Page 1

Medan 24-32 C

Berastagi 19-30 C

R. Prapat 24-320C

Parapat 19-30 0C

P. Siantar 17-270C

Sibolga 21-30 C

0

0

0

Hujan guntur

Berawan

WASPADA Demi Kebenaran Dan Keadilan

Prakiraan Cuaca Kamis

BMKG Polonia

KAMIS, Legi, 13 Januari 2011/8 Safar 1432 H

http://epaper.waspadamedan.com

No: 23385 Tahun Ke-65

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

Terbit 24 Halaman (A1-12, B1-12)

Harga Eceran: Rp2.500,-

Waspada/Hang Kesturi Said

MIMPI SUMUT: Bandara Kualanamu, Deliserdang masih dalam tahap pengerjaan. Foto dari pesawat AirAsia yang diabadikan oleh wartawan Waspada kemarin memperlihatkan proyek bandara tersebut masih sangat miskin infrastruktur sehingga sangat tidak mungkin dapat beroperasi pada tahun depan atau 2012. Pemandangan dari atas pesawat memperlihatkan hanya ada

landasan pacu, sedangkan jalan tol atau jalur khusus rel kereta api masih belum kelihatan sama sekali. Seandainya bandara selesai pada 2012 tetapi tanpa infrastrutur penunjang maka bukan tidak mungkin jika kita akan terbang maka harus bersiapsiap tujuh jam sebelum pesawat take off. Sangat melelahkan warga yang sudah biasa manja dengan keberadaan Bandara Polonia.

Kualanamu Mimpi Sumut MEDAN (Waspada): Salah satu elemen penting pembangunan bandara Kualanamu adalah akses jalan dari dan ke bandara. Namun puluhan Kepala Keluarga di Desa Pasar V, Kebun Kelapa, Kec. Beringin dikabarkan masih bertahan karena ganti rugi JAKARTA (Antara): Badan Nasional Penanggulangan Bencana belum selesai.

BNPB Minta Daerah Tetap Siaga Banjir

(BNPB) meminta Badan Penanggulangan Bencana Daerah (BPBD) untuk bersiaga menghadapi kemungkinan terjadinya banjir di wilayah masing-masing. “BNPB juga telah mengirimkan staf untuk memberikan bimbingan manajemen penanggulangan bencana ke beberapa BPBD,” kata Kepala Pusat Data Informasi dan Humas BNPB, Sutopo Purwo Nugroho di Jakarta, Rabu (12/1). Sutopo menjelaskan, pihaknya telah mengirimkan staf ke berbagai wilayah yang terjadi bencana banjir diantaranya Sumatera Utara dan Banten. “Kami mengirimkan tim untuk berkoordinasi dengan BPBD dan memantau perkembangan banjir yang terjadi di Medan, Sumatera Utara dan Pandeglang Banten,” katanya. Dia meminta BPBD di Sumatera Utara dan Banten untuk terus bersiaga dan memantau segegala perkembangan banjir. BNPB juga meminta BPBD di wilayah lainnya di seluruh tanah air untuk ikut bersiaga mengingat kondisi cuaca yang tidak menentu mengakibatkan beberapa provinsi terancam banjir. “BPBD yang ada di daerah lainnya juga harus ikut waspada karena hingga Maret 2011 kondisi cuaca tidak menentu sehingga bencana banjir masih mengancam berbagai provinsi ,” katanya. Pekan lalu, banjir juga melanda sebagian besar wilayah Kota Medan, menyusul hujan lebat sepanjang Rabu (5/1) malam hingga Kamis (6/1) dinihari. Ribuan rumah terendam dan beberapa di antaranya bahkan hanyut.

Padahal, lokasi pemukiman mereka adalah daerah vital bagi bandara baru itu. Mungkinkah bandara Kualanamu cuma proyek mimpi untuk masyarakat Sumut? Kecamatan Beringin merupakan satu dari dua kecamatan yang mengapit lokasi bandara

Kualanamu—selain Kecamatan Pantailabu di Deliserdang. Itu sebabnya Kecamatan Beringin masuk dalam pelintasan akses jalan masuk dan keluar bandara Kualanamu. Malangnya hingga kini masyarakat di sana masih nekat untuk mempertaruhkan

dirinya untuk mendapat ganti rugi yang layak. Bagi mereka masalah ganti rugi lahan dan bangunan masih belum selesai. Padahal dalam Perpres No.13 Tahun 2010 telah diatur tentang syarat pembebasan 100 persen lahan sebelum sebuah proyek diajukan. Artinya pembangunan akses jalan dari dan ke bandara masih belum bisa dilaksanakan sebelum syarat pembebasan lahan terpenuhi. Itu artinya pembangunan bandara Kualanamu secara keseluruhan masih terkendala Perpres ini.

Hal ini seperti yang dikatakan Kepala Badan Pengatur jalan Tol (BPJT) Ahmad Ghani Gazali mengatakan, proyek pembangunan Jalan tol MedanLubuk Pakan-Kualanamu masih terbentur dengan Perpres No.13 Tahun 2010. ‘’Dalam Perpres tersebut diatur tentang syarat pembebasan 100% lahan sebelum sebuah proyek diajukan. Hal ini tentu saja makin memperlama kinerja dari suatu proyek tertentu,” katanya di Jakarta, Rabu (12/1).

Lanjut ke hal A2 kol. 6

Menko Polhukam Bantah Pemerintah Berbohong JAKARTA (Antara): Menteri Koordinator Politik Hukum dan Keamanan Djoko Suyanto mengatakan, pemerintah tidak pernah berbohong kepada rakyat tentang prestasi yang telah dicapai. “Pemerintah tidak pernah berbohong,” kata Djoko di Kantor Kepresidenan, Jakarta, Rabu (12/1), menyikapi editorial sebuah media massa. Menurut Djoko, editorial media cetak itu menyebutkan bahwa pemerintah sudah terlalu banyak melakukan kebohongan kepada rakyat. Djoko menyebutkan, editorial juga menyerukan ajakan kepada rakyat untuk memerangi kebohongan tersebut. Editorial media massa itu dibuat berdasarkan pernyataan sejumlah tokoh yang menyebut tentang kebohongan yang dilakukan oleh pemerintah. Na-

mun, Djoko tidak menanggapi tudingan tokoh-tokoh tersebut, tapi lebih memilih menanggapi editorial media massa. Djoko menegaskan, pemerintah bekerja dengan sungguhsungguh dan tidak memiliki niat sedikitpun untuk berbohong kepada rakyat. Semua daftar prestasi pemerintah, katanya, disampaikan berdasar data dari lembaga resmi. Bahkan, Djoko menegaskan, pemerintah juga dengan terbuka dan jujur menyampaikan beberapa program yang belum tercapai. Djoko mengatakan, pemerintah lebih bisa menerima jika dianggap belum berhasil dalam melaksanakan program kerja di beberapa bidang. “Tapi kalau pemerintah berbohong, saya kira ini terlalu jauh,” katanya.

Lanjut ke hal A2 kol. 3

Petugas Rutan Tarutung Aniaya Tahanan

Kritik Megawati Sulit Dapat Simpati Masyarakat

TARUTUNG (Waspada): Oknum petugas Rutan (Rumah Tahanan)Tarutung, kabupatenTapanuli Utara, menganiaya seorang penghuni hingga muntah darah. Korban saat ini dirawat inap di RSUD Tarutung, Kabupaten Taput. Korban penganiayaan, Maret Sitompul ,24, warga Siatas Barita, Taput, saat ditemui Waspada, Rabu (12/1) sore di salah satu kamar di Zal 5 RSUD Tarutung,menuturkan dirinya dianiaya dua oknum Polisi Rutan, Tarutung, bermarga Sirait dan Napitupulu. Penganiayaan terjadi pada awal Januari 2011 sekira pukul 20:30 dengan memukuli seluruh bagian tubuh korban. Korban juga menceritakan pada saat kejadian dia diseret dari sel (ruang tahanan) 8 keluar, selanjutnya tubuhnya dipukuli dengan sepatu besar hingga badannya lembam dan muntah darah. “Saat itu saya tidak sadar diri, saya tidak ingat persis tanggal kejadian yang jelas awal Januari 2011,” sebut korban sambil menangis. Lanjut korban, setelah dipukuli dirinya dipindahkan ke ruang tahanan nomor tiga. ‘’Di sana saya sudah sakit, lemas dan tidak mampu untuk berdiri. Saya tetap ditahan hingga satu Minggu. Saya tidak dikasi obat dan tidak diberitahu kepada keluarga,’’ katanya. Korban menceritakan, dirinya dibawa ke RSU Tarutung, pada Selasa 11/1 malam oleh staf Rutan dan beberapa orang rekan tahanan, ungkapnya. Berawal Dari Perkelahian Saat ditanya Waspada, alasan pemukulan oleh dua oknum Polisi Rutan Tarutung, terhadap dirinya, korban MS, menceritakan karena terjadi perkelahian antara dirinya dengan tahanan lain.

JAKARTA (Antara): Pengamat politik dari Lembaga Survei Indonesia (LSI) Burhanuddin Muhtadi berpendapat kritik Ketua Umum DPP PDIP Megawati Soekarnoputri terhadap pemerintah tidak akan ditanggapi masyarakat karena telah kehilangan otentisitas (keaslian). “Kritikan Megawati terhadap pemerintahan Presiden Susilo Bambang Yudhoyono memang sejalan dengan justifikasi empiris yang dilakukan LSI. Namun, masyarakat tidak akan `membeli` kritikan Bu Mega dengan melihat track record-nya saat menjadi Presiden,” kata Burhanuddin di Jakarta, Rabu (12/1). Sehingga, lanjut dia, kritikan itu akan sulit untuk mendapatkan dukungan dan simpati masyarakat. Menurut dia, dari segi penegakan hukum dan masalah perekonomian, pemerintahan Presiden SBY lebih baik dibandingkan Megawati saat men-

Lanjut ke hal A2 kol. 1

AP

RERUNTUHAN mobil di luar kota Grantham di Tenggara Queensland, Australia, Rabu (12/1). Kota kecil itu telah dilanda oleh banjir bandang yang menimbulkan kerugian besar. Banjir maut yang telah memutuskan hubungan ke seluruh bagian timurlaut Australia telah menggenangi jalanan Brisbane, kota terbesar ketiga di negara itu.

Australia Hadapi Banjir Terburuk, 97 WNI Mengungsi BRISBANE, Australia (Waspada): Brisbane telah diperingatkan bahwa gelombang banjir telah menyapu kota melalui sistem sungai utama kota Rabu (12/1), yang mengancam akan terus melampaui kerugian yang ditimbulkan rekor banjir tahun 1974. Sungai Brisbane, yang memotong pusat kota, diperkirakan air akan meningkat 2 meter lagi

Rabu sebelum mencapai puncaknya pada pukul 04:00 Kamis setinggi lima meter lagi. “Kami bersiap untuk menghadapi bencana alam terburuk dalam sejarah,” kata Menteri Besar Queensland Anna Bligh. Dia meramalkan bahwa 19.700 rumah akan ‘mengalami banjir total’ di Brisbane, yang merupakan tempat tinggal bagi satu juta penduduk dan 4.000 rumah

Istighfarlah Oleh H.Syarifuddin Elhayat

Lanjut ke hal A2 kol. 6

bantuan datang buat Queensland, saat negara bagian itu berjuang menghadapi banjir, kata Menlu Kevin Rudd, Rabu. Berbagai negara, termasuk Indonesia, AS dan Inggris, bersama dengan negara Eropa dan Afrika, telah menawarkan dukungan guna menanggulangi banjir di Queensland.

Lanjut ke hal A2 kol. 6

Empat Korban Keracunan Bakso Masih Dirawat

LENTERA

KETIKA Taqiyuddin nama akrab Imam Hasan Al Bashri ulama besar besar itu duduk-duduk di masjid bersama para sahabatnya, tiba-tiba datang seseorang yang menghampirinya dan berkata,”Ya Taqiyuddin daerah kami kemarau panjang dan hujan tak turun-turun, apa yang harus kami lakukan,”. Kata Imam Hasan Bashri,”Perbanyak istighfar kepada Allah.” Tak lama kemudian, datang lagi seseorang menghampiri dan berkata,”Ya Imam, aku dan juga Negara kami dalam

lainnya nampaknya akan terkena dampak banjir di Ipswich, katanya. Sungai itu diperkirakan akan naik parasnya melampaui rekor banjir tahun 1974 ketika air bah membobol tanggul sungai, yang membanjiri lebih dari 6.000 rumah dan menewaskan 14 orang. Dukungan mengalir dari seluruh dunia dengan tawaran

Waspada/Muhammad Idris

SUMIATI mendapat perawatan di RSUD Dr Kumpulan Pane Tebingtinggi, Rabu (12/1).

Cari Kerja Dapat Petaka NIAT mencari kerja, Sumiati, 50, perantau asal Pulau Jawa malah mendapat siksa petaka. Dia terkapar dalam keadaan tak berdaya di pinggir jalan lintas TebingtinggiMedan tepatnya di Jalan KL. Yos Sudarso Tebingtinggi, Selasa (11/1) pagi sekira pukul 09:00. Warga yang pertama menemukanya melihat Sumiati berjalan dalam keadaan lunglai dan lemas tidak berdaya. Karena shock Sumiati sulit diajak bicara, lalu oleh warga

Lanjut ke hal A2 kol. 6

MEDAN (Waspada): Empat dari 24 siswa SD Inpres No 105292 Jl. Mesjid Pasar IX Desa Bandar Klippa, Kec. Percut Seituan, korban keracunan bakso kojek masih menjalani perawatan di Puskesmas Bandar Khalifah, Rabu (12/1) sore. Sedangkan 20 siswa lainnya diperbolehkan pulang karena kondisinya sudah membaik. Pantauan Waspada, kemarin, keempat siswa tersebut yakni Siti Nurhalijah, 8; Dian Oktavia Purba, 9; Fitri Khairunnisa, 10, dan Halimatusakdiah, 10, masih dirawat di Puskesmas Bandar Khalifah karena masih dalam observasi dokter. Di antara keempat korban tersebut, kondisi Dian Oktaviani Purba

Lanjut ke hal A2 kol. 3

Mandala Stop Penerbangan MEDAN (Waspada): Administrator Bandara (Adban) Polonia Medan Razali Abubakar membenarkan maskapai penerbangan Mandala akan menghentikan operasional mulai Kamis (13/1). “Selama ini Mandala hanya terbang sekali sehari MedanPadang dan Jakarta,” kata Razali Abubakar kepada Waspada, Rabu (12/1), sehubungan penerbangan tersebut dihentikan operasionalnya. Menurut Razali, meski operasionalnya ditutup, pihak manajemen Mandala Airline cabang Medan belum menyampaikan hal itu kepada otoritas bandara. Menurut catatan Waspada, kemarin, penerbangan itu mulai berkurang penumpangnya setelah terjadi musibah di ujung landasan pacu (runway) 05 atau di Jalan Jamin Ginting pada 5 September 2005. Lanjut ke hal A2 kol. 6

jadi presiden. “Bahkan, pada jaman Megawati menjadi presiden banyak aset BUMN yang dijual dan tidak terungkapnya kasus BLBI. Masyarakat tidak akan mudah menghilangkan catatan negatif selama kepemimpinan Megawati,” kata peneliti senior LSI itu. Burhan, sapaan Burhanuddin Muhtadi, menjelaskan, selama belum ada figur-figur alternatif baru dari generasi SBY, Megawati dan Jusuf Kalla, maka kritikan tersebut tidak akan dipandang oleh masyarakat. “Megawati merupakan wajah lama dan SBY di mata publik lebih baik dibandingkan Megawati,” katanya. Hal itu juga terungkap dalam hasil survei yang dilakukan LSI pada akhir Desember 2010 lalu, dimana penurunan terhadap tingkat kepuasan kinerja SBY hanya 22 persen dibandingkan tahun 2009 lalu. “Penurunannya tidak secara dramatis terjadi. Pada Juli 2009 tingkat kepuasan masyarakat terhadap kinerja SBY sekitar 85 persen, namun Desember 2010 tinggal 63 persen dari 1.229 responden. Saat ini belum ada figur baru yang lebih baik dibandingkan SBY,” ujarnya. Menurut Burhan, kritikan Megawati memang benar terjadi, di mana masih ada catatan merah selama pemerintahan SBY 2010, salah satunya masalah penegakan hukum dan dalam mengatasi persoalan ekonomi mikro.

erampang Seramp ang - Bolo-boloi aja bandara yang sudah ada - He...he...he...


Medan 24-32 C

P.Sidimpuan 19-30 C

R.Prapat 24-320C

Penyabungan 19-300C

Berastagi 17-270C

0

Sibolga 21-300C BMKG Polonia

Hujan guntur

Berawan

WASPADA Demi Kebenaran Dan Keadilan

Prakiraan Cuaca 0

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

http://epaper.waspadamedan.com

KAMIS, Legi, 13 Januari 2011/8 Safar 1432 H z No: 23385 * Tahun Ke-65

Terbit 24 Halaman (A1-12, B1-12) z zHarga Eceran: Rp 2.500,-

BNPB Minta Siaga Banjir

Brisbane Jadi Kota Hantu

Kirim Staf Ke Medan

20.000 Rumah Terancam Bahaya

BRISBANE, Australia (Waspada): Lebih dari 20.000 rumah kini menghadapi risiko berat Rabu (12/1) akibat banjir di Brisbane, demikian menurut menteri besar Queensland, Australia, pada saat banjir maut mengancam kota terbesar ketiga di Australia. Brisbane Pusat menjadi kota hantu karena aliran listrik terputus dan ribuan orang didesak apakah ingin mengungsi atau tinggal di rumah mereka. Di barat Brisbane, kota Ipswich digenangi air banjir yang situasinya dianggap sebagai ‘kacau total.’ Angka kematian akibat banjir bandang di Queensland sampai saat ini tercatat 12 orang dan banyak lagi yang dinyatakan hilang. Badan penyiaran Australia ABC melaporkan bahwa sungai Brisbane kini diramalkan ketinggiannya mencapai puncaknya pada 5,12 meter pada jam-jam awal Rabu, turun dari satu prediksi 5,5 meter. Kira-kira 50 orang masih dinyatakan hilang di Lockyer Valley, barat Brisbane. Pada saat hujan reda, tim pencari dan penyelamat bersiap untuk dikerahkan ke kawasan apa yang dianggap Menteri Besar Queensland Anna Bligh sebagai satu tugas ‘amat berat.’ Lanjut ke hal A2 kol 6

AP

BANJIR: Reruntuhan mobil di luar kota Grantham di Tenggara Queensland, Australia, Rabu (12/1). Kota kecil itu telah dilanda oleh banjir bandang yang menimbulkan kerugian besar. Banjir maut yang telah memutuskan hubungan ke seluruh bagian timurlaut Australia telah menggenangi jalanan Brisbane, kota terbesar ketiga di negara itu, yang memaksa ribuan orang mengungsi ke daerah perkotaan dan gedung-gedung pencakar langit.

JAKARTA (Antara): Badan Nasional Penanggulangan Bencana (BNPB) meminta Badan Penanggulangan Bencana Daerah (BPBD) untuk bersiaga menghadapi kemungkinan terjadinya banjir di wilayah masingmasing. “BNPB juga telah mengirimkan staf untuk memberikan bimbingan manajemen penanggulangan bencana ke beberapa BPBD,” kata Kepala Pusat Data Informasi dan Humas BNPB, Sutopo Purwo Nugroho di Jakarta, Rabu (12/1). Sutopo menjelaskan, pihaknya telah mengirimkan staf ke berbagai wilayah yang terjadi bencana banjir diantaranya Sumatera Utara dan Banten. “Kami mengirimkan tim untuk berkoordinasi dengan BPBD dan memantau perkembangan banjir yang terjadi di Medan, Sumatera Utara dan Pandeglang Banten,” katanya. Dia meminta BPBD di Sumatera Utara dan Banten untuk terus bersiaga dan memantau segegala perkembangan banjir. BNPB juga meminta BPBD di wilayah lainnya di seluruh tanah air untuk ikut bersiaga mengingat kondisi cuaca yang tidak menentu mengakibatkan beberapa provinsi terancam banjir. “BPBD yang ada di daerah lainnya juga harus ikut waspada karena hingga Maret 2011 kondisi cuaca tidak menentu sehingga bencana banjir masih mengancam berbagai provinsi ,” katanya. Lanjut ke hal A2 kol 2

Mandala Stop Beroperasi Sejumlah Menteri Tak Sukses Sudah Di Tangan Presiden JAKARTA (Antara): Menteri Sekretaris Negara Sudi Silalahi menegaskan, ada beberapa menteri dalam Kabinet Indonesia Bersatu II yang tidak sukses menjalankan tugas dan data tentang itu sudah diterima oleh Presiden Susilo Bambang Yudhoyono. “Ada yang berhasil dan ada yang belum berhasil. Ada yang sukses betul, ada yang tidak sukses. Nah itu semua sudah di tangan bapak Presiden,” kata Sudi di Kantor Kepresidenan, Jakarta, Rabu (12/1) ketika ditanya tentang laporan

kinerja kementerian dan lembaga yang disampaikan oleh Unit Kerja Presiden bidang Pengawasan dan Pengendalian Pembangunan (UKP4). Sudi menolak menyebutkan kementerian yang dianggap tidak sukses menjalankan tugas. Dia hanya menyatakan, Presiden pasti akan menindaklanjuti data tentang hasil kinerja kementerian demi meningkatkan prestasi kabinet. “Presiden juga memberikan evaluasi kepada menteri-

“Secara prinsip Mandala tidak akan beroperasi lagi,” ujar Freddy di Jakarta, Rabu (12/1) usai menghadiri Rapat Koordinator yang dipimpin Menteri Koordinator Perekonomian Hatta Rajasa dan 13 menteri lainnya secara mendadak. Menurut Freddy, dirinya belum mengetahui penyebab Mandala berhenti beroperasi. Namun, berdasarkan informasi yang diperoleh selama ini dengan pihak manajemen Mandala, diketahui perusahaan ini mengalami masalah keuangan.

Freddy juga belum mengetahui apakah penghentian operasi ini akan terjadi secara permanen atau sementara. Konsekuensi dari penghentian operasi ini, katanya, akan terjadi kekosongan trayek penerbangan untuk destinasi tertentu. Freddy memastikan trayek ini akan diisi oleh penerbangan lain. “Batavia Air bisa, Lion Air bisa. Namun dengan syarat kami lihat dulu trayek itu, karena bisa jadi ada yang merugikan maskapai penerbangan lain,” ujarnya. Mandala juga diminta

untuk mengatasi kerugian masyarakat yang telah memesan tiket penerbangan dari maskapai tersebut. Sementara Administrator Bandara (Adban) Polonia Me d a n Ra z a l i A b u b a k a r

Lanjut ke hal A2 kol 6

Lanjut ke hal A2 kol 6

Penerbangan Garuda Ditambah, Medan-Banda Aceh 2X Sehari MEDAN (Antara): Maskapai penerbangan nasional Garuda Indonesia mulai Januari menambah lagi frekuensi penerbangannya dari Medan menyusul meningkatnya kepercayaan warga atas layanan perusahaan itu. “Jadwal terbang yang ditambah itu Medan-Jakarta dan Medan-Banda Aceh,” kata General Manager Branch Office Garuda Indonesia Medan Muchwendi Harahap di Medan, Rabu (12/1). Ia menjelekaskan, penerbangan Medan-Jakarta ditambah satu kali sehingga menjadi 10 kali dalam satu hari, sedangkan Medan-Banda Aceh menjadi dua kali sehari.

JAKARTA (Waspada): Menteri Perhubungan Freddy Numberi membenarkan perusahaan penerbangan Mandala Airlines tidak akan beroperasi Kamis (13/1). Namun, pemerintah masih akan mendalami masalah yang tengah dihadapi oleh maskapai penerbangan ini, termasuk kemungkinan adanya missmatch keuangan dalam manajemen.

Menurut dia, penambahan jadwal terbang itu untuk memenuhi permintaan penumpang yang setelah dievaluasi manajemen juga memang berpotensi bagus. Selain menambah frekuensi penerbangan, manajemen juga terus berupaya meningkatkan pelayanan yang sejak awal memang menjadi komitmen perusahaan. Didampingi Pelaksana Harian Sales Manager Garuda Indonesia Medan, Susanna Saragih, Muchwendi mengatakan, dengan penambahan frekuensi penerbangan dan peningkatan pelayanan,

Lanjut ke hal A2 kol 1

Al Bayan

Pilar Negara Oleh: H. Ameer Hamzah Pilar Negara ada empat golongan Pertama cendekiawan yang ulama Kedua Umara yang bersifat keadilan Ketiga orang kaya yang dermawan Keempat rakyat jelata yang mau bekerja MENURUT Rasulullah SAW, ada empat golongan untuk kokohnya suatu negara atau pemerintahan. Pertama adanya ulama dan intelektual yang selalu memikirkan tentang perkembangan ilmu pengetahuan. Dari mereka itu sangat dibutuhkan pemikiran yang sehat, kritis, dan membangun. Ulama dan umara harus membantu negara (pemerintah) memberi masukan, baik tentang ilmu

Lanjut ke hal A2 kol 2

skyscrapercity.com

Ada Sindikat Besar Dalam Kasus Gayus

Jadi Tersangka Paspor Palsu JAKARTA (Antara): Menteri Hukum dan HAM (Menkumham) Patrialis Akbar menegaskan ada sindikat besar di balik kasus dugaan mafia pajak yang melibatkan mantan pegawai Ditjen Pajak Gayus Tambunan. “Ini sudah banyak perkembangan yang sangat baik ingin diungkapakan bahwa ada sindikat besar,” kata Patrialis ketika ditemui di komplek Istana Kepresidenan, Jakarta, Rabu (12/1). Patrialis menyatakan hal itu, sebagai salah satu hasil rapat tertutup antara jajaran Kementerian Hukum dan HAM dan Tim Investigasi kasus Gayus Tambunan. Rapat tertutup itu dilaksanakan di

gedung Kementerian Hukum dan HAM. Dia tidak bersedia menjelaskan lebih lanjut tentang sindikat di balik kasus Gayus tersebut. Menurut Patrialis, upaya penelusuran bisa gagal jika dia membeberkan hal itu kepada publik. “Siapa di belakang ini semua, pokoknya saya tidak mau menyebutkan orang dan nanti bakal gagal,” kata Patrialis. Gayus diduga terlibat dalam kasus dugaan mafia perpajakan. Dia semakin menjadi bahan pemberitaan karena pergi ke beberapa tempat, meski telah berstatus tahanan.

Lanjut ke hal A2 kol 3

Dicoret Pencalonan, Balon Bupati Tapteng Laporkan KPUD Ke Panwaslu ANDAN, Tapteng (Waspada): Bakal Calon (Balon) Bupati Tapanuli Tengah Albiner Sitompul secara resmi melaporkan KPUD ke Panwaslukada Tapteng, Rabu (12/1) yang diterima langsung oleh Ketua Panwaslukada Sapran Matondang. Albiner dalam kesempatan tersebut mengungkapkan secara kronologis pencoretan atas pencalonan dirinya bersama pasangannya dr Steven P Simanungkalit oleh KPUD

Tapteng pada pleno KPUD Tapteng, beberapa waktu lalu. Dikatakan Albiner, dirinya sudah tiga hari mendatangi kantor KPUD yakni pada Senin (10/1) dan Selasa (11/1) serta Rabu (12/1), namun tidak diterima dengan alasan ketua dan anggota KPUD Tapteng tidak berada di kantor. Diterangkan Albiner, dirinya secara resmi sudah melaporkan secara tertulis kepada Panwaslukada Tapteng dan Bawaslu, sedangkan sekarang

untuk melengkapi laporan dan temuan atas kejanggalan yang dilakukan KPUD Tapteng. Albiner menerangkan, ada kecurangan yang dilakukan KPUD dengan tidak melakukan verifikasi kepada 5 partai pendukung, bahkan ada satu partai yang dihilangkan termasuk ada satu partai yakni Hanura dipakai salah satu calon, sementara secara sah Partai Hanura mendukung pasangan Albiner-Steven. Albiner mengatakan, per-

soalan tersebut sudah dilaporkan ke KPUD Sumut dan KPU pusat dan sudah dilakukan verifikasi terhadap 5 partai pendukung, namun ternyata sah sebagai partai pendukung pasangannya. Albiner juga mengatakan, KPUD Tapteng tidak berdiri di kakinya sendiri yang seharusnya kapabel dalam menjalankan tugasnya sesuai aturan yang ada, sehingga sebagai

Lanjut ke hal A2 kol 2

Waspada/Alamsatriwal Tanjung

ALBINER SITOMPUL, balon Bupati Tapteng saat melapor ke kantor Panwaslukada Tapteng, Rabu (12/1) diterima Ketua Panwaslukada Sapran Matondang atas pencoretan dirinya bersama pasangannya dr Steven oleh KPUD Tapteng.

Petugas Rutan Tarutung Aniaya Tahanan Ka Rutan: Tak Ada Penganiayaan Tapi Pembelajaran

BPKP Aceh Audit Dugaan Penggelapan Mobil Dinas Pertambangan Dan LH

TARUTUNG (Waspada): Oknum petugas Rutan (Rumah Januari 2011,” sebut korban sambil menangis. Lanjut korban, setelah dipukuli dirinya dipindahkan Tahanan) Tarutung, Tapanuli Utara, menganiaya seorang penghuni hingga muntah darah. Korban saat ini dirawat ke ruang tahanan nomor tiga. ‘’Di sana saya sudah sakit, inap di RSUD Tarutung. Korban penganiayaan, Maret lemas dan tidak mampu untuk berdiri. Saya tetap ditahan hingga satu minggu. Saya Sitompul, 24, warga Siatas tidak diberi obat dan tidak Barita, Taput, saat ditemui diberitahu kepada keluarWaspada, Rabu (12/1) sore ga,’’ katanya. di salah satu kamar di Zal Korban menceritakan, 5 (lima) RSUD Tarutung dirinya dibawa ke RSU Tamenuturkan, dirinya dirutung, pada Selasa (11/1) aniaya dua oknum Polisi malam oleh staf Rutan dan Rutan, Tarutung, bermarga beberapa orang rekan taSirait dan Napitupulu. hanan. Penganiayaan terjadi pada Berawal Dari awal Januari 2011 sekira puPerkelahian kul 20:30 dengan memukuli Saat ditanya Waspada seluruh bagian tubuh koralasan pemukulan oleh dua ban. oknum Polisi Rutan TaruKorban juga menceritatung, terhadap dirinya, korkan pada saat kejadian dia ban MS menceritakan diseret dari sel (ruang takarena terjadi perkelahian hanan) 8 keluar, selanjutantara dirinya dengan tanya tubuhnya dipukuli hanan lain. “Itu terjadi pada dengan sepatu besar hingsaat saya berkelahi dengan ga badannya lebam dan Waspada/Marolop Panggabean muntah darah. “Saat itu TERBARING: Korban penganiayaan Maret Sitompul, 24, salah satu tahanan lain di saya tidak sadar diri, saya terbaring lemas dan kaki kirinya digari ke besi tempat tidur. kamar delapan gara-gara tidak ingat persis tanggal Korban saat dijumpai di ruang 5 RSUD Tarutung tanpa Lanjut ke hal A2 kol 3 kejadian yang jelas awal pengawasan aparat keamanan (Polisi Rutan), Rabu (12/1).

BIREUEN (Waspada): Tim BPKP Aceh Rabu (12/1) mulai mengaudit dugaan penggelapan mobil di Dinas Pertambangan dan Lingkungan Hidup (LH), Bireuen, sumber dana APBD 2008. Sementara pihak jajaran Polres Bireuen telah memanggil saksi ahli terkait kasus itu. Hal itu diungkapkan, Kapolres Bireuen AKBP H.R Dadik Junaedi Supri Hartono melalui Kasatreskrim AKP Khairul Saleh,SH SIK kepada wartawan Rabu (12/1) kemarin, “Tim BPKP Aceh hari ini mulai melakukan audit, untuk mengetahui besaran kerugian negara dalam kasus itu. sesuai sistemnya, audit itu bisa saja dilakukan di Polres maupun langsung ke Pemkab,” katanya. Sebagaimana informasi sebelumnya, tim penyidik Polres Bireuen sejak akhir Desember 2010 melakukan penyidikan kasus pembelian/ pengadaan mobil dinas di

Pemkab Bireuen anggaran 2008. Penyidikan yang dilakukan tim dari Polres Bireuen karena kendaraan sudah dibeli Pemkab Bireuen kemudian ditarik lagi oleh showroom karena belum dilakukan pembayaran kepada mereka, padahal uang sudah ditarik semuanya. Menurut Kasatreskrim, tim dari BPKP Banda Aceh sudah tiba di Mapolres Bireuen dan terus mengumpulkan berbagai keterangan dan meneliti dokumen pembelian kendaraan dinas. “13 orang saksi

Lanjut ke hal A2 kol 4

Serampang - Banyak merah tak naik kelas - He.... he....he....


Berita Utama

A2

Fasilitas Kesehatan Dinkes Taput Memprihatinkan

Ketua MK Mahfud MD:

Cara Berhentikan Presiden Dalam UU MPR Salah JAKIARTA (Antara): Ketua Mahkamah Konstitusi (MK) Mahfud MD mengatakan alasan MK mengabulkan permohonan delapan anggota DPR karena tata cara memberhentikan presiden dan wakil presiden itu dalam UU Nomor 27/2009 tentang MPR, DPR, DPD dan DPRD adalah salah. “Pasal 184 ayat 4 UU Nomor 27/2009 itu salah, karena menurut UUD untuk menyatakan pendapat tentang presiden dan wakil presiden itu harus disetujui oleh minimal 2/3 yang hadir. Ini diperberat menjadi usul saja perlu 3/4 belum menyatakan pendapat,” kata Mahfud di Jakarta, Rabu (12/1). Menurut Mahfud, UU tersebut menghambat pelaksanaa “check and balance” dan kontrol dari satu lembaga terhadap lembaga lain serta melampaui batas maksimal yang sudah ditentukan dalam UUD 1945. “UUD sudah mengatur secara ketat, yang kalau dalam hukum tidak boleh melebihi batas tertinggi yang ditetapkan,” katanya. Mahfud menyebut UU Nomor 27 tersebut telah melampaui batas. “Itu baru mengusulkan saja harus 3/4, itu sudah kami anggap bertentangan dengan semangat atau maksud konstitusi,” tegasnya. Selain itu, lanjutnya, UU Nomor 27 tersebut menyamaratakan hak menyatakan pendapat oleh DPR. “Untuk menyatakan pendapat pada umumnya diatur dalam pasal 20 A UUD, sedangkan menyatakan pendapat untuk menilai apakah presiden bisa dimakzulkan atau tidak itu diatur pasal 7 B,” urainya. Mahfud menjelaskan bahwa untuk menyatakan pendapat pada umumnya cukup dengan syarat mayoritas sederhana, yaitu suara terbanyak diantara berbagai pendapat berbeda. “Misalnya 30 persen menghendaki putusan A, 20 persen menghendaki B, 15 persen C, 12 persen menghendaki D, maka yang 30 persen itu sudah bisa jadi keputusan untuk pasal 20 A,” kata Mahfud. Sedangkan untuk hak menyatakan pendapat khusus untuk memakzulkan presiden, kata Mahfud, itu batas minimalnya 2/3 harus hadir, 2/3 dari yang hadir harus setuju ditingkat DPR. “Nah itu, oleh DPR dalam UU Nomor 27 disamaratakan padahal beda, pasal 20 A itu hak menyatakan pendapat secara umum, pasal 7 B menyatakan pendapat apakah presiden masih boleh terus atau tidak pada jabatannya. Itu saja, penjelasannya dan itu sama persis yang dimuat dalam putusan MK,” kata ketua MK ini.

Polri Periksa Jaksa Cirus Sinaga JAKARTA (Antara): Penyidik Badan Reserse dan Kriminal Polri baru memeriksa jaksa Cirus Sinaga sebagai saksi untuk kasus dugaan pemalsuan dokumen rencana penuntutan. “Cirus masih diperiksa dengan kapasitasnya sebagai saksi,” kata kuasa hukum Cirus Sinaga, Tumbur Simanjuntak di Jakarta, Rabu (12/1). Cirus tiba di Bareskrim Polri pada pukul 09:25 WIB dan selesai diperiksa pada pukul 16:45 WIB dengan menggunakan baju seragam kejaksaan warna coklat dan menggunakan mobil Mercy warna hitam. “Klien saya mendapatkan 42 pertanyaan dari penyidik,” kata Tumbur. Penyidik menanyakan antara lain daftar riwayat hidup, dan riwayat pekerjaan, ujarnya. “Kepada penyidik Cirus mengatakan tidak pernah bekerja sama dengan Haposan dalam pemalsuan surat rencana penuntutan Gayus ,” kata Tumbur. Kejaksaan Agung (Kejagung) melaporkan jaksa Cirus dan pengacaranya Gayus, Haposan Hutagalung ke Bareskrim Polri pada Kamis (28/10). Aksi pemalsuan surat rencana penuntutan itu dilakukan dengan mengganti tuntutan terhadap Gayus yang semula satu tahun percobaan (surat bernomor R455) menjadi satu tahun penjara (surat bernomor R431). Dalam kesaksian di persidangan, mantan pegawai Direktorat Jenderal (Ditjen) Pajak menyebutkan, dirinya menyetorkan uang 50 ribu dolar AS sebanyak dua kali sesuai rencana penuntutan. Jaksa Cirus dan Fadil Regan merupakan anggota jaksa penuntut atas perkara Gayus HP Tambunan yang mengge- BNPB Minta .... lapkan uang pajak Rp395 juta Sementara itu, ratusan milik pengusaha Korea. rumah di Kecamatan Sobang Kabupaten Pandeglang ProPenerbangan .... vinsi Banten, terendam air Garuda menargetkan bisa satu-dua meter, akibat memendapatkan penumpang luapnya Sungai Cisekeut dan lebih banyak dari 2010. pasang air laut. “ Ta r g e t m a n a j e m e n , Sementara pada pekan jumlah penumpang bisa naik lalu, banjir juga melanda 10-20 persen dari tahun 2010. sebagian besar wilayah Kota Soal angka 2010, masih belum Medan, menyusul hujan lebat lengkap datanya,” katanya. sepanjang Rabu (5/1) malam hingga Kamis (6/1) dinihari. Jawaban Problem Catur, Ribuan rumah terendam dan beberapa di antaranya TTS Dan Sudoku bahkan hanyut, sehingga warDari Halaman Sport. ga terpaksa mengungsi ke tempat-tempat yang lebih aman. Jawaban Problem Catur:

1. Mc8+, Gd8.

Dicoret Pencalonan ....

2. MxG+, Be8 (Jika 2. ...., Rf7. 3. Bf1+mat). 3. MxB+mat.

Jawaban TTS: TTS Topik

Olahraga

C E L T I C S H I E L A N G Q S J A S B U L U T A A F E D E R E R A O R O D A A P E N C M R A U D L S E P A N A T L D O H A

B A S K E E E L P O L A A O N G K I S D A A P R O N O G S S E A K S I L I I E N P S G S A S N K I P

T K O

K A O R A A T E A D O E R

Jawaban Sudoku: 6 9 7 3 4 1 2 5 8

1 5 4 8 2 9 6 7 3

2 3 8 7 6 5 9 4 1

5 8 2 6 7 3 1 9 4

4 7 3 1 9 8 5 2 6

9 6 1 2 5 4 3 8 7

8 2 9 4 3 6 7 1 5

3 4 5 9 1 7 8 6 2

7 1 6 5 8 2 4 3 9

penyelenggara Pemilukada di Tapteng betul-betul transparan jujur dan adil, sehingga calon pemimpin yang terpilih nantinya adalah orang yang terbaik sesuai pilihan rakyat. Albiner juga memberikan laporan yang didukung berbentuk video HP atas adanya temuan para PNS yang membagi-bagikan stiker salah satu pasangan calon dan hal ini sudah jelas-jelas melanggar aturan yang telah ditetapkan undang-undang. Ketua Panwaslukada Tapteng Sapran Matondang da-

Pilar Negara ....

agama maupun yang bersifat umum. Bila ulama dan intelektual ini tidak tertampung dalam sebuah negara, maka negara akan hancur karena tidak punya ulama dan ahli pikir. Kedua, adalah umara (pemegang kekuasaan) yang harus memerintah dengan sifat keadilan. Sebab keadilan itu syarat muthlak untuk kelangsungan hidup sebuah negara. Sejarah mencatat, saat pimpinan negara berlaku adil, saat itulah rakyat tenang dan meraup kemakmuran. Pimpinan negara tidak boleh sewenangwenang dalam mengayomi masyarakatnya. Misalnya pilih

WASPADA Kamis 13 Januari 2011

TRIBUANA AWARD 2010:

Foto Muhammad Riza yang menggambarkan sejumlah anak-anak nelayan di Desa Kuala Pidie, Kecamatan Kota Sigli sedang menyelamatkan seekor lumba-lumba yang sedang sakit dimuat di Harian Waspada 7 Mei 2010. Anak-anak tersebut berupaya mengembalikan lumbalumba ke tengah laut. Foto ini terpilih sebagai foto terbaik Harian Waspada 2010 dan meraih Tribuana Award pada HUT Harian Waspada ke-64.

TARUTUNG (Waspada): Sektor kesehatan merupakan primadona bagi setiap orang. Sebab harta dan warisan yang sangat berharga adalah hidup sehat. Di Dinas Kesehatan Taput, impian tersebut masih jauh dari harapan setiap orang. Sebab berbicara dengan sektor kesehatan tidak terlepas dari budaya hidup sehat yang didukung dengan berbagai fasilitas dan sarana prasarana kesehatan. Di Taput sendiri misalnya, masih ditemukan sejumlah fasilitas kesehatan yang sangat memprihatinkan karena tidak layak pakai, seperti gedung Puskesmas, Pustu dan Poskesdes. Kepala Pustu Bahalbatu, Kecamatan Siborongborong, Taput Dr Patuan Sihombing, Rabu (12/1) kepada wartawan menyebutkan, saat ini pihaknya sedang menerapkan program baru untuk membangun sektor kesehatan seca-

ra luas kepada masyarakat Taput, khusus di Kecamatan Siborongborong. Menurut dr Patuan, program tersebut menghadapi kendala karena fasilitas kesehatan seperti gedung/kamar di Pustu tidak memenuhi standar untuk unit pelayanan kesehatan yang prima. Sebab, sejumlah Pustu, Puskesmas di Taput, gedungnya sudah banyak yang lapuk, bangunannya sangat sempit. “Gedung Pustu terdiri bangunan berukuran 4x6 meter dan bangunan tahun 80-an. Padahal, unit wilayah unit kerja Pustu, Bahal Batu,Siborongborong, terdapat 1.800 kepala keluarga dengan jumlah penduduk sekira 12 ribu orang. “Dengan populasi jumlah penduduk itu sudah wajar kalau Pustu ditingkatkan menjadi Puskesmas Induk. Itu didukung dengan Alkes (alatalat kesehatan) yang sudah memadai seperti tempat tidur

pasien, oksigen, kursi roda pasien, bedah mino, lemari berkas, lemari alat-alat, troli oksigen ditambah dengan pasokan obat yang relatif cukup,” ujar dia. Dikatakan Patuan, selaku dokter yang ditugaskan di desa, pihaknya sudah menggalakkan program KB (keluarga Berencana) seperti KB untuk laki-laki, perempuan, Jamkesda (jaminan kesehatan daerah) ,Jamkesma (jaminan kesehatan masyarakat), pelayanan Askes bagi PNS ditambah dengan penyuluhan kesehatan bagi masyarakat desa. Pada satu sisi, kata Patuan, saat ini masih banyak warga desa yang primitif dengan kesehatan. Karena masih banyak keluarga yang beranak 8-10 orang. Dan proses bersalinnya masih menganut pada pola lama. Artinya masih berani seorang ibu di desa menggunting pusat bayinya pada saat dia melahirkan. (c12)

UN Jadi Acuan PTN Mulai 2011

SURABAYA (Antara): Direktur Jenderal Pendidikan Tinggi Kementerian Pendidikan Nasional Prof Djoko Santoso mengatakan ujian nasional menjadi acuan masuk perguruan tinggi negeri mulai 2011. “Pada 2011 ujian nasional (UN) akan mulai menjadi acuan masuk perguruan tinggi negeri (PTN) melalui ujian tulis secara nasional (SNMPTN),” katanya setelah mengikuti Rapat Senat ITS untuk pemilihan rektor di Gedung Rektorat ITS Surabaya, Rabu (12/1). Mantan Rektor ITB itu menjelaskan ujian tulis dalam SNMPTN akan menggunakan

dua cara yakni undangan dan pendaftaran. “Untuk cara undangan itu mirip PMDK dengan menggunakan nilai rapor (ujian sekolah/US) dan hasil UN, namun hal itu diserahkan kepada rektor masing-masing PTN,” katanya. Menurut dia, Peraturan Menteri Pendidikan Nasional (Permendiknas) Nomor 34 Tahun 2010 mengatur kuota SNMPTN untuk 60 persen mahasiswa. “Untuk PTN yang menyelenggarakan ujian mandiri akan dibatasi dengan kuota maksimal 40 persen dan ujian harus diadakan setelah SNMPTN,” katanya.

