badan Koordinasi Penanaman Modal (BKPM) dan Kepala Badan Pertanahan Nasional (BPN) di Istana Kepresidenan Bogor, Jawa Barat, Rabu (13/6).

pemberdayaan masyarakat melalui OJK melalui pengawasan yang konsisten dalam meningkatkan kredibilitas industri jasa keuangan guna menumbuhkan kepercayaan masyarakat. “Pengawasan OJK terhadap industri jasa keuangan juga akan menghindarkan masyarakat dari persaingan tidak sehat di antara lembaga keuangan, “ tandasnya. Wakil rakyat dari daerah

pemilihan Sumut 1 ini juga mengatakan bahwa OJK adalah lembaga baru yang akan melakukan supervisi industri jasa keuangan yang strategis sehingga harus diawasi orang-orang berintegritas tinggi, memiliki keahlian dan kompetensi di bidang keuangan. Sebagaimana diberitakan, saat ini Komisi XI DPR RI melakukan uji kepatutan dan kelayakan terhadap 14 calon anggota DK OJK sejak Kamis (7/6). Uji kepatutan dan kelayakan ini akan berlangsung hingga Kamis (14/6). OJK adalah lembaga baru yang akan dipimpin oleh Dewan Komisioner beranggotakan 9 orang. Sebanyak 14 orang nama calon anggota telah dipilih oleh Presiden dan diserahkan ke DPR. DPR akan memilih 7orang untuk ditetapkan sebagai anggota dewan tersebut. (aya)

JAKARTA (Waspada): Lembaga Kajian Publik SMC menilai penjelasan Juru Bicara Kepresidenan Julian Aldrin Pasha di Bina Graha, Jakarta, Senin (11/6) terkait kondisi secara umum keamanan di Papua kondusif tidak tepat. Sikap Istana itu menunjukkan penyederhanaan masalah atas perkembangan situasi Papua yang justru sebaliknya, mengingat kekhawatiran masih tinggi baik di masyarakat ataupun pihak berwenang. Ketua Dewan Direktur Lembaga Kajian Publik Sabang-Merauke Circle (SMC) Syahganda Nainggolan mengatakan hal itu di Jakarta, Selasa (12/6). SMC juga menganggap, pernyataan Istana bersifat kontradiktif karena di sisi lain mengakui masih terjadi teror berupa penembakan terhadap warga sipil termasuk aparat bersenjata. ”Kalau dibilang Papua sudah kondusif jelas ’ngawur’, sebab fakta di lapangan kan tidak demikian. Pertandingan sepakbola dalam laga nasional di Jayapura oleh Liga Super Indonesia pada Selasa, nyatanya tidak diizinkan kepolisian akibat pertimbangan keamanan,” kata kandidat doktor ilmu kesejahteraan sosial Universitas Indonesia ini. Dia mengatakan, kondisi Papua bahkan di wilayah perkotaan Jayapura sejauh ini tergolong mencemaskan, yang selama kurang dua pekan sejak 29 Mei-10 Juni 2012 terjadi tujuh rentetan

kasus penembakan kepada warga sipil dan aparat hingga tewas, mulai korban turis asal Jerman bernama Pieter Dietmar Helmut (29/5), kemudian seorang pelajar SMU, Gilbert FM (4/6), dan sehari sesudahnya (5/6) menewaskan anggota TNI, Pratu Doengki Kune. Pada hari bersamaan, penembakan kembali dilakukan atas warga sipil yaitu Iqbal Rivai serta Ardi Jayanto. Selang hari berikut (6/6), kasus serupa menimpa PNS Kodam Cenderawasih, Arwan Apuan, yang disusul penembakan terhadap Satpam Supermarket, Tri Sarono pada Minggu (10/6) malam. Di tempat lain persisnya Kampung Kulirik, Distrik Mulai, Kab. Puncak Jaya, seorang guru SD Inpres Dondobaga, Anton Arung Tambila juga ditembak oleh orang tak dikenal (OTK) pada 29 Mei saat berada di warung kelontong. Menurut Syahganda, penyelesaian rangkaian kasus memilukan yang terjadi di Papua memerlukan beban ekstra dengan keterlibatan langsung Presiden Susilo Bambang Yudhoyono, sehingga akar persoalan utama dapat dipecahkan seiring penciptaan rasa damai bagi warga Papua. ”Persoalan di Papua bukan semata-mata keamanan, tapi meliputi aspek kesejahteraan ekonomi, ketidakadilan pembangunan, serta pengakomodasian aspirasi politik masyarakatnya untuk memenuhi kemartabatan Papua,” ujarnya. (j07)

WASPADA, Kamis 14 Juni



Dr. Ir. Bob Foster, M.M., Drs. Ir. Johnson, M.M., Drs. Harlin, M.M., Parulian Panggabean, Drs. M. Deni Johansyah, Ir. Jamso Haryono Pangaribuan,M.M., Ir. Junianto, Ronald Siagian, S.H., Manuntun, S.Si., Ir. Sardianto, Drs. Adolf Simatupang, Drs. Haryono, Tandi Rosandi, S.Si., Dwina R.A., S.Si., Ir. Achya Arifudin, Ir. Anang Bambang, Drs. Kamajaya, Budiman Anwar, S.Si. M.Si., Dra. Rully Handayani, Dra. Komariah, Risni Wulandari, S.Si., Yani Destiani, S.Pd., Elly Farida, S.Si., Drs. Agus Nero Sofyan, M.Hum., Drs. Sobandi, Drs. Suyamto, Saiful Bachri, S.S., Ahmad Fauzie, S.S., Dra. Ade Mulyanah, Sulistyo, S.Pd., Sri Setyowati, S.Pd., Lia Yulianti, S.Pd., Dian Yuliani, S.Pd., Thomjones Simanjuntak,S.Sos., Fauzi Putra,S.P., Sadar Sinaga,S.T., Roma Lince, S.S., Irma Yohana,S.Pd., Edi S Tinambunan,S.T., Carles Manullang,S.Pd., Edi Susanto Tarigan,S.Pd., Ratu Verawaty,S.S., Irwansyah Lingga,S.Pd., Dermawan Syahputra,S.Pd., Ahmad Nawawi,S.Pd., Nicky Rada,S.T., A. Umar Dhani,S.Sos., Basana,S.S., Bina Kasih,S.Si., Chris Natalia, S.H., David Lumbangaol,S.T., Dody Sijabat,S.Pd., Eddy Kelana Bangun,S.E., Endang Silalahi,S.Pd., Eni Adelina Lumbangaol, S.Pd., Ihsan Fuadi,S.Pd., Junita Ginting, S.Si., Lia Girsang, S.S., Marcos Sitorus, S.Si., Melky Gunawan Harefa, S.Pd., Miranda Damanik, S.Pd., Nico Egosandro Bako, S.Pd., Rumia Ningsih, S.Pd., Salman Sitohang,S.Pd., Sudarmono Purba, S.Pd., Syofiani Lubis, S.Km., Wellington Manurung, S.Pd.

FL = B ¡ q ¡ V = 0,1 ¡ 1 ¡ 20 = 2 N

2 2 AA' = ¡3 3 3 3

AT' =

=2 3 TT' =

M 4 °½ B 2 ž M 2P P 2 °¿ 4

16. Jawaban: D

52  2 3




7. Jawaban: B Maksudnya pada soal, dari 7 orang hanya dua orang saja yang memiliki mobil, sehingga diperoleh

1. Jawaban: D

= 2 × (7 – 2)C3 = 2 ×

5˜4 2 ˜1

8. Jawaban: C

sin x

2 8




B A 2  B2 =

B • tan D = = –1 (kd. IV) A 7S 4

D= maka


x  74S < 0 2 cos x  7S < cos S 4 2 2 cos

S 7S xâ&#x20AC;&#x201C; 4 < 2 S 7S sehingga: x = 4 Âą + k ¡ 2S 2 7S S 5S k=0 o = â&#x20AC;&#x201C; +0= 4 2 4 S 2S S 7S K= â&#x20AC;&#x201C;1 o = 4 + â&#x20AC;&#x201C; = 2 4 Yang memenuhi adalah

0 1 § cos T

0 1 cossinTT

= 1 0

 tan T ¡ cos T ¸š

sin T cos T

18. Jawaban: D Karena suhunya sama maka massa es dan air tetap. 19. Jawaban: E


11. Jawaban: E 2x3 â&#x20AC;&#x201C; 5x2 â&#x20AC;&#x201C; kx + 18 : (x â&#x20AC;&#x201C; 1) sisa 10 2(1)3 â&#x20AC;&#x201C; 5(1)2 â&#x20AC;&#x201C; k(1) + 18 = 10 15 â&#x20AC;&#x201C; k = 10 k=5 12. Jawaban: D



I R2

a  1,5 2a  3 cos x = 2  0,5a = 4a

2a  3 d 1 4a

1 1 1 = I2 : I2 : (2I) 2

y = x2

|2aâ&#x20AC;&#x201C;3| d 14 â&#x20AC;&#x201C; a

28. Jawaban: A â&#x20AC;˘ U A> U B â&#x20AC;˘ F = W ; karena WA = W B o F A = F B 29. Jawaban: A y = 20 sin (4x â&#x20AC;&#x201C; 0,2t) â&#x20AC;˘

A = 20 cm = 0,2 m




P1 P2 P3 R1 : R2 : R3 = I 2 : I 2 : I 2 1 2 3


27. Jawaban : D Pernyataan: Salah. Arah arus listrik berlawanan dengan aliran elektron. Alasan: Benar. Sudah Jelas.

2S =4 O

2a  3 Â&#x; â&#x20AC;&#x201C;1 d 4  a d 1

3. Jawaban: C

f 1 1 M= = = x sf 3 1 2 h' = M ¡ h = 5 cm (nyata, terbalik, karena M (+))

y = A sin (kx â&#x20AC;&#x201C; Zt )

P1 = P2 = P3 V1 = V2 (paralel) I1 = I2 = I (P = V. I) I3 = 2I

â&#x20AC;&#x201C;1 d cos x d 1

S 6S <x< 4 5


26. Jawaban: B Cukup Jelas

Pegas yang ditarik kedua ujungnya dengan gaya sama identik dengan pegas yang ditarik sebuah ujung sementara ujung lain diikat ditembok.

10. Jawaban: A y=A¡x A = 1 0 ¨ sin(T) Š

10 N

F k

10 x= m 50 x = 0,2 m

9. Jawaban: C (x â&#x20AC;&#x201C; 6)2 + (y + 1)2 = 25 y = 4; (x â&#x20AC;&#x201C; 6)2 + 25 = 25 x=6 ? (6, 4)


10 N

cos x â&#x20AC;&#x201C; sin x < 0

1 R=+1m 2 S = 3m h = 10 cm h' = .... f

17. Jawaban: C

x 2 Â&#x2DC; cot x  S 4

S = tan 4 = 1

2. Jawaban: D


25. Jawaban: E S = luas dibawah grafik

5  10 Â&#x2DC; 4 = (5¡ 4) + 2 = 20 + 30 = 50 m


â&#x20AC;˘ K=

24. Jawaban: A Ekmax = hf â&#x20AC;&#x201C; w = 4,43 â&#x20AC;&#x201C; 2,28 = 2,15 eV

= 20 kemungkinan

C 4 ¡ 2 C 2¡ 2 C1 1¡ 1¡ 2 = 8 8 C7

Arah F L sesuai dengan aturan tangan kanan

= 0,5 S cm

O = 4


koef t 0,2 v = koef x = 4

= 1 : 1 : 0,25

v = 0,05 cm/s 20. Jawaban: B 0

1 2


Larsir =

Âł x

y=1 x


4. Jawaban: E

cos x  sinx

2 cos x  sinx



(a + 1)(3a â&#x20AC;&#x201C; 7) d 0

7 3 a Â? z Â&#x; a = {â&#x20AC;&#x201C;1, 0, 1, 2}

 1 dx




13. Jawaban: C p(x) = ax2 + bx + 1 a,b Â? [0, 4]

21. Jawaban: C V = 0,8 C

1 2 b â&#x20AC;&#x201C; 4a < 0; b <a 4

't = .... Jawab:


1  2sinx¡ cos x 1  sin2x = 1  2 sinx¡ cos x = 1  sin2x



H =N¡

1 b2 4


'B 't


P (D < 0) =


AE = EB = 3 AP  PB  AB 2AP¡PB 2

cos Â&#x2018; APB =


52  52  6 2 2Â&#x2DC;5Â&#x2DC;5

= =

7 25



T' 6


m1 ¡ ce ¡ 't e + x ¡ L = m2 ¡ ca ¡ 't a m1 ¡ 0,5 ¡ 8 + 80x = m2 ¡ 1 ¡ 12



3| v |



x V = 20m/s

3| v | cos T _ v | cos T = Â&#x; = |u| |u| 3




| u| : | v | = 3 : cos T





= 1010.102 pOH = 6 pH = 8


39. Jawaban: E Atom dengan konfigurasi [Ar]4s 2 3d 104p 4 adalah unsur golongan IV A periode 4 yakni Ge yang bersifat metaloid (semi logam). 40. Jawaban: C r = K[SO2Cl2] â&#x20AC;&#x201C; laju reaksi semakin lambat selama reaksi berlangsung karena konsentrasi SO 2Cl 2 berkurang. â&#x20AC;&#x201C; SO2 dan Cl2 akan bertambah dengan laju sebesar r 41. Jawaban: E Semua polipeptida di alam bersifat optis aktif karena memiliki C-kiral (polimerisasi tidak menghilangkan kiralitas). 42. Jawaban: D NH 4+ tidak dapat menjadi basa Lewis karena tidak punya PEB. NH3 + H2O o NH4+ + OHâ&#x20AC;&#x201C; 43. Jawaban: A Reaksi 3Zn + 2Cr3+ o 3Zn2+ + 2Cr berlangsung spontan dengan potensial sel = +0,02 V Zn = reduktor Cr3+ = oksidator

54. Jawaban: E Konservasi in situ adalah konservasi di habitat aslinya, seperti di: a. Suaka margasatwa b. Taman nasional 55. Jawaban: E Tahap proses kultur jaringan: 1. penanaman eksplant 2. pembentukan kalus 3. pembentukan planlet 4. perbanyakan planlet 5. aklimatisasi 56. Jawaban: E Pernyataan: salah Usus herbivora lebih panjang dibandingkan usus hewan karnivora Alasan : Salah Usus hewan ruminansia untuk mencerna selulosa. 57. Jawaban: C Pernyataan: benar Meiosis menghasilkan empat sel anak yang haploid Alasan: Salah Meiosis I o 2 sel anak Meiosis II o 4 sel anak 58. Jawaban: D Fungi bersifat heterotrof bukan autotrof 59. Jawaban: A Hewan yang memiliki peredaran darah tertutup adalah cacing tanah dan semua vertebrata 60. Jawaban: A Mikroorganisme untuk pembuatan kecap 1. Aspergillus sojae 2. Aspergillus oryzae 3. Saccharomyces rouxii

+ CO2(g) 'H > 0 Kesetimbangan akan bergeser ke kanan bila gas CO2 dikeluarkan, tekanan sistem diturunkan, dan suhu dinaikkan. 45. Jawaban: A Molekulnya bersifat polar, berbentuk T, mempunyai interaksi dipol-dipol antar molekul, dan punya 2 PEB

47. Jawaban: D Anteridium menghasilkan sel spermatozoa

F = mol x pBO

Q 96500

5,6 u4 22,4 Q = 96500 coulomb


112 - mol C2H2 = 22,4 = 5 mol - mol CaC2 = mol C2H2 = 5 mol - untuk 4 jam: mol CaC2 = 5 Ă&#x2014; 4 = 20 mol massa CaC2 = 20 Ă&#x2014; 64 = 1280 gram = 1,28 kg

1 (3m2 â&#x20AC;&#x201C; m1) 20

23. Jawaban: B B = 0,1 T q = 1C


(OH-) = K h .MG

32. Jawaban: B

33. Jawaban: D Q serap = Q lepas

15. Jawaban: B

C 5

Es -8 C m1




O C air





O C es

14. Jawaban: E f(x) = ax3 + bx2 + cx â&#x20AC;&#x201C; 12 f '(x) = 3ax2 + 2bx + c > 0 (naik) f '(x) > 0 Â&#x; D < 0 4b2 â&#x20AC;&#x201C; 12ac > 0 b2 â&#x20AC;&#x201C; 3ac > 0

38. Jawaban: B

46. Jawaban: E Pada sistem transport elektron, O2 berfungsi menangkap H + dari NADH dan FADH2 membentuk H2O


2 3

6. Jawaban: B T

12 C air m2

u 4u 4 4u4 O




2 3

P (D < 0) =



§ 0,14 ¡§ 0,40 ¡ ¨ 2 ¸¨ 2 ¸ Š šŠ š K = § 0,04 ¡2 § 0,02 ¡2 = 7 . 104 ¨ 2 ¸ ¨ 2 ¸ Š š Š š

40 : 60 =1:3 32 16 Rumus molekul: XY3



M 0,08 0,06 0,12 0,36 b â&#x20AC;&#x201C;0,04 â&#x20AC;&#x201C;0,04 0,02 0,04 + s 0,04 0,02 0,14 0,40

53. Jawaban: D Pada gen bebas, anak mendapat 1 1 gen dari ayah dan dari ibu. 2 2 Jika anak bergenotip Aa, dan ibunya aa maka genotip ayah AA atau Aa.

31. Jawaban: C X:Y

= 0,6 = 100 tahun (menurut pengamat di bumi jarak tempuhnya 100 tahun cahaya) 22. Jawaban: E

(3, 4) P

2NO  2H2 U N2 + 2H2O


1  v2 c 60


37. Jawaban: B NO = 0,02 u 2 = 0,04 mmol

't 0



5. Jawaban: A (x â&#x20AC;&#x201C; 3)2 + (y â&#x20AC;&#x201C; 4)2 = 25 â&#x20AC;˘ Pusat (3, 4) : r = 5

'Â&#x2021; 't

=N¡A ¡

2,46 0,082 Â&#x2DC; 300 Â&#x2DC; 2 = 0,05

2NaHCO3(s) R Na2CO3(s) + H2O(g)

0,1 Hz S

30. Jawaban: C

't 0 = 60 tahun


cos2 x  sin2 x  2sinx cos x cos2 x  sin2 x  2sinx cos x

§ rB ¡ ¨r ¸ Š Aš


44. Jawaban: C Dalam kesetimbangan

Z = 0,2 2 S f = 0,2


15050 = 91

â&#x20AC;&#x201C;1 d a d

52. Jawaban: D Faktor pembatas berupa kelimpahan dan persaingan akan menurunkan populasi sampai batas tertentu (tidak sampai punah). Penurunan populasi yang tidak sampai punah ditunjukkan huruf C.

36. Jawaban: C S=M¡R¡T¡i

34. Jawaban: A - Energi paling besar adalah 'H yang hasilnya besar Mr 35. Jawaban: E 1-pentena dapat dibuat dari eliminasi 1-bromo pentana.

48. Jawaban: C Tumbuhan kehilangan air dalam jumlah sangat besar melalui transpirasi, karena uap air keluar melalui stomata. 49. Jawaban: B Pada reaksi terang terjadi proses: 1. Transfer elektron, yaitu proses pembentukan ATP (fotofosforilasi) 2. Fotolisis, yaitu proses pemecahan air

H2O o 2H 


2 O2


50. Jawaban: C Analogi adalah perbandingan makhluk hidup yang struktur dasarnya berbeda, fungsi sama contoh sayap kupu-kupu dan sayap burung. 51. Jawaban: A Cendawan merupakan organisme yang merubah organik menjadi anorganik, di dalam ekosistem berperan sebagai pengurai.


SEKRETARIAT GANESHA OPERATION MEDAN: Jln. Hayam Wuruk No. 7A-C (061) 4152955, Jln. Abdullah Lubis 23 4562226, Jln. Sisingamangaraja No. 365 A-C (Sp. Limun) 7879379, Jln. H.M. Yamin No. 253 C 4151694, Jln. H.M. Yamin No. 572 4142880, Jln. K.L. Yos Sudarso No. 69A, Glugur (Medan Kota) 6637738, Jln. K.L. Yos Sudarso No. 48C, Glugur (Medan Kota) 6615251, Jln. Iskandar Muda No. 151A 4153827, Jln. Pancing No. 106 7344046, Jln. A.H. Nasution (Simp. POS), Komp. Griya Milala Blok A No. 10 7850845, Jln. A.H. Nasution (Simp. POS), No. 25C 8213024, Jln. Marelan Raya Pasar IV No. 146 Medan Marelan 6857669, Jln. Kapten Muslim Komplek Griya Riatur Indah Blok A No. 87A 8460308, Jln. Kapten Muslim Komplek Griya Riatur Indah Blok A No. 72A 8457209, Jln. Sriwijaya No. 14/26 4535784, Jln. Setiabudi No. 121-A 8218305, Jln. Syailendra No. 21 4144107, Jln. Syailendra No. 21-PQ 4569221, Jln. A.R. Hakim No. 153-C 7358015, Jln. Panglima Denai No. 132-D, Simpang Segitiga Seksama, KISARAN: Jln. Sisingamangaraja No. 200 & 202 (-0623) 348219, Jln. Ahmad Yani Komp. Graha Asahan Indah Blok C No. 6 7037400, NANGROE ACEH DARUSSALAM: Jln. Ahmad Yani No. 117, Birem Puntong, Kota Langsa (0641) 425947 , Jln. Ahmad Yani No. 10-11, Simpang Tugu Gampong Teungoh, Langsa 21526, LUBUK PAKAM: Jln. Medan (Negara) No. 33 D & E (depan BRI) (061) 7952339, TANJUNG BALAI: Jln. Jendral Sudirman Km. 5,5 Kel. Sijambi Lingk. 10, K-ec. Bandar (0623) 7590115, TEBING TINGGI: Jln. Jend. Sudirman A 9 & A 10 (dekat Ramayana) (0621) 22768, RANTAU PRAPAT: Jln. Husni Thamrin No. 2, Simpang Enam (0624) 327522, SIBOLGA: Jln. D.I. Panjaitan No. 9 (0631) 25724, BINJAI: Jln. Jenderal Sudirman No. 63 A-B-C (061) 76304675, Jln. Walter Monginsidi No. 2 B-C-D 77163603, STABAT: Jln. Jendral Sudirman No. 29 B-C (061) 8912941, Jln. Jendral Sudirman No. 8-A 75260234, PANGKALAN BRANDAN: Jln. Thamrin No. 5-7 (0620) 323022, KABANJAHE: Jln. Jamin Ginting No. 28 (depan SMAN 1 Kabanjahe) (0628) 323597, SIDIKALANG: Jln. FL Tobing No. 22 (0627) 23433, TANJUNG PURA: Jln. Merdeka No. 10 & 12 (061) 8961852, PEMATANG SIANTAR: Jln. Merdeka No. 389 (dekat SMPN 1) (0622) 420144, Jln. Merdeka No. 393 (dekat SMPN 1), Jln. Melanthon Siregar No. 41-B (dekat simp. PMM) 434090, Jln. Sudirman Blok A No. 4 Komp. Siantar Indah, (dekat SMPN 4) 7436792, Jln. Rajamin Purba, S.H. No. 103 (dekat SMPN 2) 27379, Jln. Akasia Raya No. 11, Perumnas Batu VI (dekat Puskesmas) 7552130, PERDAGANGAN: Jln. Merdeka No. 6, Kompleks Dwi Tunggal Jaya Lestari (0622) 96903, BALIGE: Jln. Sisingamangaraja No. 1 (Bundaran) (0632) 322201, TARUTUNG: Jln. D.I. Panjaitan No. 2-B (samping SPBU) (063) 32348202, PEMATANG RAYA: Jln. Sutomo Komp. Griya Hapoltakan No. 25 (dekat SMAN 1 Pematang Raya) (0622) 331489, DOLOK SANGGUL: Jln. Merdeka No. 56 (dekat SMPN 2/SMP ST. Lusia) (0633) 31840, KUALA SIMPANG: Jln. H. Juanda No. 11-12 (depan KOMPI) SIDAMANIK: Jln. Besar Sarimatondang No. 148, PANGURURAN: Jln. Nahum Situmorang No. 5, SIBORONGBORONG: Jln. Sisingamangaraja No. 153-B

Luar Negeri Serangkaian Ledakan Bom Guncang Baghdad, 56 Tewas A8

BAGHDAD (AP): Serangkaian serangan bom terkoordinasi di empat kota Irak yang ditujukan pada para jamaah Syiah telah menewaskan sekurang-kurangnya 56 orang dan mencederai puluhan lainnya Rabu (13/6) pagi. Serangan itu gelombang terakhir kekerasan sekte yang melanda negeri tersebut, demikian menurut sejumlah pejabat. Angka korban diperkirakan akan terus bertambang akibat serangan itu, yang termasuk sejumlah ledakan bom mobil yang merobek prosesi keagamaan warga Syiah di empat lokasi berbeda di seluruh Baghdad. Sera-

ngan seperti merupakan yang ketiga kalinya melanda ibukota yang ditujukan pada upacara tahunan jamaah Syiah yang memperingatigugurnyaimammereka pada abad ke-8 lalu. Dua petugas kepolisian me-

Buldozer Menggali Tanah Untuk Mencari Korban Gempa Bumi

ngatakan bom pertama menghantam satu prosesi para jamaah sekitar pukul 05:00 dinihari diTaji, distrik utara Baghdad, yang menewaskan tujuh orang dan mencederai 22 lainnya. Dalam beberapa jam, tiga ledakan lainnya melanda prosesi lainnya di tempat yang berbeda di ibukota Irak itu yang menewaskan sekurang-kurangnya19orang lagi dan mencederai lebih dari 50lainnya,katapetugaskepolisian. Di kota Hillah, 95 km selatan Baghdad, dua bom mobil meledak hanya dalam selisih menit satu sama lainnya pada Rabu dinihari di pusat kota, yang menewaskan 21 orang dan mencederai

53 lainnya, demikian menurut dua petugas kepolisian dan seorang petugas kesehatan. Di dekatnya, di kota selatan Karbala, satu mobil yang diparkir meledak kira-kira pukul 08:00 dekat satu kelompok jamaah Syiah lainnya, yang menewaskan dua orang dan mencederai 22 lainnya, kata pejabat kepolisian. Karbala berada 90 km selatan Baghdad. Di utara Baghdad, di kota Balad yang berpenduduk mayoritas Syiah, dua ledakan bom mobil yang bersamaan menewaskan tujuh jamaah dan mencederai 34 lainnya, kata polisi. Selainkota-kotatersebut,bom

juga mengguncang ibukota Provinsi Diyala, Baquba. Serentetan pengeboman dan penembakan yang terjadi di kota ini dilaporkan menyebabkan 5 orang tewas sementara 15 orang lainnya terluka. “Bom juga mengguncang Baghdad dimana setidaknya 12 orang dilaporkan tewas dalam sembilan insiden pengeboman yang terjadi secara terpisah. Insideninipunmenyebabkanbelasan orangterluka,”tegassalahseorang petugas keamanan Baghdad. “Kawasan Al Azizyah pun tidakluputdariancamanbommobil. Dua orang tewas dan dua lainnya terluka akibat insiden ini,” ujar petugas keamanan.

WASPADA Kamis 14 Juni 2012

Seputar ASEAN Polisi Malaysia Bongkar Pabrik Shabu Dan Ekstasi

Sejumlah kalangan berpendapat sederetan pengeboman ini merupakan upaya terkoordinasi mengingat pada saat insiden terjadi, puluhan ribu peziarah Syiah tengah memadati Kota Baghdad.Parapeziarahinitengah memperingati kematian Imam Moussa al-Kadhim. Pemerintah Irak yang saat ini dipegang oleh kalangan Syiah di bawah kepemimpinan PM Nouri Al-Maliki diketahui menganut aturan otoriter. Pemerintah pun dilaporkan memperlakukan Syiah dan Sunni dengan cara berbeda sehingga hal ini makin mempertajam pertikaian sekterianyangterjadidinegaraitu.(m10)

KABUL (AP): Sejumlah buldozer dikerahkan untuk menggali melalui berton-ton batu dan lumpur dengan harapan dapat menemukan 71 korban tanah longsor yang terjadi setelah dua gempa bumi melanda utara Afghanistan awal pekan ini. Pihak berwenang Afghanistan Rabu (13/6) mengatakan bahwa sejauh ini baru dua mayat yang ditemukan dan 69 lagi masih terkubur di dalam reruntuhan di distrik Burka, provinsi Baghlan. Mahmood Haqmal, jurubicara untuk provinsi itu, mengatakan keluarga para korban telah dijanjikan akan menerima uang kompensasi dari pemerintah Afghanistan dan bantuan kemanusiaan telah dikirimkan ke daerah bencana. Desa Sayi Hazara, yang berpenduduk kira-kira 20 keluarga, telah terkubur di bawah kira-kira 30 meter timbunan batu dan lumpur. Survei Geologi AS (USGS) mengatakan gempa bumi berkekuatan 5,4 skala Richter melanda daerah itu Senin dan disusul oleh guncangan gempa berkekuatan 5,7 skala Richter. (m10)

Kapal Terbalik Di Filipina, Dua Tewas, 26 Hilang MANILA (Antara/Xinhua-OANA): Dua orang tewas dan 26 penumpang lainnya hilang dalam kecelakaan perahu layar yang terbalik di perairan El Nido, Provinsi Palawan, Filipina tenggara. Jurubicara Penjaga Pantai Filipina May. AL Armand Balilo, Rabu (13/6),mengatakanbahwaanggotatimnyatelahmenemu-kanmayat seorang anak dan seorang pria tua. Mayat itu ditemukan setelah kapalpenumpang/kargoyangbernamaMJJosillekarampadaSelasa di dekat Pulau Pagawanin. Dia mengatakan 22 penumpang lain berhasil diselamatkan setelah mereka terapung di atas sekoci selama berjam-jam. “Perahu itu dihantam ombak besar akibat cuaca buruk. Misi penyelamatan masih berlangsung,” kata Balilo.

Suu Kyi Ke Eropa Untuk Terima Nobel YANGON (CNN): Aung San Suu Kyi Rabu (13/6) meninggalkan Myanmar untuk melakukan keliling Eropa selama 16 hari, termasuk menerima Nobel Perdamaian yang dimenangkannya tahun 1991. Pejuang demokrasi itu, yang baru-baru ini terpilih untuk duduk di parlemen Myanmar, juga akan berpidato di parlemen Inggeris, menjadi tamu kehormatan di konser music di Dublin dan merayakan ulang tahunnya bersama keluarga. Semuanya itu berlangsung Kamis (14/6) ketika dia berpidato di Organisasi Buruh Internasional di Palais des Nations di Jenewa. Organisasi itu punya sejarah lebih enam decade dengan Myanmar dan berharap bisa menghapus-kan buruh paksa pada akhir tahun 2015 dan memfasilitasi organisasi pekerja, seiring Myanmar – yang juga dikenal dengan Burma – terus melakukan perubahan. Kunjungan ke Eropa ini akan menjadi perjalanan ke luar negeri kedua yang dilakukan Suu Kyi sejak dia kembali ke Myanmar tahun 1988 untuk merawat ibunya yang sedang sekarat. Kudeta militer September lalu yang menobatkan Jenderal Sau Maung berkuasa, memicu demonstrasi antipemerintah dan penindasan yang menyebabkan ratusan orang tewas. Suu Kyi – yang suaminya, Michael Aris, masih menetap di Inggeris – menjadi aktivis dan pendiri kelompok oposisi, Liga Nasional Demokrasi (NLD), sebelum dia dijatuhi tahanan rumah untuk pertama kalinya menyusul tuduhan dia mencoba memecah belah militer. Dua dekade berikutnya juga di dihabiskan dalam tahanan rumah yang ditetapkan junta berkuasa. Ketika partai pimpinannya memenangkan pemilihan umum tahun 1990 dengan kemenangan mutlak, penguasa militer – yang berkuasa sejak 1962 – menolak NLD berkuasa, yang berarti menolak hasil pemilihan. Suu Kyi pun tetap mendekam dalam tahanan rumah. Ketika Suu Kyi memenangkan penghargaan HAM Sakharov dari Parlemen Eropa pada tahun 1991 dan kemudian Nobel Perdamaian, atas‘perjuangan demokrasi dan HAM yang dilancarkannya tanpa kekerasan’, dia tetap ditahan. Dalam menerima hadiah tersebut atas nama ibunya, Alexander Aris mengatakan “Saya pribadi meyakini dedikasi dan pengorbananannya menjadikan dia symbol lewat mana penderi-taan seluruh rakyat Burma diakui.” Sabtu,21tahunkemudian,SuuKyiakhirnyaakanmenyam-paikan pidato penerimaan no-belnya di Oslo City Hall di Nor-wegia.Dia juga akan menerima penghargaan tertinggi di Amnesty International, the Ambassador of Conscience Award, yang per-nah diterima Nelson Mandela, Vaclav Havel dan Mary Robinson. (m23)

China Tolak Izin Masuk Mantan PM Norwegia OSLO(Waspada):PemerintahChinamenolakkehadiranmantan PM Norwegia Kjell Magne Bondevik di negara itu. Sikap ini ditegaskan melalui penolakan Kedutaan Besar China untuk memberikan visa bagi Bondevik. Bondevik yang sempat menjabat sebagai PM Norwegia periode 1997-2000dan2001-2005inisebelumnyadijadwalkanakanmenghadiri seminarDewanGerejadiChinadalampekanini.Namun,haltersebut batal setelah pihak Kedubes China menolak memberikan visa. Penolakanituterkaitdenganpertikaiandiplomatikataspemberian Hadiah Nobel Perdamaian 2010 kepada seorang pembangkang pemerintah China Liu Xiaobo. Kabar ini muncul setelah diketahui bahwa Bondevik merupakan satu-satunya peserta dari 30 peserta lainnya yang ditolak masuk ke China. “Ini adalah sebuah ketidakberuntungan. Saya yakin pertemuan Dewan Gereja akan tetap berlangsung meski tanpa Saya namun, Saya tetapberharapdapatmenghadirinya.PeristiwainimembuktikanChina masihmenekankanpermasalahanpemberianHadiahNobelPerdamaian kepada Liu, bahkan setelah dua tahun berlalu,” ujar Bondevik yang dikutip AFPRabu,(13/6). Mantan PM Norwegia itu menambahkan, Kedubes China sendiri tidak pernah memberikan alasan yang jelas terkait dengan penolakan visa yang diajukannya. (ok)

KUALALUMPUR(Antara):PolisiMalaysiamembongkarpabrik shabuyangberkedokpabrikmakananbekudiKawasanPerindustrian Baru Pekan Nenas, Pontian, Johor Bahru, setelah tempat tersebut terbakar. Kepala Polisi Johor Datuk Mohd Mokhtar Mohd. Shariff seperti dikutip harian Utusan Malaysia, Rabu (13/6)mengatakan, pihaknya menduga pabrik tersebut dijadikan tempat memproses narkoba oleh sebuah sindikat internasional. Pabrik dua tingkat tersebut dilaporkan terbakar sekitar pukul 11:30.Namunpolisiyangmelakukanpenyelidikanataskasustersebut justrumenemukanshabudanekstasisenilai10jutaRinggitMalaysia di lokasi kebakaran. “Polisi juga menemukan beberapa peralatan yang digunakan untuk memproses narkoba dan kami yakin pabrik itu telah lama menjalankan aksi tersebut,” katanya. Namun polisi belum mengeluarkan semua narkoba dari lokasi kebakarankarenakawasanpabriktersebutmasihdicemarisisabahan kimia akibat kebakaran yang dikhawatirkan bisa membahayakan petugas. Tim forensik dari IPK Johor dan Kepolisian Bukit Aman sedang mengumpulkan bukti untuk dikirimke JabatanKimiauntuk penyelidikan lebih lanjut.

Mantan Presiden Tunisia Divonis 20 Tahun Penjara In Absentia


PETUGAS keamanan Kurdi memeriksa satu lokasi serangan bom mobil di Kirkuk, 250 km utara Baghdad, Irak, Rabu (13/6). Serangan bom simultan Rabu dinihari di utara kota minyak Kirkuk menewaskan satu orang dan mencederai 14 lainnya, kata polisi dan sumber rumah sakit.Mereka mengatakan, semua serangan mengarah kepada markasbesar Partai Demokrat Kurdi (KDP) dari Presiden Massoud Barzani yang adalah seorang Kurdi.

Mubarak Takut Para Dokter Penjara Mau Membunuhnya KAIRO (AP): Kondisi mantan Presiden Hosni Mubarak telah stabil, namun pengacaranya mengatakan mantan pemimpin berusia 84 tahun itu tidak percaya pada para dokternya di rumah sakitpenjaradandiatakutmereka akan membunuhnya. Ada laporan lain tentang kondisi Mubarak sejak pengadilan memvonisnya 2 Juni lalu karena kegagalannyamencegahpembunuhan para pemrotes dalam pergolakan yang menggulingkannya tahun lalu. Dia dijatuhi hukuman penjara seumur hidup. Sejak kedatangannya di penjara, Mubarak telah menderita tekanandarahtinggidansulitbernafas dan didiagnosa mengalami depresi dalam, demikian menurutparapejabatkeamanandipenjaraTorah.Senin,paradoktertelah menggunakan alat pengejut jantung dua kali setelah mereka tidak dapat menemukan nadinya. Dalam satu program televisi malam,pengacaraMubarak,Farid el-Deeb mengatakan dia telah meminta agar pihak berwenang memindahkan Mubarak ke tem-

pat yang berpelengkapan yang lebih baik karena kesehatannya rentang. El-Deeb menunjukkan satu gambar seorang pria paranoid yang tidak percaya lagi kepada tim medisnya di penjara. El-Deeb merasa khawatir dengan rencana pemerintah yang bermaksud memindahkan Mubarakkerumahsakitmiliter.Initerkaitdengankondisitubuhnyayang rapuh.“Mubaraktidakmempercayaisiapapun.Diaterkejutadadokter baru yang merawatnya, bukan dokteryangbiasamelakukanperawatanterhadapnya.Diapuntakut meminum obat dari dokter baru ini.Mubaraktidakmengenaliwajah yangberadadisekitarny,initentunyamenjadimaslalahbaginya,”ujar Farid el-Deeb, seperti dikutip The Associated Press, Rabu (13/6). El Deeb pun menceritakan ketakutan Mubarak, yang merasa cemas para dokter akan membunuhnya. “Tolong saya Farid,” cerita dari pengacara Mubarak itu. Dirinya sempat mengaku kepada saya, ‘saya tidak nyaman dansayamerasatidakaman.“Mereka segera membunuh saya,”

lanjutFariddalamketerangannya. Menurut El Deeb, keputusan untuk memindahkan Mubarak dari penjara rumah menjadi keterkejutan pada dirinya. Hal ini disebabkan, pihak dokternya tidak mengizinkan Mubarak untuk berpindah tempat. Sejak ditahan April 2011 lalu, Mubarak menghabiskan waktunya di rumah sakit mewah di Sharmel-Sheik.Dirinyakemudian dipindahkan ke rumah sakit militer ketika pengadilannya dimulai pada Agustus lalu. Di rumah sakit ini, Mubarak selalu dikunjungi oleh keluarganya. Jurubicara Kementerian Dalam Negeri Mesir Alaa Mahmoud menyatakan, kondisi Mubarak saat ini tengah stabil meskipun kondisi kesehatannya terganggu. Mahmoud menambahkan, untuk sementara ini belum ada rencana untuk memindahkan Mubarak ke rumah sakit lain. Kini dokter dari akademi polisi dan penjara, masih terus memonitor kondisi kesehatan Mubarak. Bentuk Majelis Konstitusi Sementaraitu,ParlemenMe-

sir dilaporkan telah memilih 100 orang anggota Majelis Konstitusi (MK)yangnantinyaakanbertugas untuk menulis konstitusi baru. Hal ini terjadi ditengah kuatnya desakan agar pemerintah membentuk sebuah MK yang dapat mewakilisemuakalangandiMesir. “16 Anggota MK yang terpilih berasal dari kelompok Ikhwanul Muslimin sementara 10 orang diketahui berasal dari Partai Salafi,” tulis salah satu media lokal yangdikutipTrendRabu.Dari1.310 kandidatyangterdaftardalampemilihan MK diketahui terdapat beberapanamabesarsepertimantankandidatpresidenMesirMohamed Selim al-Awa, Amr Moussa, Abul-FotouhdanHamdainSebahi. Selain itu sejumlah nama jurnalis, tokoh, hakim dan pengacara juga termasuk dalam bursa pemilihan anggota MK ini. Sebelumnya, pada Maret lalu anggota MK telah dipilih namun, pemilihanitudinilaitidakmewakili seluruh kepentingan rakyat Mesir karena anggota MK didominasi oleh kelompok Ikhwanul Muslimin dan Partai Salafi. (m10)

Kekurangan Makanan Menambah Sengsara Korban Rusuh Myanmar


PARA pengungsi Rohingya dari Myanmar duduk di atas satu boat ketika mereka berusaha untuk dapat masuk ke Bangladesh, namun para anggota Pengawal Perbatasan Bangladesh (BGB) mengusir mereka keluar di Teknaf, Bangladesh, Rabu (13/6).Kantor Urusan Pengungsi PBB (UNHCR) menyerukan pada Bangladesh agar membuka perbatasannya guna menampung pengungsian karena meningkatnya kerusuhan di negara bagian Rakhine, Myanmar Utara, kata jurubicara PBB Martin Nesirky Selasa.

SITTWE(AP):HujanlebatRabu (13/6) membuat ketenangan makinmencekamdibaratMyanmar setelah lima hari dilanda kemelutsekteyangmenelankorban jiwa.Parawargamengatakanmereka masih takut tidur pada mala haridankinimerekamenghadapi problembaru,kekuranganbahan makanan. Sekurang-kurangnya21orang tewas dan lebih dari 1.600 rumah dibakardalamkonfliktersebutyang melibatkanetnisRakhinepenganut Buddha dengan warga Muslim Rohingya, yang dianggap tidak bernegara di kawasan pantai negarabagianRakhine,tempatdimanaterjadibeberapakalikerusuhan sekteterburukdiMyanmarselama beberapa tahun. Kekhawatiran bakal terjadi kerusuhan baru menyebabkan pelayananbusdanferidariYa-ngon menyebabkanterhentinyapengirimanpasokanmakanandankargo lainnyakeSittwe,ibu-kotaRakhine, yangmenyebabkanhargakebutuhan pokok meroket. Toko-toko, bank-bank dan sekolah-sekolah serta banyak pasar tutup. Sementara itu, seorang utu-

san penting PBB tiba di Myanmar Barat yang dilanda kerusuhan Rabu menyusul pecah aksi kekerasan berlatar agama yang telah menewaskan puluhan orang dan menyebabkan meningkatnya keprihatinan internasional. PenasehatkhususSekjenPBB Ban Ki-moon tentang Myanmar, VijayNambiar,terbangkeibukota negara bagian Rakhine yang bergolak, yang diguncang kerusuhan dan pembakaran, serta mendorong pemerintah untuk mengumumkan keadaan darurat. Nambiarkemudianakanmengunjungi Maungdaw - di perbatasandenganBangladesh-dimana serentetan kerusuhan terbaru berkobar mulai Jumat. “Kami ke sini untuk mengamati dan menilai bagaimana kita dapat terus memberikan dukungankepadaRakhine,”kataAshok Nigam, koordinator kependudukan dan kemanusiaan PBB kepada AFP. PBB telah mengevakuasi sebagian besar staf asingnya dari Maungdaw, yang merupakan basis utama di negara bagian yang memiliki populasi besar Muslim

Rohingya tanpa negara. Sekitar 25 orang tewas dan 41 orang lainnyaterlukadalamkerusuhanlima hari, kata seorang pejabat. Korban tewas tidak termasuk 10wargaMuslimyangtewaspada 3Juniolehamukanbalasdendam massa Buddha atas kasus pemerkosaan dan pembunuhan seorang wanita yang mereka tuduhkan dan memicu kekerasan di Rakhine. Ratusan Rohingya, banyak dari mereka perempuan dan anak-anak, telah berusaha untuk melarikan diri ke Bangladesh denganperahureyottetapiditolak oleh penjaga perbatasan. Human Rights Watch telah mengeluarkan pernyataan Rabu yang mendesak Bangladesh agar membuka perbatasannya untuk warga Rohingyas yang berusaha mencari tempat pengungsian. MenluBangladeshDipuMoni mengatakandalamsatutemupers Selasa di Dhaka bahwa bukan kepentinganBangladeshuntukmenerima setiap pengungsi karena sumber daya negara miskin itu tidak mampu menampung mereka. (m10)

TUNIS (AP): Pengadilan militerTunisia Rabu (13/6) menjatuhkan vonis atas mantan presiden in absentia karena membangkitkan kerusuhan dan menjatuhkannya hukuman 20 tahun penjara, Hukuman itu merupakan vonis pertama atas mantan presiden Zine El Abidine Ben Ali oleh satu pengadilan militer. Dia telah didakwa melakukan perdagangan obat terlarang, perdagangan senjata gelap dan menyalahgunakan dana masyarakat dan dijatuhkan hukuman 66 tahun oleh satu pengadilan sipil. Ben Ali telah digulingkan dalam pergolakan satu bulan tahun lalu dandiamelarikandirikeArabSaudipada14Januari2011.Kejatuhannya telah mengilhami serangkaian gerakan pro-demokrasi di seluruh kawasan jazirah Arab yang dikenal dengan sebutan Arab Spring. Pengadilan itu mendakwa Ben Ali telah mengeluarkan perintah kepada pasukan keamanan untuk menembaki para pemrotes. Kasus yangdisidangkanRabuituadalahmengenaiinsidendikotaOuardanine di mana polisi melepaskan tembakan atas kerumunan massa yang berusahamenghentikankeponakanpresidenKaisyangjugamelarikan diri dari negeri itu, yang menewaskan empat orang. (m10)

Syria Nyatakan Rebut Kembali Desa Pemberontak BEIRUT(AP):PasukanSyriamenekansejumlahkubupertahanan pemberontak yang bertahan di satu kawasan yang dikuasai pemberontakdekatpantaiLautTengahRabu(13/6)dantelevisipemerintah menyatakan mereka berhasil merebut kembali kendali daerah itu menyusul perang sengit delapan hari. Daerah pegunungan Haffa merupakan salah satu dari sejumlah kawasan di mana pasukan pemerintah bertempur melawan pemberontak guna mengendalikan keadaan pada saat suasana kekerasan meningkat. Merebut kembali daerah itu merupakan hal penting bagi rezim Presiden Bashar Assad karena kota itu berada hanya 30 km darikotaasalpresidenitudiKardahadiprovinsiLatakia.Latakiaadalah jantung daerah minoritas Alawite, yang merupakan suku asal Assad dan penguasa elit itu, meski di sana ada kelompok agama lainnya. Wanita jurubicara Kemlu ASVictoria Nuland memperingatkan dua hari lalu bahwa pasukan Assad dapat melakukan pembantaian di Haffa, yang mengundang kutukan dari Kementerian Luar Negeri Syria yang menuduh AS melakukan campur tangan dalam urusan internal Syria. (m10)

China Boikot Konferensi Religi BEIJING (Waspada): Delegasi China yang bergabung dalam Konferensi Persahabatan Buddha Sedunia (WFB) di Korea Selatan (Korsel), dipulangkan kembali ke negaranya. Hal itu disebabkan karena Tibet berpartisipasi dalam acara tersebut. Sebanyak17biksudanpejabatasalChinadiundangkekonferensi WFB.Meskidemikian,Chinalangsungmemutuskanuntukmemboikot delegasi-delegasinya karena partisipasiTibet dalamWFB. Selasa, tiga delegasi asal Tibet dipaksa untuk meninggalkan rapat delgasi setelah pejabat China mengancam boikot terhadap pertemuan itu. “SekretarisJendralWFBmenerimatuntutanChinayangmeminta agar warga Tibet pergi, agar pertemuan ini berjalan dengan halus,” ujar juru bicara WFB, seperti dikutip AFP, Rabu (13/6). Namun tiga warga Tibet itu masih bergabung dalam beberapa acara dalam konferensi lima hari itu. Delegasi China pun akhirnya meninggalkan Korsel tepat pada hari ini. Sekitar 400 delegasi yang berasal dari 30 negara di dunia, datang untuk menghadiri konferensi WFB yang digelar dua tahun sekali, di Kota Yeosu, China. Namun keputusan Pemerintah Korsel yang memberikan visa kepada mantan Perdana Menteri Tibet Samdhong Rinpoche menuai kecaman dari China.(ok)

Ketua NATO Berikrar Tidak Akan Tinggalkan Afghanistan SYDNEY (Antara/AFP): Kepala NATO Anders Fogh Rasmussen Rabu (13/6) berikrar tidak akan meninggalkan Afghanistan pada saat negara-negara asing berencana menarik pasukan keluar dari negara itu setelah satu dekade konflik. “Kami tidak akan meninggalkan Afghanistan, kami tidak akan meninggalkan kevakuman keamanan,” katanya dalam acara makan siang National Press Club di Canberra. NATO berencana untuk menarik 130.000 tentaranya pada akhir 2014,danRasmussenjugamengatakantampaknyaakanterjaditransisi politik pada saat Presiden Afghanistan Hamid Karzai diperkirakan akan mundur pada pemilu berikutnya, pada tahun yang sama. “Ya, kita berharap Presiden Karzai untuk mematuhi konstitusi Afghanistan yang ... tidak memungkinkan dia untuk menjalankan lagi sebagai presiden,” katanya. Sekjen NATO Rasmussen mengatakan, masyarakat internasional memiliki ‘minat dan tanggung jawab bersama’ untuk melihat intervensi selama satu dekade di Afghanistan itu pada akhirnya sukses. Rasmussen mengatakan dia memahami ketidaksabaran mengenaikonflikdimanapasukanasingtelahmembantuAfghanistan memerangi pemberontakan gerilyawan Taliban, dan mengatakan orang ‘ingin melihat cahaya di ujung terowongan. “Orang ingin melihat perkembangannya, begitu juga saya,” katanya, dan menambahkan bahwa pasukan asing telah dikirim ke Afghanistan untuk mencegah negara itu dari sekali lagi menjadi surga yang aman bagi teroris dari mana untuk memulai serangan. “Meskipun ketidaksabaran ini, semua mitra koalisi ISAF telah memutuskan untuk berkomitmen, melihat operasi ini mungkin berujung sukses. Dan itu mendorong dukungan publik meskipun masih terjadi krisis ekonomi.”