Dalam ujian secara mandiri oleh masing-masing perguruan tinggi itulah yang memungkinkan adanya sumbangan pendidikan secara sukarela. “Tapi, sumbangan sukare l a i t u t i d a k b o l e h a d a korelasinya dengan hasil ujian. Ada banyak pula masyarakat yang menyumbang tanpa ada kaitannya dengan ikut ujian atau tidak,” katanya. Ditanya tentang beasiswa Bidik Misi untuk calon mahasiswa kurang mampu, ia mengatakan pemerintah sudah mematok 10 persen mahasiswa PTN harus dari program Bidik Misi. “Mahasiswa penerima beasiswa itu ditentukan rektor,

Ada Sindikat Besar ....

terkait sindikat pembuat paspor digunakan Gayus, Kabareskrim tidak menjawabnya. Gayus diduga pada tanggal 22-24 September 2010 berada di Macau, kemudian berangkat lagi pada tanggal 30 September 2010 kembali 2 Oktober 2010 di Kuala Lumpur dan Singapura. Penyidik Polri mendapat informasi bahwa paspor dengan foto Gayus, atas nama Sony Laksono sebenarnya diperuntukan atas nama Margareta, bocah berumur lima tahun. Gayus mengaku paspor tersebut diperoleh dari jasa calo. Jadi Tersangka Penyidik Badan Reserse dan Kriminal Polri telah menetapkan Gayus HP Tambunan sebagai tersangka terkait kasus dugaan paspor palsu yang

digunakannya ke luar negeri. “Gayus mulai hari ini telah ditetapkan sebagai tersangka terkait dugaan penggunaan paspor palsu,” kata Kepala Bagian Penerangan Umum (Kabag Penum) Polri, Kombes Pol Boy Rafli Amar di Jakarta, Rabu (12/1). Gayus diduga pada tanggal 22 - 24 September 2010 berada di Macau, kemudian berangkat lagi pada 30 September 2010 kembali 2 Oktober 2010 di Kuala Lumpur dan Singapura menggunakan paspor dengan identitas palsu. Penyidik Polri mendapat informasi bahwa paspor dengan foto Gayus atas nama Sony Laksono sebenarnya diperuntukkan atas nama Margareta, bocah berumur lima tahun.Gayus mengaku paspor tersebut diperoleh dari jasa calo.

biaya perobatan anaknya dan segala kebutuhan selama menjalani perobatan mereka tanggung. Ibu korban sangat menyesalkan dan tidak menerima perbuatan yang tidak manusiawi itu. “Kasus ini akan kami bawa ke pengadilan,” pungkasnya. Dokter RSUD Tarutung dr Ridwan Damanik yang menangani penyakit korban saat dihubungi wartawan tidak berada di tempat. Sala satu staf zal RS bermarga Manurung menuturkan, korban sudah diberi perawatan dan pengobatan. Tentang sejauhmana penyakit yang dialami korban itu adalah wewenang dokter. Kepala Rutan Tarutung

Agus saat dikonfirmasi Waspada Rabu sore seputar peristiwa pemukulan mengatakan, tidak ada penganiayaan oleh oknum Polisi Rutan. Yang ada adalah pembelajaran kepada korban Maret Sitompul. “Tidak ada penganiayaan, kami bukan preman,” katas Agus. Agus juga berdalih, saat didesak bagaimana proses dan sikap selanjutnya selaku pimpinan Rutan tarutung, dirinya melemparkan tanggungjawab dengan mengalihkan pertanyaan kepada staf yang bermarga Tobing di Rutan Tarutung. “Aku lagi di Siborongborong, sekarang, tanyakan saja ke kantor di sana lebih jelasnya,” kilah Agus seraya mematikan HP-nya. (c12)

BPKP Aceh ....

telah kita panggil sejak Kamis kemarin sampai hari ini dan juga akan memanggil tim ahli untuk meneliti kasus tersebut tentang ada tidaknya kerugian Negara dari kasus yang diduga ini,” katanya Selain itu lanjutnya, Saksi ahli dari Pemkab Bireuen juga telah dipanggilnya untuk didengarkan keterangannya untuk menjelaskan terkait Kepres 80. Berkaitan dengan mobil itu, turut memanggil

saksi ahli dar i Dirlantas Polda Aceh dan juga Satlantas Polres Bireuen, sebut Kasatreskrim. “Kerugian negara belum diketahui pasti besarannya, karena tim BPKP Aceh baru bekerja. 13 orang saksi juga masih diperiksa secara bertahap, tiga orang dalam sehari. Sedangkan dar i Pemkab Bireuen, Dirlantas Polda Aceh dan Satlantas Bireuen, sudah kita panggil sebagai saksi ahli,” terangnya lagi. (amh)

merugikan negara bersangkutan. Keempat adalah kaum dzuafa (orang miskin) yang berhati baik, tidak iri terhadap orang kaya, malah turut berbangga dengan kekayaan orang lain. Mereka selalu berdoa agar yang kaya itu bertambah kaya agar lebih banyak bantuannya kepada fakir miskin, mereka juga berdoa kepada ulama, umara dan negara. Dengan ilmu ulama, keadilan para umara, kejujuran pedagang (orang kaya) dan doa orang miskin, negara akan semakin berjaya, rakyat semakin makmur. Selain empat golongan di atas, peran wanita salehah juga

sangat diharapkan. Menurut Rasulullah wanita itu tiang negara, bila wanita baik maka baiklah negara, dan bila wanita tidak punya lagi malu seperti berpakaian minim, maka rusaklah negara. Satu hal lagi adalah akhlakul karimah. Setiap warga negara harus memiliki akhlak y a n g b a i k . Sy a u q y B eyk mengatakan, “Sesungguhnya sebuah bangsa akan tegak karena ada akhlak, bila akhlak hancur, maka hancurlah negara. Dan yang lebih penting dari semua itu adalah musyawarah untuk kebersamaan dan kebersamaan untuk musyawarah. ** ** **

Gayus bahkan diduga menyamar ketika membuat paspor. Polri Amankan Tiga Pembuat Paspor Sementara Badan Reserse dan Kriminal Polri telah mengamankan tiga orang terkait pembuatan paspor yang digunakan Gayus ke luar negeri. “Kita sudah mengamankan tiga orang dan masih diselidiki keterkaitannya dalam pembuatan paspor yang digunakan Gayus,” kata Kepala Badan Reserse dan Kriminal (Kabareskrim) Polri Komjen Pol Ito Sumardi di Jakarta, Rabu (12/1). Tiga orang yang diamankan semuanya adalah warga sipil yang bertindak sebagai calo pembuat paspor. Mengenai adanya salah satu orang yang diamankan adalah warga negara Afrika

Petugas Rutan ....

berebutan piring untuk makan. Kawanku berkelahi tidak ada dipukul,’’ ujar korban. Pantauan Waspada di RSUD Tarutung, Rabu (12/1) siang, korban terlihat terbaring di salah satu kamar zal 5. Kaki korban sebelah kiri masih melekat dengan ikatan dan ikat rapat dengan besi tempat tidurnya. Korban menceritakan, kedua orangtuanya baru mengetahui kejadian setelah berada di RSUD Tarutung. Ibu korban S boru Simorangkir, 61, didampingi kakaknya Guntur Sitompul, 30, menjawab wartawan mengatakan, lam per temuan tersebut mengatakan, pihaknya akan memanggil ketua dan anggota KPUD Tapteng ke Panwaslukada untuk dilakukan klarifikasi. “Kita usahakan Jumat (14/1), ketua dan anggota KPUD sudah hadir di kantor Panwaslukada, dan jika tidak juga hadir kita akan samasama ke kantor KPUD melakukan cross chek dan selanjutnya melakukan pertemuan yang kita fasilitasi dengan mengundang KPUD, Kapolres dan pasangan Albiner-Steven,” jelas Sapran. (a34) kasih antara satu golongan dengan golongan lainnya. maksudnya tidak boleh nepotisme dan primordialisme. Ketiga, sebuah negara harus ada para konglomerat (arghniya’) yang bersifat pemurah dan jujur. Konglomerat harus membayar pajak, zakat, banyak infaq dan sedekahnya untuk kesejahteraan rakyat dalam negara. Konglomerat tidak boleh kikir kepada rakyat, sebab dengan jasa rakyatlah mereka menikmati kekayaan. Bila para konglomerat tersebut mopoli harga bahan pokok, menguasai sumber-sumber ekonomi kecil, kikir setengah mati, berutang ke luar negeri, dan sebagainya itu tentu akan

tapi semuanya sudah sesuai aturan, yakni Bidik Misi adalah beasiswa pendidikan (bidik) untuk mahasiswa dari keluarga miskin tapi berprestasi (misi),” katanya. Bahkan, katanya, pemerintah juga akan mendorong perguruan tinggi meningkatkan jumlah penerima Bidik

Misi yakni 10 persen dari pemerintah dan 10 persen dari PTN setempat. Dalam wawancara dengan Radio Suara Surabaya (12/1), Mendiknas Mohammad Nuh menegaskan bahwa UN dijadikan acuan masuk PTN untuk menepis rasa ketidakadilan di masyarakat.

“UN diprotes karena dirasakan tidak adil, karena ukuran keberhasilan sekolah selama tiga tahun hanya ditentukan dengan UN selama tiga hari,” katanya. Oleh karena itu, katanya, pemerintah akhirnya merespons dengan menjadikan UN bersama rapor (ujian sekolah)

Hukuman Terhadap Majikan Sumiati Tak Adil JAKARTA (Antara): Menteri Luar Negeri Marty Natalegawa menyatakan pemerintah Indonesia menilai putusan pengadilan tingkat pertama di Arab Saudi yang menjatuhkan hukuman penjara tiga tahun bagi majikan yang menyiksa Sumiati tidak memenuhi rasa keadilan. Hal tersebut disampaikan Menlu usai bertemu Presiden Susilo Bambang Yudhoyono di Kompleks Istana Kepresidenan Jakarta, Rabu (12/1).

“Tanpa ada yang harus mendesak dan mengungkap kita semua merasakan bahwa hukuman tiga tahun itu tidak sesuai dengan rasa keadilan maka langsung pemerintah melalui pengacara kita, bahkan bukan hanya pengacara kita tapi juga penuntut umum dari negara Arab Saudi pun langsung banding,” kata Marty. Marty mengatakan, keputusan pada 10 Januari 2011 dari pengadilan pertama yang ha-

nya menghukum majikan Sumiati pidana penjara tiga tahun dinilai tidak memenuhi rasa keadilan, sehingga tim kuasa hukum Sumiati mengajukan banding, demikian juga dengan Jaksa Penuntut Umum dari Arab Saudi. “Keputusan hukum baru tahap pertama, baru dua hari lalu kalau tidak salah, tentu sekarang kita memasuki fase berikutnya, jadi ada fase bergulir di pengadilan Arab Saudi,” ujarnya.

Sejumlah Menteri ....

kaligus. Mungkin parsial kali ya, mungkin juga sudah ada yang dipanggil,” katanya. Sudi menolak membicarakan perombakan kabinet karena hal itu adalah hak prerogatif Presiden. Sebelumnya, Kepala Unit Kerja Presiden bidang Pengawasan dan Pengendalian Pembangunan (UKP4) Kuntoro Mangkusubroto menegaskan akan menyerahkan laporan kinerja kementerian dan lembaga kepada presiden pada

Rabu (12/1). Kuntoro menegaskan, ada beberapa kementerian yang belum mencapai target kinerja yang telah ditetapkan, atau mendapat nilai merah. “Masih ada yang merah,” kata Kuntoro ketika ditemui di komplek Istana Kepresidenan. Namun, Kuntoro menolak menyebutkan nama-nama kementerian yang dinilai belum berhasil tersebut.

Brisbane Jadi ....

mengungsi ke tiga tempat penampungan pengungsi. Brisbane saat ini menghadapi luapan banjir dari Lembah Lockyer dan Dam Wivenhoe, yang demikian penuh yang memaksa pengendaliannya dilepaskan. Arus tinggi — yang dikenal sebagai arus raja — akan menambah problem Kamis. Karung-karung pasir telah dibagikan kepada para penduduk Brisbane, satu kota berpenduduk dua juta jiwa. Hujan lagi Di Ipswich, Queensland Times mengatakan 3.000 rumah berada di bawah permukaan air dan 1.100 orang telah pergi ke pusat-pusat penampungan pengungsi. Su n g a i B remer, y a n g mengalir melalui kota tersebut, kini diperkirakan akan mencapai puncaknya sedalam 19.5 meter Rabu, turun dari perkiraan dari 20, 5 meter. Pelayanan kereta api telah ditangguhkan ke kota tersebut. Walikota Ipswich Paul Pisasale mengatakan dia berharap

paras banjir akan turun dalam waktu 36 jam, yang memungkinkan pembersihan segera dimulai setelah. “Jika saya dapati ada yang melakukan penjarahan di kota kami, mereka akan digunakan sebagai penanda banjir,” katanya memperingatkan. Saksimata: “Saya kini berada di atap rumah saya dengan satu tilam dan satu tungku camping.” Secara keseluruhan, banjir Queensland telah mengakibatkan kerugian miliaran dolar dan sekitar 200.000 terkena dampaknya. Daerah yang paling buruk diserang banjir adalah kota Toowoomba, barat Brisbane, di mana para penduduk menganggap suatu ‘tsunami darat instant’ setinggi 8 meter yang ‘menggasak’ jalanan Senin. Walikota Toowoomba Peter Taylor memberitahu Radio 4 BBC : “Kami bekerja 24 jam seharinya, menanggapi suatu jumlah yang luar biasa warga yang membutuhkan bantuan.” (bbc/m10)

Mandala Stop ....

Maka mulai besok resmi berhenti beroperasi untuk konsentrasi selesaikan semuanya masalahnya,” kata Dirjen Perhubungan Udara. Kata dia, pemerintah masih akan menahan izin rute Mandala selama 45 hari ke depan. Setelah itu, mungkin maskapai swasta itu akan diberi perpanjangan izin selama sebanyak dua atau tiga kali sebelum akhirnya izin rute tersebut dicabut. “Namun kalau dalam setahun dia tidak terbangterbang, maka SIUP (Surat Izin Usaha Perdagangan)-nya otomatis akan dicabut,” ujar Herry Bakti. Ia menambahkan, manajemen Mandala belum menginformasikan kepada pemerintah berapa lama waktu yang dibutuhkan untuk melaksanakan restrukturisasi perusahaan. Namun, jika dalam tenggat waktu yang diberikan pemerintah restrukturisasi bisa rampung, maka Mandala tidak perlu mengu-

rus perizinan lagi. “Tapi mereka belum bilang butuh waktu berapa lama. Kita lihat saja bagaimana perkembangannya nanti,” ujarnya. Seperti diketahui, Mandala Airlines sudah mengumumkan masalah kesulitan keuangannya. Mandala Airlines mengaku telah mengajukan permohonan penundaan kewajiban pembayaran utang (PKPU) ke Pengadilan Niaga Jakarta Pusat karena Mandala sedang mengalami masalah keuangan. Sekretaris Perusahaan Mandala Airlines Nurmaria Sarona mengatakan, pengajuan penundaan pembayaran utang ini merupakan jalan terbaik jika perusahaan ingin terus beroperasi. “Pengajuan PKPU merupakan langkah terbaik yang dapat diambil untuk memastikan keberlangsungan operasi perusahaan di masa mendatang,” ujar Nurmaria dalam keterangan persnya, Rabu. (kps/m32)

menteri itu dalam sidang kabinet, hal yang masih perlu ditingkatkan, yang masih perlu diperbaiki dan sebagainya,” kata Sudi. Menurut Sudi, Presiden pasti akan memanggil menteri-menteri yang dianggap belum berhasil menjalankan tugas. Namun, dia tidak bersedia menyebutkan kapan proses pemanggilan itu dilaksanakan. “Saya kira tidak mesti se“Saya kira kita akan terkejut oleh apa yang mereka temukan,” kata Bligh. “Kejadian yang amat serius.” Aliran listrik ke Brisbane Pusat telah diputus dalam langkah yang bertujuan untuk mencegah generator berisiko terbakar jika kebanjiran. Toko-toko memasang isyarat mereka tidak akan buka. Suratkabar Brisbane Courier Mail mengatakan 50 dari kawasan pinggiran kota akan dilanda banjir, dan Walikota Campbell Newman mengatakan beberapa daerah akan benar-benar terendam. Dia mengatakan Selasa akan merupakan saat yang sangat meresahkan bagi warga dan bisnis yang terkena dampak banjir.” Sungai Brisbane meluap di kawasan Yeerongpilly dan Indooroopilly, yang menggenangi jalanan. Suratkabar itu mengutip dewan kota yang meramalkan bahwa 40.000 properti akan terkena dampak. Lebih dari 6.500 warga Brisbane diperkirakan akan

membenarkan, maskapai penerbangan Mandala menghentikan operasional mulai Kamis (13/1). Selama ini Mandala hanya terbang sekali sehari MedanPadang dan Jakarta, kata Razali Abubakar saat dikonfirmasi, Rabu (12/1), sehubungan penerbangan tersebut menghentikan operasional. Begitupun Adban menyebutkan, pihak manajemen Mandala Airlines cabang Medan belum menyampaikan hal itu kepada dirinya hingga Rabu. Dirjen Per hubungan Udara Herry Bakti di Jakarta juga membenarkan, Rabu adalah penerbangan terakhir PT Mandala Airlines. Mulai Kamis (13/1/2011), maskapai swasta itu menghentikan seluruh rute penerbangannya. Batas waktu penghentian operasional Mandala belum bisa ditentukan. “Mandala sudah melapor ke kita untuk melakukan restrukturisasi perusahaan.


Berita Utama

A2 12 CPNS Pemprovsu Yang Lulus Gugur MEDAN (Waspada): Dua belas Calon Pegawai Negeri Sipil (CPNS) yang telah dinyatakan lulus ujian untuk Pemerintah Provinsi Sumatera Utara (Pemprovsu) dipastikan gugur. Karena, hingga batas akhir pelengkapan berkas (daftar ulang) 31 Desember, ke-12 CPNS tersebut tidak melengkapi berkas sebagaimana yang dipersyaratkan. “Yang belum daftar ulang ini sudah kami nyatakan gugur, namun demikian, kami masih menunggu alasan dari mereka yang nantinya dicantumkan dalam surat pengunduran diri. Hal ini sebagai laporan kami ke BKN (Badan Kepegawaian Nasional),” kata Kabid Pembinaan dan Pengadaan BKD Sumut Pandapotan Siregar, di Kantor Gubernur Sumatera Utara, Rabu (12/1). Diungkapkannya, dari 12 CPNS itu, delapan di antaranya adalah formasi guru Sekolah Luar Biasa (SLB), yakni Harsanti Tyas Andriyani, kelahiran Lu-

buk Basung, Putri Maila Frantika (Padang), Apin Kurniawati (Sleman), Arnie Multi (Padang), Leni Nelfia (Bukittinggi),Yuli Erni (Tegal Rejo), Silvia Irvan dan Sriwahyuni. Selanjutnya formasi dokter umum atas nama Rahmawati Endah Lestari Syahmi (Jakarta). Kemudian formasi Nutrisionist (D3 Gizi) atas nama Yossy Purnama (Pasar Kuok). Satu formasi medik vetenier (dokter hewan) atas nama Meilina Waty Aritonang (Medan) serta satu formasi perencana (S1 Teknik Lingkungan) atas nama Yeni Maskurah AB. “Sampai saat ini belum ada yang membalas surat dari BKD itu. Namun, informasi yang kami peroleh dari teman-temannya yang juga lulus dan daftar ulang, mereka ini ada yang lulus di daerah lain, ada juga yang sedang melanjutkan studi S2. Tapi resminya berupa surat balasan dan pengunduran diri belum ada,” tambah Pandapotan. (m28)

Perokok Uji Materi Pergub DKI Jakarta JAKARTA (Antara): Seorang perokok melalui hukumnya akan melakukan uji materi terhadap pasal 2 Peraturan Gubernur (Pergub) DKI Jakarta yang mengatur masalah Kawasan Dilarang Merokok karena antara lain dinilai melanggar hak asasi manusia aturan lain yang lebih tinggi. “Kami besok (Kamis, 13/1) akan ke MA (Mahkamah Agung) untuk mendaftarkan uji materi peraturan gubernur tersebut. Kami mengharapkan ada ruang khusus untuk merokok di dalam gedung sehingga tetap tidak mengganggu mereka yang tidak merokok,” kata kuasa hukum pemohon, Habiburokhman di Jakarta, Rabu (12/1). Habiburokhman didampingi kliennya Ariyadi mengatakan, kliennya meminta agar Peraturan Gubernur Nomor 75 tahun 2005 tetap diberlakukan karena masih memungkinkan perokok merokok di tempat khusus di dalam gedung. Sementara Pasal 2 Peraturan Gubernur

Provinsi Daerah Khusus Ibukota Jakarta Nomor 88 Tahun 2010 menghapus ketentuan tersebut. Pasal 2 Pergub Nomor 88 Tahun 2010 tentang Perubahan Atas Pergub Nomor 75 Tahun 2005 tentang Kawasan Dilarang Merokok berbunyi, ketentuan Pasal 18 diubah, sehingga keseluruhan pasal 18 berbunyi sebagai berikut,“Tempat khusus merokok harus memenuhi ketentuan terpisah secara fisik dan terletak di luar gedung serta tidak berdekatan dengan pintu keluar masuk gedung.” Habiburokhman mengatakan bahwa merokok bukanlah tindakan ilegal dan bukan tindakan pidana. Seorang perokok, katanya, mempunyai hak untuk merokok sepanjang tidak merugikanmerekayangtidakmerokok. Kuasa hukum lainnya, Daru Supriyono mengatakan bahwa mereka bukannya membela perokok dan tidak ada agenda terselubung dengan pabrik rokok. “Kami juga ingin agar perokok mempunyai etika,” katanya.

Waspada/Marolop Panggabean

KORBAN penganiayaan, Maret Sitompul, 24, terlihat terbaring lemas dan kaki kirinya digari ke besi tempat tidur. Korban saat dijumpai di ruang 5 (lima) RSUD Tarutung, tanpa pengawasan aparat keamanan (Polisi Rutan), Rabu (12/1).

Petugas Rutan ... “Itu terjadi pada saat saya terhadap salah satu tahanan lain di kamar delapan gara-gara berebutan piring untuk mau makan. Kawan ku berkelahi

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Mc8+, Gd8.

2. MxG+, Be8 (Jika 2. ...., Rf7.

3. Bf1+mat).

3. MxB+mat.

Jawaban TTS: TTS Topik

Olahraga

C E L T I C S H I E L A N G Q S J A S B U L U T A A F E D E R E R O A R O D A M A P E N C U R A L D A S E P A N T L D O H A

B A S K E E E L P O L A A O N G K I S D A A P R O N O G S S E A K S I L I I E N P S G S A S N K I P

T K O

K A O R A A T E A D O E R

Jawaban Sudoku: 6 9 7 3 4 1 2 5 8

1 5 4 8 2 9 6 7 3

2 3 8 7 6 5 9 4 1

5 8 2 6 7 3 1 9 4

4 7 3 1 9 8 5 2 6

9 6 1 2 5 4 3 8 7

8 2 9 4 3 6 7 1 5

3 4 5 9 1 7 8 6 2

7 1 6 5 8 2 4 3 9

tidak ada dipukul,’’ ujar korban. Pantauan Waspada, di RSUD Tarutung, Rabu (12/1) siang, korban terlihat terbaring di sala satu kamar zal 5. Kaki korban sebelah kiri masih melekat dengan ikatan dan ikat rapat dengan besi tempat tidurnya. Korban menceritakan, kedua orang tuanya baru mengetahui kejadian setelah berada di RSUD Tarutung. Ibu korban, S boru Simorangkir,61, didampingi kakaknya, Guntur Sitompul, 30, menjawab wartawan mengatakan biaya perobatan anaknya dan segala kebutuhan selama menjalani perobatan mereka tanggung. Ibu korban sangat menyesalkan dan tidak menerima perbuatan yang tidak manusiawi itu. Kasus ini akan kami bawa ke pengadilan, pungkasnya. Dokter RSUD Tarutung, dr Ridwan Damanik, yang menangani penyakit korban saat dihubungi wartawan tidak berada di tempat. Sala satu staf zal RS, bermarga Manurung, menuturkan korban sudah diberi perawatan dan pengobatan.Tentang sejauh mana penyakit yang dialami korban itu adalah wewenang dokter, sebut staf. Ka. Rutan Tarutung, Agus, saat dikonfirmasi Waspada, Rabu sore seputar peristiwa pemukulan membenarkan. Kata Agus, tidak ada penganiyaan oleh oknum Polisi Rutan. Yang ada adalah pembelajaran kepada korban Maret Sitompul, (tahanan). Tidak ada penganiayaan, kami bukan preman,” tangkis Agus. Agus, juga berdalih, saat didesak bagaimana proses dan sikap selanjutnya selaku pimpinan Rutan tarutung, dirinya melemparkan tanggungjawab dengan mengalihkan pertanyaan kepada staf yang bermarga Tobing di Rutan Tarutung. “Aku lagi di Siborongborong, sekarang, tanyakan saja ke kantor, di sana lebih jelasnya,” kilah Agus, seraya mematikan HP nya. (c12)

Kualanamu Mimpi ...

Antara

BATU RAKSASA: Sebuah eskavator berusaha menggulingkan batu berukuran besar yang terbawa banjir lahar dingin di aliran Kali Putih di dusun Gempol, Jumoyo, Salam, Magelang, Jateng, Rabu (12/1). Puluhan alat berat dikerahkan untuk membuat tanggul pengaman dan menormalisasi Kali Putih yang dipenuhi material vulkanik untuk mengantisipasi banjir lahar dingin jika datang sewaktu-waktu.

Menteri Tak Sukses Di Tangan SBY JAKARTA (Antara): Menteri Sekretaris Negara Sudi Silalahi menegaskan, ada beberapa menteri dalam Kabinet Indonesia Bersatu II yang tidak sukses menjalankan tugas dan data tentang itu sudah diterima oleh Presiden Susilo Bambang Yudhoyono. “Ada yang berhasil dan ada yang belum berhasil. Ada yang sukses betul, ada yang tidak sukses. Nah itu semua sudah di tangan bapak Presiden,” kata Sudi di Kantor Kepresidenan, Jakarta, Rabu (12/1) ketika ditanya tentang laporan kinerja kementerian dan lembaga yang disampaikan oleh Unit Kerja Presiden bidang Pengawasan dan Pengendalian Pembangunan (UKP4). Sudi menolak menyebutkan kementerian yang diang-

gap tidak sukses menjalankan tugas. Dia hanya menyatakan, Presiden pasti akan menindaklanjuti data tentang hasil kinerja kementerian demi meningkatkan prestasi kabinet. “Presiden juga memberikan evaluasi kepada menterimenteri itu dalam sidang kabinet, hal yang masih perlu ditingkatkan, yang masih perlu diperbaiki dan sebagainya,” kata Sudi. Menurut Sudi, Presiden pasti akan memanggil menterimenteri yang dianggap belum berhasil menjalankan tugas. Namun, dia tidak bersedia menyebutkan kapan proses pemanggilan itu dilaksanakan. “Saya kira tidak mesti sekaligus. Mungkin parsial kali ya, mungkin juga sudah ada yang dipanggil,” katanya.

Sudi menolak membicarakan perombakan kabinet karena hal itu adalah hak prerogatif Presiden. Sebelumnya, Kepala Unit Kerja Presiden bidang Pengawasan dan Pengendalian Pembangunan (UKP4) Kuntoro Mangkusubroto menegaskan akan menyerahkan laporan kinerja kementerian dan lembaga kepada presiden pada Rabu (12/1). Kuntoro menegaskan, ada beberapa kementerian yang belum mencapai target kinerja yang telah ditetapkan, atau mendapat nilai merah. “Masih ada yang merah,” kata Kuntoro ketika ditemui di komplek Istana Kepresidenan. Namun, Kuntoro menolak menyebutkan nama-nama kementerian yang dinilai belum berhasil tersebut.

Sartono Mengaku Cabuli 96 Anak JAKARTA (Antara): Pelaku pelecehan seksual, Sartono (29), mengaku telah mencabuli 96 anak dan prilaku menyimpangnya itu sudah ia lakukan sejak berusia 13 tahun. “Tersangka mengaku sudah melakukan penyimpangan seksual sejak usia 13 tahun,” kata Kepala Kepolisian Resor Metropolitan (Kapolrestro) Kepulauan Seribu Ajun Komisaris Besar Polisi Hero Henrianto Bachtiar di Jakarta, Rabu (12/1). AKBP Hero mengatakan, tersangka mencoba melakukan penyimpangan berhubungan intim dengan temannya yang berjenis kelamin sama. Pelaku melakukan tindak penyimpangan seksual itu saat menggembala kambing peliharaannya yang berlanjut hingga saat ini.

Awalnya, Sartono menyebutkan dirinya sudah mensodomi 38 anak pria yang berusia di bawah umur, kemudian pelaku mengaku sudah melakukan penyimpangan hubungan seksual itu terhadap 96 anak. Korban pencabulan berusian antara 14 tahun hingga 17 tahun dengan perincian sejak sebelum tahun 2008 mencapai 42 anak dan 2008 hingga 2010 sebanyak 54 orang. Mayoritas anak yang menjadi korban pencabulan Sartono merupakan anak jalanan di sekitar stasiun kereta api Cikampek, Purwakarta, Bandung, Serang (Banten) dan Kampung Bandan (Jakarta Utara). Sartono juga menjual korban seharga Rp25 ribu hingga Rp50 ribu per anak. Sebelumnya, anggota

Menko Polhukam ...

pat, bukan menuding pemerintah berbohong. Sementara itu, Menteri Koordinator Perekonomian Hatta Rajasa juga menegaskan, semua fakta yang disampaikan oleh pemerintah selalu berdasarkan data yang terukur. Data itu adalah data resmi yang dikeluarkan oleh lembaga kredibel seperti Badan Pusat Statistik.

Polrestro Kepulauan Seribu menangkap Sartono di Stasiun Kota, Jakarta Barat, Minggu (9/1), berdasarkan laporan dari orangtua salah satu korban pencabulan. Awalnya polisi mendapatkan laporan dari salah satu warga Pulau Pramuka berinisial MJ yang menduga anaknya, HA, menjadi korban pencabulan yang dilakukan Sat. Kemudian polisi melakukan pencarian terhadap Sar dan berhasil menangkap warga Cirebon, Jawa Barat, itu di sekitar Stasiun Kota, Jakarta Barat. Tersangka menggunakan modus mengajak korban jalan dan menjanjikan memberi hadiah berupa telepon selular kepada calon korban. Jika korban bersedia diajak jalan, tersangka akan melakukan pencabulan dan menjualnya ke beberapa daerah. Polisi telah memeriksa beberapa orang saksi terkait kasus pencabulan tersebut dan menyita barang bukti berupa tiga unit telepon selular milik korban. Tersangka dijerat Pasal 328 Kitab Undang-undang Hukum Pidana (KUHP) juncto Pasal 83 Undang-Undang Nomor 23 Tahun 2002 tentang Perlindungan Anak dengan ancaman hukuman penjara 15 tahun.

tanggung oleh pihak sekolah. “Hari ini kami diperbolehkan pulang karena sudah diperiksa oleh dokter anak,”ujar Koster Naibaho, orangtua dari pasangan kembar Dian Naibaho dan Dina Naibaho yang turut menjadi korban keracunan. Menurut Koster Naibaho, semua biaya perobatan tidak dibebani kepada keluarga korban dan dibayar oleh pihak sekolah. Begitu juga 14 korban lainnya yang berada di puskesmas setempat. “Soal biaya perobatan kami tak tau, yang penting anak kami sudah sembuh dan bisa dibawa pulang,” tuturnya. Empat saksi diperiksa Secara terpisah, Kapolsekta Percut Seituan Kompol Maringan Simanjuntak mengatakan, dalam kasus keracunan itu, sudah empat saksi diperiksa masing-masing Kepala SD Inpres 109252 Sukirman, penjaga sekolah Kasino, penjaga warung Sriyanti dan Santi. “Belum ada yang ditahan karena masih menunggu hasil penyelidikan dari Balai POM dan Labfor Poldasu,” tuturnya. Dijelaskan Simanjuntak, barang bukti berupa sisa muntahan, bakso, saos dan es lilin sengaja dibagi untuk bahan penyelidikan. “Pihak Balai POM akan meneliti mikroba yang berada di dalam campuran bahan makanan sedangkan di Labfor akan diteliti soal zat kimianya,” jelasnya seraya menambahkan

pihaknya masih menunggu hasil pemeriksaan dari kedua instansi tersebut. Sementara itu, Kepala SD Inpres 109252 Sukirman yang hendak dikonfirmasi terkait tanggungjawabnya terhadap peristiwa itu saat berada di RS Mitra Husada Tembung enggan memberi keterangan. “Silakan saja tanya sama pak polisi, semua sudah saya serahkan masalah ini kepada polisi,” ujar Sukirman sembari buru-buru masuk ke dalam warung menemui juru periksa dari Polsekta Percut Seituan. Balai Besar Pengawas Obat dan Makanan (BBPOM) Medan telah menurunkan tim untuk mengumpulkan keterangan terkait keracunan puluhan siswa SDN 105292 Jalan Mesjid, Bandar Klippa, Kecamatan Percut Seituan, Deli Serdang, kemarin. Tiga petugas BBPOM melakukan pemeriksaan dimulai dari sekolah, Puskesmas dan RS Mitra Husada. “Tadi pagi, kita sudah turunkan tim untuk melakukan pemeriksaan lebih mendalam dengan peristiwa keracunan tersebut. yang jelas, kita akan melakukan pemeriksaan mikrobiologi dari jenis makanan jajanan sekolah tersebut,” kata Kepala Seksi (Kasi) Penyidik BBPOM Ramses Pasaribu. Menurut Ramses, hasil laboratorium yang diperiksa baru bisa diketahui hasilnya empat atau lima hari ke depan. (h04/h02)

Dia menyatakan, pemerintah selalu membuka ruang diskusi jika ada pihak-pihak tertentu yang memiliki data tandingan yang tidak sama dengan data yang dimiliki pemerintah. Djoko berharap semua pihak menggunakan forum diskusi dalam menyatakan penda-

Empat Korban ... paling lemah karena dia terakhir dari 24 siswa yang dibawa ke RS, Selasa (11/1) pukul 16.00. Pasalnya, Dian mengonsumsi bakso kojek itu di rumah setelah pulang sekolah. Menurut Tio br Saragih, ibu Dian Oktaviani, putrinya mengalami muntah-muntah sekira pukul 15:00 dan segera dilarikan ke klinik bidan yang tak jauh dari rumahnya. Namun, karena korban terindikasi keracunan, pihak klinik merujuknya ke Puskesmas. “Saya membawanya ke Puskesmas ini sekira pukul 16:00, setelah ibu bidan tak sanggup mengobatinya karena korban menderita keracunan makanan,” ujarnya. Menurut br Saragih, bakso yang dibeli putrinya dari kantin sekolah itu tidak sempat dimakan di sekolah. “Anak saya membawanya pulang dan memakannya di rumah. Beberapa menit setelah menyantap bakso tersebut, tiba-tiba Dian muntah berkali-kali. Perutnya sempat digosokkan pakai minyak angin oleh opungnya (nenek-red) namun terus saja muntah,” bebernya. Sementara itu, para orangtua korban yang menjaga anaknya di RS Mitra Husada mengaku hari ini (Rabu-red) mereka diperbolehkan pulang setelah diperiksa oleh dokter anak. Sedangkan biaya perobatan di-

Masalah ini, menurutnya, mengharuskan Kementerian Pekerjaan Umum segera berkoordinasi dengan Badan Koordinasi Penanaman Modal (BKPM) untuk membicarakan revisi Perpres 13/2010 tentang pembebasan tanah. “Kita mau tender investasi, karena proyek ini merupakan show case kita pada tahun 2011 ini. Oleh karena itu kita akan segera mengusulkan ke BKPM soal revisi perpres pembebasan lahan,” ujarnya. Proyek di Sumatera Utara ini direncanakan akan dibangun jalan bebas hambatan menghubungkan Medan dengan Lubuk Pakan sepanjang 36 km, dan Medan Kualanamu sepanjang 24 km. Untuk proyek ini Kementerian PU telah menggandeng beberapa kontraktor dari China. Meski demikian pihaknya tetap akan melihat kelanjutan koordinasi dengan BKPM tersebut. Walaupun dirinya juga tidak menolak bila ke depan tetap harus melakukan amanat dari Perpres 13 tersebut. “Kalau mau cepat kita ajukan revisi Perpres 13 melalui BKPM. Na-

Australia Hadapi ... “Kita kebanjiran ungkapan dukungan dari seluruh dunia, tawaran bantuan materil,” kata Rudd kepada Nine Network, Rabu. “Jadi, ini telah menarik perhatian dunia.” Rudd juga mengucapkan terima kasih kepada rakyat di seluruh Australia atas dukungan seruan untuk meredakan dampak banjir dan mendesak mereka agar terus memberi sumbangan, sebab masalah sesungguhnya akan membentang selama 12 bulan ke depan. Brisbane Pusat menjadi kota hantu karena aliran listrik terputus dan ribuan orang didesak apakah ingin mengungsi atau tinggal di rumah mereka. Di barat Brisbane, kota Ipswich digenangi air banjir yang situasinya dianggap sebagai ‘kacau total.’ Angka kematian akibat banjir bandang di Queensland sampai saat ini tercatat 12 orang dan banyak lagi yang dinyatakan

Mandala Stop ... Ketika itu Gubsu H.T. Rizal Nurdin, mantan Gubsu Raja Inal Siregar, anggota DPD RI H. Abdul Halim bersama lebih kurang 124 penumpang dan crew merenggang nyawa setelah penerbangan itu jatuh dan meledak. Bahkan tiga tahun belakangan ini, penerbangan itu mengganti logo, namun tidak mempengaruhi calon penumpang tetap menggunakan penerbangan tersebut. Sementara itu Dirjen Perhubungan Udara Herry Bakti di Jakarta membenarkan Rabu (12/1), penerbangan terakhir PT Mandala Airlines. Mulai Kamis (13/1/2011), maskapai swasta itu menghentikan seluruh rute penerbangannya. Batas waktu penghentian operasional Mandala belum bisa ditentukan. “Mandala sudah melapor ke kita untuk melakukan restrukturisasi perusahaan. Ma-

Cari Kerja Dapat ... ia dibawa ke Mapolsek Tebingtinggi karena di sekujur tubuhnya ditemukan bekas tandatanda penganiayaan. Petugas polsek membawanya ke RS Bhayangkari Tebingtinggi agar mendapatkan perawatan di rumah sakit. Dari sana Sumiati dipindahkan ke RSUD Dr Kumpulan Pane milik Pemerintah Daerah Kota Tebingtinggi agar bisa mendapatkan perobatan secara gratis. Petugas RS yang menangani memohon kepada Dinas Sosial Pemko Tebingtinggi untuk membantu pemulangannya ke Solo Jawa Tengah setelah Sumiati pulih dari depresinya. Menurut medis, Sumiati mengalami depresi dan sulit diajak berbicara panjang lebar. Akan tetapi ia masih ingat sedikit kejadian yang menimpanya. Sumiati mengaku, dirinya

WASPADA

Kamis 13 Januari 2011 mun akan lebih baik jika kita bebaskan 100%,” jelasnya. Karena itu Kementerian PU akan melakukan tender investasi proyek pembangunan jalan segitiga di Medan pada 2011 ini. Meskipun diakui, hingga saat ini belum ada peserta tender yang secara terang-terangan mengajukan diri. “Hingga saat ini masih belum ada pihak yang berani ngomong, meski sudah kami informasikan,” tutur Ghani. Tentu hal ini menjadi masalah bagi masa depan pembangunan bandara berbiaya hampir Rp6 triliun ini. Bila salah mengurusnya, maka masalahan ganti rugi ini bisa menjadi boomerang. Pada akhirnya akan membuat proyek raksasa ini terancam tak bisa terselesaikan karena tak memiliki akses jalan. Dari sisi warga di lokasi bandara tersebut, muncul pertanyaan mengapa pihak-pihak terkait tidak merealisasikan ganti rugi yang kabarnya mencapai puluhan miliar rupiah itu. Ini pekerjaan pemerintah dan berbagai perangkat di daerah Karena sesuai domain-nya, persoalan pembebasan lahan itu menjadi bagian dari peker-

jaan daerah untuk menyelesaikannya. Masalah ganti rugi ini belum menemui titik temu karena berbagai persoalan seperti menyamakan persepsi tentang jumlah yang setara. Baik dari nilai lahan, bangunan, maupun lahan pertanian warga. Namun masalahnya, masyarakat terkendala karena menyangkut lapangan pekerjaan bertani. Karena jika mereka direlokasi maka para petani tersebut akan kehilangan lahan bercocok tanam, yang merupakan satu-satunya gantungan hidup mereka selama ini. Tapi pihak pemerintah daerah, dalam hal ini Pemprovsu sepertinya sangat optimis untuk bisa menyelesaikan masalah ini. Kepala Bappedasu, Riadil Akhir Lubis bahkan menyatakan hal yang mereka khawatirkan justru bukan persoalan pembebasan lahan. Padahal, jika masalah ini tidak bisa diselesaikan dengan baik, maka bandara yang telah terlanjur dibangun itu tidak akan pernah punya akses jalan. Itu artinya bandara Kualanamu cuma sekedar jadi mimpi bagi masyarakat Sumatera Utara. (m07/j03)

hilang.

79 WNI Mengungsi Sebanyak 79 dari 8.000 warga negara Indonesia (WNI) yang tinggal di sejumlah wilayah negara bagian Queensland , Australia terpaksa mengungsi dari bencana banjir yang sudah terjadi lebih dari dua pekan terakhir. Juru Bicara Kementerian Luar Negeri Michael Tene ketika dihubungi di Jakarta, Rabu (12/1), mengatakan bahwa sejauh ini Konsulat Jenderal RI(KJRI) di Sidney juga sudah melakukan koordinasi dengan organisasi masyarakat dan pelajar serta tokoh masyarakat setempat untuk membantu penanganan banjir tersebut. Sejauh ini, KJRI juga sudah menghubungi sejumlah WNI yang bertempat tinggal di sekitar daerah bencana untuk menyelamatkan diri mereka dan memanfaatkan 12 tempat penampungan yang sudah di bentuk berdasarkan koordinasi. “Hingga saat ini sebanyak 79 WNI sudah diminta un-

tuk mengungsi di 12 shelter (penampungan) banjir,” kata Michael. Selain berkoordinasi untuk pengadaan shelter dan imbauan untuk mengungsi dari bencana tersebut, KJRI juga membuka hotline dengan menghubungi nomor telepon +61416208869 bagi warga Indonesia yang ingin mengetahui kabar kerabatnya di sana dan sebaliknya. Berdasarkan data Kementerian Luar Negeri (Kemlu) RI, Informasi tentang kemungkinan adanya korbanWNI dikumpulkan dari Persatuan PelajarMahasiswa Indonesia di Australia (PPIA) cabang Queensland maupun dari berbagai asosiasi masyarakat Indonesia di Negara bagian Queensland tersebut. Sebelumnya pemerintah Indonesia telah memberikan bantuan dana sebesar satu juta dolar AS kepada Pemerintah Australia dalam mengatasi bencana banjir yang terjadi di Queensland, Australia. (bbc/cnn/m10/ant)

ka mulai besok resmi berhenti beroperasi untuk konsentrasi selesaikan semuanya masalahnya,” kata Dirjen Perhubungan Udara. Kata dia, pemerintah masih akan menahan izin rute Mandala selama 45 hari ke depan. Setelah itu, mungkin maskapai swasta itu akan diberi perpanjangan izin selama sebanyak dua atau tiga kali sebelum akhirnya izin rute tersebut dicabut. “Namun kalau dalam setahun dia tidak terbang-terbang, maka SIUP (Surat Izin Usaha Perdagangan)-nya otomatis akan dicabut,” ujar Herry Bakti. Ia menambahkan, manajemen Mandala belum menginformasikan kepada pemerintah berapa lama waktu yang dibutuhkan untuk melaksanakan restrukturisasi perusahaan. Namun, jika dalam tenggat waktu yang diberikan pemerintah restrukturisasi bisa rampung, maka Mandala tidak perlu

mengurus perizinan lagi. “Tapi mereka belum bilang butuh waktu berapa lama. Kita lihat saja bagaimana perkembangannya nanti,” ujarnya. Seperti diketahui, Mandala Airlines sudah mengumumkan masalah kesulitan keuangannya. Mandala Airlines mengaku telah mengajukan permohonan penundaan kewajiban pembayaran utang (PKPU) ke Pengadilan Niaga Jakarta Pusat karena Mandala sedang mengalami masalah keuangan. Sekretaris Perusahaan Mandala Airlines Nurmaria Sarona mengatakan, pengajuan penundaan pembayaran utang ini merupakan jalan terbaik jika perusahaan ingin terus beroperasi. “Pengajuan PKPU merupakan langkah terbaik yang dapat diambil untuk memastikan keberlangsungan operasi perusahaan di masa mendatang,” ujar Nurmaria dalam keterangan persnya, Rabu. (m32)

sepuluh hari lalu berangkat ke Jakarta dari kampungnya di Solo Jawa Tengah untuk mencari pekerjaan. Selama seminggu di Jakarta ia tidak mendapatkan pekerjaan. Sementara perbekalan yang dibawa dari kampung mulai menipis. Ia bingung kebutuhan hidup di Kota Jakarta begitu tinggi. Begitu bertemu dengan seorang lelaki menawarkan pekerjaan di Medan iapun langsung menurut. Tanpa banyak cerita, Sumiati berangkat ke Medan dengan menumpang bus umum bersama lelaki yang ia tidak ingat lagi namanya, namun entah bagaimana Sumiati sudah ditemukan warga dalam keadaan tergeletak dalam kondisi setengah sadar di pinggir jalan. “Aku disiksa orang yang nggak aku kenal, tanganku dan badanku dipukuli dan tas yang berisi pakaian aku juga diambil

mereka, tiba-tiba aku diturunkan di pinggir jalan yang aku sendiri gak tahu tempatnya, tiba-tiba sekarang aku sudah terbaring di sini, dimana ini? Aku mau pulang, tolong antar aku pulang,” ucapnya lirih. Hingga Rabu (12/1) korban masih menjalani perawatan di ruang Satu RSU Dr Kumpulan Pane Kota Tebingtinggi, kondisi tubuh korban masih terlihat lemas. Petugas kepolisian yang datang mengidentifikasi Sumiati di rumah sakit mengatakan, Sumiati adalah korban penganiayaan. Hal itu terlihat dari punggungnya yang membiru dan ada bekas luka gores, diduga sebelum dibuang di pinggir jalan, korban terlebih dahulu dianiaya. Pihak Dinas Sosial Pemkot Tebingtinggi diharap dapat membantu pemulangan Sumiati ke kampung halamannya. (a09)

Istighfarlah ... kemiskinan, apa yang kami harus lakukan,” “Perbanyaklah istighfar kepada Allah,” jawab Imam Hasan. Sejurus datang lagi seseorang yang lain menghadap dan berkata,”Ya Imam Taqiyuddin, saya sudah lama berumah tangga, tapi isteri saya mandul dan belum juga hamil, beri kami nasehat apa yang kami lakukan.” Imam berkata,”Perbanyak itighfar kepada Allah.” Tak lama berselang, seseorang datang lagi menghadap dan berkata, “Imam Taqiyuddin bumi daerah kami dah lama tandus sehingga kami mengalami paceklik panjang, beri kami nasehat apa yang harus kami lakukan.” Imam Hasan Al Bashri tetap menjawab,”Perbanyaklah istighfar kepada Allah.” Setelah para penanya pulang, para sahabatnya bertanya,”Ya taqiyuddin setiap orang yang datang membawa masing-masing masalah mereka yang sangat berbeda, tapi tuan tetap menjawabnya dengan

satu jawaban,’memperbanyak istighfar kepada Allah, kenapa,” kata mereka. Maka Imam Hasan Al Bashri menjawab,”memang itulah jawaban saya kerana Allah berfirman,”Maka Aku katakan kepada mereka,Istighfar (mohonlah ampun) kepada Tuhanmu, karena sesungguhnya Dialah yang Maha Pengampun,-(jika kamu istighfar),niscaya dia akan mengirimkan (menurunkan) hujan lebat kepadamu, memperbanyak hartamu, memberi kamu keturunan (anak),dan mengadakan (menyuburkan) kebun-kebunmu dan mengadakan (pula di dalamnya) sungai-sungai yang mengalir.(QS Nuh:10-12). Tuan, bukankah kita juga barangkali tidak terlepas dari empat pertanyaan bahkan lebih dari itu dalam menghadapi tantangan zaman dalam keseharian kita, karena itu mari kita lakukan segalanya dengan doa dan ikhtiar, setelah itu istighfarlah.——Insya Allah janjiNya tak pernah engkar.


Medan Metropolitan

WASPADA Kamis 13 Januari 2011

A3

Beruntung Awal Tahun 2011 Bersama Waspada PESAWAT Garuda yang menerbangkan Menteri Pemberdayaan Perempuan Dan Perlindungan Anak (PP dan PA) Hj Linda Agum Gumelar bersama rombongan yang mendarat pukul 9.55 di Bandara Polonia Medan, Selasa (11/1), disambut gembira oleh Panitia HUT Waspada di antaranya Drs Hendra DS, David Swayana, Siti Anum Purba dan Erma Tarigan SH, serta Pimpinan Umum Harian Waspada Dr Hj Rayati Syafrin MBA,MM, anggota DPD RI Parlindungan Purba. Ada pula Pelaksana tugas Biro Pemberdayaan Perempuan Sumut Dra. Marhamah, istriWagubsu Ny. Sutiyas Gatot Pujonugroho, Ketua Badan Kerjasama Organisasi Wanita Sumatera Utara, Ny Zakaria Siregar. Tiba di ruangan VIP, Menag PP dan PA ini menyebutkan ia satu pesawat dengan Wagubsu Ir Gatot Pujonugroho. “Wah, hebat sekali perjala-

nan saya ini. Dari Bandara Soeta, bertemu denganWagub ternyata kami sama-sama satu penerbangan. Rupanya untuk menghadiri resepsi Harian Waspada ini, saya sudah dikawal dari Jakarta olehWagubnya,” kata Linda. Menurut Linda, sebenarnya jadwalnya hari ini (Selasa-red) sangat padat di Jakarta. Tetapi, dia tidak bisa menolak undangan khusus dari Harian Waspada karena ia merasa menjadi bagian dari keluarga besar masyarakat Sumatera Utara. Secara otomatis ada ikatan emosional yang sulit dia bendung dalam benaknya. “Saya tidak bisa berpikir dua kali untuk mengatakan tidak. Langsung berkata ia, saat saudara kita yang di DPD Parlindungan Purba ini mengundang saya untuk datang ke Medan, khusus resepsi HUT Waspada. Sepertinya saya kembali ke tengah-tengah keluarga saya lagi. Apalagi di Medan, hanya

ada seorang lagi keluarga kandung, yakni tante saya. Alhamdulilah, saya beruntung diawal tahun 2011 ini bisa datang ke Medan dalam event yang membahagiakan.Terimakasih Harian Waspada yang mengundang saya di awal tahun ini,” ujarnya yang duduk bersebelahan dengan Ny. Sutiyas Gatot Pujonugroho dan Hj. Rayati Syafrin. Hanya butuh waktu 15 menit, untuk bisa sampai di Harian Waspada, karena Menag PP dan PA ini sudah dinantikan oleh seluruh karyawan Harian Waspada untuk kegiatan silaturahim. Bertemu dengan Pemimpin Redaksi Harian Waspada H Prabudi Said, ternyata mengundang pembicaraan tersendiri di Bumi Warta Waspada. “Saya enggak nyangka bisa sedekat ini. Ternyata setelah bertemu dan bertutur dekat, saya harus panggil tante sama ibu Rayati. Apalagi teman tante

saya,” katanya yang akhirnya membicarakan tentang PSMS, karena ia dan suaminya Agum Gumelar sangat mendukung PSMS dan selalu berucap ‘goreng-goreng’ pada pemain bola yang akan mengarahkan bola ke gawang lawan mainnya. Perbincangan tidak berlangsung lama, karena Linda dan rombongan bersedia mengikuti serangkaian acara HUT Waspada di Hotel Danau Toba Jalan Imam Bonjol. Di sini pun, Linda masih mengaku senang bisa ke Medan pada awal tahun 2011 ini. “Hebat, saya diundang di acara HUT Waspada Ke-64 dengan tanggal yang mantap. 11, 2011 pukul 11 siang. Siapa yang memilih jadwal seperti ini, katanya yang sempat meminta jasa Ny Zakaria Siregar menterjemahkan lagu “Anakku Na Burju” dilantunkan Wagubsu Gatot Pujonugroho. Meski waktu sudah beran-

jak siang, dan jadwal pesawat kepulangan ke Jakarta pukul 13.00WIB. Linda Agum Gemelar seolah enggan beranjak dari lokasi acara. Untungya, rombongan yang mengantar kepulangannya ke Bandara Polonia tidak mengalami kendala macat di jalan. Hanya dalam waktu 15 menit berikutnya, rombongan yang mengantarkan ke bandara termasuk Ny Sutiyas Gatot Pujonugroho melepas keberangkatan Menag PP dan PA ini kepesawat udara. “Terimakasih sudah menerima saya di Medan. Semoga Harian Waspada tetap menjadi koran pilihan di Sumatera Utara. Jangan lupa jadi media yang terus menyuarakan aspirasi rakyat dan ikut mensosialisasikan setaragenderdankemajuanperempuan dan anak ya,” katanya pada wartawati koran ini yang melepasnya diVIP room Bandara Polonia Selasa siang. (m37)

Besok, 150 Peserta Ikuti Muswil Ikadi

DPRDSU Terpecah Soal Penundaan Pelantikan Randiman

Wagubsu Akan Hadir Dan Membahas Kondisi Dakwah Di Daerah MEDAN (Waspada): Pengurus Wilayah Ikatan Dai Indonesia (PW Ikadi) Sumatera Utara akan menggelar Musyawarah Wilayah (Muswil) I di Asrama Haji Pangkalan Masyhur Medan, 14-16 Januari 2011. Ketua Umum PW Ikadi Sumatera Utara Sakhira Zandi mengatakan hal itu kepada Waspada, di kantor MUI Sumut Jalan Sutomo Ujung Medan, Rabu (12/1). Muswil I akan dihadiri sekitar 150-an peserta dan 22 DPD Ikadi yang ada masing-masing diwajibkan mengutus perwakilan, ditambah dari PW dan PP

(Pengurus Pusat) termasuk Sekjen PP Ikadi Pusat Idris Abdussomad yang juga Wakil Walikota Depok. Muswil akan dibuka langsung oleh Wakil Gubernur Sumut Gatot Pujonugroho. Lalu, dilanjutkan muzakarah du’ad sebagai tradisi setiap Ikadi menggelar even. Muzakarah bertema: “Peran Ikadi mencari sosok pe-

mimpin bangsa”. Kepada para ustadz dan ustadzah serta daidai dapat mengikuti muzakarah tersebut. Muswil I akan mendengarkan laporan-laporan daerah mengenai kondisi dakwah serta LPKJ dan pemilihan pengurus dengan sistem melalui musyawarah dan tidak ada one man show serta tidak dibenarkan kampanye. “Jika ketahuan berkampanye, maka akan didiskualifikasi,” tegasnya. Menjawab pertanyaan, apa yang telah dilakukan oleh Ikadi selama ini, Sakhira mengatakan antara lain pengkaderan dai dan

diterjunkan ke daerah-daerah seperti Pakpak Bharat, Dairi, karo dan Nias. Saat ini PW Ikadi juga sudah memiliki Gedung Pusdiklat (Pusat Pendidikan dan Latihan) berlokasi di Jalan Binjai Km 13. Sedangkan kegiatan lain yang sudah dilakukan yaitu setifikasi da’i menjaring anggota pemula, madya, dewasa dan paripurna, modulnya sudah ada. “Untuk melakukan semua program kerja, PW Ikadi tetap menjalin kerjasama dengan Ormas Islam terutama menggelar kegiatan seperti safari Ramadhan yang sudah lima kali deng-

an mengelilingi Sumatera Utara. Menanggapi program ke depan, PW Ikadi Sumut, lanjut Sakhira, akan menggelar pelatihan calon-calon khatib khususnya di SMA negeri dan swasta dengan memberikan materi hukum fiqih tentang Jumat, selanjutnya mereka akan ditugaskan untuk menyang berhalangan hadir. Direkturnya pelajar SMA merupakan salah satu antisipasi pengangguran, apalagi di era globalisasi saat ini sangat minim remaja/pemuda Islam menggeluti pelajaran untuk menjadi seorang khatib, kata Sakhira.(m24)

Gedung PN Di Belawan Mubazir BELAWAN (Waspada): Sejak selesai dibangun sekitar bulan Juli 2010, gedung Pengadilan Negeri (PN) Niaga, HAM, PHI dan Perikanan Medan di Jalan Selebes Gg Pekong, belum pernah difungsikan sehingga terkesan mubazir. Pentauan Waspada, Rabu (12/1), bangunan yang telah menghabiskan uang negara milyaran rupiah itu, mulai rusak pada bagian pagar dan cat bangunan mulai terkelupas. Selain itu rumput atau lalang mulai tumbuh di halaman gedung yang berubah fungsi jadi lokasi pembuangan sampah. Begitu juga, akibat belum difungsikan gedung yang direnovasi itu, seluruh perkara yang ditangani Kejaksaan Negeri (Kejari) Belawan terpaksa disidangkan ke PN Medan Jalan Pengadilan, yang jaraknya sekitar 30 km dari Belawan. “Ini sangat merepotkan karena jauh dan banyak mengeluarkan dana untuk pengamanan tahanan,” kata seorang jaksa yang tidak mau namanya disebutkan. Hal yang sama juga diungkapkan Mahmud Saragih, warga Belawan, saat ditemui di kantor Kejaksaan Negeri Belawan. Dia mengaku kesal karena harus mengeluarkan banyak biaya tambahan untuk bisa menghadiri proses sidang keluarganya dalam kasus sabu-sabu. “Katanya berperkara mudah dan berbiaya ringan, nyatanya tidak, karena aku harus menyediakan uang untuk ongkos. Parahnya, saksi tidak mau datang kalau tidak disediakan uang untuk ongkos,” ujarnya. Sementara itu, Rio Marpaung, warga sekitar gedung PN itu menuturkan, persidangan di PN Medan cabang Belawan itu sudah lama tidak dilaksanakan. “Seharusnya kejaksaan cepat mengusulkan agar sidang di sini karena gedung ini sudah selesai dan bangunannya cantik dan megah,” sebutnya. Kejari Belawan Ranu Subroto, SH.MHum saat dikonfirmasi permasalahan itu tidak bersedia ditemui karena sibuk. “Bapak lagi sibuk,” kata ajudannya. (h03)

Sekitar pukul 10.30 jam istirahat pun usai. Saat berada di ruang kelas, satu orang temannya muntah di dalam kelas IV A tersebut. Tetapi tak hanya dari lokal dia saja, gurunya menemukan korban lainnya. “Setelah itu kami disuruh cepat pulang karena banyak kawan yang muntah-muntah. Saat masih di sekolah saya belum muntah,” terangnya. Tiba di rumah, apa yang dirasakan kawannya, ternyata dirasakan juga oleh Siti. Baru saja dia membuka sepatunya, dia pun terus muntah-muntah. “Di teras rumah muntah pertamanya. Baru lari ke kamar mandi muntah lagi. Nggak tahu berapa kali muntah, lupa bang. Pokoknya banyak bang, baru langsung mamak bawa ke sini,” jelasnya. Dokter Puskesmas Bandar Khalifah Frans Sihombing menuturkan, saat ini korban yang keracunan makanan tinggal empat orang yang masih dirawat. “Yang lain sudah pulang, karena merasa sudah sembuh. Jadi mereka minta pulang sendiri. Sedangkan empat pasien yang masih dirawat masih butuh perawatan

MEDAN (Waspada): Wagubsu Gatot Pujo Nugroho diminta segera memberikan penjelasan kepada publik alasan penundaan pelantikan Sekretaris DPRD Sumut (Sekwan) definitif. Selain itu, penundaan tersebut juga membuat anggota DPRD Sumut terpecah. “Wagubsu harus menjelaskan kenapa Sekwan belum juga dilantik,” ujar Penasihat Fraksi Partai Demokrasi Indonesia (PDI) Perjuangan DPRD Sumut Eddi Rangkuti di Medan, Rabu (12/1), terkait polemik berkepanjangan di DPRD Sumut terkait belum juga dilantiknya Randiman Tarigan sebagai Sekwan, meski Gubernur Sumut Syamsul Arifin disebutsebut sudah menerbitkan surat keputusan (SK) pelantikan atas nama yang bersangkutan. Menurut Eddi, jika Randiman Tarigan dinilai layak, Wagubsu sebaiknya tidak menunda pelantikan. Namun jika dinilai tidak layak, seharusnya juga dijelaskan ke publik, dimana letak tidak layaknya. “Kalau yang bersangkutan

punya ‘kesalahan’ sehingga dinilai tidak layak menjabat sebagai Sekwan, seharusnya dijelaskan ke publik agar tidak menjadi polemik dan perdebatan berkepanjangan khususnya di antara anggota DPRD Sumut,” ujar politisi senior PDI Perjuangan itu. Eddi menilai, polemik dan perdebatan seputar pelantikan Sekwan definitif untuk menggantikan posisi pelaksana tugas (Plt) Sekwan Nirmaraya sudah sangat berlebihan. Ia juga menyayangkan kuatnya desakan dari sejumlah fraksi dan anggota DPRD Sumut agar Pemprov segera melantik RandimanTarigan. Secara terpisah, Ketua Komisi E DPRD Sumut Aduhot Simamora justru mendesak Pemprovsu segera melantik Sekwan definitif agar tidak menghambat kinerja dan pelayanan administrasi kedewananan. Dia mengaku tidak memiliki kepentingan apa pun di balik desakan itu. “Komisi E DPRD Sumut cuma berkepentingan institusi memiliki pejabat definitif dan tidak berlarut-larut berstatus Pe-

laksana Tugas (Plt). Jadi pelantikan Sekwan baru jangan ditunda-tunda, sebab administrasi dewan saat ini banyak yang terbengkalai dan tidak tertata dengan baik,” kata Aduhot didampingi anggota Komisi E DPRD Sumut lainnya, Richard Eddy M Lingga SE, Nurhasanah, Megalia Agustina, M Faisal, Arlene Manurung, Sopar Siburian, dan Hj Rahmianna D Pulungan. Menurut Aduhot, keberadaan Sekwan baru yang sudah di SK-kan itu dan sudah melalui prosedur. Sebab telah lolos pada seleksi kompetensi yang dilakukan Badan Pertimbangan Jabatan dan Kepangkatan (Baperjakat) dan melewati tahapan fit and proper test. Anggota Komisi E lainnya, Nurhasanah menambahkan, munculnya desakan agar Sekwan definitif segera dilantik, sama sekali tidak terkait dengan kepentingan-kepentingan pribadi dan kelompok, apalagi sampai muncul tudingan seputar politik transaksional seperti dinyatakan Wagubsu Gatot Pujonugroho. (m48)

Rumah Dan Pabrik Terbakar

Wasapada/ Rustam Effendi

MUBAZIR: Gedung Pengadilan Negeri (PN) Niaga, HAM, PHI dan Perikanan Medan di Jalan Selebes Gg Pekong, belum pernah difungsikan sejak selesai direnovasi sekitar bulan Juli 2010.

Siswa Korban Keracunan Lepas Dari Maut SATU per satu siswa/siswi SD Negeri 105292 Bandar Klippa Kec. Percut Sei Tuan, korban keracunan bakso kojek, pulang ke rumahnya masih-masing. Hanya beberapa orang saja yang masih dirawat di RS. Mitra Husada Tembung dan Puskesmas Bandar Khalifah, Rabu (12/1) siang. Namun diperkirakan, sore harinya mereka diperbolehkan pulang setelah kondisi kesehatan mulai membaik. Salah seorang korban keracunan Siti Nurhalizah, 10, mengatakan, kondisinya sudah mulai membaik. Siti tak lagi mengalami mual dan muntah serta pening. Selama di rumah sakit dirinya sudah menghabiskan 3 botol infus. “Udah nggak pening lagi,” katanya. Dia kembali menceritakan kejadian naas tersebut. Berawal saat jam istirahat pukul 10.00, Siti bersama kawan-kawan lainnya membeli bakso kojek makanan favoritnya dan teman-teman lainnya. Bakso tersebut dibelinya dengan harga Rp1.000. “Beli pertama gopek (Rp500red), habis itu beli lagi. Jadi yang Siti makan dua bungkus. Selama ini, kami beli itu juga tapi nggak apa-apa,” katanya.

Waspada/Anum Saskia

MENTERI PEMBERDAYAAN Perempuan & Perlindungan Anak Linda Amaliasari Agum Gumelar berbincang dengan Pemimpin Umum Harian Waspada Dr Hj Rayati Syafrin MBA,MM (kanan) bersebelahan dengan istriWagubsu Ny Gatot Pudjo Nugroho dan paling kiri Ketua Badan Kerjasama Organisasi Wanita Sumatera Utara (BKOWSU) Ny Zakaria Siregar saat berada di ruangan VIP Room Bandara Polonia Medan setelah mendarat sebelum melanjutkan perjalanan ke Redaksi Harian Waspada Jalan Letjen Suprapto No.1 Medan.

dan observasi lagi,” jelas Dr Frans Sihombing. Namun, lanjutnya, mereka yang sudah pulang maupun yang masih dirawat tidak ada

keluhan lagi seperti mual, muntah dan pusing. “Empat pasien itu masih diinfus, tapi kondisi mreka sudah lebih baik dari semalam saat pertama

datang, tapi mereka masih perlu observasi lagi, mana tahu muncul lagi keluhan-keluhan seperti semalam,” ungkapnya. * Mursal AI

Waspada/Mursal AI

LIHAT: Siti Nurhalizah, 10, (kiri) siswi kelas IV A SD Negeri 105292 Bandar Klippa Kec. Percut Sei Tuan Kab. Deli Serdang melihat temannya diperiksa oleh dokter Puskesmas Bandar Khalifa Kab. Deli Serdang Dr. Frans Sihombing, Rabu (12/1).

MEDAN (Waspada): Sebuah rumah permanen berlantai dua milik Boyke Simanjuntak di Jln Mongonsidi II, LingkunganVI, Kelurahan Anggrung, Kecamatan Medan Polonia, Rabu (12/1) siang, musnah terbakar. Saksimatamengatakankepada Waspada, rumah bercat hijau itu dihuni putri korban benama NovibrSimanjuntak.Saatitu,Novi baru beberapa menit keluar dari rumah.Tiba-tiba terlihat kobaran api disertai kepulan asap di ruang tamu lantai satu. Melihat rumah tersebut terbakar, warga setempat segera memberi pertolongan dan berusaha memadamkan api dengan peralatan seadanya. Lima mobil pemadam kebakaran milik Pemko Medan yang tiba di lokasi, berhasil memadamkan kobaran api dalam tempo 15 menit. Camat Medan Polonia Ali Nafiah di dampingi Lurah Kampung Anggrung M.Taufik,SSTP yang ditemui Waspada di lokasi kejadian mengatakan, rumah tersebut milik Boyke Simanjuntak dan dihuni anaknya, Novi. Sementara, Kapolsekta Medan Baru Kompol Saptono, SH,SIK bersama personelnya segera mengamankan lokasi guna mengantisipasi terjadinya hal yang tidak diinginkan. “Penyebab kebakaran masih dalam penyelidikan. Polisi sudah meminta keterangan

Waspada/Ismanto Ismail

KEBAKARAN: Petugas pemadam kebakaran berhasil memadamkan korbaran api yang membakar rumah permanen di Jln Mongonsidi II, Kelurahan Anggrung, Kecamatan Medan Polonia, Rabu (12/1) siang. sejumlah saksi,” ujarnya. Di tempat terpisah, kebakaran kecil terjadi di pabrik peleburan aluminium Jln Kebun Kopi Desa Mariendal I, Kecamatan Patumbak, Rabu (12/1) sekira pukul 04:00. Namun, dalam tempo relatif singkat, kobaran api berhasil dipadamkan oleh sejumlah buruh pabrik. Informasi yang dipeorleh di lokasi kejadian, kebakaran terjadi di bagian belakang pabrik tepatnya di bagian peleburan dan pengobatan. Diduga, penyebab kebakaran karena arus pendek (korsleting). “Api berhasil dipadamkan oleh karyawan yang sedang bekerja pada

malam hari,” sebut seorang karyawan PT Alumex. Sementara itu, pihak PT Alumex yang hendak dikonfirmasi tidak bersedia memberi keterangan karena dan melarang wartawan masuk. Sedangkan pihak Polsekta Patumbak enggan memberi keterangan lebih rinci terkait kebakaran tersebut. Kanit Reskrim Polsekta Patumbak AKP Parulian Samosir yang dikonfirmasi enggan memberi keterangan terkait penyebab kebakaran tersebut. “Silakan aja cek ke TKP,” ujar Samosir saat dikonfirmasi via telefon selulernya. (m36/h04)

Lembaga Penghafal Al Quran Didirikan Di Medan Didukung Wagubsu, BKM Al-Arif Dan Rumah Zakat MEDAN (Waspada): Sebuah komunitas penghafal Al Quran di Medan meresmikan Lembaga Tahfidz Al-Quran (LTQ) Al-Arif yang mengkhususkan diri untuk melahirkan para penghafal (hafidz) Al Quran di Komplek Taman Setia Budi Indah (Tasbih) II Jalan Ring Road Medan Medan. LTQ Al Arif di-launching oleh KH Abdul Aziz Abdul Rauf, LC dari Jakarta, kemarin, di Masjid Al Arif Komplek Tasbih II Medan. Acara launching juga diisi dengan ceramah “Semua Orang Bisa Menghafal Al-Quran” oleh KH Abdul Aziz Abdul Rauf, Lc dan Qiyamullail berjamaah membaca 2 Juz Al-Quran bersama 4 orang Hafidz (penghafal Al-Quran). Acara itu diikuti sekitar 150 warga dari berbagai daerah di Kota Medan. Ketua Panitia yang juga Ketua LTQ AL-Arif Ustad Raja Hamlet dalam sambutannya mengatakan, LTQ Al-Arif lahir dari keinginan para pecinta Al-

Quran Kota Medan akan adanya satu wadah tempat mereka berlatih menghafal Al-Quran. Wadah tersebut lahir dengan dukungan BKM Masjid Al-Arif, Wakil Gubernur Sumut Gatot Pujonugroho dan Rumah Zakat Medan. “Lembaga ini sudah berjalan sekitar satu bulan yang soft launching-nya bulan lalu oleh Wagubsu Gatot Pujonugroho. Setiap pekannya kita melakukan Mabit, yakni menginap untuk menyetorkan hafalan Al-Quran dengan peserta rata-rata sekitar 30 orang. Malam ini kita melakukan Mabit Akbar dengan mengundung KH Abdul Aziz Abdul Rauf, Lc pimpinan LTQ Al-Hikmah Jakarta dan Ustad Agus Subagyo dari Komunitas Sahabat Al-Quran Bandung. Mabit Akbar ini ditujukan untuk lebih memperkenalkan LTQ AlArif kepada warga Kota Medan dan meningkatkan motivasi para santri LTQ Al-Arif,” papar Raja Hamlet.

Sementara itu KH Abdul Aziz Abdul Rauf, Lc dalam ceramahnya mengatakan, menghafal Al-Quran bukan skill khusus yang hanya bisa dilakukan oleh sebagian orang, melainkan suatu keniscayaan yang bisa d i l a k u k a n s e m u a o ra n g layaknya ibadah-ibadah lain dalam Islam. Sementara itu, seusai acara, Ustad Raja Hamlet yang juga Imam tetap Masjid Al-Arif itu menuturkan LTQ Al-Arif terbuka untuk semua orang yang punya keinginan untuk menghafal AlQuran. Sistem yang mereka terapkan adalah sistem penyetoran hafalan sekali sepekan pada malam Ahad bersamaan dengan acara Mabit yang juga diisi dengan Qiyamullai berjamaah. Saat ini LTQ Al-Arif telah punya dua orang pengajar yang merupakan Hafidz 30 Juz yakni Ustad Raja Hamlet sendiri dan Ustad Nizar yang merupakan warga Komplek Tasbih II. (m48)


Medan Metropolitan A4 5.000 KK Tuntut Janji Walikota

WASPADA Kamis 13 Januari 2011

Rahudman: Saya Tetap Komit Perjuangan Tanah Warga Sari Rejo MEDAN (Waspada): Pengurus Forum Masyarakat Sari Rejo (Formas) mendatangi Balai Kota Medan menuntut janji Walikota Rahudman Harahap agar segera menerbitkan sertifikat tanah mereka yang sampai saat ini masih terkatungkatung. “Kami tetap memperjuangkan agar tanah kami disertifikatkan. Hal ini sesuai janji walikota pada saat kampanyenya ketika maju menjadi calon Walikota Medan. Jadi harapan kami supaya pak Rahudman dapat menerbitkan sertifikat tersebut,” kata Riwayat Pakpahan perwakilan Formas Sari Rejo seusai bertemu Walikota di Balai Kota, Rabu (12/1).

Menurut Riwayat, kedatangan mereka ke Balai Kota mewakili dari 5.000 KK yang terdiri dari 30.000 jiwa masyarakat Sari Rejo yang tinggal di atas lahan 260 hektar di kawasan Polonia yang masih bersengketa denganTNI AU. Dalam pertemuan itu, Formas tetap meminta Walikota untuk menyelesaikan kasus ini secara baik dan arif. “Kami tidak banyak permin-

Ikatsi UDA Akan Adakan Reuni Akbar MEDAN (Waspada): Keluarga besar Ikatan Alumni FakultasTeknik Sipil (Ikatsi) Universitas Darma Agung akan melaksanakan reuni akbar tahun 2011 di aula biro rektor kampus UDA, Sabtu (15/11). Humas panitia reuni Hadi Suwito di redaksiWaspada, Rabu (12/ 11) menjelaskan, tujuan reuni akbar Ikatsi didasari dan dilandasi peduli antarsesamaalumni,sertamelihatparaalumnitelahberkaryaditengah masyarakat dan di instansi pemerintah maupun swasta. Untuk kelancaran acara reuni, anggota telah membentuk kepengurusan kepanitiaan melalui hasil musyawarah dengan ketua Ir Lakhomizaro Zebua yang saat ini sebagai pejabat Walikota Gunung Sitoli, Nias dan sekretaris Ir Charles Marpaung. Acara reuni akbar juga sekaligus pelantikan kepengurusan Ikatsi masa priode 2011- 2014 yang kepengurusannya telah berhasil dipilih dalam musyawarah yang berlangsung di Restoran Grand Maxim. Sebagai ketua terpilih Ikatsi periode 2011–2014 Ir Karun Wirianto, sekretaris Ir Ismet Muhammad dan bendahara Ir Rubianto. Pengurus Ikatsi baru terpilih ini selanjutnya akan dikukuhkan pada acara reuni oleh Ketua Yayasan Universitas Darma Agung Sariaty Pardede. Panitia reuni juga mengharapkan kehadiran seluruh alumni pada acara nanti untuk lebih memupuk rasa persatuan dan lebih peduli antar sesama alumni fakultas teknik sipil. (m35)

Waspada Tetap Di Hati Masyarakat Karena Taat KEJ MEDAN (Waspada): Tetap eksis di usia 64 tahun menandakan harian Waspada yang didirikan H. Moh Said dan Hj Ani Idrus digemari masyarakat, khususnya umat Islam. Itu sebabnya Waspada selalu menjadi referensi dan bacaan umat Islam. Demikian dikatakan Dosen STIKP Drs H Amhar Nasution, MA, Selasa (11/1). Menurut ustadz Amhar (foto), Waspada tetap di hati masyarakat karena menampilkan berita-berita yang positif. Artinya, berita-beita yang disajikan Waspada sudah sesuai dengan Kode Etik Jurnalistik (KEJ), sehingga menjadikannya berkualitas. ‘’Saya menilai Waspada semakin maju dan berkembang, meskipun semakin banyak koran yang terbit di Kota Medan. Kemajuan yang dicapai Waspada tidak lepas dari SDM yang berada di belakang meja, baik itu wartawan, rerdaktur dan lain-lain,’’ ujarnya. Kini, Waspada tidak hanya dibaca semua kalangan, dari kelas bawah, menengah dan atas, tapi juga mampu memikat kalangan muda, anak-anak dan remaja. Namun begitu, ustadz Amhar berharap, Waspada bisa meningkatkan terus kemampuan jurnalistiknya, tetap menaati kode etik, termasuk menggunakan bahasa yang lebih baik, mengurangi kesalahan ketik dan tata bahasa lebih komunikatif. Di kalangan ulama menurut ustadz Amhar, Waspada menjadi bacaan wajib, sehingga surat kabar tertua di Medan saat ini selalu ditunggu-tunggu kehadirannya setiap hari. ‘’Rasanya tidak puas kalau belum membaca Waspada,’’ katanya memuji. Waspada ke depan wajib bisa menjaga penampilan isinya sehingga mampu memenuhi selera masyarakat.Waspada tergolong media positif karena menjalankan fungsi pers dan independen dalam bersikap. Tidak seperti banyak media lain yang menghalalkan segala cara, termasuk memuat berita dan foto yang menjurus pornografi. ‘’Secara umum Waspada pantas menjadi media massa yang diperhitungkan, namun harus terus berusaha bisa lebih baik, termasuk pemberitaan dan tulisan dalam bentuk features maupun opini yang kritis terkait sosial kontrol untuk kepentingan masyarakat, demkian ustadz Amhar.(m03)

Siswa Medicom Bantu Korban Banjir MEDAN (Waspada): Siswa Bimbingan Test Medicom Medan selama tiga hari berturut-turut sejak 8, 9 dan 10 Januari 2011 berbagi kasih dengan memberikan bantuan warga yang terkena musibah baniir yang di beberapa titik di Kota Medan. Pimpinan rombongan Mukti Sinaga mengatakan hal itu kepada Waspada di kantornya Jalan Bantam Medan, Rabu (13/1). “Ini merupakan program bagi sekolah sebagai wujud kepedulian terhadap sesama yang terkena musibah,” katanya. Para siswa/i memperlihatkan keprihatinannya pada hari pertama (8/1) membagikan nasi bungkus untuk makan siang , dan sembako berisi mi instan (10 bungkus per orang), beras 1 kg per orang, sarden 1 kaleng perhan Hamdan Lingkungan IV Medan Polonia, Kelurahan Sei Mati Lingkungan XII Medan Maimun, Kelurahan Sei Beringin Medan Selayang dan Kelurahan Darat Gg. Haji Arief Medan Baru, Sri Gunting-Sunggal Jalan S.Parman dan kawasan lainnya. Kemudian, dana Rp50 juta dikumpulkan secara spontan dan diolah berbentuk berbagai kebutuhan untuk para korban banjir. Kata Sinaga, kegiatan bakti sosial ini bertujuan menumbuhkan rasa saling mengasihi antara sesama, mendidik siswa/i dan mahasiswa/i untuk belajar member kepada sesama manusia. (m24)

taan, dan hanya mengharapkan bantuan walikota untuk dapat menerbitkan sertifikat tersebut. Hal ini sesuai dengan janji pak wali saat kampanye di tempat daerah kami,” ucapnya. Sementara Walikota ketika dikonfirmasi mengatakan komitmennya akan memberikan solusi terbaik buat masyarakat Sari Rejo. “Saya komit membantu masyarakat Sari Rejo terkait masalah tanah tersebut. Saya sudah melakukan pemaparan di depan Kepala Staf Angkatan Udara yang diikuti pimpinan dewan,” katanya. Diungkapkannya, penyelesaian kasus tanah masyarakat terus ditindaklanjuti. Bahkan,

pada 20 Januari 2011 mendatang Tim Mabes AU akan datang ke Medan untuk membicarakan masalah ini.“Kita tetap berupaya memfasilitasi dan mencari solusi terkait tanah warga yang diklaim AU. Jadi, pada 20 Januari mendatang tim Mabes AU turun meninjau lokasi tersebut,” katanya. Untuk itu, tambah Rahudman, dalam arahannya kepada masyarakat agar tetap semangat sehingga penyelesaian masalah tanah warga Sari Rejo dapat segera terealisir. Mantan Sekda Tapsel ini juga meminta kepada masyarakat Sari Rejo pada saat kehadiran Tim dari Mabes AU untuk pe-

ninjauan di lapangan agar ikut menyaksikan dan memantaunya sehingga segala sesuatu yang terjadi di lapangan diketahui masyarakat. “Saya minta masyarakat Sari Rejo agar mendampingi tim dan melihatsecaralangsung,sehingga dapat mengetahui perjuangan yang dilakukan untuk penyelesaian masalah tanah warga. “Mudah-mudahan dengan adanya komunikasi yang baik dengan pihak AU, masalah ini bisa diselesaikan. Diimbau kepada warga untuk jangan mau dipengaruhi oleh pihak-pihak lain yang mencoba-coba mengambil keuntungan,” demikian Rahudman. (m50)

Tanah Jl Jati Miliki Dua Surat MEDAN (Waspada): Praktik makelar kasus atau markus terus membayangi proses hukum Indonesia. Hak kepemilikan tanah di Jalan Jati, Pulobrayan Bengkel, Medan Timur, salah satu bukti ulah permainan markus, hingga ada dua versi surat yang diduga diterbitkan Kantor Badan Pertanahan Nasional (BPN) Medan. Versi pertama terdapat sertifikat kepe-milikan tanah seluas sekitar 70.506,45 meter yang diterbitkan pada 1997. Penerbitan itu merupakan ekses dari penjualan tanah tersebut dari masyarakat melalui Muchtamid, Kepala Kampung Pulobrayan Bengkel ketika itu, kepada Ahiruddin Nasution, dan Muhammad Nasution yang tercatat sebagai hakim Pengadilan Tinggi Sumut pada 1974. Rencananya tanah itu untuk dijadikan perumahan pegawai PT Sumut sesuai surat PT Sumut

yang diterbitkan 28 Mei 1974. Untuk menguatkan transaksi itu, pada 21 Juni 1974, Dinas Tata Kota Medan langsung menerbitkan Surat Keterangan Rencana pembangunan di lahan itu. Tapi belakangan pada tahun 2003, BPN Medan kembali menerbitkan sertifikat untuk objek tanah yang sama atas nama berbeda. Fakta itu tentu saja menimbulkan polemik hingga bergulir ke Pengadilan TataUsaha Negara (PTUN). Penggugat Abdul Kiram dan tergugat Ruslim Lugianto. Tim Operasional Penyelamatan Aset Negara (Topan) RI yang mengawasi kasus itu curiga adanya keterlibatan markus. Yang menjadi sorotan tentu saja keberadaan dua sertifikat tanah di objek yang sama. “Kami menemukan banyak kejanggalan dalam kasus ini. Tak hanya munculnya dua surat

tanah saja, tapi proses pengadilan juga banyak yang janggal,” kata Ketua Bidang Investigasi Topan RI Sumut Azis Saputra, Rabu (12/1). Berdasarkan investigasi pihaknya, penerbitan sertifikat pada 2003 itu diduga penuh rekayasa. Pasalnya RL yang sempat mengaku sebagai pengembang perumahan di lahan itu sudah melarikan diri, sejak kasus inimemasukiranahpersidangan. “Kalau tak bersalah mengapa dia lari. Kan jadi pertanyaan besar itu,” kata Azis. Dia meminta lembaga penegak hukum segera turun tangan mengusut kasus itu. Sebab kata dia, bila kasus ini dibiarkan, tak tertutup kemungkinan terjadi bentrok di arus bawah.“Berulangkali penyitaan objek tanah itu direncanakan,tapigagalkarenaadaperlawanan warga. Harus ada kejelasan hukum agar tidak terjadi bentrokan,” ucapnya. (m49)

Waspada/ist

DELEGASI PELAJAR GWANGJU: Asisten Pemerintahan (Aspem) Setdako Medan Drs Daudta P Sinurat MM (paling kanan), Kabag Hubungan Kerjasama Setdako Medan Drs Rivai Nasution MM (keenam dari kiri), Staf Ahli Pemprovsu Ir. Hj Sabrina MSi (kelima dari kiri) diabadikan bersama delegasi pelajar SMU Gwangju dipimpin Kang Ki-hyun dalam acara penyambutan kedatangan di Balai Pertemuan Avia Samudera Medan, Senin (10/1).

Pelajar Gwangju Timba Pengalaman Di Medan MEDAN (Waspada): Delegasi pelajar Kota Gwangju, Korea Selatan, melakukan kunjungan selama enam hari ke Medan untuk menimba berbagai pengalaman, khususnya di bidang pendidikan mulai 10 hingga 16 Januari 2011. Kedatangan delegasi pelajar dari kota bersaudara (Sister City) di bawah pimpinan Kang Kihyun, itu disambut hangat unsur pejabat Pemko Medan, Pemerintah Provinsi Sumatera Utara, guru dan siswa SMA Kota Medan di Balai Pertemuan Avia Samudera Senin (10/1). Walikota Medan Rahudman Harahap diwakili Asisten Pemerintahan (Aspem) Setdako Medan Daudta P. Sinurat dalam sambutannya mengatakan, kedatangan para siswa dari Kota Gwangju dalam rangka pertukaran pelajar. Dalam hal ini Pemko Medan secara resmi menyerahkan para siswa kepada sejumlah orangtua asuh. Walikota berharap kehadiran delegasi pelajar Gwangju itu dapat mempererat silaturahmi/ persahabatan antara Kota Medan dan Gwangju. Selain itu,

selama keberadaannya di Kota Medan, para siswa/i Gwangju dapat menambah pengalaman dan wawasan. Sementara itu, Kabag Hubungan Kerjasama Setdako Medan Rivai Nasution menjelaskan, selama berada di Medan mulai 10 s/d 16 Januari, para pelajar Gwangju akan mengikuti proses belajar mengajar dan mempelajari kurikulum di SMA Negeri 1 dan 2, SMA Harapan 1 dan Madrasah Aliah Negeri (MAN) 2 Medan. Kemudian, mereka akan dibawa berlibur ke Parapat dan Taman Wisata Simalem di Kabupaten Karo. Tujuannya, kata Rivai, untuk memperkenalkan daerah tujuan wisata yang ada di Sumut kepada bangsa asing. Rivai berharap kegiatan Sister City ini dapat ditingkatkan lagi di masa datang. Tidak hanya program pertukaran pelajar melainkan bidang kesehatan dan pariwisata. Terkait pertukaran program pariwisata, menurutnya sangat berpeluang mengingat Kota Medan memiliki banyak etnis, kesenian dan budaya yang

nantinya dapat ‘dijual’ kepada bangsa asing sehingga dapat menambah Pendapatan Asli Daerah (PAD) Kota Medan dengan masuknya wisatawan mancanegara ke kota ini. Banyak Perubahan Kang Ki-hyun, guru bidang studi sejarah pada Seokang High School Gwangju, menjelaskan delegasinya terdiri dari 13 orang pelajar. Mereka semuanya asal Seokang High School. Terkait keadaan Kota Medan, Kang K i-hyun yang mengaku untuk kedualinya mengunjungi kota ini mengatakan Kota Medan banyak perubahan. “Dulu sewaktu saya mengunjungi Kota Medan pada 1998, keadaannya tidak seperti sekarang ini. Banyak perubahan yang terjadi antara lain gedung-gedung pencakar langit mulai berdiri di mana-mana,” ujarnya. Dia memuji tentang kemajuan pesat Kota Medan, namun suhu udaranya sedikit panas dibanding Gwangju. “Saat ini Gwangju sedang dilanda musim dingin. Diselimuti salju tebal,” katanya. (rel/m10)

YPHAS-UMA Gelar Silaturahim MEDAN (Waspada): Yayasan Pendidikan Haji Agus Salim (YPHAS) bersama Universitas Medan Area (UMA) menggelar silaturahim selama dua hari, Sabtu-Minggu (8-9/1), di Hotel Rindu Alam Bukit Lawang, Langkat. Selain silaturahim, kegiatan itu juga diselingi pelaksanaan outbound dan melihat penangkaran orangutan. Silaturahim tersebut diikuti pengurus yayasan PHAS di antaranya Sekretaris HM Akbar Siregar, Bendahara HM Erwin Siregar, Rektor UMA HA Ya’kub Matondang, Direkur Pascasarjana UMA Heri Kusmanto, beserta para wakil rektor, wakil direktur pascasarjana, para dekan hingga ketua jurusan serta kepala UPT di lingkungan UMA. Bahrum Jamil selaku panitia kegiatan kepada wartawan di kampus UMA Jalan Kolam Medan Estate, Selasa (11/1), menyebutkan, dalam silaturahim penuh keakraban itu, Erwin Siregar mengharapkan silaturahmi di lingkungan keluarga besar UMA semakin dieratkan. Bahrum Jamil yang juga Ketua Jurusan Ilmu Komunikasi FISIP UMA mengatakan, pihak yayasan juga akan terus mendukung dan menyediakan fasilitas teknologi guna proses belajar dan mengajar. Dia meminta pihak universitas untuk lebih serius dan gigih dalam bekerja. Rektor UMA HA Yakub Matondang menyampaikan terima kasih atas dukungan dan bantuan pihak yayasan dalam membangun UMA. Apalagi berkat dukungan yayasan perolehan jumlah mahasiswa baru tahun ini meningkat dari tahun lalu. (m41)

Waspada/Ist

KELUARGA BESAR Yayasan Pendidikan Haji Agus Salim dan Universitas Medan Area foto bersama saat menggelar silaturahim.

Waspada/Anum Saskia

BERSALAMAN : Walikota Medan Drs Rahudman MM bersalaman dengan siswa SMKN 9 didampingi Kadis Pendidikan Kota Medan Drs Hasan Basri MM, Kepsek Drs Sakti Siregar MPd usai melaunching program penggalangan dana untuk korban banjir.

Walikota Galang Dana Untuk 2.214 Siswa Korban Banjir MEDAN (Waspada): Walikota Medan Rahudman Harahap mencanangkan penggalangan dana untuk siswa yang terkena bencana banjir sebanyak 2.214 siswa di Kota Medan dari tingkat SD, SMP dan SMA serta SMKN berpusat di SMKN 9 Medan, Rabu (12/1). Hadir Kadis Pendidikan Kota Medan Hasan Basri bersama Kabag Humas Pemko Medan Hanas Hasibuan, Kepala SMKN 9 Sakti Siregar bersama Kepsek SMKN Kota Medan, para pejabat kecamatan Medan Sunggal serta dari kelurahan dan undangan lainnya. Dalam arahannya di hadapan ribuan siswa SMKN 9 dan 15 siswa rumahnya terkena banjir Kamis (6/1), walikota mengatakan, penggalangan dana ini sebagai bentuk solidaritas terhadap sesama pelajar di Medan. Solidaritas begitu penting untuk lebih mempererat persaudaraan dan saling merasa senasib sepenanggungan antar pelajar di Medan. “Saya sudah melihat berbagai kawasan di Medan yang terkena banjir, dari data yang ada tercatat 2.214 siswa yang ada di Medan, rumah-

nya terkena banjir. Dengan adanya penggalangan dana ini diharapkan semakin tinggi tingkat kepedulian antar siswa dan membuktikan pendidikan kepedulian terhadap sesama di sekolah membuahkan hasil yang positif,” ujarnya. Sementara itu, Kapala Dinas Pendidikan Kota Medan Hasan Basri bersama Kabid Dikmenjur Marasutan Siregar mengatakan, program penggalangan dana ini dilaksanakan secara serentak di seluruh sekolah yang ada di Medan dari berbagai tingkatan. “Siswa yang terkena musibah banjir akan diberikan bantuan sesuai dengan kebutuhan mereka,” ujarnya. Di tempat terpisah Kacabdis Medan Amplas Sadariah, SH mengatakan, program penggalangan dana yang dicanangkan walikota telah dilaksanakan di kecamatan ini. Hingga pukul 12.00 WIB baru 14 sekolah dari 42 sekolah yang ada yakni SDN dan swasta dengan jumlah 4.782.000. Sedangkan SMAN Rayon 09 telah menghimpun dana sebanyak 925.000 yang akan diserahkan langsung ke kantor dinas pendidikan kota Medan. (m37)

Syaiful Bahri Akan Dilantik Jadi Sekda MEDAN (Waspada): Setelah melakukan fit and proper test terhadap tiga calon kandidat yang akan menduduki jabatan Sekretaris Daerah (Sekda) Kota Medan, akhirnya Syaiful Bahri Lubis yang saat ini menjabat Kepala Bappeda Kota Medan terpilih menggantikan HM Fitriyus. Informasi yang dihimpun di Balai Kota Medan, Rabu (12/1), pelantikan Sekda Kota Medan Syaiful Bahri direncanakan besok, Jumat (14/1), pagi di Balai Kota Medan. Surat Keputusan (SK) telah diteken Gubsu Syamsul Arifin di Salemba. “Kalau tidak ada halangan pak Syaiful dilantik besok pagi. Hal seperti ini sudah biasa dalam jajaran Pemko Medan,” kata pejabat di Badan Kepegawaian Daerah (BKD) Kota Medan yang tidak mau dilansir namanya. Menurut pejabat itu, nama-nama tiga calon yang sempat masuk bursa kandidat Sekda, yakni Kepala Bappeda Kota Medan Syaiful Bahri Lubis, Kepala Dinas Pemuda dan Olahraga (Kadispora) Medan Busral Manan, dan Kepala Dinas BKKBN Medan Darusalam Pohan. Namun yang lulus adalah Syaiful Bahri. “Ada tiga yang menjadi kandidat, tapi pak

Syaiful Bahri

Darussalam Pohan

Busral Manan

Syaiful yang lulus,” ucapnya. Dengan adanya isu pergantian tersebut, sejumlah pejabat di Balai Kota tampak terkejut. Ada mengaku belum mengetahui informasi tersebut. Namun, menurut sejumlah Kepala Bagian mengatakan, pergantian pejabat di lingkungan Pemko suatu hal yang biasa atau merupakan penyegaran. Kepala Badan Kepegawaian Daerah (BKD) Pemko Medan Lahum ketika dikonfirmasi mengatakan, belum mendapat surat tembusan ke pihaknya. “Saya belum mendapat surat itu, tapi enggak tahu kalau besok pagi diserahkan. Kan masih ada waktu satu hari lagi untuk menyebarkan undangannya kalau pun itu benar,” katanya. (m50)

Kunjungan Kopertis Ke UISU Al Munawwarah Jangan Disalahartikan MEDAN (Waspada): Pakar Hukum Tan Kamello menegaskan, Koordinator Kopertis Wilayah I Aceh- Sumut harus berani bertindak tegas menutup kampus UISU yang ilegal (tidak memiliki izin) pengelolaan akademik, sehingga tidak semakin banyak masyarakat yang dirugikan. “Kopertis harus berani bertindak tegas menutup kampus UISU yang tidak memiliki izin pengelolaan akademik dari pemerintah,” kata TanKamellokepadawartawandiMedan,kemarin. Disebutkannya, pernyataan Koordinator KopertisWilayah I Aceh-Sumut Prof Ir. Mohammed Nawawiy Loebis bahwa konflik UISU harus dituntaskan lewat jalur hukum sudah sangat tepat, dan ini merupakan sikap tegas Kopertis. Ini mengartikan bahwa Kopertis dalam waktu dekat harus menutup kampus ilegal yang masih beroperasi. Menanggapi kunjungan Mohammed Nawawiy Loebis ke Kampus UISU Al Munawwarah Jl. SM Raja, Tan Kamello mengatakan, agar tidak disalahditafsirkan. “Dari aspek hukum, kunjungan itu tidak memberikan legalitas, justru Kopertis ingin melihat kondisi UISU ilegal yang sudah tidak diakui pemerintah,” ujarnya.

Secara yuridis yang harus dipahami, kunjungan KopertisWilayah I Aceh-Sumut ke Kampus UISU Al Munawwarah tidak bisa merubah status tersangka dr. Chairul Mursin dan Helmi Nasution. “Statusnya tetap tersangka dan pengelolaan akademik tetap ilegal,” kata dia. Tentang masih adanya dosen Kopertis DPK UISU bekerja di Kampus Al Munawwarah, menurut Kamello, keberadaannya menyalahi wewenang dan jabatan. “Sangat tidak etis. Dosen Kopertis kan PNS yang digaji negara, tapi masih bekerja di PTS yang ilegal. Kopertis harus mengambil langkah tegas terhadap dosen itu, karena bisa berpotensi merugikan keuangan negara.Kalaudibiarkanberlarut-larutmakasangat berpotensi terjadi tindakan korupsi,” ujar dia. Tan Kamello tidak juga yakin status tersangka Chairul Mursin bisa berubah menjadi saksi, karena BAP-nya sudah lengkap (P21) oleh Jaksa. Ini berkenaan berita-berita yang menyebutkan Prof. Mohammed Nawawiy Loebis bersama dr. Chairul Mursin menjumpai Kapoldasu Irjen Oegroseno guna meminta status hukum Chairul Mursin dirubah dari tersangka menjadi saksi pelapor. (m27)

UISU Peringati Milad Ke-60 MEDAN (Waspada): Yayasan dan Akademika Universitas Islam Sumatera Utara (UISU) Jalan Karya Bakti mengadakan malam syukuran/renungan Milad lahirnya yayasan dan universitas.Yayasan Universitas Islam Sumatera Utara (UISU) ke-60 (3 Januari 1951-3 Januari 2011) dan universitas ke-59 (7 Januari 19527 Januari 2011). Malam syukuran tersebut dirangkai dengan pembacaan tahtim, tahlil dan doa yang ditujukan kepada almarhum para pendiri UISU. Prof Muhammad Taib MA, Rabu (12/11), dalam sambutannya mengajak seluruh keluarga besar UISU agar senantiasa bersyukur kepada Allah SWT. “Mari kita memperbanyak syukur karena hingga saat ini UISU masih tetap eksis, dan mari sama kita renungkan apa yang sudah diperbuat saat ini dan kedepan untuk memajukan UISU” kata Taib. Menurutnya, dengan akal saja belum tentu bisa menyelesaikan masalah, tapi harus dibarengi dengan bersyukur dan doa. Ketua Umum Yayasan Usman Pelly mengatakan, untuk menghadapi keberuntungan dan kesulitan sebenarnya sama saja karena sama-sama melahirkan perobahan. “Tergantung bagaimana kita bisa menuntaskannya, sehingga keberuntungan itu tetap

terang,” ujarnya. Menurut Usman Pelly, di balik kesulitan yang dihadapi saat ini masih dapat diraih kemenangan dengan adanya pembangunan kampus baru sehingga kejayaan UISU akan kembali diraih.“Setiap kesulitan dapat diselesaikan dengan kebersamaan, mari sama-sama kita merenung sejenak ke belakang bagaimana UISU jaya berkat perjuangan umat Islam, persoalan hukum UISU sudah selesai yang belum selesai adalah hukumannya” tambah Usman Pelly. Menurutnya, walaupun dalam pengungsian seluruh keluarga besar UISU harus mampu membangun UISU yang lebih baik, namun di balik itu kita harus mampu mempertahankan kualitas alumni UISU sesuai impian dan citacita para pendiri UISU. Sementara Pembina Yayasan UISU Prof Muhammad Hatta memaparkan, dengan cucuran keringat, tetesan air mata para pendiri UISU 60 tahun yang lalu bercita-cita untuk menciptakan UISU yang dapat dibanggakan. Sedangkan Kepala Bidang Humas UISU Syahrial Ams, SH, M.Hum meyakini kisruh UISU akan berakhir pada tahun 2011 ini, karena Kapoldasu dan Kopertis sudah memikirkan solusi terbaik untuk mengakhiri kemelut tersebut. (m30)


Medan Metropolitan

WASPADA Kamis 13 Januari 2011

A5

Kasus Aborsi Mengendap Di Polresta Medan Tersangka Bebas Berkeliaran MEDAN (Waspada): Kasus aborsi yang melibatkan lima tersangka termasuk seorang dokter, kini mengendap di Polresta Medan. Buktinya, kasus aborsi yang terungkap melalui penggerebekan di salah satu rumah Jln Sentosa Lama Gg. Margo Medan, pada Sabtu 12 Desember 2009, hingga saat ini belum dilimpahkan ke pengadilan untuk disidangkan. Informasi yang diperoleh Waspada di lapangan, Rabu (12/ 1), terbongkarnya praktik aborsi tersebut bermula ketika pihak Polresta Medan (saat itu bernama Poltabes) melakukan penggerebekan pada 12 Desember 2009 sekira pukul 19:30. Saat itu, sejumlah personel Polresta Medan mengendarai

dua unit mobil mendatangi lokasi. Kemudian, mereka menggrebek rumah yang menjadi tempat praktik dokter J. Dalam penggerebekan tersebut, polisi mengamankan tersangka SR dan DN selaku pemilik rumah serta dokter J yang diduga sebagai pelaku tindakan aborsi serta dua tersangka lainnya.