WASPADA Kamis 14 Juni 2012

Air Mata Firda Mengalir Deras Djarum Indonesia Open Super Series 2012 JAKARTA (Waspada): Cedera kaki kanan memaksa Adriyanti Firdasari mundur dari Djarum Indonesia Open Super Series Premier 2012. Alhasil, tunggal putri Indonesia itu menyerahkan kemenangan kepada Wang Yihan (China) pada babak pertama di Istora Senayan, Jakarta, Rabu (13/6). Dengan menggunakan kursi roda, Firda pun dibawa ke luar arena dalam keadaan skor 7-7. Atas cedera tersebut, Firda tak kuasa menutupi kesedihannya. Air matanya mengalir saat ribuan penonton memberi tepuk tangan untuk menyemangatinya. Buat Firda, ini merupakan akhir yang menyedihkan karena peluangnya ke Olimpiade London juga terancam. Tunggal putri lainnya, Ana Rovita, mengikuti jejak Firda saat takluk di babak pertama. Lolos secara gemilang dari babak kualifikasi, Ana kali ini harus menyerah di tangan Juan Gu (Singapura) 20-22, 17-21. Sebaliknya, Aprilia Yuswandari me-

TUNGGAL putri Indonesia, Adriyanti Firdasari, dibantu tim medis saat meninggalkan lapangan akibat cedera di babak pertama Djarum Indonesia Open Super Series Premier 2012, Rabu (13/6). -Waspada/Danau Antariksa-

langkah ke babak kedua dengan mengalahkan Hera Desi 21-15, 16-21, 21-6. Ganda kakak beradik, Markis Kido/Pia Zebadiah, menyingkirkan unggulan kelima asal Taipei, Chen Hung Ling/ ChengWen Hsing, 21-17, 21-18. Hendra Setiawan/Vita Marissa juga melaju kala menumbangkan Lukhi Apri Nugroho/Anissa Saufika 21-16, 21-18. Ganda

campuran juga meloloskan Fran Kurniawan/Shendy Puspa Irawati dan Riky Widianto/ Puspita Richi. Di ganda putri, Anneke Feinya Agustine/Nitya Krishinda Maheswari gagal melangkah lebih jauh. Pada laga perdananya, jawara SEA Games 2011 itu disingkirkan Bao Yixin/Zhong Qianxin (China) 14-21, 21-18, 16-21. Nasib serupa dialami Suci

THA 4 All, All 4 Indonesia Taufik Hidayat Arena TAUFIK Hidayat Arena, sebuah gedung yang dibuat oleh seorang anak Indonesia untuk Indonesia merupakan bangunan perjuangan, keinginan, dan keyakinan membangun bangsa Indonesia suatu saat nanti. The House Spirit of Badminton tersebut akan dibuka tahun ini di Ciracas, Jakarta Timur, sebagai rumah bulutangkis pertama dengan nama seorang atlet, dimiliki, dan dikelola oleh manajemen atlet itu sendiri. Selama Djarum Indonesia Open Super Series Premier 2012

berlangsung, THA kembali hadir menjawab berbagai pertanyaan tentang program dan fasilitas yang dapat dinikmati oleh publik hasil kerjasama dan dukungan YONEX selaku produsen perangkat alat olahraga serta perlengkapan bulutangkis. THA Center dapat dikunjungi di gerai YONEX pada 1217 Juni ini berlokasi di Istora Senayan. Berbeda dengan tahun sebelumnya yang hanya menjual produk THA, kali ini THA THA akan memberikan waktu khusus bagi pengunjung men-

dapatkan konsultasi dengan pelatih, selain program dan fasilitas. Pada kesempatan ini, setiap pengunjung dapat bertemu THAS (Taufik Hidayat Arena Squad), pasukan yang memiliki visi misi atas kecintaan dan dukungan terhadap bulutangkis nasional. THAS juga gabungan Indonesian Badminton Lovers yang akan membantu menjawab pertanyaan dan menjelaskan berbagai pengetahuan mengenai dasar, jiwa, dan isi dari THA kepada pengunjung. (m33)

Duo SSB Kisaran United Perkuat ASSBI Sumut KISARAN (Waspada): Dua siswa SSB Kisaran United PTPN III akan memperkuat tim Asosiasi Sekolah Sepakbola Indonesia (ASSBI) Sumut untuk berlaga di Malaysia dan Jakarta pada Juni ini. Kedua siswa itu adalah Bambang Rahmad Hidayat (ki-

per) yang akan memperkuat tim ASSBI Sumut di turnamen U-16 antar-SSB se-Asean di Malaysia, 29 Juni nanti. Selanjutnya, Zoky Azhari Manurung (striker) memperkuat ASSBI Sumut di turnamen Grassroots Indonesia U-12 di Jakarta, 14-24 Juni ini.


FOTO kiri: Zoky Azahri diapit Kepala SMP Diponegoro Aysan Surya didampingi Ketua I SSB Kisaran United PTPN III, A Hafiz Hasibuan. FOTO kanan: Bambang Rahmad Hidayat.

Ketua I SSB Kisaran United PTPN III, A Hafiz Hasibuan, Rabu (13/6), menuturkan bahwa prestasi dua siswanya itu diharapkan menjadi motivasi bagi siswa lainnya dalam meningkatkan talenta. “Kami ucapkan terima kasih kepada Pembina SSB Kisaran United PTPN III, Ir H Sumardi MM, yang selama ini telah memfasilitasi sarana prasarana latihan pemain di Lapangan Afdeling I Sei Dadap,” ucap Harfiz. Terpisah, Ketua Pengcab PSSI Asahan, HM Wahyudi SST, mendukung penuh program pembinaan yang dilakukan manajemen SSB Kisaran United PTPN III. Terlebih setelah berhasil meloloskan siswanya mengikuti event nasional dan internasional. (a15)

Sergai Siap Gelar Kejurwil I PBSI Sumut SEIBAMBAN (Waspada): Pengkab PBSI Serdang Bedagai telah siap menggelar Kejuaraan Wilayah (Kejurwil) I Pengprov PBSI Sumut 2012 memperebutkan Piala Bupati Sergai dan Muspida Plus. “Sebagai tuan rumah, kita sudah siap menggelar Kejurwil I Sumut pada 18-22 Juni nanti. Pesertanya dari sembilan kabupaten/kota di Sumut, yakni Langkat, Binjai, Deliserdang, Sergai, Tebingtinggi, Pematangsiantar, Simalungun, Batubara,

Karo,” ujar Ketua Pengkab PBSI Sergai, Budi Sumalim SE, Rabu (13/6). Didampingi Kepala BPBD Sergai, Drs Joni W Manik, dan Ketua Panitia Kejurwil I, Dedy Irwansyah SPd, Budi Sumalim menyebutkan kategori yang dipertandingkan terdiri atas tunggal anak putra/putri (kelahiran tahun 2000), tunggal dan ganda pemula (1998), tunggal dan ganda putra/putri (1996), serta tunggal dan ganda taruna putra/putri (1994).

Problem Catur


Putih melangkah, mematikan lawannya empat langkah.

Jawaban di halaman A2 8







1 A





“Acara ini sekaligus dirangkai dengan pelantikan pengurus PBSI Sergai periode 2012-2016. Kami juga akan menggelar kejuaraan bulutangkis beregu tingkat sekolah se-Sergai,” timpal Ketua Panitia, Dedy Irwansyah. Ditambahkan, saat ini panitia tengah melaksanakan finishing lapangan serta fasilitas pendukung lainnya. “Kami ingin menyukseskan event ini dan menjadi tuan rumah yang baik bagi kontingen lainnya,” pungkas Dedy. (c03)




Rizky Andini/Della Destiara Haris yang dikalahkan Miyuki Maeda/Satoko Suetsuna (Jepang) 18-21, 15-21. Sukses dirasakan Meliana

Jauhari/Greysia Polii yang menghadang Mingtian Fu/ Aiying Fing (Singapura) 21-10, 21-13. Langkah gemilang juga diikuti Pia Zebadiah/Rizki Amelia Pradipta. Ganda putri kualifikasi ini lolos setelah menumbangkan unggulan kelima Christinna Pedersen/ Kamilla Rytter Juhl (Denmark) 21-17, 21-18. Di ganda putra, Ricky Karanda Suwandi/M Ulinnuha mengalahkan Mads CondradPetersen/Jonas Rasmussen (Denmark) 23-21, 21-17. Pil pahit justru dialami Bona Septano/ M Ahsan yang ditaklukkan Thien How Hoon/Wee Kiong Tan 16-21, 21-19, 17-21. Namun kejutan terhebat terjadi kala Sony Dwi Kuncono menghempaskan Peter Gade. Pebulutangkis Denmark yang juga menyatakan pensiun itu disingkirkan Sony 21-14, 7-21, 18-21 dalam tempo 55 menit. Sayang, Sony langsung bertemu Taufik Hidayat yang menang atas Andre Kurniawan Tedjono 21-18, 21-19. (m33/yuslan)

Opunk Minta PASI Lebih Perhatian MEDAN (Waspada): Dalam mengembangkan olahraga di Kota Medan, tidak bisa terlepas dari peranan pengurus cabang olahraga. Karena itu, KONI Medan meminta agar Pengcab Persatuan Atletik Seluruh Indonesia (PASI) Kota Medan lebih memperhatikan perkembangan atletnya. “KONI Medan tidak bisa bekerja sendirian, tapi butuh peran dari Pengcab sehingga mampu memotivasi para atlet dalam mencapai hasil maksimal,” ujar Ketua Umum KONI Medan, Drs H Zulhifzi Lubis, ketika meninjau latihan atlet di Stadion Unimed, Rabu (13/6). Menurutnya, pengcab memiliki peranan penting dalam memajukan olahraga di Kota Medan. Kepedulian pengcab tidak hanya mengembalikan semangat, tapi juga menambah motivasi atlet untuk meraih hasil maksimal, khususnya menghadapi Pekan Olahraga Nasional (PON) 2016 mendatang. “Semua yang dilakukan KONI Medan tidak ada artinya bila tidak ada peranan dari pengcab,” jelas Opunk Ladon, sapaan akrabnya. Karena itu, Opunk berharap atlet binaan KONI Medan, khususnya cabang atletik, terus bermimpi meraih prestasi, sehingga ke depan bisa menggantikan nama-nama seperti Parlautan Sireger dan Mardi Lestari, yang pernah berjaya di tingkat nasional. “Target KONI Medan saat ini adalah PON 2016. Jadi, atlet diharapkan mulai memasang tekad lolos ke PON 2016, jangan sampai kalah dari daerah yang kurang mendapat perhatian dari KONI dan pemerintah daerahnya. Semua atlet binaan saat ini harus bisa tampil di Jawa Barat nanti,” tegas Opunk. Karena itu, Opunk berharap atlet atletik tetap serius menjalani latihan dan tidak pernah main-main. Dikatakan, Medan harus bisa menjadi kiblat atletik di Sumatera Utara. Sementara itu, pelatih atletik Kota Medan Joni Siahaan mengatakan atlet atletik binaan KONI Medan saat ini berlatih di Stadion Unimed, PPLP Sumut, dan Gaperta. (m47)

Seleksi Tim Sepakbola Popwil Sumut Jumat (15/6) Di PPLP Sumut MEDAN (Waspada): Tim sepakbola Sumut yang dipersiapkan mengikuti Pekan OlahragaWilayah (Popwil) yang dihelat di Medan pada November mendatang, akan menggelar seleksi di lapangan PPLP Sumut, Jl Sekolah Pembangunan Medan Sunggal, Jumat (15/6) sampai Minggu (17/6). Hal itu disampaikan Kabid Olahraga Dispora Sumut, Darwis Siregar, didampingi Kasi Pembinaan Prestasi Dispora Sumut, Safei Pilly, Rabu (13/6). Kepada pemain yang berminat mengikuti seleksi diharapkan datang Jumat (15/6) pukul 14:00WIB membawa perlengkapan olahraga. Seleksi digelar untuk pemain kelahiran tahun 1995 dan duduk di bangku sekolah SLTA tahun pelajaran 2012-2013. Pada Popnas 2011 di Pekanbaru, tim sepakbola Sumut memperoleh medali emas. “Tentunya kita berharap Sumut sebagai tuan rumah Popwil dapat lolos Popnas dan mempertahankan juara Popnas 2013,” terang Darwis yang diamini Pilly. Di samping sepakbola, cabang olahraga lainnya juga mengadakan seleksi. Dari delapan cabang olahraga (cabor) yang dipertandingkan pada Popwil dua tahun lalu, kontingen Sumut memperoleh 20 medali. Rinciannya, enam medali emas masing-masing disumbangkan cabang bola voli putri, bola basket putri, tenis meja beregu putra/putri, bulutangkis beregu putri, dan pencak silat. Selanjutnya, enam medali perak masing-masing satu medali tiap cabor, yakni pencak silat, sepakbola, bola voli putra/putri serta bola basket putra, sedangkan perolehan delapan perunggu diraih pencak silat (5), tenis lapangan, dan sepak takraw. “Memang prestasi musim lalu sudah cukup lumayan, dan alangkah baiknya kalau tahun ini kita meraih juara umum,” tutur Darwis. (m18)

A9 PSMS IPL Sebatas 8 Besar Piala Indonesia 2012 MEDAN (Waspada): PSMS Medan gagal ke semifinal, setelah ditahan Semen Padang 1-1 pada leg kedua perempatfinal Piala Indonesia 2012 di Stadion Teladan Medan, Rabu (13/ 6). Dengan demikian, tim Ayam Kinantan kalah agregat 1-3, setelah leg pertama kalah 0-2. Bermain di kandang sendiri, PSMS yang tampil di Indonesian Premier League (IPL) ini bak kehilangan asa. Berjalan lima menit, Semen Padang mendapatkan peluang emas melalui Yu Hyun Koo (Korsel). Beruntung, kiper Decky Ardian berhasil mengamankan bola dan gawang PSMS. Menit 29, Semen Padang baru berhasil membobol gawang Ayam Kinantan berkat Elie Aiboy yang notabene mantan pemain PSMS juga. Dua menit menjelang bubaran babak pertama, Vagner Luis membalas gol tim tamu. Palang pintu tangguh asal Brazil itu membuat kedudukan imbang hasil memanfaatkan umpan free kick Ahn Hyo Yoen. Memasuki babak kedua, pertandingan berjalan dengan tempo yang lebih cepat. Namun peluang demi peluang yang diraih kedua tim belum menemui sasaran. Menit 53, Semen Padang mendapatkan hadiah penalti menyusul pelanggaran DenyWahyudi terhadap Joshua Pahabol. Layaknya di babak pertama, penampilan apik Decky menyelamatkan PSMS dari kekalahan. Dengan sigap, sang kiper berhasil menghalau eksekusi penalti yang dilakukan Edward Wilson. Kendati begitu, PSMS tetap tersingkir dari pentas Piala Indonesia tahun ini. Pelatih PSMS IPL, Fabio Lopez, mengatakan, hasil kegagalan ini agar tidak dijadikan alasan pihak-pihak tertentu untuk me-


BEK PSMS IPL,Vagner Luis (kiri), berduel di udara dengan Abdul Rahman asal Semen Padang dalam leg kedua perempatfinal Piala Indonesia di Stadion Teladan Medan, Rabu (13/6). nyalahkan pemain. Fabio berpendapat banyak masalah terjadi di manajemen yang juga berimbas pada performa pemain. “Jadi, jangan salahkan pada pemain kalau mereka tidak bisa bermain secara maksimal,” kata pria asal Negeri Pisa itu. Menanggapi permasalahan di manajemen, Heru Prawono

selaku Sekretaris Tim PSMS IPL mengakui bahwa pemain belum menerima gaji selama tiga bulan. Di lain pihak, pelatih Suhatman Imam mengaku kecewa dengan penampilan anak-anak asuhnya yang bermain seolah tanpa semangat. Meski demikian, Suhatman mensyukuri lolosna Semen Padang ke semifinal. (m18)

Persib Minus Alamshah, Nasuha MEDAN (Waspada): Rombongan Persib Bandung direncanakan tiba Kamis (14/6) di Medan. Namun kehadiran tim Maung Bandung itu dikabarkan minus dua pemain andalannya, Noh Alamshah (Singapura) dan Muhamad Nasuha. Menurut keterangan LO Persib, Zulkifli, absennya kedua pemain pada untuk laga lanjutan Indonesian Super League (ISL) di Stadion Teladan, Minggu (17/ 6) nanti, akan terobati dengan pulihnya cedera Abanda Herman dan Jajang Sukmara. Pelatih Persib, Robby Darwis, menyebutkan absennya Noh Alamshah dan Nasuha tidak akan memengaruhi penampilan skuadnya karena mereka masih memiliki pemain andal lainnya. Begitu juga dengan lini depan di mana Persib memiliki

empat striker termasuk Marcio Souza. Sebaliknya, kubu tuan rumah siap membalaskan kekalahan di putaran pertama lalu. Tampil di Bandung, Ayam Kinantan takluk 1-3. Karena itu, Zulkarnaen cs bertekad melupakan tiga kekalahan beruntun di tanah Papua dan bangkit untuk meraih poin di kandang sendiri. “Kita tahu Persib sedang bagus-bagusnya, tetapi kita ingin menang. Sasa Zecevic dan kawan-kawan akan berusaha bermain maksimal dan memberi perlawanan semampunya untuk meredam kekuatan tim tamu,” terang Asisten Pelatih PSMS, Roekinoi, Rabu (13/6). Keyakinan PSMS sedikit banyak dipengaruhi komplitnya pemain. Absen di tur Papua,

Yoseph Nico Malau, Nastja Ceh, dan Shin Hyun Joon yang sempat cedera sudah bisa membela PSMS. Begitu juga Sasa yang habis menjalani hukuman akumulasi kartu. Bersama Suharto AD, Roekinoi mengakui pihaknya kini fokus memantapkan formasi 4-4-2. Pola ini sempat tidak berjalan saat lawan Persipura dan Persiwa, karena hanya ada dua striker, Osas Saha dan Nico Malau. Tampilnya kembali Ceh, Shin, dan Nico pun bakal banyak membantu. “Kondisi ketiganya saat ini lagi bagus-bagusnya. Diharapkan pada pertandingan nanti tidak ada masalah, terutama dengan Ceh. Selama ini dia cukup mampu menjadi jenderal di lini tengah,” beber Kinoi. (m17)

Waspada/Edi Saputra

SEJUMLAH anak karyawan PTPN III Kebun Gunung Pamela diabadikan bersama usai mengikuti seleksi pemain di Stadion Gunung Pamela, Sipispis, Selasa (12/6).

PTPN III Distrik I Jaring Pemain SIPISPIS (Waspada): PTPN III Wilayah Kebun Distrik Serdang I, Kebun Gunung Pamela, Kecamatan Sipispis, menggelar seleksi pemain sepakbola berbakat mulai usia 9 hingga 14 tahun, di Stadion Gunung Pamela, Selasa (12/6) lalu. Seleksi pemain itu dihadiri langsung Pengurus Harian PS PTPN III, Jaya Bakti, dan Mana-


jer Kebun Gunung Pamela, H Tambal Siregar. Menurut Jaya Bakti, untuk mendapat bibit pemain berkualitas, pihaknya menjaring pemain di setiap distrik. “Direktur PTPN III telah menginstruksikan bahwa pihaknya siap membina pemain yang telah terjaring atau hasil seleksi di distrik-distrik. Mereka nanti-

nya diharapkan bisa menjadi pemain andal masa mendatang,” ujar Jaya. Manajer Kebun Gunung Pamela, H Tambal Siregar, mengaku seleksi dilakukan untuk menjaringbibit-bibitpemaindarianakanak karyawan kebun. Mereka akan memperkuat PS PTPN III yang akan menggelar latihan di Gunung Pamela Serdang I. (c03)


1. Tuan rumah yang kipernya diusir wasit dengan kartu merah. 4. Kota reformis Lech Walesa, tempat pertandingan Euro 2012. 8. Negara mantan “bos” Pakta Warsawa, sepakat 1-1 dengan negara yang punya kota Warsawa. 10. Timnya Robbie Keane, keroak disikat Kroasia 3-1. 11. Orang yang kerjanya meniup peluit di lapangan. 13. Panggilan akrab Zlatan Ibrahimovic, kapten Swedia. 14. Tim kincir angin, rusak kena dinamit Denmark 1-0. 16. Singkatan Belanda yang biasa ditulis di Indonesia. 18. Negara asal gladiator, imbang 1-1 lawan matador Spanyol. 19. Nama penulis Euro 2012 Waspada bermarga Panggabean. 20. Bendera (Inggris), senjata pamungkas penjaga garis. 21. Negeri legenda Medusa, gagal membuat lawannya jadi patung. 24. Tim negara pecah-belah Yugo slavia. 25. Tim negara pecah-belah Uni Soviet. 26. Tim lain yang mewakili negeri “The Vikings”.


1. Salah satu klub sepak bola Portugal memperkuat timnas Euro 2012. 2. Hari setelah besok (penentu nasib Polandia dan Ceko). 3. Andres____, penyerang tim El Matador. 5. Tim dinamit, meletup tim favorit 1-0. 6. Negara juara Piala Dunia 2010, sesuai ramalan gurita. Incumbent Euro 2012. 7. Michel_____, mantan pemain Prancis, kini Presiden UEFA. 9. OK Khaidar_____, penulis Euro 2012 Waspada. 12. TulisJerman dalam bahasa yang dikenal di Inggris. 15. Tulis Jerman dalam bahasa Spanyol. 16. Si kulit bundar, membuat sejumlah pemainnya kaya raya. 17. Seri (Inggris). 18. Negara asal pedang Excalibur, gagal menyabet Prancis (1-1). 20. Singkatan Federation Internationale de Football Association. 22. Pertandingan (Inggris). 23. Garis tengah lapangan.

Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tingkat kesulitan: sulit (****), bisa diselesaikan dalam waktu tak sampai 15 menit. Jawabannya di halaman A2 kolom 1.

5 3

3 9 8 6 5 1 7 2 6 1 7 6 2 4 1 9 8 8 6 4 5 1 6 1 7 7 6 4 3 2 1 9 5 3 ****236



WASPADA Kamis 14 Juni 2012

Pengakuan Cassano Euro Grup C Malam Ini

Calon Top Skor

Di Poznan : Italia vs Kroasia *RCTI live pkl 23:00 WIB Di Gdansk : Spanyol vs Irlandia *RCTI live pkl 01:45 WIB

3 Gol: Alan Dzagoev (Rusia) 2 Gol: Mario Mandzucic (Kroasia) Vaclav Pilar (Ceko) Andriy Shevchenko (Ukraina)

Klasemen Grup A

Klasemen Grup C

Rusia Rep Ceko Polandia Yunani

2 2 2 2

1 1 0 0

1 0 2 1

0 1 0 1

5-2 3-5 2-2 2-3

4 3 2 1

Klasemen Grup B Denmark Jerman Belanda Portugal

1 1 1 1

1 1 0 0

0 0 0 0

0 0 1 1

1-0 1-0 0-1 0-1

Kroasia Spanyol Italia Irlandia

1 1 1 1

1 0 0 0

0 1 1 0

0 0 0 1

3-1 1-1 1-1 1-3

3 1 1 0

Klasemen Grup D 3 3 0 0

Ukraina Inggris Prancis Swedia

1 1 1 1

1 0 0 0

0 1 1 0

0 0 0 1

2-1 1-1 1-1 1-2

3 1 1 0


KONVOI ORANYE: Par pendukung Belanda konvoi berjalan dari kamp perkemahan mereka menuju Kota Kharkiv di Ukraina, Rabu (13/6), guna menyaksikan langsung pertandingan antara De Orange melawan Jerman pada partai kedua Grup B Euro 2012 di Metalist Stadium.

KRAKOW, Polandia (Waspada): Antonio Cassano membuat pengakuan, dirinya sempat berpikir melupakan Euro 2012, setelah dia didiagnosa menderita masalah jantung yang memerlukan operasi. “Saya tidak berharap untuk bermain di Piala Eropa. Saya cedera, namun saya berterimakasih bukan hanya karena hal itu saya ada di sini. Sebab saya dapat menjadi penting (bagi tim),” ungkap Cassano, seperti dikutip dari AFP, Rabu (13/6). Bomber berumur 29 tahun itu jatuh sakit saat membela klub AC Milan di Liga Seri A, Oktober silam. Dia segera dilarikan ke rumah sakit, lantas diketahui menderita stroke ringan. Belakangan juga terdeteksi, Cassano punya lubang kecil di jantungnya, sehingga dia perlu menjalani operasi untuk memperbaiki masalah tersebut. Mantan striker AS Roma itu terpaksa menepi selama hampir enam bulan dari lapangan hijau. Dia baru kembali merumput pada akhir April 2012, tapi masih merasakan khawatir sampai menjelang laga perdana Italia melawan Spanyol di Grup C, 10 Juni lalu. “Sebelum pertandingan, berkali-kali saya pikirkan, saya tidak tahu mengapa saya berada

Brescia (Italia) Inter Milan (Italia) Reggina (Italia) Brescia (Italia) AC Milan (Italia) Juventus (Italia)

Karier Timnas 1998-2002 Italy U-21 2002Italia (senior) Debut vs Azerbaijan (7 Sept 2002) 84 caps/9 gol

Pembuktian Kaki Pirlo TEPAT setahun lalu, AC Milan memprediksi Andrea Pirlo (foto) sudah tak bergigi lagi. Ketika usianya memasuki 32 tahun dan lebih banyak menghabiskan waktu mengurusi cederanya, Pirlo dinilai kalah greget dari gelandang asal Belanda, Mark Van Bommel. Setelah 10 tahun bersama juara Liga Champions tersebut, kubu Milan hanya menawarkan satu tahun perpanjangan kontrak. Pirlo pun terluka karena merasa harga dirinya terinjak. Akhirnya, Pirlo hengkang dan secara mengejutkan bergabung dengan Juventus yang saat itu dalam krisis setelah bercokol di peringkat tujuh Seri A. Di tengah kondisi tim yang sedang tak stabil, Pirlo datang sekaligus membuktikan dirinya belum habis. Gelandang kelahiran 19 Mei 1979 ini tetap seorang maestro di lini tengah, mengatur tempo Juve tanpa henti, poros penghubung lini pertahanan dan serang, dan paling rajin merebut bola dari lawan.

0 2 1 0 1 2 1 kali)

Persahabatan Kualifikasi Euro Kualifikasi Euro Persahabatan Piala Dunia Persahabatan

PRAKIRAAN FORMASI PEMAIN Italia 1-3-5-2 Usia 1-Gianluigi Buffon 34 19-Leonardo Bonucci 25 16-Daniele De Rossi 28 3-Giorgio Chiellini 27 2-Christian Maggio 30 5-Thiago Motta 29 21-Andrea Pirlo 33 8-Claudio Marchisio 26 13-E Giaccherini 27 10-Antonio Cassano 29 11-Antonio Di Natale 34 Pelatih: Cesare Prandelli di sini. Saya mungkin bermain, mungkin juga tidak. Tentu saja saya sangat emosional,” kenang Cassano. Bomber bengal didikan Bari itu juga mengakui, ada masamasa ketika dirinya depresi setelah masalah yang menimpanya. “Saya memiliki ide-ide yang bertentangan di kepala, sekarang saya dapat berbicara dengan tenang mengenai masalah ini,” ucapnya. “Saat sampai pada poin hidup atau mati, semua hal lain diletakkan dalam perspektif. Itu mengerikan, dan saya tidak akan mengharapkan hal itu lagi. Satu hari Anda baik-baik saja, dan kemudian...” ujarnya lagi. Komentar Cassano mengenai masalah kesehatannya, menutupi kontroversi karena ber-

Kroasia 1-4-4-2 Usia 1-Stipe Pletikosa 33 11-Darijo Srna 30 5-Vedran Corluka 26 13-Gordon Schildenfeld 27 2-Ivan Strinic 24 7-Ivan Rakitic 24 8-Ognjen Vukojevic 28 10-Luka Modric 26 20-Ivan Perisic 23 17-Mario Mandzukic 26 9-Nikica Jelavic 26 Pelatih: Slaven Bilic bagai hal yang dia ucapkan sebelumnya. Termasuk saat mengatakan, dirinya berharap tidak ada pemain gay di tim Italia, yang memancing protes keras dari kelompok homo. Kini Cassano menjadi andalan allenatore Cesare Prandelli di garis serang Gli Azzirri. Setelah menjadi starter saat menjajal Spanyol, dia juga bakal mendapat peran sama ketika menghadapi Kroasia malam nanti di Municipal Stadium, Poznan. “Hal terpenting saat ini adalah tetap melaju di jalan kami tanpa mendapat bantuan dari siapapun. Kami akan mencoba melaju sejauh mungkin semampu kami. Saya piker, kami memiliki kualitas untuk melakukannya,” klaim Cassano. (m15/ant/afp/uefa)


STRIKER Antonio Cassano (kanan) membersihkan wajahnya dalam sesi latihan tim Italia di Krakow, Polandia, Rabu (13/6).

Mandzukic Kepala Tajam Kroasia

Karier Klub 1995-1998 1998-2001 1999-2000 2001 2001-2011 2011-

Catatan Sejarah Pertemuan 05/04/42 Italia 4 Kroasia 16/11/94 Italia 1 Kroasia 08/10/95 Kroasia 1 Italia 28/04/99 Kroasia 0 Italia 08/06/02 Kroasia 2 Italia 16/08/06 Italia 0 Kroasia (Kroasia menang 3, imbang 2, kalah

Statistik membuktikan Pirlo memang masih gelandang terbaik di Seri A. Tak hanya pemberi assist terbanyak, spesialis pemakai nomor 21 ini juga tercatat memberi umpan lebih banyak dari pemain lain di Liga Italia tersebut. Itu pula yang membuat pelatih Cesare Prandelli tak ragu menjadikannya sebagai andalan lapangan tengah Italia di Euro 2012. Kemampuan Pirlo melepaskan umpan terobosan, kepiawaiannya membuka ruang serta tendangan jarak jauhnya yang mematikan menjadi senjata andalan Gli Azzurri. Terlebih, Pirlo adalah pemain yang sarat pengalaman dan alumnus skuad juara dunia 2006 yang masih tersisa. Tentu pengalamannya yang segudang akan dimanfaatkan Prandelli untuk menjadi mentor pemain yang masih hijau. Bahkan ketakutan pelatih Vicente del Bosque akan sosok Pirlo menjadi kenyataan kala Spanyol bertemu Italia. Pirlo


terlihat berada di hampir semua posisi saat bola berada dan beberapa kali melepaskan tendangan berbahaya ke arah gawang Iker Casillas. Pergerakan Pirlo mampu membuat pertahanan Spanyol kocar-kacir. Italia juga patut berbangga karena Pirlo dipilih sebagai man of the match. Playmaker berusia 33 tahun itu masih memiliki stamina, kecepatan, dan kemampuan yang sempurna sebagai motor serangan. Hal inilah yang membuatnya menjadi sosok penting bagi terjadinya gol Italia. Sukses melewati Sergio Busquets, Pirlo mengumpan bola ke arah Antonio Di Natale yang kemudian menyelesaikan assist matang tersebut. Beruntung, Spanyol diselamatkan aksi Cesc Fabregas. “Pirlo adalah pemimpin yang tenang. Ia berbicara lewat kerja keras kakinya di lapangan,” ujar mantan pelatih Italia dan Juventus, Marcello Lippi. (m33/uefa/fbi)

DUA gol Mario Mandzukic (foto) membawa Kroasia unggul 3-1 atas Irlandia pada laga Grup C Euro 2012, Senin (11/ 6) lalu. Kemenangan tersebut membawa pasukan besutan Slaven Bilic itu ke puncak klasemen sementara dengan nilai maksimal. Secara khusus, Bilic memuji penampilan Mandzukic yang menjadi bintang dengan dua golnya. Bahkan, striker Vfl Wolfsburg itu terpilih sebagai man of the match dalam pertandingan tersebut. “Mario adalah pemain kelas dunia. Ia bermain di kemampuan puncaknya. Wolfsburg bertahan di Liga Jerman berkat dirinya,” kata Bilic mengenai penyerang berusia 26 tahun itu. Melawan Irlandia, Mand-

zukic tidak terlalu mendapat beberapa kesempatan mencetak gol. Ia hanya mampu mendapatkan dua peluang, namun kedua kesempatan tersebut berhasil dimanfaatkan dengan sempurna olehnya menjadi gol. Bahkan mantan penyerang Yugoslavia, Predrag Mijatovic, ikut menyanjung Mandzuvic. Penampilan apiknya itu kemudian menjadikannya pemain dengan indeks tertinggi. Castrol Edge Index memberinya nilai 9,21 dan menjadi yang tertinggi mengungguli Nikica Jelavic yang ada di posisi kedua. Mandzukic mencetak gol pertamanya saat laga berjalan belum sampai tiga menit, tepatnya 2 menit 38 detik sekaligus gol tercepat keenam dalam sejarah Euro. Gol pertamanya menunjuk-


MARIO Balotelli (kanan) menjadi korban tindakan rasisme di Euro 2012.

Italia Lebih Pengalaman

UEFA Selidiki Kasus Rasisme Euro 2012

MEDAN (Waspada): Meski Kroasia sukses menaklukkan Republik Irlandia 3-1 pada laga pembuka, tak lantas membuat Derry Ananda Putra (foto) memandang rendah Italia yang hanya mampu menahan Spanyol 1-1. Remaja berusia 13 tahun yang kini mengenyam pendidikan di SMPN 2 Medan itu menilai skuad Gli Azzurri layak menang atas Kroasia saat keduanya bersua pada laga penyisihan Grup C Euro 2012, Kamis (14/6) malam ini. “Saya optimis Itali dapat mengatasi Kroasia. Hasil imbang atas Spanyol bukanlah catatan buruk bagi Mario Balotelli

WARSAWA (Waspada): Konfederasi Sepakbola Eropa (UEFA) berjanji akan melakukan penyelidikan resmi terhadap kasus rasisme yang terjadi di Euro 2012 Polandia-Ukraina. “Berdasarkan laporan informasi independen terbaru, mengenai dua kasus dugaan rasis dalam pertandingan Spanyol vs Italia dan Rusia vs Republik Ceko, UEFA akan melakukan penyelidikan lebih lanjut,” demikian bunyi pernyataan UEFA, yang dikutip Rabu (13/6). Korban dari aksi rasisme itu adalah dua pemain berkulit hitam, Mario Balotelli (Italia) dan Theodor Gebre Selassie (Republik Ceko). Balotelli mendapat perlakuan tak terpuji itu saat Gli Azzurri bermain 1-1 dengan Spanyol di PGE Gdansk Arena, Polandia, 10 Juni lalu. Sedangkan Selassie mengklaim, telah menerima nyanyian rasis saat timnya dikalahkan Rusia 1-4 di Wroclaw pada 8 Juni. Saat berjalan menuju stadion, Selassie menerima ejekan yang menirukan suara monyet dari sejumlah pendukung Rusia. “Namun sampai sekarang belum ada hukuman yang akan dijatuhkan,” tambah UEFA dalam pernyataannya yang dilansir Soccerway. (m15/sw)

cs, melainkan awal positif untuk Italia meningkatkan grafik permainan pada laga berikutnya,” ucap Derry. Kapten tim SSB Generasi Medan di Turnamen Super Seri Piala Plt Gubsu yang saat ini sedang berlangsung itu, menilai Italia dengan segudang prestasi yang telah diukir jauh lebih berpengalaman dibanding Kroasia. Dari segi materi pemain, Italia juga lebih baik dengan diperkuat nama-nama besar seperti Andreas Pirlo, Daniel de Rossi, dan Mario Balotelli. “Saya yakin Italia akan tampil lebih terbuka untuk memenangkan pertandingan. Saat itulah Kroasia akan merasakan la-

Waspada/Dedi Riono

wan yang sesungguhnya. Mario Mandzukic dan Nikica Jelavic tidak akan mudah mencetak gol seperti saat mereka melawan Irlandia,” pungkas Derry. (m42)

kan insting ketajamannya. Menerima bola pantulan dari sisi kanan, Mandzukic yang tak terkawal menyundul bola ke pojok kiri gawang Shay Given. Meski sempat terpeleset sebelum melakukan sundulan, hal itu tak mengurangi kekuatan tandukannya. Gol kedua Mandzukic di menit 49 juga diciptakan lewat sundulan. Berawal dari eksekusi tendangan bebas, Mandzukic memanfaatkan tinggi badannya untuk menyundul bola. Hasil sundulannya mengenai tiang gawang kemudian mengenai kepala Given sebelum masuk gawang. Dengan dua gol yang dicetaknya, Mandzukic juga menyamai torehan bintang masa lalu Kroasia, Davor Suker. Penyerang yang bermain untuk VfL Wolfsburg itu menjadi pemain kedua Kroasia yang mengemas dua gol untuk di sebuah pertandingan Euro atau Piala

Karier Klub 2004-2005 2005-2007 2007-2010 2010-

Marsonia (Kroasia) NK Zagreb (Kroasia) Dinamo Zagreb (Kroasia) VfL Wolfsburg (Jerman)

Karier Timnas 2005-2007 Kroasia U-21 2007Kroasia (senior) Debut vs Macedonia (17 Nov 2007) 30 caps/9 gol Dunia, sejak Suker melakukannya ke gawang Denmark pada 1996. Atas pencapaiannya itu, Mandzukic juga bangga memenuhi permintaan ayahnya. Karena sadar anaknya berbadan tinggi, sang ayah meminta Mandzukic mencetak gol dengan kepala. Mungkinkah Mandzukic mengulanginya ke gawang Italia yang dikawal Gianluigi Buffon? Tunggu saja.... (m33/uefa/afp)



WASPADA Kamis 14 Juni 2012

A11 Klaim Bagus Blaszczykowski


KAPTEN Jakub Blaszczykowski (tengah) histeria merayakan golnya, yang menyelamatkan Polandia dari kekalahan atas Rusia di Stadion National, Warsawa, Rabu (13/6) dinihari WIB.

WARSAWA (Waspada): Kapten Jakub Blaszczykowski mengklaim, timnya telah bermain bagus dan meraih hasil bagus saat menahan Rusia pada partai kedua Grup A Euro 2012. “Kami membuktikan bisa bermain bagus dan mendapat hasil bagus. Para suporter bisa membuat perubahan dan kami sangat yakin pada diri kami sendiri,” beber Blaszczykowski di situs, Rabu (13/6). Sang kapten menjadi pahlawan Polandia dalam laga lawan Rusia di Stadion National, Warsawa, Selasa (Rabu WIB). Gol cantiknya menit 57 ke gawang kiperVyacheslav Malafeev, memaksakan hasil 1-1, setelah pasukan Franciszek Smuda lebih dahulu tertinggal akibat gol Alan Dzagoev menit 37. “Memang benar mencetak gol penyeimbang memberikan energi yang baik bagi tim. Taktik Smuda sangat tepat dan kami menempel mereka di seluruh bagian lapangan,” jelas Blaszczykowski. Jika ingin lolos ke babak delapan besar, Si Putih Merah harus mengatasi Republik Ceko pada partai pamungkas Grup A, 17 Juni mendatang.

“Jika memiliki sikap dan mendapatkan energi dari para suporter, kami bisa menunjukkan sebagai tim bagus dan kami pantas mendapatkan dukungan mereka,” klaim gelandang Borussia Dortmund berusia 26 tahun tersebut. “Kami masih bisa bersaing dengan dua poin ini. Jika kami memenangkan laga terakhir, maka kami akan lolos. Kami akan bertarung sampai akhir,” pungkas Blaszczykowski. Polandia kini di peringkat tiga klasemen dengan dua poin, Rusia memimpin dengan tiga angka dan Ceko di peringkat dua nilai tiga. “Tujuan kami adalah lolos ke perempat final. Karena itu di pertandingan terakhir, kami harus menang,” tekad Robert Lewandowski, striker andalan White Eagles. Bomber Dortmund itu juga menyerukan agar rekan-rekannya bermain lebih padu ketika melawan Ceko, yang diperkuat Petr Cech, kiper Chelsea yang baru memenangkan trofi Liga Champions. “Saya butuh dukungan dari rekan setim, mungkin kami bisa membuat beberapa peluang.



1 Skor Akhir 1 43% Penguasaan Bola 57% 15 Tembakan Total 7 9 Tembakan Tepat 3 1 Penyelamatan 6 12 Pelanggaran 13 4 Sepak Pojok 6 2 Offsides 2 2 Kartu Kuning 2 0 Kartu Merah 0 *Sumber ESPN Kami harus bermain lebih tenang dan tidak terburu-buru,” harap Lewandowski. Pelatih Franciszek Smuda juga bangga dengan kemampuan pasukannya menahan pasukan Beruang Merah. Namun dia sedikit terganggu dengan kemarahan yang diperlihatkan Ludovic Obraniak, ketika diganti pada menit-menit akhir pertandingan. “Kami adalah tim muda, kami akan lebih baik lagi. Saya di atas segalanya gembira dengan para pemain, sebab mereka tempur sesuai rencana permainan, sejak menit pertama sampai menit terakhir,” sanjung Smuda. (m15/uefa/rtr)

Rusia Langsung Evaluasi WARSAWA (Waspada): Rusia langsung melakukan evaluasi, Rabu (13/6), setelah mereka ditahan 1-1 oleh tuan rumah Polandia pada partai kedua Grup A Euro 2012. Dalam sesi latihan di Sulejowek, Polandia, Rabu (13/6), pelatih Dick Advocaat lebih dahulu mengumpulkan para asistennya untuk melakukan diskusi. Setelah itu dia banyak memberikan pengarahan kepada Andrei Arshavin cs, yang saat ini masih memimpin klasemen Grup A dengan nilai empat dari dua laga. “Kami membiarkan mereka (Polandia) menciptakan terlalu banyak peluang saat menyerang. Itu berarti kami tetap perlu untuk memperkuat pertahanan kami,” ucap Advocaat, seusai laga Rusia-Polandia di National Stadium, Warsawa. “Kami bermain baik dan mencetak gol sebelum masa istirahat, juga punya banyak peluang di babak kedua. Tapi kami tidak mampu memanfaatkan-

nya,” papar pelatih asal Belanda berusia 64 tahun tersebut. Gol indah Alan Dzagoev menit 37 diWarsawa, Selasa (Rabu WIB), membawa Rusia memimpin 1-0 sampai memasuki masa rihat. Itu gol ketiga Dzagoev dari dua partai Grup A, sehingga membuatnya sendirian memimpin di puncak daftar pencetak gol terbanyak. Namun gol yang lebih cantik dari kapten Jacub Blaszczykowski menit 57, menunda tiket lolos Rusia ke babak perempatfinal. “Polandia bermain sangat bagus malam ini, kendati ada resiko kehilangan peluang memenangi tempat di babak delapan besar jika mereka kalah,” puji Advocaat. Menurut Arshavin, timnya hanya dapat menyalahkan diri sendiri karena membiarkan Po-

landia menyamakan kedudukan. “Kami memulainya dengan baik dan sempat memimpin. Namun setelah turun minum kami bermain terlalu longgar, sehingga membiarkan Polandia untuk membalas melalui serangan balik berbahaya,” sesalnya. Kiper cadangan Polandia, Przeymslaw Tyton, berhasil menggagalkan beberapa peluang Beruang Merah, termasuk tendangan bebas Arshavin. Tensi sangat tinggi di dalam stadium, mengimbangi tensi tinggi saat polisi melakukan penangkapan terhadap lusinan orang dan menggunakan water cannon untuk menghentikan keributan di antara pendukung dari kedua kubu di Kota Warsawa. “Kami seharusnya menang dan lolos ke perempatfinal. Tapi kami tidak berhasil. Selanjutnya kami akan menghadapi Yunani dan kami harus siap untuk itu,” harap Dzagoev kepada Rossiya TV 2 Channel. Menurut bintang berusia 21

Polandia Vs Rusia 1-1 Stadion Penonton Gol Wasit Kartu Kuning

: National, Warsawa (Polandia) : 55.920 Orang : Blaszczykowski57'; Dzagoev 37' : Wolfgang Stark (Jerman) : Lewandowski 60', Polanski 79'; Denisov 60', Dzagoev 75'

Polandia 1-4-4-2 22 Przemyslaw Tyton 15 Damien Perquis 13 Marcin Wasilewski 2 Sebastian Boenisch 20 Lukasz Piszczek 5 Dariusz Dudka/Mierzejewski 73' 7 Eugen Polanski/Matuschyk 85' 10 Ludovic Obraniak/Brozek 90' 16 Jakub Blaszczykowski 9 Robert Lewandowski 11 Rafal Murawski Pelatih: F Smuda tahun itu, tak ada yang spesial dari golnya ke gawang kiper Tyton. “Sebenarnya, saya tak biasa datang ke daerah kotak penalti. Saya biasa berdiri di pinggir. Namun saya melihat Arshavin sering mengarahkan bola ke sana dan saya memutuskan maju,” beber Dzagoev.

Rusia 1-4-3-3 16 Vyacheslav Malafeev 4 Sergei Ignashevich 12 Alexei Berezutsky 5 Yuri Zhirkov 2 Alexander Anyukov 7 Igor Denisov 8 Konstantin Zyryanov 6 Roman Shirokov 10 Andrei Arshavin 11 Alexander Kerzhakov/Pavlyuchenko 70 17 Alan Dzagoev/Izmailov 79' Pelatih: Dick Advocaat Rusia akan menghadapi laga penentuan melawan Yunani di Warsawa pada 16 Juni 2012. Hasil seri sudah menjamin tiket Yuri Zhirkov cs, tak terpengaruh hasil duel Polandia vs Republik Ceko yang digelar bersamaan waktunya. (m15/uefa/afp/rtr/espn)



1 Skor Akhir 54% Penguasaan Bola 7 Tembakan Total 5 Tembakan Tepat 1 Penyelamatan 14 Pelanggaran 1 Sepak Pojok 6 Offsides 3 Kartu Kuning 0 Kartu Merah *Sumber ESPN

2 46% 8 3 0 26 4 0 3 0

KAPTEN Ceko Tomas Rosicky (kanan) jatuh bangun duel dengan kapten Yunani Giorgos Karagounis di Wroclaw, Polandia, Rabu (13/6) dinihari WIB. -AP-

Kegembiraan Berubah Jadi Kekhawatiran Kapten Rosicky Cedera WROCLAW, Polandia (Waspada): Kegembiraan pelatih Republik Ceko, Michael Bilek, berubah menjadi kekhawatiran karena kapten Tomas Rosicky cedera ketika timnya mengatasi Yunani 2-1 pada partai kedua Grup A Euro 2012. “Tomas Rosicky mendapat cedera dan sulit untuk mengungkapkan seberapa parah (cedera) tersebut saat ini. Kami hanya berharap dia baik-baik saja,” beber Bilek, Rabu (13/6). Bintang Arsenal berusia 31 tahun ini memang dikenal sebagai pemain yang rentan cedera. Namun dia tampil bagus di babak pertama dan memotori dua gol cepat Ceko, sebelum digantikan pada babak kedua karena cedera otot tendon achilles. Ketika petugas pers Ceko mengatakan kondisi Rosicky 5050 untuk pertandingan fase grup terakhir melawan tuan rumah

Polandia, Bilek malah memilih untuk menunggu. Dia berharap pemindaian bisa memberikan cerita yang berbeda. “Kami akan melihatnya besok, dia akan menjalani pemindaian. Namun ini mengkhawatirkan, sebab dia adalah pemain kunci. Sangat sulit bagi kami di babak kedua, sebab Rosicky tidak dapat dimainkan,” ratap Bilek. Si Mozart Kecil itu datang ke Polandia-Ukraina 2012 dengan membawa cedera betis yang didapatnya dari laga terakhir musim di Liga Inggris. Namun dia dinyatakan cukup bugar sekaligus dapat dimainkan saat Ceko kalah 1-4 dari Rusia pada pertandingan pertama Grup A. Rosicky kemudian memotori gol Ceko ke gawang Yunani di Wroclaw, Selasa (Rabu WIB), yang dilesakkan gelandang Petr Jiracek menit kedua dan Vaclav

Rosicky Tidak Ikut Lagu Kebangsaan WARSAWA (Antara/AFP): Kapten Republik Ceko, Tomas Rosicky, mengaku tidak ikut menyanyikan lagu kebangsaan negaranya sebelum laga melawan Rusia dan Yunani di Grup A Euro 2012. “Saya tidak menyanyikan lagu itu sejak lama. Saya melantunkannya dalam kepala saya,” ungkap bintang klub Arsenal itu, Rabu (13/6). “Saya bukannya percaya tahayul. Tapi ketika masih muda, setiap saya menyanyikannya, kami selalu kalah. Tapi bukan karena itu maka saya tidak hafal lagunya. Bukan karena itu saya tidak ikut bernyanyi,” ujarnya lagi. Lagu kebangsaan Ceko berjudul “Kde domov muj” bila diterjemahkan berarti “Di Mana Negara Saya”.

Yunani Vs Republik Ceko 1-2 Pilar menit keenam. Satu-satunya gol balasan Negeri Dewa dicetak Theofanis Gekas 53, setelah Rosicky keluar dari lapangan pertandingan. Ceko mengambil keuntungan dari situasi Yunani, yang memainkan opsi pilihan kedua di jantung pertahanan dengan menduetkan Kostas Katsouranis dan Kyriakos Papadopoulos. Mereka menggantikan peran Avraam Padadopoulos (cedera) dan Socratis Papastathopoulos (terkena sanksi). Kemenangan pun membuat Ceko mengoleksi tiga poin dengan satu laga tersisa melawan tuan rumah Polandia. (m15/ant/afp/espn)

Stadion Penonton Gol Wasit Kartu Kuning

: Miejski, Wroclaw (Polandia) : 40.803 Orang : Theofanis Gekas 53'; Jiracek 2', Pilar 6' : Stephane Lannoy (Prancis) : Torosidis 34', Papadopoulos 56', Salpingidis 57'; Rosicky 26', Jiracek 36', Daniel Kolar 65'

Yunani 1-4-3-3 1 Kostas Chalkias/Michail Sifakis 23' 5 Kyriakos Papadopoulos 21 Kostas Katsouranis 20 Jose Holebas 15 Vasilis Torosidis 2 Giannis Maniatis 10 Giorgos Karagounis 16 Giorgios Fotakis/Gekas 46' 22 Konstan Fortounis/Mitroglou 71' 7 Georgios Samaras 14 Dimitris Salpingidis Pelatih: Fernando Santos

Ceko 1-4-4-2 1 Petr Cech 3 Michal Kadlec 6 Tomas Sivok 8 David Limbersky 2 Theodor Gebre Selassie 13 Jaroslav Plasil 17 Tomas Hubschman 19 Petr Jiracek 14 Vaclav Pilar 10 Tomas Rosicky/Kolar 46'/Rajtoral 90' 15 Milan Baros/Tomas Pekhart 64' Pelatih: Michel Bilek

Polisi Tahan Lebih 100 Pelaku Keributan WARSAWA (Antara/AFP): Polisi di Kota Warsawa, Rabu (13/ 6) mengatakan, telah menahan lebih dari 100 pendukung tim yang terlibat keributan menjelang pertandingan Polandia-Rusia di Grup A Euro 2012, yang berakhir imbang 1-1. Beberapa petugas juga menahan beberapa penggemar sepakbola di sekitar area fanzone resmi di Warsawa sepanjang pertandingan. “Polisi telah memobilisasi lebih dari 6.000 petugas untuk menjaga ketertiban umum untuk pertandingan dengan resiko keamanan yang tinggi,” ujar juru bicara kepolisianWarsawa, Maciej Karczewski. Unit-unit kekuatan tambahan dari pinggir kota datang untuk mobilisasi penonton yang keluar dari Stadion Nasional. Perkelahian terjadi antara pendukung Polandia dan Rusia, sebelum duel. Peristiwanya berlangsung ketika ribuan pendukung Rusia berjalan kaki sambil berbaris menuju Stadion Nasional di Warsawa.