Poldasu Musnahkan 100 Batang Pohon Ganja MEDAN (Waspada): Direktorat Narkoba Polda Sumut memusnahkan 100 batang pohon ganja dan 11.300 gram ganja siap edar di halaman Mapoldasu, Rabu (12/1). Pemusnahan narkoba itu disaksikan perwakilan Kejaksaan Tinggi Sumut (Kejatisu), Pengadilan Negeri dan Labfor Polda Sumut. Direktur Narkoba Polda Sumut Kombes Pol John Turman Panjaitan mengatakan, pemusnahan tersebut merujuk UU Nomor 35 Tahun 2009 tentang Narkotika.Narkoba golongan satu ini, sebelumnya disita dari enam tersangka selama periode Desember 2010 hingga Januari 2011. Keenam tersangka yakni, abang beradik Lilik Miskiyanto dan Agustian alias Agus, keduanya warga Pasar II Pemancar Desa Padang Cermin Kec Selesai Kab Langkat. Keduanya, ditangkap pada Minggu (9/1), karena menanam 112 pohon ganja di halaman rumah mereka. Kemudian, tersangka Muhammad Zein Lubis alias Izen, ditangkap atas kepemilikan 10 ribu gram ganja di Jln Muhammad Yakob, Desa Bandar Khalifah, Kecamatan Percut Sei Tuan Kabupaten Deli Serdang, pada 15 Desember 2010. Setelah itu, dua oknum TNI yakni Yogi Apriadi dan Sri Untung serta seorang warga sipil Freddy Tarigan ditangkap di Jln Flamboyan Kelurahan Sempah Kata, Kecamatan Medan Selayang atas kepemilikan ganja kering sebanyak 5 ribu gram pada 8 Desember 2010. Panjaitan menambahkan, pemusnahan dilakukan setelah sebagian barang bukti berupa 10 batang pohon ganja dan 800 gram daun ganja kering diserahkan ke Laboratorium Forensik Polda Sumut untuk diperiksa. Selain itu, dua batang pohon ganja dan 2.900 gram daun ganja kering diserahkan ke Pengadilan Negeri untuk bukti di persidangan. “Sisanya sebanyak 100 batang pohon ganja dan 11.300 gram ganja yang kita sita dari enam tersangka, dimusnahkan hari ini,” ujar Panjaitan kepada wartawan. Nilai nominal ganja tersebut antara lain, untuk 100 batang pohon ganja seberat 56 ribu gram ditaksir mencapai Rp56 juta. Sedangkan, ganja kering seberat 11.300 gram ditaksir mencapai Rp11.3 juta. “Total nominal keseluruhan ganja yang kita musnahkan mencapai Rp67.300.000,” rincinya. Soal dua oknum TNI yang ditangkap tersebut, Panjaitan menjelaskan, pihaknya hanya memproses empat warga sipil. “Dua oknum TNI tersebut diserahkan ke Polisi Militer. Sedangkan empat tersangka lainnya kita proses,” jelasnya.(m39)

Eksekusi Ruko Picu Kemacetan MEDAN (Waspada): Proses eksekusi yang dilaksanakan Pengadilan Negeri (PN) Medan terhadap tanah dan bangunan di Jln Asia No. 57 A, Kel. Sei Rengas I, Kec. Medan Kota, berjalan lancar. Awalnya, sempat terjadi protes dari pihak yang kalah berperkara sehingga memicu kemacetan arus lalu lintas, Rabu (12/1). Pelaksanaan eksekusi dilaksanakan setelah adanya putusan kasasi dari Mahkamah Agung RI tertanggal 26 September 2006, No. 83 K/Pdt/2005 yang mengabulkan permohonan Nelly Purnamasari Boenjamin, MA selaku ahli waris mendiang Sahar Boenjamin, SH atau Boen Foet Chong terhadap lawannya (termohon) Hanwaty Kweetarto. Dalam putusannya, Mahkamah Agung menyatakan tanah seluas 69 m2 berikut bangunannya berupa ruko bertingkat 3 berukuran 4x16 meter di Jln Asia No. 57 A, sah secara hukum milik Nelly Purnamasari Boenjamin, MA yang merupakan harta warisan mendiang Sahar Boenjamin, SH dan Maria Limiardi (Lim Kim Giok). Selain itu, putusan MA menyatakan secara hukum penggugat (Nelly Purnamasari Boenjamin-red) sebagai satu-satunya ahli waris yang berhak atas tanah dan bangunan itu. Eksekusi dilaksanakan juru sita Pengadilan Negeri Medan Hasil Sembiring, SH dan dua saksi dari PN yakni H. Ahmad Sulaiman, SH dan Susanto. Sejumlah aparat keamanan sengaja dikerahkan guna memperlancar proses eksekusi tersebut. Sedangkan proses eksekusi sempat diwarnai protes dari pihak tergugat yang memohon agar tanah dan bangunan ruko tersebut tidak dieksekusi. (m49)

Setelah menjalani pemeriksaan, kelima tersangka ditahan. Namun satu persatu tersangka yang diamankan tersebut diberi penangguhan penahanan termasuk dokter J. Kasat Rerskrim Polresta Medan Kompol Fadillah Zulkarnaen yang dikonfirmasi Waspada di ruang kerjanya mengatakan, belum mengetahui perkembangan kasus aborsi tersebut. Sebab, seluruh pejabat yang menangani kasus itu sudah dimutasi. “Nanti akan saya cek dulu kasus aborsi itu,” jelasnya. Tidak ada Sementara itu, informasi yang diperoleh Waspada di lapangan, selama 2010 pihak Pengadilan Negeri Medan tidak

pernah menyidangkan kasus aborsi yang ditangani Polresta Medan. Seorang pegawai bidang penerimaan pelimpahan berkas dari polisi ke jaksa Kejaksaan Negeri (Kejari) Medan dan Kejatisu yang dikonfirmasi Waspada, mengaku tidak ingat apakah kasus aborsi tersebut telah dilimpahkan atau tidak. Namun, pegawai itu mengakui, pihaknya tidak ada menerima pelimpahan berkas kasus aborsi dari Polresta Medan selama dua tahun terakhir. Hal yang sama juga dikatakan sumber Waspada di Kejatisu.”Seingat aku, kasus aborsi tidak ada masuk,“ katanya. Berdasarkan pantauan

Waspada di lapangan, oknum dokter J yang menjadi tersangka dalam kasus aborsi tersebut, sudah memulai aktivitasnya sejak setahun yang lalu. Ketika pertama kali kasus tersebut mencuat, oknum dokter J menghentikan segala aktivitasnya selama sebulan karena ditahan pihak kepolisian. Namun oknum dokter J mendapat fasilitas penangguhan penahanan. Bahkan, setelah satu tahun kasus aborsi tersebut ditangani pihak kepolisian, oknum dokter J tidak pernah lagi mendekam di penjara. Diduga pihak kepolisian tidak pernah melimpahkan kasus aborsi tersebut ke pengadilan. (m39/m49)

Dituduh Tidak Punya Boarding Pass Penumpang Air Asia Diturunkan MEDAN (Waspada): Pihak penerbangan AirAsia nomor penerbangan QZ-7611 menurunkan seorang penumpang bernama Ujang Sutrisno, 33, karena identitasnya tidak sesuai dengan boarding pass, Selasa (11/1). Penumpang itu sempat diproses pihak kepolisian Bandara Polonia. Petistiwa itu terjadi diduga akibatkelalaian,sehinggapenumpang itu bisa lolos dari pintu terminal dan masuk ke pesawat. Keterangan diperoleh, sesuai jadwal AirAsia itu akan terbang ke Jakarta pukul 12.00 WIB. Saat seluruh penumpang sudah naik ke pesawat, pramugari melakukan penghitungan. Ternyata seluruh penumpang yang duduk di dalam kabin berjumlah 180 orang, berbeda dengan data manifest yang berjumlah 179 orang. Hal itu baru diketahui setelah kru pesawat tiga kali melakukan penghitungan, ternyata identitas penumpang itu tidak sesuai boording pass. Peristiwa itu menyebabkan pesawat delay 1,5 jam. Masalah itu pun sempat ditangani Pj Kadin Sekurity PT Angkasa Pura II Armensyah dan Rafli Siregar, kemudian dilimpahkan ke Pos Polisi Bandara diterima Kapospol Aiptu Saut Sihombing. Dalam keterangannya,

Ujang mengaku dirinya berangkat bersama 11 temannya menuju Kalimantan via Jakarta dan transit di Surabaya. Sedangkan keberangkatannya ke Kalimantan untuk bekerja di perkebunan. Seluruh ongkos ditangani bosnya bernama Riswan.“Boarding pass saya dipegang pak Riswan. Saya pun tidak ngerti kenapa saya diturunkan dan yang lainnya sudah berangkat,” kata Ujang. Sedangkan menurut keterangan salah satu pimpinan AirAsia, Mulyana penumpang tersebut tidak memiliki boarding pass, makanya setelah tiga kali dihitung, jumlah penumpang berlebih sehingga diturunkan. Dengan penjelasan Mulyana beberapa petugas spontan menuding petugas pintu gate AirAsia telah lalai sehingga penumpang bisa lolos masuk pesawat. Hal itu membuat Mulyana berusaha mencari-cari alasan. Dengan penjelasan pihak AirAsia itu, Aiptu Saut Sihombing pun menyarankan mereka melaporkan kasus tersebut ke Polsek Medan Baru dengan dugaan kasus penyusupan ke pesawat tanpa tiket karena hal itu kata dia cukup rawan bagi keselamatan penerbangan. Di tempat lain, Riswan dan rombongannya saat tiba di Surabaya sempat ditahan untuk

ditanyai pihak AirAsia tentang pembatalan yang dialami anggotanya Ujang di Medan. Akhirnya Saut Sihombing menyarankan pihak AirAsia melaporkan kasus tersebut ke Polsek Medan Baru dengan dugaan kasus penyusupan ke pesawat. Di pihak lain beberapa agen tiket yang menyaksikan pemeriksaan itu menyarankan Ujang balik melaporkan pihak AirAsia karena telah dirugikan akibat menurunkannya dari pesawat. Di tempat terpisah, Kapolsekta Medan Baru Kompol Saptono,SH,SIK yang dikonfirmasi Waspada mengatakan, pihak AirAsia tidak ada membuat pengaduan resmi. “Kita menilai Ujang dan pihak maskapai penerbangan sama-sama sebagai pihak yang dirugikan. Karena kasus itu tidak dilaporkan secara resmi, maka Ujang dipulangkan,” ujarnya. Usai diinterogasi di Mapolsekta Medan Baru, Ujang mengatakan kepada Waspada, dia bersama 10 temannya berangkat dari Aceh Singkil menuju Medan dengan menumpang bus, Senin (10/1) malam. Setiba di Medan, Riswan selaku ketua rombongan membeli tiket di Bandara Polonia. “Kami hendak merantau ke Kalimantan mencari pekerjaan,” ungkapnya. (m32/m36)

Polisi Kirim BAP 29 Tersangka Judi Ke Kejari Medan MEDAN (Waspada): Reskrim Polresta Medan telah mengirim Berita Acara Pemeriksaan (BAP) 29 tersangka kasus judi Sam Kwan ke Kejari Medan. Sebelumnya para tersangka ditangkap dalam penggerebekan di kawasan Jln Karang Sari Medan, Sabtu (18/12) malam, sekira pukul 22:30. ”BAP 29 tersangka sudah kita kirim ke Kejari Medan. Tapi, sampai saat ini polisi masih menunggu petunjuk dari kejaksaan apakah masih ada kekurangan pada BAP atau sudah lengkap,” kata Kasat Reskrim Kompol Fadillah Zulkarnaen melaluiWakasat Reskrim AKP Ruruh saat

dikonfirmasi wartawan, Rabu (12/1). Menurut Ruruh, pihaknya masih menunggu jawaban dari kejaksaan soal BAP tersangka judi Sam Kwan tersebut. “Jika Jaksa menyatakan BAP-nya lengkap (P21), kita tinggal melengkapi segala sesuatu yang terkait dengan kasus tersebut guna penyerahan para tersangka sekaligus barang bukti lain untuk proses persidangan,” ujar Ruruh. Menurut Ruruh, ke 29 tersangka tersebut dikenakan pasal 303 subsider 303 bis yo 55, 56 KUHPidana dengan ancaman hukuman 10 tahun penjara. . Dalam penggerebekan ter-

sebut, Polresta Medan mengamankan 52 orang dari markas judi Sam Kwan di Jln Karang Sari. Setelah menjalani pemeriksaan di Polresta Medan, sebanyak 23 orang mengaku sebagai penonton dan 29 orang lainnya terbukti terlibat dalam kasus tersebut. Penggerebekan markas judi Sam Kwan ini dipimpin Kapolresta Medan Kombes Pol Tagam Sinaga, SH melibatkan tim khusus yang telah dibentuk sebelumnya. Keterlibatan Kapolresta yang terjun langsung ke Tempat Kejadian Perkara (TKP) membuahkan hasil yakni diamankannya dua bandar judi Sam Kwan. (m39)

Gara-gara Pungli, PNS Berkelahi

Waspada/Rudi Arman

Kasi Hiburan Dinas Pariwisata Ridwan Mahmud saat menjalani perawatan di RS Estomihi Jalan SM Raja, Rabu (12/1).

DUA Pegawai Negeri Sipil (PNS) di lingkungan Dinas Pariwisata dan Kebudayaan Kota Medan terlibat perkelahian di kantor tersebut. Pemicunya adalah pungutan liar (pungli) di sejumlah tempat hiburan pada malam tahun baru. Aksi main pukul dua PNS yang seharusnya menjadi panutan ini bermula dari pemberitaan media massa menyangkut pungli yang dilakukan Dinas Pariwisata dan Kebudayaan Kota Medan terhadap semua tempat hiburan malam untuk menyambut pergantian tahun. Untuk memastikan sumber berita tersebut, Kadis Pariwisata dan Kebudayaan Kota Medan Rismaria Hutabarat memanggil kedua stafnya yakni Kabid Objek Daya Tarik Wisata berinisial AH dan Kasi Hiburan Ridwan Mahmud ke ruang kerjannya, Selasa (11/1). Selama dikonfrontir keduanya membantah sebagai sumber informasi dalam berita tersebut. Bahkan aksi saling tuding berlanjut ketika Ridwan memperlihatkan SMS di ponselnya yang berisi pesan bahwa informasi itu berasal dari Kabid Daya Tarik Wisata dan disampaikan kepada wartawan. Karena tidak ada yang

mengaku sebagai sumber informasi, akhirnya Kadis Pariwisata dan Kebudayaan Kota Medan memerintahkan kedua staf tersebut keluar dari ruang kerjanya. Sebagaimana laporan Ridwan Mahmud di Polresta Medan, Selasa (11/1), AH langsung memukul wajahnya saat mereka masih berada di depan ruangan Kadis. Bahkan, kata Ridwan, saat dirinya tersungkur di lantai, AH menginjak-injak tubuh dan wajahnya. Beruntung, aksi ala preman tersebut dapat dilerai setelah Kadis dan pegawai lainnya mendengar kegaduhan tersebut. Namun akibat penganiayaan itu, Ridwan mengalami luka dan memar pada kening dan wajah. Kini kasus tersebut ditangani Polresta Medan. Minta diproses Saat ditemui di RS Estomihi Jln. SM Raja Medan, Ridwan yang mengaku jadi korban penganiayaan AH meminta Polresta Medan memproses pengaduannya. “Saya minta Polresta Medan memproses kasus ini, biar diketahui siapa yang salah dalam kejadian ini,” jelasnya. Di tempat terpisah, Kadis Kebudayaan dan Pariwisata Kota Medan Rismaria Hutabarat

ketika dikonfirmasi Waspada mengatakan, kasus tersebut merupakan persoalan pribadi dan hanya salah paham. Keduanya akan dipanggil untuk diberikan peringatan. “Hanya salah paham saja. Saya akan panggil dua-duanya untuk diselesaikan secara kekeluargaan,” katanya. Secara terpisah, Kepala Badan Kepegawaian Daerah (BKD) Kota Medan Lahum mengatakan, kasus penganiayaan yang terjadi antara dua PNS di lingkungan Dinas Kebudayaan dan Pariwisata (Disbudpar) Kota Medan ini telah melanggar Peraturan Pemerintah tentang Disiplin PNS No 53 Tahun 2010. Dalam aturan itu menjelaskan beberapa kategori pelanggaran yang disertai sanksinya. Kategori itu terdiri dari ringan, sedang dan berat. Begitu pula sanksinya, disesuaikan dengan kategori kesalahan yang dilakukan. Ada sanksi teguran hingga yang terberat berupa pencopotan. “Setiap kesalahan ada sanksinya sesuai tingkat kesalahannya. Namun saya tidak bisa menjelaskan sanksi apa yang harus diberikan kepada dua PNS itu. Ini wewenang dari kepala dinas terkait,” kata Lahum. (m39/m50)

Waspada/ist

Kadis Kesehatan Sumut dr. Candra Syafei, SpOG (tiga dari kiri) dan Ketua PMI Daerah Sumut Drs. H. Kasim Siyo (dua dari kiri) menyerahkan tenda berlogo call center 118 kepada penarik becak bermotor di pelataran parkir Masjid Raya Al-Mashun Medan, Selasa (11/1).

Alat Transportasi Tidak Memadai

Korban Kecelakaan Berisiko Meninggal Sebelum Tiba Di RS MEDAN (Waspada): Karena alat transportasi tidak memadai, banyak kasus gawat darurat seperti korban kecelakaan lalu lintas atau kecelakaan kerja berisiko meninggal dunia sebelum tiba di rumah sakit. “Selama ini, korban kecelakaan hanya diangkut ke rumah sakit dengan alat transportasi seadanya seperti becak dan mobil angkutan umum, bukan ambulans,” kata Kadis Kesehatan Sumut dr. Candra Syafei, SpOG kepada Waspada disela-sela sosialisasi Unit Pelayanan Gawat Darurat 118 di pelataran parkir Masjid Raya AlMashun Medan, Selasa (11/1). Karena alat transportasi tersebut tidak dilengkapi peralatan medis untuk pertolongan pertama, maka korban kecelakaan tersebut berisiko meninggal dunia sebelum mendapat pertolongan dokter di rumah sakit. “Berbeda dengan ambulans dari Unit Pelayanan Gawat Darurat 118 yang dilengkapi fasilitas peralatan medis sehingga korban kecelakaan tersebut bisa mendapatkan pertolongan pertama,” ujar Candra. Sampai saat ini, lanjut Candra, hanya Provinsi Sumatera Utara yang mempunyai Unit Pelayanan Gawat Darurat 118 dilengkapi dengan fasilitas ambulans, petugas kesehatan dan peralatan medis untuk pertolongan pertama.

Unit Pelayanan Gawat Darurat 118 dibiayai Pemprovsu bekerjasama dengan Palang Merah Indonesia (PMI), Jasa Raharja, kepolisian dan rumah sakit rujukan. Targetnya yakni memberi pertolongan pertama kepada korban kecelakaan lalu lintas, korban kecelakaan kerja, penderita penyakit yang bersifat emergensi, korban bencana alam dan lain-lain. Setelah itu, ambulans akan membawanya ke rumah sakit rujukan terdekat. “TujuankeberadaanUnitPelayananGawatDarurat 118 adalah meningkatkan mutu pelayanan pra rumah sakit, khususnya pelayanan ambulans atau pelayanan medis yang diberi kepada masyarakat sebelum tiba di rumah sakit,” ujar Candra. Pada kesempatan itu, Kadis Kesehatan Sumut dr. Candra Syafei, SpOG dan Ketua PMI Daerah Sumut Drs. H. Kasim Siyo menyerahkan tenda berlogo call center 118 kepada penarik becak bermotor dilanjutkan dengan konvoi keliling Kota Medan. Dengan adanya sosialisasi ini diharapkan masyarakat lebih mengenal lagi Unit Pelayanan Gawat Darurat 118 yang sudah sesuai dengan Standar Pelayanan Gawat Darurat Secara Terpadu (SPGDST). Bahkan ambulans yang digunakan untuk memberi pelayanan tersebut sudah dilengkapi fasilitas peralatan medis.(m25)


Ekonomi & Bisnis

A6

Di Plaza Millenium, Sehari Terjual 150 Unit HEBOH berbagai rencana untuk menutup layanan BlackBerry tidak sampai mempengaruhi penjualannya di Medan. Pedagang dan konsumen seperti tidak mau tahu dengan wacana pemerintah tersebut. Pantauan Waspada di pusat perbelanjaan ponsel terbesar di Medan, Plaza Millennium, Rabu (12/1), transaksi berjalan seperti biasa. Peminat BlackBerry tetap tinggi. Di pusat belanja ponsel ini ada sekira 390 toko ponsel. Kemudian ada 20 toko yang khusus menjual BlackBerry. Dari data yang dihimpun dari para pedagang mereka menjualnya bervariasi antara 6-7 unit per hari. Bahkan sehari setelah ancaman pemerintah untuk menutup layanan BlackBerry ada satu toko yang bisa menjual hingga sembilan unit satu hari. Dengan kalkulasi sederhana penjualan BlackBerry di Plaza Millennium dalam kurun waktu sehari bisa mencapai 150 unit. Hal itu dibenarkan Manager Marketing Plaza Millennium Machruzar yang dihubungi via BlackBerry Messanger, kemarin sore. Dia mengungkapkan sejauh ini tidak ada pengaruh apa pun dengan semua ancaman yang disampaikan pemerintah. Pasar bergerak apa adanya dan peminat tetap saja tak bisa dipengaruhi. Malah, menurutnya, wacana atau gertakan terhadap BlackBerry bisa saja karena ada pesanan pihak lain. Keterpurukan berbagai jenis ponsel bisa saja dijadikan alasan untuk mendongkrak pasarnya kembali dengan ’menggembosi’ BlackBerry. Atau juga karena persaingan dagang, tuturnya. Namun sejauh ini, kata Machruzar, pasar berjalan normal dan tidak bisa diintervensi. Peminat tetap saja tinggi, bahkan mereka cenderung tidak yakin akan ada pemblokiran layanan tersebut, ungkapnya. Hingga saat ini handheld tersebut terus menancapkan pasarnya di Medan. Bahkan data terakhir menunjukkan ada 500 ribu pengguna BlackBerry di daerah ini. Secara global (dunia_ pun BlackBerry belum tersaingi. Dikutip dari Forbes, saat ini BlackBerry menikmati sekitar tiga persen pasar ponsel dunia. Sementara Apple memiliki sekitar dua persen pangsa pasar. Tapi, diperkirakan keunggulan BlackBerry atas iPhone Apple akan menyusut pada awal tahun ini. Pangsa pasar Apple akan menyusul RIM tahun ini, dan Apple dan RIM

masing-masing akan memiliki 11 persen dan delapan pangsa pasar, di akhir periode peramalan Trefis. Trefis didefinisikan sebagai platform keuangan baru untuk mengetahui bagaimana pengaruh produk perusahaan pada sahamnya. Forbes yakin penjualan iPhone akhirnya akan melebihi penjualan BlackBerry. Forbes memberikan alasan Apple dengan produk-produk konsumer (Mac, iPad, Apple TV) dan jasa (iTunes, iPhone apps) membuat iPhone telepon yang lebih menarik bagi banyak konsumen dibandingkan dengan BlackBerry. Research In Motion (RIM) Kanada sendiri mengklaim telah mencetak rekor penjualan. Perusahaan yang bermarkas di Waterloo, Ontario, ini mengungkapkan telah mengapalkan 11,2 juta perangkat, atau naik dibandingkan periode tahun sebelumnya yang hanya 10,5 juta unit. Dengan hasil penjualan itu, RIM membukukan laba bersih kuartal pertama sebesar 769 juta dolar AS, naik 19,5 persen dibandingkan dengan kuartal sama tahun lalu, sementara pendapatan tumbuh 24 persen menjadi 4,24 miliar dolar AS. Hasil ini masih di bawah prediksi pendapatan RIM. Jumlah pengguna layanan BlackBerry diperkirakan bertambah 4,9 juta pelanggan selama kuartal pertama tersebut atau kira-kira sebesar jumlah penambahan pelanggan pada kuartal sebelumnya. Total pengguna layanan BlackBerry saat ini diperkirakan telah mencapai 46 juta pelanggan. Wall Street Journal melaporkan bahwa RIM sedang mengembangkan ponsel pintar layar sentuh dengan keyboard slide-out dan komputer tablet untuk pelayanan pendukung layar lebar bagi BlackBerry. Langkah tersebut kemungkinan dirancang untuk mencegah pasar BlackBerry diambil oleh iPhone dan iPad kreasi Apple serta perangkatperangkat mobile yang menggunakan sistem operasi Android milik Google. iPhone dan BlackBerry memang akan tetap bersaing. Tapi di Medan, BlackBerry-lah penguasa pasarnya. Apalagi kehadiran iPhone 4 belum menjadi acuan konsumen karenanya harganya masih bergerak di level Rp7 juta-an. Sementara BlackBerry Gemini kini hanya dijual di level Rp2 juta-an saja. Bahkan pasar BlackBerry second terus tumbuh. Sehingga di daerah ini iPhone masih perlu waktu lama untuk menjadi idola. ●

Armin Nasution

Komputer, Handphone Alami Penurunan LEMBAGA survei Accenture memprediksi daya beli konsumen terhadap ponsel dan computer akan turun sebesar 30 s/d 50 persen namun tidak halnya dengan produk-produk elektronik lainnya seperti televisi. Untuk antisipasi hasil survei tersebut lah LG Mobile Communication menerapkan tiga sistem unik didalam menggaet pasar. Yaitu unik didalam pembuatannya, produknya, dan pemasarannya. “Hal ini selain dapat mengalihkan perhatian pelanggan dari produk-produk lainnya juga akan memberikan rasa nyaman terhadapnya,” ujar Customer Service Manager PT LG Electronics Indonesia, Rully Sujarko kemarin. Pembenahan, lanjutnya, tidak hanya menyentuh pada sisi infrastruktur namun pula dilakukan dalam pemberian layanan pada pemilik handphone LG Mobile. “Jadi tidak hanya lengkap dengan sejumlah tenaga teknisi handal melainkan pelayanannya pun dilakukan secara face to face,” ujarnya. “Peningkatan jumlah konsumen harus diimbangi dengan layanan purna jual prima. Ini merupakan upaya kami untuk lebih mendekatkan layanan purna jual LG Mobile kepada konsumennya,” lanjutnya. Mobile service ctersebut, lanjutnya, dibangun di tengah-tengah pusat grosir penjualan handphone di kota-kota besar seperti Medan seperti di Millenium Plaza. Sehingga memberikan keleluasaan para pengguna handphone LG dalam mendapat layanan dari pusat layanan purna jual bagi para pemilik handphone LG Mobile di wilayah Medan dan sekitarnya. “Tak hanya bicara keleluasaan, berbagai kelengkapan dan pembenahan pun dilakukan dalam LG Mobile service center ini yang tujuannya untuk memberikan kenyamanan kepada tiap pengunjung. Disamping ruang tunggu nyaman, pengunjung LG Mobile Service Center inipun dapat menikmati berbagai hiburan di dalamnya,” ujarnya. Diantaranya, lanjutnya, pengunjung dapat menjelajah dunia maya selama kunjungannya di pusat layanan purna jual LG Mobile ini. Hal ini dapat dilakukan dengan memanfaatkan perangkat computer yang terkoneksi internet di free internet zone ataupun melalui sambungan internet nirkabel dengan adanya WiFi. Bahkan, LG Mobile Service Center ini juga menyediakan layanan pengisian baterai cuma-cuma bagi pengguna LG yang membutuhkannya. “Kami ingin menjauhkan kesan membosankan berada di service center ini. Jadi sembari konsumen mendapatkan layanan atas handphonenya, mereka juga dapat melakukan aktivitas yang menyenangkan,” ujar Rully Sujarko kembali.

Pengurus Asosiasi Pengusaha Komputer Indonesia (Apkomindo) Lukman menyatakan minat masyarakat terhadap IT sedikit mengalami penurunan pada awal tahun karena berbagai faktor seperti Imlek, inflasi, dan lainnya. “Untuk sementara ini harga-harga IT ada sedikit naik tapi bukan masalah inflasi melainkan menguatnya dolar terhadap rupiah,” ujarnya. Begitupun, lanjutnya, inflasi yang terjadi berpengaruh terhadap angka penjualan. “Kita harap dengan bekerjasama dengan berbagai fasilitas kredit hal ini akan membantu pelanggan untuk memilih produkproduk tersebut. Hal itu juga diakui Pengurus Asosiasi Forum Komunikasi Pengusaha Komputer Medan (Fomikom) Edyson menyatakan prediksi dari Accenture menimbulkan pertanyaan baru apakah dalam jangka panjang, PC desktop dan laptop di rumah akan semakin tergantikan? “Namun untuk saat ini pemakai PC desktop adalah tempat-tempat pendidikan ataupun sekolah-sekolah dan sekarang ini banyak tempat pendidikan yang belum lengkap fasilitas komputernya,” ujarnya kembali. Dalam hal ini, lanjutnya, pasar untuk PC desktop di Asia khususnya Indonesia sepertinya masih sangat memungkinkan naik sebesar 25 s/d 30 persen begitupula dengan notebook. “Mungkin secara garis besar sesuai dengan prediksi Accenture adalah masyarakat Eropa,” ujarnya kembali. “Jika diukur dari tingkat pertumbuhan, pasar PC akan terus lesu dan merosot secara global atau dunia. Ada potensi di mana era PC di rumah akan berakhir, tidak lagi seperti yang dilihat sekarang ini,” tuturnya. Sedangkan di Indonesia, lanjutnya, seperti Medan maupun daerah sekitarnya, hal ini memerlukan jangka panjang tidak secepat apa yang diperkirakan Accenture memungkinkan perangkat alternatif seperti komputer tablet, netbook, smartphone, dan perangkat pembaca e-book akan semakin besar. “Untuk itu kita akan berusaha untuk meningkatkan market share untuk produkproduk computer PC ataupun notebook dengan harga yang lebih minimalis agar dapat terjangkau oleh kalangan pelajar,” lanjutnya. Edyson mengakui untuk trend 2011 sepertinya masih dipengaruhi oleh produsenproduk elektronik dengan modifikasi dan desain yang sangat menarik pelanggannya. “Yang pastinya kita akan menggelar Expo agar hal ini dapat diketahui khalayak untuk memilih sesuai dengan gaya hidup mereka dengan fasilitas-fasilitas yang memuaskan,” lanjutnya kembali. ● Hamzah

WASPADA Kamis 13 Januari 2011

Blackberry Belum Terkalahkan Di Pasar KEINGINAN Menkominfo Tiffatul Sembiring untuk memblokir BlackBerry di Indonesia pada akhirnya reda. Sebab tuntutan pemerintah kepada RIM (research in motion) yang memiliki lisensi sendiri pada handheld tersebut memenuhi keinginan menteri. Awalnya memang sempat terjadi pro kontra. Karena tidak mau ikut membantu pemerintah memblok situs porno, Menkominfo akhirnya berkeputusan untuk menutup layanan tersebut. Niat Menkominfo pada dasarnya bagus. Untuk mengatasi persebaran pornografi lebih mudah. Memang bukan karena semata-mata BlackBerry yang menjadi penyebar akses porno tetapi Menkominfo berfikiran dengan menutup banyak jalan kepada pengakses paling tidak sudah membantu pemerintah mengatasi hal-hal berbau porno. Sebelumnya pun pemerintah sudah sempat menuntut perusahaan asal Kanada itu agar membuka service center di Indonesia. Masih lewat ancaman baru mereka mau memenuhinya. Akhirnya tuntutan pemerintah memang dipenuhi RIM.Baik soal memblok pornografi dan service center sudah ada deal. Pantauan Waspada di berbagai pusat perbelanjaan di Medan, Rabu (12/1), penjualan BlackBerry tetap saja tinggi. Terutama di Sun Plaza, Deli Plaza lantai I dan Medan Fair Plaza. Menurut Darwin, salah satu penjual handheld tersebut, walau sempat ada isu pemblokiran BlackBerry tapi pembelinya tetap saja ramai.

BLACKBERRY: Walau diterpa polemik bakal diblokir namun di Medan peminatnya tetap saja tinggi. Apalagi saat ini berbagai kemudahan ditawarkan bank. Termasuk misalnya dengan cicilan tetap, kata dia. Menurutnya, penjualan BlackBerry sudah mengalahkan ponsel merek lain. Belum ada merek ponsel yang sampai sekarang bisa menyaingi besutan RIM tersebut, ujarnya. Hal senada juga diungkapkan Ati, penjual ponsel di kawasan Jl. Thamrin. Setelah lebih dari 10 tahun berbisnis ponsel berbagai merek akhirnya dia mengaku harus mengikuti trend. “Dua tahun lalu saya paling cepat mengupgrade berbagai program ponsel merek terkenal. Namun sekarang saya harus beralih ke BlackBerry. Sebagai

penjual ponsel kita memang harus ikut trend,” ujarnya. Bahkan sampai kini konsumennya sudah dominan memakai BlackBerry dibanding yang lain, ujarnya. “Semua software tetap ada. Tapi biasanya pengguna BlackBerry yang lebih dominan,” ungkapnya. Ati mengatakan kalau dilihat dari sisi penjualan BlackBerry termurah dengan kondisi baru masih dijual Rp2,2 juta sampai Rp2,4 juta. Di samping itu ada pula yang ditawarkan dengan harga tinggi. Malah dia mengulas sedikit harga BlackBerry Torch yang sudah memasuki OS (versi) 6. Saat model ini dipasarkan di Medan sekira dua bulan lalu, harganya seperti emas. Kadang

naik tinggi, tiba-tiba sudah jatuh dipermainkan pasar, ungkapnya. Dia menceritakan pengalaman salah satu pembeli yang m e n e b u s To rc h s e h a rg a Rp6,450 juta. Saat itu, kata Ati, terjadi kekosongan barang di Medan. Hanya ada satu toko yang menjual Torch hanya dengan garansi toko bukan garansi RIM. Harganya semahal itu, ujarnya. Namun seminggu kemudian ketika barang sudah tersedia harga turun menjadi Rp6,150 juta. Dan sudah pasti garansi RIM, ungkapnya. Perlahan-lahan BlackBerry versi terbaru itu pun terus mengalami penurunan harga. Bahkan kini sudah berada

Waspada/Surya Efendi

di level Rp5,5 juta saja. Bayangkan bagaimana kecewanya mereka yang sudah membeli lebih dulu di harga tinggi, ungkap Ati. Di bursa ponsel bekas pun BlackBerry tetap menjadi yang terlaris. Apalagi saat ini untuk memindahkan BlackBerry dari satu operator ke operator lain tinggal meng-OFF kan layanan. Setelah itu register dengan operator baru. Dulu konsumen harus mendatangi service center operator tapi sekarang tidak lagi. Dua penjual ponsel itu yakin ke depan penjualan BlackBerry akan tetap tinggi walau banyak kontroversi yang dilontarkan para pembuat kebijakan. ● Armin Nasution

Barang Elektronik Rumah Tangga Terus Tumbuh Hingga 15 Persen TIBA-TIBA, kijang berhenti di depan pintu ruko bercat keputihan di hiasi warna keabuabuan yang ditutupi pamplet iklan pusat produk-produk elektronik di kawasan Jl Asia, Rabu (12/1) siang itu. Petugas parkir langsung menghampirinya kemudian mengarahkan agar tidak mengganggu pengguna jalan yang melintasi kawasan tersebut. Kijang berwarna kemerahan itu tidak hanya sendiri, banyak mobil lain parkir dipinggir jalan tersebut. Hitungan menit, pengendara kijang langsung menuju ke ruko dan melihat produk elektronik dengan berbagai merek dan varian-varian yang tersedia, tidak hanya televisi, kulkas, AC, radio, tape, dan lain sebagainya. Di salah satu sudut ruko tersebut, Asun sedang menulis beberapa bon pesanan para pelangganya yang berada di luar daerah, mereka bukanlah masyarakat umum lainnya melainkan pedagang yang mengambil produk-produknya dari toko Asun tersebut. Pelanggan itu pun melihatlihat produk-produk yang ditawarkan Asun kemudian bertanya harga dan tahun pembuatannya. Ya tak ayal para petugas menerangkan dengan seksama produk-produk tersebut dengan keunggulan masing-masing. Sawal, nama pelanggan tersebut berasal dari Deliserdang dirinya menginginkan beberapa peralatan elektronik rumah tangga seperti televisi, kulkas dan air conditioner (AC) yang merupakan permintaan pelanggannya. “Ya tidak memiliki toko, namun beberapa masyarakat yang ada di daerah Deliserdang seperti Petumbukan meminta saya untuk menyediakan produk-produk ini. Dan saya memberikan keringan kepada mereka untuk mengangsurnya,” ujarnya. Menurut dia, kedatangannya ke toko tersebut merupakan langganan biasa tempat me-

Waspada/Surya Efendi

LAPTOP: Pangsa pasar laptop di Medan kian semarak. Produsen pun menawarkan berbagai trik untuk memasarkan barangnya agar bisa diminati konsumen. ngambil produk-produk elektronik dari sana. “Ya selain karena pelanggan tetap juga untuk dijual kembali harga lebih miring dari pada resminya,” lanjutnya. “Sepertinya beberapa pelanggan atau masyarakat sudah beralih ke pada televisi flat kebanyakan mereka tidak lain untuk diusahakan kembali seperti rental playstation. Sedangkan plasma seperti belum ada permintaan,” ujar Sawal kembali. Asun mengakui pada 2011 diramalkan industri elektronik masih tetap tumbuh sebesar 15 persen meski terjadi inflasi yang cukup tinggi akibat kenaikan bahan makanan seperti beras, cabai, dan lainnya. “Namun trend pasar yang masih bergerak adalah produk-

produk kebutuhan rumah tangga atau pasar domestik, karena kebanyakan setiap keluarga setidaknya minimal memiliki satu unit televisi, kipas angin, rice cooker, dan lainnya,” ujarnya. Sedangkan untuk high and, lanjutnya, sepertinya hanya kalangan tertentu saja meski pun hal ini juga akan dicari pelanggan-pelanggan kita khususnya di daerah per kotaan seperti Medan. “Beberapa pelanggan kita dari daerah seperti Stabat, Binjai, Tebingtinggi, Lubukpakam banyak mengambil produk-produk dari kita dengan merek yang beraneka macam seperti Samsung, LG, Toshiba, dan lain sebagainya,” ujar distributor elektronik tersebut. Begitupun, lanjutnya, soal

harga sepertinya tidak ada berubah setiap tahunnya hanya jika masuk produk-produk yang baru, otomatis harga produk yang lama akan turun dengan sendirinya sehingga hal ini sangat menguntungkan pelanggan. “Hanya saja tidak semuanya toko ataupun distributor menyediakan produk-produk lama karena memungkinkan jika terjadinya kerusakan tidak ada garansi melainkan hanya diperbaiki saja, sedangkan produk baru memungkinkan garansi ganti yang baru pula,” lanjutnya kembali. Namun dirinya juga tidak memungkiri bahwa kebutuhan pasar domestik masih didominasi oleh produk-produk elektronik impor bahkan China hampir memasuki segala lini

produk-produk elektronik tersebut tidak hanya televisi, kulkas, rice cooker, kipas angin, bahkan varian-varian lainnya. “Masuknya barang dari China memberikan pilihan terhadap masyarakat terhadap produk-produk yang beredar di pasar memilih harga yang murah apa yang bergaransi dengan merek yang terkenal,” lanjut Asun. Begitupun, lanjutnya, tidak semua produk impor tersebut kebal terhadap serangan varian dari China hal ini ditunjukkan semakin menjamurnya produk-produk dari negra tersebut tidak hanya elektronik melainkan komputer, handphone, dan mainan anak-anak.

● Hamzah


Nusantara

WASPADA Kamis 13 Januari 2011

Pantai Kuta Bali tempat utama para wisatawan berselancar.

Perbandingan Bali Dengan Danau Toba

Waspada/andy yanto aritonang

DANAU Toba salah satu danau terbesar di dunia yang memiliki keindahan alam sangat menakjubkan, dan bahkan lebih indah dibandingkan dengan danau yang ada di Swiss. Tetapi, kenapa pariwisata Danau Toba ini tidak mengalami kemajuan bahkan dari tahun ke tahun makin terpuruk? Apa sih hebatnya Bali dibanding DanauToba.? Pertanyaan yang memprihatinkan itu pantas dilontarkan.Pasalnya Danau Toba

dengan keindahan alam yang membuat para wisatawan terkagum-kagum makin melorot, bahkan posisi sebagai Daerah Tujuan Wisata (DTW) Nomor tiga setelah Bali dan Yogya sudah bergeser. Lontarkan kata wonderful.... woderful ..... oleh wisatawan Belanda mengambarkan keindahan alam Danau Toba hanya jadi kenangan, sebab sudah digantikan kata-kata sayonara.... sayonara........ !!!!!.