PELATIH Dick Advocaat memberikan pengarahan kepada para pemain Rusia dalam sesi latihan di Sulejowek, Polandia, Rabu (13/6).

Santos Sesali Diri Sendiri WROCLAW (Waspada): Pelatih Fernando Santos kecewa dengan rapuhnya lini belakang Yunani, sehinggga kebobolan dua gol cepat di babak pertama ketika dipecundangi Republik Ceko 2-1. “Pertandingan berjalan sangat buruk bagi kami. Kami tertinggal sangat cepat dan kami tahu ini memang mungkin terjadi,” ucap Santos dalam laman UEFA, Rabu (13/6). Dia pun menyesali dirinya sendiri, karena menepikan sinyal bahaya Ceko. “Mengingat mereka telah melihat pertandingan perdana kami, kami sadar mereka mungkin akan keluar menyerang dan mencoba mendominasi,” tambah pelatih asal Portugal tersebut. Prediksi Santos ternyata tepat. Ceko langsung menyerang sejak awal di Wroclaw, Selasa (Rabu WIB), sebab sudah mendapat banyak masukan dari laga perdana Yunani melawan Polandia yang berakhir 1-1 pada partai pembukaan Euro 2012. Ceko pun unggul cepat lewat gol Petr Jiracek menit kedua dan Vaclav Pilar menit keenam. Satusatunya gol balasan Negeri Dewa dihasilkan Theofanis Gekas menit 53. “Meski kami telah diperingati dan kami sadar mereka tampil menekan, kami gagal memberi respon. Kami memiliki pertahanan yang telah kebobolan empat gol dari 10 pertandingan resmi. Dalam dua laga di sini, kami kemasukan tiga gol,” sesal Santos. Untuk lolos ke perempatfinal, Yunani berarti wajib menang telak atas Rusia pada partai pamungkas Grup A di National Stadium,Warsawa, 16 Juni mendatang. “Kini kami harus mengubah


PELATIH Fernando Santos memberikan instruksi khusus kepada Giorgos Karagounis ketika menghadapi Ceko di Wroclaw, Polandia. pandangan kami ke partai selanjutnya. Kami hanya memiliki sedikit kesempatan, tetapi masih ada harapan,” pungkas Santos. BekVasilisTorosidis juga menyalahkan diri sendiri atas kekalahan dari Ceko. “Saya tidak mengerti mengapa kami bermain seperti itu di babak pertama. Ceko menciptakan dua peluang dan mencetak dua gol,” tuturnya. “Gol kedua mereka sedikit beruntung. Lalu kami bangkit, tapi sudah terlambat. Ini kesa-

lahan kami, kami mesti bertanggung jawab atas apa yang terjadi,” tukas Torosidis. Sedangkan Theofanis Gekas mendesak rekan-rekan setimnya untuk tidak kembali mendapatkan hasil mengecewakan ketika menjajal pasukan Beruang Merah. “Kami berada di tempat yang sulit sejak awal,” jelas Gekas. “Semua tim di grup kami masih bisa lolos ke perempatfinal. Laga melawan Rusia adalah final bagi Yunani. Kami harus menang jika mau maju,” tegasnya lagi. (m15/okz/uefa/rtr)

Gol Jiracek Tercepat Ketiga Euro WROCLAW ( Waspada): Gelandang Republik Ceko, Petr Jiracek (foto), menjadi pencetak gol tercepat ketiga sepanjang sejarah Piala Eropa, setelah membobol gawang Rusia di Municipal Stadium, Wroclaw, Polandia. Selain membantu timnya menang 2-1 pada partai kedua Grup A Euro 2012, Selasa (Rabu WIB), gol Jiracek ke gawang Kostas Chalkias menit kedua lewat 14 detik, membuat namanya masuk dalam daftar lima besar pencetak gol tercepat sepanjang perhelatan Euro. Catatan waktunya sama dengan gol Alan Shearer, saat Inggris menghadapi Jerman di semifinal Euro 1996. Pemegang rekor gol tercepat masih dipegang, Dmitri Kirichenko ketika membawa Rusia mengalahkan Yunani 2-1 pada laga pamungkas penyisihan Grup A Euro 2004. Kala itu,

Lima Besar Pencetak Gol Tercepat Piala Eropa 1: 07 menit 2:07 menit 2:14 menit 2.14 menit 2:25 menit

: Dmitri Kirichenko (Rusia 2-1 Yunani, 20/6/2004) : Sergei Aleinikov (Uni Soviet 3-1 Inggris, 18/6/1988) : Petr Jiracek (Rep Ceko 2-1 Yunani, 12/6/2012) : Alan Shearer (Inggris 1-1 Jerman, 26/6/1996) : Michael Owen (Inggris 2-2 Portugal, 24/6/2004)

Kirichenko mencetak gol detik 67 atau 1:07 menit. Jiracek sendiri mengaku lega dan gembira karena akhirnya Narodak, julukan Ceko, mampu meraup tiga poin sekaligus menghidupkan lagi kans ke perempatfnal, setelah sempat kalah 1-4 dari Rusia pada laga perdana Grup A. “Kami telah melakukannya, gol itu sangat penting, dan kami sangat bahagia sekarang,” ujar Jiracek, seperti dilansir Sky Sports, Rabu (13/6). Namun dia juga meminta rekan-rekan setimnya untuk tetap fokus menghadapi laga ter-

akhir Grup A melawan tuan rumah Polandia pada 16 Juni mendatang. “Kami tidak harus terlalu puas atas kemenangan ini, karena kami tahu bahwa sekarang kami malah harus berjuang lebih keras. Pertandingan terakhir grup akan menentukan,” papar gelandang berusia 26 tahun tersebut. “Kini kami mesti fokus pada pertandingan terakhir melawan Polandia, yang akan menjadi sangat penting dan kami harus mengatasi tuan rumah yang juga sangat bersemangat,” tambah Jiracek. (m15/okz/sky)



WASPADA Kamis 14 Juni 2012

Thunder Punya Modal OKLAHOMA CITY, AS (Waspada): Oklahoma City Thunder mencatat awal yang baik dalam Final NBA 2012. Thunder sukses memenangi game pertama melawan Miami Heat 104-95 dengan memanfaatkan dukungan puluhan ribu penonton di Chesapeake Energy Arena, Rabu (13/6).

Kevin Durrant cs tampil menggila di kuarter keempat, kendati di tiga kuarter sebelumnya selalu tertinggal dalam perolehan angka. Di awal pertandingan, Heat langsung tancap gas dan unggul 10-2. Meski tembakan James Harden masuk,

Mourinho Puji Pesepakbola Asia


KEVIN Durrant (35) tidak menghiraukan penjagaan Chris Bosh saat melakukan dunk dalam duel Final NBA antara Oklahoma City Thunder melawan Miami Heat pada game pertama di Chesapeake Energy Arena, Rabu (13/6).

JAKARTA (Waspada): Pelatih Real Madrid, Jose Mourinho (foto), memberikan pujian kepada pesepakbola Asia. Hal tersebut diungkapkan di sela-sela acara Meet and Greet di Hotel Borobudur, Jakarta, Rabu (13/6) malam. Pada kesempatan itu, pelatih berjulukan The Special One itu angkat bicara soal trend pesepakbola Asia yang kian banyak merambah Eropa. Sebut saja Hidetoshi Nakata, pesepakbola asal Jepang yang meraih kesuksesan di Seri A bersama Perugia dan AS Roma. Setelah era Nakata, giliran Park Ji Sung (Korsel) sukses bersama Manchester United. Kini, kembali pesepakbola Jepang yang menjadi buah bibir adalah Shinji Kagawa. Pemain yang sukses mengantar Borussia Dortmund menjuarai Bundesliga tersebut resmi bergabung dengan MU sekaligus menjadi pemain Asia kedua setelah Park


Ji Sung yang menginjakkan kaki di Old Trafford. “Saya teman dekat Sir Alex Ferguson dan saya sering berbagi pengalaman. Sekarang ada pemain Jepang di sana,” ujar Mourinho.

Ijeck Minta HDCI Sumut Tingkatkan Kepedulian MEDAN (Waspada): Ketua Umum Harley Davidson Club Indonesia (HDCI) Sumut, Ijeck, meminta anggota klub motor besar yang dipimpinnya meningkatkan kepedulian sosial. Hal tersebut diungkapkan Wakil Sekretaris HDCI Sumut, Oesman Tiong (Ationg), saat menyerahkan bantuan kepada korban kebakaran di Lorong Jaya Jl AR Hakim Gg Aman, Kelurahan Tegal Sari Mandala I, Kec Medan Denai, Rabu (13/6). “Ketua Umum HDCI Sumut meminta kita agar memiliki kepedulian tinggi terhadap lingkungan dengan membantu korban kebakaran di Gang

Aman,” kata Ationg didampingi Uche B Parama (Bidang Kegiatan), Charlie Andrian, SH (Bidang Hukum), dan Steven. Ationg menambahkan kepedulian terhadap warga Kota Medan yang ditimpa musibah kebakaran ini, sesuai keinginan Ketua Umum HDCI Sumut agar pehobi Harley Davidson mempunyai manfaat dan image secara positif di tengah masyarakat. “Kepengurusan HDCI Sumut yang kembali dipimpin Ijeck untuk kedua kalinya telah dilantik belum lama ini, keberadaannya untuk menyalurkan hobi motor besar di provinsi ini yang saat ini sudah berkem-

bang pesat dan memiliki ratusan anggota,” papar Ationg lagi. “Tak sedikit pula anggota klub HDCI Sumut yang menyerahkan bantuan dana secara langsung langsung, sebab korban kebakaran cukup membutuhkan dana untuk memperbaiki rumahnya,” ujar Ationg tanpa menyebut jumlah bantuan dana yang diberikan. Pengurus HDCI Sumut pada saat baru terjadinya kebakaran, Minggu (10/6), cukup tanggap dan langsung turun ke lapangan menyerahkan bantuan minuman dan makanan yang memang sangat dibutuhkan. (m47)

Waspada/Armansyah Th

WAKIL Sekretaris HDCI Sumut, Oesman Tiong (2 kiri), didampingi pengurus lain menyerahkan bantuan dana untuk korban kebakaran di Jl AR Hakim Gg Aman, Medan, Rabu (13/6).

“Semua orang bisa lihat (Kagawa). Dia memiliki skill tinggi, kreatif, punya flair yang bagus. Orang-orang Asia biasanya sangat terbuka dan paham tim dan kerjasama, sehingga mereka bisa meraih kesuksesan,” sambungnya. “12 tahun lalu hanya Nakata yang di Eropa. Namun sekarang sudah banyak pemain Asia yang main di Eropa,” tukasnya. Selain itu, Mourinho mengaku masih berambisi meraih gelar penting bersama Timnas Portugal. Meski telah banyak meraih trofi klub di Liga Portugal (FC Porto), Italia (Inter Milan, Inggris (Chelsea), dan Spanyol (Real Madrid), pelatih kawakan itu masih merasa belum lengkap. “Saya punya tiga tujuan. Satu sudah tercapai, memenangkan gelar di tiga liga penting, ditambah liga Portugal. Yang kedua adalah meraih gelar Liga Champions ketiga. Ketiga, meraih gelar bersama Portugal,” ujar The Special One. (m33/ini)

Thunder tetap tertinggal 22-29 di kuarter pertama. Di kuarter berikutnya, Heat belum mengendurkan serangannya. LeBron James membuat dunk yang membawa Heat memimpin 37-24 sebelum menutup kuarter kedua 54-47. Memasuki kuarter ketiga, Thunder yang tak mau dipermalukan di kandangnya mencoba bangkit. Aksi shooting guard Thabo Sefolosha berhasil menyamakan kedudukan 60-60 sebelum free throw dari Russell Westbrook membawa tuan rumah unggul tipis 74-73. Di kuarter terakhir, Heat justru tampil antiklimaks. Baik LeBron maupun Dwyane Wade gagal menghentikan dominasi Durrant dan Westbrook hingga akhirnya menyerah 95-104. Durrant kembali menjadi pahlawan kemenangan Thunder berkat sumbangan angka terbanyak di antara semua

pemain dengan 36 poin. Westbrook menambah 27 angka 11 assist bagi Thunder. Sementara itu, Heat dipimpin LeBron James dengan kemasan 30 poin dan Wade yang menoreh 19 angka. “Saya pikir kami tidak bermain dengan kemampuan terbaik di babak pertama. Beruntung kami bisa memenangkan pertandingan. Kami bermain penuh energi di babak kedua,” ujar pelatih Thunder, Scott Brooks. Sementara itu pelatih Heat, Erik Spolestra, mengakui timnya lengah di babak kedua. “Kami berpikir telah dalam posisi menang, kemudian mereka menyingkirkan kami. Mereka mengalahkan kami dengan permainan terbaik,” paparnya. Game kedua final NBA masih akan dimainkan di kandang Thunder, Chesapeake Energy Arena, pada Jumat (15/6) besok. (m33/ap)

EURO 2012

WASPADA Kamis 14 Juni 2012


Kali Ini Matador Lebih Berani GARA-GARA takut memainkan striker murni sebagai starter saat bermain 1-1 dengan Italia, 10 Juni lalu, formasi Spanyol menjadi misteri pada dua partai sisa Grup C Euro 2012. Terutama ketika menghadapi Republik Irlandia dinihari WIB nanti di PGE Gdansk Arena, Polandia. Pertanyaan yang banyak muncul ke permukaan, masihkah entrenador Vicente del Bosque memarkir para penyerang timnya di banch cadangan sang juara bertahan?‘ Menurut awak, gak bakalan. Kali ini El Matador lebih berani, karena tuntutan menang besar sangat mendesak setelah Kroasia memukul Irlandia 3-1 di Poznan. Sukses Hrvatska itu bisa saja memaksakan situasi, tiket lolos dari Grup C mesti dikonversi melalui produktivitas gol. Dengan demikian filosofi perang La Furia Roja beda dibanding penampilan pertamanya. Saat bentrok dengan Gli Azzurri, target Del Bosque menguasai bola sepenuhnya supaya tidak kalah. Makanya, dia sampai menurunkan enam pemain typegelandang untuk memenangkan pertarungan di lapangan tengah. Kini menghadapi The Boys in Green, target Matador lebih berani sekaligus lebih pasti. Misi Xavi Hernandez cs bukan sekadar mendominasi permainan, melainkan ingin menusuk dan mencabik-cabik jala gawang Si Bocah Hijau.

Gol dan gol bakal mereka buru, tugas itu tentu lebih maksimal jika dibebankan kepada pemain target man. Bagaimana pun, para penyerang lebih matang dalam membuka ruang sekaligus menuntaskan peluang di jantung pertahanan lawan. Fernando Torres, Fernando Llorente, Alvaro Negredo maupun Pedro Rodriguez, sudah biasa mengemban kewajiban tersebut. Memburu gol merupakan tugas rutin mereka sebagai striker, beda dengan Andres Iniesta, Cesc Fabregas dan David Silva, yang sejatinya pelayan bagi bomber. Juga, tak ada alasan ngeri bagi Del Bosque untuk mengurangi sedikit kekuatan di lapangan tengah pasukannya. Sebab karisma Irlandia ibaratkan ‘bumi dan langit’ dengan Italia, yang sudah sangat sering mempecundangi Spanyol di ajang resmi maupun ujicoba. Azzurri penyandang gelar Piala Dunia dan Eropa, The Irish hanyalah negara semenjana, yang jarang sekali mentas di turnamen akbar. Boys in Green baru tiga kali tampil di Piala Dunia dengan

Ulasan Khaidar Aswan Mantan Pemain PSMS prestasi puncak menjadi perempatfinalis di Italia 1990. Irlandia juga baru dua kali merasakan panasnya atmosfer Piala Eropa, yakni tahun 1988 dan 2012 ini. Secara teknis, Robbie Keane dan kawan-kawan bagaikan banteng kecil dengan tenaga dan naluri membunuh tidak sekuat dan seganas Azzurri, kendati diotaki pelatih kawakan asal Italia, Giovanni Trapattoni. Maestro Trap, begitu dia dijuluki karena prestasinya menjuarai semua kompetisi antar klub UEFA dan Intercontinental, sebenarnya sudah cukup maksimal meloloskan Bocah Hijau ke Polandia-Ukraina 2012. Hanya bermodalkan para pemain yang merumput di klubklub medioker Liga Premier, Trap mampu membawa Irlandia menjadi runner-up di bawah

Peran Penting Fabregas


CESC Fabregas (foto) berharap memainkan peran penting bersama timnas Spanyol di Euro 2012 dengan target gelar juara untuk kedua kali. Setelah menghabiskan waktunya selama beberapa hari untuk memulihkan cedera, Fabregas pun mendapat kesempatan menjalani peran penting tersebut. Gelandang Barcelona ini ditunjuk pelatihVicente del Bosque sebagai penyerang La Furia Roja dalam laga melawan Italia. Del Bosque mengungkapkan alasannya memilih Fabregas sebagai striker bayangan karena dinilai memiliki kemampuan hebat untuk menusuk area penalti lawan. Mantan kapten Arsenal itu juga menjawab kepercayaan pelatih. Hal itu sudah dibuktikannya ketika mencetak gol semata wayang La Furia Roja ke gawang Gianluigi Buffon. Semula Fabregas mengaku terkejut diturunkan sebagai starter dengan tugas striker, namundirinyaselaluoptimis

dapat memberi bukti layak diandal-kan. “Saya gembira untuk moment ini. Saya berharap akan bermain pada pertandingan selanjutnya, sehingga dapat melanjutkan permintaan pelatih plus membawa Spanyol meraih kemenangan pertama,” kata Cesc, Rabu (13/6). “Saya percaya diriku mampu bermain di beberapa variasi posisi. Merupakan kejutan saat saya berada di daftar pemain starter, namun hal yang paling penting adalah tim,” lanjutnya. Kendati posisinya direbut Fabregas, Fernando Torres dan justru mendukung rekannya itu. Di saat taktik Del Bosque dikritik karena bermain tanpa striker dan menyimpan Torres di bangku cadangan, striker Chelsea itu tidak mempermasalahkannya. Spanyol memang mendominasi permainan, namun kesulitan membongkar pertahanan Italia. Bahkan, El Matador tertinggal lebih dulu. Beruntung, Fabregas kemudian mencetak gol penyama kedudukan dan menyelamatkan negaranya dari kekalahan. Hasil seri itu memaksa Spa-

Rusia pada babak kualifikasi Grup B. Padahal di grup itu ada Norwegia dan Slovakia. Di babak play-off, Bocah Hijau kemudian dengan meyakinkan sukses menyingkirkan Estonia agregat 5-1. Irish pun mentas buat kali kedua di putaran final Eruo, setelah hanya sampai babak pertama saja dalam debut tahun 1988 silam. Sukses itu sungguh tak terlepas dari karya besar Maestro Trap. Mengarsiteki Damien Duff cs sejak 2008, pelatih gaek berusia 73 tahun itu mampu mentransformasi pengalaman hebatnya sebagai mantan pelatih Timnas Italia (2000-2004), serta klub raksasa AC Milan, Juventus, Inter Milan, Fiorentina, Benfica, Bayern Munich, dan VfB Stutgart. Semula, Trap beserta asistennya Marco Tardelli, legenda Italia dan Juventus, berharap Irlandia dan Azzurri yang lolos ke perempatfinal dari Grup C. Namun semuanya berantakan, setelah Shay Given cs ditaklukkan Kroasia di Poznan. Justru Bocah Hijau kini malah‘di ujung tanduk’. Dua laga berikutnya mesti dimenangkan, padahal lawan yang ditantang berstatus juara bertahan, dan satunya lagi negeri nenek moyang Trap-Tardelli. Bakal berakhirlah petualangan Robbie Keane dan kawan-kawan, mungkin malam ini juga waktu Polandia, setelah ‘ditusuk pedang tajam’ anakanak Negeri Matador.*****

Karier Klub 2003-2011 Arsenal (Inggris) 2011Barcelona (Spanyol)

Karier Timnas 2002-2003 Spanyol U-16 2003-2004 Spanyol U-17 2005 Spanyol U-20 2004-2005 Spanyol U-21 2006Spanyol (senior) Debut vs Pantai Gading (2006) 63 caps/8 gol nyol harus menang saat melawan Republik Irlandia, Jumat (15/6). Jika tidak, maka peluang ke perempatfinal bisa menjadi kecil. Usai menyabet trofi Euro 2008 dan Piala Dunia 2010, Fabregas ingin mengukir prestasi yang lebih impresif. Mantan ikon Arsenal itu berharap La Roja dapat kembali menjadi kampiun di Euro 2012 sekaligus mencatatkan sejarah sebagai negara pertama yang mampu meraih tiga titel di ajang terakbar internasional secara berurutan. “Kami ingin mencetak sejarah musim panas ini dan menjadi tim pertama yang memenangi Euro, Piala Dunia, kemudian Euro lagi. Tapi, kami sadar ini tak akan mudah. Semua orang ingin mengalahkan Spanyol karena kami favorit juara,” tutupnya. (m33/uefa/afp)

Irlandia Tak Takut GDYNIA, Polandia (Waspada): Republik Irlandia tak takut menghadapi Spanyol di laga kedua Grup C Euro 2012 dinihari WIB nanti, kendati lawannyaa berstatus juara dunia dan juara Eropa. Irlandia mengawali turnamen dengan hasil negative, kalah 1-3 dari Kroasia di laga pertama, pekan lalu. Tim arahan Giovanni Trapattoni itu berarti tak boleh lagi kalah di laga berikutnya, supaya tidak masuk kotak. Sial buat Irlandia, lawan selanjutnya yang akan mereka hadapi adalah Spanyol. Spanyol pastinya akan mengejar poin maksimal setelah mereka cuma bermain imbang 1-1 dengan Italia di laga pertama. “Anda tak akan datang ke turnamen utama dan menjalani laga-laga mudah,” ucap penyerang Irlandia, Simon Cox, seperti dikutip dari ESPN Star, Rabu (13/6). “Sekarang kami akan menghadapi dua negara yang mungkin paling ditakuti di dunia sepakbola. Mereka ada di depan kami, kami akan menghadapi mereka dan menikmatinya,” sambungnya. “Kami tak takut menghadapi laga melawan Spanyol. Itu akan jadi laga yang kami nantikan. Kami harus yakin,” tegas Cox. “Kami baru saja menghadapi tim yang secara teknis sangat kuat. Namun setiap pertandingan di turnamen ini bisa jadi kejutan,” timpal pelatih Trapattoni. Striker Kevin Doyle juga menunjukkan semangatnya. “Memang kemunduran bagi kami, namun kami tampil bagus dalam kondisi sulit dan inilah yang harus kami lakukan,” katanya.”Spanyol takkan lebih sulit dari ini dan kami butuh para pendukung kami untuk memberi semangat lagi,” klaimnya melalui BBC. Bek Sean St Ledger, yang jadi penyelamat muka Irlandia dengan mencetak satu-satunya gol ke gawang Kroasia, juga yakin timnya mampu mengatasi juara dunia Spanyol. “Jelas bakalan berat, tapi itulah sepakbola. Anda tak bisa menjalani turnamen tanpa kalah sama sekali,” dalihnya. “Kroasia ada di 10 besar karena alasan yang jelas. Tak ada pertandingan yang lebih baik ketimbang melawan Spanyol. Jelas kami akan meladeni tantangan juara dunia ini, jadi kenapa tidak berjuang dan mendapatkan hasil,” tambah St Ledter. (m18/espn/bbc)

STRIKER Fernando Torres (tengah) menguasai bola dalam sesi latihan tim Spanyol di Gniewino, Polandia, Rabu (13/6). -AP-

Amukan Sang Juara Bertahan GDANSK, Polandia (Waspada): Setelah berbagi angka 1-1 melawan Italia, juara bertahan Spanyol bakalan mengamuk dalam laga kedua Grup C melawan Republik Irlandia dinihari WIB nanti di PGE Arena Gdansk, Polandia. Spanyol sudah 24 kali melawan Irlandia, hasilnya menang 13 kali, tujuh seri dan empat kalah. Dari enam pertemuan terakhir kedua tim di Piala Eropa, Spanyol bahkan empat kali menang, sisanya seri. Pada tahun 2002 di Piala Dunia Kore/Jepang, Spanyol menang 3-2 setelah bermain 1-1 pada 90 menit waktu normal di babak knock out. PasukanVicente del Bosque pun diunggulkan untuk memperoleh nilai penuh. Sang juara bertahan bisa menampilkan full team, walaupun Arbeloa dan Jordi Alba terkena kartu kuning ketika Spanyol menghadapi Italia dan apabila mereka terkena kartu kuning kembali maka mereka tidak dapat bermain pada pertandingan berikutnya.

Iker Casillas dipastikan di bawah mistar. Kiper klub Real Madrid itu membuat lima penyelamatan ketika Spanyol menghadapi Italia. Permainan satu dua sentuhan dari kaki ke kaki dengan mendominasi penguasaan bola akan merepotkan barisan pertahanan Irlandia dengan ciri khas Britania Raya atau mengandalkan bola-bola atas. Del Bosque dihadapkan kepada sebuah pilihan di lini depan. Pola 4-3-3 yang diusung Spanyol dengan menempatkan David Silva, Iniesta dan Fernando Torres di posisi depan. Untuk mendukung posisi depan, Sergio Busquets akan menurunkan skuad yang sama saat menghadapi Italia, yakni Xavi Hernandes, Busquets dan Xabi Alonso. Di posisi pertahanan, Arbeloa, Pique, Ramos dan Alba. Bosque yang dikutip dari Eurosport, Rabu (13/6) mengakui bahwa dia tetap mewaspadai Irlandia terutama serangan balik, jika pasukan yang dipoles pelatih asal Italia Giovanni Tra-

PRAKIRAAN FORMASI PEMAIN Spanyol 1-4-2-3-1 Usia 1-Iker Casillas 31 17-Alvaro Arbeloa 29 15-Sergio Ramos 26 3-Gerard Pique 25 18-Jordi Alba 23 16-Sergio Busquets 23 14-Xabi Alonso 30 8-Xavi Hernandez 32 6-Andres Iniesta 28 10-Cesc Fabregas 25 9-Fernando Torres 28 Pelatih: Vicente del Bosque pattoni bermain bertahan. Gelandang Sergio Busquets menepis anggapan para punggawa La Furia Roja tengah mengalami tekanan, karena posisi mereka yang difavoritkan sebagai calon juara Euro 2012. Menurut Busquets, tampil di Polandia-Ukraina, timnya malah tanpa beban dan tak merasa ada tekanan, sebab tujuan datang ke Euro 2012 adalah untuk memenangkannya, seperti yang mereka lakukan pada

Irlandia 1-4-4-2 Usia 1-Shay Given 36 4-John O’Shea 31 2-Sean St. Ledger 27 5-Richard Dunne 32 3-Stephen Ward 26 7-Aiden McGeady 26 6-Glenn Whelan 28 8-Keith Andrews 31 11-Damien Duff 33 10-Robbie Keane 31 9-Kevin Doyle 28 Pelatih: Giovanni Trapattoni Euro 2008 lalu. “Tekanan untuk menjadi juara lagi? Itu memang keinginan kami dan itu sebabnya kami berada di sini,” tegas Busquets, seperti dilansir Soccerway, Rabu. “Hal ini tidak akan mudah. Ada tim bagus yang bermain dengan baik dan mereka akan membuat hal sulit bagi kami. Tekanan adalah normal bagi tim seperti kami, tapi itu bisa diatasi,” jelas pemain Barcelona ini. (m18/euro)

Sumatera Utara

B2 Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:27 12:40 12:28 12:35 12:34 12:31 12:28 12:23 12:30 12:30

‘Ashar 15:54 16:07 15:54 16:02 16:01 15:57 15:54 15:50 15:57 15:56

Magrib 18:37 18:54 18:38 18:48 18:47 18:38 18:37 18:33 18:40 18:42



Shubuh Syuruq


19:52 20:09 19:53 20:03 20:02 19:52 19:52 19:47 19:55 19:57

04:43 05:52 04:43 04:47 04:48 04:51 04:44 04:40 04:46 04:44

04:53 05:02 04:53 04:57 04:58 05:01 04:54 04:50 04:56 04:54

L.Seumawe 12:33 L. Pakam 12:26 Sei Rampah12:25 Meulaboh 12:37 P.Sidimpuan12:24 P. Siantar 12:25 Balige 12:25 R. Prapat 12:22 Sabang 12:40 Pandan 12:26

06:14 06:24 06:15 06:19 06:20 06:23 06:16 06:12 06:18 06:16

Zhuhur ‘Ashar 16:00 15:53 15:52 16:04 15:51 15:52 15:52 15:48 16:07 15:53

TEBINGTINGGI (Waspada): PT Jasa Raharja Perwakilan Kota Tebingtinggi memberi bantuan pembangunan menara Masjid Tanbihul Ghafilin di Desa Jaharusn B, Kab. Sergai, Rp10 juta. Bantuan itu, kata Kepala Perwakilan Herry Kesuma, SE, MM dari program Corporate Sosial Responsibility (CSR) perusahan asuransi itu. Menurut Herry Kesuma, Selasa (12/6), pemberian bantuan wujud komitmenPTJasaRaharjadalamrangkaturutsertamembenahifasilitas umum, baik agama dan sosial yang digunakan masyarakat secara luas. Ditambahkan,bantuankepadaMasjidTanbihulGhafilin,diberikan dalam bentuk semen, bataspit dan besi cor, diterima kenaziran masjid. “Kami berharap bantuan akan mempercepat proses penyelesaian bangunan, agar kegiatan ibadah menjelang ramadhan kian semarak,” ujar Herry Kesuma didampingi staf PKBL Novaria Simanjuntak, SH. Herry menegaskan, PT Jasa Raharja memiliki program CSR setiap tahun yang dianggarkan untuk memperbaiki berbagai fasilitas publik. CSR salah satu komitmen perusahaan asuransi negara, dalam memberi manfaat lebih luas atas kinerja perusahaan selama ini.(a09)

Sabu Diselipkan Di Kartu Pers




Shubuh Syuruq


Zhuhur ‘Ashar




Shubuh Syuruq


20:01 19:51 19:51 20:03 19:46 19:49 19:48 19:45 20:10 19:48

04:45 04:42 04:41 04:52 04:45 04:42 04:44 04:41 04:51 04:46

04:55 04:52 04:51 05:02 04:55 04:52 04:54 04:51 05:01 04:56

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:26 12:28 12:38 12:30 12:27 12:34 12:22 12:33 12:26 12:25

18:34 18:37 18:51 18:39 18:38 18:46 18:32 18:43 18:34 18:35

19:48 19:52 20:06 19:53 19:53 20:01 19:47 19:57 19:48 19:50

04:46 04:45 04:50 04:49 04:43 04:48 04:40 04:49 04:45 04:41

04:56 04:55 05:00 04:59 04:53 04:58 04:50 04:59 04:55 04:51

Panyabungan 12:23 Teluk Dalam12:30 Salak 12:28 Limapuluh 12:24 Parapat 12:26 GunungTua 12:23 Sibuhuan 12:23 Lhoksukon 12:32 D.Sanggul 12:26 Kotapinang 12:21 AekKanopan 12:23

06:18 06:14 06:13 06:24 06:16 06:14 06:15 06:12 06:24 06:17

15:53 15:54 16:05 15:57 15:54 16:01 15:49 15:59 15:52 15:52

LUBUKPAKAM (Waspada): Muktasar, 50, salah satu tahanan hakim kritis terjun dari lantai 2 tahanan Lembaga Pemasyarakatan (Lapas) Lubukpakam. Informasi Waspada himpun kemarin,penghuniblokKamboja II Lapas Lubukpakam itu berbuat nekatsaatmenjelangputusansidang ataskasus378KUHPpenggelapan yang disangkakan padanya. “Hari ini (Rabu 13/6) menjelang sidang putusan kasusnya,

sekitar pukul 12:30, ketika baris tiba-tibaMuktasarlarinaikkelantai 2dikamarDahlialapasdanlangsung terjun,” sebut KPLP Simon Sembiringkepadawartawankemarin. Menurut Simon, warga Perbaungan ini sejak masuk lapas sebulan lalu diduga mengalami

SEIRAMPAH (Waspada): Dalam memperingati bulan lahir dan meninggalnya Bung Karno, pada Juni 2012 DPC PDIP Serdang Bedagai menggelar arisan PAC PDIP se- Kab. Sergai sekaligus menepungtawari Ketua DPD DPIP Sumut, Panda Nababan, Minggu (10/6) sore di Desa Mangga Dua, Kec. Tanjung Beringin. HadirPengurusDPPPDI-PH,IrmadiLubisdanrombongan,anggota DPRD Sumut dari Fraksi PDIP, H. Alamsyah Hamdani, SH, Jantogu Damanik,S.Sos,Drs.BaskamiGinting,KetuaDPCPDIPSergai,H.Khairi A.Zhulmi,WakilKetua,Drs.EdiWarmanSaragih,WasnerSianturi,Sekretaris, PangihutanSihombing,SE,LimbasHutagalung,KetuaPACPDIP,Tanjung Beringin, Bung Kasno selaku tuan rumah. Selain itu Ir. Rusmadi, Nurdin Sipayung dan sejumlah anggota DPRD Sergai asal DPIP, serta 15 Ketua PAC PDIP se Sergai dan lainnya. Ketua DPC-P Sergai Khairi. A Zhulmi SH, mengatakan kegiatan ini hasil keputusan rapat kerja untuk menciptakan suatu kekuatan dalam bersilaturahmi, komunikasi atau informasi dalam menyampaikan masalah- masalah yang terjadi di PAC-PAC sekaligus mengevaluasi kinerja pengurus. Sementara itu Ketua DPD PDIP Sumut, Panda Nababan terharu atas penyambutan dan penepungtawaran 4 adat sekaligus yakni Jawa, Malayu, BatakToba dan Simalungun tersebut serta mendukung kegiatan arisan bertujuan membentuk kekuatan. Panda Nababan juga menceritakan kondisinya selama 1,4 tahun tinggal di Blok 0 Kamar 7 Rutan Salemba sekaligus memberi hadiah berupa buku ciptaannya tentang lambang Banteng moncong putih, mata merah kepada Pengurus PDIP se-Sergai.(c03)

PTPN III Distrik Serdang I Salurkan Sembako Murah SIPISPIS (Waspada): Badan Usaha Milik Negara (BUMN) PTPN III Distrik Serdang I meliputi Kebun Gunung Para, Gunung Pamela, Gunung Manaco dan Kebun Silau Dunia menyalurkan 1.208 paket sembako murah kepada warga miskin sekitar perkebunan. Distrik Manajer Serdang I, Ir. Felix Giwa Djaha, MSC didampingi Kabid Umum, Bastanta Parangin-angin, SE dan Manejer PTPN III Kebun Gunung Pamela, H.Tambal Siregar mengatakan pasar murah 5 hingga 9 Juni, bentuk kepedulian PTPN III terhadap masyarakat miskin dan kurang mampu di sekitar perkebunan. “Sembako yang disalurkan dengan harga di bawah 30 persen dari harga pasar, meliputi beras 7,5 kg, gula pasir 2 kg dan minyak goreng 2 liter,” papar Felix kepada Waspada di PTPN III Kebun Pamela, Senin (11/6) siang. Ditambahkan,1.208wargamiskinmendapatkuponpaketsembako murah dengan harga Rp29.850. Kerjasama ini atas partisipasi Pemkab Sergai dengan warga sekitar perkebunan PTPN III Distrik Serdang I. Dari 1.208 paket sembako murah, 308 paket untuk Kebun Gunung Para, 300 paket kebun Gunung Manako, 300 paket kebun Silau Dunia, 300 paket kebun Gunung Pamela.(c03)

Waspada/Edi Saputra

MANAJER PTPN III Kebun Pamela, H, Tambal Siregar menyalurkan sembako murah kepada warga miskin Desa Gunung Pane, Kec. Sipispis baru-baru ini.

Zhuhur ‘Ashar 15:49 15:56 15:55 15:50 15:52 15:49 15:49 15:59 15:53 15:47 15:49




Shubuh Syuruq

18:29 18:36 18:37 18:34 18:35 18:30 18:29 18:45 18:35 18:29 18:32

19:43 19:50 19:51 19:48 19:49 19:44 19:43 20:01 19:49 19:43 19:46

04:44 04:52 04:46 04:40 04:43 04:43 04:43 04:45 04:45 04:40 04:41

04:54 05:02 04:56 04:50 04:53 04:53 04:53 04:55 04:55 04:50 04:51

06:16 06:23 06:18 06:12 06:15 06:14 06:15 06:17 06:16 06:12 06:12

depresi berat. “Sekitar pukul 03:00 (Rabu dinihari-red), Muktasar berteriak ada pembunuhan dan kuburan saya telah siap ada di kamar mandi,” ujar Simon mengutipocehananehMuktasar. Kata Simon, pasca peristiwa takterdugaitu,Muktasarlangsung dilarikan ke Instalasi Gawat Darurat (IGD) RSUD Deliserdang dalam keadaan koma. Hingga berita ini dikirim menurut pihak RSUD Deliserdang, Muktasar belum juga siuman.(m16)

Waspada/HM Husni Siregar

BUPATI Deliserdang Drs. H. Amri Tambunan didampinggi Ketua TP PKK Ny. Hj. Anita Amri Tambunan menyerahkan surat hak Tanah dan IMB kepada ibu Aminah yang rumahnya dibedah lewat program bedah rumah tidak layak huni menjadi layak huni di Kec Percut Seituan.

Komunitas Pecinta Sepeda ‘Praktis’ PS Tuan Bedah Rumah Lansia

Kapolres Harapkan Kesadaran Masyarakat Tertib Lalulintas

DPC PDIP Sergai Peringati Bung Karno

06:17 06:17 06:22 06:20 06:15 06:20 06:11 06:21 06:16 06:13

Penghuni Lapas Kritis Terjun Dari Lantai 2

STABAT (Waspada): Polantas Resort Langkat meringkus oknum wartawan mingguan yang menyelipkan narkotika jenis sabu-sabu di kartu pers, Selasa (12/6) pagi. Penangkapan berawal saat petugas menggelar razia kendaraan bermotor di Jalan KHZ Arifin Stabat. Tersangka IL, 36, warga Desa Batu Malenggang Kec. Hinai melintas dengan Suzuki Smash tanpa plat kemudian distop untuk diperiksa kelengkapan surat-suratnya, namun yang bersangkutan menghindar dan lolos. Tidak jauh dari lokasi tersangka terjebak lampu lalulintas hingga personel Polantas memeriksa surat-surat kendaraannya. Ketika itu ditemukan sabu 0,2 gram diselipkan di kartu pers miliknya. Untuk penyelidikan lebih lanjut pria berkulit hitam itu dibawa ke Mapolres Langkat. Dikatakan tersangka, sabu hanya untuk dikonsumsi dan tidak diedarkan. Kasus tersebut telah ditangani petugas Sat Narkoba Polres Langkat.(a03)

TEBINGTINGGI (Waspada): Kapolres Tebingtinggi AKBP Drs. Andi Rian Djajadi, S.Ik beserta jajarannya bekerjasama dengan instansi terkait menggelar Operasi Simpatik Toba 2012. Usai apel, dilanjutkan turun ke jalan. Kapolres juga sempat memperbaiki tali helm pengendara yang tidak tepat penggunaannya, serta memberikan sosialisasi berupa sejumlah brosur kepada pengemudi roda dua berisi imbauan agar tertib berlalu lintas. Kapolres Tebingtinggi, AKBP Drs. Andi Rian Djajadi SIk, mengatakan operasi simpatik toba 2012 digelar sekaligus menyabut Hut Bhayangkara Polri ke- 66. Dengan digelarnya Operasi Simpati ini diharapkan muncul kesadaran masyarakat untuk tertib lalu lintas. Sementara itu, salah seorang pengendara roda dua ketika dimintai tanggapannya secara terpisah mengatakan kegiatan yang dilakukan pihak kepolisian sangat membantu mereka dalam pemahaman tertib berlalulintas dan mereka akan mendukung kegiatan positif tersebut karena ketertiban lalu lintas berguna untuk kepentingan pengendara itu sendiri. (a11)

Kamis 14 Juni 2012

18:46 18:37 18:36 18:48 18:31 18:35 18:34 18:30 18:55 18:34

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

PT Jasa Raharja T. Tinggi Bantu Pembangunan Masjid


Waspada/Eddi Gultom

BUPATI Sergai Ir. HT. Erry Nuradi bersama Dandim 0204/DS Letkol Arh Wawik Dwinanto, S.Sos., M.Si selaku Dansatgas mengucapkan terimakasih kepada prajurit TNI jajaran Kodim 0204/DS dan masyarakat yang berpartisipasi dalam pelaksanaan TMMD ke-88 tahun 2012 di Desa SiujanUjan Kec. Kotarih.

Pangdam I/BB Mayjend TNI Lodewijk F. Paulus:

Program TMMD Bantu Tingkatkan Kesejahteraan Masyarakat Pedesaan KOTARIH (Waspada): Program TNI Manunggal Membangun Desa (TMMD) wadah perwujudan TNI bersama instansi terkait dalam membantu meningkatkan kesejahteraan masyarakat pedesaan. TMMD sekaligus upaya mensinergi pembangunan fisik dan non fisik agar setara dengan daerah lain yang lebih maju. Manfaat lain yang dapat dipetik dari kegiatan ini, untuk menumbuhkan semangat persatuan dan kesatuan di masyarakat. Menurut Pangdam I/BB Mayjend TNI Lodewijk F. Paulus dalam sambutan tertulis dibacakan Bupati Serdang Bedagai (Sergai) Ir. H.T. Erry Nuradi, M.Si sebagai Irup pada upacara penutupanTMMDke-88wilayah Kodim 0204/DS tahun 2012, di lapangan PT. Perkebunan SU Sei Kari Kecamatan Kotarih Kabupaten Sergai, Selasa (12/6), secara keseluruhanprogramTMMDke88 selesai dilaksanakan, tentu berkat kerja keras dan kesungguhan segenap unsur komando dan pelaku TMMD ke-88, serta keikutsertaan seluruh elemen masyarakat. Selaku komandan

upacara Pabung 0204/DS Mayor Inf. GLP Dongoran. Sebagai tindak lanjut dari program TMMD ke-88 ini, Pangdam I BB berharap kebersamaan dapat terus terpelihara sehingga tercipta hubungan emosional yangharmonisdanhidupgotongroyong atas dasar kesetiakawanan, kekeluargaan dan toleransi yang tinggi, kemudian hasil yang dicapai hendaknya terus dipelihara sehingga memiliki usia pakai yang panjang. Selain itu melalui TMMD diharapkan memantapkan kemanunggalan TNI dan rakyat, agar tercipta kesadaran bela negara dan cinta tanah air sehingga terwujud ketahanan wilayah yang tangguh. Penutupan TMMD yang ditandai serah terima proyek dari Dandim 0204/DS Letkol Arh Wawik Dwinanto, S.Sos, M.Si selaku Dansatgas TMMD kepada Bupati Sergai Ir. H.T. Erry Nuradi, M.Si dan peninjauan hasil pekerjaan fisik di Desa Kotarih Baru danDesaSiujan-UjanKec.Kotarih. Hadir Ketua DPRD Sergai H. AzmiYuli Sitorus SH, MSP, Ketua DPRD Deliserdang Hj. Fatmawati Takrim, Kapolres Sergai AKBP

Arif Budiman, S.Ik, SH mewakili Danrem 022/PT Kasi Ops Korem 022/PT Letkol Inf EH. Limbong, Wakapolres Deliserdang Kompol Arief, Wakapolres Tebingtinggi Kompol I Made Ary Pradana, mewakiliKajariSeiRampahLomo Parondian Harahap, SH, Ketua TP PKK Sergai Ny. Hj. Evi Diana Erry, Ketua Persit KCK Kodim 0204/DS Ny. Wawik Dwinanto, Asisten Pemum Rudi Sitorus, SH, parakepalaSKPDSergai,Manajer PT. Perkebunan SU Kotarih, Danramil se-jajaran Kodim 0204/ DS, organisasi kepemudaan dan masyarakat. Hasil TMMD ke-88 di Kec. Kotarih,23Meihingga12Juni2012 di Desa Kotarih Baru dan Desa Siujan-ujan menurut Dandim 0204/DS Letkol Arh. Wawik Dwinanto, S.Sos, M.Si, meliputi beberapa sasaran fisik yaitu pembangunan jalan baru sepanjang 3500 x 3 M di Dusun Bahisam Desa Kotarih Baru ke Dusun III DesaSiujan-Ujan,pembangunan duaunitjembatanplatbetonukuran 6 x 1,5 M di Dusun Bahisam Desa Kotarih Baru dan satu unit jembatan plat beton ukuran 5 x 4 M di Desa Siujan-ujan.(a08)

Amri Tambunan Layak Pimpin Sumut MEDAN (Waspada): Amri TambunanyangmenjabatBupati Deliserdang,dinilailayakmemimpin Sumatera Utara. Demikian dikatakan salah satu tokoh masyarakat Pakpak, Ir. Baharuddin Berutu kepada wartawan, di sekretariat DPP Himpak, Gedung Johor saat Rapat Kordinasi dengan pengurus, Minggu (10/6). Menurut Ir. Baharuddin Berutu yang juga Ketua Umum Lembaga Adat Budaya Pakpak SilimaSuak,halinidilihatdarifigur Amri Tambunan, satu-satunya calon Gubsu dari kalangan birokrat. “Amri Tambunan meniti karier dari bawah yaitu sebagai lurah, camat, Sekda Kota Medan dan satu-satunya bupati Deliserdang yang menjabat dua periode,” kata Berutu. Beliau juga salah satu putra tokoh Sumut yang disegani Jamaluddin Tambunan (alm/ mantan gubernur Jambi). Dalam kepemimpinannya yang tidak banyak bicara namun banyak berbuat terobosan-terobosan pembangunan pemerintahan dan kemasyarakatan, dilihat dari program GDSM, Cerdas, Ceria dan bedah rumah. “Saat bertemu beliau juga tak segan-segan memeluk dan mencium rakyatnya,” kata Ketua Umum Lembaga Adat Budaya PakpakSilimaSuak,Ir.Baharuddin Berutu. 70 Ribu Warga Sekira 70 ribu warga Banten di Sumut menyatakan dukungan sekaligus mendoakan Drs. H. AmriTambunanyangjugaBupati Deliserdang, maju pada Pilkada

Gubsu 2013. Pernyataan tersebut disampaikan Ketua DPD Paguyuban Banten Sumut Kab. Deliserdang, A. Riva’I, SH di hadapan Wabup Deliserdang H. Zainuddin Mars dan Ketua Pabansu Baharuddin Syahputra, pada pelantikan Pengurus DPC Paguyuban Banten Sumut (Pabansu) Kecamatan se Kabupaten Deliserdang, di lapangan Kampung Banten Tanjungmorawa, Minggu (10/6). Menurut Riva’i, alasannya karena berbagai program maupun gerakan yang digagas Drs. H. AmriTambunan, sudah sangat dirasakan manfaatnya oleh masyarakat. “Ini modal besar H. Amri Tambunan maju menjadi salah satu kandidat balon (bakal calon) gubernur.” Sementara Ketua Pabansu Sumut Baharuddin Syahputra, menyebutkan warga Banten di Sumut mencapai 70 ribu KK. Di Deliserdang 12 ribu KK lebih. Kepada para pengurus DPC Pabansu Kecamatan se-Kab. Deliserdangyangdilantik,diharap mendukung semua program kegiatan Pemkab Deliserdang, harap Baharuddin. Wabup Deliserdang H. Zainuddin Mars, menyampaikan terimakasih serta penghargaan kepada seluruh warga Banten bahkan merasa haru dan bangga karena telah mendoakan dan mendukung Bupati Drs. H. Amri Tambunan yang telah mencalonkan diri sebagai balon Gubsu. Bersyukur Sementara warga Kec. Percut Seituan bersyukur setelah Drs. H. AmriTambunan maju menjadi bakal calon (Balon) Gubsu.

WalauAmriTambunanmenjabat Ketua Dewan Pembina di DPD Partai Demokrat Sumut, namun ia berprinsip pencalonannya ini demi kepentingan masyarakat di Sumut yang dianggap butuh perubahan. Kec. Percut Seituan yang jumlahpenduduknya384.672jiwa lebih dengan luas wilayah 190,92 km,mengelilingiKotaMedanakan bekerjakerasmemenangkan Amri Tambunan menjadi Gubsu. Hal itu karena sejak Deliserdang dipimpin AmriTambunan, sangat besar perubahan yang sudah dinikmati warga dimulai dari Konsep Cerdas, (Perbaikan Sekolah) Ceria (Kesehatan Ibu/ Anak), GDSM (Gerakan Deli Serdang Membangun). Bahkan saat ini giat-giatnya dilakukan Bedah Rumah yang hanya melibatkan 3 pilar yaitu masyarakat, pengusaha serta pemerintah di DS, memperbaikirumahtaklayakhuni menjadilayakhunibagimasyarakat kurang mampu di 22 kecamatan, di Kab. Deliserdang. Sementara itu ketika ditemui di Desa Sampali Ketua Front Pembela Islam (FPI) Provinsi Sumatera Utara, Al-Ustadz M. Dahrul mengatakan, cukup syarat untuk maju ke Sumut satu. Apalagijikadilihatpembangunan di Deliserdang saat ini. Hal sama dilontarkan Ketua Gema Bakti Kec. Batangkuis, Bambang Hartoko. Menurut Bambang, sudah sepantasnya Amri Tambunan memimpin Sumut. Apalagi beberapa daerah tingkat dua di Sumut banyak mencontoh program H. Amri Tambunan.(m39/a06/crul)

PERCUT SEITUAN (Waspada): Gerakan kemanusiaan melalui program‘BaruYakin’ (Bedah rumah masyarakat miskin/kurang mampu) yang dicanangkan Bupati Deliserdang Drs. H. Amri Tambunan terus mendapat dukungan berbagai elemen masyarakat. Seperti dilakukan Komunitas Pencinta Sepeda “Praktis” (Percut, Cinta rakyat, Saentis) Kec. Percut Seituan dipimpin Rakhmadsyah, SH yang juga anggota DPRD Deliserdang, melakukan bedah rumah milik ibu Aminah warga Dusun I Desa Cinta Rakyat Kec. Percut Seituan ditandai peletakan batu pertama oleh Bupati Drs. H. Amri Tambunan, Minggu (10/6). Pelaksanaan bedah rumah dirangkai gerak jalan dan lomba sepeda santai serta lukcy draw diikuti ribuan warga masyarakat, tua dan muda, turut dihadiri Ketua TP PKK Ny. Hj. Anita Amri Tambunan, anggota DPRD Deliserdang Jaresman Sitanggang, Asisten I H. Syafrullah S.Sos, MAP, Kadis Perhubungan Ir. H. Anda Subrata M.Si, Kadisdikpora Hj. Sa’adah Lubis SPd, MAP, Kadis Infokom Drs. Neken Ketare, sejumlah pejabat Pemkab, Ketua PMI Deliserdang H. Ismayadi SH, Camat Percut Seituan Darwin Zein, S.Sos, beserta Muspika.