Jangan meninggalkan dunia dulu sebelum melihat Danau Toba, juga hanya sebuah kata kiasan yang sudah tak relevan lagi. Padahal, di samping memberikan keindahan alam bagai ‘sorga dunia’, Danau Toba yang terletak pada ketinggian 9.03,7 meter dari permukaan laut, juga memberikan kontribusi tenaga listrik yang dahsyat. Namun, tidak dapat disangkal, kepariwisatawan Danau Toba yang menjadi aset pariwi-

sata yang sangat mengagumkan dan memberikan devisa cukup besar, terpuruk dalam kesedihan. Ketertinggalan sebagai daerah tujuan wisata dibanding dengan Bali merupakan bukti ketidakseriusan seluruh elememan masyarakat, khususnya pemerintah untuk membenahi, dan membangun Danau Toba. Kita hanya menjual keindahan alamnya , sedangkan sarana maupun prasarana di kawasan DanauTobakurangdiperhatikan. Tidak adanya pembenahan, membuat kepariwisatawan Danau Toba monoton, sehingga seorang wisatawan yang sudah pernah ke DanauToba dan ingin kembali berkunjung akan merasa bosan dan tidak betah tinggal lama. Akibatnya, masa waktu tinggal wisatawan yang relatif singkat, jelas menjadi kerugian yang besar, karena uang yang dibawa si wisatawan tak banyak dihabiskan di Danau Toba. Harus diakui pula, berbagai masalah menyelimuti pembenahan Danau Toba, antara lain menyangkut masalah mutu jalan , penertiban pem-bangunan di pinggiran pantai Danau Toba, tidak adanya atraksi budaya, sarana transportasi darat dan danau, bahkan juga terkait

Soal Gayus

Anggota Komisi III Minta Mantan Kapolri Dihadirkan JAKARTA (Waspada): Pernyataan mantan Kapolri Jenderal Bambang Hendarso Danuri (BHD) kepada Ketua Komisi III, Benny Kabur Harman, menimbulkan kecurigaan di kalangan anggota Komisi III DPR. Anggota Komisi III dari Fraksi Gerindra Martin Hutabarat, merasa perlu mengetahui kebenaran pernyataan BHD itu. “Saya akan rekomendasikan ke Komisi III agar BHD dipanggil,” ujar Martin di gedung DPR, Jakarta, Selasa (11/1). Menurut Martin, pemanggilan BHD lebih penting daripada pemanggilan Gayus Tambunan ke DPR. Sebab, pemanggilan Gayus justru menunjukkan intervensi Komisi III terhadap penegakan hukum. “Sebenarnya, kita mau saja memanggil tapi buat apa. Lebih

baik kita panggil BHD saja,” tandasnya. Kecurigaan Martin akan disampaikannya dalam rapat internal Komisi III yang digelar Rabu, (12/1). Ia berharap rekanrekan sekomisinya setuju BHD dihadirkan. Sementara anggota Komisi III DPR kecewa dengan kinerja petugas imigrasi sehingga Gayus Tambunan dapat keluar negeri dengan mempergunakan paspor atas nama Sony Laksono. Untuk itu, Komisi hukum yang mengadakan inspeksi mendadak di ruang pemeriksaan paspor Terminal II Bandara Soekarno Hatta meminta pihak Imigrasi untuk melakukan penyelidikan internal terkait lolosnya Gayus Tambunan ke luar negeri dan selanjutnya melaporkan secara tertulis dalam waktu secepatnya. Anggota DPR Ahmad Yani

mempertanyakan proses pembuatan paspor yang mengizinkan foto identitas mempergunakan kaca mata dan wig (rambut palsu). Menurutnya telah terjadi kejahatan yang sistematis terhadap dokumen negara. Kepala Kantor Imigrasi Bandara Soekarno-Hatta Dirman Sukardi mengakui kelalain petugas imigrasi bandara, Dia mengatakan saat dilakukan pemerikasaan paspor yang dikeluarkan kantor imigrasi Jakarta Timur atas nama Sony Laksono telah ada sinyal kuning, yang berarti paspor ini bermasalah, namun petugas tidak mengecek ulang. PLH Dirjen Imigrasi Erwin Ajis juga mengakui kesalahan yang dilakukan petugas imigrasi, petugas yang bertugas pada saat itu sedang dalam pemeriksaan tim Kementerian Hukum dan HAM.(aya)

Kontraktor Bermasalah Tidak Boleh Ikut Bangun Gedung Baru JAKARTA (Waspada): Koordinator Forum Masyarakat Peduli Parlemen Indonesia (Formappi) Sebastian Salang meminta pimpinan DPR untuk menseleksi kontraktor-kontraktor utama maupun sub kontraktor yang ingin ikut serta dalam pelaksanaan pembangunan Gedung DPR baru. “Kita harapkan pimpinan DPR dapat mengeluarkan larangan agar kontraktor-kontraktor yang selama ini bermasalah dalam mengerjakan proyekproyek di DPR untuk tidak lagi disertakan. Kalau hal ini tidak dilakukan maka keraguan masyarakat bahwa ada apa-apanya dalam setiap pengerjaan proyek di DPR selama ini akan semakin menguat,” ujar Salang di Jakarta, Senin (10/1). Agar ada efek jera kepada para kontraktor , katanya, untuk mengerjakan dengan sungguhsungguh apa yang menjadi tanggungjawabnya. “Kita tahu bahwa banyak

A7

proyek di DPR itu bermasalah. Seperti proyek renovasi perumahan DPR itu banyak masalah, selain keterlambatan, juga aspek bangunan dan hasil yang dikerjakan pun tidak sesuai dengan perjanjian. Namun para kontraktor ini tetap bisa leluasa, padahal negara jelas-jelas dirugikan oleh ulah para kontraktor ini. Bukan hanya negara dirugikan akibat harus membayar biaya sewa tambahan bagi anggota DPR, juga karena usia pakai rumah tersebut tidak sesuai dengan yang diharapkan,” jelasnya. Koordinator Advokasi Forum Indonesia untuk Transparansi Anggaran (Fitra) Uchok Sky Khadafi mengatakan selalu lolosnya kontraktor-kontraktor bermasalah di DPR tidak lepas dari permainan antara kontraktor, calon dan pihak kesekjenan. Selain itu dirinya juga mempertanyakan penalty yang tidak pernah dibebankan kepada para kontraktor itu. Padahal

kontraktor utama selalu menjatuhkan penalty pada sub kontraktor jika telah mengerjakan kewajibannya. “Nah kalau kontraktor utamanya telat mematuhi perjanjian selama ini tidak pernah terlihat kan penalty mereka bayarkan, padahal mereka pasti membebankan penalty pada sub kontraktornya,” tegasnya. Khadafi menyatakan terdapat indikasi ‘mark up’ dalam proyek itu. Caranya dengan melakukan subkontrak dua kali. Padahal, Pasal 32 ayat (3) Keputusan Presiden No 80 Tahun 2003 tentang Pedoman Pelaksanaan Pengadaan Barang/Jasa Pemerintah menegaskan bahwa pemenang tender dilarang melakukan subkontrak kepada perusahaan lain. Pembangunan renovasi rumah sendiri selama ini dianggap janggal. Salah satu keanehan adalah adanya pembagian dana APBN sebesar Rp445 miliar kepada sembilan subkontraktor. (aya)

Infrastruktur Jadi Masalah Utama Di Sumut JAKARTA (Waspada): Wakil Ketua Komisi VI DPR RI yang juga wakil rakyat dari daerah pemilihan Sumut 1 Ir Nurdin Tampubolon mengakui masalah infrastruktur masih masalah utama di Sumut. Pernyataan itu disampaikan Nurdin setelah melakukan reses di Sumut. Menurutnya, meski masalah infrastruktur di Sumut ini selalu disampaikan ke pemerintah dalam kesempatan rapat kerja di komisi, namun masih tidak ada perubahan signifikan. Infrastruktur yang disebut Nurdin, bukan hanya mengenai jalan, tapi juga jembatan, irigasi, air bersih, dan sarana infrastruktur lainnya yang masih belum menggembirakan dan dinikmati oleh masyarakat.(aya)

sadar wisata. Salah satu contoh ketidakseriusan adalah pembendahan perairan Danau Toba, dimana munculnya jaring apung yang tidak teratur, bahkan bangunanbangunan banyak hingga menjulur ke dalam danau. Padahal, Pemerintah Daerah Provinsi Sumatera Utara memiliki Peraturan Daerah (Perda) No 1 Tahun 1990 yang melarang mendirikan bangunan berbentuk apa pun di sepanjang pantai Danau Toba, dengan ketentuan 100 meter dari pantai yang landai dan 50 meter dari lokasi yang terjal.Tingkat kesadaran wisata para pelaku pariwisata di Danau Toba juga belum menggembirakan, terutama di bidang pelayanan. Seluruh elemen harus sadar, kekecewaan yang dialami wisatawan akan pelayanan, pasti berdampak negatif. Artinya, si wisatawan akan menceritakan kepada teman-temannya apa yang dialaminya. Jika dia sudah cerita, maka salah satu promosi yang cukup ampuh adalahceritadarimulut-kemulut. Keprihatinan yang ditandai anjloknya kunjungan wisatawan ke Danau Toba, kita harapkan jangan membuat pemerin-

Salah satu sisi keindahan alam Danau Toba dari bukit Motung-Ajibata

Waspada/andy yanto aritonang

tah dan pelaku pariwisata di daerah itu berpangku tangan saja. Tetapi, dengan situasi keprihatinan ini, pemerintah dan para pelaku pariwisata harus bercermin dan merenung apa yang sudah diberikan Danau Toba. Secara khusus, Pemerintah Daerah 7 kabupaten yang ikut memiliki akses ke Danau Toba, yaitu Kabupaten Samosir, Tobasa, Tapanuli Utara, Humbang Hasundutan (Humbahas), Dairi, Karo dan Simalungun di-

harapkan bekerja sama dengan baik dalam mengembangkan pariwisata Danau Toba. Sedangkan untuk meningkatkan sadar wisata di kalangan pelaku pariwisata Danau Toba, dinas pariwisata harus menjadikan sebagai prioritas. Jangan lagi ada kesan dinas pariwisata hanya berpangku tangan dan jangan sampai ada pelaku pariwisata yang tidak kenal kepala dinas pariwisatanya. Sikap kepedulian kita selama

ini lebih banyak kata daripada karya, harus diubah menjadi lebih banyak karya daripada kata. Jika sudah lebih banyak karya daripada kata, maka pertanyaan Apa Sih Hebatnya Bali Dibanding Danau Toba? tidak akan pernah terjawab dengan sempurna . Sebaliknya, pariwisata Danau Toba terus menjadi gadis pinggitan yang merintih minta didandani. (andy yanto aritonang)

Tol Medan-Lubuk Pakam-Kualanamu Terbentur Perpres No.13 JAKARTA (Waspada): KepalaBadanPengaturjalanTol(BPJT) Ahmad Ghani Gazali mengatakan, proyek pembangunan jalan tol Medan-Lubuk Pakam-Kualanamu masih terbentur dengan Perpres No.13 Tahun 2010. Dalam perpres tersebut diatur tentang syarat pembebasan 100% lahan sebelum sebuah proyek diajukan. “Hal ini tentu saja makin memperlama kinerja dari suatu proyek tertentu,” katanya di Jakarta, Rabu (12/1). Oleh karena itu, menurutnya, permasalahan ini mengharuskan Kementerian Pekerjaan Umum akan segera berkoordinasi dengan Badan Koordinasi Penanaman Modal (BKPM) untuk membicarakan revisi Perpres 13/2010 tentang pembebasan tanah. “Kita mau tender investasi, karena proyek ini merupakan show case kita pada tahun 2011 ini. Oleh karena itu kita akan segera mengusulkan ke BKPM soal revisi perpres pembebasan lahan,” ujarnya. Proyek di Sumatera Utara ini direncanakan akan dibangun jalan bebas hambatan menghubungkan medan dengan Lubuk Pakan sepanjang 36 km, dan Medan Kualanamu sepanjang 24 km. Untuk proyek ini Kemen-

Gerindra Tolak Pembangunan Gedung Baru DPR RI JAKARTA (Waspada): Partai Gerindra secara tegas menolak rencana pembangunan gedung DPR RI seperti sikapnya semula pada Oktober 2010 dan sudah disampaikan kepada pimpinan DPR RI. Karena itu pembangunan yang akan menelan biaya hingga Rp 1,3 triliun dengan 36 lantai tersebut belum dibutuhkan dan sebaiknya digunakan untuk pembangunan rumah sakit dan peningkatan kesejahteraan ekonomi rakyat yang lain. Demikian disampaikan Sekjen dan Sekretaris Fraksi Gerindra Ahmad Muzani bersama Wakil Ketua Umum DPP Gerindra Fadli Zon di Gedung DPR/MPR RI Jakarta, Selasa (11/1). Dana Rp 1,3 triliun tersebut akan dikeluarkan secara bertahap dari APBN 2010 sebesar Rp 50 miliar, APBN 2011 Rp 800 miliar dan sisanya APBN 2012. Jika dihitung rata-rata satu ruangan Rp 2,2 miliar. Padahal menurut Fadli Zon, kalau dikonversikan dengan kepentingan rakyat, total dana pembangunan gedung baru DPR dialihkan untuk tambahan dana jaminan kesehatan masyarakat (Jamkesmas) untuk lebih 22 juta rakyat miskin, selama satu tahun maka alokasi dana Jamkesmas naik 100 persen dari alokasi dana bantuan iuran Jamkesmas yang ditetapkan sebesar Rp 6.000 per bulan atau Rp 72.000 per tahun untuk satu warga. Sementara jika dialihkan untuk pembangunan gedung sekolah baru dengan standar biaya pembangunan untuk gedung sekolah perlokal Rp 50 juta/ruang kelas. Sehingga anggaran pembangunan gedung dewan tersebut bisa membangun 12.000 gedung sekolah. “Kalau dialihkan untuk pembangunan perumahan sederhana tipe 21 dengan biaya Rp 60 juta per unit, maka akan terbangun 22 ribu rumah baru bagi 22 ribu kepala keluarga,”ujar Fadli.(j07)

terian PU telah menggandeng beberapa kontraktor dari China. Meski demikian pihaknya tetap akan melihat kelanjutan koordinasi dengan BKPM tersebut. Walaupun dirinya juga tidak menolak bila ke depan tetap harus melakukan amanat dari

Perpres 13 tersebut. “Kalau mau cepat kita ajukan revisi Perpres 13 melalui BKPM. Namun akan lebih baik jika kita bebaskan 100%,” jelasnya. Karena itu Kementerian PU akan melakukan tender investasi proyek pembangunan jalan

segitiga di Medan pada 2011 ini. Meskipun diakui, hingga saat ini belum ada peserta tender yang terang-terangan mengajukan diri. “Hingga saat ini masih belum ada pihak yang berani ngomong, meski sudah kami informasikan,” tutur Ghani. (j03)

Laporan ke: 40

DOMPET PEDULI UMMAT WASPADA Setiap sedeqah yang kita salurkan di jalan Allah akan menjadikan pelindung kita dari api neraka. Salurkan Zakat, Infaq dan Shadaqah Anda ke lembaga yang Amanah, Profesional & Transparan Transfer via bank, AC. Peduli Ummat Waspada

Infak/Sedekah BMI 211.00044.15 BSM 006.0008321 BNI 005.7504808 Bank Sumut 100.02.04.034144.5

Zakat BMI 211.00002.15 BSM 006.0022407 BCA 022.1750828 BNI Syariah 0092687629 Bank Mandiri 106.0002203803

ZIS terpublikasi 1 Januari 2010 s/d laporan 39

Rp733.411.667

ZIS

ZIS

2374. Ir. H. Baginda M.A Pulungan, MM Rp 1.250.000 2375. Ir. Hj. Nurmala Dewi Hasibuan, MM Rp 1.000.000 2376. Ir. M. Dedy Pratopo Rp 600.000 2377. H. Effendi Nasution Rp 500.000 2378. Ir. Eddy Usman Rp 500.000 2379. Ir. Riswan Effendi Siregar Rp 400.000 2380. drg. H. Syaiful Anwar Nasution Rp 400.000 2381. Syahruddin Ali, SH Rp 400.000 2382. Syahrul A. Siregar Rp 300.000 2383. Ir. Ilyas Armein Pane Rp 200.000 2384. Drs. H. Abdul Hadi Nasution Rp 200.000 2385. A. Rahim Purba, SE Rp 200.000 2386. H. Buana Ginting, SH Rp 200.000 2387. Ir. Rasyid Dian Rp 200.000 2388. Ir. Elfi Diana Lubis Rp 200.000 2389. Ir. H. Hobol Mulia Siregar Rp 200.000 2390. Taufiq Qurrachman Rp 200.000 2391. Mili Mahardhika, SE Rp 200.000 2392. Haris Muda Siregar Rp 200.000 2393. Dr. Mazrisyaf Muaz Rp 200.000 2394. Ir. Andi Wibisono Rp 200.000 2395. Drs. Muhtadin Harahap, SmH Rp 200.000 2396. Siti Indriani K Rp 150.000 2397. Ir. Eka Priari Rp 150.000 2398. RM. Widyawan HNKP, ST Rp 120.000 2399. Ir. H. Makmur Rp 100.000 2400. Ir. Muchlis Murad Rp 100.000 2401. Ir. Ahmad Sulaiman Lubis Rp 100.000

2402. Ir. Asral Tanjung Rp 100.000 2403. Swelli Sholihah Nasution, SP Rp 100.000 2404. Mhd. Ihsan Rangkuti, SE, Ak Rp 100.000 2405. Ir. Mohd. Syafii Batubara Rp 100.000 2406. Ir. Erwin Zulkarnain Hasibuan Rp 100.000 2407. Wispramono Budiman, SE Rp 100.000 2408. Ir. Hidayat Darpo, MM Rp 100.000 2409. Andry Sally, SP Rp 100.000 2410. Surya Brata, MCP, SE Rp 100.000 2411. Dra. Indah Triharyani Rp 100.000 2412. Andriansyah, SE Rp 100.000 2413. Suharso Rp 100.000 2414. Ir. Indra Azhari Rp 100.000 2415. Ir. H. Sriyono Susilo Rp 100.000 2416. Ir. Amrin Pane Rp 100.000 2417. Ir. Nasrul Rp 100.000 2418. Siman Rp 100.000 2419. Rudi Hartono, SH Rp 100.000 2420. Farida Jayasumarta, SE Rp 100.000 2421. Rohana Sinaga, SE Rp 100.000 2422. M. Asri Rambe Rp 100.000 2423. Ir. Mazriefnal Muaz Rp 100.000 2424. Ir. Ima Sulastri Rp 100.000 2425. Drs. Edi Syahputra Rp 100.000 2426. Erwin Syafii Siregar, SE Rp 100.000 2427. M. Ridho Nasution Rp 100.000 2428. Hamba Allah Rp 50.000 2429. M. Edward Samudra, ST Rp 50.000

Rp 8.670.000

Jumlah laporan ke: 40

Rp 11.370.000

PENYALURAN DANA BULAN SEPTEMBER 2010 NO

KETERANGAN

JUMLAH

1. Bantuan Safari Ramadhan 1431 H untuk Waspada Green Club 2. Penyaluran zakat khusus untuk anak Panti Asuhan Arso X Papua 3. Penyaluran zakat fitrah untuk Panitia ZIS Masjid Jami’ Aur 4. Penyaluran zakat khusus untuk warga Lingk. VIII Kelurahan Tanjung Sari 5. Bantuan pangan untuk Tonggi Gultom, Jl. Harapan Pasti Timur No. 56 Medan 6. Bantuan pendidikan untuk Devi Agustina, Jl. Beo Gg. Rahim No. 18 Medan 7. Bantuan dakwah untuk Panitia Pemb. Masjid H.M. Said Kec. Bonatua, Kab. Tobasa 8. Bantuan pendidikan untuk MDA Nurul Huda Nusa Indah Padangsidempuan 9. Bantuan pengobatan untuk Eko Sri Ismayanto, Lingk. VI Nelayan Indah, Medan 10. Bantuan pendidikan Rizsky Ichwan, Jl. Ar-Ridho Dsn XI Empl. Desa Bandar Klippa 11. Bantuan rutin bulan September 2010 12. Honor dai bulan September 2010 13. Honor Badan Pengurus bulan September 2010 14. Pembayaran Beasiswa Anak Pejuang 15. Program : SPUW di STM Hulu 16. Operasional bulan September 2010 Jumlah

RAYAKAN HUT KE-64 WASPADA :

Waspada/adji k

Segenap karyawan Harian Waspada perwakilan Jakarta berfoto bersama usai acara syukuran HUT ke-64 Waspada di Kantor perwakilan Jalan Siaga II, Pasar Minggu Jakarta Selatan. Dalam rangkaian HUT tersebut, para karyawan dan keluarganya akan melakukan family gathering di kawasan Puncak, Bogor, 29-30 Januari mendatang. Tujuannya untuk menjalin silaturahim, menjalin kekompakan dan meningkatkan kinerja kerja.

Rp 4.000.000 Rp 1.000.000 Rp 405.000 Rp 2.067.500 Rp 300.000 Rp 446.000 Rp 500.000 Rp 600.000 Rp 1.000.000 Rp 500.000 Rp 2.140.000 Rp 2.500.000 Rp 8.900.000 Rp 9.700.000 Rp 3.000.000 Rp 19.863.900 Rp 56.922.400

Penerimaan dan Pemanfaatan Dana

Penerimaan

Pemanfaatan

Saldo

Periode Mei 2000 s.d Desember 2008 Periode 1 Januari s.d Desember 2009

4.909.978.548 1.696.397.466

4.198.629.299 1.233.343.200

711.349.249 463.054.266

Total

6.606.376.014

5.431.972.499

1.174.403.515

Keterangan : Seluruh donatur adalah staf PTPN IV anggota Majlis Ta’lim Syiar Islam (MTSI) PTPN IV untuk pendebetan bulan Oktober dan November 2010

Hubungi Kami: Lembaga Amil Zakat Provinsi Sumatera Utara Peduli Ummat Waspada Jl. Brigjen Katamso No. 1 Medan telp. 061-4511936 - 4150858 (evi) Fax. 061-4511936 E-mail: peduliummat@waspada.co.id Khusus Kodya Medan, ZIS diatas Rp 500.000,- kami siap menjemput (4511936 - 08126375062) Keterangan : Seluruh donatur adalah staf PTPN IV anggota Majlis Ta’lim Syiar Islam (MTSI) PTPN IV untuk pendebetan bln Agst & Sept 2010

Konsultasi Zakat Bersama Ustadz M. Nuh Abdul Muis SMS: 08126526295 e-mail: peduliummat@waspada.co.id


Luar Negeri Iran: Perundingan Nuklir Pekan Depan, Peluang Akhir Bagi Barat A8

TEHERAN, Iran (Antara/Reuters): Perundinganperundingan pekan depan antara Iran dan negaranegara penting menyangkut program nuklirnya bisa merupakan ‘peluang terakhir’ bagi Barat, kata seorang pejabat senior yang dikutip kantor berita IRNA, Rabu (12/1). IRNA yang mengutip pernyataan Ali Ashghar Soltanieh, duta besar Iran untuk Badan Tenaga Atom Internasional (IAEA) yang mengatakan apabila Iran dapat membuat sendiri bahan bakarnya bagi satu reaktor riset medis, yang menurutnya akan dilakukan tahun ini, Iran mungkin tidak akan kembali ke

meja perundingan jika perundingan di Turki gagal. “Itu mungkin merupakan peluang terakhir karena dengan memasang batangan-batangan bahan bakar yang diproduksi Iran ke dalam Reaktor Riset Teheran, mungkin parlemen Iran tidak mengizinkan pemerintah berunding atau mengirim ura-

niumnya ke luar negeri dan pertemuan Istanbul kemungkinan merupakan peluang terakhir bagi Barat untuk kembali melakukan perundingan,” kata IRNA mengutip pernyataan Soltanieh kepada media Prancis. Komentar itu diucapkan seminggu sebelum Iran bertemu dengan lima anggota tetap Dewan Keamanan PBB dan Jerman di Istanbul, Turki 21-22 Januari. Negara-negara itu menginginkan jaminan bahwa Iran tidak membuat senjata nuklir. Perundingan serupa berlangsung Oktober 2009 dengan

satu perjanjian sementara bagi Iran untuk mengekspor sejumlah uraniumnya yang diperkaya dalam tingat rendah untuk ditukarkan dengan uranium yang diperkaya dalam kadar lebih tinggi 20 persen uranium, untuk reaktor Iran yang membuat isotop-isotop medis. Tetapi perjanjian itu — yang bertujuan sebagai satu tindakan membangun kepercayaan menuju pada perundingan-perundingan lebih jauh gagal ketika Iran tidak mentaati ketentuanketentuan itu, yang akhirnya Dewan Keamanan PBB menge-

nakan sanksi baru yang menurut para pengamat membantu mendesak Iran kembali ke meja perundingan. Penjabat Menteri Luar Negeri Al Akbar Salehi, Sabtu mengatakan Iran akan mampu membuat sendiri bahan bakar bagi reaktor Teheran akhir tahun ini, yang menyebabkan perjanjian pertukaran bahan bakar nuklir “tidak berarti lag. Para pengamat Barat mengatakan Iran kadang-kadang sengaja membesar-besarkan kemajuan nuklirnya untuk memproleh pengaruh dalam

konfliknya dengan Barat. “Kami menganggap pemilikan teknologi nuklir damai, khususnya pengayaan uranium untuk tujuan damai dan berada dalam pengawasan IAEA sebagai hak mutlak kami.. yang berarti kami tidak akan melepaskan teknologi nuklir damai kami.” Dewan Keamanan PBB menyerukan Iran menangguhkan pengayaan uranumnya, yang dapat memproduksi bahan bakar untuk reaktor-reaktor nuklir, dan jika diperkaya lebih tinggi dapat menjadi bahan bakar untuk membuat senjata nuklir.

Kecelakaan Jalan Raya Di China, 16 Orang Tewas

ST. PAUL, Minnesota (AP): Seorang wanita Minnesota telah melahirkan bayi perempuan tepat pada jam 1:11 Selasa (11 Januari 2011 = 11-1-11) dinihari. Amy Zeller dan Codjo Mensah menyambut gembira kelahiran putri mereka, yang diberi nama Flora Mensah, di RS United di St. Paul. Zeller memberitahu KARE-TV bahwa mereka menyaksikan jam berdetak ke arah waktu tersebut dan bayi pun lahir tepat pada momen yang paling ditunggu-tunggu itu. Bayi dan ibunya saat ini berada dalam kondisi sehat. (m10)

Banjir Di Filipina Renggut 40 Jiwa MANILA, Filipina (Antara/AFP): Banjir di Flipina yang meluas menewaskan tujuh orang lagi, menambah jumlah korban tewas akibat dua pekan hujan lebat menjadi 40 orang, kata para pejabat, Rabu (12/1). Tujuh orang tewas terjadi dalam empat hari belakangan ini ketika banjir melanda Samar, pulau terbesar ketiga negara itu, kata Badan Manajemen Penanggulangan Risiko Bencana Nasional dalam pengumuman terbarunya. Tujuh orang lain hilang setelah dibawa arus atau terkubur tanah longsor. Tentara dan personil pemerintah mengungsikan lagi penduduk di Samar dan pulau terdekat Leyte, kata pengumuman itu. Hujan lebat dimulai segera sebelum malam Tahun Baru dan menyebabkan sekitar 1,29 juta orang dari 144 kota, termasuk 338.000 orang yang meninggalkan rumah-rumah mereka atau menerima pangan atau bantuan lainnya dari pemerintah, katanya. Lebih dari 22.000 orang tinggal di tempat-tempat penampungan sementara yang dikelola pemerintah sementara menunggu air surut, dengan hampir 1.300 rumah rusak atau hancur, tambahnya. Pemerintah memperkirakan kerusakan pada jalan-jalan, jembatan jembatan dan rumah-rumah dan pertanian mencapai hampir 900 juta peso (20,29 juta dolar).

Iran Gantung 7 Pedagang Narkoba Dan Pemerkosa TEHERAN, Iran (Antara/AFP): Iran Rabu (12/1) menggantung tujuh orang yang terbukti melakukan perdagangan narkoba dan seorang yang memerkosa seorang gadis berusia belasan tahun, kata kantor berita IRNA. Pemerkosa itu digantung di penjara Evin Teheran karena menculik dan memerkosa seorang gadis berusia belasan tahun, kata laporan itu. Tujuh orang lainnya menjalani hukuman gantung di Teheran, kata laporan itu tanpa menyebutkan apakah mereka itu juga digantung di sebuah penjara atau di depan publik. Dengan pelaksanaan hukuman gantung terbaru itu maka sejauh ini sudah 28 orang dieksekusi tahun ini, kata data AFP yang mengutip laporan-laporan media. Sebagian besar mereka adalah para pedagang narkoba. Paling tidak 179 orang dieksekusi tahun 2010. Bersama dengan China, Arab Saudi dan Amerika Serikat, Iran merupakan salah satu negara yang paling banyak mengekseskui hukuman mati setiap tahun. Pembunuhan, perkosaan, perampokan bersenjata dan perdagangan narkoba dan perzinahan adalah tindakan kriminil yang dapat dihukum mati di Iran.

SEOUL, Korea Selatan (Antara/Reuters): Korea Utara mengontak Korea Selatan melalui hotline perbatasan, menurut seorang pejabat pemerintah di Seoul, dalam komunikasi langsung pertama antara dua negara tetangga itu sejak serangan mematikan Korea Utara terhadap pulau Korea Selatan, November. Pyongyang menyerukan perlunya dilakukan perundingan dengan Seoul dan mengatakan bahwa pihaknya akan membuka kembali hotline Palang Merah di desa perbatasan bersama Panmunjom serta sebuah kantor penghubung di kawasan industri yang dikelola bersama di wilayah perbatasan Utara. “Merekaberbicaradaripukul12.15sampai12.25waktusetempat, dan sambungan kini telah dibuka,” kata seorang pejabat kementerian unifikasi tanpa memberikan penjelasan lebih lanjut Selasa (11/ 1). Korea Selatan (Korsel) telah menolak tawaran Korea Utara (Korut) untuk menggelar pembicaraan yang dikatakannya tidak tulus, dan mengatakan itu hanyalah taktik seperti yang dilakukan pada masa lalu untuk mendapatkan dukungan dan bantuan keuangan. Seoul menuntut Korut mengakui dan meminta maaf atas dua kali serangan mematikan tahun lalu. Seoul berdasarkan hasil penyelidikan forum multinasional menuduh Korut telah menorpedo kapal perangnya, Cheonan, yang menewaskan 36 pelaut. Terakhir Korut melakukan serangan artileri terhadap sebuah pulau perbatasan Korsel, Yeonpyeong, di Laut Kuning yang menewaskan empat orang, termasuk dua penduduk sipil.

MIRANSHAH, Pakistan (Antara/AFP): Serangan rudal Amerika Serikat menewaskan sedikitnya tiga gerilyawan di daerah suku Waziristan Utara Pakistan pada Rabu (12/1), menurut para perwira keamanan. Rudal-rudal itu menghantam sebuah kompleks di desa Haiderkhel, sekitar 25 km di timur Miranshah, kota besar di wilayah suku Waziristan Utara yang berbatasan dengan Afghanistan, kata tiga perwira keamanan. “Pesawat tak berawak AS menembakkan dua rudal pada satu kompleks gerilyawan. Sedikitnya tiga gerilyawan tewas dan dua lainnya terluka,” kata seorang perwira senior keamanan Pakistan kepada AFP. Identitas para gerilyawan yang tewas tidak dijelaskan, namun para petugas intelijen lokal mengatakan mereka adalah “orang-orang asing”, suatu sebutan yang digunakan bagi Taliban dan gerilyawan Arab non-Pakistan yang berkaitan dengan Al Qaida serta para pejuang Asia Tengah. Daerah itu adalah kubu pertahanan komandan Taliban Hafiz Gul Bahadur. Washington mengatakan, pemusnahan ancaman gerilyawan di sabuk suku semi-otonomi Pakistan adalah penting untuk memenangkan perang sembilan tahun melawan Taliban di Afghanistan dan mengalahkan Al Qaida. Jaringan-jaringan gerilyawan di Waziristan Utara dituduh sedang meningkatkan perang sembilan tahun di Afghanistan dan para pejabat AS ingin Pakistan melancarkan serangan darat di distrik itu untuk membatasi ancaman kelompok garis keras. AS tidak mengkonfirmasikan serangan-serangan pesawat tak berawak itu, namun militernya dan Badan Intelijen Pusat (CIA) sedang beroperasi di Afghanistan dan merupakan satu-satunya pasukan yang menggelar pesawat tanpa awak di wilayah itu.

LUCKNOW, India (AP): Polisi mengatakan, suhu udara mendekati beku serta angin Himalaya menewaskan sedikitnya 13 gelandangan di bagian utara India, sehingga jumlah korban tewas akibat cuaca dingin yang menggigit bertambah jadi 129 jiwa. Suhu menurun tajam sampai 1 derajat Celsius di beberapa bagian Uttar Pradesh minggu ini, dan bahkan sampai 0,6 derajat Celsius di Agra, kota di mana Taj Mahal berada. 13 Orang tewas di Uttar Pradesh Rabu malam meski pihak penanggulangan kesejahteraan telah membagikan selimut dan kayu api, kata jubir polisi Surendra Srivastava. Sedikitnya 26 orang tewas di Bihar dan Jharkand dan di ibukota, New Delhi, selama tiga minggu dilanda angin dingin. Buruknya jarak pandang mengganggu operasi kereta api di kawasan utara India, sehingga ribuan orang terlantar. (m23)

Bayi Perempuan AS Lahir Tepat 11-1-11 Pukul 1:11

Dua Korea Lanjutkan Kontak Melalui Hotline Perbatasan

Rudal AS Tewaskan Tiga Gerilyawan Di Pakistan

13 Orang Lagi Tewas Akibat Udara Beku Di India

BEIJING, China (AP): Tabrakan antara satu mobil dan satu bus yang sarat penumpang di kawasan ChinaTengah menewaskan 16 orang dan mencederai banyak korban lainnya, demikian laporan situs pemerintah provinsi Rabu (12/1). Bus ukuran sedang itu membawa 35 penumpang, lebih dari kapasitasnya, ketika bertabrakan dengan mobil sedan di jalan raya di luar kota Xuchang Selasa malam, lapor situs Provinsi Henan itu. Polisi menemukan empat orang tewas di tempat dan lebih 12 tewas kemudian. Kantor berita Xinhua mengatakan 23 orang cedera. Belumdiketahuiapapenyebabkecelakaan.Namunkepemilikan mobil di China meningkat tajam seiring dengan meningkatnya kesejahteraan, dan kecelakaan lalu lintas biasanya akibat kenderaan kelebihan muatan dan kebiasaan buruk para pengemudi. (m23)

WASPADA Kamis 13 Januari 2011

The Associated Press

KERUSUHAN DI TUNISIA BERLANJUT. Masyarakat berkumpul di luar satu bank yang dirusak di Ettadhamoun, barat Tunis, ibukota Tunisia, Rabu (12/1), Kerusuhan dilaporkan terjadi Selasa malam di kawasan pinggiran Ettadhamoun yang terletak lima kilometer dari Tunis untuk pertama kalinya ketika aksi kekerasan menjalar ke kawasan di sekitar ibukota Tunis. PM Tunisia mengatakan Rabu, menteri dalam negeri telah dipecat setelah meletusnya aksi protes yang mengakibatkan beberapa orang tewas.

Para Pemilih Yang Berikan Suara Lewati 60 Persen Di Sudan Selatan JUBA, Sudan (AP): Lebih dari 60 persen pemilih yang terdaftar telah memberikan sua-ranya dalam satu referendum independen, yang melewati jumlah yang diperlukan bagi keabsahan pemberian suara untuk membentuk negara baru Sudan Selatan sebagai mana yang diharapkan, demikian menurut seorang pejabat selatan Rabu (12/1). Pemisahan selatan akan memecah negara terbesar di Afrika itu menjadi dua dan daerah utara merupakan kaya minyak, namun

Presiden Sudan Omar al-Bashir mengatakan dia akan membiarkan selatan memisahkan diri dengan damai. Ann Itto, seorang pejabat partai berkuasa di Sudan Selatan, Gerakan Pembebasan Rakyat Sudan (SPLM), mengatakan kepada para wartawan Rabu bahwa hampir 2,3 juta pemilih telah memasukkan surat suaranya, yang melampaui 60 persen dari pemilih yang terdaftar dan jumlah itu dibutuhkan untuk menjamin hasil referendum itu sah. Kira-kira 2 juta orang tewas

dalam perang dua dasawarsa antara Sudan Utara dan Selatan yang berakhir pada 2005 dengan tercapainya satu perjanjian damai yang memungkinkan dilakukannya referendum kemerdekaan. Pemungutan suara selama seminggu itu telah disambut gembira meski masa depan kawasan miskin di negara itu masih belum diketahui nasibnya. Kemerdekaan belum akan final sampai Juli dan banyak masalah masih belum dikerjakan, termasuk hak minyak utara-

selatan, hak air ke Nil Putih, garis demarkasi perbatasan dan status daerah yang diperebutkan, Abyei, satu kawasan yang berbatasan dengan utara dan selatan di mana ancaman paling besar akan selalu menjadi problem. Kerusuhan di kawasan yang dipertikaikan di Abyei telah menewaskan sekurang-kurangnya 30 orang di sepanjang perbatasan yang membelah utara dan selatan Sudan dalam beberapa hari terakhir ini, demikian menurut sejumlah kalangan. (m10)

Kelompok ‘Kaos Merah’ Segera Unjukrasa Kembali 23 Januari BANGKOK, Thailand (Antara/Xinhua-OANA): Front Persatuan Demokrasi Melawan Kediktatoran (UDD) atau ‘Kaos Merah’ mengumumkan Rabu (12/1) tentang unjukrasa selanjutnya di ibukota Bangkok yang dilaksanakan 23 Januari. Jurubicara UDD, Worawut Wichaidit mengatakan bahwa ‘Kaos Merah’ hari itu pertama kali akan berkumpul di persimpangan Ratchaprasong di Bangkok Pusat pada 13:00 waktu setempat sebelum pindah ke Monumen Demokrasi di jalan Ratchadamnern pukul 15:00. Unjukrasa akan berlanjut hingga tengah malam, tambah dia. Kekhawatiran terhadap kemungkinan terganggunya kegiatan ekonomi di Ratchaprasong akibat unjuk rasa ituWorawut mengatakan bahwa ‘Kaos

The Associated Press

MOGOK DI TENGAH SALJU DI JALANRAYA WINDSOR. RoyWilliams dariWestfield, Massachussets, menggali salju yang merintangi jalan di depan mobilnya di satu Jalanraya Antar Negara Bagian 91 ke arah selatan, ketika badai salju musim dingin melanda Windsor, Connecticut., Rabu (12/ 1).Williams mengatakan alat pembersih salju melintas yang menyebabkan terhambatnya jalan.

Merah’ tidak akan menggunakan banyak tempat untuk menghindari kerusakan. Para pebisnis diharapkan tidak mengirimkan surat kepada pemerintah yang memrotes barisan unjuk rasa UDD melainkan mereka seharusnya mendukung keadilan bagi‘Kaos Merah,’ kata dia yang merujuk kepada protes Selasa oleh pebisnis lokal yang kesal akibat sering terjadinya perkumpulan di tempat itu. Ketua Wanita UDD, Thida

Thavornseth mengatakan pendapatan bisnis mengkin akan terpengaruh oleh pertemuan itu namun mereka harus mengerti tentang alasan ‘Kaos Merah’ mengadakan hal tersebut. Mereka berjuang demi keadilan, kata Thida. UDD akan bekerja sama dengan polisi untuk menjaga unjuk rasa tetap berlangsung dengan aman namun tidak akan berkompromi mengenai tuntutan terhadap pemerintah, kata Thida.

Gerakan anti pemerintah itu telah mengumumkan rencananya untuk melakukan dua unjuk rasa dalam satu bulan di persimpangan Ratchaprasong yang meminta keadilan bagi mereka yang tewas pada unjuk rasa bulan April hingga Mei. Sebanyak 91 orang yang kebanyakan ‘Kaos Merah’ tewas pada bentrokan antara pasukan keamanan dan pengunjuk rasa sewaktu pertemuan kritis di Ratchaprasong.

Pangeran Harry Berharap Dapat Bergabung Dengan Tim Ke Kutub LONDON, Inggris (AP): Pangeran Harry — cucu Ratu Elizabeth II dari Inggris — berharap dapat bergabung dengan satu kelompok penyandang cacad veteran militer saat mereka berusaha berski ke Kutub Utara. Tim tersebut akan memulai perjalanan empat pekan itu, sejauh 320 km, dari Siberia menyeberang ke benua es itu Maret depan dengan bantuan dari lembaga amal Walking with the Wounded (Berjalan dengan Kaum Cedera). Harry adalah pelindung bagi lembaga tersebut, yang membantu para anggota militer pria dan wanita yang mengalami cedera serius atau kehilangan anggota tubuhnya. Kantor Pangeran Harry di Istana St. James’ mengatakan Rabu (12/1) bahwa Harry, 26, ‘akan senang bergabung dengan ekspedisi tersebut.’ Harry, yang merupakan orang ketiga dalam garis pewaris tahta Kerajaan Inggris, menjalani latihan pilot helikopter Apache di dalam korps udara tentara Kerajaan Inggris. Istana mengatakan satu keputusan mengenai keikutsertaannya akan bergantung pada jadwal latihannya.(m10)

Polisi Swiss Tangkap 10 Pemberontak Macan Tamil JENEWA, Swiss (Antara/AFP): Polisi Swiss menggerebek beberapa bangunan dan menangkap 10 pemberontak Macan Tamil, serta menuduh mereka terlibat dalam kelompok kriminal dan juga pencucian uang, kantor jaksa penuntut umum negara itu mengatakan. “Hari ini Polisi Kriminal Federal Swiss melakukan operasi yang dikoordinasikan secara nasional yang ditujukan pada perorangan Tamil dan anggota Macan Pembebasan Tamil Eelam (LTTE). Mereka dituduh, di antara kejahatan-kejahatan lain, dengan pencucian uang dan jadi anggota sebuah kelompok kriminal,” kata kantor penuntut umum itu Selasa (11/1). Sekitar 23 tempat telah digerebek di 10 wilayah, menghasilkan penangkapan-penangkapan dalam operasi yang terjadi setelah penyelidikan kriminal terhadap aktivitas Macan Tamil di Swiss. “Dalam serangkaian penyelidikan itu, dugaan bahwa, selama bertahun-tahun, orang-orang yang dituduh itu telah memaksa rekan-rekan senegara mereka untuk membantu keuangan LTTE, telah dibenarkan,” jelas kantor penuntut umum itu.

Badai Tewaskan 13 Di Brazil Dan 10 Orang Di Mozambik RIO DE JANEIRO, Brazil (Antara/PNA): Tigabelas orang tewas akibat badai yang melanda negara bagian Sao Paulo, Brasil tenggara sejak Senin siang, kata pemerintah setempat. Sempat anak kecil termasuk di antara korban itu, sementara di metro Sao Paulo sendiri tujuh orang tewas akibat banjir dan tanah longsor. Di Monica, Mozambik, Afrika, badai dahsyat juga merenggut korban 10 jiwa dan tujuh lainnya dinyatakan hilang, demikian menurut laporan televisi Mozambique TV Rabu (12/1). Menurut Departemen Pemadam Kebakaran Brazil Selasa bahwa terdapat 47 tanah longsor di kawasan metro Sao Paulo dan beberapa bagian di kawasan jalan raya utama juga dilanda banjir. Lembaga pembagian makanan terbesar di Brazil, Perusahaan Pusat Logistik Umum Sao Paulo (Ceagesp) juga terkena banjir. Pada sepuluh hari pertama Januari, badai menurunkan 221,1

milimeter curah hujan di Sao Paulo yang berjumlah 93 persen darikeseluruhandebithujanyang diperkirakan pada Januari. Badai di Monica Senin itu menghancurkan lebih dari 100 rumah dan tiang-tiang listrik, kata televisi tersebut. Tujuh di antara yang tewas adalah anggota sebuah sekte keagamaan yang sedangmenghadirisatupertemuan gereja yang terletak di bawah po-

hon besar, kata penyiar itu mengutip Conde Adriano, wali kota Chimoio, ibukota provinsi. Hujan lebat di Mozambik dan tetangga Afrika Selatan beberapa bulan terakhir telah menimbulkan kekhawatiran atas terulangnya banjir besar pada 2000 yang menewaskan sedikitnya 350 orang dan mengungsikan satu juta lainnya di Mozambik tengah dan selatan.

Bom Bunuhdiri Tewaskan Dua Petugas Di Kabul KABUL, Afghanistan (Antara/Reuters/AFP): Seorang pelaku bom bunuhdiri dengan sepeda motor menewaskan sedikitnya dua petugas keamanan Afghanistan dan melukai empat lainnya dalam satu serangan dekat parlemen negara di Kabul pada Rabu (12/1), kata seorang pejabat pemerintah Afghanistan. Serangan di ibukota Afghanistan itu ditargetkan ke sebuah bus mini yang sedang membawa pasukan keamanan Afghanis-tan, kata jurubicara Kementerian Dalam Negeri Zemari Bas-hary. Dia tidakmemberikanpenjelasanlebihdetil. Kekerasanituadalahterburuk dalam hampir sedasawarsa perang menghadapi gerilyawan yang dipimpin Taliban. Tapi serangan di ibukota Afghanistan telah relatif jarang dalam setahun terakhir, terutama sejak “cincin baja” didirikan di sekitar kota sebelum pemilihan parlemen September.

The Associated Press

MEMERIKSA VAN TERKENA BOM JALANAN. Seorang pekerja bantuan Pakistan memeriksa satu van yang rusak terkena bom jalanan di satu desa dekat Peshawar, Pakistan, Rabu (12/1). Dua bom jalanan meledak dekat van tersebut yang mengangkut anak sekolah dan para guru wanita, yang menewaskan dua orang guru, kata petugas kepolisian Tajmir Shah. Tujuh orang lainnya mengalami cedera akibat ledakan tersebut. Tidak jelas apakah van tersebut merupakan sasaran serangan itu.


Sport Seleknas Jaring 20 Pemain Tunggal

A9

WASPADA

Kamis 13 Januari 2011

JAKARTA (Antara): Seleksi Nasional yang dilaksanakan Pelatnas Bulutangkis pada 17-23 Januari akan menjaring masing-masing 10 atlet tunggal putra dan putri. “Akan diambil masing-masing 10 orang tunggal putra dan putri. Karena tunggal kita agak kekurangan materi, itu yang diprioritaskan,” ujar Ketua Subbid Pelatnas, Christian Hadinata saat ditemui di Pelatnas Cipayung, Rabu (12/1). Seleknas bagi pemain ganda, jelas Christian, akan dilakukan berikutnya. “Karena untuk sek-

tor ganda (pemain Pelatnas) sudah banyak dan cukup berpotensi,” katanya. Menurut Christian, sekitar 30 pemain tunggal putra dan putri terdiri atas pemain Pelatnas Pratama yang diikutkan seleknas kembali ditambah beberapa pemain dari luar yang dinilai berprestasi. Lima tunggal putra dan em-

Langkah Bertahap Forki Gelar Kejuaraan Dunia JAKARTA (Waspada): PB Forki berencana mengggelar Kejuaraan Dunia Karate 2015 di Pusat Pengelolaan Komplek Kemayoran Jakarta. Demikian Ketua Umum PB Forki Hendardji Supandji yang juga Direktur Utama Pusat Pengelolaan Komplek Kemayoran PPKK pada acara Coffee Morning, Rabu (12/1). ”Langkah ini akan kita lakukan bertahap dengan terlebih dahulu menggelar Kejuaraan Karate Indonesia Terbuka setiap tahun mulai 2011,” kata Hedardji. Menurut Hendardji, pada 2011 PPKK baru akan mulai membangun gedung olahraga yang memenuhi syarat untuk menggelar sebuah kejuaraan dunia dengan perkiraan pesertanya lebih dari 100 negara. Gedung olahraga itu, jelasnya, bukan hanya menjadi yang paling megah dan indah di Indonesia, tapi juga mampu menampung penonton hingga 25.000 orang. Hendardji juga menyampaikan visi dan misi baru Kemayoran yang pada puncaknya akan menjadikan kawasan itu sebagai sebuah Cyber City. Seluruh kawasan Kemayoran akan dilengkapi degan jaringan komunikasi berteknologi, sehingga aksi kriminalitas yang terjadi di sudut mana pun bisa diketahui dan direkam. Dia tambahkan, tujuan akhir dari semua program PPKK adalah untuk menciptakan kualitas warga Kemayoran menjadi manusia seutuhnya yang tentu memiliki akhlak dan budi pekerti yang baik serta sehat. (yuslan)

20 Tim Voli Pelajar Sudah Daftar Dhamawangsa Cup XVII MEDAN (Waspada): 20 Tim voli pelajar SMA negeri/swasta menyemarakkan turnamen voli Dharmawangsa Cup XVII yang digelar Universitas Dharmawangsa, 22 Januari mendatang. Demikian Ketua Panitia Bambang Hendra SPi MSi didampingi penanggungjawab kegiatan Salahuddin Has SH MA dan sekretarisnya Dra Hj Farida Hanum Nasution di Medan, Rabu (12/1). Menurut Bambang, hingga kini baru 20 tim putra/i voli pelajar SMA sudah mendaftar untuk turnamen yang bakal digelar pekan depan. Panitia mengimbau kembali kepada pelajar SMA se Sumatera Utara agar segera mendaftarkan timnya supaya bisa ikut. “Segera persiapkan regu dan mendaftarkannya di Kampus Universitas Dharmawangsa Jl. KL. Yos Sudarsno No. 224 Medan, Telp 061-6613783,” ucap Bambang. Syarat peserta, mengirimkan satu tim putra/I terdiri dari 12 pemain, menyertakan pas foto 3 x 4 dan nomor induk siswa yang disahkan kepala sekolah, foto copy rapor SMA dan ijazah SMP, membayar pendaftaran Rp125.00 dan uang WO Rp 250.000. Melalui penyelanggaraan Dharmawangsa Cup XVII, Bambang berharap, dapat melahirkan atlet-atlet voli yang mahir sekaligus menyahuti program pemerintah menumbuhkan jiwa sportivitas di kalangan siswa. Menurutnya, pertandingan rencananya akan diadakan di lapangan voli Gajah Mada setiap Sabtu dan Minggu, 22 Januari sampai 27 Februari 2011. Pemenang akan mendapatkan piala bergilir, uang pembinaan dan piala tetap, acara juga dimeriahkan dengan lucky draw setiap pertandingan. “Bagi peserta akan diberikan pemotongan uang kuliah sebagai mahasiswa baru di Universitas Dharmawangsa sebesar 50 persen dari total pembayaran uang kuliah,” jelasnya lagi. (m43)

pat tunggal putri Pelatnas Pratama di antaranya Evert Sukamta, Ary Trisnanto, Hermansyah, Bellaetrix Manuputy, Mazziyah Nadhir, akan mengikuti seleknas lagi. Sisanya adalah pemain-pemain dari luar berdasarkan prestasi antara lain dari Sirkuit Nasional dan hasil usulan pemandu bakat. Selain berdasarkan hasil pertandingan yang dilaksanakan mulai Senin (17/1), seleknas juga mempertimbangkan hasil tes kesehatan, IQ, psikologi termasuk kepribadian. Seluruh atlet tersebut akan

dipimpin pelatih asal China Li Mao yang akan menjadi penanggung jawab sektor tunggal. Hasil seleknas tersebut selanjutnya akan bergabung dengan tiga tunggal putra utama yakni Sony Dwi Kuncoro, Simon Santoso dan Dionysius Hayom Rumbaka dan empat tunggal putri, Adriyanti Firdasari, Maria Febe Kusumastuti, Linda Weni Fanetri dan Aprilia Yuswandari. Soal Li Mao yang mulai dikontrak Januari 2011 hingga dia tahun ke depan, Christian mengatakan, ia ditergetkan membawa pemain tunggal meraih medali emas Olimpiade.

Ketua Subbid Pelatnas, Christian Hadinata (tengah) bersama sejumlah pebulutangkis saat sesi latihan di Pelatnas Cipayung, Jakarta, Rabu (12/1). -Antara-

Vincent Datang Demi Seleksi Timnas U-23

Dedeh Bidik Emas Lari Gawang 100M JAKARTA (Antara): Peraih medali emas SEA Games Thailand dan Laos Dedeh Erawati membidik medali emas nomor lari gawang 100 meter putri di SEA Games 2011. “Saya optimistis merebut medali emas di SEA Games 2011,” katanya di Jakarta, Rabu (12/1). Atlet yang berasal dari Sumedang dan kini memperkuat DKI Jakarta ini telah mempersiapkan diri dengan masuk pelatihan nasional di Jakarta sejak awal Januari lalu. “Pelatihan sudah dimulai sejak Januari lalu di Jakarta,” jelasnya. Dia berupaya untuk mem-

perbaiki catatan dirinya sendiri. “Saya fokus mempersiapkan diri,” tambah atlet kelahiran 25 Mei ini. Terakhir, Dedeh tampil di nomor lari gawang 100 meter putri di Asian Games XVI/2010. Ia hanya finish di urutan keenam pada partai final. Catatan waktu Dedeh Erawati turun tajam menjadi 13,42 detik. Sangat jauh dibandingkan dengan babak penyisihan atau heat kedua di mana pelari asal Jawa Barat berhasil mencatat waktu 13,20 detik sekaligus memecahkan rekornas atas namanya sendiri 13,23 detik. Sementara itu, medali emas

nomor lari gawang 100 meter putri Asiah Games itu diraih atlet Korea Selatan Lee Yeon Kyung dengan catatan waktu 13,2 detik, perak Natalya Ivoniskaya (Khazakstan) 13,24 detik, dan perunggu oleh pelari tuan rumah Cina, Sun Yawai dengan catatan waktu 13,27 detik. Untuk Asia Tenggara, ia melihat ada saingan dari Thailand. Untuk SEA Games ini, menurut Dedeh, ia juga dipersiapkan untuk tampil di nomor estafet. “Tapi hal itu tergantung pelatih,” katanya. Cabang atletik SEA Games sendiri akan mempertandingan 46 nomor.

Ajang Tingkatkan Persatuan Porseni Madrasah Batu Bara LIMAPULUH (Waspada): Guna meningkatkan persatuan dan kesatuan serta prestasi atlet di bidang olahraga dan seni antar pelajar madrasah se Kabupaten Batu Bara, Pekan Olahraga Budaya dan Seni (Porseni) VI/2011 resmi dibuka oleh Bupati H OK Arya Zulkarnain SH MM, Rabu (12/1). Acara berlangsung di lapangan sepakbola Lima Puluh dan turut dihadiri Sekdakab Drs H Sofyan MM, Plt Kepala Kantor Kementerian Agama Kab Batu Bara Drs Muhd Nurdin, Ka KUA Lima Puluh Ahmad Sofyan SAg,

sejumlah pejabat terkait dan ratusan pelajar. “Kegiatan ini diharapkan sebagai upaya pembinaan generasi muda sekaligus menjembatani komunikasi dan silaturrahim antar pelajar. Kepada pelajar agar nantinya memahami esensi dari kegiatan hingga tertanam rasa tanggungjawab, loyalitas dan dedikasi dalam menyikapi setiap dinamika. ‘Bersainglah penuh sportif!,” tegas bupati. Sebelumnya, Ketua Panitia Dra Reviyanti melaporkan Porseni diselenggarakan pada 12-

13 Januari 2011 di tiga titik lokasi, yakni tingkat Madrasah Aliyah (MA) di MAN Lima Puluh, tingkat Madrasah Tsanawiyah di MTsN Lima Puluh dan tingkat Madrasah Ibtidaiyah (MI) di MIN Kuala Gunung. “Porseni diikuti 1820 atlet dari berbagai tingkat dan mempertan-dingan lima cabang olahraga antara lain atletik, bola voli, tenis meja, bulutangkis dan sepakbola. Sementara lima cabang seni adalah MTQ, kaligrafi, pidato, cipta puisi kandungan Al-Qur’an dan Hahmil Qur’an,” terang Reviyanti. (a31)

JAKARTA (Antara): Pemain asal Belanda, Vincent Partosoberoto, datang di Jakarta, Rabu (12/1), demi mengikuti seleksi tahap kedua tim nasional Indonesia U-23. “Vincent sudah tiba di Jakarta. Dia besok (Kamis) sudah mulai menjalani latihan,” kata asisten pelatih Timnas U-23 Wolfgang Pikal di Jakarta, Rabu (12/1). Vincent yang kini membela SV Hooddorp, pemain keturunan Indonesia yang telah menjadi warga negara Belanda. Dia merupakan saudara kembar kiper tim junior Ajax Amsterdam, Donovan Partosoberoto.

Sementara dua calon pemain naturalisasi lainnya, Stefano Lilipaly dan Mark van de Mareel, rencananya datang pada 14 Januari. Disinggung soal pelatih Alfred Riedl sudah mengantongi delapan nama pemain calon anggota tim nasional Indonesia U-23, menurut Pikal, mereka masih dalam tahap seleksi untuk pra Olimpiade. Setelah sesi seleksi tahan II, dilakukan seleksi tahap III pada 15-17 Januari 2011. Pikal mengatakan, jadwal pelatnas pra Olimpiade dimulai pada 24 Januari 2010 sedangkan untuk pelatnas SEA Games rencananya 15 Maret mendatang.

KBPPP Yamaha Road Race Seri III Di Pematang Siantar MEDAN (Waspada): Ajang balapan bermotor seri III KBPPP Yamaha Road Race berlangsung di sirkuit buatan Jl H Adam Malik, Pematang Siantar, 23 Januari mendatang. Even memperlombakan 10 kelas dengan menyediakan tiga trofi juara umum untuk diperebutkan. Koordinator Panpel Aga Munte didampingi Pimpinan Lomba Mulia Nasution di Medan, Rabu (12/1) mengatakan, even seri III di Siantar merupakan kelanjutan dari rangkaian kejuaraan KBPPP Yamaha Road Race 2010 yang berlangsung lima seri. Disebutkan, seri I dan II kejuaraan KBPPP Yamaha Road Race telah berlangsung di Siantar dan Kisaran. Seri IV dan V rencananya di Stabat.

Bagi juara umum keseluruhan seri, masing-masing juara yang bermain di katagori tuneupYamaha dan standarYamaha, berhak atas satu unit sepeda motor Kejuaraan seri III, kata Aga, memperebutkan tiga trofi, yakni trofi Kapolresta Pematang Siantar, Kapolres Simalungun, dan Ketua KBPPP Pematang Siantar/Simalungun, sebagai wujud dukungan Muspida setempat. Kelas diperlombakan adalah bebek 4 tak tune-up 115 cc open, bebek 4 tak tune-up 125 cc open, bebek 4 tak standar 115 ccYamaha pemula, dan kelas bebek matik tune-up 125 cc Yamaha. Kemudian, kelas bebek 4 tak tune-up 115 cc FFA pemula, bebek 4 tak tune-up 125 cc FFA pemula, matik tune-

up 150 cc, bebebk 4 tak standar 115 cc pemula, bebek 4 tak standar 125 cc pemula dan kelas bebek 4 tak standar 125 cc lokal. “Kejuaraan pasti seru dan menarik, karena mengakomodasi semua tingkatan para pembalap mulai lokal, pemula hingga open,” ucap Aga. Mulia menambahkan, untuk kelas FFA 115 cc dan 125 cc, boleh diikuti racer dari kelas bebek 2 tak standar 115 cc. “Untuk kemudahan, kami juga membuka dua tempat pendaftaran,” ungkap mantan racer andal, yang juga pengurus IMI Sumut itu. Tempat pendaftaran, masing-masing di Sekretariat Panpel Jl. Asrama, No. 5 Medan, dan di Penginapan Saur Singkar, Jl. Kartini Ujung, P.Siantar. (m47)


Sport Jaminan Dzeko

A10

LONDON (Waspada). Manajer Manchester City Roberto Mancini mengungkapkan, striker Mario Balotelli harus beristirahat selama sebulan akibat cedera kaki.

AP

Striker West Ham Carlton Cole (atas) melewati hadangan pemain Birmingham Roger Johnson di Upton Park Stadium, London.

“Saya khawatir karena dia tidakdapatturunlapanganselama tiga sampai empat minggu. Padahal momen itu amat penting bagi kami,”ucapMancinimelaluiBBC, Rabu (12/1). Masa bertanding bomber Italia berusia 20 tahun itu selama ini terganggu dengan cedera dan hukuman. Praktis, Balotelli baru tampil tujuh kali sejak dia gabung dari Inter Milan.

Blunder Foster Menangi Hammers LONDON (Wapsada): Kesalahan kiper Birmingham City Ben Foster menguntungkan 10 pemainWest Ham United di Upton Park Stadium, London. Akibat blunder Foster yang dimanfaatkan Carlton Cole menjadi gol menit 77, membuat The Hammers menang 2-1 pada leg pertama semifinal Piala Liga Inggris, Rabu (12/1) dinihariWIB. Hammers asuhan Avram Grant pun kembali pada jalur yang benar. Apalagi Liam Ridgewell menit 55 sempat menyamakan kedudukan atas gol pembuka striker Hammers Mark Noble menit 13. Berselang empat menit, tim tuan rumah bahkan terpaksa

tempurdengan10pemain.Pasalnya, striker asal Nigeria Victor Obinna dikeluarkan wasit dari lapangan karena menendang Sebastian Larsson. Tetapi Foster terlalu ceroboh ketika mengamankan tendangan lemah Cole, sehingga Hammers memiliki modal bagus untuk menghadapi leg kedua di St Andrew pada 26 Januari. “Pada babak pertama kami memiliki peluang antara tujuh sampai delapan, tetapi tidak ada yang berakhir dengan gol,” papar Grant. “Babak kedua berbeda. Rasanya sulit bermain dengan 10 orang, tetapi pemain pengganti kami dapat mengubah per-

mainan,” katanya lagi. West Ham terakhir kali maju ke turnamen besar ketika John Lyall membawa klub dari timur London itu ke final Piala FA 1980. Grant yang kedudukannya terancam, paham bahwa posisinya tergantung dari hasil peningkatan permainan Cole cs. Mantan bos Blackburn Sam Allardyce malah disebut-sebut akan menempati posisi Grant untuk mengangkat Hammers dari zona degradasi Liga Premier. “Semangat pemain begitu besar, kendati kami tim kecil dan bermain tidak banyak dalam kompetisi lain. Tetapi para pemain tidak menyerah,” beber Grant. (m15/ant/afp/rtr)

Higuain 4 Bulan Lagi MADRID (Waspada): Striker Real Madrid Gonzalo Higuain, Selasa (Rabu WIB), sukses menjalani operasi di Amerika Serikat untuk memperbaiki cedera kaki yang menyebabkannya absen sejak November silam. Namun Higuain (foto) mesti istirahat empat bulan lagi. “Operasi berlangsung selama satu jam 15 menit. Dia bisa memulai peregangandalamwaktusepekandan berjalan dalam dua atau tiga hari ini,” beber dokter ahli bedah Richard G Fessler. “Operasi berjalan dengan baikdanwaktupemulihansekitar empat bulan. Tapi untuk pulih

100persen,butuhwaktu1tahun,” tambah Fessler, seperti dilansir Goal, Rabu (12/1). Dokter di Northwestern Memorial Hospital Chicago itu menambahkan, tempo empat bulan bukanlah waktu yang panjang terkait pemulihan pasca operasi. “Saya tidak melihat ada komplikasi penyakit lainnya. Penyakit ini biasa dimiliki pemain sepakboladanpemainbasket,”katanya. Media Spanyol lantas berspekulasi, Los Blancos akan memburu striker lagi pada bursa transfer Januari ini, kendati presiden klub Florentino Perez berusaha menampiknya.

Kembali absennya Balotelli, menjadi jaminan bagi striker anyar City Edin Dzeko untuk segera melakukan debut saat melawanWolverhampton di Liga Premier, Sabtu mendatang. Mancini akan menduetkan bomber Bosnia-Herzegovina itu dengan bintang Argentina Carlos Tevez.“Saya sangat bahagia, klub berhasil mendapatkan Dzeko. Sebab sayamerasadiaakanmenjadi pemain penting buat klub ini di masa depan,” puji Mancini. Dzeko merupakan pilar VfL Wolfsburg menjuarai Bundesliga buat kali pertama pada 2009 lalu. Sejak itu dia langsung diminati banyak klub elit Eropa.

WASPADA Kamis 13 Januari 2011

“Kami sudah menginginkannya sejak musim panas lalu, karena kami tahu dia pemain yang tepatuntukkami.Dzekomemiliki kemampuan berbeda dari deretan striker yang kami miliki,” jelas Mancini. “Saat ini kami memiliki kombinasi yang bagus dan saya harap dia bisa melanjutkan suksesnya seperti di Jerman. Saya ingin dia mencetak banyak gol buat kami,” ujarnya lagi. Mantan pelatih Lazio dan InterMilanitujugayakin,bomber barunya bisa cepat beradaptasi dengan iklim Liga Premier. “Jika seorang striker mampu mencetakgoldiJermandanItalia, saya pikir dia juga akan mampu mencetak gol di Inggris. “MungkinkompetisiLigaPremier agak berbeda dengan kompetisilain.NamunsayayakinDzeko bakal mampu menunjukkan

AP

kepiawaiannyamencetakbanyak gol,” optimisme manager asal Italia berumur 46 tahun itu. Dzeko dalam temu pers pertamanya di Carrington, Manchester, Selasa (RabuWIB), sejak dikontrak sebesar 30 juta pound, menjamin akan mempersembahkankesuksesanbuatfansCitizens.

“Saya melihat sesuatu yang berbeda di Manchester City, tidak seperti yang orang bicarakan. Bagi saya ini sebuah klub besar dengan ambisi besar. “Saya juga seorang pemain ambisius dan saya pikir kebersamaan akan dapat membuat kami meraihbanyakkesuksesan,”jamin Dzeko, seperti dikutip dari Goal.

Striker berusia 24 tahun itu jugataklupamemujisemuakomponen Citizens. “Sungguh ini sebuah tim bagus dengan pelatih sangatbagus.Sayadengarbanyak tentang fans dan saya dengar sebagianbesarorangManchester adalah fans Manchester City,” katanya menambahkan. (m15/bbc/goal/rtr)

Gunners Krisis Bek Tengah

AP

David Beckham (tengah) latihan bersama pemain Tottenham di Spurs Lodge, Chigwell, London, Selasa (Rabu WIB).

Spurs Masih Berharap Beckham

Bomber Argentina itu dikontrak Real dari River Plate pada 2007. Dia merupakan penyerang pilihan pertama pelatih Jose Mourinho dengan pelapis striker Prancis Karim Benzema. Higuain sudah mencetak tujuh gol dari 12 kali penampilan musim ini di La Liga Primera. (m15/goal/afp)

AP

Manajer City Roberto Mancini memperkenalkan Edin Dzeko (kanan) di Carrington, Manchester, Selasa (Rabu WIB).

LONDON (Antara/AFP): David Beckham mulai berlatih dengan Tottenham untuk pertama kalinya, Selasa (Rabu WIB), saat pelatih Spurs Harry Redknapp kembali menyatakan harapan untuk mengontraknya. Mantan kapten Inggris itu tersenyum dan bergurau dengan para pemain Spurs, ketika dia ambil bagian dalam suatu sesi pelatihan ringan di Spurs Lodge, Chigwell. Redknapp mengaku, Spurs masih berharap agar gelandang LA Galaxy itu bisa menandatangani kesepakatan jangka pendek sebelum kembali ke Amerika Serikat untuk musim baru Major League Soccer (MLS), Maret mendatang. “Tidak terjadi hal apa pun saat ini, tetapi kami akan melihat apa yang akan terjadi. Saya tidak berurusan dengan tim (Galaxy) itu, tetapi baik juga untuk menghadirkannya di sini,” ujar Redknapp kepada Sky Sports. “David seorang pemain top dan seseorang yang fantastis. Setiap orang menghargai David dan menghormatinya oleh karena itu baik juga untuk memilikinya di sini hari ini,” katanya lagi.

LONDON(Waspada):Arsenalmengalamikrisis bektengah,sehinggamembuatpanikpelatihArsene Wenger. Problem pelik itu kemungkinan memaksa The Professor untuk berburu lagi di jendela transfer Januari ini. Sebab Wenger kini hanya punya Laurent Koscielny dan Johan Djourou sebagai bek tengah. “Jika kami menemukan seseorang pada level yang tepat, kami akan berusaha membelinya. Jika tidak mungkin, kami akan melanjutkan seperti ini saja,” beber Wenger dalam Sky Sports, Rabu (12/1). Koscielny dan Djourou praktis tanpa pelapis, karena ThomasVermaelen dan Sebastien Squillaci sedang bergelut dengan cedera akut. Bek BelgiaVermaelen yang sudah‘menghilang’ dalam dua bulan terakhir, harus absen selama enam minggu lagi akibat cedera otot archiles. Veteran Prancis Squillaci mesti menunggu tiga minggu untuk bisa menjejaki kaki kembali di lapangan hijau akibat cedera hamstring saat melawan Leeds United di Piala FA, Sabtu lalu. PadahalLondonRedssedangmenjalaniagenda padat. Arsenal menghuni posisi ketiga klasemen Liga Premier dan masih harus berlaga di Liga Champions, Piala FA dan Piala Carling. “Idealnya akan sangat bagus jika dia (bek baru) bisalangsungberadaptasidengansepakbolaInggris. Sebab jika Anda ingin seorang pemain Januari ini, Anda tidak bisa menunggu tiga bulan sampai dia bisa bermain untuk Anda,” papar Wenger. Gunners sendiri dikabarkan rawan kehilangan gelandang serang Andrey Arshavin, yang tengah diincar klub raksasa Italia, Juventus.

AP

Laurent Koscielny (kanan) tidak punya pelapis di jantung pertahanan Arsenal. “Ada kemungkinan Arshavin pindah ke Juventus. Tapi ada dua hal yang bisa mencegah kesepakatan itu,” jelas Dennis Lachter, agen Arshavin. Melalui Lifesport.ru, Rabu (12/1), Lachter yakin Juve tak akan sungkan mengucurkan dana besar untuk membeli bintang Rusia tersebut. “Ini bukan spekulasi. Juventus seharusnya telah mendapatkan Arshavin 2,5 tahun lalu, tapi mereka saat itu tidak serius menginginkannya,” tambah Lachter. Untuk mempertahankan kontrak Arshavin yang sebenarnya baru berakhir 2013 mendatang, dia meminta; “Arsenal mesti memenangkan gelar tahun ini. Medali emas Liga Premier impian bagi setiap pemain,” katanya lagi. (m15/rtr/sky/ls)


Sport

WASPADA Kamis 13 Januari 2011

A11

Persikabo Tahan PSAP SIGLI (Waspada): Ambisi PSAP Sigli menuai poin penuh atas tuan rumah Persikabo Bogor pada lanjutan Kompetisi Divisi Utama Liga Indonesia di Stadion Persikabo, Cibinong, Bogor, Rabu (12/1), belum dapat terwujud setelah hanya bermain imbang 2-2. Duel kedua tim berlangsung ketat dengan sama-sama menampilkan permainan menyerang. PSAP yang diperkuat sejumlah pilarnya seperti Mousa B. Troure, Osas Saha dan Feri Komul lebih bayak mendapat peluang mencetak gol. Namun peluang-lepuang itu kerap gagal

dimanfaatkan dengan baik. Hingga babak pertama berakhir, kedua tim belum mampu mencetak gol. PSAP membuka gol lebih dahulu lewat striker Osas Saha pada menit 48 dengan memaksimalkan umpan terobosan gelandang serang Mousa B. Troure. Gol Saha membuat ribuan pendukung tuan rumah sontak terdiam. Setelah tertinggal, tuan rumah terus meningkatkan serangan dan tidak jarang melakukan pelanggaran. Namun beberapa pelanggaran yang dilakukan para pemain Persikabo kerap dibiarkan

wasit. Pada menit 52 pemain depan Persikabo Tcayana Ciril kembali melakukan pelanggaran keras terhadap pemain bawah PSAP Sigli di areal kotak penalti hingga keduanya terjatuh. Namun sangat disayangkan, wasit bukanya memberi peringatan terhadap permain tuan rumah, malah sebaliknya menghukum tendangan penalti kepada PSAP. Eksekusi penalti yang dilakukan Zainal Arif pada menit 55 pun berhasil menyamakan skor 1-1. Menit 60 pemain bawah Persikabo melakukan pelanggan

keras terhadap pemain depan PSAP di dalam kotak penalti. Beruntung, kali ini wasit memberi hadiah penalti kepada tim tamu. Osas Saha yang diberi kepercayaan menjadi eksekutor menjalankan tugasnya dengan baik untuk membawa PSAP unggul 2-1. Namun keunggulan itu tidak bertahan lama setelah pada menit 81 tuan rumah melalui aksi Ilham berhasil menyamakan skor 2-2. Pelatih PSAP Sigli Anwar yang dihubungi Waspada mengaku kecewa terhadap kepemimpinan wasit yang dengan jelas terlalu membela tuan ru-

mah. Kendati begitu, dirinya tidak ingin terlalu ambil pusing dengan hal itu. “Kita bermain di kandang orang, jadi mau bagaimana lagi,” katanya dengan nada kesal. (b20)

Sriker PSAP Osas Saha (kiri) mencetak dua gol saat bermain 2-2 dengan tuan rumah Persikabo Bogor 2-2 di Stadion Persikabo, Cibinong, Bogor, Rabu (12/1). -Waspada/Muhammad Riza-

Persiraja Mantapkan Posisi JAKARTA (Waspada): Persiraja Banda Aceh terus memantapkan posisinya di puncak klasemen sementara grup I Kompetisi Divisi Utama Liga Indonesia 2010/2011 setelah menekuk tuan rumah Persitara Jakarta Utara 3-2 di Stadion Tugu, Jakarta Utara, Rabu (12/1).

Waspada/Munawardi Ismail

Skuad Persiraja Banda Aceh kembali membanggakan pendukungnya setelah menuai poin penuh di kandang Persitara Jakarta Utara, Rabu (12/1).

Raihan tiga poin dari laga ini membuat skuad tim besutan pelatih Heri Kiswanto tersebut menggemas 22 poin dari delapan laga. “Sebetulnyahasilimbangpun sudah cukup buat kami. Tapi syukur Alhamdulillah,anak-anak bisa mencuri gol di menit akhir pertandingan,sehinggakamibisa

Aceh United Masih Nego Mark Viduka BANDA ACEH (Waspada): Presiden Aceh United Muhammad Zaini Yusuf menyebutkan klubnya kini sedang bernegosiasi dengan agen MarkViduka. Pihaknya berniat merekrut mantan striker timnas Australia yang juga pernah memperkuat sejumlah klub Liga Inggris. “Kami sekarang sedang bernegosiasi dengan MarkViduka,” kata Zaini, Rabu (12/1). Dia menyebutkan, timnya terus berbenah demi mempersiapkan diri menghadapi Liga

Primer Indonesia. Selain mendatangkan Pierre Njanka, klub itu juga serius mengejar Mark Viduka. “Njanka sedang dalam perjalanan ke Aceh,” sebut dia. Kepastian mau atau tidaknya Viduka bermain di LPI akan diketahui pada Sabtu (15/11). Sedangkan CEO LPI untuk Aceh United,AriWibowosepertidikutip detiksport menyebutkan, memang untuk mempertajam lini depan,AcehUnitedsedangmembidik Mark Viduka. “Ini untuk membuat LPI lebih menarik

dibanding ISL,” ungkapnya. Vidukasaatiniberstatustanpa klub setelah terakhir membela Newcastle United dalam kurun 2007 sampai 2009. Striker yang tahuninimenginjakusia35tahun itu sempat menjadi andalan lini depanTheSoceroos,selainmemperkuat beberapa klub Liga Primer Inggris seperti Leeds United, Middlesbrough dan Celtic di Liga Skotlandia. Upaya mengejar pemilik 43 capsdansumbangan11goluntuk Australia itu sejauh ini sudah mu-

Sengketa Lapangan Sepakbola Meureudu MEUREUDU (Waspada) : Batas lapangan sepakbola Kecamatan Meureudu, Kabupaten Pidie Jaya dan status pengurus yayasan yang mengurus masalah lapangan tersebut terus dipersengketakan oleh masyarakat peduli olahraga. Untuk menyelesaikan persoalan itu, Panitia Khusus (Pansus) IX DPRK Pidie Jaya telah memanggil kedua belah pihak, yakni yang mengatasnamakan dirinya masyarakat peduli olahraga maupun pengurus yayasan selaku pemilik dan pengurus lapangan. Berbagai informasi diperoleh Waspada di Meureudu, Rabu (12/1), baik dari kalangan tokoh masyarakat maupun yayasan dan masyarakat peduli olahraga. Intinya, mereka menginginkan lapangan diperjelas luas dan batasnya serta peremajaan pengurus yayasan agar lapangan dapat difungsikan kembali sebagaimana layaknya sebuah lapangan sepakbola. Dalam rapat pertemuan pengurus Yayasan Pembangunan Kewedanaan Meureudu (YPKM) dengan Pansus IX DPRK Pidie Jaya yang dipimpin langsung Drs H Bahrom Muhammad Rasyid, disepakati akan dilakukan pengukuran luas dan menetapkan tapal batas lapangan sepakbola milik YPKM tersebut. H Bachtiar Effendi SPd MM dalam rapat dengar pendapat antara YPKM dengan Pansus IX

DPRK Pidie Jaya itu mengharapkan penyelesaian kasus lapangan harus mengutamakan musyawarah sehingga tidak ada pihak yang dirugikan. Menurut Bachtiar, dalam surat jual yang ada disebutkan, luas lapangan sepakbola itu 5 naleh 2 are bijeh. Berdasar ukuran yang berlaku umum, pernaleh itu luasnya 2.500 meter. Jika dikali 5 naleh 2 are, maka total luasnya mencapai 12.812,50 meter. Jika dalam pengukuran nanti tidak seluas itu dan terkena pagar rumah warga, maka harus diselesaikan secara baik. Keterangan itu dibantah H Sulaiman Ary yang menyebutkan membeli tanah di samping lapangan dari HT Bahrum (alm) yang sebelumnya membeli dari Cut Nyak Ti. Berdasarkan akta jual beli dan batasnya sudah sesuai dan itu dibenarkan Ketua YPKM H Nafiah Ali saat itu. Dalam rapat dengar pendapat itu juga disepakati rencana Pemkab Pidie Jaya melalui Bappeda akan membenah lapangan dengan membuat jalan di sekelilingnya sebagai tempat berolahraga ringan. Dalam surat jual tertanggal 21 Agustus 1961 No Regno:99:/ 1961 disebutkan, tanah seluas 5 naleh 2 are bidjih dibeli YPKM dari Mahmud Ben seharga Rp122 ribu berwatas timur dengan Jl PDG, Barat dengan tanah sawah sendiri (Mahmud Ben-red), KYusuf Mesdjid Tuha

Problem Catur Putih melangkah, mematikan lawannya tiga langkah.

Jawaban di halaman A2.

di Utara dengan rel dan tanah pemerintah (PJKA-red) dan selatan dengan tanah/kilang padi TH/TS Thalib. (b21)

TTS TOPIK

lai dilakukan kubu Aceh United. “Lionel (Charbonnier, pelatih Aceh United) punya link di Australiahinggadialahyangmencoba melakukan kontak dengan agen Viduka.Viduka sudah tahu kalau Aceh United menincar dia. Kepastian mau atau tidaknya dia akan didapat akhir pekan ini,” tuntas Ari. Presiden Klub Aceh UNited, Zaini Yusuf menambahkan, mereka tinggal selangkah lagi untuk mendapatkan pemain berusia35tahunitu.“UntukPierre Njanka baru akan tandatangan besok Kamis (13/1/) dengan konsorsium LPI pusat,” sebutnya. Menurut dia, kesepakatan kontrak dengan Njanka sudah mencapai 99,9%, durasi kontraknya satu tahun. Meski begitu, kedua pihak ternyata belum sepakat soal nilai kontrak. (b05)

membawa pulang poin penuh. Kemenangan ini memang lebih pada faktor keberuntungan,” ujar Heri Kiswanto dalam keterangan persnya usai laga. Ditambahkan, fisik pemainnya yang masih kelelahan ditambah kondisi lapangan yang licin membuat pihaknya sejak awal sama sekali tidak menargetkan poin penuh. Hal itu yang membuat ia menurunkan formasi bertahan sejak menit awal dengan hanya menempatkan Abdul Musawir sendiri di lini depan. “Padababakkedua,kamibaru mengubah pola dengan tampil

lebih berani untuk menyerang. Apalagi setelah sempat unggul 2-1 saat turun minum. Tapi memang semangat juang pemain kami cukup baik. Ini salah satu kunci sukses kami bisa meraih poinpenuhdilagaini,”tandasnya. Pelatih Persitara Syamsul Bahri mengaku kecewa dengan kegagalan anak asuhnya menuai poin.Terlebih karena merupakan laga kandang yang mestinya harus dimaksimalkan. Meski begitu, pelatih yang sukses membawa Persires Rengat dan Persih Tembilahanpromosikedivisisatu inimengatakankekalahantimnya atas Persiraja lebih karena faktor kurang beruntung. “Untukhasilakhir,sayasangat kecewa. Tapi secara permainan, anak-anak sudah maksimal. Hanya saja keberuntungan belum berpihak kepada kami. Gol Pesiraja di masa enjury time

menjadi bukti,” kata Syamsul, sembari menambahkan pihaknya akan segera melakukan evaluasi, terutama di sektor penjaga gawang yang memang menjadi titik lemah timnya selama ini. Maklum saja karena dari delapan laga yang sudah dilakoni, timnya kebobolan 11 gol. Bermain dalam tempo sedang,tuanrumahPersitarasukses mencetakgollebihdahulumelalui kaki Hari Salisbury pada menit ke-33.Perjuangantidakkenallelah membuat Persiraja mampu menyamakan kedudukan melalui sontekan striker Abdul Musawir. Laskar Rencong julukan Persiraja bahkan mampu membalikkan keadaan menjadi 2-1 jelang turun minum melalui tendangan jarak jauh Erik Saputra. Memasukibabakkedua,tuan rumah yang tidak ingin dipermalukan berupaya meningkat-

kan tempo permainan sehingga tensi laga pun meninggi. Hal itu sempat merusak konsentrasi Persiraja. Terbukti, striker asing Sanusi Brima Pepito membuat papan skor beubah menjadi 2-2, setelah tandukannya memanfatkan kemelut gagal diantisipasi kiper Dicky Anggriawan. Pertandang pun sepertinya akan berakhir dengan skor imbang, setelah wasit cadangan memberikan tanda waktu enjury time selama empat menit. Tapi rupanya dewi fortuna memang milik Persiraja. Berawal dari sepak pojok, di penghujung laga, Diallo A. Jibril yang datang dari belakang dan bebas dari pengawalan sukses menyudul bola dengan sempurna sekaligus mengubah skor menjadi 3-2 untuk timnya yang bertahan hingga laga usai. (yuslan/b05)

Agara FC Taklukkan Aceh Utara 2-1 KUTACANE(Waspada):Tuan rumah Aceh Tenggara (Agara) FC memetik poin penuh setelah membungkam Aceh Utara United 2-1 pada lanjutan babak delapan besar K-Liga Aceh di Stadion H Syahadat Kutacane, Rabu (12/1). Kemenangan itu sekaligus membuka peluang Agara maju ke putaran empat besar dan bersaing ketat dengan Pidie United sebagai pimpinan klasemen dan Meulaboh United. Bertanding di hadapan sekira 10.000 penonton, Agara yang padapertandinganperdanakalah

dari Meulaboh United mencoba mengambil inisiatif menyerang. Lewat kombinasi umpan panjang dari pertahanan yang dikoordinir MYusuf dan umpan pendekdarilapangantengahyang dialirkan Abdul Manaf, kerap membuat barisan pertahanan Aceh Utara kewalahan. Hasilnya, beberapa peluang nyaris membuahkan gol lewat tendangan dan tandukan Dicky Ari Prayogo, Al Hadad dan Fandi. Sayangnya peluang yang diperoleh pemain depan tuan rumah itu kerap digagalkan M Ikhsan yang mengawal gawang

Mendatar

Menurun

OLAHRAGA 1. Salah satu tim basket tangguh NBA dari kota Boston, AS, dua kali kalah beruntun bulan ini. 3. Lingkaran berjaring setinggi tiga meter untuk tempat bola dimasukkan. 6. Burung buas yang namanya sering dipakai untuk perkumpulan olahraga. 8. Permainan bola dengan berkuda. 10. Cabang olahraga turnamennya bernama Super Series Mas ters Final, berlangsung di Taiwan saat ini. 12. Roger ______, juara turnamen tenis terbuka Qatar 2011. 14. Tempat parkir pesawat, biasa jadi tempat latihan aeromodeling. 16. Gedung Olah Raga. 17. Barang bulat, kenderaan balap bergantung padanya. 19. Cabang olahraga yang kejuaraan dunia berlangsung di Jakarta bulan lalu dan ketum IPSInya Prabowo Subianto. 21. Persatuan Sepakbola Angkatan Darat. 22. Sirkuit di Malaysia, tempat tes MotoGP bulan depan. 23. Ibukota Qatar, penyelenggara turnamen tenis terbuka 2011. 24. Penjaga gawang.

1. Catur (Inggris). 2. Cabang olahraga atletnya bernama Shane Mosley dan Manny Pacquiao. 3. Negara asal perenang Ranomi Kromowidjojo, berdarah Indonesia. 4. Gerakan menendang sesuatu. 5. Technical Knock Out. 7. Negara Arab penyelenggara MotoGP pada Maret 2011 dan Piala Dunia 2022. 9. Kapanjangan LA dari LA Lakers, mengalahkan Detroit Pistons seminggu lalu. 11. Kepanjangan “ka” dari Lemkari, ketum terpilih 2011-2016 adalah Priyo Budi Santoso. 12. Balap mobil memakai angka satu. 13. Uji; Latih (Jawa). 15. Valentino _____, pembalap MotoGP tidak fit sejak pindah dari Yamaha. 18. Lawan dalam bersaing; Pesaing. 20. Rafael ______, petenis nomor satu dunia kalah di semi final Qatar Open 2011. 21. Organisasi yang ketumnya Nurdin Khalid. 22. Sekolah Tinggi Olahraga.

Aceh Utara. Sebaliknya, Aceh Utara yang berambisi meraih kemenangan untuk menjaga peluang lolos ke empat besar, mencoba menekan pertahanan tuan rumah lewat serangan balik dan aksi individu Iqbal dan KhairulYadi. Tim tamu nyaris unggul andai saja tendangan deras Mustafa tidak berhasil ditepis Galih Widana, kiper Agara. Menit ke-29 Fandi Ardianto berhasil mencetak gol bagi Agara memanfaatkan umpat Al Hadad. Gol itu pun disambut suasana bergemuruhsuportertuanrumah.

Memasuki babak kedua, tempo permainan semakin tinggi dandiwarnaibeberapapelanggaran yang membuat wasit menghadiahi dua kartu kuning kepada pemain Aceh Utara. Di paruh babak kedua Nanjar yang menerima umpan dari Amri berhasil menggandakankeunggulantuan rumah 2-0. Aceh Utara baru mampu memperkecilkekalahandimenitmenit akhir pertandingan lewat tendangan jarak jauh di luar kotak penaltiKhairulYadiyanglangsung membobolgawangGalihWidana. (b27)

Sudoku Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tidak ada keterlibatan matematika, hanya membutuhkan pertimbangan dan logika. Tingkat kesulitan: sulit (****), bisa diselesaikan dalam waktu 15 menit. Jawabannya lihat di halaman A2 kolom 1.

2 4 9 3 8 8 6 3 2 9 4 3 4 9 2 6 9 8 4 6

9 5 6 9 8 2 7 1 5 h213


Sport A12 Lakers Toreh Sejarah Baru

WASPADA

Kamis 13 Januari 2011

Bucks 107-96. Kelima hadiah tembakan itu diberikan wasit

LOS ANGELES, AS (Waspada): Penampilan fantastis diperlihatkan Los Angeles Lakers ketika menjamu Cleveland Cavaliers. Tampil di Staples Center, sang juara bertahan meraih kemenangan telak 112-57, Rabu (12/1). Ron Artest dan Andrew Bynum masing-masing me-

ngemas 15 poin dalam pertandingan tersebut. Bila Ar-

PANGGILAN PERTAMA

Sdra. Fikri Fatah STT (foto) Pimpinan Perusahaan Q Architect Consultant alamat terakhir Jl. Sei Asahan No. 1 Tj. Rejo Medan. Agar segera menyelesaikan pekerjaan renovasi kantor Serikat Penerbit Suratkabar (SPS) Cabang Sumut di Jl. Sena No. 96-98 Medan sesuai surat pernyataan Sdra tertanggal 08 Oktober 2010. Sdra. sudah mengambil uang SPS tapi ingkar janji. Fikri juga sudah mengambil uang/barang/jasa dari pihak lain, tapi tidak diselesaikan dengan baik. Yang mengetahui keberadaan Sdra. Fikri Fatah STT mohon memberitahu Eko via Tlp. (061) 4535812.

test menambah koleksinya dengan enam assist, maka Bynum mengoleksi lima blok. Pau Gasol mencatat 13 angka 14 rebound, sedangkan bintang Lakers Kobe Bryant kali ini tampil dingin dan hanya mendulang 13 poin. Sementara itu, pemain inti Cavaliers sama sekali tidak berdaya. Penampilan apik justru diperlihatkan dua pemain cadangan, Alonzo Gee dan Ramon Sessions. Gee mencatat 12 angka dan Sessions mengumpulkan 10 poin. Dominasi sudah diperlihatkan Lakers sejak awal pertandingan. Strategi bertahan yang dimainkan Kobe cs membuat Cavs tidak berkutik. Skuad Phil Jackson menutup kuarter kedua 57-25. Selanjut-

Ken Mauer di 10 detik pembuka kuarter ketiga. Guard Spurs,

Manu Ginobili, sukses memasukkan kelima free throw itu

untuk menjadikan total raihannya 19 angka. (m33/ap)

nya, Cavs benar-benar tidak mampu membendung serangan tuan rumah. Sebaliknya, pertahanan mantan tim LeBron James ini dengan mudah ditembus tim asal kota selebritis dunia itu. Ini merupakan kekalahan ke11 secara beruntun yang dialami Cavs. Rekor menjadi semakin buruk, karena ini menjadi kekalahan ke-21 dari 22 pertandingan terakhir. Dilansir dari LA Times, ini adalah jumlah poin tersedikit yang bisa dibukukan lawan ke jala Lakers sejak era shot clock dimulai pada musim 1954-1955. Ada pun rekor lama adalah 66 poin. Di Minneapolis, lima technical foul membantu San Antonio Spurs untuk mengalahkan tuan rumah Milwaukee

Hasil Rabu (12/1) Indiana Pacers vs Philadelphia 76ers Washington Wizards vs Sacramento Kings San Antonio Spurs vs Minnesota T’wolves Denver Nuggets vs Phoenix Suns New York Knicks vs Portland T’blazers LA Lakers vs Cleveland Cavaliers Atlanta Hawks vs Milwaukee Bucks

Pengurus SPS Sumut

111-103 136-133 107-96 132-98 100-86 112-57 tunda

Atas Pelantikan :

Ir. Leo Lopulisa Haloho, MSi

Sebagai Kadis Pertanian Kota Tebingtinggi Oleh Pj. Walikota Tebingtinggi Drs. H. Eddy Syofian, MAP Dari :

� Keluarga H. Salamat Damanik (Alm) - Hj. Siti Aminah (Desa Bartong, Kec. Sipispis, Kab. Sergai) � Keluarga Dr. Ramulia Damanik Sp.OG (Kadis Kesehatan Kab. AGARA) - Hj. Yusnani Purba, SE, Kotacane Aceh Tenggara. � Keluarga Besar Almarhum Dotang Damanik BarungBarung, Kab. Sergai.

AP

Center LA Lakers, Andrew Bynum (tengah), mengambil alih peran sebagai motor serangan timnya kala menjamu Cleveland Cavaliers dalam laga NBA di Staples Center, Rabu (12/1).

Badan Kepegawaian Daerah Provinsi Sumatera Utara Mengucapkan:

“Semoga WASPADA makin eksis dan terus komitmen menyampaikan kebenaran dan keadilan serta semakin profesional” Ttd.

PENGUMUMAN KEDUA LELANG EKSEKUSI HAK TANGGUNGAN Berdasarkan pasal 6 Undang undang Hak Tanggungan Tahun 1996, PT. Bank Sumut akan melaksanakan pelelangan eksekusi hak tanggungan dengan perantaraan Kantor Pelayanan Kekayaan Negara dan Lelang (KPKNL) Medan terhadap barang agunan dalam kondisi apa adanya ( as is) sebagai berikut : No

Objek Yang dilelang

Harga Limit (Rp)

1

2

3

1

Juindar,Sujarwati/Jln. Pertahanan Gg. Supir No.212 Kel Timbang Deli Medan 1.1 Sebidang tanah seluas 160 M2 berikut bangunan rumah semi permanen diatasnya terletak di Jln. H.M. Yamin SH Gang Ketoprak No.7 Kel Sei Kera Hilir II Kec. Medan Perjuangan Kota Medan sesuai SHM No. 305 tgl 12-01-2004 an. Juindar.

75,000,000

26,250,000

650,000,000

227,500,000

700,000,000

245,000,000

4,000,000,000

1,400,000,000

500,000,000

175,000,000

500,000,000

175,000,000

3

CV. Ase Mandiri/Wilmar Pangaribuan,Rosdiana Tamba, Jln. Mesjid No. 26 Kel Helvetia Timur Kec. Medan Helvetia Medan 3.1 Sebidang tanah seluas 566 M2 berikut 1 (satu) unit SPBU beserta segala yang ada diatasnya terletak di Jln. Sisingamangaraja Kel Sitirejo II Kec. Medan Amplas Kota Medan sesuai SHM No. 626 tgl 23-10-2001 an. Rosdiana Tamba. 3.2 Sebidang tanah seluas 233 M2 berikut bangunan yang ada diatasnya terletak di Jln. Sisingamangaraja Gang Syukur Kel Sitirejo II Kec. Medan AmplasKota Medan sesuai SHM No. 687 tgl 12-05-2005 an. Rosdiana Tamba.

4

70,000,000

1.3 2 (dua) bidang tanah menjadi satu kesatuan masing-masing seluas 20 M2 dan 74 M2 berikut bangunan rumah permanen diatasnya terletak di Jl. H. M. Yamin SH Gang Ketoprak Kel Sei Kera Hilir II Kec. Medan Perjuangan Kota Medan sesuai SHM No. 363 tgl 4-4-2006 an. Sujarwati, dan SHM No. 536 tgl 27-08-2010 an. Juindar. UD. Usaha Era Baja / Suhendra Jln. Brig Jend Katamso Lk II-A Gg. Saedah Comp No.8 C-A . Sebidang tanah seluas 83 M2 berikut bangunan ruko 3 (tiga) lantai permanent diatasnya terletak di Jln. Brigjend Katamso No.47 Kel Titi Kuning Kec. Medan Johor Kotamadya Medan sesuai SHGB No. 39 tanggal 23-11-1991 an. TJAI JUNG.

Kepala BKD Provsu

4

200,000,000

1.2 Sebidang tanah seluas 240 M2 berikut bangunan rumah permanen diatasnya terletak di Jln. Pertahanan Gang Supir Kel. Timbang Deli Kec. Medan Amplas Kota Medan sesuai SHM No. 803 tgl 10-06-2005 an. Sujarwati.

2

Drs. Suherman, MSP

Uang Jaminan (Rp)

CV.Hilal Motor/Ubaidullah/Sugiarti Ningsih, Jln. Mesjid No.114 Pangkalan Brandan 4.1 Sebidang tanah seluas 802 M2 berikut bangunan rumah permanen diatasnya yang terletak di Jln. Imam Bonjol Kel. Brandan Timur Kec. Babalan Kab. Langkat sesuai SHM No. 507 tanggal 13-08-2002 an. UBAIDULLAH . 4.2 Sebidang tanah seluas 86 M2 berikut bangunan permanen diatasnya yang terletak di Jln.Dempo Kel. Brandan Timur Kec. Babalan Kab. Langkat sesuai SHM No. 304 tanggal 26-05-1995 an. UBAIDULLAH.

300,000,000

111,000,000

4.3 Sebidang tanah seluas 3441 berikut bangunan rumah diatasnya terletak di Jln. Tanjung Pura Desa Pelawi Utara Kec. Babalan Kab. Langkat sesuai SHM No. 56 tanggal 22-05-1998 an. Maisyarah.

600,000,000

210,000,000

4.4 Sebidang tanah seluas 3,060 M2 berikut segala yang ada diatasnya terletak di Jln Desa, Desa Pantai Geni Kec. Stabat Kab. Langkat sesuai SHM No. 579 tgl 24-03-2006 an. UBAIDULLAH, ST

92,000,000

32,200,000

4.5 Sebidang tanah seluas 3,167 M2 berikut bangunan rumah diatasnya terletak di Jl. Brandan ke Tj. Pura Desa Paluh Manis Kec. Gebang Kab. Langkat sesuai SHM No. 38 tgl 10-04-2002 an. Hj. Syarifah.

320,000,000

112,000,000

5

PT.Karya Harun Nauli/Ir.H. Ishar Lubis, Hj. Rukiyati Br. Ginting, Jln. Rajawali No. 15 Medan Sebidang tanah seluas 927 M2 berikut 3 (tiga) unit bangunan diatasnya terletak di Jln. Rajawali No. 109 Kel Sei Sikambing B Kec. Medan Sunggal Kota Medan sesuai SHM No. 1087 tgl 31-03-1998 an. Insinyur Ishar Lubis.

1,100,000,000

385,000,000

6

Harianti,Muhammad Faisal/Jln. Baru Lk XV Kel Terjun Kec. Medan Marelan 6.1 Sebidang tanah seluas 1,050 M2 berikut 1 (satu) uni bangunan rumah tempat tinggal diatasnya terletak di Jln. Pancing / Jln. Platina III Kel Titi Papan Kec. Medan Deli Kota Medan sesuai SHM No. 317 tgl 24-05-1994 an. Wariman.

300,000,000

105,000,000

150,000,000

52,500,000

6.2 Sebidang tanah seluas 203 M2 berikut bangunan rumah permanen diatasnya terletak di Jln. Baru sudut gang kel Terjun Kec. Medan Marelan Kota medan sesuai SHM No. 2709 tgl 18-11-2009 an. Muhammad Faisal. 7

Erpan Lubis,Nuridah Harahap/Kompleks RSK P. Sicanang Kel Sicanang Sebidang tanah seluas 1,696 M2 berikut bangunan rumah diatasnya terletak di Lingkungan XIX Kel Belawan Sicanang Kec. Medan Belawan Kota Medan sesuai SHM No. 84 tgl 15-09-2009 an. Erpan Lubis.

175,000,000

61,250,000

8

Syahrizal SE, Rosmanetti/Jln. Bunga Wijaya Kesuma No. 30-A Medan Sebidang tanah seluas 131 M2 berikut bangunan rumah permanen diatasnya terletak di Jln Bunga Wijaya Kesuma Kel Padang Bulan Selayang II Kec. Medan Selayang Kota Medan sesuai SHM No. 2460 tgl 8-03-2005 an. Syahrijal Sarjana Ekonomi.

300,000,000

105,000,000

9

Sartono, Nurasiah/ Jln. Titi Papan Gg. Pertahanan No.9 Medan Sebidang tanah seluas 9311 M2 berikut segala yang ada diatasnya terletak di Desa Mencirim Kec. Sunggal Kab Deli Serdang sesuai SHM No. 245 tanggal 12-06-1985 an. SARTONO.

500,000,000

175,000,000

10

Tirnau Karsu,Santi Kumari/Jln. Mawar Gg Buntu No. 2 Lk IV Kel Sari Rejo Kec. Medan Polonia Sebidang tanah seluas 80 M2 berikut bangunan rumah toko berlantai II diatasnya terletak Jln. Kangkung Kel Petisah Hulu Kec. Medan Baru Kota Medan sesuai SHM No. 569 tgl 17-11-1997 an. Tirnau Karsu

500,000,000

175,000,000

11

Dahlia Dewi Tetti/ Jln. Parang No. 23 Kel Kwala Bekala Kec. Medan Johor 11.1 Sebidang tanah seluas 35 M2 dan segala yang ada diatasnya yang terletak di Jl. Kapten Pattimura Kel Kwala Bekala Kec. Medan Johor Kotamadya Medan sesuai SHM No. 226 tgl 12-08-1986 an. Dahlia Dewi Tetti juga ditulis Dahlia Dewi Tetti Sarjana Hukum.

35,000,000

12,250,000

263,000,000

92,050,000

11.2 Sebidang tanah seluas 263 M2 dan segala yang ada diatasnya yang terletak di Jln Let Jend Jamin Ginting Kel Kwala Bekala Kec. Medan Johor Kota Medan sesuai SHM No. 980 tgl 13-11-2001 an. Dahlia Dewi Tetti juga ditulis Dahlia Tetti Sarjana Hukum. Hari/Tanggal Pukul Tempat

: Kamis / 27 Januari 2011 : 10.00 WIB s/d selesai : PT. Bank Sumut, Jln. Imam Bonjol No. 18 Medan.