H. Ismayadi didampingi Rakhmadsyah sebagai Koordinator Gerakan Bedah Rumah Kec. Percut Seituan menjelaskan bedah rumah yang diprakarsai komunitas pecinta sepeda ini merupakan bedah rumah yang ke 51 di Kec. Percut Seituan dari 250 rumah yang ditargetkan. Bupati Drs. H. Amri Tambunan disela-sela peletakan batu pertama bedah rumah milik Ibu Aminah, menjelaskan perlu terjalinnya kebersamaan dan rasa kesetiakawanan sosial, karena selaku makhluk sosial kita harus berintraksi dan saling membutuhkan. Kita harus pupuk kebersamaan yang sudah terjalin di daerah ini sehingga percepatan pembangunan yang kita harapkan dapat tercapai. Karena ke depan masih banyak lagi tuntutan dan harapan seluruh masyarakat yang harus segera kita sahuti, papar H Amri Tambunan. Pada kesempatan itu, bupati menyerahkan surat alas hak atas tanah dan IMB kepada ibu Aminah dengan harapan bisa menikmati rumah tersebut dengan rasa aman dan terlindungi serta mengingatkanuntukmenjagadanmerawatrumah denganbaiksertadnikmatiseluruhkeluargahingga dapat memberi semangat baru untuk kuat bekerja bagi kesejahteraannya, harap Bupati.(a06)

Buntut Penahanan Kadis PU Pelaksana Swakelola Resah LUBUKPAKAM (Waspada): Pelaksana sistem swakelola di Deliserdang mengaku resah pasca penahanan Kadis PU Deliserdang beberapa waktu lalu.“Akibat penahanan ini jelas berdampak pada tagihankamisebagaipelaksanaswakelola.Pokoknya macatsemua,”tegasSumali,salahseorangpelaksana swakelola kepada harian ini, Selasa (12/6). Sumali lewat pesan singkatnya mengaku saat ini rekan-rekannya yang juga mengerjakan proyek dengan sistem swakelola merasakan hal serupa. “Mereka jelas bersyukur dengan adanya proyek bersistem swakelola ini, sehingga dapat berbuat untuk lingkungannya, namun saat mendengar kabar penahanan Kadis PU Deliserdang, kami tak bisa tidur. Bagaimana nasib tagihan pekerjaan kami ini,” tanya Sumali didampingi beberapa rekannya yang mengaku berasal dari Kec. Hamparan Perak. Sebelumnya juga diterima komentar hampir senada dari kecamatan yang sama. Yakni Juari dan Paidi. Juari dalam laporan tertulisnya sebagai pemerhati pembangunan dan Ketua Lembaga GP3A Sri Rezeki yang berdomisili di Hamparan Perak, merujuk kembali hal perbaikan kinerja pejabat pemerintah sesuai pasal 6 Kepres No.

80 tahun 2003. “Aturan ini jelas menyatakan pelaksanaan barang/jasa dilakukan dengan menggunakan penyedia barang/jasa secara swakelola, namun masalahnya pahamkah semua unsur yang ada di negeri ini. Jika kurang paham ya pelajari dan kalautaksetujucarisolusiterbaikuntukmelakukan perubahan,bukansebaliknyamainhantamkromo seperti dialami Kadis PU Deliserdang,” sebut Juari. Juari yang pada alinea terakhir suratnya mengaku tulisan dia untuk menyikapi tuduhan terhadap Kadis PU Deliserdang yang diduga telah melakukan proyek fiktif Rp80 miliar. “Ini sudah kebablasan,” tudingnya. Lain lagi dengan Paidi yang dalam suratnya mengaku sebagai tokoh masyarakat. Dia mengaku sedikit emosi saat menerimakabarpenahananKadisPUDeliserdang akibat sistem swakelolanya. “Wajar saya terpancing emosi, mosok lagi gencar-gencarnya masyarakat menjalin kebersamaan dalam pembangunan, tiba-tiba pejabat yang selama ini bekerja serius dan berbuat untuk rakyat justru terjerat hukum,” ujarnya yang dalam alinea terakhir coba menyentuh pihak yang berwenang agar bekerja sesuai hati nurani.(m16)

Waspada/Hotma Darwis Pasaribu

KAKI buruh batubata masuk ke mesin penggiling tanah.Warga membawa korban bersama mesin ke bengkel las untuk melepas kaki korban dari dalam mesin.

Kaki Buruh Batubata Remuk Tergiling Mesin Pelumat Tanah LUBUKPAKAM (Waspada): Saat mencetak batubata, kaki pekerja remuk akibat terpeleset kemesinpenggilingtanah,Selasa(12/6).Akibatnya, kaki kanan M. Sunardi, 20, warga DusunVI Desa Kotasan, Galang harus diamputasi. Kini korban masih menjalani pertolongan medis di RSU Sari Mutiara, Lubukpakam. Sumber dihimpun, siang itu Sunardi melaksanakanpekerjaanyasebagaiburuhpencetakbatubata milikPoniNigar,diDusunI,DesaPurwodadi,Pagar Merbau. Seperti biasa, pekerja awal, Nardi pun memasukkanpasirkedalammesinpelumattanah. Setahu bagaimana Nardi terpeleset, naas kaki kanannyamasukkemesinpenggiling.Nardiberteriak,

hingga rekan kerjanya pun kaget, dan tahu Nardi kecelakaan,lantastemankerjanyamematikanmesin. Teman sekerjanya berupaya menarik kaki Nardi yang lengket di dalam mesin. Namun kaki Nardi tak bisa dicabut, lantas warga berinisiatif membawa Nardi ke bengkel dalam kondisi kaki masihlengketdimesin.Setibanyadibengkel,mesin penggiling pun dibuka dengan las, dan akhirnya kaki Nardi terlepas, selanjutnya dibawa ke RSU Sari Mutiara, Lubukpakam. Kanit Reskrim Polsek Pagar Merbau, Aiptu Karya Tarigan mengatakan pihaknya melakukan penyelidikan, dan sudah meminta keterangan beberapa saksi.(a07)

Sumatera Utara

WASPADA Kamis 14 Juni 2012


Massa Guru Uber Wali Kota P. Siantar Mobil Wali Kota Dihadang, Digedor PEMATANGSIANTAR (Waspada): Massa guru yang kembali melakukan aksi unjukrasa di halaman gedung DPRD, Rabu (13/6), sempat mengejar Wali Kota Pematangsiantar Hulman Sitorus, SE sesaat setelah menerobos massa menggunakan mobil pribadinya Nissan Cherokee warna putih BK 63 H. Ketikaitu,walikotabermaksud menghadiri rapat paripurna DPRD. Di depan mobil wali kota ada mobil dinas Satpol PP. Beberapa guru yang mencoba menghadang laju mobil hampir tertabrak bila tidak segera lari menghindar. Meski mobil wali kota dan mobil dinas Satpol PP tetap

melaju, para guru itu tetap ngotot mengejar sepanjang halaman gedung DPRD dan berteriak meminta wali kota turun dan menjawab tuntutan mereka. Beberapa gedoran tangan sempat mengenai dinding mobil wali kota, namunmobilwalikotatetapmelaju. Akibat hadangan para guru itusuasanamenjadigaduh,apalagi

puluhan anggota Satpol PP dan puluhanpersonelPolresdipimpin KapolresAKBPAlberdTBSianipar S.Ik, MH, turut berusaha mengamankandanmenenangkan guru. Bentrok fisik antara guru dengan anggota Satpol PP nyaris terjadi ketika seorang guru berusahamenghadanglajumobil Wali Kota. Anggota Satpol PP berusaha menyingkirkan guru itu dengan menariknya. Guru berusaha melepaskan diri hingga sempat terjadi tarik-menarik. Tindakan anggota Satpol PP itu membuat guru lainnya marah dan berusaha mengejar para anggota Satpol PP. Namun, para anggota Satpol PP itu segera

menyingkir ke kantor mereka yangberadasatukomplekdengan gedung DPRD. Para guru yang tergabung dalam Forum Guru Siantar (FGS) dengan Ketua Drs. Hendri ETampubolon dan Sekretaris Eastman Napitupulu, S.Pd dan sudah melakukan demonstrasi setiap hari sejak Senin (28/5), memulai aksi mereka di depan ruang sidang ketika wali kota sedang membaca notajawabanatastanggapananggotaDPRDberupapemandangan umum terhadap penyampaian Sembilan rancangan peraturan daerah (Ranperda) ke DPRD. Demo yang berlangsung persis di sudut depan ruang sidang

DPRD dan suara mereka sampai kedalamruangsidang,membuat anggota Satpol PP segera menutup pintu seluruh ruang sidang dan suara wali kota yang sebelumnya lembut membaca nota jawaban menjadi terdengar dengan nada tinggi. Menjawab pertanyaan mengapa wali kota tidak mau berdialog dengan para guru tentang berbagai tuntutan itu, Kabag Humas dan Protokoler Pemko Drs. Daniel H Siregar yang dihubungi secara terpisah menegaskan, sejak awal wali kota sudah menyatakan tidak akan meladeni berbagai aspirasi yang disampaikan melalui demonstrasi. (a30)

Realisasi PAD Simalungun Baru 10 Persen SIMALUNGUN (Waspada): Hingga menjelang berakhirnya semester pertama tahun 2012, realisasi PAD (Pendapatan Asli Daerah) Kab. Simalungun dinilai sangat minim, baru terealisasi Rp12 miliar atau sekira 10 persen dari target Rp113 miliar. Minimnya realisasi PAD Simalungun hingga semester pertama 2012 mengundang tanda tanya di kalangan anggota dewan daerah itu. Anggota DPRD Simalungun, Bernhard Damanik, mengatakan, masih minimnya perolehan PAD tersebut akibat lemahnya kinerja pihak Dinas Pengelolaan Ke-

uangan dan Aset Daerah dalam upaya mengejar atau menarik PAD dari Satuan Kerja Perangkat Daerah (SKPD) yang dibebani target, atau bisa juga karena adanya kebocoran dalam pengelolaannya atau tidak dicatatkan sebagai pemasukan daerah. “Saya menduga minimnya realisasi PAD yang hanya baru tercapai 10 % dari target, disebabkan ketidakmampuan Dinas Pengelolaan Keuangan dan Aset Daerah menarik PAD dari masing-masing SKPD atau memang ada kebocoran dengan tidak mencatatkannya dalam pemasukan keuangan daerah,” kata

Damanik. Dia berharap Bupati Simalungun mengevaluasi kinerja Kepala Dinas Pengelolaan Keuangan dan Aset Daerah terkait minimnya pencapaian PAD, dan meminta inspektorat melakukan pemeriksaan kemungkinan adanya kebocoran dalam pengelolaannya. Apalagi tandas Bernhard,

Bupati Simalungun JR Saragih pernah menyatakan akan memberikan sanksi bagi para pimpinan SKPD yang tidak mampu memenuhi beban target PAD, sehingga diharapkan sanksi tersebut benar-benar diterapkan bukan hanya sekadar ancaman. Kepala Dinas Pengelolaan Keuangan dan Aset DaerahWil-

son Simanihuruk, saat dikonfirmasi lewat selulernya mengatakan penyebab minimnya realisasi PAD, bukan karena adanya kebocoran namun disebabkanbeberapafaktordiantaranya perubahan tarif yang disesuaikan dengan perda baru, dan pendataan terhadap wajib pajak serta objek retribusi baru selesai dilakukan April 2012 lalu. (a29)

Aset Pemko P. Sidimpuan Bermasalah P.SIDIMPUAN (Waspada): Pemerintah Kota Padangsidimpuan sampai saat ini masih belum mampu menuntaskan hak kepemilikan aset. Tentu saja ini menjadi masalah serius. ‘’Dari tahun ke tahun, permasalahan kepemilikan aset daerah dari kabupaten induk yaitu KabTapanuli Selatan masih mengambang, jadi inilah persoalan setiap tahunnya,’’ ujar Kepala Bagian Humas (Kabag Humas) Pemko Padangsidimpuan H Saeful Bahri, didampingi Kasubbag Humas Asrul dan Asisiten I, H Rahuddin Harahap Dijelaskannya juga, Pemerintah Kota Padangsidimpuan mendapatkan nilai Wajar Dalam Pengecualian (WDP) dari Badan Pemeriksa Keuangan (BPK) perwakilan Sumatera Utara. Penilaian tersebut diserahan Kepala Pelaksana Harian BPK Sumut Ayub Armali kepada Ketua DPRD Kota Padangsidimpuan H Azwar Syamsi Lubis SE, Wali Kota Drs Zulkarnaen Nasution MM, Kadis Pendapatan HYusran Nasution di kantor BPK Perwakilan Sumatera Utara, Medan, Senin (11/6) pukul 10:00. ‘’Dari penilaian BPK Sumut kemarin di Medan, Pemko Padangsidimpuan memperolehWDP dalam mengelola Anggaran Pendapatan Belanja Daerah (APBD) Tahun Anggaran 2011,’’ ujar Kabag Humas, Selasa (12/6). Dasar dari penilain itu, ungkapnya, sudah tiga bulan berjalan APBD untuk roda Pemko Padangsidimpuan tidak ada kendala. (c13)


Kepsek MAN 2 Padangsidimpuan Abdul Fattah Nasution memberikan ucapan selamat kepada Abriyantina Nasution.

Siswa MAN 2 P. Sidimpuan Juara III Olimpiade Fisika Tingkat Sumut PADANGSIDIMPUAN (Waspada): Siswa MAN 2 Padangsidimpuan, Apriyantina Nasution, kembali meraih prestasi sebagai juara ketiga pada olimpiade fisika SMA/MA/SMK se-Sumatera Utara yang diselenggarakan Universitas Negeri Medan, baru-baru ini. Pada 2011, MAN 2 Padangsidimpuan juga mengukir prestasi dengan meraih juara ketiga karya ilmiah pada Physics Festival dan juara pertama lomba poster fisika dengan tema Physics your mind tingkat SMA/MA se-Sumatera di Universitas Andalas. Menurut guru Pembina olimpiade fisika sekaligus pendamping, Rostina Sari Harahap, S.Pd. tim yang mengikuti lomba telah dipersiapkan sejak lama dan dibina dengan memberikan materi soal-soal fisika setara dengan soal olimpiade tingkat nasional. Kepala MAN 2 Padangsidimpuan, Abdul Fattah Nasution, S.Ag. M.Pd., mengungkapkan rasa syukur atas perestasi tersebut. Dia mengapresiasi sekaligus meminta kepada seluruh siswa MAN 2 Padangsidimpuan agar terus memacu prestasi dalam berbagai bidang ilmu, karena pembinaan olimpiade mata pelajaran merupakan salah satuprioritaspembinaan kegiatanyangadadiMAN2Padangsidimpuan dan sudah berlangsung secara berkesinambungan. (a26)

Guru Seharusnya Malu Tidak Produktif PADANGSIDIMPUAN (Waspada): Setiap guru seharusnya punya rasa malu jika tidak memiliki disiplin, tidak produktif, tidak berprestasi, tidak memiliki kepribaadian yang baik, sehingga tidak dapat menjadi sosok teladan bagi siswa apalagi bagi masyarakat. Demikian penegasan Kepala Bidang Mapenda Kanwil Kementerian Agama Provinsi Sumatra Utara Drs.H.Yulizar,MAg pada acara pelatihan Lesson Study berbasis MGMP dan Madrasah di MAN 2 Padangsidimpuan, baru baru ini. “Karena itu kita harus berupaya mengembangkan diri, sehingga memiliki integritas dan kompetensi diri yang baik, serta berbuat kebajikan, yang dapat menjadi contoh bagi siswa pada khususnya dan masyarakat umumnya,” ujarnya. Menurut Kepala MAN 2 Padangsidimpuan Abdul Fattah Nasution,M.Pd, pelatihan Lesson Study ini dilaksanakan selama dua hari di Aula MAN 2 Padangsidimpuan dengan narasumber dari Balai Diklat Keagamaan Medan Drs. M. Halomoan Lubis, M.Pd dan Drs. H. Yulizar, M.Ag dari Kanwil Kementerian Agama Provinsi Sumatera Utara. Lebih lanjut Ketua Panitia Drs. Jalaluddin Harahap didampingi Sekretaris Mahyuddin, MSi menjelaskan, kegiatan ini bertujuan untuk meningkatkan profesionalisme guru dalam pembelajaran yang berkualitas dan berkarakter. Praktik open class yang disajikan Asriana, M.Ag dan Mahyuddin, MSi dengan melibatkan siswa dan observer membuat acara ini semakin menarik sehingga peserta berjumlah 61 orang terdiri dari berbagai guru matapelajaran antusias mengikutinya. (a26)

Waspada/ Sarmin Harahap

BUPATI Madina HM Hidayat Batubara saat megukuhkan kepengurusan Badan Pemangku Adat (BPA) Madina di Pendopo Rumah Dinas Bupati Madina, Desa Parbangunan, Panyabungan.

Bupati Madina Mengharapkan BPA Lestarikan Adat-istiadat PANYABUNGAN(Waspada): Peranan Badan Pemangku Adat (BPA) yang bersifat independen dandinamismempunyaperanan strategis dan urgen dalam membangun Mandailing Natal (Madina) menuju masyarakat yang sejahtera, adil dan makmur. “BPA selain menjadi harapan dalam menggali, mengembangkan, dan melestarikan adat-istiadat, juga membawa kemajuan untuk akselerasi dalam pembangunansecarapositif,”ujarBupati Madina, HM Hidayat Batubara, SE saat pengukuhan Badan Pemangku Adat Madina Periode 2012 – 2017, Selasa (12/6) di RumahPendopoDinasBupati,Jalan Lintas Sumatera, Desa Parbangunan, Panyabungan. Karena itu, lanjut bupati, keberadaan BPA selaku mitra pemerintah harus turut serta memberikan kontribusi nyata dalam menjaga dan mengawal generasi muda tidak terkontaminasi dengan budaya luar, yang tidak sesuai dengan agama dan adat. Hadir pada kesempatan itu Sekda Madina Daud Batubara, para Asisten, Kadis, Kabag dan

Kaban, Muspida, Muspika, tokoh masyarakat, alim ulama, organisasi Alwashliyah, serta raja-raja seMadinabaikitudariMandailing Julu,MandailingGodang,danjuga dari Pantai Barat. Bupati berharap keberadaan BPA bisa menjadi filter dan juga penyeimbang di tengah arus globalisasi. Sehingga generasi muda sebagai penyangga negara tetap berada dalam tatanan kehidupan yang normal berdasarkan agama dan budaya. “Dengan kata lain saya tidak inginBPAinimenjadianakpanah. Tapi akan kita jadikan sebagai busur panah sekaligus sebagai alat pemersatu di Bumi Gordang Sambilan, untuk bergandengan tangan dan sama-sama bekerja mewujudkan cita-cita daerah,” ucap Hidayat Batubara. BPA Madina dikukuhkan berdasarkan SK Bupati Nomor: 224/399/K/2012, tanggal 12 Juni 2012 dalam bentuk presidium dengan sruktur Ketua BPA, Bgd MgrSoaloonNasution,Sekretaris, Mgr Gunung Nasution, dan Bendahara,SutanPalemangNasution. Sedangkan unsur patik paha

adalah, Sutan Batara Guru Nasution, patik ugari, Mgr Porkas Nasution, patik uhum, MgrTagor Rudang Sinabung Nasution, dan ujar-ujar ari, Mgr Pinayungan Pulungan. Ketua Pembina BPA Bupati MadinadengananggotaWakilBupati dan unsur Muspida, Penasehat Bgd Raja Batubara, Dewan Pemangku Adat, Mgr Gunung Mandailing Nasution. Pengukuhan BPA di tutup dengan acara pagelaran seni budaya Gordang Sambilan. Ketua BPA yang baru di lantik, Bgd Mgr Soaloon Nasution akrab disapa Raja Pidoli usai acara mengatakan siap lahir batin untuk mengemban tanggung jawab, dalam menjaga nilai-nilai luhur budaya dan adat istiadat yang di sinergikan dengan program-program pembangunan berdasarkan aspirasi masyarakat. Mgr Soaloon Nasution ini berharap BPA bisa bekerjasama dengan semua elemen masyarakatsecaraterbukamenjagapersatuan dan kesatuan, untuk percepatan pembangunan di segala aspekkehidupanmasyarakat.(c14)

Waspada/Sori Parlah Harahap

BANGUNAN Masjid Raya Gunungtua yang masih tahapan pengerjaan menelan dana miliaran rupiah, beberapa bagian luar kubah masjid hancur diterbangkan angin. Bangunan baru yang dikerjakan PT Waskita Karya ini baru tahapan pengerjaan dan belum diresmikan.

Menelan Anggaran Miliaran Rupiah

Kubah Masjid Agung Gunungtua Porak-poranda Ditiup Angin GUNUNGTUA (Waspada): Kubah Masjid Raya Gunungtua, milik Pemda Kabupaten Padanglawas Utara (Paluta) di Jalan Sisingamangaraja, Kel. Pasar Gunungtua, Kecamatan Padangbolak porak-poranda dan beterbangan ke berbagai arah setelah diterjang angin kencang disertai gerimis, baru-baru ini. Amatan Waspada, Selasa (12/6) bangunan Masjid Raya Gunungtua yang masih tahapan pengerjaan menelan dana miliaran rupiah, beberapa bagian luar kubah masjid diterbangkan angin ke berbagai arah. Bangunan baru yang dikerjakan PT Waskita Karya ini baru tahapan pengerjaan dan belum diresmikan. Pihak PT Waskita sudah menyelesaikan pengerjaan tiang hingga atap masjid. Sementara bagian dinding masih dilakukan tahapan pengecatan di sejumlah tempat. Masjid Raya Gunungtua dibangun berlantai dua. Lantai satu dijadikan tempat ruang serba guna, sedangkan untuk lantai dua dijadikan tempat ibadah. Bangunan masjid memiliki menara dengan tinggi 40 meter, dan luas taman 2.955,25 m2. Masjid itu memiliki luas bangunan 1.655,34 m2 dan berkapasitas sekira 1.100 jamaah. Tidak ada korban jiwa dalam peristiwa itu. Akantetapiakibatrusaknyakubahmasjidtersebut menjaditontonanwargasetempatdanparawarga yang hilir mudik yang melintas di sepanjang Jalan

Sisingmangaraja, tepatnya di depan SPBU Lingk I, Kelurahan Pasar Gunungtua. Bahkan ada beberapa warga mengabadikannya dengan menggunakan handpone saat melintas. Tokoh Pemuda Lingkungan I, Kelurahan Pasar Gunungtua, Luhut Harahap yang ketepatan berada di tempat itu, kepada wartawan menyesalkan adanya kejadian tersebut serta menuding PT Waskita selaku pelaksana proyek pembangunanMasjidRayakebangganmasyarakat Paluta pengerjaannya asal jadi dan diduga bahan kubah masjid itu menggunakan bahan yang tidak standar. “Biaya pembangunannya miliaran rupiah, baru angin kencang yang menimpanya sudah rusak. Sudah miliaran (rupiah) uang rakyat habis untuk membangunannya, lho,” kata Harahap. Humas PT Waskita Karya, Adi dikonfirmasi melalui Asisten Humas, Budi mengakui, kondisi yang terjadi itu. Namun pihak PTWaskita membantah bahwa kejadian tersebut akibat kelalaian dari perusahaan. “Kubah masjid itu dikerjakan oleh mitra kita. Kita hanya menerima saja, namun karena adanya kejadian ini kita berjanji akan segera memperbaiki kubah masjid yang rusak tersebut,” kata Budi. Terpisah, Kabid Cipta Karya dan Bidang Marga PU Paluta Ramlan ST, berjanji akan menindaklanjuti kejadian ini. (a35)

Puting Beliung Mengganas Di Silahisabungan SIDIKALANG (Waspada): Tiga desa di Kecamatan Silahisabunga Dairi, dilanda angin putting beliung,Minggu (10/6) sekira pukul 17.00. Akibatnya, sejumlah rumah warga dan bangunan sekolah serta cafe dan restoran mengalami rusak parah. Pantauan Waspada di lapangan, Senin (11/ 6) kerusakan terparah terlihat di SMA Negeri 1Silalahi.Bangunanatapsekolahitubeterbangan. Roberto Tampubolon wakil kepala sekolah SMA 1 Silalahi, kepada wartawan, Senin (11/6) mengatakan, akibat peristiwa itu, enam dari 12 ruang kelas sekolah tidak dapat terpakai. Namun dikatakan, peristiwa itu tidak menelan korban sebab kejadiannya sudah di luar jam sekolah. Disebutkannya, selain kerusakan pada ruang kelas siswa, kerusakan juga terjadi pada ruang tata usaha, kantor guru dan ruang tempat menyimpan barang-barang milik sekolah. Ruang kelas siswa terpaksa digabung dengan kelas lain, agar proses belajar mengajar tetap berjalan. Angin puting beliung juga menghantam satu

bangunan gedung pendingin yang ada di sekitar jalan Lae Pondom. Kepala Desa Silalahi 1, Tiopulus Sidebang, kepada wartawan menyebutkan, kerusakan terparah terdapat pada bangunan sekolah, dan untuk rumah warga banyak mengalami kerusakan termasuk atap kantor camat.Atapnya nyaris ludes diterbangkan angin. Kepala Desa Silalahi III, Rincon Situngkir menyebutkan, kerusakan pada atap rumah penduduk cukup banyak. Demikian juga dengan tempat usaha seperti cafe dan restoran yang ada disekitarDesaSilalahiIIIcukupbanyakmengalami kerusakan. Akibat peristiwa itu, banyak tempat usaha untuk sementara tutup. Dia mengatakan, para pemilik restoran lebih memilih menutup usahannya sementara, menunggu cuaca membaik, karena kebanyakan usaha cafe dan restoran milik warga berada pada bibir pantai, Danau Tobase. Di kecamatan itu menurut Situngkir, mencapai 75 unit rumah penduduk mengalami kerusakan. (a20)

PT Astra Penghijauan Di Dairi SIDIKALANG (Waspada): PT Astra Tbk melalui unit bisnis Auto 2000 melakukan penghijauan di Kabupaten Dairi dalam rangka peringatanharilingkunganhidup dan ulang tahun perusahaan ke55. Ir Martogi Siahaan, MM, Manajer Cabang Auto 2000 Medan Amplas, David Tuerah Manajer Auto 2000 Gatot Subroto dan Herry Liu Manajer Auto 2000 Jalan Sisisingamangaraja Medan menyerahkan 1.000 bibit pohon jenis sengon dan mahoni kepada delapan sekolah di Kec. Sumbul, Kamis (7/6). Martogi Siahaan di sela penanaman di pekarangan SMK Rismaduma menjelaskan, PT Astrra mempunyai tanggung jawab moral dalam menyelamatkan bangsa. Diantaranya diwujudkan melalui penghijauan. Bibit dimaksud, merupakan sebagian kecil dari rencana. Dalam waktu dekat, ditanam sebanyak 50 ribu di luar Medan. Ditambahkan, selain menyediakan lowongan kerja, PT Astra berkontribusi bagi penguatan ekonomi. Kegiatan terlaksana atas kerja sama dengan Lembaga Studi Pemantauan Lingkungan (LSPL) Medan. Poltak Simanjuntak, Direktur LSPL menjelaskan, penghijauan merupakan solusi

guna meminimalisasi efek pemanasan global. PaulusPandiangan SaingSPd Kepala SMK Rismaduma mengharapkanatensiperusahaantidak berhenti pada tahapan itu. Dia berharap, manajemen membuka diri untuk membekali siswa. PT Astra diminta menjadi lokasi prakerin (praktek kerja industri) sehingga alumni sekolah punya keahlian sesuai pasar kerja. Begitupun, dia menggaransi, akan

merawat tanaman tadi. Camat Sumbul Drs Hutur Siregar merespons positif kepedulian ini. Langkah tersebut selaras dengan komitmen Pemerinah Kabupaten Dairi. Bupati bersama tim telah banyak menanam bibitpohonsetiapdua minggu saat kunjungan kerja ke desa. Dia meminta, daerah ini mendapat porsi dalam alokasi dana CD damn CSR di waktu mendatang. (a20)

Waspada/Natar Manalu

MARTOGI Siahaan dan Henry Liu manajer Auto 2000 Medan menanam bibit sengon di lapangan SMK Rismaduma Kecamatan Sumbul Kabupaten Dairi sebagai wujud kepedulian meminimalisasi pemanasan global.

Waspada/Natar Manalu

ATAP Gedung SMA Negeri 1 Silalahi, Kecamatan Silahisabungan rusak berat akibat diterjang angin puting beliung.

BPBD Madina Setuju Pembukaan UPT Di Kecamatan PANYABUNGAN (Waspada): Kepala Badan Penanggulangan Bencana (BPBD) Kab. Mandailing Natal Rizfan Hutasuhut ST, menyatakan setuju terhadap usulan pembukaan kantor Unit PelaksanaTeknis(UPT)PenanggulanganBencana di kecamatan. Usulan itu, menurut Risfan, sangat realistis, mengingatpelaksanaanpenanggulanganbencana selama ini kendalanya salah satu faktor geografis. “Kita akui yang menjadi kendala selama ini dalam penanganan bencana memang lebih banyak karena faktor geografis. Terkait dengan ini kita juga sudah mengusulkan pembukaan UPTini,tapibelumadarealisasinya.Kitaberharap tahundepanpembukaanUPTbisadirealisasikan,” katanya di Panyabungan, Selasa (5/6). Menurutnya, dengan dibentuknya UPT, pola dangerakanpenanggulanganakansemakincepat dan sinergis serta penanganan lebih rinci pada

setiap kasus dan titik bencana. Lebih lanjut diungkapkannya bahwa selain kendala geografis, kelemahan penanggulangan bencana di daerah itu juga menyangkut alat dan sarana teknis. Kemudian anggota tim penanggulangan juga sangat membutuhkan pelatihan agar mereka bisabertugaslebihbaikdanmaksimaldalampenanganan setiap kali terjadi bencana. Seterusnya, dana juga menjadi faktor kendala, sehingga sangat dibutuhkan dana taktis yang siap pakai. “Jadi kalau sewaktu-waktu terjadi bencana, dana ini bisa kita pakai terutama sebagai tindakan darurat untuk makan korban atau pengungsi dan keperluan lainnya. Karena dana siap pakai tidak ada selama ini, sebagai tindakan pertama kita hanya bisa melakukan tindakan evakuasi dan pertolongan, padahal korban ini juga perlu makan, pakaian dan kebutuhan lainnya,” tambahnya. (a28)

Sumatera Utara


Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu Lusia Damayanti (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: Edward Thahir. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Armin R. Nasution. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Sinur Manik (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi). Wartawan Kota Medan: Umum: Zulkifli Harahap, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa,. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Dedek Juliadi, Hajrul Azhari Ritonga. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebingtinggi: Muhammad Idris, Abdul Khalik. Pematangsiantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanafiah, Hasanul Hidayat. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Bustanuddin, Wintoni. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan WASPADA dilengkapi dengan kartu pers. Tidak dibenarkan menerima uang dalam bentuk apapun. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan WASPADA tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Keluarga Korban Diintimidasi TANJUNGBALAI (Waspada): Kasus sindikat perdagangan gadis di bawah umur Tanjungbalai semakin terkuak. Pasalnya, seorang korban lainnya yang juga anak baru gede (ABG) datang ke Mapolres Tanjungbalai, Rabu (13/6), melaporkan peristiwa yang menimpanya. Dalam keterangannya kepada wartawan sebelum membuat pengaduan, korban Belia (nama samaran), 16, mengaku pernah dianiayaseoranglelakiparuhbaya di Ujungbatu, Rokan Hulu, Prov. Riau. Bukan itu saja, dia juga menjadi korban pemerkosaan setelah diberi minuman berisi pil tidur. Dituturkan Belia, kejadian berawal sekitar sebulan lalu. Saat itu teman sepermainannya Hera, 15,menghubungiviateleponagar datang ke daerah Ujungbatu, Rokan Hulu, Prov. Riau. Sebab, Hera mengaku disiksa oleh seseorang di salah satu kafe dan tidak dapat pulang ke Tanjungbalai. Tak berapa lama, Belia bersama dua temannya menemui seorang perempuan dipanggil EndangsesuaipetunjukHeraagar mau mengantar mereka ke Ujungbatu. Keesokan harinya, Belia dan temannya disuruh Endang datang ke rumahnya di komplekPelabuhanTeluknibung. Endang lalu memberangkatkan mereka dengan menyuruh seorang lelaki mendampingi ketiga gadis belia itu ke tempat yang dituju. Setelah satu malaman berada di perjalanan menggunakan bus, mereka lalu tiba di tempat

dimaksud. Sesampainya di sana, alangkah terkejutnya Belia dan temannya karena Hera yang dicari tidak berada di sana dan belakangan terdengan kabar sudah kembali ke Tanjungbalai. Beliapun kebingungan karena tidak mengetahui cara untuk pulang ditambah lagi mereka tidak memiliki uang. Belia kemudian meminta agar dipulangkan namun pemilik kafe malah marah dan memaksa mereka bekerja di warung remang-remang di tengah hutan melayani para tamu umumnya kaum adam. Tiga hari berada di sana, seorang lelaki yang telah berumur mengajak Belia makan ke luar kafe menjelang malam. Korban pun terpaksa menurutinya karenakondisinyasedang kelaparan sebab mereka tidak diberikan makan dan minum selama di sana. Ternyata bukan warung atau restoran yang dituju melainkan Belia dipaksa masuk ke kamar sebuah hotel. “Pertamaakutakmaumasuk, tapi ditarik-tarik dan dipukuli. Pas sudah di dalam, aku dikasih minum air putih dan setelah itu aku tak sadar lagi,” ujar Belia terisak sedudidampingikeduaorangtuanyaAbuBakarSiddikdanMuliani

Pangaribuan di kantor Polisi. Keesokan harinya, bagai disambar petir, Belia sangat terkejut saat melihat tubuhnya tanpa sehelai busana. Hatinya bertambah hancur begitu merasakan adayanglaindidaerahkewanitaan seperti perih dan sakit. Kapolres Tanjungbalai AKBP EP Sirait melalui Kasubbag Humas AKP Y Sinulingga dikonfirmasi Waspada mengatakan pihaknyasudahmenerimalaporan itu. Diterangkan, korban lainnya juga telah melapor sebelumnya dengan kasus dan diduga pelaku yang sama yakni Endang. Diintimidasi Terkait kasus perdagangan manusia(anak)yangkiniditangani Polres Tanjungbalai, sejumlah pelaku pernah mendatangi rumah keluarga korban dengan melakukan intimidasi dan ancaman. “Mereka datang ke rumah minta damai, tetapi karena aku tolak,merekamenggertakdengan nada yang menurutku adalah sebuah ancaman,” tutur kakak kandungkorbanYentiElsaHartati kepada Waspada, Selasa (12/6). Dikatakan Yenti, malam itu dia didatangi tujuh orang tamu yang mengaku sebagai orang yang telah dilaporkan ke Mapolres terkait kasus perdagangan anak (trafficking). Mereka meminta agar ditempuh jalur perdamaian dan memaksa agar mencabut laporan di kepolisian. Penasihat Hukum korban dari Lembaga Bantuan Hukum

Kecelakaan Kerja Masih Tinggi Di Labura AEKKANOPAN (Waspada): Tingkat kecelakaan kerja di Kab. Labuhanbatu Utara (Labura) masih tinggi. Bahkan sejak kabupaten itu dimekarkan ada empat kasus tergolong besar, dari empat kasus itu dua orang meninggal dunia dan dua orang mengalami buta mata. Hal itu dikatakan Kepala Dinas Sosial dan Tenaga Kerja LabuhanbatuUtaraMuhammad Asril S.sos, saat pelaksanaan Sosialisasi Keselamatan dan Kesehatan Kerja (K3) di gedung KNPI Labura, Rabu (13/6).”Untuk keempat kasus ini, semua korban sudah terlindungi dengan Jamsostek,” katanya. Menurutnya, pembudayaan K3 perlu dikembangkan secara terus-menerus, karena K3 mempunyaikorelasieratdenganupaya peningkatan mutu kerja dan pro-

duktivitas perusahaan, sehingga pelaksanaannya perlu dikoordinasikan dan dikonsolidasikan secara baik dan dinamis. “Pembudayaan K3 sangat perlu dikoordinasikan dan dikonsolidasikan, baik tingkat pemerintahan sebagaipembuatkebijakanmaupundiperusahaansebagai pihak yang membudayakannya,” kata Asril. Dikatakan, masalah K3 harus lebih dicermati secara seksama mencakupseluruhtahapan.Penerapan K3 harus menjadi syarat utama, terencana, terdokumentasi dan di kelola melalui sistem manajemen K3 yang terintegrasi serta dibarengi dengan sikap perilaku tenaga kerja yang yang memahami. “Sebagaimana disebutkan dalam pasal 87 ayat 1 UU RI No 13 tahun 2003, setiap perusahaan

wajib menerapkan Sistem Manajemen Keselamatan dan Kesehatan Kerja (SMK3) yang terintegrasi dalam sistem manajemen perusahaan,” jelas Asril. Untuk itu, katanya, Dinas Sosial danTenaga Kerja Labura telah dan terus berupaya untuk melaksanakan pengawasan dan penegakan hukum serta mendorong kesadaran pimpinan perusahaan dan tenaga kerja melakukan peningkatan terhadap pemenuhan syarat-syarat K3. Pelaksanaan Sosialisasi Keselamatan Kerja (K3) diikuti 24 peserta terdiri dari dua orang mewakili perusahaan dari 12 perusahaan yang ada di Labuhanbatu Utara.NarasumberIrRoslianiLubis MAP,pengawastenagakerjaSumut danRobbySipayungST,pengawas tenaga kerja dari Dinas Sosial dan Tenaga Kerja Labura.(c08)

Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874.

� Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan: hitam-putih Rp. 33.000,-, berwarna Rp. 90.000,Ukuran kolom: 40,5 mm. E-mail Iklan: Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

PDIP Surati Bupati Labusel Terkait Lapangan MHB KOTAPINANG (Waspada):Terkait rencana Pemkab Labuhanbatu Selatan (Labusel) untuk membangun lapangan MHB, Kotapinang, melalui proyek APBD 2012, DPC PDI-P menyurati bupati mengenai status lahan itu yang masih bersengketa dengan ahli waris Alm. Tengku Mustafa. Dalam surat No. 51/Ex/26.02/VI/2012 tertanggal 6 Juni 2012 yang ditandatangani Sekretaris DPC PDI-P Labusel Simson Sibarani dan Wakil Ketua Bidang Hukum dan Advokasi Rusdin Hasibuan itu Bupati diminta untuk tidak melakukan pembangunan di atas seluruh lahan milik Alm.Tengku Mustafa (Sultan Kotapinang) sebelum ada keputusan tetap dan mengikat dari pengadilan. “Kita mendapat mandat tertulis dari ahli waris Tengku Mustafa yakni T. Idrus Mustafa als Aizuz Thafa Hamid dan T Musnillah pada 10April2012laluuntukmengawasiseluruhasetsampaiselesainyaperkara pengadilan. Sebab seluruh aset eks Kesultanan Kotapinang kini masih bersengketa,” kata Simson dikonfirmasi Waspada, Selasa (12/6). Menurutnya, pemberitahuan itu mereka sampaikan, sehubungan rencana pembangunan lapangan MHB yang ditenderkan di Dinas Pasar Pemkab Labusel dengan pagu anggaran Rp2,1 miliar pada tahun ini. Simson mengatakan, jika Pemkab tetap ngotot membangun lapangan itu, pihaknya akan mengambil sikap tegas untuk menghentikannya. “Kita harus sama-sama menghargai proses hukum yang berjalan,” katanya. Kabag Humas Milhan Harahap yang dikonfirmasi mengaku belum tahu mengenai surat tersebut. Namun diakuinya tahun ini lapangan tersebut akan dibangun. Sedangkan mengenai putusan MA atas sengketa tersebut, menurut Milhan saat ini sedang dijemput Pemkab. “Dasar kita nanti ya putusan pengadilan itu,” katanya. (c18)

Waspada/Rasudin Sihotang

PETUGAS Kepolisian Resort Tanjungbalai sedang menanyai korban perdagangan anak, Belia, saat akan membuat pengaduan didampingi kedua orangtuanya. (LBH)Tri Sila Musa Setiawan SH, didampingi Amri SH, dan Ismail SH, juga didatangi pelaku perdagangan manusia. Kedatangan mereka meminta agar ditempuh jalur kekeluargaan dan tidak sampai ke ranah hukum. “Kita tegaskan kita tidak ingin berdamai, kasus ini harus dilanjutkan secara hukum,” ujar Musa. Kapolres Tanjungbalai AKBP EP Sirait dikonfirmasi melalui

Kepala Unit Ruang Pelayanan Khusus (RPK) IptuTettyW Pohan terkait penetapan tersangka belum dapat memberikan keterangan.Kepolisianberdalihmasih melakukan pemeriksaan dan memintai keterangan sejumlah saksi. Sebelumnya, lima orang didugasindikatperdagangananak diperiksaintensifolehPolisiWanita (Polwan) di Ruang Pelayanan

Khusus (RPK) Polres Tanjungbalai, Rabu (6/5) berlangsung dari pagi hingga sore. Pemeriksaan itu terkait pengaduan Mawar, 15, (bukan nama asli) yang didampingi kakaknyaYenti Elsa Hartati dan penasehat hukum karena menjadi korban perdagangan anak. Korban diduga dibawa lari ke Ujung Batu, Kab. Rokanhulu, Provinsi Riau tanpa izin orangtua oleh sindikat itu. (a32)

Jembatan Amblas, Kejari Kisaran Tunggu Hasil Uji Fisik Bangunan KISARAN (Waspada): Untuk mengungkap apakah ada penyelewengan pembangunan konstruksi jembatan Kec. Rawangpancarga yang amblas dan belum diperbaiki, Kejari Kisaran menungguhasilujifisikyangakandilakukanDPRD dan Pemkab Asahan. Demikian Kasi Intel Kejari Kisaran Rudhy Parhusip, ditemui Waspada, Rabu (13/6) di ruang kerjanya. Menurutnya, dari hasil itu diketahui dengan jelas penyebab runtuhnya jembatan tersebut. “Banyakfaktorpenyebabruntuhnyajembatan, bisa karena usia, atau kapasitas kendara yang melewati melebihi tonase, boleh jadi adanya penyelewengan saat pembangunan sehingga jembatan tidak sesuai bestek,” ujar Rudhy. Karena itu, kata Rudhy, hasil uji fisik itu sangat membantu dalam penyelidikan penyebab runtuhnya bangunan, karena dalam hal ini pihaknyatidakbisamenduga-dugatanpadiketahui penyebab dengan jelas. “Kita berharap Pemkab Asahan segera melakukan uji fisik bangunan, sehingga diketahui dengan jelas hasilnya. Sehingga Kejari bisa

melakukan penyidikan dalam masalah ini,” ujar Rudhy. Belum Jelas Sampai saat ini belum jelas kapan Pemkab Asahan akan melakukan uji fisik dan akan memperbaiki jembatan, karena Kabag Humas Pemkab Asahan belum memberikan keterangan dengan jelas, dan saat dihubungi Waspada belum berhasil dengan alasan rapat. “Tunggu bentar ya, saya masih rapat,” ujar Kabag Humas. Komisi D DPRD Asahan Syamsul Qodri Marpaung mendesak Pemkab Asahan untuk melakukan uji fisik bangunan. “Karena itu, dalam masalah ini harus ada yang bertanggung jawab, dan dilakukan pengusutan sehingga penyebab amblasnya jembatan diketahui dengan jelas,” ujar Syamsul. Jembatan penghubung antar Desa Pasar IV dan PasarV, Kec. Rawangpancaarga, amblas saat satu truk bermuatan sawit melintas, Jumat (1/ 6) lalu. Hampir dua pekan jembatan itu belum diperbaiki, dan belum ditentukan siapa yang akan bertanggungjawab.Sementarawilayahitu penghasil padi dan sawit, sehingga perekonomian masyarakat tersendat. (a15)

Mayat ABK KM Muara Jaya Ditemukan Di Sungai Asahan

Penerbit: PT Penerbitan Harian Waspada

� Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109.

Kamis 14 Juni 2012

Sindikat Perdagangan ABG Semakin Terkuak

Hubungi kami

� Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385.


Waspada/Syahri ilham Siahaan

PESERTA Sosialisasi Keselamatan Tenaga Kerja(K3) terlihat serius mendengarkan penjelasan dari narasumber tentang penerapan keselamatan tenaga kerja.

12 Hari Ops Simpatik

276 Tilang, 2.046 Teguran KISARAN(Waspada):Selama 12 hari Opersai Simpatik Toba 2012 Sat Lantas Polres Asahan telah mengeluarkan sedikitnya 276 tilang, dan 2.046 teguran. Sedangkan untuk jumlah laka 23 kasus 11 orang tewas. Kapolres Asahan AKBPYustanAlpiani,dikonfirmasiWaspada melaluiKasatLantasAKPEkoHartanto, Rabu (13/6) menuturkan selama12 hari Ops Simpatik (1-

12 Juni) untuk laka lantas sebanyak 23 kasus, dengan jumlah korban yang tewas sebanyak 11 orang,lukaberatempatorang,luka ringan39orangdantotalkerugian materialsebanyakRp38jutalebih. “Sedangkan mayoritas laka lantas dan melanggar peraturan adalah sepeda motor. Oleh sebab itu diharapkan masyarakat untuk lebih mematuhi lalu lintas dan safety riding, sehingga laka lantas

bisa ditekan,” ujar Eko. Untuk merangsang masyarakat dalam mematuhi lalu lintas, SatLantasmemberikanpenghargaan kepada pengguna jalan seperti memberikan bunga dan jaket. “Kita berharap masyarakat untuklebihresponkarenadengan mematuhi lalu lintas akan menciptakan disiplin dan akan menguntungkan masyarakat itu sendiri,” ujar Eko. (a15)


POLWAN Sat Lantas Polres Asahan sedang melakukan patroli di jalan Imam Bonjol saat Operasi Simpatik Toba 2012, dan yang patuh lalu lintas akan penghargaan dalam bentuk bunga.

TANJUNGBALAI (Waspada) : Anak buah kapal (ABK) KM Muara Jaya yang sempat dinyatakan hilang ditelan arus sungai Asahan sekitar dua dua hari lalu telah ditemukan, Rabu (13/6) sekira pukul 04:00. “Selain Basarnas Tanjungbalai-Asahan, kita juga mengerahkan tiga kapal patroli untuk melakukan pencarian dan ternyata tepat pukul empat korban ditemukan dalam keadaan telungkup di dermaga PT Timur Jaya,” ungkap Kasat Pol Air PolresTanjungbalai AKP Edi Plantino melalui staf Ipda Jumadi. Diterangkan, upaya pencarian secara berkesinambunga telah dilakukan sejak pertama kali kejadian Senin (11/6) malam. Namun baru membuahkan hasil setelah tiga hari pencarian dan langsung mengevakuasi jenazah ke RSUD Kota Tanjungbalai. Dikatakan, tidak terlihat tanda-tanda mencurigakan dari tubuh korban yang diduga akibat pembunuhan. Dan kesimpulan sementara, korban tewas akibat kecelakaan. Kapos Basarnas Tanjungbalai-Asahan Armei SP Siregar juga membenarkan penemuan mayat itu. Seorang anak buah kapal (ABK) KM Muara Jaya diduga menghilang ditelan derasnya arus Sungai Asahan tepatnya di Lingk. I, Kel. Kapias Pulau Buaya, Kec. Teluknibung, T.Balai, Selasa (11/6) malam.

Kronologi kejadian, korban Ahmad Purwadi, 22, sedang asyik makan mi instan bersama dua temannya saat istirahat setelah bekerja memperbaiki kapal. Usai makan bersama, ketiganya pergi mandi dan berencana lomba adu cepat berenang menuju seberang sungai yang cukup lebar itu. Tak berapa lama, kedua rekannya yang telah tiba di seberang heran melihat korban yang tak kunjung muncul kendati telah ditunggu beberapa menit. Merasa ada yang aneh, mereka yang curiga kemudian melakukan pencarian dan memanggilmanggil korban yang tinggal di daerah Jampalan, Kec. Simpangempat, Kab. Asahan itu. Namun sayang, pria lajang yang telah bekerja sekitar 15 tahun sebagai nelayan itu tetap saja tak muncul. Keduanya kemudian meminta bantuan masyarakat sekitar dan Tim Basarnas Tanjungbalai-Asahanuntukmelakukanpenyisiran korban. Menurut sepupu korban, Arifin, 28, yang juga berprofesi sebagai nelayan, adiknya itu baru saja melangsungkanpertunangandengangadistercinta sebulan lalu. Dia menduga korban hanyut terbawa arus yang saat itu air cukup deras sebab terjadi pasang surut laut. Dijelaskanpriaberkulithitammanisitu,Kapten Kapal pencari ikan GT 30 No. 2597 PPb didampingi abang kandung korban Irwansyah telah melapor secara resmi ke pihak Kepolisian. (a32/a14)

Balapan Liar Makin Meresahkan RANTAUPRAPAT (Waspada): Balap liar di Jalan Imam Bonjol, Rantauprapat, Kab. Labuhanbatu kian meresahkan. Aksi puluhan pengendara sepedamotordenganmenggunakanknalpotblong hingga menjelang pagi itu hanya berjarak sekira 350meterdarirumahdinasKapolresLabuhanbatu. Kelakuan puluhan oknum remaja tanggung yang seharusnya ditertibkan oleh polisi tersebut diakui sangat mengganggu ketenteraman warga. “Terus terang, kami sangat terganggu,” ujar warga ImamBonjolyangtidakingindisebutkannamanya. Kini, sejak pukul 24:00-04:00 dinihari, pemuda dengan mengendarai sepedamotornya adu nyali kecepatan tanpa dilengkapi baju pengaman di jalan Imam Bonjol. Aksi tidak terkendali itu jelas sangat mengganggu ketenangan warga. “Tidak bisa kami tidur nyenyak, suara knalpot bolongnya memekakkan telinga. Parahnya, sampai pagi baru anak-anak itu meninggalkan lokasi dari Jalan Imam Bonjol,” ujar warga.