Syarat-syarat lelang: 1 Peserta lelang wajib menyetorkan uang jaminan kerekening Kantor Pelayanan Kekayaan Negara dan Lelang (KPKNL) pada PT. Bank Sumut Cabang Utama Medan No. A/C.100.01.02.022642.0 paling lambat 1 (satu) hari sebelum pelaksanaan lelang sudah efektip. 2 Pelunasan harga lelang dalam waktu 3 (tiga) hari kerja setelah ditunjuk sebagai pemenang lelang. 3 Setiap peserta lelang wajib menawar seharga limit yang ditetapkan sesuai pengumuman lelang apabila peserta lelang tidak menawar maka untuk lelang berikutnya tidak diperbolehkan mengikuti lelang diwilayah kerja KPKNL Medan (sesuai ketentuan PMK No. 93/PMK ,06/2010 tanggal 23-April 2010). 4 Apabila pemenang lelang tidak melunasi kewajibannya maka dinyatakan ì Wanprestasiî dan uang jaminan akan disetorkan ke Kas Negara sebagai pendapatan jasa lainnya serta peserta lelang akan dimasukkan kedalam DAFTAR HITAM LELANG. 5 Peserta lelang membawa materai Rp 6000 sebanyak 4 (empat) lembar dan foto copy indentitas (KTP) yang berlaku. 6 Bagi peserta lelang yang tidak ditunjuk sebagai pemenang lelang, uang jaminan akan dikembalikan tanpa potongan apapun. 7 Kondisi asset dijual apa adanya (as is), syarat-syarat lainnya ditentukan pada saat lelang. 8 Informasi lebih lanjut hubungi PT. Bank Sumut Telp : ( 061.4515100) pesawat 1555,1562 dan Kantor Pelayanan Kekayaan Negara dan Lelang (KPKNL) Jln. P. Diponegoro No. 30-A Medan Telp : 061.4513612 serta Sdr. M.Yamin No.0812.608.3036, Sdr. Legiarto No.081,376,718,500, Sdr. Elida Dian Novita No. 0812,603,5353, Sdr. Zakiyuddin Harahap No. 08126010173, Sdr. M. Rafles 081370968908 Medan, 13 Januari 2011 TTD

PT. Bank Sumut


Sumatera Utara

WASPADA Kamis 13 Januari 2011

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:35 12:48 12:36 12:43 12:42 12:39 12:36 12:31 12:38 12:38

‘Ashar 15:59 16:11 15:59 16:06 16:05 16:04 16:23 15:55 16:02 16:01

Magrib 18:34 18:44 18:34 18:39 18:39 18:41 18:35 18:31 18:37 18:35

‘Isya

Imsak

Shubuh Syuruq

Kota

19:47 19:57 19:48 19:52 19:52 19:55 19:48 19:44 19:50 19:48

05:05 05:21 05:06 05:15 05:14 05:05 05:05 05:00 05:08 05:09

05:15 05:31 05:16 05:25 05:24 05:15 05:15 05:10 05:18 05:19

L.Seumawe 12:41 L. Pakam 12:34 Sei Rampah12:33 Meulaboh 12:45 P.Sidimpuan12:33 P. Siantar 12:33 Balige 12:33 R. Prapat 12:30 Sabang 12:48 Pandan 12:35

06:35 06:51 06:36 06:45 06:44 06:35 06:35 06:30 06:38 06:39

Zhuhur ‘Ashar 16:04 15:58 15:57 16:08 15:57 15:57 15:58 15:54 15:10 15:59

B1

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

Zhuhur ‘Ashar

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

18:37 18:33 18:32 18:43 18:35 18:33 18:34 18:31 18:43 18:36

19:50 19:46 19:45 19:56 19:48 19:46 19:47 19:44 19:56 19:49

05:14 05:04 05:04 05:16 04:59 05:02 05:01 04:58 05:22 05:02

05:24 05:14 05:14 05:26 05:09 05:12 05:11 05:08 05:32 05:12

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:35 12:36 12:46 12:39 12:36 12:42 12:31 12:41 12:34 12:33

18:36 18:36 18:41 18:39 18:34 18:39 18:30 18:40 18:35 18:32

19:49 19:49 19:55 19:52 19:47 19:53 19:43 19:53 19:48 19:45

05:02 05:05 05:19 05:06 05:06 05:14 05:00 05:10 05:01 05:03

05:12 05:15 05:29 05:16 05:16 05:24 05:10 05:20 05:11 05:13

Panyabungan 12:31 Teluk Dalam12:38 Salak 12:36 Limapuluh 12:32 Parapat 12:34 GunungTua 12:31 Sibuhuan 12:31 Lhoksukon 12:41 D.Sanggul 12:35 Kotapinang 12:29 AekKanopan 12:31

06:43 06:34 06:33 06:46 06:29 06:32 06:31 06:28 06:52 06:32

15:59 16:00 16:08 16:03 15:59 16:05 15:54 16:05 15:58 15:57

06:31 06:34 06:48 06:36 06:36 06:44 06:29 06:40 06:31 06:33

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

Zhuhur ‘Ashar 15:56 16:03 16:00 15:56 15:58 15:56 15:55 16:03 15:59 15:54 15:55

Magrib

‘Isya

Imsak

Shubuh Syuruq

18:34 18:42 18:37 18:31 18:34 18:33 18:33 18:37 18:35 18:31 18:31

19:48 19:55 19:50 19:44 19:47 19:46 19:47 19:50 19:49 19:44 19:44

04:57 05:03 05:05 05:01 05:03 04:58 04:57 05:13 05:02 04:57 04:59

05:07 05:13 05:15 05:11 05:13 05:08 05:07 05:23 05:12 05:07 05:09

06:27 06:33 06:34 06:31 06:32 06:28 06:27 06:43 06:32 06:26 06:29

Rektor Unimed

Menurunnya Karakter Bangsa Sangat Menakutkan TEBINGTINGGI (Waspada): Kemiskinan sebenarnya tidak pantas untuk ditakuti, tapi menurunnya kualitas karakter bangsa merupakan hal yang sangat ditakuti. Karena, ketika suatu bangsa kehilangan karakternya, maka bangsa itu berada di ambang kehancuran. Pendidikan karakter (soft skill) saat ini menjadi tuntutan wajib yang harus dilakukan untuk menyelamatkan bangsa ini ke depan. Waspada/Abdul Khalik

KARAKTER BANGSA : Rektor Unimed Prof Syawal Gultom saat memaparkan persoalan karakter bangsa dihadapan peserta seminar di Balai Kartini Kota Tebingtinggi, Rabu (12/1).

Agen Shabu Kabur Dari Polisi Dengan Tangan Digari BINJAI (Waspada) : Seorang agen shabu-shabu, I, 35, dilaporkan kabur dari tangan polisi dengan kondisi tangan tergari. I berhasil kabur dalam penggerebekan yang dilakukan aparat dari Sat Narkoba Polres Binjai, dipimpin Kanit Idik Ipda Nazrides S, SH, Rabu (12/1) pukul 07:00, di Simpang Turiam, Kecamatan Binjai Timur. Keterangan yang diperoleh Waspada menyebutkan, polisi awalnya, Rabu (12/1) pukul 07:00 menangkap dua warga KM 12 jalan Binjai- Medan, Desa Purwodadi, Kecamatan Sunggal, Kabupaten Deliserdang, masing-masing AY alias Ceper dan seorang wanita Baru Gede (ABG) F, 15, usai membeli sabhu satu pekat kecil (Pahe) seharga Rp 100.000, dari agen sabhu I, 35 residivis kasus narkotika, warga jalan Cuk Nyak Dhien, Kecamatan Binjai Timur. Usai membeli, keduanya menunggu angkot (Angkutan Kota) di Simpang Turiam, Kecamatan Binjai Timur. Petugas yang mendapat informasi itu langsung meluncur ke lokasi dan mengamankan kedua tersangka bersama barang bukti satu paket kecil sabhu. Dari hasil pengembangan kedua tersangka mengaku kalau sabhu ini dibeli dari I. Keduanya

kemudiandigiringkerumahagen,daniapunberhasil diringkus. Dengan tangan digari agen yang merupakan residivis kasus yang sama dimasukkan ke dalam mobil. Mobil yang mengangkut ketiga tersangka kasus sabhu ini baru bergerak baru beberapa meter. Saat mobil melaju, I berhasil kabur dengan melompat walau tangan digari. Petugas melihat kejadian langsung melepaskan tembakan peringatan ke udara agar menyerahkan diri namun tidak dihiraukannya. Hingga berita ini diturunkan, Polresta Binjai menurunkan tim menyusuri keberadaan pelaku. AY yang ditemui wartawan dari balik rumah tahanan Sat Narkoba Polres Binjai, mengaku pagi itu dia diajak oleh F membeli sabhu di Binjai untuk mereka pakai. Sementara F masih diinterogasi Polwan yang bertugas di Sat Narkoba Polres Binjai, berapa kali sudah beli sabhu di Binjai dan gunakannya. Kapolres Binjai, AKBP Dra Rina Sari Ginting, melalui Kasat Narkoba AKP Achiruddin Hasibuan, SH.MH ketika dikonfirmasi seputar dua warga Sunggal diringkus beli sabhu dan kaburnya agen shabu di Binjai membenarkan. (a04)

Delapan Hari Hilang, Cewek ABG Ditemukan Tewas Dalam Sumur P.BRANDAN (Waspada): Delapan hari hilang, seorang cewek anak baru gede (ABG), Jumati, 17, warga Kompleks Baru, Kel. Sei. Bilah Timur, Kec. Sei. Lepan, ditemukan tewas dengan kondisi tanpa busana di dalam sumur yang berjarak sekira 400 meter dari rumah teman prianya di Dusun Aras Mesin, Desa Harapan Baru, Kec. Sei. Lepan, Rabu (11/1) petang. Mayat korban pertama sekali ditemukan warga setempat, Kadir, bersama anaknya saat mereka sedang mencari keong mas. Kadir merasa terkejut begitumelihatkedalamsumursedalamlebihkurang 5 meter terdapat sesosok tubuh perempuan mengapung dengan kondisi bagian pinggang terikat tali yang diberi beban batu besar. Polsek P.Brandan begitu menerima informasi tentang temuan mayat segera turun ke lokasi mengevakuasi mayat cewek ABG itu ke RSU Pirngadi Medan untuk keperluan visum et revertum. Berat dugaan, kematian tragis yang dialami remaja yang hanya tamatan SLTP tersebut akibat pembunuhan. Menurut keterangan yang dihimpun Waspada, pada tanggal 3 Januari, korban pergi dari rumah bersama pacarnya, Sugianto, 16, warga Desa Harapan Baru, Kec. Sei. Lepan. Pacar korban mengaku, pada malam itu mereka dirampok dan pelaku mengambil paksa uang Rp250 ribu, handphone serta membawa kabur, Jumati.

Sehari setelah itu, Sugianto, baru melaporkan persitiwa yang diakuinya sebagai perampokan dan penculikan kepada polisi. Menerima laporan ini, polisi terus melakukan penyelidikan dan berselang delapan hari kemudian, sang pacar yang dilaporkan diculik perampok ditemukan tewas dengan kondisi cukup mengenaskan. Untuk kepentingan pengusutan, polisi mengamankan pacar korban guna mengorek informasi lebih mendalam terkait kasus kematian korban. Sampai, Kamis (12/1), polisi belum dapat menyimpulkan siapa pelaku pembunuhan sebenarnya. Namun, dari HP sang cowok, ditemukan SMS yang mencurigakan. Sumber di kepolisian mengatakan, di HP pria itu ditemukan ada terdapat beberapa SMS dari korban. Dalam pesan singkat yang dikirim melalui prangkat alat komunikasi selular itu pada intinya korban meminta pertanggungjawabkan kepada sang cowok atas perbuatannya hubungan terlarang yang pernah mereka lakukan. Kapolsek P.Brandan, AKP HM. Kosim Sihombing,dikonfirmasimengatakan,pacarkorbansudah diamankan dan saat ini yang bersangkutan sedang dalam proses pemeriksaan intensif. Ditanya apakah ada indikasi keterlibatan pacar korban, ia menyatakan, tunggu saja hasil penyelidikan dan penyidikan.(a02/h02)

Penegasan ini disampaikan Rektor Universitas Negeri Medan Prof DR Syawal Gultom, Selasa (13/1) saat menjadi pembicara seminar sehari berthema “Pendidikan Budaya dan Karakter Bangsa Serta Sinkronisasi Tugas PengawasSekolahdenganKepala SekolahdanGuru,”diBalaiKartini Tebingtinggi. Kegiatan itu, dipadu dengan pelantikan pengurus Asosiasi Pengawas Sekolah Indonesia (APSI) kota Tebingtinggi

periode 2011-2016. Syawal menyontohkan sejumlah kasus terkait perilaku bangsa-bangsa di dunia, meski mereka bukan orang beragama, tapi perilaku mereka sangat agamais. Misalnya, bangsa-bangsa Eropa yang umumnya bukan penganut agama tertentu, tapi dalam perilakunya, mereka menjalankan kesehariannya sesuai dengan kaedah agama. Bahkan, salah satu kasus menarik dunia pendidikan di Malaysia, dicontohkan Rektor Unimed itu. Diungkapkan, saat dia menguji sejumlah siswa setingkat SMA di negeri jiran itu, maka pengurus sekolah mempersilahkanSyawalGultomuntuk meninggalkan ruangan ujian. “Mereka menjamin takkan ada peserta ujian yang menyontek. Jika peserta ujian tak tahu jawaban itu, mereka akan langsung berhenti,” kata Syawal. Mereka menyerah dan dengan besar hati akan berkata, tak tahu jawabannya dan akan belajar untuk persiapan tahun depan. Semestinya dalam proses pendidikan yang dijalani pada tingkat SD, SMP dan SMA, pendidikan terkait paedagogis, sudah harus selesai. Sehingga di tingkat

mahasiswa dibentuk andragogi. Namun, nyatanya pada pendidikan di negeri ini hingga tingkat mahasiswasekalipunpendidikan paedagogis belum selesai. “Maka janganheranjikaditingkatS2pun masih ada mahasiswa yang menyontek,” tegas dia. Memenuhi Berbagai Kriteria Pj Walikota Tebingtinggi H Eddy Syofian menegaskan, pendidikan di Kota Tebingtinggi ke depanharusmemenuhiberbagai kriteria,misalnyaterkaitsertifikasi. Sudah tidak masanya lagi jika ada kepala sekolah yang tidak memiliki sertifikasi, begitu pula dengan pengawas. Pj Walikota juga menyindir perilakuguruyangselalumemberikan laporan buruk kepadanya, misalnya soal keterlambatan pembayaran dana sertifikasi. Disampaikan pula, saat ini pelayanan pendidikan di KotaTebingtinggi meningkat pesat. Hal itu bisa dilihat dari ketersediaan pendidik dan tenaga kependidikan yang memenuhi kualifikasi dan kompetensi yang kompetitif. Saat ini jumlah pendidik di Disdik dan Kemenag mencapai 3.662 orang. Dari jumlah itu 2.181 orang atau 59,57 persen berpen-

BINJAI (Waspada):Walikota BinjaiHMIdaham,SH.MSisetelah memimpinkotaBinjailimabulan Senin (11/1) mulai menyusun kabinet baru. 43 penjabat eselon II dan III dilantik dan diambil sumpahnya di aula Pemko Binjai. Dari 43 penjabat eselon II dan III, sebelas orang dinonjobkan. Namun penjabat impor masih ada. Di antara Kadis Kesehatan dr Agusnadi yang sudah dicopot sebagai Direktur RSU Tanjungpura Kab.Langkat, Kadis PU Alfi Syahriza dari Medan. Kadis PendidikanDrsHDwiAnangWibowo juga dari Medan Sekertaris Dinas Pendidikan Ismail Ginting dari Langkat. Walikota Binjai HM Idaham menyebutkan, penjabat yang dilantik sudah sesuai dengan ketentuan yang berlaku dan diharapkanSKPDmerupakankabinet baru di Pemko Binjai dapat mewujudkan visi dan misi Pemko Binjai. 43 penjabat eselon II dan III yang dilantik terdiri Drs H Aspian selamainistaf ahlisebagaiAsisten Pemerintahan dan Kesra menggantikan Drs HMTulen. Hanuzar Rawi yang juga staf ahli sebagai Asisten ADM. Makmur Ginting sebagai staf ahli bidang hukum dan politik dan jabatan Kadis Pasar dan Perindag dijabat oleh Drs HM Tulen. Dra Nani Sundari sebagai staf ahli bidang pemerintahan menjadi Kadis Kependudukan dan Catpil diserahkan kepada Iswan,S.Sos yang selama ini sebagai Kadis Tenaga Kerja. Dr HT Murad El Fuad staf ahli bidang kemasyarakatan dan SDM. JabatanKadisKesehatandiisioleh dr Agusnadi Tala. H Asnawi, S.Sos sebagai staf ahli bidang ekonomi dan keua-

ngan.KemudianHMYasriselama ini staf ahli ditetapkan menjadi Kadis Tenaga Kerja. Alfi Syahriza,ST,M,ENG,SC menjadi Kadis PU menggantikan Hj Mariani. Kadis Pendidikan Drs H Dwi AnnangWibowo. Kadis Pertanian Ir Edi Gunawan, sedangkan Drs Kongsi Tarigan menjalani masa pensiun.DrsJanuAsmadisebagai Kadispora,sedangkan Drs Darmanto akan dikembalikan menjadi guru. Drs Ezidin Kalo sebagai Kadis Koperasi dan UKM. Di eselon III, tiga penjabat penting selama ini juga dinonjobkan. Drs T Syarifuddin yang selama ini sebagai Ka SKB dilantik menjadiKabidPembinaanTenaga dan Pendidikan Luar Sekolah di Dinas Pendidikan. Bahkan penjabat di BKD bidang mutasi juga ikut dimutasi yaitu Drs M Uzeir Nasution yang dipercayakan menjadi Sekretaris Badan Kesatuan Bangsa. Mutasi di Pemko Binjai menurut keterangan, Rabu ( 12/1) akan terus bergulir apalagi ada SKPDyangakanmemasukimasa pensiun. Reformasi Birokrasi LSM P3 H Kota Binjai melalui Ketuanya Syamsuddin Damanik dan Sekretaris Mhd.Jaspen Pardede,Rabu(12/1)mendukung reformasi birokrasi olehWalikota Binjai. Namun Syamsuddin mengingatkan, reformasi birokrasi harus memilih figur yang tepat, jangan PNS yang sudah dinonjobkandidaerahlaindipakai di Binjai. Jaspen Pardede menyebutkan, kasus itu akan bernilai nepotisme. Penjabat yang diangkat hendaknya tidak berdasarkan “balas jasa” . Disebutkan, tiga dari 15 eselon II yang dilantik terkesan

mengangkangi Undang-undang no 23 tahun 2004 tentang Pemerintah Daerah babV yang direvisi menjadi Undang Undang No 12 tahun 2008. Pengangkatan eselon II harus mempuyaisyaratyaituatasusulan sekretaris daerah (Sekda) pasal 125 ayat 2 dan mempuyai satu jabatan tiga calon. Para calon yang akan dipromosikan dari luar daerah terlebih bertugas tiga bulan di daerah dimana tempat ia akan dipromosikan.Yang mengherankan lagi dalam pengangkataneselonIImasihadayang berstatus pejabat. Diakui, sebelumnya dalam pengangkatanduajabataneselon II Pemko Binjai pada September 2010 yang lalu ia telah menyurati DPRD Kota Binjai untuk memanggil Sekretaris Daerah KotaBinjaiselakupengusulpengangkataneselonII(pengangkatan BKD dan Ka Rumah Sakit Djoelham Binjai, sekaligus pengusulan pengangkatan camat dari empat kecamatan). Namun hingga saat inipanggilanuntukpertanggungjawabanbelumadaklarifikasinya. Sementara itu Ketua DPRD Kota Binjai Ir H Haris Harto ketika dikonfirmasi wartawan seputar masuknya surat klarifikasi dari LSM Peduli Politik Pemerintah Hukum Smatera Utara (P3H-SU) Kota Binjai untuk memanggil Sekda dan BKD, pihaknya membenarkan. Diakui, dalam waktu dekat ini masalah itu akan dipertanyakan dan memanggil pihakpihak yang berkompeten. Sedangkan Kepala BKD Kota Binjai Drs H Amir H ketika dikonfirmasi wartawan mengenai pengangkatan jabatan eselon II Pemko Binjai, pengangkatan pejabat eselon II Pemko Binjai sudah mengikuti prosedur yang berlaku. (a03/a04)

Umat Islam Harus Peduli Makmurkan Masjid

Waspada/Ibnu Kasir

pengangkatan guru-guru sertifikasi harus melalui pengawas sekolah. Ketua APSITebingtinggi, Drs Hazairin Sitorus, MPd. salam sambutannya mengatakan, selamainihubungan komunikasi antara pengawas sekolah dan pengawas madrasah agak macet. Dengan terbentuknya APSI ini, hubungan komunikasi dapat terjalin lebih baik. Kompetensi dan keberadaan APSI untuk meningkatkan pendidikanyangbermutudiKota Tebingtinggi oleh karena itu perlu dukungan semua pihak terutama Pj.Walikota, Kemenag, Pengurus APSI Provinsi dan APSI Pusat. Pengurus APSI Kota Tebingtinggi yang dilantik, Ketua Drs Hazirin Sitorus, MPd, Sekretaris Ulil,Spdi.BendaharaHj.Ernawati Siregar serta wakil ketua dan dilengkapi bidang-bidang. Hadir di antaranya Kadis Pendidikan Drs PardameanSiregar,Kemenag T.Tinggi Asbul Husaini, Wakil Ketua Dewas Pendidikan Drs Abdul Khalik, MAP, Kepala PerpustakaanDrs Zahidin,MPdserta hadir puluhan pengurus APSI daerah Kabupaten Sergai, Batubara,SimalungundanKabupaten Deliserdang. (a08/a09)

Pemko Binjai Gelar Mutasi Besar-besaran

Bupati Langkat

BANTUAN: Bupati Langkat H Ngogesa Sitepu ketika menyerahkan bantuan 20 kodi seng untuk pembangunan RA Raudathul Jannah seusai meresmikan Masjid As-Syuhada di Dusun Kantil, Desa Padangbrahrang, Kec. Selesai, Selasa (11/1).

didikan S1 dan S2. Sedangkan 1.480 orang lainnya atau 40,43 persen berpendidikan SLTA, D1, D2 dan D3. Di antara jumlah itu, 1340 orang sedang mengikuti pendidikan S1. Dilantik 37 orang pengawas sekolah dan madrasah yang tergabung dalamAsosiasiPengawasSekolah Indonesia (APSI) Kota Tebingtinggi priode 2011-2015 dilantik Ketua APSI Provinsi Sumut. Ketua APSI Provinsi Sumut Drs Gunawan Ginting yang melantik APSI Tebingtinggi mengatakan, organisasi APSI baru ini terbentuk di Kota Tebingtinggi. Organisasiinibesarkalauanggota bersatu dalam meningkatkan kualitas pendidikan sehingga keberadaanyaterasabagimasyarakat. Diakuiposisipengawasselalu berubah-ubah dan terjadi pergantian posisi. Hal itu diakui karenapengawasmemilikipengetahuan yang handal sehingga seringditempatkandipadabagian lain. “Pengawas itu adalah gurunya guru. Guru meminta petunjuk kepada pengawas,” ucap Gunawan. Berdasarkan peraturan menteri, pengawas harus mengawasi perekrutan kepala sekolah, serta

STABAT (Waspada): Masjid yang megah bukan hanya dipandang dari sisi bangunan fisiknya semata, akan tetapi terletak pada kepedulian ummat dalam memakmurkannya. Masjid sebagai salahsatupilarkekuataneksistensi bagi berhimpunnya beragam masyarakat dalam menyatukan diri selain kaitan Habluminallah juga Habluminanas. ‘’Selaintempatibadahmasjid jugamerupakanpusatkehidupan komunitas muslim,’’ kata Bupati Langkat H Ngogesa Sitepu saat memberikan sambutan di acara peresmian Masjid As-Syuhada, Dusun Kantil, Desa Padangbrahrang, Kecamatan Selesai, Selasa (11/1). Bupati mengharapkan agar jamaah masjid dapat memakmurkan masjid ini dengan berba-

gai kegiatan pengajian, kajian agama, diskusi dan kegiatan perayaan hari besar Islam. Bupati yang hadir bersama keluarga besar Ikatan Alumni Pendidikan Pamong Praja (IKADIK-PP)KabupatenLangkat, memandang pentingnya memfokuskan pemahaman religius pada setiap kegiatan di masyarakat yang berdampak pada kebaikan akhlak generasi muda. Sebelumnya Camat Selesai mengucapkan selamat datang kepada rombongan Bupati dan Muspida dan mengucapkan ribuan terima kasih mewakili seluruh masyarakat kecamatan karena berkat bantuan bupati secara pribadi, para donatur dan masyarakat selama kurun waktu 4 tahun Masjid As-Syuhada dapat berdiri dengan megah .

Usai meresmikan Masjid AsSyuhada, bupati melakukan penanaman 200 pohon mahoni danmenyerahkanbantuan5kodi seng untuk rehab RA Raudathul Jannah yang berada berdekatan dengan Masjid As-Syuhada sebagai rangkaian kegiatan IKADIK-PP menyambut Hari Jadi Langkat ke-261. Acara peresmian masjid juga diisi tausiyah yang disampaikan Al-Ustadz H Irfan Yusuf. Hadir dalam acara itu di antaranya Asisten Adm Ekbangsos dr H Indra Salahuddin, pengurus IKADIK yang diketuai Drs H Astaman, Ketua MUI H Saleh Hamid, sejumlah SKPD, unsur pengurus pengajian Al Hidayah, unsurMuspikaSelesaisertatokoh masyarakat setempat. (a01)

Waspada/Nazelian Tanjung

SANTAI DI JAM DINAS: Sekira sepuluh orang para Pegawai Negeri Sipil (PNS) Pemko Binjai walau sudah pukul 09:15 masih santai sarapan di warung depan kantor DPRD Kota Binjai dan terkesan tidak ada beban. Foto direkam Rabu (12/1).

Aksi Jambret Di Jalinsum P. Brandan Semakin Berani P.BRANDAN (Waspada): Aksi jambret di Jalinsum P.Brandan semakin berani. Kamis (12/1) siang, Maimunah, 24, warga Dusun I, Sei. Tualang, Kec. Brandan Barat, terpaksa kehilangan kalung emas akibat dijambret dua pria mengendarai sepeda motorYamahaVixon, Rabu (12/1) di Jalinsum depan Rumah Makan Shimpony Bukit I. Menurut keterangan korban kepada Waspada saat membuat pengaduan ke Mapolsek, saat itu ia mengendarai sepeda motor Yamaha Mio berboncengan dengan ibunya, Ramisem, 62, rencananya hendakberbelanjakeP.Brandan.Diperjalanan,duapenjahatmemepet sepeda motornya lantas memukulkan wajah korban dengan baju kaos. Salah seorang dari pelaku yang duduk diboncengan dengan gerak cepat menyambar kalung emas seberat 1,5 mayam dari leher, Maimunah, lalu kabur dengan memacu kecepatan sepeda motornya. Aksi jembret ini membuat korban spontan berteriak dan berupaya melakukan pengejaran. Kapos Lantas Bukit I, Aiptu Risman Tambunan yang saat itu berada di depan pos merasa curiga melihat korban berteriak. Bersama anggota Kapos melakukan pengejaran. Namun, sesampainya di pertigaan Jalan Thamrin, petugas lalulintas itu kehilangan jejak kedua pelaku jambret yang mengendarai sepeda motor Yamaha Vixon. Empat hari sebelumnya, dua pasangan kekasih juga menjadi korban aksi perampokan di kawasan jalan lingkar yang menghubungi Alurdua, Kec. Sei. Lepan ke Desa Securai, Kec. Babalan. Akibat aksi itu, Lukmanul Hakim, 19, warga Gg Armenia, Kel. Sei. Bilah Barat, Kec. Sei. Lepan, kehilangan sejumlah uang, handphone dan jam tangan. Tiga pelaku tidak hanya menguras barang dan uang, tapi juga menganiaya korban sehingga wajah dan bagian mata korban mengalami luka memar. Persitiwa ini telah dilaporkan ke Mapolsek setempat dan hingga kini polisi masih melacak identitas para penjahat.(a02)


Sumatera Utara

B2

Tiga Tahun Ke Depan Labura Jadi Kabupaten Percontohan

WASPADA

Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir

Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini dan Artikel: Dedi Sahputra. Redaktur Edisi Minggu & Akhir Pekan: Hendra DS. Redaktur Berita: H. Akmal AZ, H. Halim Hasan. Redaktur Kota Medan: Muhammad Thariq. Redaktur Sumatera Utara: M. Zeini Zen. Redaktur Aceh: Rizaldi Anwar. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: Edward Thahir. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Armin R. Nasution. Redaktur Agama: H. Syarifuddin Elhayat. Kalitbang: Hj. Emma Sujianti Tarigan. Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumut), Aji Wahyudi (Aceh). Asisten Redaktur: David Swayana (Kota Medan, Infotainmen); Irwandi Harahap (Kota Medan); Feirizal Purba, Diurna Wantana (Sumatera Utara); H.T. Donny Paridi (Aceh); Armansyah Thahir (Aceh, Otomotif); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); Hj. Ayu Kesumaningtyas (Kesehatan). Wartawan Kota Medan: Umum: Zulkifli Harahap, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, David Swayana, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Hasanul Hidayat, Rustam Effendi, Mursal Alfa Iswara. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Dedek Juliadi, Hajrul Azhari, Syahrial Siregar, Khairil Umri Batubara. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian W, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebing Tinggi: Muhammad Idris, Abdul Khalik. Pematang Siantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Pakpak Bharat: Arlius Tumanggor. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Asahan: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun. Kuala Simpang: Muhammad Hanafiah. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, Agusni AH, H. Samsuar. Lhoksukon: Musyawir. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin. Takengon: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapak Tuan: Zamzamy Surya. Blang Pidie: Sudarmansyah Putra. Kutacane: Ali Amran. Blangkejeren: Bustanuddin, Wintoni. Bener Meriah: Irham Hakim. Singkil: Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan Waspada dilengkapi dengan kartu pers. Tidak dibenarkan menerima uang dalam bentuk apapun. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: redaksi@waspadamedan.com KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan: hitam-putih Rp. 33.000,-, berwarna Rp. 90.000,Ukuran kolom: 40,5 mm. E-mail Iklan: iklan@waspadamedan.com Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Bandar Togel ‘Aman’ Di Langkat STABAT (Waspada): Aksi perjudian togel hingga kini tidak hentihentinya beroperasi di Kab. Langkat.Walau aparat kepolisian banyak meringkus juru tulisnya, namun mata rantai perjudian tersebut tidak dapat diputus karena sang bandar belum ada yang tertangkap. Umumnya pelaku juru tulis yang tertangkap saat diinterogasi polisi mengakui menyerahkan kepada siapa uang hasil pemasang, namun tidak diketahui kendala penyidikan hingga oknum berkelas bandar belum ada yang ditangkap. Di Stabat, dalam sepekan terakhir, lebih dari dua pemuda pengangguran mengaku mendapat tawaran menjadi penulis togel dengan iming-iming jika tertangkap dapat diurus hingga bebas, atau selama menjalani hukuman biaya makan keluarga ditanggung. Sementara polisi yang sewaktu-waktu menerima laporan dari masyarakat adanya perjudian dimaksud, tetap merespon menahan sang juru tulis yang merupakan garda depan bisnis ilegal itu, meskipun dalam tiga pekan terakhir ada dua juru tulis togel warga Stabat yang penahanannya ditangguhkan. Kapolsek Stabat AKP Risya Mustario ketika dimintai tanggapannya terkait maraknya judi togel dan belum adanya bandar yang diringkus untuk memutus mata rantai perjudian, Rabu (12/1), menanggapi pihaknya tetap berkomitmen memerangi togel dan bentuk judi lainnya. (a38)

WASPADA Kamis 13 Januari 2011

AEKKANOPAN (Waspada) : Bupati Labuhanbatu Utara H Kharuddin Syah bertekad akan menjadikan Labura sebagai kabupaten percontohan di Sumatera Utara dalam bidang pendidikan. “Insya allah tiga tahun ke depan pendidikan di Labuhanbatu Utara lebih maju dari kabupaten lain, bahkan bisa dijadikan kabupaten percontohan di bidang pendidikan,” kata Kharuddin Syah (H Buyung) saat membuka workshop perakitan Laptop/ Netbook, MGMP SMK seLabura di SMK swasta Zauhari Damuli, Kecamatan Kualuh Selatan, Rabu (12/1). Dijelaskan, sebagai Kepala Daerah Labuhanbatu Utara, dia merasa bangga dan terharu atas semangat para guru yang bergabung dalam Musyawarah Guru Mata Pelajaran (MGMP) SMK bekerjasama dengan Musyawarah Kerja KepalaSekolah(MKKS)yanginginmelaksanakan peningkatan kualitas dan keterampilan guru

Waspada/Syahri Ilham Siahaan

TINJAU: Bupati Labuhanbatu Utara H Kharuddin Syah meninjau workshop perakitan laptop/ notebook MGMP SMK di SMK Swasta Zauhari Damuli, Rabu (12/1).

Wakil Ketua DPRD Labura Terancam Lengser Anggota DPRD Sesalkan Penahanan AEKKANOPAN (Waspada): Posisi HAP yang tersangkut kasus dugaan penipuan dan kini mendekam dalam Lembaga Pemasyarakatan Rantauprapat terancam lengser dari posisi Ketua DPRD Labura dan Wakil Ketua Partai Hanura Labura. Menurut sumber dari seorang pengurus anak cabang Partai Hanura Kecamatan Kualuhhulu, Rabu (12/1), Partai Hanura Labura saat ini sedang melaksanakan rapat kerja cabang (rakercab) guna membicarakan pelaksanaan musyawarah cabang (Muscab) Hanura Labura. “Dalam rakercab berkembang usulan dari tujuh pengurus anak cabang di Labura mendukung Edi Susanto Ritonga yang kini menjabat ketua sementara menjadi Ketua DPC Partai Hanura Labura,” katanya seraya me-

nambahkandalamMuscabnanti EdiSusantoRitongaakanmuncul sebagai kandidat tunggal calon Ketua DPC Hanura Labura. Disinggung mengenai posisi HAP, sumber menuturkan kemungkinan besar HAP tidak akan masuk dalam susunan kepengurusan karena saat ini HAP masih ditahan di dalam lembaga pemasyarakatan dan itu berarti posisi HAP sebagai anggota dan Wakil Ketua DPRD Labura juga terancam. Disesalkan Namun di lain pihak, penahananWakil Ketua DPRD Labura HAP oleh PN Rantauprapat disesalkan anggota DPRD Labura EriGusriSianipar,karenaperkaranya hanya berawal dari utang piutang saat bisnis jual beli buah kelapa sawit. “Semestinya HAP tidak perlu ditahan sampai putusan pengadilan ditetapkan kepadanya karena masalahnya merupakan pidana ringan serta banyaknya tugas yang dihadapi di DPRD Labura,” kata Eri Gusri di Aek-

kanopan, Rabu (12/1). Selain itu, kata Eri, HAP juga tidak akan kabur sampai perkara yang dihadapinya selesai. Selain itu upaya hukum telah dilakukan penasehat hukumnya agar status tahanannya menjadi tahanan kota, namun belum dikabulkan. Dia berharap permohonan untuk mengalihkan status tahanan HAP jadi tahanan kota dikabulkan, bila perlu jaminan untuk ituiadansejumlahanggotadewan lain siap menjaminnya. Eri Gusri mengimbau agar lembaga pemerintah yang ada harus saling menjaga kehormatan, artinya bila ada perkara yang dilakukan oknum yang aktif disalahsatulembagapemerintah itu hendaknya ditelaah dulu dengan arif. “Kalau perkaranya tidak terlalu berat jangan terus dilakukan penahanan terhadap oknum tersebut dan seharusnya sesama lembaga pemerintah itu harus mencari solusi untuk penyelesaian yang terbaik,” jelas Eri. (a29/csi)

mengikuti perkembangan dan kemajuan teknologi. “Dengan pelatihan ini saya harapkan dapat menciptakansiswayangterampilmerakitkomputer maupun laptop dan apabila terus dikembangkan dapat dijadikan industri sekolah ataupun home industribagilulusanSMKdiLabura,”jelasHBuyung didampingi Asisten I Pemerintahan HM Amin Daulay, Kabag Humas Syahrul Adnan Hasibuan dan Camat Kualuh Selatan Marwan. Ketua Panitia MGMP Kabupaten Labuhanbatu Utara Rahmad mengatakan, workshop perakitan laptop dan netbook pesertanya guru dan siswa SMK sebanyak 20 orang, terdiri dari 14 SMK Negeri dan Swasta di Labura, dan menghadirkan tim tutor/ tenaga ahli dari SMK Zyrex Medan. Sebelumnya dihari yang sama Bupati Labura H Kharuddin Syah menyerahkan bantuan kepada 14 orang petugas Kebersihan berupa, topi, baju, sarung tangan dan sepatu. (csi)

Kepemilikan Tanah Di Rantau Lama Berkekuatan Hukum MEDAN (Waspada) : Kepemilikan tanah di Jalan Rantau Lama Labuhanbatu sudah berkekuatan hukum tetap. Demikian disampaikan H Ilham Sagala, selaku kuasa hukum dari Ahmad Muhajir Damanik, Selasa (11/1) terkait kekuatan hukum yang sudah dimiliki kliennya. “Klien kami membeli tanah itu tahun 2003 dariahliwarisBagindaSoilangonyangperkaranya di Pengadilan Tinggi Sumut menang dan berkekuatan hukum tetap (inkrah),” katanya. Menurutnya, adanya pihak dari ahli waris Marasangka yang menyatakan tanah itu masih dalam sengketa, karena putusan kasasi dari Mahkamah Agung (MA) belum turun, hal itu bukanmenjadiurusanAhmadMuhajirDamanik. Sebab, sewaktu tanah itu dibeli dari ahli waris Baginda Soilongon sudah berstatus “inkrah”. Artinya, tidak tersangkut-paut lagi dengan perkara di pengadilan. Apalagi, lanjut Ilham Sagala, permohonan kasasi dilakukan ahli waris Marasangka Siregar yang kalah dalam perkara banding di PT Sumut sudah melampaui batas dibenarkannya mengajukan kasasi yakni 14 hari setelah diterima surat pemberitahuan tentang putusan banding itu tidak dimanfaatkan, maka otomatis permohonan kasasi ke MA gugur atau kadaluarsa. “Rentang waktu 10 tahun baru pihak yang kalah di PT Sumut mengajukan kasasi ke MA, maka tidak ada lagi hak untuk mengajukan kasasi ke MA,” tegasnya sembari menyebutkan tidak ada alasan atau dasar hukum pihak yang mengklaim tanah berukuran 17 x 112 meter itu sebagai

miliknya, kecuali hak milik secara penuh oleh Ahmad Muhajir Damanik. Perkara tanah berukuran 17 x 112 meter itu berawal ketika Marasangka mengajukan gugatan ke PN Rantauprapat terhadap Baginda Soilangon. Dalam perkara itu dimenangkan Marasangka Siregar berdasarkan putusan PN Rantauprapat bernomor 6/Perd/1975/PN Rap tanggal 8 April 1975. IlhamSagalamenambahkan,BagindaSoilangon mengajukanbandingkePTMedan.Dalam putusan hukumnya, PT Sumut mengabulkan permohonan bandingBagindaSoilangonmelaluiputusanNo.267/ Perd/1975/PT Mdn tanggal 27 Oktober 1975, sehingga membatalkan putusan PN Rantauprapat bernomor 6/Perd/1975/PN Rap tanggal 8 April. “Tetapi, surat pemberitahuan putusan PT Medan oleh Hubbanuddin Rangkuti selakuWakil JurusitapadaPNRantauprapat kepada Marasangka Siregar pada 26 Januari 1976. Dalam rentang waktu 10 tahun lebih, Marasangka Siregar tidak memanfaatkan hak mengajukan kasasi. Pada 8 September 1996, dia mengajukan permohonan kasasi ke MA melalui PN Rantauprapat yang keluar risalah pernyataan permohonan kasasi dari PN Rantauprapat. “Sekarang, kepemilikan tanah milik klien saya berukuran 17 x 112 meter di Jalan Rantau Lama, Kelurahan Bakaran Batu, Rantau Selatan, Rantauprapat berkekuatan hukum tetap, karena memiliki sertifikat dari BPN Labuhanbatu yang jual-belinya di hadapan Notaris PPAT Ahmad Ramli berkedudukan di Rantauprapat,” ujarnya. (m37)

Disalahgunakan, Kamar Rusunawa Dikosongkan T. TINGGI ( Waspada) Sebanyak 53 kamar di Rusunawa (rumah susun cara sewa) di Jalan Syech Beringin, Tebingtinggi terpaksa dikosongkan. Pasalnya tempat itu disebut-sebut sering disalah gunakan menjadi tempat mesum. KepalaUPTRusunawa,Abdul Khayat Sinambela didampingi Kepling Hasanuddin Lubis, Senin (10/1) mengatakan, penghuni kamar rusunawa terpaksa disuruhpindah,karenamenggunakan kamar tempat penampungan perempuan dan laki-laki. Hal itu terbukti setelah mereka menangkap seorang laki-laki yangsedangtidurhanyamemakai celana dalam di kamar seorang istrioknumpolisiyangsudahpisah ranjang,Minggu(9/1)sekirapukul 15:30. Penangkapan bersama Satpam, Kepling Rusunawa Hasa-

nuddin dan anggota Polsek Padang Hilir terhadap seorang pria, Bu,30, warga Jalan Abdul Muis, Tebingtinggi sedang tidur hanya memakai celana dalam di kamar seorang istri Polisi yang sudah pisah ranjang, N.H,40. Kini kasus itu sudah ditangani Polsek Padang Hilir. Istri polisi yang sudah pisah ranjang itu sudah sering diperingati agar tidak membawa orang lain, apalagi laki-laki yagn bukan mukrimnya ke dalam kamar. Namun peringatan tersebut tidakdiindahkansehinggadengan tertangkapnya seorang laki-laki yang bukan suaminya maupun saudaranya sedang tidur di kamarnya. Kamarnya terpaksa dikosongkan dan ia harus segera pindah. Sinambela mengatakan, pihaknyatetapmelakukanpenertiban dan razia terhadap seluruh

penghuni Rusunawa sebab selamainidicurigaibanyakkamar yang dijadikan sebagai tempat mesum baik oleh peremuan maupun laki-laki. Dari hasil penertiban dan razia, 53 dari 192 kamar Rusunawa terpaksa dikosongkan dan penghuninya disuruh pindah. Walaupun begitu, sebut Sinambela, pihaknya masih tetap ada menemukan kamar Rusunawa yang diduga digunakan sebagai tempat mesum. “Kita akan kembalikan fungsi Rusunawa sebagaimana mestinya,” tegas Sinambela yang baru 4 bulan bertugas menjabat Kepala UPT Rusunawa Tebingtinggi. Untuk memberikan rasa jera, pihak Rusunawa dan Polsek Padang Hilir terus melakukan razia agar fungsi utama rumah benarbenar dijalankan. (a09)

SMPN 1 Binjai Jalin Kerjasama Dengan SMK Pulau Pinang BINJAI (Waspada): SMP Negeri1Binjaimenjalinkerjasama dengan SMK Penang Free dan SMK Kampung Selamat Pulau Pinang Malaysia. Penandatanganan MoU kerjasama sister school dilakukan oleh Haji Ramli bin Din, Kepala SMK Penang Free, Arsun Binti Jasin kepala SMK Kampong Selamat Pulau Pinang, dengan Drs H Hasmir , MPd, Kepala

SMP Negeri 1 Binjai disaksikan Wakil Walikota Timbas Tarigan, Selasa (11/1) di Balai Kota Binjai. Menurut Hasmir , kerjasama meliputi pertukaran guru dan pelajar, pertukaran informasi kurikulum, pertukaran informasi tentang budaya lokal , pertukaran bahan ajar, metode serta strategi pembelajaran. Penandatangan ini akan ditindaklanjuti, keberangkatan

Waspada/Riswan Rika

CENDERA MATA: Wakil Walikota Binjai Timbas Tarigan menyerahkan cenderamata kepada kepala SMK Penang Free H Ramli bin Din dan Kepala SMK Kampong Selamat Arsun Binti Jasin usai penandatanganan kerjasama Sister School antara SMP Negeri 1 Binjai dengan SMK Penang Free dan SMK Kampong Selamat Pulau Pinang Malaysia, Selasa (11/1).

guru dan siswa 15 Januari terdiri 11 guru dan 24 siswa rintisan sekolah berstandar internasional (RSBI) SMP Negeri 1 Binjai ke PulauPinang.Paragurudansiswa ini akan ikut belajar dan ikut upacara di SMK Penang Free dan SMK Kampong Selamat. Hasmir menambahkan, program ini sebagai tindak lanjut dari program pemerintah pusat agar RSBI memiliki wawasan global perlu mencari sister school. “Untuk Provinsi Sumut, baru Kota Binjai yang telah membuat MoU dengan sekolah luar negeri, “ jelas Hasmir. Wakil Walikota Timbas Tarigan menilai kerjasama ini merupakan langkah positif untuk meningkatakan kualitas pendidikan di Kota Binjai. Timbas mengingatkan kerjasamainiharusdievaluasi hasilnya sehingga dapat diketahui manfaatnya dan apa yang harus diperbaiki. Evaluasi juga perlu terhadap program RSBI. Timbas TariganberharapRSBIhendaknya tidak sekedar beda ruangan dan beda pakaian seragam saja tetapi harus bisa melahirkan siswa pintar tapi juga berkualitas dan berkarakter. (a03)

Waspada/Rasudin Sihotang

UANG HASIL KORUPSI: Tersangka dugaan pelanggaran PP No.109 Tahun 2000, SH mengembalikan sisa uang korupsi sejumlah Rp447 juta lebih kepada Kajari Tanjungbalai melalui pengacara dan anak kandungnya, Selasa (11/1).