Bukan hanya mengganggu ketenangan warga untuk istirahat, aksi balapan liar di sekitaran jalan yang kini sudah masuk dalam Kawasan Tertib Lalulintas (KTL) itu telah merenggut beberapa nyawawarga,namuntidaksatupunyangdiketahui bertanggungjawab. Disinggung tentang upaya yang dilakukan polisi lalulintas setempat, warga mengakui hanya sebatas penanganan sementara, itupun setelah warga merasa resah dan disorot sejumlah media massa. “Dari dulunya gitu, apalagi akhir-akhir ini semakin menjadi jumlah pembalapnya, hendaknya jangan setelah ada korban baru ada yang jaga,” sindir warga lainnya. “Kami sudah melaksanakan patroli rutin dan penindakan pada jam-jam rawan balap liar di jalan Imam Bonjol dan jalan baru, kami sweeping menggunakan unit roda empat yang kami miliki,” ujar Kasat Lantas Polres Labuhanbatu AKP Faidil, Senin (11/6). (c07)

Ekonomi & Bisnis B5 Pedasnya Harga Cabai Giliran Sayur Pemicu Inflasi Pedagang Untung WASPADA Kamis 14 Juni 2012

KOMODITAS bahan pokok seperti cabai kembali mengalami kenaikan. Bahkan, dalam sepekan lalu, harga cabai di beberapa pasar tradisional Medan makin ‘pedas’ lantaran mengalami kenaikan hampir mencapai 50 persen dari harga sebelumnya. Saat di telusuri, tumpukan cabai pun terlihat di salah kios pedagang di Pusat Pasar Medan, Rabu lalu. Harga cabai di sejumlah pedagang Pusat Pasar saat ini naik hingga mencapai Rp 38.000 per kg, akibat makin sedikitnya pasokan lantaran tingginya curah hujan yang membuat hasil panen cabai menurun jumlah dan kualitasnya. Naiknya harga cabai membuat pedagang mengeluh. Omset pedagang turun, keuntungan sekaligus menipis. Keluhan itu seperti yang disampaikan Tarigan, pedagang cabai di Pusat Pasar Medan. Pria berusia 41 tahun tersebut mengatakan naiknya harga cabai pada beberapa hari belakangan membuat turunnya omset pedagang karena banyak masyarakat konsumen mengurangi pembelian cabai. “Omset berjualan sekarang ini menurun drastis, sampai 50 persenan, tapi mau bagaimana lagi memang dari petani sudah naik, kita pun tidak bisa berbuat banyak,” ujarnya sembari menyusun dagangan cabainya. Tarigan mengaku kenaikan harga yang cukup tinggi terjadi pada cabai merah dari Rp20.000 jadi Rp38.000 per kg, untuk cabai rawit dari sebelumnya Rp13.000 jadi Rp25.000 per kg, sedangkan cabai hijau tidak terlalu meningkat kenaikannya, harganya hanya Rp15.000 per kg. Sejak terjadi kenaikan, Tarigan mengaku bukannya mendapatkan keuntungan, melainkan penurunan pendapatan atau omset penjualan cabai. Dia mengungkapkan, setiap pembeli dari kalangan usaha warung nasi yang biasanya membeli cabai satu kg, menjadi kurang dari satu kg setiap hari. Bahkan pembelian cabai dari kalangan ibu rumah tangga, mengalami pengurangan rata-rata 1 ons sampai dengan 2,5 ons. “Jadi kenaikan harga bukan membuat untung pedagang, tapi pendapatan jadi turun,” katanya. Naiknya harga cabai tersebut ternyata juga merugikan para pemilik usaha rumah makan di Medan. Tingginya harga jual cabai yang mencapai Rp38.000 per kg membuat para pengusaha rumah makan di Medan banyak yang mengeluh. Mereka terpaksa harus mengurangi pemakaian cabai sebagai menu utama masakan, agar bisa menerapkan harga tetap. “Mau tak mau kita harus mengurangi pemakaian cabai sebagai menu masakan, jika kenaikan bahan utama produksinya diimbangi dengan dinaikkannya harga jual dipastikan akan mengurangi pelanggan,” ujar Buyung, pemilik rumah makan Padang yang berlokasi di Jalan Karya Menurutnya, meskipun harga bahanbahan pokok usahanya seperti cabai merah meningkat tajam, namun pihaknya tetap menjual nasi Padang kepada masyarakat

RENCANA kenaikan harga bahan bakar minyak sepanjang April lalu setidaknya memantik spekulasi yang berujung pada inflasi. Walau kemudian pemerintah membatalkan rencana itu,

Petani cabai pun merasa lega, kenaikan harga cabai hingga belasan ribu sedikit membuat petani gembira. Soalnya dengan lahan satu hektar petani bisa menghasilkan 40 kg per minggu atau Rp 600.000. Andre Petani cabai Desa Batubara

dengan harga normal. Buyung mengatakan, tingginya harga cabai ini membuat makanan khas Padang yang terkenal pedasnya, harus menambahkan merica agar tak mengurangi rasa pedas khas Padang. Sementara kebingungan akan naiknya cabai juga dialami para ibu rumah tangga di Medan. Saat ditemui, Lina, salah satu warga Jalan Halat Medan yang sedang berbelanja cabai di Pusat Pasar mengatakan, kenaikan harga cabai ini sangat berpengaruh pada perekonomian masyarakat khususnya ibu rumahtangga. Di tempat terpisah, seorang petani cabai yang bermukim di Desa Batubara Kecamatan Payung, Andre mengaku, kenaikan harga cabai saat ini hanya dipengaruhi oleh masa panen yang telah berakhir, sehingga pasokan tidak banyak. Untuk kondisi cuaca yang beberapa waktu ini buruk, tidak ada mempengaruhi. “Cabainya naik, karena belum panen. Pasokan tidak banyak, bukan karena kondisi cuaca,” jelasnya saat dihubungi lewat telepon. Pada April lalu petani cabai baru saja selesai panen, dan saat ini petani baru memasuki masa tanam. Menurutnya, kenaikan harga cabai akan bertahan hingga satu bulan kedepan. Petani cabai pun merasa lega, kenaikan harga cabai hingga belasan ribu sedikit membuat petani gembira. Soalnya dengan lahan satu hektar petani bisa menghasilkan 40 kg per minggu atau Rp 600.000. Andre mengatakan dengan harga cabai naik level, masyarakat didaerahnya berlomba-lomba menanam seluas mungkin. “Petani yang mengharap stabil harga hasil pertanian jangan seperti main judi, terkadang untung, kadang buntung. Pemerintah diharapkan stabilisasi harga cabai di pasar lelang tradisional,” ujarnya. � Dio Utama Nasution

dan inflasi tetap terkendali, namun pergolakan harga di pasar tak semua bisa diatasi. Itu bisa dilihat dari fenomena inflasi yang dikeluarkan BPS untuk Sumut sepanjang Mei lalu. Naiknya harga buahbuahan dan sayuran sepanjang Mei ternyata memicu inflasi di Medan yakni 0,11 persen. Meski begitu, dibanding dengan bulan sebelumnya angka inflasi ini cenderung lebih rendah dari inflasi April 0, 20 persen. Apa saja yang mendorong inflasi tersebut? Jeruk, misalnya. Mengalami kenaikan harga 10, 45 persen. Begitpula dengan sayur jenis sawi hijau naik 9,32 persen serta ketupat/lontong sayur naik 9,46 persen. Bahkan cabai merah yang sepanjang Mei belum begitu berfluktuasi mengalami kenaikan hingga 3,64 persen. Selanjutnya tarif angkutan udara naik 6,16 persen, gula pasir 1,77 persen, dan sewa rumah naik 0,57 persen ikut andil menyumbang inflasi. Sepanjang Mei dari empat kota besar yang dipantau indeks harga konsumennya Padangsidimpuan juga mengalami inflasi 0,22 persen, sementara dua kota lainnya mengalami deflasi yakni Sibolga sebesar 0,04 persen dan Pematangsiantar sebesar 0,49 persen. Dengan demikian, Sumut pada Mei 2012 inflasi 0,05 persen. Terjadinya inflasi Mei 2012 juga menyebabkan laju inflasi year on year (Mei2012 terhadap Mei 2011) masingmasing kota yakni Medan 5,13 persen, Pematangsiantar 6,07 persen, Sibolga 6,03 persen, dan Padangsidimpuan 5,29 persen. Kejadian nyaris serupa sudah terjadi Maret lalu. Dalam

Waspada/Armin Nasution

PEDAGANG sayur di Jl. Soetomo Medan terlihat menunggu datangnya pembeli sambil beraktivitas seperti biasa, kemarin. Harga cabai sempat mereka jual hingga mendekati Rp40 ribu dan itu menyebabkan inflasi. periode tersebut Badan Pusat Statistik (BPS) mencatat inflasi Maret 0,07 persen. Laju inflasi naik tipis bila dibandingkan Februari yang sebesar 0,05 persen. Sementara inflasi tahun kalender sebesar 0,88 persen dan year on year 3,097 persen. Untuk inflasi inti sebesar 0,20 persen, inflasi dari harga yang diatur pemerintah sebesar 0,24 persen dan deflasi pada komponen harga bergejolak 0,41 persen. Kepala BPS Suryamin menjelaskan penggerakan laju inflasi adalah kenaikan harga cabai rawit dan cabai merah. “Ini karena kurangnya pasokan dari sentra produksi,” katanya. Kenaikan harga cabai rawit mencapai 10 persen hingga 75 persen. Sedangkan kenaikan harga cabai merah berkisar 10

persen hingga 56 persen. Sementara penyumbang deflasi adalah beras. Harga beras turun karena panen raya. Selain beras, harga daging ayam ras dan telur ayam ras juga turun. Tomat sayur juga menjadi penyumbang deflasi pada Maret lalu. Itu untuk kondisi Maret. Lalu sepanjang Mei pun harga sayur terus berfluktuasi bahkan cenderung tinggi. Sementara kenaikan harga cabai yang sempat mendekati Rp40 ribu per kg akan dihitung indeks harganya per Juni. Jadi 1 Juli nanti akan kelihatan apakah harga cabai tersebut masih mendorong inflasi ke level yang lebih tinggi. Kenaikan harga cabai ini tidak saja di Sumut. Kenaikan juga berlangsung di Sulawesi Utara. Secara umum April di

wilayah itu terjadi karena adanya kenaikan indeks pada tiga kelompok pengeluaran yakni kelompok bahan makanan 5,65 persen, kelompok perumahan, air, listrik, gas dan bahan bakar sebesar 0,15 persen dan kelompok transpor, komunikasi dan jasa keuangan sebesar 0,04 persen. Kelompok bahan makanan yang paling banyak memberi kontribusi inflasi pada April 2012 terutama komoditas cabai rawit yang mengalami kenaikan harga rata-rata 79,12. Selain cabai rawit tomat sayur juga naik 36,55 persen selama April 2012, memberi sumbangan inflasi sebesar 0,138 persen, bawang merah naik harga 24,82 persen dengan inflasi sebesar 0,1281 persen, beras sekitar satu persen dengan sumbangan inflasi 0,0967

persen. Dampak kenaikan harga tiga kelompok pengeluaran tersebut menjadikan wilayah tersebut sebagai pencipta inflasi tertinggi dibandingkan delapan kota lainnya di wilayah Sulawesi. Kondisi serupa terjadi di Jawa Timur. Naiknya harga cabai rawit 40 persen dari Rp17.300 per kg menjadi Rp28.450 sempat membuat daerah itu menghadapi tekanan inflasi. Ke depan harga sayur mayur masih akan berfluktuasi. Kali ini giliran cabai yang meroket. Selanjutnya akan muncul komoditas lain. Ini terjadi selain minimnya pasokan juga cuaca ekstrim yang masih terus melanda Sumut. � Armin Nasution

Hitung-hitungan Inflasi Sepanjang Tahun

Harga Buah Merangkak Naik

KOMODITAS yang paling cepat mendorong inflasi sepanjang tahun ini sebenarnya kalau harga bahan bakar minyak naik. Namun sepertinya itu belum akan terjadi. Pemerintah malah sibuk kalkulasi menaikkan tarif dasar listrik. Hitung-hitungan pemerintah laju inflasi pada tahun ini bisa lebih rendah dari 5,3 persen jika pemerintah tidak jadi menaikkan harga BBM bersubsidi. Asumsi inflasi di APBN P 2012 sebesar 6,8 persen itu sudah memasukkan kenaikan harga BBM Rp1.500 per liter. Kalau itu tidak jadi dilakukan maka realisasi inflasi tahun ini bisa di bawah 5,3 persen. Pemerintah yakin naik atau tidaknya harga BBM bersubsidi tidak akan mengganggu stabilitas fiskal tahun ini karena APBN P 2012 dalam keadaan sehat karena pemerintah sudah memiliki cadangan yang cukup untuk merespon gejolak yang mungkin terjadi. Sasaran inflasi 2013 dan 2014 sebesar 3,5 - 5,5 persen dan inflasi 2015 sebesar 3 - 5 persen, yang diputuskan setelah berkoordinasi dengan Bank Indonesia. Untuk laju inflasi tahun ini akan lebih besar dibanding 2011 selain karena kenaikan harga komoditas pangan internasional, juga disebabkan rencana pemerintah menaikkan harga BBM bersubsidi serta pengenaan tarif pajak BBM lima persen. Namun, berbagai hal positif juga berhasil menahan laju inflasi seperti stabilnya nilai tukar rupiah, kebijakan mitigasi gejolak harga pangan, integrasi sistem logistik, naiknya investment grade, dan kebijakan pemerintah untuk menyiapkan cadangan fiskal untuk pangan. Hitungan Bank Indonesia pun sebenarnya tidak berbeda jauh. Kalau pemerintah nekad menaikkan harga BBM maka inflasi 2012 bisa mencapai 7,1 persen. Menurut perkiraan otoritas moneter itu inflasi 4,4 persen sepanjang tahun tercapai kalau tidak ada apa-apa. Tetapi ketika harga BBM naik itu bisa menjadi 6,8 persen sampai 7,1 persen. Apabila ada kenaikan harga BBM sebesar Rp1.000 per liter maka terjadi inflasi sebesar 6,8 persen, sedangkan apabila ditetapkan subsidi konstan sebesar Rp2.000 per liter maka terjadi inflasi 7,1 persen. Peningkatan inflasi juga berasal dari dampak langsung kenaikan harga BBM dan dampak lanjutannya ke barang-barang lain. Risiko inflasi sulit untuk dihindari, tapi dalam perspektif jangka menengah panjang kebijakan BBM akan positif dalam menjaga prospek kesinambungan fiskal, meningkatkan efisiensi perekonomian dan memperkuat kinerja neraca pembayaran. Bank Indonesia menempuh kebijakan yang memadai dan terukur agar inflasi kembali pada sasarannya, dengan tetap memperhatikan dampaknya terhadap perekonomian secara keseluruhan. Kebijakan tersebut antara lain dengan

MESKI aturan baru yang memperketat impor buah dan sayur akan diberlakukan 15 Juni 2012 mendatang, namun harga buah yang dijual di beberapa pasar tradisional Kota Medan telah mengalami kenaikan. Pantauan Waspada, Selasa (12/6), para pedagang mengaku hampir semua jenis buah yang dijual mengalami kenaikan Rp2.000 hingga Rp5.000 per kg. Hal ini seperti yang diungkapkan Adi, pedagang buah di Pusat Pasar Medan. Dikatakannya, hampir semua jenis buah mengalami kenaikan seperti yang terjadi pada buah naga merah harga sebelumnya Rp30. 000 naik menjadi Rp35.000 per kg, buah naga putih sebelumnya Rp15.000 naik menjadi Rp20.000 per kg, mangga udang sebelumnya Rp18.000 naik menjadi Rp20.000 per kg, buah apel harganya tetap yakni Rp20.000 per kg. Ditambahkannya, karena naiknya harga membuat omset penjualan turun. “Kenaikannya mempengaruhi minat beli masyarakat. Orang jadi malas makan buah, paling hanya buahbuah segar yang biasa,” ujarnya. Hal yang senada juga dikatakan Iwan, pedagang buah di Pasar Halat Medan. Dia mengaku, untuk harga buah yang paling naik adalah buah jeruk lokal maupun buah jeruk impor, seperti yang terjadi saat ini harga jeruk madu Berastagi sebelumnya Rp10.000 naik menjadi Rp20.000 per kg, buah jeruk sankis sebelumnya Rp18.000 naik menjadi Rp20.000 per kg, dan anggur lokal yang biasanya dijual Rp 35.000 kini naik menjadi Rp 40.000 per kg. Dikatakannya meski harga buah beranjak naik namun daya beli masyarakat belum menurun. “Permintaan masih ada, belum ada penurunan, meski harganya telah naik,” ujarnya. Menurutnya, banyak faktor yang membuat harga buah naik, satu diantaranya adalah buah yang dijual tidak pada musim panennya. Ketika disinggung mengenai adanya aturan baru yang memperketat impor buah dan sayur akan diberlakukan, Iwan mengaku tidak memahami persoalan kebijakan pemerintah yang akan memperketat impor sayur

Apabila ada kenaikan harga BBM sebesar Rp1.000 per liter maka terjadi inflasi sebesar 6,8 persen, sedangkan apabila ditetapkan subsidi konstan sebesar Rp2.000 per liter maka terjadi inflasi 7,1 persen. mengoptimalkan kebijakan dari suku bunga, nilai tukar, pengelolaan likuiditas dan kebijakan makroprodensial. Dampak kebijakan subsidi BBM ke inflasi masih memungkinkan ditekan lebih rendah dengan menerapkan subsidi ke sektor transportasi dan komunikasi kebijakan yang baik untuk meminimalkan efek psikologis. Pemerintah dalam RAPBN-P 2012 mengubah asumsi laju inflasi menjadi 7,0 persen dari sebelumnya dalam APBN sebesar 5,3 persen terkait kemungkinan adanya penyesuaian harga BBM yang seharusnya April. Sementara Bank Pembangunan Asia (ADB) memprediksi inflasi Indonesia tahun ini sekira 4,5 persen. Prediksi ADB tersebut tentu belum memperhitungkan kebijakan pembatasan konsumsi bahan bakar minyak bersubsidi. Inflasi 2012 memang harusnya cenderung kecil karena harga komoditas dunia akan turun. Sebenarnya yang sangat menggangu sasaran inflasi adalah ketika rencana kenaikan bahan bakar bergulir kencang. Di April saja secara nasional efeknya bisa mendorong inflasi 0,21 persen. Ini merupakan tertinggi sejak empat tahun terakhir. Dari perhitungan BPS, infl0asi yang terbentuk pada periode Januari-April 2012 (inflasi tahun kalender) menjadi sebesar 1,09 persen, sedangkan dibandingkan periode yang sama tahun lalu (yoy) terbentuk inflasi sebesar 4,50 persen. Kalau kita lihat dari 66 wilayah yang disurvei oleh BPS, 52 kota mengalami inflasi, 14 kota mengalami deflasi Berdasarkan catatan BPS, pada April 2007, 2009, dan 2011, terjadi deflasi berturut-turut -0,16 persen, -0,31 persen, dan -0,31 persen. Sementara pada April 2008 dan 2010 terjadi inflasi 0,57 persen dan 0,15 persen. Berdasarkan kelompok pengeluaran, inflasi bulan lalu terutama didorong oleh inflasi pada kelompok makanan jadi, minuman, rokok dan tembakau 0,62 persen. � Armin Nasution

Waspada/Armin Nasution

PEDAGANG dan pembeli berinteraksi di pasar buah Pusat Pasar Medan. Hingga saat ini harga buah terus mengalami kenaikan.

Hampir semua jenis buah mengalami kenaikan seperti yang terjadi pada buah naga merah harga sebelumnya Rp30.000 naik menjadi Rp35.000 per kg, buah naga putih sebelumnya Rp15.000 naik menjadi Rp20.000 per kg, mangga udang sebelumnya Rp18.000 naik menjadi Rp20.000 per kg. Iwan Pedagang buah di Pusat Pasar

dan buah-buahan tersebut. Sebelumnya, Pemerintah melalui Kementrian Perdagangan RI berencana memperketat impor sayur dan buah dengan mengeluarkan Peraturan Menteri (Permen) No 30/MDAG/PER/5/2012 untuk mengendalikan angka impor hortikultura yang semakin melonjak. Permen No 30/MDAG/PER/5/2012 akan berlaku efektif tanggal 15 Juni 2012. Permen yang didasarkan pada amanat UU No 13 Tahun 2010 tentang hortikultura yang mewajibkan importir untuk memperhatikan aspek keamanan pangan, dan menjaga

stabilitas nasional. Jeruk terpuruk Bukan itu saja produksi jeruk dikalangan petani kian terpuruk dengan adanya serangan hama lalat buah yang sulit diberantas. Meski sudah banyak upaya yang dilakukan, tetap saja lalat buah menyerang dan membuat busuk buah sebelum bisa dipanen. Hal tersebut seperti yang diungkapkan B Surbakti, petani jeruk di Desa Nangbelawan Kecamatan Simpang Empat Kabupaten Karo, saat dihubungi Waspada lewat telepon, Selasa (12/6). Dikatakannya jika

dihitung dari produksi, hampir sebagian besar petani jeruk di Kabupaten Karo mengalami penurunan. Penyebab utama dari menurunnya produksi tersebut karena serangan lalat buah. “Dari 1 hektar lahan yang saya punya, tinggal 200 sampai 300 pokok yang masih berdiri dan berproduksi dari sebelumnya sekitar 500 pokok.Yang lainnya sudah mati, dan dibiarkan mati karena buahnya rusak. Dari lahan tersebut setidaknya saya bisa menghasilkan 80 hingga 100 kg, namun setelah munculnya serangan lalat buah, tidak sampai separuhnya yang bisa dipetik untuk dijual di pasaran, “ ujarnya. Dia katakan yang menyulitkan untuk menghalau serangan lalat buah adalah karena lalat tersebut menjadikan kulit buah sebagai tempat untuk lalat bertelur. Dia mengakui, buah yang kulitnya sudah terdapat telur lalat nantinya buah itu terdapat bintik berwarna putih dan jika dibuka didalamnya terdapat semacam belatung

halus yang memakan daging buah kemudian meninggalkan bekas luka. Menurutnya, sudah banyak upaya yang dilakukan oleh petani untuk mencegah serangan lalat buah. Diantaranya dengan tidak membiarkan buah yang membusuk tersebut berada di bawah pohon. Buah yang membusuk tersebut harus disingkirkan agar tidak menjadi tempat berkembangbiaknya lalat buah secara lebih menyeluruh. Selain itu, ada juga beberapa petani lain yang berinisiatif untuk membuat jaring di sekeliling kebun untuk mencegah lalat masuk. Jaring dalam ukuran besar tersebut bisa mencapai tinggi 5 hingga 10 meter dengan asumsi lalat tidak bisa terbang lebih tinggi dari jaring tersebut. Namun untuk mengadakan jaring tersebut, jutaan rupiah harus dikeluarkan dari kantong petani padahal belum tentu efektif. � Dio Utama Nasution

B6 1 CM 2 CM


Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000


AUTOMOTIVE Informasi Pembaca

Bursa Automotive

A C : Air Condition BR : Ban Radial CL : Central Lock ND : Nippon Denso DB : Double Blower


: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

DAIHATSU Feroza Th. 1994. BK Mdn Asli. Warna biru ban baru, AC, Tape, VR, BR, Mulus dan sehat. Hub. 0813 6139 1011. Harga damai.


All New Xenia, Terios, Pick Up, Luxio, Sirion 100% Baru. DP Murah, Full Disc, Ready Stock. Hub. IRNANDA 081375802895 / 0821 6761 2659

DAIHATSU Espass MB Rooling Door Thn.96. Mdn AC, Tape, VR 1.3. Mobil cantik luar dalam.Body kaleng2.Alamat Jl. Perdamean No. K.17. Helvetia Zipur. HP. 0812 6424 995


CRV New MMC - Freed MMC Jazz Harga Khusus + Hadiah. HP. 0813 7069 8282 - 061.6996 0810 HONDA Grand Civic ‘88. Warna Hijau tua, PS, CL, PW, AC, Mulus. 0853 5955 7488 HYUNDAI ACCENT Thn.2000, warna merah maroon, Manual, dijual. Hrg. Hubungi 0853 6091 9127

ISUZU Panther Delux Thn. 96. W. Biru AC, Tape VR BR, Mesin sehat. 55Jt/ Nego. Hub. 0813 6150 8497 BK Medan.

ISUZU Panther High Tex 96. Warna hijau metalik lengkap dengan radio, TV, AC, Hub. 0812 646 0880 HONDA CRV MANUAL TH. ‘07 Abu2 metalik, 2000cc, mbl ctk, Full orisinil, pajak panjang, 1 tangan dr baru, Rp. 249Jt. Jl. SM. Raja No. 200. 0821 6767 7000 / 7851402

5 CM 6 CM

Rp. 65.000 Rp. 78.000

SUZUKI Carry Thn. 91. Adiputro 1.0 Warna merah, Velg Racing. Tape. Mobil siap pakai. Harga 26Jt. Nego. Hub. 0821 6399 9191 SUZUKI Escudo Nomade Tahun 99 W. Merah metalic. AC, Tape, VR, BR, PS, PW, CL, BK Medan. body kaleng. Jamin mulus. H. Nego. Hub. 061 7760 9041 DEALER RESMI SUZUKI MOBIL Carry PU 1.5 FD DP 10Jt-an Angs. Rp. 2.663.000. Ertiga Ready: Pesan sekarang juga Hub. 0852 6222 6789 / 77722121

SUZUKI APV Arena Elegant Dijual. Tahun 2008, warna hitam kondisi mulus. Jok kulit. Tangan pertama. Bukan mobil Rental Km. 65000. Hubungi 0812 6549 788 TOYOTA BARU 100% Ready Stock Avanza, Fortune, Innova, Yaris, Rush, Hilux, Dina, Bisa Tukar Tambah. Hub. 0813 6120 1719 / 6878 3325 TOYOTA Kijang LGX New Model 1.8 EFITh. 2004 Sgt orisinil. Mulus luar dalam. Complit, sound sytem pake TV 3 Unit. Hrg. 155Jt. Nego. Hub. 061.6967 9753

- Kijang Krista Diesel 03 Hitam - Kijang LGX Bensin Matic 03 Hitam Hub. 0853 7089 9893 TOYOTA Kijang LGX 1.8 Bensin Thn 2000 Biru met. Plat BL Rp. 100Jt. Hub. 0852 7538 3218 TOYOTA Kijang LX 1.8 Bensin Thn. 2004. AC, VR, PS, CL. Jok Kulit, silver, Plat BM Rp.104Jt. Hub. 0812 65942789

TOYOTA Kijang Capsul Dijual. LSX Solar Thn. 2001. AC/ST Lock. Tape, Jok kulit, BK Mdn, T. Pertama cantik. Cat Orisinil. Harga 110 Jt/Nego. Hub. 081 2639 3235


TOYOTA Kijang Super Commando Th. 95 W. Abu2 metalik. AC, Tape, VR, BR, PS, PW, CL, BK Medan. Body kaleng, mulus. Cat asli. H. Nego. Hub. 0852 6129 5788

M- Eterna 93 M-Eterna 90 Kondisi mulus, original. Hub. 0821 6399 3022 NISSAN Livina XR M/TThn. 2008.Biru met. BK Pajak STNK Baru. Hub. 0853 6161 5977

TOYOTA Kijang LGX Solar W. Biru met, BK Medan asli Th. 2001. Lengkap, siap pakai. Rp. 125Juta Nego. Hub. 0813 6227 1115. Jl. Amaliun. Dpn SD Kartini No. 146 Toko ULGA

SUZUKI APV Tahun 2005 2006. TPX wrn. hitam original 103 Juta. Hub. 0811 634 279

Mobil sehat luar dalam. Komplit semua. body mulus. VR 16. Warna hitam mulus. Hub. 0812 6338 3979 - 0813 6162 4975

SUZUKI Carry Futura Minibus Dijual. Thn. 92/93. 1.3. AC/DB, BK Mdn. Cantik, jok kulit. Harga 36Jt. Nego. Hub. 0812 8621 4177


Hub. 0852 6111 7724 08527084 7017 Terima Tukar Tambah

TOYOTA Corolla SE Salon ‘86. Peminat Hub. Lsg. 0852 6120 1056 (Hrg. Nego/TP) TOYOTA BARU 2012 Bunga 3,35 %. Proses Cepat & Data Dijemput. Hub. Predy Simatupang. 0853 6207 2000 - 0813 6165 1801 TOYOTA LGX Solar thn. 2000 Dijual. Akhir Bln Desember Biru Mika. Mesin ok. Body, cat original, siap pakai, mulus. Harga Rp. 117,5Jt. Nego. Hub. 0823 6883 9561


KIA Carnival Thn. 2000 W. Silver metalik. BK Medan asli. 1 tangan. Mulus sekali. Siap pakai: Hub. 0812 650 3136


Jaminan apa saja Sertifikat Tanah mobil & Sp. Motor. Segala tahun. Hub. 061-8222774 HP. 0853 6199 1500


(Setelah survey usaha dan jaminan), SK Camat 10Jt s/d 100Jt. SHM 100Jt s/d milyar. Take over 500Jt ke bawah. Hub.08126437095, 08137089 5543




TOYOTA Kijang LSX Solar Wrn biru thn. 98/99 Harga 93 Juta. Hub. 0852 6162 5569 TOYOTA Avanza Type G Th. ‘09/ 08. New, Wrn hitam, Full orisinil, Mbl ctk, istimewa, Km sedikit Rp. 137,5Jt. Depan Kampus UISU No. 200. 0815 33733688 / 7851402

11 CM Rp. 165.000 12 CM Rp. 180.000

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000


Apabila anda mencurigai sesuatu, silahkan hubungi kami di 061-4576602






BPKB Dan STNK BK 1743 EK. Atas nama KPUM Nomor Koperasi 2538


Telah tercecer 1 (satu) buah Surat Penyerahan Perlepasan Hak/Ganti Rugi No. 592.23/001/1991 tertanggal 15 Januari 1991 di sekitar Jalan H.T. Rizal Nurdin Pantai Cermin Kec. Pantai Cermin Kab. Serdang Bedagai pada tanggal 21/05/2012. Demikianlah Pernyataan ini kami perbuat dengan sebenarnya an. Ahli Waris. Tengku Haji Mawardi Arifin Tengku Ari Zumairi Arifin

KOMPUTER JUAL WARNET Komputer 14 unit: Harga Rp. 65.000.000,- Nego. Hub. Ismail, No. HP. 0821 6463 5402 TOSHIBA 14” Dvd= 3,3Jt - Diskon 50% =Rp. 1,7Jt - berlaku 6hr. LAPTOP-Coi 5 acer + VGA (3,3Jt)-(Coi3?) Co2mulai (1,9Jt) -KAMERA - Pulpen / digital - Sony - Kodak - nikon DLSR?? (CCTV=195Rb) PC-hdd40-500Gb?Ddr3 (99rb) Spk-aktf(39)adaptor (78rb)LCD (450rb) Dana-cash (jaminan-Laptop-DII) 0812-636-1967-Jl. Rantang 20S


TELAH HILANG/TERCECER Asli Surat Perjanjian Pelepasan Hak dan Ganti Rugi No. 331/SPPH-GR/MJ/ 1989 Tgl. 12 Juni 1989 sekitar Jalan Brigjend Zein Hamid A/n. M. Jenam Sitepu.

SIM A dan C, KTP. ATM BCA, dll. atas nama Taufik Siregar, STNK Kereta Mio CW. BK, 6525 AAH. Hilang disekitar Jl. Mesjid, Sukamulia samping D. Toba Htl, Imam Bonjol. Dpn sklh imanuel, Sudirman, msk Jln. W. Kota tembus Pardede Hotel langsung ke rumah.

Ingin Promosikan Produk Anda


WASPADA Media yang Tepat untuk Iklan Anda




- 09 Hr Umroh Reguler - 09 Hari Awal Ramadhan - 11 Hari Awal Ramadhan - 12 Hari Tengah Ramadhan - Lailatul Qodr/Akhir Ramadhan - 1 Bulan Ramadhan & Puasa 6

brgkt tgl 02, 04, 09 Juli brgkt tgl 14 Juli brgkt tgl 21 Juli brgkt tgl 25 Juli brgkt tgl 11 Agust brgkt tgl 28 Juli

SEGERA HUBUNGI KANTOR MULTAZAM = SEAT TERBATAS Jl. Titi Papan/ Pertahanan No. 10 Sei Sikambing Medan Telp. (061) 457.6116 - 7731.3385 HP. 0813.6137.2321 - 0812.6495.8456



BELAJAR AL-QUR’AN Mari kita tingkatkan Taqwa dengan mempelajari membaca Al-Qur’an yang disertai dengan ilmu Tajwid Al-Qur’an. Segera hubungi 0853.5672.1227 (Guru Al-Qur’an) Bersedia mengajar di rumah anda


BPKB Spd. Motor Honda BK 5563 KH. A/n. MISNAN. Alamat: Jl. Komp. Barakuda blok A No.5 Lk. 16 Tj. Mulia Hilir. No. Rangka MH IKEVA275K0751000. No mesin: KEVAE - 2073578

Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput


Pelanggan Yang Terhormat

Surat SKT Kuma Medan No. 83/SKT/MS/1980. Tanggal 04-03-1980. A/n. SUPAH yang terletak Jl. Budi Luhur Gang Keluarga I Kec. Medan Helvetia.



HA TI-HA TI terhadap penipuan yang HATI-HA TI-HATI mengatas namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk membeli produk anda, TI-HA TI apabila anda ingin dan HA HATI-HA TI-HATI melakukan transaksi jual beli melalui transfer. Segala akibat yang terjadi diluar tanggujawab




9 CM Rp. 126.000 10 CM Rp. 140.000

TELAH TERCECER BPKB Sepeda motor. Atas Nama: SUTRISNO. BK: 6713 CP. Alamat: Jl. Tinta No. 62A. Merk: Honda 125. No. Rangka: MH.IJB81187 KO 18260. No. Mesin: JB81E - 1024501

TOYOTA Kijang Super Commando Th. 92 W. Biru metalik. AC, Tape, VR, BR, Jok kulit. Lampu Green Mulus. Seperti Baru. H. Nego. Hub. 0852 7599 6758

Avanza, Innova, Fortuner Purba: 08139 789 4633

Carry Pick Up - Ertiga / APV DP Murah, Angsuran Ringan

Rp. 91.000 Rp. 104.000

TOYOTA Kijang Th. ‘89 dijual segera, damai. Merah metalik, long, jantan. 4 speed. Hub. 061.77230319. Harga 36Jt. Nego. TP.

OPEL Blazer Lt Injection Biru met Th. 97. Mulus, terawat sekali, AC Dingin, Full sound. Pake TV, Hrg. 46 Jt. Nego. Hub. 0812 6949 9450 L300 PU, Colt Diesel, Pajero, Fuso Hub. MAZMUR. 081 269 901 133

7 CM 8 CM

TOYOTA Avanza Type G. Thn. 2010. Warna hitam. Km. 40.000. Pajak baru perpanjang. Hub. 0813 7586 4313

Kamis, 14 Juni 2012

Jl. Sutomo Ujung No. 102 B-Medan Telp. (061) 664.3024 Fax. 061) 664.0250 Email:


UMROH RAMADHAN: SPECIAL PAKET IQTIKAF (Apartement) 9 Hari (Rp. 16.200.000) 11 Hari (Rp. 17.000.000) 13 Hari (Rp. 18.000.000) Lailatul Qadar + Puasa Syawal 17 Hari (Rp. 19.500.000,-) Full Ramadhan 37 - 38 Hari (Rp. 23.500.000) Arbain HAJI PLUS 27-28 Hari Harga Mulai USD 7000 Info lebih lanjut hub: Hj. Nasla: 0813.7077.7555 - 0852.2177.7555 Dian: 0852.7556.6555


UMROH REGULER 9 HARI 6 JULI UMROH REGULER 1 3HARI 11 JULI UMROH RAMADHAN - RAMADHAN 9 HARI 17, 21 JULI - RAMADHAN 1 1 HARI 28 JULI - RAMADHAN 1 3 HARI 25 JULI - FULL RAMADHAN 18 JULI Bagi jama’ah dari luar kota nginap di Hotel Madani (Gratis) Penerbangan Via Singapore Menjual Tiket Domestik DAFTAR SEGERA Kantor: Gedung Gelora Plaza Lt. 1

Jl. S.M. Raja No. 4/18 Medan Telp. 061-7326981, 0813 7503 1889, 0852 6213 3488 Website:



ELEKTRONIK REPARASI AC, KULKAS, MESIN CUCI Kompor Gas, Dispenser H & C TV, M. Pompa Air Sanyo

Hub. SURYA TEKNIK SERVICE Telp.66482216 - 0813 7589 8757 Siap Ketempat





845.8996 0812.631.6631 Bergaransi/ Jl.Kpt. Muslim

TUMPAT/ SEDOT SETIA BUDI HP. 8442246 0812 631 6631 Ada Garansi





Kelakuan baik, Rapi, Berpengalaman keluar kota, syarat: 1. Muslim 2. Foto copy KTP 3. Foto copy SIM 4. Foto copy Ijazah 5. Pasphoto 3x4: 2 lembar 6. Usia 25 s/d 35 tahun Lamaran diantar: Jl. Brigjend. Katamso No. 328 (Pangkas Sarah Baber shop) Dari jam 9.00 s/d 20.00 WIB HP. 0823.6943.8432 - 0878.6851.8051





Tukang masak Mie Aceh/Mi Goreng, Laki²/Perempuan, Berumah tangga/ Single Muslim, Disediakan penginapan Peminat hub. 0821.6457.7884 Andre - 0821.6555.9855 DIBUTUHKAN PEREMPUAN/ LAKI-LAKI

Utk jualan bubur/kue-kue/Es cendol, syarat: Islam, Ada KTP, Jujur, Gaji bulanan Hub. Bg. Epi 0853.7206.7644/0878.6964.7856 Jl. Karya Pembangunan No. 20 Asrama Haji Medan



Informasi Pembaca Bursa Property

G R : Garasi LB KM : Kamar Mandi LT KP : Kamar Pembantu RM KT : Kamar Tidur RT SHM: Sertifikat Hak Milik

: Luas Bangunan : Luas Tanah : Ruang Makan : Ruang Tamu





Dahsyaatt, Hanya 16 Juta bisa buka usaha laundry kiloan + diajarkan Cry clean + Spa helm, kami yg termurah, terprofesional di dunia, maukan penghasilan halal minimal 300 ribu - 1 juta tiap hari seumur hidup? 0852.6298.7114


Pemasangan Depot Air Minum Isi Ulang paling murah Sesuai kemampuan anda 1. Depot RO 40 s/d 400 Galon/ hari 2. Depot Air Mineral/ Pegunungan 3. Jual alat-alat depot isi ulang Terima siap untuk jualan

UD. RIZKY ABADI JAYA Jl. Veteran Psr. 10 (dpn Mesjid Al-Hidayah) Helvetia Telp. (061) 685.3334 HP. 0813.7580.8866



MATERIAL TANAH TANAH Dijual, Luas 10x80m, Jalan Danau Tempe Gg. Rambutan Km. 18 Binjai, SK Camat, Harga 130 Jt/nego, Tanpa perantara Hub. 0813.6219.0476


- Lokasi Simalungun 82 km dari Medan, SK Camat - Bibit coklat setahun berbuah - Bibit karet okulasi Hub. Kopsamar 0852.7759.0338






TANAH DIJUAL Jl. Kiwi Gg. 6 No. 72E Siskambing B P. 30m, L.9½m HP. 0813.7507.1252



Uk. ±30x400 (Sertifikat Hak Milik), Lokasi Desa Aek Kota Buntu Kec. NA. IX-X, untuk Sumatera Hub HP. 0813.9646.3253, Maaf TP






Jl. Sutomo No. 436 Medan 20231 (samping Bank Maspion) Telp. (061) 452.2588 - 415.7504 - 455.7204 - 455.7194 Fax. (061) 415.7504 SUMUT - INDONESIA


Ekonomi & Bisnis

WASPADA Kamis 14 Juni 2012


Menkeu: Pertemuan G-20 Bahas Krisis Eropa JAKARTA (Waspada): Menteri Keuangan Agus Martowardojo mengatakan pertemuan G-20 yang akan berlangsung di Los Cabos, Meksiko akan membahas mengenai perkembangan terkini krisis yang terjadi di Eropa.


MENTERI Negara BUMN Dahlan Iskan (kanan) sedang berbincang-bincang dengan Direktur Utama PT Sidomuncul Irwan Hidayat disela-sela acara WOMM Award di Grand Melia Jakarta Kamis lalu. Pada acara tersebut Dahlan Iskan bertindak sebagai keynote speaker.

Kuku Bima Energi Kembali Raih WOMM 2012 JAKARTA (Waspada): Kamis lalu di Grand Melia Hotel minuman energi Kuku Bima Energi produk dari Sidomuncul kembali meraih penghargaan Word of Mouth Marketing (WOMM) Award 2011 untuk yang keempat kalinya untuk kategori “minuman energi serbuk” dari Majalah Swa Sembada, bekerjasama dengan buzz & Co dan onbee. Penghargaan akan diserahkan oleh Direktur Octovate Brand dan diterima oleh Direktur Utama PT Sidomuncul Irwan Hidayat. The Word of Mouth Marketing (WOMM) Award adalah suatu program penghargaan tahunan yang secara rutin diberikan oleh Majalah Swa Sembada dan Swanetwork

bekerja sama dengan buzz & Co dan onbee sebagai bentuk apresiasi kepada perusahaan yang produknya paling sering dituturkan. WOMM bukanlah sekedar pemasaran dari mulut kemulut, tetapi sebuah konsep marketing yang mencakup tiga hal yaitu: Do The Talking, Do The Promotion dan Do The Selling.WOMM bukan hanya membuat sebuah brand dibicarakan saja, tetapi bagaimana menjalankan strategi TPS (Talking, Promotion dan Selling) tersebut. Menurut Octobrand, WOMM diyakini sangat relevan dengan kondisi bisnis di Indonesia seperti sekarang, dimana sebuah merek tidak harus mengeluarkan anggaran yang besar untuk kegiatan pema-

sarannya. Namun bukan berarti bahwa merek yang sukses lewat model pemasaran tidak memerlukan Above The Line. Above The Line (ABL) tetap diperlukan untuk mendukung eksistensi merek. Dengan diterimanya WOMM Award 2012 untuk Kuku Bima Energi yang memiliki rasa original, kopi, jambu, jeruk, anggur, susu soda, nanas, dan mangga dapat memberikan gambaran yang jelas kepada masyarakat/publik tentang marketing dari mulut ke mulut (Word of Mouth Marketing). Sebelumnya Kuku Bima Energi meraih penghargaan Top Brand untuk kategori yang sama dari Majalah Marketing bekerjasama dengan Fronitier Consulting Group.

“Diterimanya penghargaan-penghargaam untuk Kuku Bima Energi, menjadi satu kehormatan bagi kami. Penghargaan ini diterima tentunya karena masyarakat percaya terhadap produk-produk Sidomuncul, sehingga menjadi perbincangan di masyarakat. Ini akan menjadi referensi bagi kami agar kami dapat meningkatkan kualitas produk-produk kami, ujar Irwan Hidayat. Sebagai produsen Kuku Bima Energi, Tolak Angin, Kuku Bima Kopi Ginseng, Kopi Jahe Sidomuncu, Jahe Susu, dan produk-produk lainnya, Sidomuncul terus melakukan inovasi produk dan berbagai aktifitas yang mendukung upaya tersebut.(rel)

Stok Kian Menipis Gula Pasir Naik Lagi MEDAN (Waspada): Harga gula pasir semakin tak terkendali. Kepada Waspada Rabu (13/6), pedagang menyebutkan kenaikan harga eceran gula pasir saat ini diperkirakan akibat minimnya pasokan yang masuk Sumut. Gula pasir untuk konsumsi hingga saat masih tergantung dari luar daerah yang dipasok melalui perdagangan antar pulau. Akibat minimnya pasokan mengakibatkan harga gula pasir saat ini selama periode dua bulan mengalami kenaikan dua kali. Pedagang saat ini menjual harga eceran menjadi Rp13.300 hingga Rp13.500 per kg. Ida, pedagang eceran di Simpang Limun, mengakui



Tanaman investasi umur 7 thn bisa panen, Puluhan Juta, yg butuh bibit Gaharu, Obat suntik gaharu & mau jual isi batang gaharu, serta mau pesan bbt yg lain, yg bersertifikat Hub. Pak Jamal di Limau Manis Tanjung Morawa HP. 0813.7091.2113



harga gula pasir saat ini mulai tidak terkendali dan mengalami kenaikan sangat dratis. Terakhir gula pasir mulai naik lagi hingga menjadi Rp13.500 per kg sejak Senin (11/6). Padahal gula pasir ini telah mengalami kenaikan saat memasuki awal Mei menjadi Rp13.000 per kg dari harga sebelumnya Rp12.500 per kg, sedangkan gula pasir merek Gulaku Rp12.300 per kg, jelasnya. Naiknya harga gula pasir mengakibatkan paniknya ibu rumah tangga dan pedagang makanan juga minuman karena naiknya dratis. Bagaimana pula ketika masuk bulan Ramadhan yang merupakan bulan naiknya semua kebutuhan, jelas Endang, pedagang minuman.

Minimnya stok gula pasir ini diperparah akibat kebijakan pemerintah yang saat ini menghentikan impor gula pasir konsumsi, sementara pabrik gula nasional tidak mampu memproduksi sesuai kebutuhan. Berdasarkan data bongkar muat barang di PT Pelabuhan Indonesia I (Persero) Belawan terlihat pembongkaran gula pasir sangat minim sejak Maret hingga Mei. Biasanya gula pasir masuk setiap bulannya . Asisten Hukum dan Humas Pelabuhan Belawan Azmi Jauhari membenarkan minimnya pembongkaran gula pasir di Pelabuhan Belawan. ‘’Gula pasir yang masuk ke Pelabuhan Belawan sebahagian besar


Melayani berbagai macam keluhan antara lain: KHUSUS PRIA TAMBAH UKURAN: - Panjang: 13 - 16 - 19 - 22 cm - Diameter: 3.5-4-4.5-5-5.5-6cm - Kuat dan tahan lama - Ejakulasi dini, sphilis/ Raja singa - Mani encer - Lemah syahwat, diabetes, impoten, dl KHUSUS WANITA: - Memperbesar, payudara, terapi perawan/ virgin, kista, lemah kandungan, kanker payudara, ingin mempunyai keturunan, dll PRIA & WANITA Ingin cepat dapat jodoh, penghasilan disegani atasan, menyatukan & memisahkan PIL/WIL, Puter giling, juga melayani pasang susuk, dll --> Bergaransi, hasil permanen alami tanpa efek samping, langsung reaksi ditempat

Spring Bed 6 kaki 2 lapis Rp. 1.150.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun Hub Telp. (061) 661.8116 - (061) 661.6802 - 7653.2188





Alamat: Jl. SM. Raja depan Taman Makan Pahlawan No. 130B Medan samping Show Room AUTO 2000. Dibelakang bengkel tambal ban HP. 0813 8042 6253




Dengan H. TEJA SAEFUL Cucu Asli Mak Erot Bersama



Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041 KHUSUS PRIA: - Ejakulasi dini - Impotensi - Memperbesar “Alvit” - Memperpanjang “Alvit” - Keras dan tahan lama dll KHUSUS WANITA: - Ingin punya keturunan - Memperkencang & memperbesar payudara - Mengobati keputihan dll KONSULTASI UMUM: - Buka Aura - Cari Jodoh - Sesama jenis - Pelaris - Memikat lawan jenis - Besar PYDR

DIJAMIN 100% Hanya Tempat

Kami Klinik Mak Erot Jl. Laksana No. 55J masuk dari Jl. Amaliun Yuki Simpang Raya Medan (Praktek Tetap) HP .0812.4038.333

menginginkan adanya pembahasan mengenai rencana pembangunan berwawasan lingkungan yang akhir-akhir ini sangat intens disuarakan. “Jadi, meyakinkan ada `green economy` dan ini juga salah satu yang diusulkan oleh pihak Meksiko,” katanya. Hal lain dibahas dalam pertemuan selama dua hari ini adalah mengenai pentingnya akses keuangan secara luas (financial inclusion) untuk meningkatkan kesejahteraan masyarakat secara berkelanjutan. “Kita melihat `financial inclusion` ini mendapat sambutan baik dari anggota G-20,” kata Menkeu. Data pajak Sementara itu Pihak Kementerian Keuangan (Kemenkeu) JUGA membantah adanya perlindungan bagi para Wajib Pajak (WP). Hal ini diungkapkan, terkait adanya pengemplangan pajak oleh beberapa oknum pajak. Sekretaris Jenderal Kemenkeu Kiagus Badaruddin menjelaskan, pihak Kementerian

Keuangan tidak dapat membuka data tersebut karena para WP itu dilindungi oleh UndangUndang (UU). Oleh karena itu, data tersebut tidak dapat diungkapkan kepada publik. “Oleh karena itu kalau sudah menyangkutWP kadangkadang memang pejabat pajak, ataupun Dirjen Pajak hati-hati, karena dia bisa diancam pidana,” ungkap dia kala ditemui di kantornya, Jalan Wahidin Raya, Jakarta, Rabu (13/6). Kiagus menambahkan, di lingkungan Kemenkeu memang ada data-data yang boleh dibuka dan ada sebuah data tidak boleh sembarangan di-publish kepada publik. “Tapi kalau bertanya data apa yang ada di pengadilan, itu kan dia berani. Apa yang tidak melang-gar UU dia pasti sampaikan,” tukas dia. Seperti diketahui, Menteri Keuangan Agus DW Martowardojo, menginginkan ke depannya paraWP yang terlibat kongkalikong dengan oknum pagawai pajak juga bisa ditangkap tidak hanya oknum pegawai pajaknya saja. (okz/ant)

Gaji Ke-13 Baru Bisa Cair Juli-Agustus JAKARTA (Waspada): Kementerian Keuangan (Kemenkeu) menyatakan gaji ke-13 untuk Pegawai Negeri Sipil (PNS), TNI/Polri dan lainnya cair pada Juli atau Agustus 2012. Padahal, rencana awal, gaji ke-13 dapat dibagikan pada bulan ini. Sekretaris Jenderal Kemenkeu Kiagus Badaruddin menjelaskan, saat ini sedang menyelesaikan Peraturan Kementerian Keuangan (PMK) mengenai pencairan gaji ke-13 tersebut kepada Kantor Pelayanan Perbendaharaan Negara (KPPN). Hal ini harus dilakukan agar ada teknis pemberian gaji ke-13.

“Sedang kita susun PMKnya, mungkin sudah jadi beberapa hari yang lalu. Jadi ada PP, lalu ada PMK, untuk memerintahkan kepada kepala KPPN, kuasa penggunaan anggarannya secara teknis untuk mengatur. Kita harap juli atau agustus ini bisa cair,” jelas dia kala ditemui di kantornya, Jakarta, Rabu (13/ 6). Kiagus melanjutkan, diharapkan gaji ke-13 tersebut dicairkan pada Juli. Pasalnya, pada bulan tersebut merupakan bulan ajaran baru, sehingga akan mendukung anak

masuk sekolah. “Kalau gaji, Julinya sempat, ya boleh, tapi di belakang itu juga boleh. Tapi kita usahakan Juli bisa dibayar karena itu bersamaan waktunya dengan masuk sekolah anak-anak,” paparnya. Sekadar informasi, pemerintah telah menerbitkan Peraturan Pemerintah Nomor 57 Tahun 2012 yang ditandatangani oleh Presiden Susilo Bambang Yudhoyono (SBY) pada 28 Mei lalu. Dalam PP tersebut, dikatakan, yang dimaksud dengan

pegawai negeri adalah Pegawai Negeri Sipil (PNS), anggota Tentara Nasional Indonesia (TNI), dan anggota Kepolisian Republik Indonesia (Polri). Gaji ke-13 ini juga akan diberikan pada pensiunan pegawai negeri, pejabat negara, janda/duda/anak penerima pensiun, dan penerima pensiun orangtua PNS yang tewas. Dalam kategori ini juga termasuk, penerima tunjangan veteran, tunjangan kehormatan anggota KNIP, perintis pergerakan kebangsaan/kemerdekaan atau janda/dudanya, dan lain-lain. (okz)

BI: Ekonomi Global Hambat RI JAKARTA (Waspada): Bank Indonesia (BI) memprediksi kondisi perekonomian global yang tengah lesu akan menghambat pertumbuhan ekonomi Indonesia. Sebab, sumber pertumbuhan dari eksternal seperti ekspor mengalami penurunan. “Kondisi tersebut tidak mengimbangi impor yang masih tetap tinggi. Impor masih tumbuh cukup tinggi sejalan dengan meningkatnya permintaan domestik,” kata Direktur Eksekutif Perencanaan Strategis dan HubunganMasyarakatBI,DodyBudi Waluyo dalam kete-rang-annya di Jakarta, Selasa (12/6). Namun untuk pertumbuhan ekonomi RI pada triwulan II2012 dan secara keseluruhan

tahun 2012 masih dapat mencapai kisaran 6,3-6,7 persen, meskipun dengan risiko bias ke batasbawahkisaran.“Kitaoptimis pertumbuhan berada di level itu,” ujar Dody. Sumber pertumbuhan terutama akan ditopang dari permintaan domestik, baik konsumsimaupuninvestasiyang tetap kuat. “Di tengah ketidakpastian perekonomian global, BI yakin daya tahan perekonomian domestik sejauh ini masih baik,” tandasnya. Menteri Perdagangan Gita Wirjawanmenyampaikan,imbas krisis ekonomi di Eropa dan AS sudah menjalar ke negeri China. Saat ini sudah ada sekitar 10 ribu pabrik di China tutup akibat

permintaanekspormenurundari Eropa dan AS. “Sama seperti kita, Tiongkok juga mengalami hal seperti ini. Pertumbuhan utility menurun dari 80 persen menjadi 60 persen saat ini, dan berimbas pada penutupan sekitar 10.000 pabrik di Tiongkok,” jelas Gita. Karena itu, lanjutnya, China pun mencari pasar-pasar baru untuk barang ekspornya, sehingga tidak ada lagi pabrikpabrik yang ditutup. Salah satu yang sudah menjadi sasaran adalah Indonesia karena pasar dalam negerinya yang besar. “Pasar baru itu adalah Indonesia. Harus diingat konsum-si domestik kita 60 persen. Tingkat konsumsi rumah tangga di In-

donesia yang besar menjadi incaran dari produk China,” kata Gita. Apalagi, sambungnya, ada slogan‘murah dan kenyang’ dan banyak barang-barang pangan dannonpangan(asalChina)yang jumlahnya ribuan tidak sesuai K3L (keselamatan, keamanan, dankesehatanlingkungan),”cetus Gita. Sementara hasil analisa BI, proses perekonomian global masih dihadapkan pada krisis Eropa yang memburuk dan semakin tidak pasti, kondisi perekonomian AS yang masih rentan, serta pertumbuhan ekonomi China dan India yang diperkirakan melambat sebagai dampak krisis di Eropa. (j03)

GraPARI Telkomsel Buka 24 Jam



TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 7653.2188

berasal dari Lampung, namun sejak beberapa bulan ini sangat minim, ‘’ jelas Azmi. Sementara data bongkar muat barang di Pelabuhan Bela-wan International Container Terminal (BICT) terlihat masih ada gula pasir yang dibongkar dengan menggunakan petikemas. Asisten Hukum dan Humas BICT Pelindo I Suratman membenarkan di dermaganya masih masuk gula pasir yang berasal dari antar pulau maupun impor. Namun khusus untuk gula pasir berasal dari luar negeri bukan gula untuk konsumsi tetapi gula mentah jenis rafinasi untuk memenuhi kebutuhan pabrik makanan dan minuman.(m35).

“Dari jadwal, terlihat akan ada pembahasan yang mendalam untuk membahas tentang perkembangan ekonomi global,” ujarnya saat ditemui di Jakarta, Selasa (12/6) malam. Menkeu menjelaskan tema tersebut sangat relevan dengan kondisi saat ini dimana krisis masih belum akan berakhir dan Yunani akan melaksanakan pemilihan umum yang menentukan keberlangsungan zona euro. “Itu sangat relevan karena kita sama-sama mengikuti pada tanggal 17 (Juni) itu ada

Pemilu Yunani. Jadi, pimpinan G-20 pasti akan melakukan pemba-hasan mendalam untuk bisa merespon dengan baik perkem-bangan itu,” katanya. Menurut Menkeu, forum ini merupakan kesempatan yang baik untuk menyampaikan pentingnya pembiayaan proyek infrastruktur karena dapat mendorong pertumbuhan ekonomi bagi negara maju dan negara berkembang. “Negara maju akan mempunyai kesempatan untuk menjual teknologi kepada negara berkembang dan negara berkembang bisa menyelesaikan percepatan pembangunan infrastrukturnya,” ujarnya. Selain itu juga dalam pertemuan konferensi tingkat tinggi yang berlangsung pada tanggal 18—19 Juni tersebut, akan dibahas mengenai keterlibatan dana moneter internasional (IMF) untuk mengatasi krisis dan volatilitas harga komoditas terutama sektor energi. Menkeu mengatakan Meksiko sebagai tuan rumah forum

Setelah sukses di propinsi di Papua, kini hadir di kota Medan, pengobatan nyata luar biasa, bila anda ingin perkasa, ingat jangan salah informasi disini yang pasi ±30 menit kami akan buktikan alat vital menjadi besar dan perkasa. Dengan metode pengurutan disekitar alat vital melalui totok urat-urat kejantanan. Kami tidak mengumbar janji belaka. Tdk ada efek samping, bebas utk semua agama. Bukan janji tapi bukti ditempat Penanganan khusus pria: - Memperbesar, panjang, keras, kuat dan tahan lama - Kencing manis, diabetes, L. syahwat - Ejakulasi dini/ impotensi Khusus Wanita: - Memperbesar/ kencang payudara - Ingin punya keturunan/ gurah vagina - Ingin kembali perawan/ keputihan Konsultasi umum - Ajian semar mesem/ buka aura - Penglaris/ penghasihan/ cari jodoh - Pasang susuk, karir/ jabatan DIJAMIN 100% Alamat Jl. Halat / Masuk Jl. Senam No. 19C. Belakang Makam Pahlawan HP. 0821.6655.3222



Merawat kejantanan secara alami (tidak ada efek samping) besar dan panjang, permanen dan cukup sekali datang Alamat: Jl. SM. Raja masuk Jl. Sempurna No. 18 (samping UISU SM. Raja) H P. 0 8 1 3 1 1 1 9 6 3 3 1 No. Izin Kejaksaan, Nomor: B12/DSP.5/01/2012 Metode: Penanganan dari ujung kaki sampai pada pangkal alat vital untuk membetulkan urat yang tersumbat dan melancarkan peradaran darah membetulkan aliran sperma. kemudian dikusuk/ terapy untuk penambah ukuran besar dan panjang tidak ada efek samping, permanen, bebas pantangan dan untuk semua agama.

PRIA - Panjang: 10 - 12 - 14 - 16 - 18 - Besar: 3 - 4 - 5 - 6 - 7 - Sperma encer - Lemah syahwat - Ejakulasi dini - Impotensi

W A N I TA : - Memperindah payudara - Menjadikan G-spot, seperti perawan kembali - keturunan

DIJAMIN BERGARANSI KONSULTASI UMUM: - Susuk semar asih - Ajian tali raga - Susuk Ratu Malam - Bedak aura kinasih - Ajian pemutus & penyambung cinta - Pelet tuyul

M E D A N ( Wa s p a d a ) : Telkomsel kembali menambah kenyamanan pelanggan dalam mengakses pusat pelayanan pelanggan dengan meresmikannya GraPARI 24/7 yang berlokasi di Gedung Selecta lantai 1 Jl. Listrik no 2 Medan. Sesuai namanya GraPARI ini siap mela-yani pelanggan non-stop 24 jam sehari, 7 hari dalam seminggu Head of Area Sumatera Group Telkomsel Gilang Prasetya mengatakan sebagai perusahaan yang mengedepankan pelayanan kami memahami betul akan kebutuhan pelanggan. “Kami menyadari bahwa tingkat mobilitas masyarakat di Medan sangatlah tinggi, hal ini menyebabkan adanya kebutuh-an pelanggan dalam pelayanan di malam hari dan di luar hari kerja. Untuk itu kami berusaha mengakomodir kebutuhan pelanggan tersebut dengan membuka pelayanan GraPARI 24/7 sebagai alternatif layanan. Selain graPARI di Medan Selecta, kami juga mempunyai graPARI di Sun Plaza level 1 Medan yang melayani pelanggan setiap hari hingga pk.21.00,” katanya. “Kehadiran GraPARI 24/7 ini kami harapkan mampu menjadi solusi disela-sela kesibukan pelanggan untuk mendapatkan pelayanan di jam-jam yang sesuai dengan kebutuhan pelanggan. GraPARI 24/7 akan melayani seluruh pelanggan yang berada di Medan maupun pelanggan Telkomsel lainnya yang sedang berada di wilayah Medan,” tambah Gilang. Graha Pari Sraya atau yang disingkat GraPARI berasal dari bahasa Sansekerta yang diberi-

Waspada/Armin Nasution

SEORANG pelanggan sedang berdialog dengan petugas GraPARI Telkomsel. Kini layanan GraPARI Telkomsel gedung Selecta buka 24 jam. kan Sri Sultan Hamengkubuwono X untuk nama kantor pelayanan Telkomsel sebagai tanda penghargaan atas diresmikannya kantor pelayanan Telkomsel di Yogyakarta. Sejak itulah seluruh kantor pelayanan Telkomsel ditetapkan dengan nama GraPARI Telkomsel atau Grha Pari Sraya Telkomsel. “Kami terus meningkatkan

pelayanan dari GraPARI. Selain menikmati layanan 24 jam, GraPARI ini juga telah memperoleh sertifikasi mutu International Organisation for Standardization (ISO) 9001:2008. Pelayanan kelas dunia berstandar ISO merupakan komitmen sekaligus janji kami untuk menjaga mutu pelayanan, yang diawasi secara berkala oleh

pihak ketiga yakni perusahaan pemeringkat mutu,” ungkap Gilang. “Sertifikasi ISO ini nantinya akan semakin memberikan keuntungan yang dirasakan langsung oleh pelanggan, seperti kecepatan layanan maksimal 15 menit, serta First Visit Resolution yaitu solusi pada kunjungan pertama

pelang-gan,” pungkas Gilang. Akses layanan walk-in GraPARI 24 jam ini tentunya juga menambah kemudahan pelanggan dalam mengakses layanan Telkomsel, setelah sebelumnya juga tersedia call center 24 jam bagi pelanggan melalui akses 133 kartuHALO dan 155 simPATI dan Kartu As.(m06)



Cabut Izin Tambang Emas Bermasalah Dengan Warga


ibuan warga enam desa di Kecamatan Muara Batangtoru, Kabupaten Tapanuli Selatan mengamuk membakar truk dan pipa pembuangan limbah yang sedang dalam proses penanaman milik perusahaan tambang emas PT Agincourt Resources (AR). Peristiwa ‘’anarkis’’ Selasa (12/6) itu sebenarnya tidak perlu terjadi andaikan pihak perusahaan menyikapi permintaan warga di sana. Tentu penolakan warga bukan tanpa alasan. Sebab, limpah pabrik apalagi limbah pertambangan emas, termasuk yang dikelola secara liar banyak menghasilkan limbah yang membahayakan kesehatan (senyawa kimia berbahaya). Tidak itu saja, pada umumnya limbah pabrik dan sejenisnya atau apapun yang bernama limbah selalu membahayakan ekosistem dan kesehatan, terlebih lingkungan di sekitar perusahaan tambang akan rusak parah. Kalau dialirkan ke sungai bakal banyak biota sungai seperti ikan-ikan akan mati, bisa-bisa membahayakan warga di sekitar sungai yang selama ini memanfaatkan air sungai untuk keperluan sehari-hari, apakah mandi, mencuci, kebutuhan dapur sampai minum. Justru itu, pemerintah dan aparat keamanan perlu tanggap dan tegas berpihak pada warga masyarakat dengan menghentikan penanaman pipa pembuangan limbah ke sungai. Jika tidak maka insiden serupa bakal terulang lagi, bahkan dalam skup yang jauh lebih besar sebagaimana terjadi di berbagai daerah, seperti di Bima, Sulawesi dll. Sampai-sampai sarana dan prasarana milik perusahaan tambang emas dan kantor pemerintahan ikut dibakar/dirusak oleh masyarakat karena jalur komunikasi sudah tertutup. Hemat kita, alangkah bagusnya jika perusahaan tambang atau pabrik klasifikasi sedang dan besar membangun mesin pengelola limbah di areal pabriknya sendiri dengan membangun kolam-kolam berikut teknologi mesinnya, sehingga limbah pabrik tidak langsung meracuni biota sungai dan laut maupun lingkungan sekitarnya. Setelah kondisi limbah pabrik tidak lagi mengandung racun, atau di kolam terakhir ikan-ikan peliaraan sudah bisa hidup, barulah salurannya dialirkan ke sungai sehingga masyarakat dapat menerima dengan tangan terbuka. Bukan seenaknya mengalirkan limbah ke sungai. Perusahaan untung sementara warga buntung (menderita).Tapi, harus ditunjukkan pada warga masyarakat sekitar tambang. Intisari Jangan melakukan rekayasa, seperti pernah terungkap, satu perusahaan tambang atau bubur kertas membuat unit pengelola Selain merusak hutan, pabrik limbah fiktif. Saat dilakukan peninjauan dari limbah tambang emas di- dalam kolam ditemukan ikan jenis air laut. sekali penipuannya. khawatirkan meracuni Tampak Aksi ‘’anarkis’’ di Muara Batangtoru ini juga warga masyarakat se- bisa dikendalikan jika aparat keamanan sigap melakukan antisipasi sejak awal sehingga kitar Polres Tapsel terkesan kecolongan. Apalagi kalau jumlah personel yang hadir di lokasi pada saat terjadi aksi pembakaran cukup banyak sangat kecil massa berani bertindak anarkis. Boleh saja pihak berwajib melakukan penyelidikan dan mencari para pelaku pembakaran untuk pertanggungjawaban. Tapi melihat aksi-aksi massa yang main hakim sendiri sebagaimana terjadi selama ini tidaklah mudah. Apalagi aksi brutal dan anarkis itu dipicu pihak ketiga. Dan satu hal yang tidak boleh didiamkan adalah mencari tahu latar belakang mengapa aksi ‘’anarkis’’ itu terjadi. Justru itu jangan pilih kasih. Silakan para pelaku ‘’anarkis’’ ditindaklanjuti, namun dasar warga melakukan ‘’anarkis’’ terkait pembuangan limbah juga harus ditindaklanjuti. Kalau tidak, permasalahan dan perseteruan perusahaan tambang emas dengan warga sekitarnya tidak akan pernah selesai karena masyarakat sangat dirugikan dengan kerusakan lingkungan di daerahnya. Segelintir orang saja yang diuntungkan, apalagi kalau cadangan emasnya sudah habis, maka kondisi alam di sekitarnya bisa dipastikan akan hancur –berantakan dan mengerikan. Sebagai contoh kasus perusahaan pertambangan emas raksasa asal Amerika Serikat PT Newmont Nusa Tenggara dan Freeport di Papua telah mengeksplorasi kawasan hutan lindung dengan kompensasi yang sangat minim untuk Indonesia dan masyarakat di sekitarnya sehingga selalu menimbulkan aksi unjuk rasa, bentrok, konflik sosial dll. Pihak investor biasanya tidak peduli akan kerusakan lingkungan di sekitarnya. Setelah cadangan emas, perak, tembaganya ludes nanti mereka akan segera hengkang. Tinggallah masyarakat di sekitarnya hidup dalam penderitaan lahir dan batin. Harusnya perusahaan pertambangan apakah emas dll tidak hanya mengurus izin dari kalangan pejabat dan elitisnya saja, tapi juga memperoleh izin dari masyarakat di sekitar areal tambang. Sebab, mereka yang merasakan dampaknya, seperti suara ‘’bom dan dinamit’’ untuk memecahkan gunung dan bukit, termasuk merasakan dampak kerusakan lingkungan dan limbahnya. Hitung-hitungannya juga harus menguntungkan buat pusat dan daerah. Jangan sampai emasnya habis rakyatnya tetap miskin, pembangunan di daerah itu tetap saja memprihatinkan. Dan jika memang tidak membawa kesejahteraan bagi masyarakat dan pembangunan daerah, apalagi membuat warga sekitar bergolak marah sebaiknya izin eksplorasi dicabut.+


Faks 061 4510025

Facebook Smswaspada

+6282168040028 Perang Iran melawan Amerika/PBB, akan terjadi. Dalam waktu 1 tahun ini. +6282166180203 EURO 2012 telah bergulir para jagoan terpilih benua biru siap tempur di tanah POLANDIA UKRAINA,diatas lapangan biru mereka adu fisik,strategi,skill individu,emosional dan banyak lagi yg dipertaruhkan,jutaan mata dipenjuru dunia menyaksikan parade bintang dunia dlm mengolah sikulit bundar,tak terkecuali kita di negeri ini hanya bisa menyaksikan diantara carut marut persepakbolaan indonesia, dualisme yg terjadi,gaji pemain yg tak dibayar,aksi anarkis para suporter,aksi pemukulan terhadap pengadil lapangan dan banyak lagi yg sangat memalukan dari sepak bola kita,ingat lagi hadiah manis yg diberikan bahrain 10 kosong tanpa bls,ditahan philipina dua dua yg dlm sejarahnya kita tak pernah seri ataupun kalah bila jumpa,tragis memang bukan tambah maju tapi semakin terpuruk ke dasar samudera,kita masih bisa berbangga diri dlm keterpurukan ini karena kita masih dpt menciptakan puluhan pemain kelas dunia seperti ronaldi. +6285262513825 Kepada pemerintah ACEH. khususnya ACEH TAMIANG.Kalau Rakyat jelata kendaraan mereka umumnya berpelat BL. Kenapa kalau pejabat semua kendaraan mereka berpelat BK. Jadi pendapatan Daerah akan berkurang.Tolong kepada pemimpin ACEH Tertibkan Agar pejabat pemerintah membayar pajaknya di ACEH. Ini saran buat pemerintah kita yg baru. Semoga ACEH Tetap jaya.wasalam....PUTRA TAMIANG +6282168040028 Jarak 500000 meter keatas tebok Cina dapat dilihat dari udara. artinya 100000 ribu meter bisa juga. sebahagian penduduk dunia tidak percaya. jadi supaya percaya, tidak usah jauh kali. jadi orang bisa melihat. Dan bisa dapat uang banyak. jadi khususnya sebahgian orang islam yang tadinya tidak percaya jadi percaya. itu tembok cina bisa dilihat dengan teleskop, hanya pengkuan sendiri. angin/udara dan awan serta hasil minyak bumi yang telah dipakai, juga kabut.Itu yang dilihat teleskop itu. Lagi pula warna bumi sama dengan angin/udara dll itu. Itu dapat dilihat dari warna laut, biru. +6287744832383 Pak KADIS BATU BARA,apa kabarnya uang sertifikasi kami,kenapa belum dicairkan juga. janjinya bulan april.apalagi yg ditunggu? +6282168040028 a hal tidak ada. Kita bisa mengetahui bumi berputar. Kita berdiri dilapangan. Helikopter berputar diatas kepala kita. Perputaran helikopter itu tetep diatas kepala kita. Misalnya selama 2 jam. Jadi jika helikopter perputaratnya tidak sejajar diatas kepala kita. Maka benar bumi berputar. Tetapi kalau tetap seperti semula. Maka bumi itu tidak berputar. Pendapat saya sudah jelas. Helikopter tetep berada diatas kepala kita. +6285361741578 Kepada Dinas Pertambangan Langkat mohon tertibkan penambang pasir di dekat jembatan Sei Wampu Stabat. Kepada Pak Kapolres Langkat tangkap d pengusaha pen Sei Wampu. wassalam Rusdi +6285275437438 PSAP MEMALUKAN ACEH,Kalah lagi 7-1 dari Persipura Jayapura sangat Memalukan,mrk tdk layak main di ISL dan cocok main di Div Utama setingkat PSBL Langsa dan PSLS Lhokseumawe,pemain asingnya tdk berbobot.

WASPADA Kamis 14 Juni 2012

Keamanan Dan Perubahan Iklim Oleh Handa S.abidin, SH, LL.M Saat ini sejumlah pulau kecil di Indonesia telah tenggelam. Baru-baru ini bahkan diberitakan sekitar 120 pulau yang ada di Provinsi Kepulauan Riau akan tenggelam dalam 10 tahun ke depan.


eberapa waktu lalu Jill Fitzsimmons, seorang peneliti dari Media Matters for America merangkum pernyataan sejumlah pensiunan tokoh militer Amerika Serikat (AS) mengenai bahaya perubahan iklim bagi keamanan nasional AS. Hampir seluruh negara telah terikat secara hukum dengan Protokol Kyoto yang mewajibkan negara maju untuk mengurangi emisinya. Negara yang tidak terikat secara hukum dengan Protokol Kyoto dapat dihitung dengan jari. AS merupakan salah satunya. Sampai saat ini tidak ada perjanjian internasional yang mewajibkan AS untuk menurunkan tingkat emisinya secara nasional. Meskipun demikian, bukan berarti AS tidak cemas. Rangkuman Fitzsimmons memperlihatkan kecemasan mantan petinggi militer AS terhadap masalah perubahan iklim. Jenderal Gordon Sullivan (Purn) mengatakan perubahan iklim adalah permasalahan keamanan nasional (CNA, 2007). Pendapat yang sama juga dikemukakan oleh Jenderal Bob Barnes (Purn) (Nature Conservancy, 2009), Vice Admiral Richard Truly (CNA, 2007), dan Vice Admiral Lee Gun (2009). Kenapa pensiunan tokoh militer AS khawatir? Vice Admiral Dennis McGinn (Purn) mengatakan dampak perubahan iklim yang mengakibatkan kelangkaan kebutuhan pokok akan memperburuk stabilitas keamanan suatu negara, terutama negara-negara lemah (AMNH, 2010). Negara-negara ini menurut McGinn berpotensi menjadi negara gagal yang dapat menyuburkan ladang bagi pertumbuhan benih-benih kriminal dan terorisme karena alasan kemiskinan. McGinn memberi contoh apa yang telah terjadi di Darfur (Sudan) dan Somalia dapat terjadi pada negaranegara lemah lainnya apabila dampak perubahan iklim tidak diminimalisir Sejumlah jenderal (Purn) lainnya juga mengaitkan bahaya dampak perubahan iklim dengan potensi tumbuhnya kegiatan terorisme, misalnya Jenderal Anthony Zinni (Purn) dan Admiral Joseph Lopez (Purn) (CNA, 2007). Para tokoh militer AS tersebut cemas apabila negara-negara “gagal” tersebut, cepat atau lambat akan menghantui kondisi keamanan AS. Selain itu AS juga me-

miliki kekhawatiran apabila pulau Diego Garcia yang saat ini digunakan sebagai pangkalan militer Britania Raya dan AS akan tenggelam apabila permukaan laut mengalami kenaikan akibat dampak perubahan iklim (Gunn, 2009). Menurut Gunn lokasi pulau ini sangat strategis secara militer bagi AS untuk menjaga situasi keamanan di Timur Tengah dan Asia Tengah. Kecemasan bukan hanya datang dari pensiunan tokoh militer AS saja. Menteri Pertahanan AS, Leon Panetta pada saat menghadiri acara Environmental Defense Fund pada bulan Mei 2012 lalu mengatakan dampak perubahan iklim yang menimbulkan bencana akan meningkatkan permintaan akan bantuan kemanusian dan rehabilitasi wilayah yang terkena bencana. Dengan kata lain akan timbul anggaran tambahan untuk mengatasi masalah tersebut. Indonesia Perlu Cemas Perlukah Indonesia cemas terhadap dampak perubahan iklim? Hampir 2000 tahun yang lalu Marcus Aurelius pernah mengatakan kemiskinan adalah ibu dari segala kejahatan (Mason, 2009). Pernyataan Aurelius masih relevan dengan kondisi hari ini. Hancurnya atau hilangnya wilayah di Indonesia akibat perubahan iklim akan mengakibatkan kemiskinan pada penduduk yang terkena dampak tersebut yang pada akhirnya sangat berpotensi menyuburkan tingkat kejahatan. Apakah Indonesia sudah memprioritaskan permasalahan perubahan iklim dalam konteks pertahanan dan keamanan? Kementerian Luar Negeri RI pernah menyelenggarakan acara mengenai ”Perubahan Iklim dan Kemungkinan Dampaknya Terhadap Keamanan Negara: Implikasi bagi Indonesia” pada tahun 2010 lalu. Fokus yang dibahas dalam acara tersebut salah satunya mengenai wilayah daratan yang dapat tenggelam akibat perubahan iklim. Siaran pers Kementerian Luar Negeri RI terkait dengan acara tersebut mengatakan dengan proyeksi kenaikan permukaan laut kira-kira 0,56 meter di tahun 2050, Indonesia berpotensi akan kehilangan wilayah sekitar 30.120 km+ (Kemenlu, 2010). Menurut siaran pers tersebut hal ini dapat terjadi pada tahun 2050 nanti. Tentu kenaikan permukaan

laut yang lebih tinggi dari 0,56 meter akan semakin banyak menenggelamkan wilayah daratan Indonesia. Saat ini sejumlah pulau kecil di Indonesia telah tenggelam. Baru-baru ini bahkan diberitakan sekitar 120 pulau yang ada di Provinsi Kepulauan Riau akan tenggelam dalam 10 tahun ke depan (Antara, 9 Juni 2012). Selain potensi pulau kecil tenggelam, wilayah pesisir padat penduduk juga memiliki resiko tenggelam secara permanen atau tidak permanen (banjir). Dalam hal ini pemerintah perlu memperhatikan daerah pesisir, terutama yang padat penduduk untuk mencegah dan mengurangi dampak perubahan iklim dalam konteks keamanan nasional. Seberapa tinggi kenaikan permukaan laut akan terjadi sangat tergantung pada komitmen negara-negara terbesar penghasil emisi gas rumah kaca dalam mengurangi emisinya karena kenaikan permukaan laut turut dipicu oleh perubahan iklim (IPCC, 2007). Oleh karena itu salah satu cara apabila Indonesia ingin mengurangi dampak perubahan iklim secara maksimal di wilayahnya, Indonesia perlu membuat negara-negara penghasil emisi terbesar di dunia seperti AS, China, India, dan juga Indonesia sendiri berkomitmen untuk mengurangi emisinya. Negosiasi perubahan iklim di Durban yang dilakukan pada 2011 lalu telah menyepakati pembentukan Ad Hoc Working Group on the Durban Platform (ADP). Fungsi utama dari ADP antara lain untuk mempersiapkan instrumen hukum mengenai penurunan emisi dari semua pihak yang telah terikat secara

hukum oleh Konvensi Kerangka Kerja PBB mengenai Perubahan Iklim tahun 1992 (UNFCCC) paling lambat tahun 2015 sehingga dapat diterapkan pada tahun 2020. Perlu digarisbawahi, kesepakatan ini belum tentu terjadi mengingat rentang waktu yang panjang. Perubahan susunan pemerintahan di suatu negara dapat saja mengubah kesepakatan yang tidak mengikat secara hukum ini. Pertemuan pertama ADP yang dilakukan di Bonn beberapa saat lalu tidak berjalan dengan mulus. Saat ini ADP belum memperlihatkan suatu hasil positif dalam membentuk rancangan kesepakatan tersebut. Perjalanan kesepakatan pengurangan emisi gas rumah kaca secara global yang mengikat secara hukum masih harus menempuh jalan panjang dan berliku. Indonesia perlu menjadi negara terdepan untuk memastikan keputusan Konferensi Para Pihak (COP) ke-17 dapat terlaksana. Bahkan, akan lebih baik apabila Indonesia dapat mendorong percepatan komitmen penurunan emisi secara global pada COP berikutnya. Indonesia perlu mengingatkan negara-negara penghasil emisi besar mengenai ancaman keamanan nasional dan global yang dapat timbul dari dampak perubahan iklim. Kesepakatan pengurangan emisi secara global dengan menjalani prinsip “Tanggung Jawab Bersama yang Dibedakan” (Common but Differentiated Responsibilities) pada akhirnya akan menguntungkan semua negara. Penulis adalah Peneliti Hukum Perubahan Iklim Internasional, Kandidat Ph.D Dari Edinburgh Law School, UK.

Memaknai Ujian Oleh Nana Raihana Askurny, SPd, SH, MHum

...siapkah bangsa ini menghadapi ujian tanpa adanya pengawasan?


i Indonesia, bulan Juni adalah bulan penuh ujian. Sesuai kurikulum dan kalender pendidikan di Indonesia tahun ajaran akan berakhir di bulan Mei sampai dengan Juni. Dari tingkat pendidikan terendah yakni Taman Kanak-kanak (TK) sampai dengan Perguruan Tinggi pada bulan Mei atau Juni adalah masa-masa penutupan sebuah fase tahun ajaran. Maka tidak heran, ujian demi ujian terselenggara pada ke dua bulan ini. Mulai dari ujian kenaikan kelas, kelulusan sekolah, kenaikan semester pada pergeruan tinggi, ujian atau seleksi masuk sekolah, akademi ataupun perguruan tinggi.Ada banyak cerita menarik pada bulan-bulan ini, berkaitan dengan ujian. Tidak hanya pelajar, murid, ataupun mahasiswa yang sibuk wara-wiri mempersiapkan ujian, para orang tua pun teramat kerepotan membantu anak-anaknya untuk dapat lulus dalam melewati tahapan-tahapan ujian. Tak pelak, dari cara fair sampai curang menjadi pilihan alternatif bagi para orang tua dan pelajar untuk satu kata akhir yaitu Lulus. Adapun cara elegan yang kerap dipilih para orang tuanya yaitu di antaranya memasukkan anakanak mereka ke lembaga-lembaga kursus bimbinngan tes dan belajar yang berani menajamin tingkat kelulusan berdasarkan porsentase tertinggi, ataupun memanggil guru-guru privat di rumah demi sebuah kelulusan. Namun tidak sedikit, orang tua, yang tidak dapat dimengerti dari mana idenya, mencari cara-cara ”abrakadabra” untuk memuluskan jalan putra-putrinya agar lulus dari sebuah ujian. Maka muncullah istilah-isilah gacok, joki, atau dalam istilah perfilman dikenal sebagai stunt man , yaitu pelaku pengganti peserta ujian, tak tanggung-tanggung ratusan ribu bahkan jutaan rupiah disiapkan para orang tua untuk jasa orang-orang ini.Pengawasan UjianSelayaknya ujian adalah momen-momen terindah bagi peserta didik, mengapa tidak. Proses belajar yang berbulan-bulan dihadiri dan dipatuhi tentunya menuntut sebuah hasil dan pembuktian. Pembuktian bukan hanya bagi peserta didik juga bagi para pendidik, yakni merujuk pada hasil belajar yakni bagi pelajar dan hasil mengajar bagi para pengajar. Namun dalam kenyataannya, ujian menjadi ajang menang-kalah baik itu bagi pelajar dan juga pengajar. Hanya ada dua hasil dari sebuah ujian yakni jika lulus berarti akan menjadi pemenang, dan jika tidak lulus ujian akan menjadi pecundang. Tentunya, setiap orang apalagi pelajar

tidak ingin menjadi pecundang, pemaknaan pemenang dan pecundang menyebabkan peserta didik dan pendidik menjadi ”haus” akan ”gelar juara”, ini sekali lagi akan memosisikan seorang peserta didik sebagai petarung dan bukan pelajar.Maka tidak heran pemerintah dengan segala daya dan kekuasaannya menyiapkan langkah-langkah mengawal dan mengawasi jalannya sebuah ujian negara. Seperti yang terjadi di musim ujian nasional (UN) kemarin, untuk kelulusan SD, SMP, SMA dan juga pada ujian sertifikasi guru, miliaran anggaran negara dikucurkan hanya untuk ”mengupah” tenaga pengawas ujian bahkan dengan melibatkan unsur POLRI dan TNI. Namun anehnya, sekali lagi, tetap saja ada celah melakukan kecurangan. Dari kasus raibnya lembar jawaban, pemakaian ponsel pada saat ujian, bahkan nomor ujian yang ganda, menjadi persoalan ujian setiap tahunnya. Untuk sebuah perguruan tinggi negeri yang merupakan muara cita-cita dan harapan pelajar-pelajar berprestasi, pelaksanaan ujian untuk menjaring pelajar unggulpun tak lepas dari pengadaan sebuah sistem pengawasan. Maka dengan bekerjasama dengan beberapa perguruan atau lembaga tinggi lainnya, biasanya PTN menyiapkan tenaga-tenaga dosen yang akan menjadi ”polisi” dalam mengawasi jalannya ujian.Begitu pula dengan pelaksanaan ujian pada perguruan tinggi atau sekolah-sekolah pada umumnya, masa-masa ujian adalah masa yang mengerikan bagi peserta didik. Masa melelahkan bagi pengajar karena seluruh konsentrasi lembaga pendidikan difokuskan pada penyelenggaraan pengawas ujian. Ironisnya, karena dipandang cukup melelahkan, setiap tenaga pengawas memperoleh upah atau honor atas kerja kerasnya selama mengawas ujian.Penulis sempat tertegun, siapkah bangsa ini menghadapi ujian tanpa adanya pengawasan? Tentu ini tidak akan menjadi pertanyaan jika seseorang tidak pernah melihat bagaimana orang-orang dari bangsa-bangsa lain menghadapi ujian. Penulis yang juga pengajar bahasa Indonesia untuk orang asing, keseharian tugasnya adalah mengajari dan menguji pencapaian belajar murid asing dari berbagai bangsa di dunia. Pada saat kali pertama menguji orang asing, penulis sangat terkesima dan tertegun menyaksikan bagaimana tenangnya orang-orang asing tersebut menghadapi ujian. Penguji tidak perlu repot-repot mengawasi karena para peserta ujian pasti tidak akan curang,

mereka akan sibuk pada kertas ujian masing-masing. Jika tidak ada penghapus, mereka akan membiarkan kertas ujiannya terdapat coretan, jika tidak paham mereka cukup bertanya pada penguji dan bukan pada peserta ujian lainnya.Refleksi Karakter BangsaBagi penyelenggaraan pendidikan, ujian merupakan alat untuk mengukur atau ”tool of measurement” keseluruhan sistem pelaksanaan belajar mengajar— yakni dari seleksi masukan (input selection), proses belajar mengajar (teaching-leraning process), dan evaluasi hasil (output evaluation). Artinya, ujian adalah sebuah syarat yang harus dipenuhi namun bukanlah sebuah kemutlakan prosedural atau absolute procedure, yang menyebabkan seseorang itu menjadi pemenang ataupun pecundang. Orientasi sebuah ujian sebagai sebuah hasil akhir tentulah menjadi sebuah bahan pemikiran. Jika menyaksikan bagaimana bangsa lain meyikapi dan memaknai sebuah ujian seperti yang disaksikan oleh penulis sendiri tentulah tidak ada yang harus takut menghadapi ujian. Sebab, ujian, pada dasarnya adalah pengulangan dari proses-proses belajar yang telah dilalui sebelumnya, maka tidak ada kegagalan untuk itu.Banyak tindak-tanduk masyarakat Indonesia yang bisa merefleksikan bagaimana sebenarnya karakter bangsa Indonesia. Bisa dari tindak tutur atau bahasa, kajian sastra, kecendrungan terhadap kesukaan, dan lain-lain, namun, penulis meyakini bahwa karakter bangsa bisa secara kasat mata tercermin dari sebuah penyelenggaraan ujian. Tanpa mendiskreditkan fungsi dan peran sebuah ujian, penulis hanya akan menguraikan bagaimana bangsa yang pernah terjajah ratusan tahun ini menyikapi dan memaknai sebuah ujian.Dari sebuah penyelenggaraan ujian ada beberapa refleksi karakter bangsa yang secara vulgar dapat teramati yakni tidak percaya diri, tidak punya harga diri, gotong royong atau kesetiakawanan, beroerintasi pada hasil bukan pada proses. Tentu tidaklah semua bagian bangsa ini yang mengalami ”gagap ujian”. Namun setidaknya secara umum itulah yang tergambar pada saat terselenggaranya ujian. Tidak percaya diri, peserta didik tidak pernah mempunyai kepercayaaan diri terhadap kemampuannya sendiri, ini menyebabkan pelajar Indonesia selalu ingin berkonsultasi dengan temannya pada saat ujian. Tidak punya harga diri, diawasi pada saat ujian berarti diperlakukan seperti layaknya ”pencuri” yang selalu harus diawasi ketika melakukan aksinya, sederhananya, tindak-tanduk selama ujian pastilah curang. Seharusnya karakter ini tidak perlu ada, jika seluruh pelajar memiliki cukup harga diri. Gotong royong, perbuatan menyontek, memberi

jawaban kepada teman, dianggap sebuah perbuatan mulia yakni gotong royong, padahal pada saat ujian adalah saat-saat pembuktian kemampuan pribadi.Yang terakhir, berorientasi pada hasil bukan proses, bagaimanapun cara dan metodenya, selagi nilai yang didapat sangat baik atau baik dan mampu meluluskan peserta ujian, maka perbuatan curang akan dimaklumi.Tidak ada yang tidak mungkin di dunia ini, menjadikan ujian sebagai sebuah fase yang menggembirakan dan membanggakan tentunya bukan hal yang mustahil. Pembenahan tentu diperlukan di sana sini. Dari pemangku kepentingan, pelaksana sampai masyarakat luas turut membidani sebuah ujian akan menjadi ajang pembuktian diri bagi perserta ujian dan bukan sebagai ajang penghakiman seorang terdakwa. Penulis adalah Aktivis Perempuan Aisyiyah, Peneliti Dan Penerjemah Balai Bahasa Medan.

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di Media manapun.Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Tarif listrik diisyaratkan naik - Kalau turun baru paten! * Arus penumpang padat, tiket pesawat naik - Tak mau kalah dengan tarif listrik * Medan kawasan strategis bisnis kuliner - Termasuk bisnis billboard!


D Wak


WASPADA Kamis 14 Juni 2012

Ancaman Awal Pilgubsu 2013

Perampokan Semakin Meresahkan Masyarakat merupakan sekelompok orang yang membentuk sebuah sistem semi tertutup atau semi terbuka dimana sebagian besar interaksinya adalah antara individuindividu yang berada dalam kelompok tersebut. Dengan mengingat bahwa manusia yang satu tidak akan bisa hidup tanpa ada bantuan atau relasi dengan manusia lain. Maka untuk itulah seorang manusia sangat membutuhkan manusia lain untuk melangsungkan hidupnya. Selain itu semua, masyarakat juga sangat membutuhkan kenyamanan dan keamanan dalam lingkungan hidupnya. Tapi bagaimanakah jika masyarakat tidak mendapatkan keamanan itu lagi? Seperti yang sering sekali terjadi di Medan tepatnya di sekitar Mandala, perampokan sangat sering sekali kita dengar atau kita jumpai dan sepertinya perampokan atau pencurian sudah tidak asing lagi di daerah ini saat ini. Adapun pencurian yang paling sering terjadi adalah pencurian sepeda motor dengan waktu hanya sekejap mata. Tentu saja warga sangat merasa khawatir dan terganggu dengan kejadian yang berulang-ulang kali ini. Dan akibatnya masyarakat merasa tidak nyaman lagi dengan lingkungan seperti ini. Perampokan ini benarbenar sangat meresahkan warga atau masyarakat yang berada di posisi ini. Lalu, bukankah negara menjamin keamanan dan kenyamanan setiap orang? Inilah yang menjadi pertanyaan saat ini. Untuk itu masyarakat sangat mengharapkan supaya keamanan di daerah ini dan daerah-daerah lain yang mengalami kejadian serupa agar keamanannya dapat diperketat. Dan masyarakat juga sangat mengharapkan agar kejadian ini dapat segera ditindaklanjuti. Adelina Sarumpaet Mahasiswa PPKn UNIMED

Surat Terbuka Untuk Bapak HM Nasir, LC, MA Assalamualaikum Warahmatullahi Wabarakatuh Sangat menarik perhatian kami atas tulisan bapak di Harian Waspada tanggal 1 Juni 2012 di halaman C5 kolom Mimbar Jum’at dengan hudul “Bagaimana Seyogyanya azan dikumandangkan|” Dari pengamatan kami selama ini, ibadah azan oleh sebagian orang dianggap remeh, padahal azan itu berhubungan erat dengan ibadah shalat. Dari uraian bapak ternyata betapa azan tersebut sangat penting dan diatur dengan dalil dalil yang shohih dari Rasulullah SAW. Namun demikian Bapak Ustadz Nasir mungkin terlupa beberapa hal yang berhubungan dengan mengumandangkan azan. Oleh karena itu mohon penjelasan dari bapak ustadz disertai dalil yang shohih tentang: 1. Di beberapa masjid sebelum azan dikum andangkan harus didahului membaca ayat Alquran :” Innalaha wamalaikatuhu..dst”, sementara dimasjid lain hal itu tidak perlu dilakukan, dan malah dibeberapa masjid lain pula boleh baca ayat dan boleh tidak baca ayat, suka-suka muazzin kira-kira begitulah. 2. Di dalam penguburan mayat di pekuburan sebelum mayat dimasukkan keliang lahat dikumandangkan azan,akan tetapi tidak didahuli pembacaan ayat Alquran. Demikian juga pada waktu pemberangkatan calon jemaah haji dikumandangkan azan, akan tetapi tidak didahului dengan membaca ayat Alquran seperti tersebut diatas. Bagaimana sebenarnya hukum tentang membaca ayat Alquran sebelum mengumandangkan azan, karena seperti kelihatan suka-suka muazzin untuk melaksanakannnya. 3. Bagaimana pula bila zaman ini semakin maju, orang semakin pintar menciptakan hukum hukum diluar ketentuan yang sah bolehkah wanita mengumandangkan azan?


Oleh Shohibul Anshor Siregar Kelima Tim Pemenangan Pasangan pada Pilkada DKI 2012 tanpa dikomando sama-sama memprotes DPT (daftar pemilih tetap) yang dianggap bermasalah. Bahkan ada yang mengadukan KPUD DKI ke pihak berwajib.


ejadian seperti ini memang amat lazim di Indonesia, bahkan dapat dicatat sebagai salah satu pertanda negatif terpenting untuk proses demokratisasi Indonesia yang cuma mampu tiba pada capaian prosedural belaka. Bayangkan, pemilihan umum itu kan sebuah mekanisme politik yang memfasilitasi rakyat untuk menunjukkan aspirasinya agar dihitung sebagai akumulasi pengabsahan. Dengannya pula dijanjikan sebuah penentuan masa depan. Tetapi mengapa harus selalu ada pencederaan demokrasi yang dengan sendirinya pula bermakna peruntuhan masa depan? Itulah soal yang tanpa harus berfikir panjang sesungguhnya dapat dijawab dengan menunjuk absennya moralitas apalagi martabat dalam proses politik. Anak kecil saja yang tak tahu ini.Tak hanya untuk Pilkada, bahkan untuk Pilpres sekalipun sudah dianggap lazim. Ingatlah, pada tahun 2008 DPT untuk Pilgubsu juga bermasalah. Karena sangat kerap terjadi dan umum, pastilah masalah ini tidak boleh dipandang sederhana, misalnya sebagai human error belaka. Meski tak akan sanggup bertindak se-elegan Filipina yang menghadapkan seorang mantan Presiden ke peradilan mahkamah karena dugaan perbuatan jahat dalam Pemilu. Paling tidak bangsa ini semestinya sudah mulai mengenal perasaan malu meski itu dari sisi terluar sekalipun. Pada kasus Pilpres rakyat dibuat bingung karena saling tuding antara Depdagri dan KPU. Tetapi dari riuhnya perdebatan yang amat tak produktif tentang itu, ternyata tak kunjung jua ada perubahan yang dilandasi “pertaubatan”. Penduduk Sumut Hampir 16 Juta? Terjadi pertumbuhan penduduk Sumut yang amat spektakuler sepanjang sejarah. Ini diketahui saat penyerahkan Data Penduduk Potensil Pemilih Pilkada (DP4) kepada KPUD Sumut awal bulan ini. Apa penyebab pembengkakan jumlah yang diduga keras amat potensil mengundang masalah itu? Saat penye-

rahan DP4 itu Nurdin Lubis, Sekretaris Daerah Pemprovsu, menegaskan bahwa data yang diserahkannya dijamin tidak bodong dan sudah lengkap by name and by address (dengan nama dan alamat) penduduk sesuai dengan domisili masing-masing. Waktu itu media juga tak lupa mencatat ucapan Nurdin Lubis lainnya: “Kita pertanggungjawabkan, sudah lengkap dan nanti akan diverifikasi lagi oleh KPU”. Sadar akan mengejutkan bagi banyak pihak, Nurdin Lubis pun berucap “Mungkin orang terkejut data penduduk sekarang sudah 15 juta. Padahal selama ini kita anggap 13 juta penduduk,”Memang, dari rekapitulasi secara keseluruhan, diberitakan jumlah penduduk Sumut menurut DP4 itu sudah mencapai 15.977.383 jiwa. Dari jumlah itu kategori pemilih potensial disebut sebanyak 11.300.526 jiwa. Itulah besaran angka DP4. Masih menurut Nurdin Lubis, “angka tersebut sudah jauh dari perkiraan jumlah penduduk selama ini”. Jika menurut DP4 jumlah penduduk Sumut saat ini sebesar 15.977.383 jiwa dan berdasarkan Sensus Penduduk 2010 hanya berjumlah 12.931.065 jiwa, itu berarti dalam kurun yang amat singkat Sumut mengalami lonjakan pertambahan penduduk terbesar sepanjang sejarah, yakni 3.046.318 jiwa hanya dalam satu tahun lebih.Memang luar biasa. Jika dibandingkan dengan pertumbuhan jumlah penduduk Sumut menurut catatan BPS adalah 8.360.894 (1980), 10.256.027 (1990), 11.513.973 (2000) dan 12.982.204 (2010). Sedangkan persentase angka pertumbuhan penduduk Sumut hanyalah 2,06 % selama 1980-1990, 1,20 % dalam kurun 19902000 dan 1,22 % selama 2000-2010. Dari manakah asal pertumbuhan penduduk Sumut yang spektakuler itu? Menurut rumus, kelahiran dan perpindahan masuk penduduk (dari derah lain) adalah faktor yang dianggap umum. Hanya saja menjadi pertanyaan besar apakah jumlah sedemikian besar. Dari manakah penduduk baru itu berasal dan di mana

saja mereka bermukim kini? Betulkah dapat dipertanggungjawabkan dengan menunjukkan nama dan alamat mereka masing-masing?Mencari Faktor PenyebabTidak mungkin kedua pihak berkompeten (BPS dan Pemprovsu) salah semua atau benar semua dalam pembuatan data kependudukan ini. Salah satunya pastilah telah melakukan kesalahan. Itu sangat penting karena Indonesia tidak saja memerlukan kepastian, melainkan juga landasan kebijakan untuk pembangunan. Bisa saja terdapat perbedaan metode dalam pencacahan, yang itu semua sangat perlu dijelaskan oleh kedua belah pihak.Memang anggaran pembuatan maupun veryfikasi DP4 hingga akhirnya menjadi DPT nanti, otomatis akan disesuaikan dengan pertambahan jumlah penduduk itu. Jika hal itulah yang patut diduga menjadi motif di balik pertambahan jumlah penduduk dan DP4 itu, rasanya terlalu berselera rendah. PenutupSatu-satunya mekanisme pengujian yang ditunggu saat ini ialah verifikasi yang menurut aturan dilakukan oleh jajaran KPUD untuk melahirkan

Daftar Pemilih Sementara (DPS). Perubahan demi perubahan kelak akan melahirkan DPT. Jika pekerjaan pada bagian ini tidak karu-karuan sebagaimana pengalaman selama ini, dipastikan masalah besar sudah ditetapkan baik ancaman maupun daya rusaknya terhadap demokrasi. Sayangnya di tengah kecenderungan semakin apatisnya rakyat terhadap politik, akan semakin sempurna pulalah kebobrokan itu kelak.Di DKI kemarin ada spanduk berbunyi “bermuka-dua tanpa nurani, Ber DPT-ganda merusak aspirasi”. Di sela protes terhadap incumbent itu, tuntutan membongkar mafia KTP ganda juga marak. Kubu Faisal Basri, salah seorang Cagub DKI yang menempuh jalur perseorangan dengan tegas menimpakan kesalahan sebagai tanggungjawab incumbent, Foke. Faisal Basrimalahmenegaskanjalanterakhirbuat mereka kelak adalah boikot. Ini memang sebuah bom waktu, sebagaimana ditegaskan oleh Hidayat Nurwahid. Penulis Dosen Sosiologi Politik FISIP UMSU, Koordinator Umum ‘nBASIS.

Atas penjelasan bapak ustadz kami ucapkan terima kasih.

Percepatan Pembangunan Daerah Tertinggal

Mahidin Siregar Medan


Dedi Sahputra

Negeri Penggembira Saya sebenarnya cukup tersinggung mendengarnya. Coba bayangkan, ada orang yang bilangkalaunegeriinidipenuhiolehorang-orang yang kecanduan menjadi penonton, tetapi tidak kecanduan berprestasi. Ini bahaya yang nyata, katanya. Lha, orang-orang di negeri ini-kan termasuk saya, teman-teman, saudara sekampung, saudara se-kota, saudara se-provinsi, saudara sebangsa dan se-negara. Enak saja dibilang kita ini bangsa spesialis nonton bareng. Ngajak ribut apa? Apa dia pikir kita tidak punya prestasi? Apa dia gak tahu kita punya prestasi yang gak terlampaui bangsa lain. Kita pernah punya prestasi bulutangkis (pernah lho), kita dulu pernah punya prestasi sepakbola (kayaknya sih), soal korupsi kita tak ada yang bisa ngimbangi. Uda korupsi, tak tersentuh hukum, dihormati lagi seperti dewa-dewi. Maka hampir saja saya melompat dan kalap menerjang membabibuta orang itu.Walaupun dia tidak sedang di hadapan saya, tapi saya bisa berhalusinasi dia sedang di sini, dan saat ini. Saya gunakan kaki, tangan, dan segala kemampuan untuk membuatnya celaka. Biar tahu rasa. *** Apa yang dinisbatkan dari pernyataan itu adalah perhelatan sepakbola antarnegaradiEropaatauPialaEropasaatini.Sebagaisuatubangsa,selerakitaadalahmenontonbareng.Dihampir sudut kota di seluruh negeri ini, nonton barengmenjadisuatu fen ome n a y a n g menggejala. Saya beranijamin,kemeriahannyatidakkalahdengan kemeriahan di tempat pertandingannya sana. Bedanya, kalau di sana ditonton secara langsung di sini cuma melalui televisi. Teriak keasyikan misalnya: Goooolllll….. sambil lari berkeliling-keliling dan bersalaman dan saling berpelukan. Ini tentu seasyik-asyik hidup itu. Karena ketika menjadi penonton kita akan merasa bebas untuk melakukan apa saja. Merasa gembira luar biasa, memarahi pemain di lapangan; goblok, atau bersedih hati karena kekalahan mereka. Pada level-level tertentu, menjadi penonton bahkan seolah mendapat mandat untuk boleh melakukan apa saja; memblokir arus lalu lintas padat, melempari botol, bahkan memukuli orang sampai mati. Di bangku penonton, kita bisa berhalusinasi bahwa kitalah si pemenang itu, bahkan kecemerlangan mereka adalah kebanggaan kita. Ketika Iker Casillas mengangkat trophy juara dengan penuh kebanggaan, maka di saat kita bisa merasa kebanggaan itu juga merasuk ke diri kita. Ketika Cesc Fabregas dengan taktik tikitakaakhirnyamenjeboljalalawandenganindah,

maka saat itu kepuasan meluap di dadamu. Kalau hidupmu, dari remajamu sampai usia dewasamu bahkan sampai usia tua menjelang “gelap” datang—engkau isi dengan banyak nonton bareng, mengagumi keperkasaan orang lain dan bersedih pula untuk kekalahan mereka. Maka inilah jenis tabiat penggembira. Tabiat yang merasa amat puas untuk sekedar menjadi penonton saja bagi orang lain. Lho, kalau hanya sekedar iseng mengendurkan urat syaraf dengan sesekali nonton bola kegemaran, apa itu salah, protesku sendiri.Tentu saja tidaksalah. Tapi apa yang disebut dengan iseng itu adalah sesuatu yang menjadi sebuah industri besar berskala dunia.Yang bahkan bagi anak-anak muda itu telah menjadikannya sebagaiideology,kiblatbagipanutanbudayanya. *** Untuk menjadi negeri penjajah di dunia ini, ternyata dibutuhkan suatu keberanian dalam diri suatu bangsa. Keberanian itu ditopang oleh kebanggaan atas suatu jati diri sebagai bangsa yang besar dan lebih hebat dari negeri manapun itu. Kebanggaan ini atas jati diri inilah yang telah menggerakkanpenjajahandimukabumiselama ratusan tahun lamanya. Kebanggaan yang pada akhirnya mengalahkan dan menghimpit sisi kemanusiaan— kebanggaan harus sanggup melakukan penindasan manusia atas manusia. Kebanggaan yang kemudian “memaksa”orangyang dijajahuntukikutbanggaataspenjajahanyang dialaminya. Jika untuk menjadi penjajah saja perlu keberanian, maka untuk menjadi pahlawan yang melawan penjajahan,jugaperlukeberanian.Sifatkepahlawanan lahir dari rasa kekaguman pada kepahlawanan itu sendiri. Sang pengagum memiliki motivasi untuk menjadi pahlawan juga—melawan penjajahan. Begitulah selalu kisah klasik tentang kepahlawanan bergulir. Jadi, pahlawan bukan seperti Mr.Bean yang turun dari langit, bisa terbang seperti Superman, bisa jadi besar seperti Hulk. Bukan. Tapi pahlawan adalah manusia biasa yang punya kebanggaan pada sosok dan nilai kepahlawanan, memunculkan kesadarannya akan penindasan dan ketidakadilan, memiliki komitmen melakukan langkah besar untuk orang lain, dan memiliki daya tahan menanggung segala konsekuensi di kesendiriannya— terus begitu sampai jatah hidupnya selesai. Semuanya berawal dari kebanggaan. Maka ketika rasa banggamu hanya untuk tim favoritmu yang asing itu, ini sama artinya engkau telah menandatangani kontrak menjadi penggembira sepanjang hidup bangsamu.(Vol.321, 14/6/2012)

Kolom foliopini dapat juga diakses melalui

Oleh Wahyu Ario Pratomo Nias Barat memiliki nilai IPM terendah di Sumut, disusul dengan Kabupaten Nias Selatan dan Nias Utara.


ejak krisis ekonomi tahun 1997 hingga 2003, ekonomi Sumatera Utara (Sumut) masih terperangkap pertumbuhan rendah, yakni ratarata 4-5% per tahun. Namun sejak tahun 2004 hingga tahun 2011 pertumbuhan ekonomi Sumut mengalami pertumbuhan yang cukup tinggi yakni di atas 6%. Pada tahun 2011, pertumbuhan Sumut mencapai 6,58%. Berdasarkan data Badan Pusat Statistik (BPS), Produk Domestik Regional Bruto (PDRB) Sumut atas dasar harga berlaku tahun 2011 mencapai Rp314,16 triliun. Sektor ekonomi yang paling berperan dalam PDRB adalah sektor industri pengolahan sebesar Rp 70,67 triliun, disusul sektor pertanian sebesar Rp70,64 triliun serta sektor perdagangan, hotel dan restoran sebesar Rp60,03 triliun. Sektor pertanian di Sumut masih cukup dominan akibat berkembangnya perkebunan kelapa sawit dan karet. Bahkan kedua jenis perkebunan ini pulalah yang mendorong berkembangnya sektor industri pengolahan di Sumut. Sektor industri pengolahan dan sektor perdagangan, hotel dan restoran menjadi sektor yang dominan di beberapa kabupaten/kota seperti Kota Medan, Kota Pematangsiantar, Kabupaten Deliserdang dan Kabupaten Batubara. Sementara di daerah lain, sektor pertanian menjadi sektor yang memiliki kontribusi terbesar. Walaupun dari sisi pendapatan, kontribusi sektor pertanian tidak begitu dominan, namun dari sisi penyerapan tenaga kerja, sektor ini memberikan sumbangan yang signifikan. Data BPS tahun 2010 menunjukkan bahwa sektor pertanian di Sumut telah menyerap 46,94% dari total pekerja. Sementara sektor perdagangan, hotel dan restoran serta sektor industri masing-masing hanya menyerap 19,52% dan 7,43%. Penyerapan tenaga kerja yang besar di sektor pertanian terjadi khususnya di daerah kurang berkembang seperti Tapanuli Tengah, Tapanuli Utara, Nias dan Nias Selatan. Di Kabupaten Tapanuli Tengah, sektor pertanian mampu menyerap 55,97% pekerja, sedang di Tapanuli Utara menyerap 53,06% pekerja. Sedangkan di Kabupaten Nias dan Nias Selatan masing-masing menyerap 41,60% dan 40,45% pekerja. Banyaknya jumlah penduduk yang masih bekerja di sektor pertanian menyebabkan pendapatan per kapita di kabupaten ini menjadi relatif rendah jika dibandingkan kabupaten/kota yang lainnya. Berdasarkan data BPS tahun 2010, pendapatan per kapita terendah di Sumut terdapat di kabupaten Nias Barat yakni sebesar Rp7,03 juta per tahun. Kondisi yang sama juga dialami kabupaten lain di Kepulauan Nias. Pendapatan per kapita tertinggi di Kepulauan Nias terdapat di Kabupaten Nias Utara yakni sebesar Rp8,68 juta per tahun. Pendapatan ini hanya 20% dari

pendapatan perkapita Kota Medan sebagai daerah yang memiliki pendapatan tertinggi di Sumut. Rendahnya pendapatan per kapita masyarakat di Kepulauan Nias menyebabkan jumlah penduduk miskin dan indeks pembangunan manusia (IPM) juga tidak menggembirakan. Data BPS tahun 2010 menunjukkan bahwa Kota Gunungsitoli merupakan daerah dengan persentase penduduk miskin terbesar di Sumut yakni mencapai 33,87%. Disusul kabupaten Nias Utara dan Nias Barat, masing-masing sebesar 31,94% dan 30,89%. Kabupaten di kepulauan Nias yang paling rendah persentase penduduk miskinnya adalah Kabupaten Nias, yakni sebesar 19,98. Dari segi IPM, kabupaten di kepulauan Nias sangat tertinggal dibanding daerah lainnya di Sumut. Adalah kabupaten Nias Barat yang memiliki nilai IPM terendah di Sumut, disusul dengan Kabupaten Nias Selatan dan Nias Utara. Rendahnya angka ini lebih disebabkan oleh angka melek huruf di kabupaten ini yang masih relatif rendah yakni sekitar 85,0%. Selain penduduk yang mayoritas merupakan petani, rendahnya pendapatan per kapita di Kepulauan Nias disebabkan beberapa faktor seperti jumlah investasi, infrastruktur jalan, jumlah sekolah dan ketersediaan infrastruktur lainnya. Dari segi jumlah investasi, jumlah industri besar dan menengah di kabupaten yang ada di Kepulauan Nias sangat memprihatinkan. Data BPS tahun 2010 menunjukkan bahwa industri besar dan menengah hanya terdapat dua industri di Nias Selatan dan satu industri di Kota Gunungsitoli. Rendahnya niat investor besar dan menengah di kabupatenkabupaten ini disebabkan infrastruktur yang buruk, seperti infrastruktur jalan. Di Kabupaten Nias, dari 554,3 km jalan yang ada, 419,5 km (75,6%) merupakan jalan dengan kondisi rusak dan rusak berat. Hal senada juga terjadi di Kabupaten Nias Selatan. Dari 600,2 km jalan yang tersedia, 372,8 km (62,1%) merupakan jalan yang buruk. Buruknya kondisi sosial dan ekonomi pada beberapa kabupaten/kota di Sumut khususnya di Kepulauan Nias, memerlukan kebijakan yang strategis. Perlu dibuat strategi percepatan pembangunan khususnya yang melibatkan kabupaten/kota tertinggal. Pemerintah pusat telah menjadikan Sumut sebagai pusat pertumbuhan ekonomi Koridor 1 dalam MP3EI (Masterplan Percepatan dan Perluasan Pembangunan Ekonomi Indonesia). Dalam MP3EI, pemerintah telah mendesain 41 proyek skala besar yang sumber dananya dari Pemerintah, BUMN dan Swasta. Nilai investasi proyek-proyek ini direncanakan mencapai Rp43 triliun. Sebagian besar dana investasi proyek ini digunakan untuk membangun infrastruktur seperti jalan tol, pelabuhan udara (Kualanamu), pela-

buhan laut (Kualatanjung), jalan kereta api dan energi. Guna mendorong pertumbuhan ekonomi Sumut yang lebih tinggi melalui penciptaan nilai tambah yang lebih tinggi lagi, pemerintah melalui PP No. 29 Tahun 2012, menetapkan Kawasan Ekonomi Khusus (KEK) Sei Mangkei sebagai kawasan industri kelapa sawit. Pembangunan KEK diharapkan dapat mendorong percepatan pembangunan daerahdaerah tertinggal di Sumut, termasuk di Kepulauan Nias. Sayangnya dari ke41 mega proyek yang diusulkan, tidak satupun secara spesifik dirancang untuk pembangunan infrastruktur di Kepulauan Nias. Akan tetapi, walaupun tidak dirancang secara khusus, pembangunan infrastruktur diharapkan akan memberikan dorongan bagi pertumbuhan ekonomi di seluruh kabupaten/kota di Sumut. Di samping itu, percepatan pembangunan di daerah tertinggal dapat dicapai dengan pembangunan infrastruktur yang cukup, hemat dan tepat sasaran. Ketertinggalan pembangunan ekonomi di Kepulauan Nias sudah terjadi sebelum daerah ini diguncang bencana gempa dan tsunami pada tahun 2004. Bencana alam yang terjadi ketika itu menyebabkan daerah ini menjadi semakin tertinggal dari kabupaten/kota lainnya. Upaya-upaya untuk mengejar ketertinggalan pembangunan ekonomi di Kepulauan Nias telah dilakukan oleh pemerintah, swasta dan LSM. Beberapa negara di Eropa seperti European Commission, Belanda, Inggris, Bank Dunia, Swedia, Denmark, Norwegia, Jerman, Kanada, Finlandia, Belgia, Bank Pembangunan Asia, Amerika Serikat, Salendia Baru dan Irlandia menghimpun dana dalam satu wadah yang disebut Multi Donor Fund (MDF) untuk Aceh dan Nias. Dalam pembangunan Nias, MDF telah mengeluarkan dana sebesar US115 juta dollar atau sekitar Rp1,03 triliun untuk membiayai 14 jenis proyek yang dikerjakan oleh LSM dan pemerintah daerah dalam bentuk penyediaan sarana dan prasarana, peningkatan kapasitas masyarakat melalui proyek ILO-RACBP (International Labor Organization – Rural Access and Capacity Building Project). Program ini merupakan salah satu inisiatif pembangunan yang cukup efektif dalam mengatasi gap kebutuhan infrastruktur dengan dana yang minim tetapi memiliki multiplier effect yang cukup besar. Dampak dari pembangunan yang didanai MDF secara fisik adalah terbangunnya infrastruktur trasportasi pada 3 klaster yakni di Utara, Tengah dan Selatan Nias, pembangunan kembali pelabuhan, rehabilitas perumahan masyarakat, dan akses ke pedesaan serta pemeliharaan jalan dengan menggunakan teknologi berbasis lokal. Selain fisik, MDF juga melakukan pelatihan dan pembangunan kapasitas pada masyarakat pedesaan, tokoh masyarakat dan Bappeda. Secara makro, dampak pembangunan kembali Kepulauan Nias peningkatan pendapatan per kapita, pertumbuhan ekonomi, kemiskinan dan tingkat pengangguran terbuka (TPT). Akibat bencana tsunami pada tahun 2005, per-

tumbuhan ekonomi di Kabupaten Nias mengalami pertumbuhan -3,61%. Hal yang sama juga terjadi di Kabupaten Nias Selatan yang pertumbuhannya sebesar -2,12%. Pembangunan infrastruktur, kelembagaan, serta pemberdayaan masyarakat sejak tahun 2005, telah membawa dampak yang cukup signifikan bagi pertumbuhan ekonomi di Kepulauan Nias. Mulai tahun 2006 pertumbuhan ekonomi Kabupaten Nias telah berbalik menjadi positip yakni sebesar 4,65%. Demikian pula Kabupaten Nias Selatan, pertumbuhannya menjadi 3,99%. Sejak tahun 2007 hingga 2010, ekonomi Kabupaten Nias rata-rata tumbuh sebesar 6,69%. Sedangkan pertumbuhan ekonomi Kabupaten Nias Selatan ratarata hanya tumbuh 4,45%. Upaya untuk mempercepat pertumbuhan ekonomi di Kepulauan Nias melalui pemekaran Kabupaten Nias Barat, Nias Utara dan Kota Gunung Sitoli saat ini cukup efektif. Hal ini ditunjukkan dengan pertumbuhan di ketiga daerah ini yang cukup tinggi yakni di atas 6,0%. Kondisi yang semakin membaik pasca pembangunan ekonomi di Kepulauan Nias, juga ditunjukkan oleh peningkatan pendapatan per kapita masyarakat. Pada tahun 2005, pendapatan per kapita Kabupaten Nias dan Kabupaten Nias Selatan masing-masing sebesar Rp3,5 juta dan Rp3,4 juta. Pada tahun 2010, pendapatan per kapita di Kabupaten Nias dan Nias Selatan telah tumbuh lebih dari dua kali lipat yakni masing-masing mencapai Rp8,7 juta dan Rp7,7 juta. Bahkan di Kota Gunung Sitoli pendapatan perkapita masyarakat telah mencapai Rp15,9 juta. Keberhasilan pembangunan di Kepulauan Nias juga berdampak pada penurunan jumlah penduduk miskin di Kabupaten Nias dari 159,9 ribu pada tahun 2006 menjadi 26,4 ribu pada tahun 2010. Dampak yang sama juga terjadi di Kabupaten Nias Selatan dimana jumlah penduduk miskin pada tahun 2006 berjumlah 102,1 ribu turun menjadi 60,1 ribu pada tahun 2010. Di samping itu, pembangunan menyebabkan terjadinya penurunan pada tingkat pengangguran terbuka (TPT) di Kabupaten Nias dari 7,22% pada tahun 2005 menjadi 2,57% pada tahun 2010. Demikian pula di Kabupaten Nias Selatan, TPT menurun dari 4,78% tahun 2005 menjadi 2,43% tahun 2010. Keberhasilan pembangunan ekonomi di Kepulauan Nias setelah bencana tsunami selanjutnya memberikan tantangan dengan berakhirnya pendanaan pembangunan dari MDF pada Desember 2012. Pemerintah daerah bersamasama dengan masyarakat dan LSM harus melanjutkan program pembangunan ekonomi, memelihara infrastruktur yang telah tersedia dan peningkatan pembangunan kapasitas masyarakat. Dengan demikian keberlanjutan pembangunan ekonomi akan dapat dipertahankan dan melanjutkan perbaikanperbaikan pada indikator ekonomi dan sosial di Kepulauan Nias. Penulis adalah Dosen Fakultas Ekonomi Universitas Sumatera Utara.


B10 LHOKSEUMAWE (Waspada) : Minat baca di Aceh masih sangat rendah, hal ini mengakibatkan rendahnya kualitas manusianya. Jika malas membaca, maka generasi Aceh makin tertinggal. “Untuk mewujudkan minat baca, maka perlu dilakukan pembinaan di sekolah yang merupakan cara paling efektif. Jangan hanya sebatas buku pelajaran,” tegas Ketua Lembaga Balai Sastra Samudra Pasai (BSSP), Zulfadli di Lhokseumawe, Selasa (12/6). Menurutnya, kurangnya minat baca ini disebabkan karena tidak dibudayakan, sedikit sekali orang yang cinta pada buku daripada makanan. Sedikit sekali yang minat terhadap berbagai buku, maka anak ini akan tampil lebih berkualitas dan cerdas. Namun, harus ada upaya sedari kecil untuk membiasakan membaca yang kelak akan terbawa hingga dewasa. Hal ini juga harus ditunjang penyediaan buku-buku yang menarik dan representatif. “Kalau minat baca tidak bisa dijadikan budaya, maka yang lahir adalah kebodohan,” tegasnya. Membaca untuk menguasai banyak pengetahuan merupakan modal dasar memperbaiki masyarakat saat ini. “Untuk mengatasi masalah ketersedian sarana baca anak dapat dilakukan dengan memanfaatkan eksistensi perpustakaan sekolah. Perpustakaan sekolah dapat difungsikan sebagai institusi penyedia sarana baca cuma-cuma bagi anak-anak. (b14)

SAWANG (Waspada) : Eksplorasi galian C di Sungai Krueng Sawang, Kecamatan Sawang, Aceh Utara kini menjadi ancaman bagi petani setempat. Akibatnya, puluhan hektare sawah di pinggir sungai terus mengalami erosi. Keuchik Gunci Sawang Jamaluddin menuturkan, di desanya sudah terjadi erosi sekitar dua tahun lalu. Hal itu disebabkan eksplorasi galian C di pinggir sungai tersebut yang dilakukan PT Kutaraja. Kondisi sekarang sekitar tiga hektare sawah khusus di Gampong Gunci telah amblas ke sungai. “Erosi itu memang disebabkan aktivitas galian C. Sebelumnya, arah aliran sungai sebelah timur, setelah diambil batu sebelah barat, arus sungai jadi berpindah dan sebelah timur jadi tertutup. Kalaupun mereka punya izin dan lahan milik sendiri sekitar 2.800, tapi mereka harus peduli lingkungan,’ ucap Jamal. Mukim Sawang Selatan Mawardi mengatakan, atas kejadian itu masyarakat yang terkena

Aceh Utara Terima Dana PNPM

Ibu RT Ikut Pelatihan Menjahit LHOKSEUMAWE (Waspada) : Sepuluh ibu rumah tangga dan remaja putri dari Aceh Utara dan Kota Lhokseumawe mengikuti pelatihan menjahit. Dengan keterampilan itu diharapkan mereka mampu menambah pendapatan keluarga. Koordinator Lembaga Pengembangan Bisnis (LPB) Wanita Mandiri, Agustiana Elfitria, Selasa (12/6) mengatakan, peserta pelatihan terdiri dari remaja putri dan ibu rumah tangga berasal dari lima kecamatan di Kabupaten Aceh Utara dan Kota Lhokseumawe. Yaitu, Kecamatan Matang Kuli, Syamtalira Arun, Nibong, Blang Mangat dan Kecamatan Banda Sakti mulai tanggal 11 sampai 15 Juni 2012. Agustina juga menjelaskan, dipilihnya ibu rumah tangga dan remaja putri karena menurut hasil monitoring LPB-WM selama ini masih banyak perempuan yang menganggur di Aceh Utara dan Kota Lhokseumawe. (b15)

Pelanggan Listrik Prabayar Di Bireuen Capai 2.017

Waspada/Mustafa Kamal

INILAH kondisi tebing sungai Krueng Sawang yang dihantam arus sungai akibat aktivitas galian C

DPRK Perjuangkan Dana Korupsi Rp220 M LHOKSEUMAWE (Waspada) : DPRK Aceh Utara kembali memperjuangkan dana korupsi Rp220 miliar untuk menunjang anggaran pembangunan daerah. Selama terjadi kasus bobolnya dana deposito Pemkab Aceh Utara, pihak legislatif setempat sudah pernah membentuk tim Pansus yang kerjanya bolak-balik Aceh – Jakarta, dengan menghabiskan uang daerah ratusan juta rupiah. Belum termasuk yang sengaja dianggarkan dalam APBK Aceh Utara, untuk menggugat perdata terhadap Bank Mandiri, tempat dana Rp220 miliar itu bobol. Akhirnya gugatan perdata itu ditolak, namun dana yang diplot dalam APBK berhasil dicairkan. Kini, DPRK Aceh

Utara kembali membentuk tim Pansus, dengan judul sama tidak serupa, kata tokoh masyarakat Aceh Utara, Selasa (12/6). Target DPRK Aceh Utara agar uang segar Rp181 miliar sisa korupsi kas Pemkab Aceh Utara yang telah disita Kejaksaan Tinggi Jakarta Selatan dapat segera dibawa pulang ke Aceh Utara, untuk dimasukkan dalam draf Perubahan (APBKP) tahun 2012 yang pembahasannya diperkirakan Agustus 2012. “Kami telah mengadakan pertemuan khusus dengan pihak Kejati Jaksel, 11 Juni lalu dan sudah ada lampu hijau terhadap pengembalian uang korupsi tersebut, kalau keputusan hukum terhadap mantan Bupati/wakil Bupati Aceh Utara Ilyas A Hamid – Syarifuddin sudah inkrah,” kata anggota tim

Pansus pengembalian dana korupsi DPRK Aceh Utara, Ahmad Satari, Selasa (13/6). Politisi Partai Demokrat tersebut menjelaskan, pihaknya bersama 17 personel panitia khusus (Pansus) DPRK Aceh Utara masih di Jakarta. Selasa kemarin, terjadwal audiensi dengan Mahkamah Agung dalam rangka meminta fatwa dari MA masalah pengembalian dana korupsi tersebut. Pengembalian itu diharapkan seluruhnya Rp220 miliar sesuai nilai korupsi yang melibatkan mantan Bupati/Wakil Bupati Aceh Utara. “Untuk saat ini kita minta dulu sisa uang korupsi itu, Rp181 miliar hasil sitaan dari Bank Mandiri kantor cabang pembantu (KCP) Jelambar, Jaksel,” ujar Ahmad Satari, anggota Pansus DPRK Aceh Utara. (b13/b15)

745 Peserta Ramaikan MTQ Aceh Utara

BIREUEN (Waspada) : Hingga memasuki Juni 2012, pelanggan listrik prabayar di Bireuen mencapai 2.017. Pelanggan tersebut yang paling banyak berada di seputaran Kota Juang. “Pemasangan meteran listrik pintar di wilayah Bireuen mulai dari Gandapura hingga Kecamatan Samalanga sudah mencapai 2.017 pelanggan dan untuk saat ini, PLN Bireuen sedang melakukan pemasangan listrik prabayar wilayah kota Juang dan itu akan terus dilakukan untuk wilayah-wilayah kecamatan lainnya,” kata Manajer PLN Ranting Bireuen, Ridwan Adam, Selasa (12/ 6) di sela-sela melihat langsung pemasangan satu meteran PLN prabayar di sebuah toko di Kota Bireuen. Disebutkan, pemasangan meteran listrik prabayar di Kota Bireuen sekarang ini telah dilakukan beberapa hari lalu, di antaranya di kawasan jalan lapangan VOA, jalan meunasah Kuta, Komplek PJKA, Jalan Jati, Jalan T Hamzah Bendara, Jalan Kol Husein Yusuf dan Jalan T Panglima Polem/Andalas. ”Sebelum kita memasang meteran prabayar ini, selama ini juga kita sudah lakukan sosialisasi kepada pelanggan, dilanjutkan dengan acara launching, dan pernah diberitahukan secara kusus kepada para pelanggan tentang perubahan data ke kwh digital sehingga para pelanggan tidak kaget lagi,” katanya. (cb02)

ACEH UTARA (Waspada) : 745 Peserta Musabaqah Tilawatil Quran (MTQ) akan meramaikan MTQ ke-31 Aceh Utara yang dilaksanakan di lapangan Kuta Makmur (Buloh Balang Ara), Rabu (27/6) malam. Ada sembilan cabang yang akan dilombakan dalam MTQ kali ini. Kesembilan cabang lomba tersebut yaitu Tilawatil Quran untuk putra dan putri dewasa, remaja dan anak-anak serta untuk golongan cacat netra putra dan putri. Cabang Hifzil Quran untuk golongan 1 hingga 30 juz untuk putra dan putri. Selanjutnya cabangTafsirul Quran untuk golongan Bahasa Arab, Inggris dan Bahasa Indonesia untuk putra dan putri.

Berikutnya, cabang Fahmil, Syarhil, Khattil, Qira’ah Saba’ah, Tartil, dan tulisan arab. “Ada 35 dewan hakim yang akan menilai para peserta MTQ dari sembilan cabang lomba tersebut. Panitia telah melaksanakan berbagai persiapan untuk acara tersebut, hingga saat ini persiapan telah dilakukan mencapai 60 persen, termasuk persiapan mimbar dan tempat pemondokan para peserta,” kata Amir Mahmud, Kadis Syariat Islam Aceh Utara, Rabu (13/6). Kata Amir, pomondokan para kafilah dari 27 kecamatan di Aceh Utara disiapkan di 70 rumah penduduk Kuta Makmur. Sedangkan untuk tempat lomba dibagi di beberapa tem-

pat yaitu di mimbar utama, aula kantor camat, gedung SMAN 1, SMPN 1 dan di Masjid Pulo atau disebut Masjid Adnan Ganto. Acara akan berlangsung selama satu minggu. Pada acara pembukaan panitia sengaja menampilkan qari internasional H Darwin Hasibuan, sebelumnya diisi tarian tradisional Aceh. Dana yang dibutuhkan untuk acara tersebut mencapai Rp1,9 miliar bersumber dari APBK Aceh Utara. Agar kegiatan tersebut berjalan sukses, masyarakat Kuta Makmur yang telah diberikan kepercayaan Pemerintah Aceh Utara sebagai tuan rumah MTQ, hendaknya dapat memberikankontribusitermasuk dalam urusan keamanan. (b18)

Irfan Riandi, Kacab Rutan Bireuen BIREUEN (Waspada) : Kakanwil Kementerian Hukum dan HAM Provinsi Aceh Yatiman, melaksanakan serah terima jabatan Kepala Cabang Rutan Bireuen dari pejabat lama Jumadi kepada pejabat baru Irfan Riandi di ruang Rutan setempat, Selasa (12/6). Serah terima jabatan tersebut berlangsung secara sederhana yang dihadiri seluruh staf dan karyawan Rutan Cabang Bireuen. Pejabat baru Irfan Riandi sebelumnya Kepala Cabang Rutan Calang, Aceh Barat, sedangkan pejabat lama Jumadi mendapat tugas baru di Balai Pemasyarakatan Banda Aceh.

Waspada/Abdul Mukthi Hasan

MANAJER PLN Ranting Bireuen, Ridwan Adam (tengah) melihat karyawannya memasang meteran listrik prabayar di sebuah toko di Kota Bireuen, Selasa (12/6).

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu) Garuda Indonesia

Berangkat (flight, tujuan, waktu)

GA 142 Jakarta/Medan GA 146 Jakarta/Medan

10:40 15:50

GA 143 Medan/Jakarta GA 147 Medan/Jakarta

11:25 16:45

Y6 555 Jakarta * Y6 537 Jakarta/Medan

19:05 12:30

Y6 556 Jakarta** Y6 538 Medan/Jakarta

07:05 12:30

JT 304 Jakarta JT 396 Jakarta/Medan

11:35 20:00

JT 397 Medan/Jakarta JT 307 Jakarta

06:40 12:15

SJ 010 Jakarta/Medan


SJ 011 Medan/Jakarta


Batavia Air Lion Air

Sriwijaya Air Air Asia

AK 305 Kuala Lumpur *** 12:20

AK 306 Kuala Lumpur*** 12:45

FY 3401 Penang ****

FY3400 Penang ****

Fire Fly


* Setiap Selasa, Kamis, Minggu. ** Setiap Senin, Rabu, Jumat. *** Setiap Senin, Rabu , Jumat dan Minggu. **** Setiap Selasa, Kamis dan Minggu.


Kamis 14 Juni 2012

Eksplorasi Galian C Ancam Petani

Agar Berkualitas, Perlu Tingkatkan Minat Baca

ACEHUTARA (Waspada) : Bustanuddin, Kadis PMBS Aceh Utara, Selasa (12/6) mengatakan, Aceh Utara pada 2012 telah menerima Rp71.350 miliar dana PNPM Mandiri. Dari jumlah tersebut, sebanyak Rp68.215 miliar bersumber dari pusat dan Rp7.135 miliar bersumber dari daerah. Dana tersebut disebarkan kepada 27 kecamatan di Aceh Utara. Ratarata setiap kecamatan mendapatkan Rp3 miliar, begitupun ada beberapa kecamatan yang hanya mendapatkan Rp1,1 miliar. Pembagian jatah anggaran disesuaikan dengan data statistik. Petugas melihat luas wilayah dan jumlah penduduk di kecamatan. Dari jumlah dana Rp71.350 miliar itu baru dicairkan sebanyak 40 persen dari APBN, sementara anggaran yang bersumber dari daerah akan dicairkan pada tahap ke tiga. Bustanuddin mengatakan, semua proyek PNPM Mandiri yang telah dikerjakan berjalan sesuai harapan, karena proyekproyek tersebut semuanya dilaksanakan masyarakat kecamatan masing-masing. Begitupun, ada juga program PNPM yang terkendala seperti pada program Simpan Pinjam Perempuan. Pasalnya, proses pengembalian uang pinjaman itu sedikit terkendala. “Kalau ada gampong yang tersendat pengembalian uang pinjaman, maka gampong itu akan dipending pemberian proyek fisik.(b18)


Kakanwil Kementerian Hukum dan HAM Yaiman dalam pengarahannya antara lain menyampaikan penghargaan dan terima kasih kepada pejabat lama Jumadi yang selama ini telah memberikan pengabdian dalam melakukan pembinaan para napi dan tahanan rutan sangat baik. Kepada pejabat baru, Kakanwil berharap dalam melakukan pembinaan para napi dan tahanan harus dapat menjaga ketertiban dan keamanan di rutan dan mencegah hal-hal yang dapat menimbulkan kerusuhan di dalam rutan.

Usai sertijab Kakanwil Yatiman berkesempatan bertatap muka dengan lima perwakilan dari 321 napi dan tahanan penghuni rutan Bireuen dengan memberikan pengertian soal keterlambatan pembebasan bersyarat yang sudah jatuh tempo bagi para napi karena belum turunnya SK pembebasan bersyarat dari Kementerian Hukum dan HAM Jakarta. Pihaknya berjanji akan terus berupaya agar SK bebas bersyarat 20 dari 32 napi yang diusulkan Kacab Rutan Bireuen sudah jatuh tempo, SK-nya diharapkan dapat segera turun. (b12)

Mediasi Kasus Pembakaran Kandang Bebek Gagal SAMPOINIET (Waspada) : Upaya Muspika, Majelis Adat dan Tetua Desa memediasi kasus pembakaran kandang bebek milik Irwansyah, 35, adik Ketua Komisi B DPRK Aceh Utara, Tgk Khaidir, di Desa Matangpanyang, Kec. Baktiya Barat— Sampoiniet, Aceh Utara, gagal. Dalam mediasi yang digelar di aula Kantor Camat Baktiya Barat, 30 Mei 2012 itu, kedua belah pihak gagal mencapai kata mufakat. Pihak pemilik kandang menuntut ganti rugi Rp2 juta. Sementara pihak pelaku mengaku tak punya uang sebanyak itu dan hanya sanggup menyediakan sekadar uang peusijuek atau biaya tepungtawar. Tgk Khaidir yang ikut hadir dalam musyawarah tersebut meminta polisi melanjutkan

kasus itu secara hukum dan pelaku pembakaran, Asria, 40, ibu tiga anak, tetangga Tgk Khaidir yang nekat membakar kandang karena tak tahan terus-terusan menghirup bau kotoran ayam dari kandang samping rumahnya, terancam masuk penjara. “Saya ini orang miskin. Kalau materi, saya tidak ada. Di hadapan Muspika, saya bilang terus-terang hanya sanggup menyediakan alakadar uang peusijuek. Tgk Khaidir tak terima. Dia langsung minta polisi melanjutkan kasus ini lewat jalur hukum,” kata Asria, Selasa (12/6). “Setelah diberitakan di Waspada, kotoran ayam yang biasanya dibiarkan dalam parit dekat kandang sudah dibuang ke tempat lain dan dibakar. Tapi baunya belum hilang. Saya juga su-

dah mengeluhkan lagi masalah ini ke Mukim. Beliau menyarankan saya melapor ke Badan Lingkungan hidup. Tapi saya tak tahu di mana kantornya,” tutur Asria. Kapolres Aceh Utara AKBP Farid BE melalui Kapolsek Baktiya Barat Ipda Samsul Bahri membenarkan upaya mediasi kasus ini gagal. “Mediasi kita lakukan berdasarkan Qanun Nomor 9 Tahun 2008 tentang adat istiadat. Proses ini melibatkan banyak pihak, termasuk Muspika Plus. Tapi kedua belah pihak tak mencapai kata sepakat,” katanya. Advokasi Gratis Sementara Razali, advokat dari HR and Partner Lhoksukon menyatakan rasa simpatinya terhadap persoalan hukum yang dialami Asria. Dia juga mengatakan siap mengadvokasi kasus Asria secara cuma-cuma. (b19)

imbas dari eksplorasi galian C tersebut ingin melakukan demo, namun atas inisitif camat setempat niat warga tersebut diurungkan. Namun sampai kini belum timbul satu kesepahaman bersama terkait aktivitas itu. Camat Sawang Ilyas saat dikonfimasi menjelaskan, hal itu sudah pernah disampaikan warga kepadanya, namun belum ada kesepahaman bersama. Karena yang melakukan aktivitas itu juga warga setempat, walaupun beberapa orang. Kepala Kantor Lingkungan Hidup (KLH) Aceh Utara Nuaraina menuturkan, pihaknya Senin (18/6) mendatang akan melakukan pengawasan pada setiap perusahaan liar yang mencemari lingkungan seperti di Sungai Krueng Sawang dan lepas pantai Krueng Mane, Muara Batu. Karena perusahaan itu harus mendapatkan izin serta dokumuen dari lingkungan hidup yang harus dipelajari. (cmk)

Sejahterakan Warga, Zaini-Muzakir Kembangkan Pelabuhan Krueng Geukueh ACEHUTARA (Waspada) : Gubernur dan Wakil Gubernur Aceh terpilih untuk periode 2012-2017, Zaini Abdullah-Muzakir Manaf wajib kembangkan Pelabuhan Umum Krueng Geukueh. Langkah ini ditempuh untuk mensejahterakan masyarakat Aceh khususnya masyarakat Aceh Utara. Hal tersebut disampaikan Tgk Fauzi alias Wapang,anggotaKomisiADPRKAcehUtara,Rabu (13/6) di ruang kerjanya.“Program ini harus segera dilaksanakan oleh gubernur dan wakil gubernur. Sifatnya wajib. Karena ini merupakan salah satu amanah MoU Helsinki,” kata Fauzi. Dia juga mengatakan, Pelabuhan Umum Krueng Geukueh merupakan salah satu pelabuhan di Indonesia yang berstandar internasional. Mubazir, jika aset tersebut tidak difungsikan dengan maksimal, mengingat cukup banyak hasil tani masyarakat Aceh yang berkualitas ekspor dikirim keluar negeri melalui Pelabuhan Belawan, Sumut. Dengan dihidupkan pelabuhan tersebut, diyakini perekonomian masyarakat akan membaik, karena semua hasil tani dapat dipasarkan dengan harga yang pasti, tidak melalui calo. Contoh kecil, selama ini masyarakat Aceh menjual gabah kepada toke-toke yang ada di Medan,

Sumatera Utara. Gabah-gabah tersebut diolah menjadi beberapa jenis beras oleh para pengusaha Tionghoa. Produksi beras tersebut dikirim lagi ke Aceh dalam berbagai jenis antara lain Kuku Balam, Ramos, Rajawali dan beberapa jenis beras lainnya dengan harga yang tergolong mahal. Jika Aceh memiliki mesin penggiling yang berkualitas, tentunya beras-beras Aceh dapat dijual ke luar negeri atau ke provinsi tetangga. Selain gabah, Aceh juga memiliki kunyit, kelapa sawit, pinang dan berbagai hasil bumi lain. “Dengan cara seperti ini, Pemerintah Aceh telah membantu petani,” katanya. Tak ada alasan bagi Pemerintah Pusat untuk menghalang-halangi Pemerintah Aceh dalam upaya membuka Pelabuhan Umum Krueng Geukueh. Karena persoalan pengembangan pelabuhan di Aceh masuk dalam salah satu butir MoU Helsinki. Zainal Abidin Badar alias Jimbron, Direktur Eksekutif Reuncong Aceh mendukung program pengembangan pelabuhan di Aceh, agar program tersebut berjalan sesuai target, antara eksekutif dan legeslatif harus sejalan. Bukan hanya itu, semua lapisan masyarakat diharapkan mendukung. (b18)

Australian AID Lanjutkan Program Di Aceh Tengah TAKENGEN (Waspada) : Australian AID (AusAid) yang bergerak di bidang pendidikan, kesehatan dan tata kelola pemerintahan merencanakan melanjutkan program bantuan di Aceh Tengah. Program AusAid bertajuk Local Govemance Innovatiaon for Communities in Aceh Phase (LOGICA) yang melakukan kerjasama dengan Pemda AcehTengah ini, sebelumnya pada 20102012 telah menyelesaikan proyek bantuan donor mencapai seratus persen. “Pada program LOGICA-1 telah disalurkan bantuan donor seratus persen atau sekitar Rp2 miliar lebih. Dana itu guna meningkatkan pem-

bangunan fasilitas bidang tata kelola pemerintahan, pendidikan dan kesehatan seperti gedung sekolah, MCK, kebutuhan air bersih dan lainnya,” ujar Azroy Meilana, Distrik Manager AusAid, Rabu (13/6) usai Workshop LOGICA2 di Oproom Pemda Aceh Tengah. Dia katakan, sebelumnya, donor dana LOGICA-1 telah disalurkan di enam kecamatan di kabupaten setempat yakni; Bebesen, Atu Lintang, Pegasing, Celala, Ketol dan Silih Nara. Sementara ada 72 kampung dari kecamatan dimaksud yang menerima bantuan masingmasing sebesar Rp20 juta. (cb09)

MPU Aceh Utara Antisipasi Aliran Sesat LHOKSEUMAWE (Waspada) : Majelis Permusyawaratan Ulama (MPU) Aceh Utara menyelenggarakan pendidikan khusus untuk para santri melalui purna ulama. Mereka diharapkan mampu menjadi penggerak dalam mengantisipasi penyebaran ajaran sesat dalam masyarakat. Ketua MPU Aceh Utara Tgh Mustafa Ahmad, Selasa (12/6) menjelaskan, para peserta pendidikan purna ulama sudah memahami tentang agama secara mendalam. Namun untuk memperluas pengetahuan perlu dibuka kembali pengetahuan yang selama ini telah diperolehnya di dayah (pesantren). “Kegiatan ini untuk memperluas ilmu yang telah diterima

di dayah,” jelas Ketua MPU Aceh Utara yang lebih dikenal Abu Paloh Gadeng. Memberantas aliran sesat dan pemurtadan, menurut Mustafa, bukanlah kegiatan yang mudah. Upaya tersebut dapat dilakukan melalui pendidikan. Sekretaris MPU Aceh Utara Tgk Idris mengatakan, peserta purna ulama terdiri dari para santri wanita. Jumlahnya mencapai 36 dari seluruh Aceh Utara. Mereka mendapat pengetahuan dari Ketua MPU Provinsi Aceh Prof Muslim Ibrahim, Ketua MPU Aceh Utara dan akademisi dari Sekolah Tinggi Agama Islam (STAI) dari Langsa. (b15)

Warga Berharap Pilkada Berlangsung Damai BLANGPIDIE (Waspada) : Tingginya intensitas politik di Aceh Barat Daya menjelang Pilkada putaran kedua di kabupaten tersebut saat ini, membuat sebagian warga mulai merasakan kekhawatiran akan munculnya‘gesekan’ serta intimidasi dari kelompok tertentu yang dinilai akan ‘membelenggu’ hak demokrasi dan kebebasan berpolitik dari setiap warga negara. Harapan tersebut diungkapkan tokoh masyarakat Waspada/Sudarmansyah Kecamatan Suak Setia, Muhammad Saleh atau akrab SUASANA politik jelang pilkada putaran kedua di Abdya mulai disapa Ayah Saleh, Selasa ‘memanas’, seperti terlihat dalam gambar pelaksanaan debat kandidat di gedung DPRK Abdya, beberapa waktu lalu. (12/6). Menurut Ayah Saleh, adanya sikap intimidasi dari kelompok tertentu selama pelaksanaan pilkada dikemukakan berkaitan adanya sikap dari di Abdya dinilai akan mempengaruhi kondisi oknum dari salah satu kelompok yang sempat sosial serta rasa aman di masyarakat, semestinya melakukan tindakan intimidasi kepada ulama dalam menghadapi pilkada ini diharapkan serta sejumlah warga beberapa waktu lalu, tinsemua pihak memiliki komitmen yang kuat dakan tersebut dinilainya berkaitan erat jelang untuk menjaga perdamaian di bumi Aceh ini pilkada putaran kedua di Abdya yang saat ini dengan tidak melakukan pemaksaan kehendak intensitas politiknya dinilai semakin tinggi dan serta tindakan intimidasi politik demi kepen- menjurus panas. Namun demikian Ayah Saleh meyakini akan ada reaksi tegas dari masyarakat tingan kelompok tertentu. “Ada kecenderungan yang kita lihat selama itu sendiri bilamana kondisi intimidasi masih pilkada ini yaitu tindakan dari oknum tertentu terus berlangsung demi terwujudnya situasi yang mencoba melakukan pemaksaan kehen- yang kondusif. Aktifis LSM dari Himpunan Pemuda Masyadak demi kepentingan politik kelompok tertentu sehingga masyarakat merasa tidak nyaman, rakat Abdya (HIPMA) M Syahril mengharapkan semestinya semua pihak harus berkomitmen adanya peran aktif dari seluruh kalangan khumenjaga perdamaian tanpa harus melakukan susnya para elit politik untuk mensukseskan intimidasi atau tindakan tidak terpuji dengan Pilkada Abdya putaran kedua di Abdya secara menjadikan pilkada ini sebagai barometer aman, damai dan tanpa tindakan intimidasi bahwa pernyataan untuk memegang teguh ataupun pemaksaan kehendak. Menurutnya, kondisi tersebut akan terwujud perdamaian di bawah bingkai NKRI benarbenar konsisten dan bukan sekadar omong apabila upaya provokatif serta tindakan yang bertentangan dengan hak-hak demokrasi warga kosong belaka,” ungkap Ayah Saleh. Menurut Ayah Saleh, pernyataan tersebut negara tidak sampai terjadi di lapangan. (cb05)


WASPADA Kamis 14 Juni 2012

Tebing Runtuh Ancam Transportasi Agara-Gayo Lues

SNMPTN Di Unsyiah Lancar BANDAACEH (Waspada) : Ujian tulis Seleksi Nasional Masuk Perguruan Tinggi Negeri (SNMPTN) Panlok Banda Aceh, Selasa (12/6) berjalan lancar. Masalah teknis masih sempat terjadi serta peserta yang tidak hadir. Secara umum ujian berjalan lancar. Ujian tulis itu diikuti sebanyak 16.386 peserta dari Universitas Syiah Kuala dan Universitas Malikul Saleh Lhokseumawe. Dari 16.386 peserta yang ikut ujian tulis, 13.982 ada di Universitas Syiah Kuala dan 2.404 di Universitas Malikul Saleh Lhokseumawe. Data yang diperoleh dari Panitia Lokal menyebutkan, dari 13.982 peserta yang ikut di Unsyiah terdiri dari 3.354 kelompok IPA, 2.292 IPS,dan8.338kelompokIPC.SedangkandiUnimal,dari2.404peserta, 471 kelompok IPA, 395 IPS, dan 1.538 kelompok IPC. Ketua Koordinator Sosialisasi dan Humas Panlok Banda Aceh SNMPTN 2012, A Wahab Abdi mengatakan, untuk mengawasi ujian ini, pihak panitia melibatkan 1.211 pengawas. Mereka terdiri atas 35 koordinator sektor, 69 koordinator lokasi, 392 penanggung jawab ruang, dan 715 pengawas. Disebutkan, lokasi ujian tersebar di kampus Unsyiah bagian selatan untuk kelompok IPC, dan sebelah utara mulai dari Gedung AAC Dayan Dawood kelompok IPA. Sedangkan untuk kelompok IPS mulai dari SD Tahija, Lingke sampai ke SMP Negeri 18 Lampine-ung. Ketua Panlok Banda Aceh SNMPTN 2012 Prof Samsul Rizal yang juga penjabat Rektor Unsyiah ketika meninjau pelaksanaan ujian mengaku puas. “Alhamdulillah, semuanya lancar,” katanya. (b07)

KUTACANE (Waspada) : Keganasan Sungai Kali Alas selalu mengancam badan jalan di Aceh Tenggara, salah satunya ruas jalan nasional di Desa Lawe Sekerah, Kecamatan Badar, kondisinya hari ini terancam putus. Pasalnya tebing jalan ituambrukdikikissungai,berpotensimengganggu arus transportasi hasil bumi dan kebutuhan warga baik di Agara maupun Gayo Lues. Kondisi badan jalan nasional di Lawe Sekerah saat ini, Selasa (12/6) sangat memprihatinkan, pasalnya guyuran hujan lebat pada Rabu (6/6) berdampak telah meruntuhkan tebing jalan sepanjang 200 meter serta merobohkan bronjong di sepanjang lintasan jalan nasional di Lawe Sekerah dikawatirkan mengancam keselamatan badan jalan nasional itu. Kondisi ini dapat mengancam arus transportasi dari Gayo Lues menuju Kutacane dan

TMMD Di Rikit Gaib Ditutup BLANGKEJEREN (Waspada) : Kegiatan TNI Manunggal Membangun Desa (TMMD) di Kecamatan Rikit Gaib, Selasa (12/6) resmi ditutup Penjabat Bupati Gayo Lues Cipta Hunai di lapangan bola kaki, Kecamatan Rikit Gaib. Sesuai jadwal berjalan, TMMD ke-88 telah berlangsung selama tiga pekan, terhitung sejak 22 Mei hingga 12 Juni hari ini. Selama kegiatan berlangsung, TMMD telah banyak memberikan sumbangsih pekerjaan, di antaranya membuka jalan sepanjang 5 km dengan lebar 6 meter dari perkebunan warga Desa Kuning, Rikit Gaib menuju Desa Cane Baru, Kecamatan Pantan Cuaca. Selain itu, telah menyelesaikan perehaban 2 unit rumah kaum dhuafa, 2 unit pos ronda malam, 1 unit meunasah dan membangun lapangan bola kaki dan voli. Cipta Hunai pada kesempatan itu menyampaikan ucapan terima kasih kepada pihak TNI dalam membantu Pemkab Gayo Lues dengan segenap hati dan ketulusannya. “Gayo Lues sebagai dambaan kita semua, dengan adanya akses jalan tersebut akan memudahkan warga dalam segala hal, terutama mengangkut hasil pertanian,“ ujar Cipta Hunai. (cjs)

Hari Lingkungan Se-Dunia Di Blangjerango BLANGKEJEREN (Waspada) : Memperingati Hari Lingkungan Hidup Se-Dunia, Pemkab Gayo Lues melalui Dinas Kehutanan dan Perkebunan menanam pohon sebanyak 5.000 batang pohon. Penanaman itu dilakukan di Kecamatan Blangjerango, dirincikan masing-masing pohon mahoni sebanyak 1.000 batang, gaharu 1.000 batang, durian 500 batang, alpokat 500 batang, nangka 500 batang dan pinang 500 batang. Kegiatan ini bekerjasama Pemerintah Provinsi Aceh, Pemkab Gayo Lues, USAID IFAC,Yayasan Taman Nasional Gunung Leuser dan Polisi Hutan dihadiri seluruh unsur muspida plus. “Penanaman pohon untuk di Blangjerango ini, selain hari lingkungan hidup sedunia, juga untuk membangun dan mendorong semangat kepedulian terhadap perlindungan dan pengelolaan lingkungan hidup, baik secara individu, pemerintah, dunia usaha dan pendidikan,“ kata Kadis Kehutanan dan Perkebunan Gayo Lues, Alimin. Senin (11/6) di Desa Kedah, Blangjerango. Penjabat Bupati Gayo Lues Cipta Hunai mengatakan, gerakan ini dilakukan untuk menyadari betapa pentingnya pelestarian lingkungan hidup. Selain tujuan menekan perusakan lingkungan serta kelangkaan sumber daya alam, juga dapat membangkitkan ekonomi hijau guna meningkatkan standar hidup manusia. (cjs)

Pemda Gelar Lomba Bercerita TAKENGEN (Waspada) : Untuk meningkatkan minat baca di kalangan siswa, Pemda Aceh Tengah melalui Kantor Perpustakaan dan Arsip Daerah (KPAD) menggelar lomba bercerita. Kegiatan ini berlangsung di Gedung Wanita (GW) Takengen, diikuti 40 peserta tingkat SD/MI se-Aceh Tengah. Sementara tujuan lain dari ajang tersebut diharapkan bisa meningkatkan kecintaan anak akan budaya nusantara. Demikian ungkap Hamdan, ketua panitia, Selasa (12/6) pagi di sela-sela pagelaran lomba seraya menambahkan pihaknya juga menyediakan sejumlah hadiah hiburan plus tropi dan piagam.“Kami berharap acara ini bukan sekadar perlombaan, namun bisa menumbuhkan pengetahuan siswa tentang pentingnya nilai budaya. Selain itu, mencegah punahnya cerita legenda milik urang (orang) Gayo yang telah ada sejak turun temurun,” paparnya. Dalam pagelaran itu beberapa cerita daerah Gayo disampaikan peserta secara silih berganti, di antaranya seperti Legenda Putri Ijo, (batu) belah dan Putri Pukes. Meski terbilang amatiran, namun sewaktu bercerita mereka kerap mendapat aplaus dari para penonton. “Bagi yang terpilih sebagai juara pertama, nanti-nya akan mewakili Aceh Tengah mengikuti lomba tingkat provinsi di Banda Aceh, Juli mendatang. Selanjutnya bila di provinsi lolos, mereka kembali terjun di ajang nasional di Jakarta,” jelasnya.(cb09)

PLN Nagan Awasi Angin Kencang NAGANRAYA (Waspada) : Pantai Barat Selatan Aceh belakangan ini terus dilanda angin kencang dan hujan lebat membuat arus listrik di beberapa titik di Kabupaten Nagan Raya Listrik padam. Hal ini akibat banyaknya pohon yang tumbang ke jalan menyebabkan arus listrik terganggu. Dari pantauan, cuaca buruk yang melanda di Suka Makmue, Nagan Raya, akibatnya aliran listrik putus total, membuat masyarakat setempat mengeluh. Menurut seorang warga setempat Rusli, 30, Selasa (12/6), selama sepekan arus listrik di kawasan Suka Makmue sering padam secara mendadak. Setiap hari listik padam 2 jam bahkan lebih sejak mulai pukul 17:30 sampai 21:00. Kepala Rayon Suka Makmue Nagan Raya Kalimanda mengungkapkan, selama sepekan ini arus listrik di kawasan Suka Makmue sering padam secara mendadak. Listrik sering padam karena ada beberapa titik jaringan terganggu, ini akibat hujan badai yang melanda kawasan Suka Makmue. Sebab jaringan arus listrik mayoritas di bawah pohon. (cb07)

Empat Pejabat Eselon IV Dilantik BANDAACEH (Waspada) : Empat pejabat Eselon IV di lingkungan Sekretariat Komisi Independen Pemilihan (KIP) Kota Banda Aceh, Selasa (12/6) dilantik dan diambil sumpahnya oleh Wali Kota Banda Aceh. Empat pejabat Eselon IV yang dilantik dan diambil sumpahnya itu masing-masing, Syamsul Rizal sebagai Pj Kasubbag Teknis Pemilu dan Humas pada Sekretariat KIP Kota Banda Aceh, Razali sebagai Kasubbag Umum pada Sekretariat KIP Kota Banda Aceh, Nur Azizah sebagai Kasubbag Program dan Data pada Sekretariat KIP Kota Banda Aceh serta Erminzal sebagai Pj Kasubbag Hukum pada Sekretariat KIP Kota Banda Aceh. Pj Wali Kota Banda Aceh yang diwakili Asisten Pemerintahan Kota Banda Aceh Tarmizi Yahya usai melantik mengatakan, pejabat yang dilantik di lingkungan sekretariat KIP ini merupakan orang-orang terbaik yang diangkat berdasarkan prinsip profesionalitas, prestasi kerja, kedisiplinan, loyalitas dan dedikasi masingmasing PNS serta rekomendasi dari atasan langsung dengan mendapat persetujuan dari Baperjakat tanpa menganut prinsip suka atau tidak suka. Sekretaris KIP Kota Banda Aceh Rahmad Sadli mengatakan, pelantikan dan mutasi pejabat Eselon IV di lingkungan sekretariat KIP ini dilakukan karena ada jabatan yang lowong dan untuk penyegaran organisasi. (b02)


Waspada/Mahadi Pinem

BUPATI Agara H Hasanuddin B saat menyampaikan LKPJ 2011 dan LKPJ akhir masa jabatan 2007 – 2012 di gedung DPRK Agara, Rabu (13/6) dihadiri Muspida, SKPK, para camat, tokoh masyarakat, LSM dan pers pada sidang dipimpin Ketua DPRK Agara Salim Fakhri.

Bupati Agara Sampaikan LKPJ

Berkat Kerja Keras Semua Pihak KUTACANE (Waspada) : Bupati Aceh Tenggara H Hasanuddin B menyatakan dalam penyampaian Laporan Keterangan Pertanggungjawaban (LKPJ) akhir masa jabatan Bupati/ Wakil Bupati Agara periode 2007-2012 bahwa semua keberhasilan pembangunan dan penghargaan yang diterima selama lima tahun ini adalah buah karya hasil kerja keras semua pihak. Pidato Hasanuddin B pada acara penutupan rapat paripurna masa sidang II tahun 2012 tentang LKPJ tahun 2011 serta LKPJ akhir masa jabatan tahun 2007 – 2012 di gedung DPRK Agara, pada masa sidang hari terakhir yang dipimpin Ketua DPRK Agara Salim Fakhri, Rabu (13/6) yang diikuti unsur muspida, SKPK, para camat,

tokoh masyarakat LSM dan pers tersebut, Hasanuddin B menyampaikan terimakasih kepada semua pihak atas kerjasama di peiode 5 tahun pertama masa jabatan duet Hasanuddin BSamsul Bahri. Dikatakan, dengan dukungan semua pihak, telah terbukti dan teruji roda pembangunan di Agara dilaksanakan dengan baik melalui visi misi terbaik, namun demikian diakui ada kelemahan, dan kesalahan itu semua dijadikan acuan ke depan, walau masa jabatan Hasanuddin B berakhir pada September 2012, namun itu bukan tanda berhenti berbuat serta berjuang dengan dedikasi yang tinggi bagi negeri Sepakat Segenep, karena di ajang Pilkada Agara 2012 – 2017 Hasanuddin B maju berpasangan dengan calon wakil Bupati H Ali Basrah. Ketua DPRK Agara Salim Fakhri selaku pimpinan sidang didampingi dua wakil ketua, Nazaruddin dan Syahbudin BP menyampaikan agenda kegia-

tan penyampaian LKPJ Bupati Agara ini merupakan amanat PP nomor 3 tahun 2007 tentang laporan penyelenggaraan pemerintahan daerah kepada pemerintah. Laporan keterangan pertanggungjawaban kepala daerah kepada dewan dan informasi laporan penyelenggaraan pemerintahan daerah kepada masyarakat. Salim Fakhri menyebutkan, banyak daerah yang tidak menggelar rapat paripurna istemewa seperti yang dilaksanakan di Agara, hal ini membuktikan Agara lebih tanggap dan lebih maju atas dinamika agenda kedaerahan. Di akhir penyampaiannya, ketua DPRK Agara ini menyampaikan pada Jumat (15/6) dilaksanakan agenda penyampaian visi dan misi 7 pasang calon Bupati –Wakil Bupati Agara di gedung dewan tersebut, hal ini perlu dicermati rakyat sebagai landasan program lima tahun ke depan. (b25)

PETRI Gelar Kongres Nasional Di Aceh BANDAACEH (Waspada): Perhimpunan peneliti penyakit tropik infeksi Indonesia (PETRI) menggelar kongres nasional yang diadakan di Banda Aceh, dan hal ini merupakan pertama kalinya berlangsung di Aceh. Ketua panitia Kurnia F Jamil kepada warta-wan, Senin (11/ 6) mengatakan, kongres nasional tersebut akan berlangsung selama tiga hari di Hotel Hermes Palace Banda Aceh, tanggal 1416 Juni. Kongres nasional PETRI akan mendatang-kan pakar-pakar kesehatan dari Jakarta. Jamil

mengharapkan para praktisi kesehatan di Aceh, seperti dokter, bidan, perawat bisa mendaftar menjadi peserta dalam kongres ini. Kegiatan ini diselenggarakan dalam rangka menyebarluaskan berbagai penelitian dan pe-ngetahuan di bidang tropik infeksi kepada dokter spesialis, dokter umum. “Harapan kami kepada peserta supaya memperoleh manfaat yang besar dalam meningkatkan keahlian pro-fesi khususnya penyakit tropik dan infeksi,” terangnya. Sekretaris pelaksana Dr

Hendra Zufry me-ngatakan, kali ini Banda Aceh menjadi tuan rumah PETRI XVIII yang sebelumnya berlang-sung di Bali. Dalam kongres ini nantinya akan dipaparkan tentang penyakit mata, THT, kulit, malaria, tipes, DBD, TBC, hepatitis dan HIV-AIDS dan penyakit dalam lainnya. Pemaparan masing-masing penyakit akan dijelaskan pakarpakar yang membidangi penyakit tersebut yakni Prof DR Dr Sri Hartini KS, Kariadi, Prof DR dr Nasronudin, Prof DjokoWidodo dan pakar lainnya. (cb01)

16.386 Peserta Rebut Kursi Unsyiah Dan Unimal BANDAACEH (Waspada) : 16.386 Peserta Seleksi Nasional Masuk Perguruan Tinggi Negeri (SNMPTN) Panlok Banda Aceh, hari ini dan besok akan berebut kursi mahasiswa Universitas Syiah Kuala dan Universitas Malikul Saleh Lhokseumawe. Ketua Koordinator Sosialisasi dan Humas Panlok Banda Aceh SNMPTN 2012, A Wahab Abdi, mengatakan, dari 16.386 peserta yang ikut ujian tulis, sebanyak 13.982 ikut di Universitas Syiah Kuala dan 2.404 di

Universitas Malikul Saleh Lhokseumawe. Lebih jauh dia merinci, dari 13.982 peserta yang ikut di Unsyiah terdiri dari 3.354 kelompok IPA, 2.290 IPS, dan 8.338 kelompok IPC. Sedangkan di Unimal, dari 2.404 peserta, 471 kelompok IPA, 395 IPS, dan 1.538 kelompok IPC. Kata Wahab, ujian tulis SNMPTN 2012 akan berlangsung Selasa (12/6) dan Rabu (13/ 6) ini. Untuk mengawasi ujian tulis SNMPTN di Unsyiah tahun

ini, panitia melibatkan 1.211 pengawas. Mereka terdiri atas 35 orang koordinator sektor, 69 koordinator lokasi, 392 penanggung jawab ruang, dan 715 pengawas. Disebutkan, lokasi ujian tersebar di kampus Unsyiah bagian selatan untuk kelompok IPC, dan sebelah utara mulai dari Gedung AAC Dayan Dawood kelompok IPA. Sedangkan untuk kelompok IPS mulai dari SD Tahija, Lingke sampai ke SMP Negeri 18 Lampineung. (b07)

MDF Akhiri Program Di Aceh-Nias Desember 2012 BANDAACEH (Waspada) : Setelah tujuh tahun beroperasi dengan kemitraan bersama pemerintah dan masyarakat, Multi Donor Fund (MDF) mengakhiri upaya rekonstruksi dan rehabilitasi Aceh dan Nias pasca bencana gempa dan tsunami. “Aceh telah memberi pelajaran yang berharga kepada daerah lain yang terkena bencana,” ucap Stefan G Koeberle, Direktur Bank Dunia untuk Indonesia usai rapat panitia pengarah MDF, Selasa (12/6) di gedung Serbaguna Setda Aceh, Banda Aceh. Dikatakan, operasi MDF akan berakhir di Aceh dan Nias, Sumatera Utara, pada Desem-

ber 2012 mendatang. Pihaknya mengakui keberhasilan program MDF itu karena kemitraan yang terjalin antara pemerintah pusat dan daerah dan penyandang dana. MDF telah membangun dan merehabilitasi 20.000 unit rumah, 600 kilometer jalan nasional dan provinsi, 3.000 kilometer jalan kabupaten dan desa, rehabilitasi lima pelabuhan serta pembangunan dan rehabilitasi 650 unit sekolah, membangun mata pencaharian yang terkena dampak serta peningkatan kapasitas pemerintahan. Fasilitas hibah MDF untuk Aceh dan Nias terdiri 15 donor,

masing-masing 12 negara dan dua lembaga bank serta Uni Eropa. “Kita berhasil membangun sebuah pendekatan kemitraan untuk rekonstruksi pasca bencana dan telah diadopsi untuk daerah rawan bencana lainnya di Indonesia,” tandasnya. Sekda Aceh T Setia Budi pada kesempatan yang sama menyampaikan konstribusi MDF tidak hanya berhenti pada pembangunan fisik melainkan juga di bidang pembangunan ekonomi dan kehidupan sosial. “MDF telah memberikan dukungan yang luas bagi upaya rekonstruksi Aceh dan Nias,” katanya. (b06)

Medan (Sumut), maupun arus kendaraan yang mengangkut hasil bumi dan kebutuhan warga dari Gayo lues tujuan Kutacane dan Medan sehingga warga dan pengguna jalan berharap pemerintah daerah segera tanggap mengantisipasi ancaman hancurnya badan jalan nasional tersebut. Warga setempat Mulyadi, Selasa (12/6) menyebutkan, ambruknya bronjong yang selama ini berfungsi sebagai pengaman ruas jalan nasional itu bila tidak segera disikapi dengan pemasangan bronjong kembali sebagai pengendali arus sungai, dikhawatirkan akan mengancam arus transportasi antar kabupaten, bahkan hubungan darat menuju Medan tidak butuh waktu lama, bila guyuran hujan kembali deras, maka dipastikan badan jalan akan amblas diterjang arus sungai.(b25)

Tak Ada Tanggul, Perkebunan Warga Terancam Amblas BLANGPIDIE (Waspada) : Dua kelompok tani dari Desa Alue Jeurejak dan Desa Blang Dalam di Kecamatan Babahrot, Kabupaten Aceh Barat Daya saat ini semakin cemas dan terancam kehilangan lahan perkebunan milik mereka yang sudah amblas karena sungai yang tidak memiliki tanggul pengaman tebing sehingga menyebabkan lahan warga yang berada di sekitar sungai tersebut rusak dan terjadi erosi, akibatnya ratusan hektare lahan warga sudah habis dikikis oleh tajamnya air sungai. Lahan kebun tersebut sudah ditanami warga dengan berbagai macam tanaman seperti coklat, singkong dan tanaman lainnya, namun akibat meluasnya sungai sehingga lahan warga tersebut secara pelan-pelan mulai berkurang, hal ini karena tebing sungai yang berada di areal lahan warga tersebut tidak dibentengi dengan tanggul pengaman. Kondisi tersebut diungkapkan salah seorang ketua kelompok tani di sana M Yusuf, 46, Senin (11/6). Dia mengaku pada 2008 lalu pernah dilakukan normalisasi sungai di kawasan tersebut yang disinyalir sebagai proyek dari pemerintah daerah, pada saat itu pihak pekerja sempat membuat perjanjian dengan warga dengan menjanjikan ganti rugi bagi lahan warga yang dikerok pada saat perluasan sungai, lahan ganti rugi yang dibayar pada masing-masing warga adalah 14 meter dengan jumlah harga yang bervariasi. Kemudian dari hasil keputusan rapat di kan-

tor Kecamatan Babahrot saat itu juga menjanjikan akan membuat tanggul pengaman tebing setelah pelaksanaan normalisasi sungai tersebut, tapi sayangnya sampai saat ini pengaman tebing juga belum terlihat di sekitar sungai, justru akibatnya sekitar 143,7 hektare dari 89 orang yang memiliki lahan habis diterjang dengan derasnya arus sungai. “Walaupun 14 meter dari lahan tersebut sudah dibayar, akan tetapi masalah pengamanan tebing sungai masih belum ada sampai saat ini sehingga kami mewakili 89 petani yang lahannya berada di sekitar areal sungai tersebut memohon pemerintah setempat untuk segera menindaklanjuti persoalan yang sedang terjadi pada petani di dua desa Kecamatan Babahrot tersebut, di mana lahannya sudah mulai dikikis derasnya air sungai, apalagi dengan kondisi hujan yang tak reda-reda,”ungkap M Yusuf, Ketua Kelompok Tani Sejahtera Bersama. Saat ditanyai kepada ketua kelompok tani tentang siapa yang bertanggung jawab pada pelaksanaan proyek tersebut warga tidak ada yang tahu alias ‘buram’, mereka hanya mengetahui pelaksana proyek tersebut adalah pemerintah daerah. Persoalan tersebut juga sudah mereka kemukakan kepada anggota DPRK Abdya dan Penjabat Bupati setempat, namun hingga saat ini persoalan tersebut belum mendapat tanggapan apapun dari pihak pemerintah. (cb05)

Wisatawan Malaysia Kunjungi Situs Manusia Prasejarah Di Gayo TAKENGEN (Waspada): Situs kerangka manusia prasejarah di Loyang Ujung Karang, Aceh Tengah, yang sedang dalam proses pembuatan duplikat (casting) oleh tim Balar Medan, dikunjungi puluhan wisatawan asal Malaysia, Senin (11/6). “Kami takjub melihat temuan para arkeolog ini. Meski belum tahu banyak tentang pentingnya temuan ini bagi warga di sini. Namun setelah pulang kami akan menceritakannya ke sanak familydiKualaLumpur,”ucap Noraziah Binti Razak, sorang wisatawan, Senin (11/6) di Loyang Ujung Karang. Menurutnya, selain keWaspada/Irwandi MN beradaan situs tersebut, banyak hal lain yang menarik SEORANG pekerja sedang membuat duplikat di lokasi temuan di daerah Gayo ini seperti; kerangka manusia prasejarah di Loyang Ujung Karang, Aceh keunikan budaya, bahasa Tengah. dan indahnya panorama alam. ”Kami merupakan mahasiswi Interna- ini selain bisa mengungkap fakta sejarah, juga sional Islami University Malaysia (IIUM) datang dapat dijadikan lokasi wisata sehingga membanke Indonesia (Aceh) berjumlah 34 orang. keda- tu sumber PAD Aceh Tengah. Selain itu peluang tangan kami kesini mengadakan humanitarian ini bila dikelola dengan baik dapat meningkattrips dari kampus,” akunya dalam logat bahasa kan ekonomi rakyat, karena mereka bisa berjuamelayu Malaysia. lan di sekitar lokasi situs ini,” ucap Ketut. Di tempat yang sama, Ketua Balar Medan, Terkait proses casting, dia mengaku sejak KetutWiradyana yang sedang melakukan proses dimulai proses pengerjaann 6 Juni lalu, pekan pencetakan kerangka manusia prasejarah di ini kemungkinan akan rampung. Di mana nanLoyang Ujung Karang menyebutkan, jika pem- tinya, kerangka asli akan dipindahkan ke mubuatanduplikattelahrampung,lokasigoainidapat seum, sementara hasil pencetakan akan diletadipugar untuk dijadikan lokasi obyek wisata. kan sesuai posisi tengkorak ketika ditemukan “Inilah yang sering saya katakan, temuan sebelumnya. (cb09)

Keterlibatan MDF Pasca Bencana Luar Biasa BANDAACEH (Waspada) : Penjabat Gubernur Aceh Tarmizi A Karim mengakui keterlibatan Multi Donor Fund (MDF) serta lembaga internasional lainnya dalam mendukung program rehabilitasi dan rekonstruksi Aceh pasca bencana tsunami, termasuk pendampingan masa transisi pembangunan, sangat luar biasa. “Keterlibatan anda dalam pembangunan kembali Aceh pasca bencana sangat luar biasa dan kami berharap kerjasama kita akan terus berlanjut,” ujar Tarmizi A Karim pada malam resepsi MDF yang dibacakan Asisten II Setda Aceh T Said Mustafa, Senin (11/6) di Hermes Palace, Banda Aceh. Malam resepsi tersebut selain dihadiri Direktur Bank Dunia Indonesia, manager MDF, Kepala operasi komisi Eropa, para duta besar dan perwakilan negara donor, Deputi Menteri Bappenas, sejumlah bupati/wali kota, juga dihadiri Pemangku Wali Nanggroe Malek Mahmud dan Gubernur Aceh terpilih Zaini Abdullah. Tarmizi menyebutkan, MDF telah memberikan dukungan pendanaan yang luas terhadap rekonstruksi Aceh. Pembangunan perumahan, infrastruktur, perlindungan lingkungan dan program lainnya yang telah memberi kesempatan yang lebih luas terhadap Aceh dalam mempercepat pembangunan berkelanjutan. “Layaknya sebuah program, pada akhirnya mandat MDF juga memiliki batas waktu pelaksanaan, yakni sampai penghujung 2012 ini. Kami yakin masih banyak pekerjaan yang belum selesai,” tutur Tarmizi. Dikatakan, program pembangunan Aceh

pasca 2012 akan membutuhkan perhatian dan dukungan untuk memastikan pembangunan ekonomi yang berkelanjutan dengan fokus pada peningkatan kapasitas lokal untuk pelayanan publik, manajemen keuangan publik dan kelanjutan program mata pencaharian untuk penciptaan lapangan kerja. Deputi Pengembangan dan Otonomi Daerah Kementerian Bappenas Max Pohan menyatakan, meskipun MDF berakhir pembangunan di Aceh tetap dilanjutkan bersama dengan program-program pembangunan nasional dan pusat, akan terus mendorong Pemerintah Aceh untuk terus melanjutkan pembangunan. Dalam tujuh tahun terakhir, MDF sebuah organisasi non pemerintah yang dibentuk untuk mengelola dana hibah 15 negara donor pasca bencana gempa yang diikuti gelombang tsunami Aceh tahun 2004 yang menewaskan lebih dari 150.000 ribu jiwa. Direktur Bank Dunia Indonesia, Stefan Koeberle mengakui kegigihan masyarakat Aceh untuk bangkit setelah dihantam tsunami yang menewaskan sekitar 150 ribu jiwa. “Masyarakat Aceh menunjukkan ketangguhannya setelah bencana tsunami melanda untuk bangkit membangun kembali kehidupannya,” tandasnya. Manajer MDF untuk Aceh dan Nias, Shamima Khan, mengakui pihaknya datang untuk membantu masyarakat Aceh. Namun di balik itu, pihaknya juga mendapat pelajaran yang berharga ikut dalam proses pemulihan pasca bencana serta berharap masyarakat Aceh sendiri akan melanjutkan pembangunan itu. (b06/b04)


B12 PEUREULAK (Waspada) : Boat bantuan yang dikelola secara kelompok di Desa Paya Gajah, Kec.Peureulak Barat, Kab. Aceh Timur diduga sengaja tak difungsikan dan dibiarkan terbengkalai di semak-semak di kawasan Tempat Pendaratan Ikan (TPI) Dusun Seumatang, desa setempat. Kini boat bantuan itu terancam dimakan rayab. Muksin, tokoh pemuda Peureulak Barat, Rabu (13/6) mengatakan, boat ukuran sekitar 2 X 8 meter kini terancam dimakan rayab karena lokasi boat diletakkan di semak-semak di kawasan TPI. “Kita duga boat itu sengaja diterlantarkan, padahal bantuan itu diberikan untuk desa untuk kemaslahatan masyarakat setempat,” katanya. Muksin menambahkan, boat bantuan tersebut diperkirakan sudah terbengkalai selama setahun lebih, bahkan hasil penelusuran ke lokasi mesin boat sudah tidak ada. Camat Peureulak Barat T Reza Rizki mengatakan, boat tersebut bukan diterlantarkan oleh kelompok, tetapi menunggu mesin boat yang sedang diperbaiki. (b24)

BNN Akan Tes Urin Anggota DPRK Langsa

Siswa Wajib Kuasai Bahasa Inggris PEUREULAK (Waspada) : Persaingan global belakangan semakin ketat terutama di tingkat siswa. Untuk meningkatkan mutu pendidikan dan keterampilan dalam persaingan, para siswa diminta untuk menguasai bahasa asing, khususnya Bahasa Inggris yang sudah menjadi bahasa dunia internasional. “Bahasa Inggris itu penting dipelajari. Kenapa penting, karena Bahasa Inggris itu kunci untuk mempelajari ilmu pengetahuan yang lebih luas,” papar Kadis Pendidikan Aceh Timur Agussalim saat membuka Lomba Pidato Bahasa Inggris tingkat SLTA di MAS Al Widyan Alue Lhok, Kecamatan Peureulak Timur, Rabu (13/6). Di hadapan Kepala Kemenag Aceh Timur Tgk Faisal Hasan, Kadisdik mengatakan, karena Bahasa Inggris sudah dijadikan bahasa internasional sehingga sejak tingkat SMP sudah diwajibkan untuk mempelajari Bahasa Inggris yang dijadikan sebagai salah satu mata pelajaran, bahkan daerah-daerah yang maju Bahasa Inggris itu diwajibkan belajar sejak tingkat SD. (b24)

92 Peserta Ramaikan MTQ Banda Alam BANDAALAM (Waspada) : Sebanyak 92 peserta dari berbagai cabang meramaikan Musabaqah Tilawatil Quran (MTQ) tingkat kecamatan di Banda Alam—Keude Geurobak, Kab. Aceh Timur, Selasa (12/6) malam. MTQ yang dibuka Camat Banda Alam ditutup Kamis (14/ 6) malam. Pada malam penutupan, masing-masing Cabang MTQ akan diberikan hadiah dan uang pembinaan untuk peserta. “Dan untuk Juara I dari masing-masing cabang akan dikirim ke MTQ tingkat kabupaten,” kata Camat Banda Alam, Abdul Aziz. Abdul Aziz menambahkan, MTQ di Banda Alam tak hanya sebatas kegiatan untuk mencari bibit dan menumbuhkan rasa cinta umat Islam terhadap Alquran, tetapi melalui ajang MTQ ini masyarakat se kecamatan bisa saling memperkuat tali silaturrahmi. (b24)

Waspada/Muhammad H Ishak

BOAT bantuan yang dikelola secara kelompok terlihat disemak-semak di kawasan TPI Dusun Seumatang, Desa Paya Gajah, Kec.Peureulak Barat, Aceh Timur, Senin (11/6).

Pencairan Gaji Ke-13 Tunggu SE Menkeu IDI (Waspada) : Penjabat Bupati Aceh Timur Nasrullah Muhammad mengatakan, pencairan gaji ke-13 Pegawai Negeri Sipil (PNS) di lingkungan Pemkab setempat akan segera cair setelah turunnya Surat Edaran (SE) dari Menteri Keuangan di Jakarta. “Menyusul pemberitaan di media cetak terkait sejumlah

kabupaten/kota akan mencairkan gaji ke-13 pada akhir Juni ini, pihak Pemkab Aceh Timur belum bisa berjanji jadwal pencairan tersebut, karena sampai sekarang masih menunggu surat edaran Menteri Keungan,” kata Nasrullah Muhammad, Rabu (13/6) di Idi. Dia menambahkan, surat edaran Menkeu tersebut dinilai penting dalam proses pencairan gaji ke-13 yang nilainya ratusan miliar itu. Pasalnya, surat edaran tersebut menjadi salah satu payung hukum dalam mencair-

kan uang negara. “Jadi, belum ada kabupaten/kota yang telah menentukan jadwal pencairan itu, karena surat edaran turun secara serentak,” tutur Nasrullah. Bupati Nasrullah menyebutkan, pada kebiasaan gaji ke13 akan dicairkan pertengahan tahun dalam tiap-tiap tahun, tetapi tahun ini surat edaran belum diterima kabupaten/kota di Aceh. “Jika surat edaran tersebut turun, maka kita langsung mencairkan kepada yang ber-hak menerima,” kata Nasrullah. (b24)

Warga Laporkan Kasus Perusakan Rumah ACEHUTARA (Waspada): Asmawati, 34, melaporkan tindak pidana perusakan rumah dan perampasan lahan di Gampong Cempedak, Kecamatan Tanah Jambo Aye, Aceh Utara ke Polres setempat. Sebelumnya, korban mengaku telah melaporkan ke Polsek, namun ditolak. Asnawati, Selasa (12/6) menjelaskan, kasus perusakan rumahnya yang dilakukan oknum warga telah dilaporkan ke Polres Aceh Utara. Dalam lapo-

ran yang diterima Aiptu Anung Harijono dijelaskan, pada Selasa 5 Juni 2012 terjadi perusakan dan perampasan di Cempedak. Berdasarkan laporan polisi nomor:LP/III/VI/2012/PA/RES AUT/SPKT, kejadian pada 5 Juni 2012, pelakunya SG bersama sejumlah rekannya. Korban juga mengatakan, rumah permanen dan tanah merupakan miliknya yang dibeli bersama suami yang meninggal sekitar tahun 2003. Lahan ter-sebut dibeli dari

keluarga suaminya Muhammad Dahlan. Namun, setelah suami mening-gal dunia, pihak keluarga meminta tanah tersebut diganti dengan tanah di lokasi lain sehingga korban tidak terima. Karena mempertahankan tanah tersebut, Asmawati bersama dua anaknya terpaksa mengungsi ke Matang Drien sehingga rumah tersebut dibiarkan kosong. “Sekitar pukul 09:30 pada Selasa, 5 Juni 2012, rumah saya dirusak,” jelasnya. (b15)

NAGANRAYA (Waspada) : Kementerian Keuangan Republik Indonesia Direktorat Jenderal Pajak Kantor Wilayah Direktorat Jenderal Pajak Aceh memberikan piagam penghargaan kepada PT Socfindo Indonesia Medan Kebun, Nagan Raya. Pengurus PT Socfindo Kebun Seunagan Danang Bayu Saksono mengatakan, penghargaan tersebut adalah penghargaan pertama yang diterima PT Socfindo Nagan Raya Karen telah membayar pajak tepat waktu. “Piagam penghargaan yang diterima tersebut sebagai sepuluh besar pembayar pajak tahun 2012,” kata Danang Bayu.(cda)

Petugas BP4K Terima Kendaraan Dinas

Waspada/Muhammad H Ishak

ASISTEN II Setdakab Aceh Timur M Yasin (kiri) menyerahkan kendaraan dinas untuk petugas penyuluh di wilayah Aceh Timur di halaman Kantor BP4K Aceh Timur di Langsa, Selasa (12/6).

LANGSA (Waspada) : Masyarakat Kota Langsa kembali memberikan hak suaranya untuk memilih Wali Kota Langsa periode 2012/ 2017, Kamis (14/6). Sekitar 110.260 pemilih diharapkan akan datang di 260 Tempat Pemungutan Suara (TPS) yang telah disediakan panitia pemilihan di setiap gampong di wilayah pemerintahan Kota Langsa. Pemilihan kepala daerah (Pilkada) ini merupakan pelaksanaan putaran kedua setelah putaran pertama 14 April 2012 lalu tidak ada pasangan calon yang memperoleh 30 persen suara. Dalam putaran kedua ini tampil dua pasangan calon, masing-masing Zulkifli Zainon yang berpasangan dengan Syaifullah dan Usman Abdullah (Toke Seue’um) yang menggandeng Marzuki Hamid. Pada putaran pertama lalu PilkadaWali Kota Langsa diikuti 13 kandidat pasangan calon, Zulkifli Zainon mendapatkan suara 27,92 persen, sementara Usman Abdullah memperoleh 21,48 persen suara. Sedangkan 11 pasangan lainnya meraih suara bervariasi 1.06 hingga 12,34. Ketua KIP Kota Langsa Agusni AH, Selasa (12/6) mengatakan, tahapan pemu-ngutan suara pilkada putaran kedua tetap dilaksanakan Kamis (14/6) sesuai keputusan KIP dan seluruh

persiapan sudah rampung. Agusni mengimbau masyarakat yang memiliki hak pilih untuk berbondong-bon-dong mendatangi setiap Tempat Pemungutan Suara (TPS) untuk menyalurkan hak demokrasinya. ‘’Saya juga berharap masyarakat proaktif untuk menghubungi Panitia Pemungutan Suara (PPS) apabila belum menerima surat undangan. Saya mengimbau penyelenggara bekerja netral,” ungkapnya. Dikatakan, seluruh logistik pe-nunjang pelaksanaan pilkada pu-taran kedua sudah berada di Panitia Pemilihan Kecamatan (PPK). “Saya juga memas-tikan satu hari sebelum pemungutan suara, seluruh logistik sudah berada di 260 TPS,” katanya. Sementara pengamatan di lapangan, peluang kedua pasangan yang maju untuk menduduki kursiWali Kota Langsa masa bhakti lima tahun ke depan masih tetap fifty-fifty alias samasama berpeluang. Apalagi masing-masing memiliki dukungan yang besar dari masyarakat Kota Langsa sehingga sulit diprediksi siapa yang bakal tembus menjadi Wali Kota Langsa. Kandidat tersebut masing-masing mempunyai basis dukungan tersendiri yang kini menjadi andalan calon dalam upaya menjaring suara dalam pilkada tahap kedua hari ini. (b21/m43)

BK- DPRK Proses Usulan PAW REDELONG (Waspada) : Ketua Badan Kehormatan Dewan Perwakilan Rakyat Kabupaten (BK-DPRK) Bener Meriah akan memproses surat usulan Pergantian Antar Waktu (PAW) yang diusulkan pengurus Partai Hanura terhadap kadernya yang dianggap membangkang dan melanggar AD/ART. Menjawab pertanyaan Waspada, Selasa (12/6), Sarhamija, Ketua BK-DPRK Bener Meriah menyebutkan, sudah dua kali surat dari pengurus Partai Hanura Aceh tersebut dikirim ke DPRK. ”Yang pertama dikirim pada 21 Mei 2012 dan isi surat tersebut berupa rekomendasi agar anggota DPRK Andi Sastra di-PAW dan digantikan Saiful Bahri,” ungkap Sarhamija. Selanjutnya, surat yang kedua dikirim pada 25 Mei 2012 dan lebih tegas lagi isinya berbunyi agar lakukan PAW dengan segera. ”Hingga saat ini kami telah memeriksa beberapa berkas usulan tersebut, masih ada beberapa form lagi yang

belum dilampirkan sehingga proses tersebut agak lamban,” ungkap ketua BK-DPRK ini. Ketua badan kehormatan ini tidak menyebutkan kesalahan anggota DPRK-Bener Meriah yang masih muda ini ingin di-PAW oleh partainya sendiri, namun isi surat tersebut berbunyi bahwa dia tidak menjalankan AD/ART Partai Hanura. Menurut Sarhamija, pada dasarnya untuk melakukan PAW surat pengurus partai tersebut tidak harus dari pengurus pusat, cukup dari pengurus daerah. ”Sesuai tatib, untuk melakukan PAW surat dari pengurus daerah sudah cukup kuat untuk dijadikan alasan pemberhentian,” ujarnya. Saiful Bahri yang akan menggantikan Andi Sastra ketika dihubun melalui telepon mengaku sedang berada di Jakarta. ”Persoalan ini agar jangan diekspose, karena saat ini lagi dalam proses negosiasi,” papar Andi. (b33)

Pelantikan Pimdes Se-Agara KUTACANE (Waspada) : Ketua Dewan Pimpinan Daerah (DPD) II Partai Golongan Karya Hasanuddin B MM, Minggu (10/6) melantik pengurus Pimpinan Desa (Pimdes) se- Kabupaten Aceh Tenggara di Pekan Lawe Sigala-gala, Kecamatan Lawe Sigala-gala. Acara itu dihadiri para kader Golkar, anggota DPRK, dan pendukung partai koalisi sejumlah 12 partai, serta dan simpatisan. Sekretaris DPD II Golkar M Salim Fakhri, Selasa (12/6) mengatakan, mereka yang dilantik adalah Pimdes partai berlambang pohon beringin dari Kecamatan Lawe Sigala-gala, Semadam dan Kecamatan Babul Makmur, dengan jumlah 834 personil. Sebelumnya, juga telah dilantik enam kecamatan pengurus Pimdes Golkar. Dalam waktu dekat ini dilantik tujuh kecamatan Pimdes Golkar sehingga seluruhnya pengurus Pimdes 16 kecamatan dengan jumlah

2.743 orang. Kata M Salim Fakhri yang juga Ketua DPRK Agara, kader Golkar pada 2 Juli 2012 Pilkada Agara periode 2012 -2017 mendatang akan bertarung untuk memenangkan pasangan Hasanuddin B-Ali Basrah (SABAR) dan kader Golkar akan berupaya memenangkan calon yang diusung dari partainya dan mereka yang dilantik ini akan bekerja seluruhnya untuk memenangkan nomor urut 2, pasangan Sabar. Ketua DPD II Golkar yang juga Bupati Agara Hasanuddin B mengatakan, pilkada merupakan seni, pertandingan politik untuk menjadi pemimpin dan menjalankan amanah rakyat. Tidak perlu curang, menjelek-jelekan atau fitnah, dan cukup meyakinkan masyarakat, pasalnya masyarakat tahu persis, kita adalah yang terbaik dan telah terbukti untuk melanjutkan pembangunan di Agara. (b25)

Nelayan Urung Melaut, Harga Ikan Melambung

Socfindo Dapat Penghargaan

IDI (Waspada) : Untuk mencapai hasil kineja yang maksimal, pegawai negeri sipil dituntut untuk melaksanakan tugas dan fungsi sebagaimana menstinya untuk memberikan pelayanan ke masyarakat. Untuk mendukung kerjanya itu, Pemkab menyerahkan kendaraan dinas untuk Kepala Badan Penyuluhan Pertanian, Perikanan, Perkebunan dan Kelautan (BP4K) Aceh Timur, Selasa (12/6). Belasan kendaraan dinas tersebut diserahkan Penjabat Bupati Aceh Timur Nasrullah Muhammad melalui Asisten II M Yasin usai apel di halaman Kantor BP4K Aceh Timur di Langsa. Menurutnya, kendaraan dinas tersebut diharapkan dapat dimanfaatkan untuk kebutuhan dinas dalam melayani masyarakat. M Yasin menyerahkan 16 unit kendaraan dinas roda dua itu tujuannya sebagai kendaraan operasional untuk petugas penyuluh pertanian, perikanan, perkebunan dan kelautan yang bertugas di kecamatan yang didampingi. Dalam penyerahan kendaraan itu juga ikut hadir Kepala Badan Penyuluhan Pertanian, Perikanan, Perkebunan dan Kelautan (BP4K) Aceh Timur Zulkifli Gani dan Kabid Bidang Sistem Penyuluhan BP4K, Said Junaidi. Ke-16 kendaraan operasional tersebut diperuntukan bagi petugas badan penyuluhan di Kecamatan Madat, Simpang Ulim, Darul Aman, Rantau Selamat, Simpang Jernih, Banda Alam, Darul Ichsan, Idi Rayeuk, Julok, Serbajadi, Darul Falah, Pante Bidari, Peureulak Kota, Peureulak Timur dan Birem Bayeun. (b24)

Kamis 14 Juni 2012

Hari Ini Pilkada Putaran Kedua Kota Langsa

Boat Bantuan Dimakan Rayab

LANGSA (Waspada) : Untuk menciptakan masyarakat bebas narkoba pada 2015, BNN Langsa semakin gencar melakukan penyuluhan. Di samping itu juga melakukan tes urin terhadap semua pihak terutama orang-orang yang menjadi panutan rakyat banyak. Maka itu dalam waktu dekat ini seluruh anggota DPRK Langsa juga akan dites urinnya. Demikian dikatakan Ketua BNN Kota Langsa Kompol NavriYuleni usai memberi materi pada lokakarya yang diselenggarakan keluarga besar Kodim 0104/ Aceh Timur, Selasa (12/6). Lokakarya tersebut diikuti 500 orang anggota Persit Chandra Kirana,Warakauri dan pejabat utama Kodim Aceh Timur. Thema yang diusung dalam lokakarya itu adalah: Peran Orangtua Dalam Mendidik Anak Agar Terhindar Dari Penyalahgunaan Narkoba. Tempatnya dilaksanakan di aula terbuka Makodim Aceh Timur. Berkaitan dengan rencana melakukan tes urin terhadap anggota DPRK Langsa, kata Navri Yuleni, bertujuan agar mereka benar-benar menjadi bersih. Karena mereka adalah wakil rakyat, untuk mengetahui mereka menggunakan atau tidak alat tes urinlah yang akan menjawab.(b20)


Waspada/ Bahtiar Gayo

KETUA Komisi D DPRK Bener Meriah Hasbi Sulaiman dan sekretarisnya Darwinsyah saat meninjau pelayanan kesehatan di Puskesmas Simpang Tiga.

Puskesmas Simpang Tiga Jadi Contoh Pelayanan KIA ANAK yang sehat dambaan semua orang. Apakah mungkin anak akan sehat bila sang ibu yang merawatnya tidak sehat? “Itu menjadi tanggungjawab kita! Bagaimana agar kesehatan ibu dan anak dari hari ke hari semakin baik,” kata Risnawati SSit. Kepala Puskesmas, Simpang Tiga, Bener Meriah ini mulai merubah paradigma dalam memberikan pelayanan kesehatan di daerahnya. Risna, 40, begitu panggilan akrabnya, benar-benar berbenah ingin menunjukkan bahwa Puskesmas Simpang Tiga di Bener Meriah bisa dijadikan contoh dalam pelayanan Kesehatan Ibu dan Anak (KIA) serta pelayanan lainnya. Walau kepala Puskesmas ini seorang wanita dan mengurus 60 staf ditambah 33 bidan desa, namun Risna terlihat mampu menggerakkan potensi. Walau tanpa dasar ilmu managemen, hanya ahli dalam kebidanan, namun roda organisasi di puskesmas ini berdenyut. Demikian dengan 4 unit Puskesmas Pembantu (Pustu) serta 40 kampung

di sana mendapat layanan kesehatan dengan baik. “Kita bekerja bukan sendiri. Ada teamwork. Saya memberikan kepercayaan penuh kepada staf untuk menggerakkan puskesmas ini. Bila ada kendala baru saya turun tangan, mengatasinya bersama-sama,” papar Risna, Kepala Puskesmas Simpang Tiga. Dalam memberikan pelayanan kepada masyarakat, visi dan misi Puskesmas ini jelas. Standar operasional prosedur masing-masing ruang serta alur layanan sudah memiliki ketentuan baku. Aturan itu yang harus dijalankan staf. Puskesmas di sentral ibu kota Bener Meriah itu saat sekarang ini sudah membuat banner (spanduk besar) dan tertempel di dinding puskesmas. Masyarakat bisa mengetahui apa yang akan dikerjakan pihak puskesmas dalam memberikan layanan. Apa visi dan misi mereka serta apa hak masyarakat dalam mendapatkan layanan. Semua informasi itu terpampang di puskesmas. Selama ini di Bener Meriah

belum ada puskesmas yang memberikan informasi terbuka, dalam memberikan pelayanan. Walau fasilitas puskesmas ini belum memadai, namun Risna berusaha memberikan yang terbaik untuk masyarakat. “Kami berterimakasih atas keseriusan pihak KINERJAUSAID dan Dinas Kesehatan yang telah mendampingi kami dan memberikan bantuan teknis. Kerja keras KINERJA mendorong terciptanya layanan kesehatan yang baik, sangat kami hargai,” tutur Risna. Dicky Ariesandi, Lokal Publik Service Specialist (LPSS) KINERJA-USAID, yang turut mendampingi Risna menambahkan, pihaknya tetap mendampingi pelayanan puskesmas semakin baik. “Pelayanan persalinan aman, inisiasi menyusu dini dan ASI ekslusif benar-benar tepat. Itu tanggungjawab kami selaku mitra dari program KINERJAUSAID. Bukan hanya untuk Puskesmas Bukit, namun Puskesmas Bandar serta Puskesmas Buntul,” tutur Dicky. Bahtiar Gayo

TAPAKTUAN (Waspada) : Hingga kemarin, ribuan nelayan di Kabupaten Aceh Selatan belum sepenuhnya melakukan aktivitas melaut akibat terpaan angin kencang dan ombak besar yang melanda kawasan pantai barat Aceh sejak sebulan terakhir. Kondisi ini menyebabkan selain ribuan nelayan terus menganggur, harga ikan basah menjadi langka dan membuat harganya praktis melambung mencapai dua hingga tiga kali lipat. Harga ikan karang berkualitas ekspor seperti bandi, tuna dan jenis ikan merah, biasanya seharga Rp30.000 hingga Rp35.000 per kilogramnya, naik menjadi Rp75.000 hingga Rp80.000 per kilogram. “Ini pun susah kita peroleh, meski di daerah basis seperti Sawang Ba.U, Kecamatan Sawang, Meukek dan Labuhanhaji,” ucap Heri, 35, pedagang ikan, warga Gampong Hilir, Tapaktuan di Tapaktuan. Sedangkan ikan basah yang beredar di pasaran hanya jenis ikan tongkol yang

diawetkan, juga dijual dengan harga mencekik leher. Amiruddin, 40, nelayan Gampong Lhok Bengkuang menyebutkan, telah hampir sebulan mereka nganggur, tidak melaut karena gangguan badai dan ombak ganas masih menyelimuti Samudra Indonesia. Camat Trumon Isa Ansari yang dihubungi secara terpisah mengatakan, hubungan transportasi laut dari Keude Trumon ke Kemukiman Bulohseuma masih lumpuh, karena kapal motor yang melayani trayek kedua daerah itu belum berani beroperasi karena gangguan ombak dan angin kenacang. Warga Bulohseuma, menurut Isa Ansari, hanya bisa pasrah, menyikapi krisis sembako yang melanda kawasan tersebut belakangan ini. “Kita sangat prihatin, tetapi sejauh ini belum ada solusi memasok sembako ke sana,” ucap Ansari. (b30)

43 Gampong Serentak Pemilihan Keuchik 30 Juni LANGSA (Waspada) : 43 Gampong di lima wilayah kecamatan di Pemeritahan Kota (Pemko) Langsa akan menggelar serentak pemilihan keuchik (kepala desa) pada 30 Juni 2012. Demikian dijelaskan Kepala Bagian Pemerintahan Pemko Langsa Rinaldi Aulia di kantornya, Senin (11/6). Rinaldi Aulia yang didampingi Kasubag Pemerintahan Ernie Yanti mengemukakan, pemilihan keuchik secara masal ini dilakukan karena sebagian besar pejabat keuchik di gampong-gampong tersebut telah berakhir masa tugasnya sejak Juni 2011. Untuk kelangsungan dan kelancaran jalannya roda pemerintahan desa, maka Wali Kota Langsa (ketika itu) Zulkifli Zainon mengangkat pejabat sementara sebagai pelaksana tugas. Pejabat sementara yang diangkat itu, sebagian dari unsur Sekretaris Gampong atau kalangan pejabat Pemko Langsa ditetapkan masa tugas selama satu tahun sejak berakhir masa bhakti pejabat defenitif keuchik dan mrreka bertugas sampai 30 Juni 2012 mendatang. Oleh karena itu, sebelum masa bhakti mereka sebagai pelaksana tugas pejabat keuchik berakhir, maka dilaksanakan pemilihan pejabat baru. 43 Gampong yang akan melaksanakan pemilihan keuchik meliputi 12 gampong di Kecamatan Langsa Timur, Buket Pulo, Matang Seutui, Buket Rata, Alue Merbau, Matang Cengai, Seunebok Antara, Alue Pineueng, Sukarejo, Cinta Raja, Buket Medang Ara, Kapa

dan Alue Pineung Timu. Dua gampong terakhir adalah gampong pemekaran. Kecamatan Langsa Kota tiga gampong yakni, Gampong Blang, Gampong Meutia dan Tualang Teungoh. Lima gampong di Langsa Barat terdiri dari PB Teungoh, Sungai Pauh berikut tiga gampong pemekaran, Sungai Pauh Pusaka, Sungai Pauh Tanjong dan Sungai Pauh Firdaus. Selanjutnya di Langsa Timur 13 gampong, Pondok Kemuning, Seulalah, Siderejo, Gampong Baro, Meurandeh, Asam Petik, Baroh Langsa Lama berikut enam gampong pemekaran, Meurandeh Tengah, Meurandeh Dayah, Meurandeh Aceh, Seulalah Baru, Bate Puteh dan Sukajadi Kebun Ireng. Kecamatan Langsa Baro 10 Gampong adalah Timbang Langsa, Alue Dua, Pondok Kepala, Karang Anyar, Paya Bujok Tunong, Geudubang Jawa, Geudeubang Aceh, Lengkong, Sukajadi Makmur dan Alue Dua Bakaran Batee. Tiga terakhir adalah gampong pemekaran. Khusus Gampong Meutia yang juga akan menggelar pemilihan keuchik defenitif, menurut HM Yusuf Hamid yang merupakan pejabat sementara keuchik mengatakan sudah ada empat bakal calon yang mengambil formulir. Selain dia, katanya, ada tiga figur muda yang maju dan bersaing dalam pemilihan nanti. Mereka adalah Saifol, Imran dan Khalid. Sedangkan mantan keuchik M NoorYahya, belum memutuskan apakah akan maju atau tidak. (b21/m43)

Waspada, Kamis 14 Juni 2012  

waspada daily

Read more
Read more
Similar to
Popular now
Just for you