Mantan Walikota T. Balai Tuntaskan Pengembalian Uang Korupsi PP 109 TANJUNGBALAI (Waspada): Mantan Walikota Tanjungbalai SH tersangka korupsi PP 109 menuntaskan pengembalian uang hasil korupsi negara kepada Kejaksaan Negeri Tanjungbalai sebesar Rp447,5 juta, sementara tersangka mangkir dari pemeriksaan dengan alasan sakit, Selasa (11/1). Informasi dihimpun menyebutkan, uang itu dikembalikan melalui anak kandungnya Etty Puspita Sari beserta kuasa hukum tersangka Sahat Halomoan Tambunan dan L Simbolon. Hinggasaatini,tersangkamasihdirawatdiRumah Sakit Permata Bunda Medan, karena menderita kanker prostat stadium 1b dan harus menjalani pemeriksaan rutin di RSUD Pirngadi dua kali dalam seminggu. Kajari Tanjungbalai Herry Sunaryo didampingi Kasi Pidsus PDE Pasaribu saat temu pers mengatakan, tersangka harus dirawat medis dan kemotrapi secara rutin hingga 13 Januari 2011 dan wajib beristirahat selama dua minggu ke depan. Selain menyerahkan sisa uang korupsi, anak danpengacarajugamenyampaikansuratpermohonan agar Kejari melakukan pemeriksaan lanjutan di Medan mengingat perjalanan dari Medan menuju Tanjungbalai cukup jauh dan pertimbangan kesehatan tersangka. “Permohoan mereka itu akan kita teruskan ke Kejatisu,” ujar Kajari sembari memperlihatkan surat keterangan inap di rumah sakit yang bersangkutan. Lebih lanjut dikatakan Kajari, penanganan kasus dugaan korupsi mantanWalikotaTanjungbalai itu tetap berjalan dan untuk pemeriksaan

lanjutan dilakukan pada 26 Januari 2011, namun tempat belum dapat dipastikan di Medan atau Tanjungbalai. PantauandiKejaksaanTanjungbalai,penasehat hukum tersangka tiba pada pukul 10:30 menuju ruangan Kasi Pidsus dan melakukan pertemuan tertutup. Namun sekira pukul 12:20, PH keluar dari ruangan dan kembali lagi bersama anak kandung tersangka dengan membawa uang tunai Rp337.500.500. Lalu sekira pukul 17:00, PH dan anak tersangka meninggalkan Kejaksaan Negeri Tanjungbalai. MantanWalikota Tanjungbalai SH mengembalikan uang Rp500 juta melalui penasehat hukum dan anaknya pada pemeriksaan beberapa pekan lalu. Tersangka diperiksa karena dugaan pelanggaran PP No.109 Tahun 2000 tentang kedudukan keuangan kepala daerah pada TA 2001-2004. Unjuk Rasa Sementara, pemeriksaan kasus dugaan pelanggaran PP No. 109Tahun 2000 dengan tersangka mantanWalikota Tanjungbalai itu diwarnai unjukrasa.Aksimassaitumempertanyakandugaan korupsi pengadaan alat-alat kesehatan (Alkes) seniai Rp3 miliar lebih di Dinas Kesehatan Kota Tanjungbalai. Menyikapi hal itu, Kajari melalui Kasi Pidsus PDE Pasaribu dan Kasi Intel Kifli R Harahap mengatakan, dugaan korupsi tersebut masih tahap penyidikandanmembutuhkanpemeriksaanuntuk melengkapi data. Ditambahkan Kasi Intel, saat ini kinerja Kejaksaan tersita untuk menangani kasus PP 109 dengan tersangka mantan walikota itu. (crs)


WASPADA Kamis 13 Januari 2011

B3

Sumatera Utara

Baliho Rusak Keindahan Tugu Pahlawan RANTAUPRAPAT(Waspada): Pemkab Labuhanbatu dinilai tidak peduli dan tidak pernah merespon keluhan para Pengurus Dewan Harian Cabang (DHC ) Angkatan 45. Organisasi pejuang itu berulangkali mengusulkan agar tiang dan kerangka permanen dari besi tempat pemasangan Baliho bergambar dr Tigor Panusunan Siregar berukuran raksasa yang terpajang di depanTugu Pahlawan di Jalan Jendral Sudirman Rantauprapat itu segera dibongkar karena dinilai merusak pemandangan dan keindahan serta keberadaan Tugu Pahlawan yang menjadi kebanggaan masyarakat Labuhanbatu khususnya masyarakat Kota Rantauprapat. Wakil Ketua DHC Angkatan 45 Labuhanbatu Abdul Hakim Lubis, Rabu (12/1) kepada wartawan di Rantauprapat, atas nama pengurus DHC Angkatan 45 merasa keberatan dengan pemasangan baliho yang berada di depan Tugu Pahlawan itu. Selain merusak pemandangan juga merusak keindahan serta kelestarian lingkungan di lokasi Tugu Pahlawan, karena dengan terpajangnya baliho ukuran raksasa bergambar dr Tigor Panusunan Siregar Bupati Labuhanbatu di depan Tugu Pahlawan itu, maka dengan sendirinya keberadaan Tugu Pahlawan tidak lagi kelihatan dan sudah tak sedap dipandang mata. Menurut Hakim Lubis, bagaimana masyarakat Labuhanbatu mau menghargai para pahlawannya, kalau aparat di jajaran Pemkab terutama Bupatinya sendiri tidak peduli dengan Tugu Pahlawan sebagai salah satu peninggalan sejarah. Padahal, kata Hakim Lubis, pihaknya sudah berulangkali mengingatkan serta mengkoordinasikan hal ini dengan Pemkab Labuhanbatu, tapi sampai saat ini tidak pernah ditanggapi, padahal lokasi Tugu Pahlawan yang terletak di seputaran simpang enam kota Rantauprapat itu termasuk salah satu taman kota yang sejuk, nyaman dan asri. (c01)

Kasus Bocah Korban Terbakar Makin Tak Jelas TALAWI (Waspada) : Nasib Ika Amalia, 10, bocah warga Batubara korban terbakar yang mengalami cacat seumur hidup dan diproses di Polres Asahan hingga kini tak jelas. Pasalnya Siti Hawa ibu korban yang tinggal di Desa Mesjidlama Talawi, Rabu (12/1) merasa kecewa karena tidak mendapat kepastian berkas perkara yang menimpa anaknya Ika diproses juper Unit Perlindungan Anak Polres Asahan sudah dilimpahkan ke kejaksaan. Siti Hawa mengaku, dia sudah datang ke Polres Asahan, Senin (10/1) menanyakan sejauhmana hasil proses perkara anaknya itu. “Berkas perkara anak ibu sudah saya limpahkan ke kejaksaan Kisaran,” ujar Siti Hawa menirukan ucapan oknum Polwan selaku juper menangani perkara korban Ika. Mendengar penjelasan oknum juper tadi, ibu korban mendatangi Jaksa Erta. Namun dia tambah bingung karena berkas yang disebutkan tidak pernah dikirim juper bersangkutan. Merasa dipermainkan, ibu korban esoknya kembali mempertanyakan nasib anaknya itu ke Polres dan masih memberikan jawaban sama sudah dilimpahkan ke jaksa. (a30)

Dana Bantuan Mahasiswa Di Dinas Pendidikan L. Batu Dipertanyakan RANTAUPRAPAT(Waspada):Adanyabantuandanayangdiberikan kepada mahasiswa berprestasi dan dianggarkan di APBD tahun anggaran 2010 di Dinas Pendidikan layak dipertanyakan. Pasalnya pagu yang dana dianggarkan sekitar Rp280 juta hanya diberikan kepada sepuluh mahasiswa berupa uang makan per bulan dan uang semester. Hal itu terungkap saat wartawan mengkonfirmasi Sumarso, Kabid yang menangani bantuan mahasiswa, Jumat (7/1). Dikatakan Sumarsobahwamemangbenaradabantuanbagikeluargamahasiswa berprestasi. Bentuk bantuan itu berupa biaya makan per bulan dan biaya uang semester. “Untuk uang makan kita berikan Rp500 ribu per bulan dan uang semester sekitar Rp600 ribu. Itulah yang dibantu,” katanya. Ditanya seputar pemberian dana, apakah langsung diberikan kepada mahasiswa berupa uang kontan atau dimasukan ke rekening mahasiswa, katanya bantuan itu diberikan ke mahasiswa langsung. Tapi saat ini belum diberikan karena menunggu hasil ujian berupa laporan dalam bentuk Kartu Rencana Studi (KRS). Sekretaris Dinas Pendidikan Adi S Purba juga membenarkan adanya bantuan untuk mahasiswa S1 Dan S2. Di akhir bulan dana yang telah dianggarkan itu sudah diusulkan untuk dicairkan. (c01)

Kredit Mobil Sudah Dibayar, Tapi Tidak Disetor Ke Bank P. SIANTAR (Waspada): Kredit satu unit mobil sudah dibayar melalui pengusaha show room, namun pengusaha show room tidak meneruskan pembayaran kredit itu ke bank hingga korban Rudi Saut Siregar, 31, guru, warga Jalan Meranti, Kelurahan Kahean, Kecamatan Siantar Utara, Kota Pematangsiantar mengadukan pengusaha show room ke Polres Simalungun dengan tuduhan penipuan atau penggelapan. Keterangan dihimpun dan pengaduan korban di Polres Simalungun, Selasa (11/1) menyebutkan Wa, 60, pemilik show room UD Ananda Mobil, Jalan Asahan, Nagori Siantar Estate, Kecamatan Siantar, Kabupaten Simalungun diduga melakukan penipuan dan penggelapan terhadap uang cicilan kredit korban di show room mobil milik Wa pada Kamis 1 Oktober 2010 pukul 14:00. Awalnya, korban membeli satu unit mobil kepada Wa dengan cara kredit dan membayar kreditnya kepada Wa. Namun, Wa tidak meneruskan pembayaran kredit mobil itu ke Bank Syariah Mandiri hingga pihak bank menarik mobil itu dari korban. Akibat ditariknya mobil itu, korban terpaksa membayar lagi kredit mobil ke pihak bank agar mobil itu dikembalikan. Kemudian, korban menghubungi Wa dan meminta kredit mobil yang sudah dibayarnya. Wa berjanji akan mengembalikan kredit mobil korban pada Kamis 1 Oktober 2010. Namun sampai batas waktu itu, Wa tidak mengembalikan kredit mobil korban hingga akhirnya korban mengadukan Wa ke Polres Simalungun. Kapolres Simalungun AKBP Drs. Marzuki, MM saat dikonfirmasi melalui Kasubbag Humas AKP Sulaiman Simanjuntak dan Kasat Reskrim AKP Nasrun Pasaribu, SIK di Mapolres, Rabu (12/1) menyebutkan pengaduan korban masih dalam penyelidikan dan Wa diduga melakukan penipuan atau penggelapan dan melanggar Pasal 372 atau pasal 378 KUH Pidana. (a14)

Tidak Bertanggungjawab Diadukan Ke Polisi P. SIANTAR (Waspada): Seorang pria, Am, 22, pegawai swasta diduga tidak bertanggungjawab terhadap perbuatan cabul yang dilakukannya hingga diadukan ke Polres Simalungun. Keterangan dihimpun dan pengaduan korban NS, 19, warga Huta III Karang Kari, Nagori Silampuyang, Kecamatan Siantar, Simalungun di Polres Simalungun, Selasa (11/1) menyebutkan Am diduga mencabuli korban di dalam rumah orangtua Am di Huta Ladang Kongsi, Nagori Pematang Silampuyang, Kecamatan Siantar, Simalungun pada rabu 23 September 2010 pukul 23:30. Am mencabuli korban di rumah orangtua Am dengan cara melakukan hubungan suami istri. Saat itu, Am menyatakan akan bertanggungjawab atas perbuatannya. Namun, sesudah ditunggutunggu sampai berbulan-bulan, Am tidak menepati janjinya hingga akhirnya, korban memberitahukan perbuatan Am terhadapnya. Keluarga Am tidak mau menerima perbuatan Am terhadap korban dan langsung mengadukan Am ke Polres Simalungun. Kapolres Simalungun AKBP Drs Marzuki, MM saat dikonfirmasi melalui Kasubbag Humas AKP Sulaiman Simanjuntak dan Kasat Reskrim AKP Nasrun Pasaribu, SIK di Mapolres, Rabu (12/1) menyebutkan pengaduan korban masih dalam penyelidikan dan Am diduga melakukan perbuatan cabul terhadap korban dan melanggar Pasal 293 KUH Pidana. (a14)

Waspada/Budi Surya Hasibuan

RUSAK KEINDAHAN: Baliho raksasa Bupati Labuhanbatu Dr Tigor Panusunan Siregar yang merusak keindahan kota Rantauprapat terpajang di depan Tugu Pahlawan tepatnya di Jalan Jenderal Sudirman Rantauprapat. Foto direkam, Rabu (12/1).

Dugaan Manipulasi Kelulusan CPNS Batubara

Rektor UI-Panitia Seleksi Dilaporkan Ke Mabes Polri MEDAN (Waspada) : Gerakan Rakyat Penyelamat Harta Negara (GERPHAN) melaporkan Rektor Universitas Indonesia (UI) dan Panitia Seleksi CPNS Daerah Batubara ke Mabes Polri terkait dugaan manipulasi kelulusan CPNS di daerah itu. “Laporan kami sudah masuk secararesmi Sabtu8Januari2011, “ kata Direktur GERPHAN Janto Dearmando, Rabu (12/1) kepada wartawan di Medan. Didampingi Koordinator GERPHAN Sumut Didhin Mahidin, Dearmando mengatakan, dari 362 orang yang diumumkan lulus oleh panitia, ternyata berdasarkan hasil scanning/scoring tim UI diketahui hanya 91 pelamar yang lulus murni. Sisanya 271 orang diduga kelulusannya dimanipulasi. Dikatakan Dearmando, pihaknyamendugaRektorUIdan Panitia Seleksi CPNSD Batubara berkolusi memanipulasi kelulusan peserta seleksi CPNSD Batubara tahun 2011.

Menurut Dearmando, berdasarkan tanda bukti Lapor Nomor : TBL/10/I/2011/Bareskrim tanggal 10 Januari 2010 disebutkan, dugaan pemalsuan dan atau menempatkan keterangan palsu atau dan korupsi dalam penerimaan CPNS, sebagaimana dimaksud pasal 263 dan 266 KUHP dan atau pasal 12B UU Nomor :20tahun2001tentangperubahan atas UU nomor: 31 tahun 1999 tentang pemberantasan tindak pidana korupsi. Berdasarkan surat Menpan RI nomor : B/3010/M.PAN-RB/ 10/2010, Pemkab Batubara mendapat jatah 370 formasi CPNSD terdiri dari tenaga pendidikan 156, tenaga kesehatan 75 dan tenaga teknis 139. Seleksi CPNS Pemkab Batubara tahun 2008 dan 2009 menggunakan jasa asistensi UI ditengarai juga bermasalah, sehingga atas desakan masyarakat maka agar mengganti UI dengan UN PAD Bandung, akan tetapi tidak jadi karena tidak adannya kesepahaman antara pejabat di sana. Dikatakan,padapelaksanaan seleksi pada 15 Desember 2010 ternyata naskah soal yang dibagikan UI hanya Tes Kompetensi

Dasar (TKD) yang terdiri dari 100 soal ,padahal seharusnya 200 soal yang terdiri dari TKD dan TKB. Katanya, penyimpanan naskah soal ujian yang tiba pada 14 Desember2010sekitarpukul18:00 di Batubara diduga tidak memenuhi standar keamanan rahasia negara karena disimpan dan diamankan di salah satu mess sebuah kantor perkebunan Kecamatan Limapuluh, bukan di Kantor Polisi sebagaimana ketentuan Badan Kepegawaian Negara (BKN) Koordinator GERPHAN SumutDidhinMahidinmenduga ada kolusi antara Panitia Seleksi CPNSD Batubara yang terdiri dari pejebat teras di sana. Diduga bereder isu peserta yang kelulusannya dimanipulasi tersebut telah membayar Rp100-150 juta per orang . Dalam konteks ini, tegas Mahidin, GERPHAN meminta agar Bareskrim Mabes Polri segera melakukan penyidikan terhadap kasus CPNSD Gate itu. Sebab dikhawatirkan kemungkinan ada upaya pihak menghilangkan dan merusak bukti-bukti berupa data seleksi di Pemkab Batubara maupun di UI. (m49)

JR Saragih: Selesaikan Sengketa Lahan Bandarbetsy Dengan Damai SIMALUNGUN (Waspada): Bupati Simalungun, JR Saragih, mengharapkan sengketa lahan antara pihak PTPN-III Bandarbetsy, Kec. Bandar Huluan, Kab. Simalungun dengan masyarakat dapat segera diselesaikan dengan hati yang bersih dan bijaksana, sehingga tidak ada yang merasa dirugikan. Demikian dikemukakan, Bupati Simalungun, JR Saragih, dalam rapat kordinasi bersama unsur muspida, BPN (Badan Pertanahan Nasional), dengan pihak PTPN-III membahas masalah sengket lahan kebun Bandarbetsy,dikantorbupatiSimalungun di Pamatang Raya, kemarin. Dikatakan bupati, Pemkab Simalungun dalam hal ini hanya sebagai sebagai penengah dan tidak menginginkan adanya korban dari sengketa lahan, baik dari pihak perkebunan maupun dari masyarakat. Kemudian penyelesaian masalah harus diawali dengan hati yang bersih, sehingga kebijakan yang diambil tidak

merugikan pihak-pihak yang bersengketa. “PemkabSimalungunadalah sebagai penengah dan tidak ingin ada korban dari masalah ini, baik dari pihak PTPN-III maupun masyarakat,”tegasJRSaragih,didampingi Wakil Bupati Simalungun Hj Nuriaty Damanik, SH dan Plt Sekda Drs Ismail Ginting M.Si. Halsenadajugadikemukakan KetuaDPRD Simalungun,Binton Tindaon, yang mendukung agar masalah sengketa lahan antara PTPN-IIIdanmasyarakattersebut dapat segeradiselesaikandarihati nurani yang paling dalam sesuai dengandatayangbenardansurat – surat yang legalitasnya dapat dipertanggungjawabkan. Dalam kesempatan tersebut, Dandim0207Simalungun,Letkol ARM Anton I Popang antara lain menyarankan, agar masalah ini jangan sampai berlarut – larut dan segera diambil langkah – langkahyangharusdibuat.Seperti memperjelas data kepemilikan lahan yang bermasalah saat ini.

Sedangkan, Kajari Simalungun, Tri Subardiman, SH. MH, menyampaikan bahwa mengingat lahan PTPN III merupakan asetnegarayangharusdiselamatkan. Dengan melihat permasalahan ini, Subardiman mengatakan pihaknya akan melakukan koordinasi dengan pihak PTPN III dan tim dari Kejatisu karena merekalah yang mengetahui permasalahan secara detail. Untuk, dia mengajak agar membicarakan dahulu tentang penyelesaian lahan yang tidak bermasalah sehingga status HGU bisa diperpanjang sebagai pedoman pihak PTP III, selanjutnya baru dibicarakan tentang lahan yang bermasalah untuk dicari jalan keluarnya. SementaraituManajerDistrik Simalungun PTPN-III, H Irfan Lubis pada rapat itu mengatakan hasil rapat akan dibawa ke Manajemen PTPN-III di Medan. Pihaknya berharap dalam waktu dekat akan ada solusi untuk menyelesaikan masalah lahan di kebun Bandarbetsy itu.(a15)

Waspada/Khairil Umri Batubara

POTONG KUE: Kepala Perwakilan Waspada Asahan, Tanjungbalai, Batubara, Nurkahim Nehe (tengah) sedang memotong kue Ultahnya ke- 46 tahun saat acara pembukaan Waspada Idol di Food Court Amaliun Pujasera, Minggu (9/1).

Pencuri Getah Perkebunan Tinggalkan Sepeda Motor P. SIANTAR (Waspada): Seorang pria tersangka pelaku pencurian getah milik perkebunan PTPN III Bandar Betsy yang belum diketahui identitasnya diduga takut ditangkap pihak pengamananperkebunanhinggameninggalkan sepeda motornya dan getah yang dicuri. Keterangandihimpundanpengaduanpihak perkebunan PTPN III Bandar Betsy di Polres Simalungun, Selasa (11/1) menyebutkan pencurian getah itu diduga dilakukan pria yang belum diketahui identitasnya di Afdeling II Bandar Betsy Tanam 1956, Kecamatan Bandar, Kabupaten Simalungun pada Senin (10/1) pukul 21:00. Pencurian getah itu diketahui ketika pengamanan perkebunan sedang melakukan patroli di tempat kejadian. Saat itu, pengamanan perkebunan melihat seorang pria yang tidak dikenal sedang membawa getah dengan mengenderai

satu unit sepeda motor Honda Astrea Prima tanpa plat nomor polisi. Pengamanan perkebunan segera berusaha menangkap pria yang tidak dikenal itu, namun pria itu langsung menjatuhkan sepeda motornya dan getah latex yang diduga dicurinya serta langsung melarikan diri. Pria yang tidak dikenal itu tidak berhasil ditangkap hingga pihak perkebunan hanya melaporkan barang bukti yang disita berupa satu unit sepeda motor dan getah latex lebih kurang 7 Kg ke Polres Simalungun. Kapolres Simalungun AKBP Drs Marzuki, MM saat dikonfirmasi melalui Kasubbag Humas AKP Sulaiman Simanjuntak dan Kasat Reskrim AKP Nasrun Pasaribu, SIK di Mapolres, Rabu (12/1) menyebutkan pengaduan pihak perkebunanmasihdalampenyelidikandanpengejaran terhadap tersangka pelaku.(a14)

Sempoa Diusulkan Masuk Muatan Lokal Di SD Kota Binjai BINJAI (Waspada): Mata pelajaran sempoa diusulkan sebagai salah satu kurikulum untuk muatan lokal sekolah dasar di kota Binjai. Usulan itu disampaikan pimpinan Sempoa Indonesia Pratama (SIP) Binjai Hendra Sucitra ketika beraudiensi kepada WakilWalikota Binjai TimbasTarigan, Selasa (11/1). Menurut Hendra Sucitra, sempoa sering disalah-artikan sebagai matematika. Sempoa suatu metode mengoptimalkan kemampuan otak kanan dan otak kiri anak agar pintar sekaligus kreatif, imajinatif dan percaya diri. Pendidikandisekolahselamaini,olehHendra, dinilai cenderung hanya mengasah otak kiri. Jika hanya otak kiri dilatih anak menjadi pintar tapi cenderung kurang percaya diri dan pemalu. Sejakberdiripadatahun1998,siswaSIPBinjai banyak menorehkan prestasi mengharumkan

nama kota Binjai. Sempoa SIP ingin mendukung upayakotaBinjaisebagaikotapendidikan. Tahap awal metode sempoa bisa diujicoba di beberapa sekolah , kemudian dievaluasi hasilnya, Hendra didampingiYoan Purnomo, Ledya Fadillah serta siswa SIP mewakili Indonesia di Kejuaraan Sempoa di China, M Aldy Azizi dan Enda Ribka Meganta. WakilWalikotaTimbasTarigansempatkagum ketika keduanya menunjukkan kemampuan menjumlahangkaratusan bahkanribuandengan cepat hanya dengan membayangkan manikmanik sempoa. Timbas Tarigan diwakili Asisten IIWahyudi, SH mengatakan, Pemko Binjai menyambut baik usulan SIP dan berharap SIP dapat terus berkontribusi bagi kemajuan pendidikan di kota Binjai. (a03)

Pesisir Pantai Batubara Berubah Fungsi Perlu Payung Hukum KASUS illegal logging, itulah julukan bagi pelaku perambah hutan secara liar baik itu Hutan Lindung maupun Mangrove dan pelakunya dapat dikenakan sanksi hukum dengan ancaman pidana kurungan. Lain halnya di Batubara yang merupakan daerah otonomi baru setelah dimekarkan dari Asahan pada 2007 sebagaimana dilandasi oleh Undang-undang No.5 Tahun 2007 tentang pemekaran daerah/kota di Indonesia. Daritujuhwilayahkecamatan di Batubara sepertiTanjungtiram, Talawi, Medang Deras dan sebagian desa di Kec. Seisuka dan Limapuluh dikenal merupakan wilayah pesisir (pinggir laut). Masyarakatnya secara otomatis kebanyakan bermata pencarian

nelayan memilikki panjang garis pantai hampir 64 km. Menurut informasi hutan Mangrove yang masih tersisa dan bertahan saat ini berkisar 30 persen, baik itu dikategorikan status Hutan Produksi Terbatas (HPT) maupun Hutan Lindung (HL). Maka dapat disimpulkan sekitar 70 persen kawasan hutan punah dan salah satu faktor penyebabnya karena dirambah atau illegal logging yang tidak saja dilakukan secara kelompok melalui badan usaha maupun perorangan. Dikuatkan lagi hasil survei pinggiran pantai di Batubara ratarata berubah fungsi menjadi areal perkebunan kelapa sawit dan proses pengalihan itu mulai terjadi pada beberapa tahun lalu hingga sekarang. Belum lagi kebutuhan arang bakar maupun bahan bangunan perkayuan oleh masyarakat. Di

sini perlu dipertanyakan sejauhmana jalannya peraturan UU No.41 Tahun 1999 tentang Kehutanan. Padahal bila dicermati undang-undang itu secara tegas pelakunya dapat diancam hukuman pidana maksimal 10 tahun penjara dan denda Rp5 miliar sebagaimana dijelaskan Koordinator LBH Publiek AsahanTanjungbalai dan Batubara yang juga aktivis lingkungan Zasnis Sulungskepadapenulis,beberapa waktu lalu. Seperti contoh perambahan hutan Mangrove seluas ratusan haktare di Desa Baganbaru, Kec. Tanjungtiram yang kini beralihfungsi menjadi perkebunan kelapa sawit oleh perusahaan. Bahkan hasil survei ke lokasi menemukan kawasan perkebunan itu masuk dalam wilayah batas sempadan pantai. Sedangkan hutan Mangrove seperti jenis Bakau, Api-Api, Nyiri

dan Buta-Buta habis dirambah yang diperkirakan terjadi sekitar 2004 mulai dari perbatasan Air Joman (Asahan) sampai Baganbaru atau dikenal dengan nama kapal merah hingga Desa Ujung Kubu yang rata-rata kondisi hutannya telah beralihfungsi. Kondisi itu mengakibatkan dampaknya sekarang terjadi intrusi air laut masuk ke lahan penduduk dan abrasi maupun pasang besar karena ekosistem pantai selama ini rusak. Belum lagidaerahpesisirlainmengalami kondisi sama. Karenanya dipertanyakan kinerja Dinas Kehutanan selaku dinas teknis maupun DPRD dan terkait selama ini dalam pengawasan mengamankan hutan dari praktik illegal logging yang sejalan penegakan hukum peraturan UU No.41 Tahun 1999 dimana pelakunyadapatdiancampidana kurungan 10 tahun dan denda Rp5 miliar. Iwan Has

Waspada/Iwan Has

TUMPUKAN KAYU : Tumpukan kayu laut yang bersumber dari kawasan hutan Mangrove untuk keperluan bangunan masyarakat.


Sumatera Utara

B4

WASPADA Kamis 13 Januari 2011

Bedah Rumah 4 RTM Di P. Siantar P. SIANTAR (Waspada):WakilWalikota Pematangsiantar Drs. Koni Ismail Siregar meletakkan batu pertama bedah rumah empat rumah tangga miskin (RTM) sebagai penerima bantuan ALADIN (atap,lantaidandinding)PNPMMandiriPerkotaan Kota Pematangsiantar. “Ini merupakan salah satu tujuan pemerintah seperti yang diprakarsai Badan Keswadayaan Masyarakat (BKM) Naga Bonar, Kelurahan Naga Pita guna menaikkan taraf hidup keluarga miskin di kelurahan itu,” sebut WakilWalikota Drs Koni IsmailSiregarusaimeletakkanbatupertamabedah rumah itu di rumah Ali Umri Tanjung yang mendapat kehormatan kediamannya di Jalan Rakutta Sembiring, Gang Metro, Kelurahan Naga Pita, Kecamatan Siantar Martoba, Pematangsiantar, Senin (10/1) seperti dikutip Kabag Humas dan Protokoler Pemko Drs Daniel H Siregar, Rabu (12/1). WakilWalikota menilai positif kegiatan itu dan bisa dijadikan contoh bagi kelurahan lain. “Pemko Pematangsiantar sangat peduli dengan peningkatan taraf hidup setiap warga.” MelaluiPNPMMandiriPerkotaanyangdibentuk, sebutWakilWalikota, Pemko Pematangsiantar mengalokasikan dana untuk menunjang kesejahteraan masyarakat. “Bedah rumah salah satu cara menaikkan taraf hidup keluarga miskin.

Pemko Pematangsiantar sangat mendukung kegiatan ini.” Pada kesempatan itu,WakilWalikota mengingatkan warga yang rumahnya dibedah agar menjaga sebaik mungkin dan semakin terpacu untuk meningkatkan taraf hidup. “Bedah rumah inibarupertamakalidilakukandiPematangsiantar. Pemko Pemangsiantar tahun ini akan menyalurkan dana sebesar Rp 10,7 miliar untuk menunjang kegiatan PNPM Mandiri Perkotaan.” Atas nama Pemko Pematangsiantar, Wakil Walikota mengucapkan terimakasih kepada BKM Naga Bonar yang sudah melakukan kegiatan spektakuler pertama kali di Pematangsiantar. Peletakan batu pertama bedah rumah RTM itu disaksikan anggota Komisi I DPRD Pematangsiantar H Aulul Imran, SPdI, Dirut PDAM Tirtauli Badri Kalimantan, SE.MM, Plt Kadis PU Ir. Adres Tarigan, Sekretaris Kecamatan Siantar Martoba Kasrun,LurahNagaPitaJasianSinaga,Koordinator PNPM Mandiri Perkotaan Pematangsiantar Roby Batubara,ST,RahmatHidayatdariTimMonitoring Provsu, para undangan dari beberapa BKM sePematangsiantar serta masyarakat sekitar. Dalam kesempatan itu Dirut PDAM Tirtauli Badri Kalimantan berjanji pemasangan aliran air bersih ke rumah warga yang dibedah tidak akan dipungut biaya. (a14)

Kadisdik Sibolga: Waspada/Edward Sinaga

BEDAH RUMAH: Wakil Walikota Pematangsiantar Drs Koni Ismail Siregar meletakkan batu pertama bedah rumah salah satu rumah di Jalan Rakutta Sembiring, Gang Metro, Kelurahan Naga Pita, Kecamatan Siantar Martoba, Senin (10/1) dari empat rumah milik Rumah Tangga Miskin (RTM) yang mendapat bantuan ALADIN (atap, lantai dan dinding) dari dana PNPM Mandiri Perkotaan Badan Keswadayaan Masyarakat Naga Bonar, Kelurahan Naga Pita.

Logo PKB Terpampang Di Baliho Salah Satu Balon Bupati Tapteng Kader Diimbau Tak Terpengaruh PANDAN (Waspada) : Ketua Dewan Syuro Dewan Perwakilan Daerah(DPD)PartaiKebangkitan Bangsa MisranTanjung meminta seluruh warga dan simpatisan partai untuk tidak terpancing dengan pencaplokan PKB gambar baliho, pamflet dan lain sebagainya pada pasangan calon bupati dan calon wakil bupati periode 2011 – 2016. “PKB belum memiliki dukungan terhadap satu orangpun calon bupati dan calon wakil

bupati sesuai yang ditetapkan KPUD pemilihan kepala daerah (Pilkada) Tapteng periode 2011– 2016 ini pada Desember 2010,” ungkap Misran Tanjung didampingi Sekretaris Dewan Syuro Sahwi Sigalingging di Pandan, Selasa (11/1). Menurut Misran, hal ini merujukpadasuratberitaacararapat pleno KPUTapteng Nomor : 725/ KPU-TT/002.434687/XII/2011 tentang pemberitahuan hasil penelitian ulang verifikasi dan klari-

Mobil Boks Dibongkar Maling SIDIKALANG (Waspada): Mobil boks jenis colt diesel BK 9717 CG pengangkut rokok Gudang Garam dibongkar maling saat parkir di samping Hotel Sidikalang Dairi, Rabu (12/1) sekira pukul 03:00. Akibatnya, empat karton rokok hilang dengan nilai Rp40 juta. Sopir mobil L Sianturi, 35, warga Medan Labuhan didampingi sales rokok Hendra, 35, saat melapor di ruang Samapta Polres mengatakan, mereka datang dari Kutacane untuk membagikan rokok ke berbagai grosir di Sidikalang. Karena sudah sudah sore dan kelelahan, mereka langsung menuju Hotel Sidikalang. Sedangkan mobil diparkir di samping hotel berlokasi di Jalan SM Raja. Sebelum masuk kamar, mereka terlebih dahulu menggembok pintu boks mobil. Setelah mereka bangun sekira pukul 06:00, mereka terkejut setelah melihat pintu mobil terbuka lalu diperiksa ternyata empat karton rokok gudang garam senilai Rp40 juta lewong disikat maling. Diduga, pelaku menggunakan linggis untuk merusak gembok ukuran besar itu. (a28)

HUT Ke-30 Satpam Diperingati Di Sidikalang SIDIKALANG (Waspada): Hari UlangTahun (HUT) ke-30 Satpam diperingati di halaman Mapolres, Rabu (12/1). Pada upacara itu, inspektur upcara Kapolres Dairi AKBP Yustan Alpiani Acara dihadiri puluhan anggota Satuan Pengaman (Satpam), para pimpinan dan pengelola badan usaha seperti BUMN/ BUMD serta jajaran Polres Dairi. Inspektur upacara AKBPYustan Alpiani saat membacakan kata sambutan Kapolri menyebutkan, upcara itu seharusnya dilaksanakan pada 30 Desember 2010.Tetapi karena padatnya kegiatan dari jajaran Polri di tingkat pusat hingga daerah melaksanakan tugas pengamanan Tahun Baru 2011 serta kesibukan dari semua pihak yang tergabung dalam Komunitas Industrial Security. Diharapkan, seluruh komponen Industrial Security dapat bekerjasama untuk mempercepat proses pengakuan terhadap profesi security di Indonesia. Sehingga eksistensi Satpam semakin diakui sebagai penyelenggara pengamanan di lingkungan kerja. (a28)

Di Simalungun Terdapat 1.800 Personil Satpam Terdaftar P. SIANTAR (Waspada): Di wilayah hukum Polres Simalungun saat ini terdapat 1.800 personil Satpam yang berasal dari 38 instansi terdiri pemerintahan, BUMN dan swasta, perbankan, sekolah, perkebunan, industri dan lainnya yang bertugas mengamankan kawasannya masing-masing. Ketua AMSI (Assosiasi Manager Security Indonesia) Kabupaten Simalungun Fadil Muhammad menyebutkan itu kepada sejumlah wartawan usai pelaksanaan apel HUT Satuan Pengamanan (Satpam) ke-30 tahun 2011 di halaman Mapolres Simalungun, Rabu (12/ 1). Menurut Fadil, jumlah itu bukanlah jumlah standar, sebab di luar itu masih ada lagi dan itu terjadi disebabkan adanya segelintir pengusaha nakal, tanpa memasukkan nama-nama personil lainnya dan diduga, karena belum mendapat pendidikan khusus. Sementara, Wakapolres Simalungun Kompol Harry Haryadi Bajuri, SIK mewakili Kapolres Drs Marzuki, MM bertindak sebagai Irup dalam apel HUT Satpam ke-30 itu dan sekaligus membacakan amanat tertulis Kapolri Jenderal Polisi DrsTimur Pradopo. Peringatan yang berlangsung sederhana dan hikmat serta dihadiri para manajer perkebunan, Muspida plus, mewakili ketua DPRD Simalungun, para perwira Polres Simalungun, Ketua AMSI dan undangan lainnya, diwarnai pelepasan balon HUT Satpam ke udara dan tarik tambang antar Satpam. Hal sama turut dilaksanakan di Mapolres Pematangsiantar dengan Irup Kapolres AKBP Alberd TB Sianipar, SIK, MH serta membacakan amanat tertulis Kapolri. Dalam kesempatan itu Kapolres Pematangsiantar menyerahkan piagam penghargaan kepada Satpam terbaik yakni Ade Kurniawan dari PT STTC dan Makmuri dari RSU Vita Insani serta kepada tiga orang perwakilan penerima penghargaan selaku Pos penjagaan terbaik yakni PT STTC, PT Bumi Sari Prima dan PDAM.Tirtauli. (a14)

fikasi partai politik (parpol) atau gabunganparpolpadapemilihan umum (pemilu) Bupati danWakil Bupati Tapteng tahun 2011. “Padahal dalam surat KPU, PKB yang memiliki satu kursi di DPRD dinyatakan tidak memenuhi syarat (PMS). Selain itu, surat rekomendasi dari DPP PKB pusat melalui DPW PKB Sumut juga tidak ada dan tidak kita ketahui seperti apa hasilnya,” ujarnya. Misran mengatakan, DPD PKBTapteng sesuai hasil penjaringan yang dilaksanakan panitia timpenjaringanhanyamenjaring nama pasangan bakal calon (balon) Bupati danWakil Bupati Tapteng MA Effendy Pohan dan

Hotbaen Bonar Gultom. Namun DPD cq DPP PKB belum menerbitkan surat rekomendasi terhadap pasangan calon ini. “KPU menyatakan PKB tidak memenuhipersyaratandanDPD cq DPP yang sama sekali tidak mengetahui telah menerbitkan surat rekomendasi dukungan terhadap salah satu pasangan calon, maka dalam waktu dekat ini, kita mengadakan rapat menentukan arah dukungan terhadap pasangan calon pada Pilkada 2011 ini,” katanya. Misran meminta tim Anugerah selaku tim sukses pasangan tertentu untuk mencabut logo PKB yang dipampang di setiap

baliho yang ada. Sebab, PKB tidak memenuhi persyaratan sesuai hasil rapat pleno KPU Tapteng. Ketua DewanTanfiziah DPD PKB Abu Salim Hutabarat yang ditanya enggan mengungkapkannya. Maruli Firman Lubis, selaku anggota KPUD Tapteng yang membidangiDivisiHumasmembenarkan, sesuai hasil penelitian ulangdanverifikasisertaklarifikasi dukungan parpol atau gabungan parpol,PKBtidakmemenuhipersyaratan. Sebab surat rekomendasi untuk administrasi dari DPD PKB ke KPU tidak ditandatangani sekretaris partai. (a18)

HTI Sumut Kecam KPUD Tapteng MEDAN (Waspada) : Hizbut Tahrir Indonesia (HTI) Sumut mengecam Komisi Pemilihan Umum Daerah (KPUD)Tapanuli Tengah, dinilai telah menyalahgunakan wewenang dalam menjalankan tugas-tugasnya. Dalam melakukan verifikasi berkas, KPUD Tapteng telah merugikan salah satu pasangan Cabup danWabupTapteng, Effendy Pohan dan Bonar Gultom. “Untuk itu, diminta kepada KPU Pusat dan Bawaslu memerintahkan KPU Provinsi untuk membuka permasalahan yang terjadi di KPUD Tapteng, dalam halpenetapancalonBupati/Wakil Bupati dengan menggelar kasus dan gelar perkara,” ujar simpatisan HTI Sumut H Azwir Ibnu Aziz di Medan, kemarin.

Disamping itu, kata Azwir didampingi Ketua Majelis Zikir Az Zikra Sumut H Rizal Mahaputra, pihaknya minta agar KPU Provinsi Sumut lebih proaktif mengusut kecurangan dalam penetapan calon bupati/wakil bupati Tapteng yang pilkadanya tidak lama lagi akan digelar. “Bila ada unsur pidana yang dilakukan KPUD Tapteng, maka aparat hukum diminta memprosesnya sesuai ketentuan hukum. Karena, KPUD Tapteng diduga telah melakukan pelanggaran dokumen, menyalahi tahapan dan prosedur pilkada,” ujar Azwir. Untuk menetralisir pelaksanaan Pilkada di Tapteng, ujarnya lagi, KPU pusat dan KPU Provinsi diminta mengambil alih pelaksanaan pilkada di Tapteng.

“Siapapun warga negara Indonesia yang telah memenuhi syaratdanketentuan,bisamencalonkandirisebagaibupati,walikota dan gubernur,” tegas Azwir. Di bagian lain Azwir mengingatkan, pernyataan yang dikumandangkan Presiden Susilo BambangYudhoyono (SBY). SBY menyatakan,dalam pelaksanaan pilkada tidak dibenarkan melakukanmanuver-manuver,seperti mengandalkan kekuatan dengan mengandalkan hukum melawan kekuatan kekuasaan. Biarkan semua berjalan sesuai dengan harapan presiden. Pernyataan presiden itu akan tetap kita hargai sebagai pemimpin tertinggi di negeri ini,” kata Azwir. (m32)

2 Korban Dihipnotis, Sepeda Motor Lewong P. SIANTAR ( Waspada): Dengan modus sama dan lokasi kejadian tidak berapa jauh jaraknya, dua orang korban diduga dihipnotis tersangka pelaku yang jumlahdansepedamotordigunakan hampir sama hingga mengakibatkan dua unit sepeda motor lewongbersamabarangberharga lainnya. Keterangan dihimpun dan informasidariPolresSimalungun, Rabu(12/1)menyebutkankorban pertama seorang perempuan, korban Nurbaiti Damanik, 35, wiraswasta, warga Bagori Bangun, KecamatanGunungMalela, Kabupaten Simalungun dan korban kedua seorang laki-laki, korban Ruslan Saragih, 29, pengurus Koperasi Serba Usaha Mandiri Bersama, warga Marihat Dolok, Kecamatan Siantar, Simalungun. Kejadian menimpa Nubaiti terjadi di kebun kelapa sawit Bah Jambi Timuran, Kecamatan GunungMalela,Simalungunpada Sabtu (8/1) pukul 14:00 dan dilaporkan ke Polres Simalungun pada Senin (10/1). Sedang kejadian menimpa Ruslan terjadi di kebun kepala sawit, Jalan Blok Songo, Kecamatan Siantar, Simalungun pada Jumat (7/1) serta dilaporkan ke Polres Simalungun pada Selasa (11/1). Menurut Nurbaiti, kejadian yang menimpanya terjadi ketika sedang mengendarai satu unit sepeda motor Honda Revo BK 4346 LI dari Bangun 13 hendak ke Timuran. Ketika tiba di Km 12,5, sepeda motor Nurbaiti dipepet satu unit sepeda motor jenis Honda Supra Fit yang dikenderai

dua pria yang tidak dikenal. Salah seorang pria tidak dikenal itu berteriak pinggir dan korban mematuhinya. Ketika sepeda motor sudah saling berhenti, salah seorang pria tidakdikenaldanmengemudikan sepeda motor menepuk badan Nurbaitidanmengatakanmereka akan ke Timuran. Selanjutnya, pria itu mengemudikan sepeda motor Nurbaiti dan Nurbaiti menurut saja apa dikatakan pria tidak dikenal itu dan duduk di boncengan. Ketikasampaidikebunkelapa sawit Bah Jambi lewat Pos Palang HansipTimuran,priatidakdikenal itu menghentikan sepeda motor dan menurunkan Nurbaiti. Nurbaiti saat itu diam saja ketika pria tidak dikenal itu membawa sepeda motornya. Nurbaiti baru sadar ketika pria tidak dikenal itu sudah lenyap. Akibat kejadian itu, Nurbaitimengalamikerugiansatu unit sepeda motor dan resi KTP serta sejumlah uang yang disimpan di bagasi sepeda motor. Sementara, kejadian yang menimpa Ruslan terjadi ketika berada di tempat kejadian tibatiba pundaknya ditepuk seorang pria tidak dikenal. Kemudian, pria tidak dikenal lainnya meminjam sepeda motor Ruslan jenis Suzuki BK 6991 MZ dengan alasan hendakmembelirokok.Tanpabanyak bicara, Ruslan memberikan sepeda motornya dipinjam dan pria tidak dikenal itu pergi membawa sepeda motor Ruslan. Ketika sepeda motor dibawa, pria yang menepuk punggung Ruslan mengajak Ruslan bercerita. Ruslan yang hanya diam mendengarkan pria tidak dikenal

itu bercerita tidak menyadari ketika pria itu secara diam-diam pergi meninggalkannya. Kapolres Simalungun AKBP Drs Marzuki, MM saat dikonfirmasi melalui Kasubbag Humas AKP Sulaiman Simanjuntak dan Kasat Reskrim AKP Nasrun Pasaribu, SIK di Mapolres, Rabu (12/ 1) menyebutkan kasus yang menimpa Nurbaiti dan Ruslan diduga pencurian pemberatan dengan cara hipnotis dan masih dalam penyelidikan. (a14)

2011, UN Ulangan Ditiadakan SIBOLGA (Waspada) : Kepala Dinas Pendidikan Kota Sibolga Rustam Manalu mengatakan, sesuai perubahan dalam penyelenggaraan Ujian Nasional (UN) mendatang tidak ada ujian ulang lagi bagi siswa seperti tahun-tahun lalu. Selain perhatian dan tanggungjawab guru di sekolah, para orangtua juga dituntut lebih berperan mempersiapkan anaknya menghadapi UN tahun 2011 ini. “Kami mengharapkan agar siswa mulai sekarang mempersiapkan dirinya dengan banyak belajar. Tidak ada waktu untuk bermain-main lagi,”ungkap Rustam Manalu didampingi Kabid Dikjar Jhonson Sihombing, Selasa (11/1). Dikatakan, ujian sekolah akan dilaksanakan sebelum UN, untuk jadwal pelaksanaan UN SMA/ MA dan SMK dimulai 18 April mendatang, sementara jadwal UN SMP/MTS dimulai 25 April mendatang. “Kriteria kelulusan UN kali ini turut mengikutsertakan nilai sekolah. Di mana nilai sekolah tersebut adalah gabungan nilai rapor semester 3,4,5 dan ujian sekolah, begitu juga halnya pengabungan nilai UN dan nilai sekolah itu langsung dilaksanakan oleh pusat,” katanya. Perlu juga diketahui, kriteria kelulusan UN tidak ada nilai gabungan di bawah 4 dan rata rata harus lebih dari 5,50, khusus SMK rata-rata

harus lebih dari 7,00. Selain itu, pihak sekolah akan mengirimkan nilai sekolah, baik mata pelajaran UN maupun yang tidak ke pusat. Artinya, nilai sekolah harus sudah diterima pusat satu minggu sebelum pelaksanaan UN. Menurut Rustam, pihaknya sudah mengirimkan daftar rekap calon peserta UN SMA/MA dan SM ke Dinas Pendidikan Sumut untuk SMA/MA sebanyak 1.320 orang dan SMK sebanyak 967 orang. Adapun daftar calon peserta UN dari tingkat SMA/MA meliputi SMAN 1 Sibolga sebanyak 275 siswa, SMAN 2 Sibolga sebanyak 236 siswa, SMAN 3 Sibolga sebanyak 165 siswa, MAN Sibolga sebanyak108siswa,SMASwastaPGRI14sebanyak 40 siswa, SMA Swasta HKBP Sibolga sebanyak 91 orang, SMA Swasta Muhammadiyah 15 Sibolga sebanyak 24 orang, SMA Swasta Katolik Sibolga sebanyak 222 orang, SMA SwastaTri Ratna Sibolga sebanyak87orang,MASwastaIslamiyahsebanyak 15 orang dan MA Swasta PTH Darur Rachmad sebanyak 57 orang. SementarauntuktingkatSMKmeliputiSMKN 1 BM sebanyak 216 siswa, SMKN 1 TI sebanyak 205 siswa, SMKN 2 sebanyak 112, SMK PGRI 04 sebanyak 242 orang, SMK HKBP sebanyak 63 orang,SMKMuhammadiyah13sebanyak69orang dan SMK Eka Satria sebanyak 60 siswa. (a18)

Pembuatan Saluran Air Di Kabung Dinilai Mubazir BERASTAGI (Waspada) : Pembuatan saluran air (drainase) di persawahan yang lazim disebut Sabah Bagahen di Desa Kabung, Kecamatan Barusjahe,dinilaimubazirolehKetuaLSMKarisma Sibayak,KecamatanBarusjaheDSembiring.Selain mubazir, kegiatan ini tidak diketahui sumber dananya, karena tidak memiliki plank proyek. Hal ini disebutkan Sembiring, Rabu (12/1). Penilaian mubazir, menurut Sembiring, karena areal persawahan atau pertanian di lokasi proyek hanya sedikit dapat diairi dibanding luas lahantidurnya.Sedangkanjikaproyekiniditempatkan di areal persawahan yang masih aktif di Desa Kabung dengan hamparan luas yakni di Sabah Jehen nilai manfaatnya lebih baik. “Sebab jika proyek ini berada di sana dapat digunakan petani sawah, maka tentunya hasil persawahan lebih terjamin. Selain itu, saluran

ini juga dapat dimanfaatkan petani sawah Desa Gurisen, Kecamatan Barusjahe, sebab lokasi persawahannya berbatasan dengan Desa Gurisen,” terangnya. Dikatakan, selain itu terdapat di Desa Siberteng, luas lahan persawahan masih ada puluhan hektare dan jika sarana ditempatkan di sana lebih baik dan mendukung pertanian sawah warga. Sejumlah warga Desa Siberteng di antaranya RonalTarigan mengakui kegiatan seperti ini sudah ada setahun lalu di desanya, tetapi manfaatnya belum optimal dibanding luas persawahan yang akan diairi. Bahkan, menurutTarigan, yang mengerjakan proyek tahun lalu ketika itu di Siberteng berinisial JS, mantan pegawai Pengairan di PUD Karo. Ketika hal ini hendak ditanyakan kepada Kabid Sumber Daya Air Pemkab Karo tidak dapat ditemui. (cdb/ a17)

Radio Gundaling Berastagi Pindah Frekwensi BERASTAGI (Waspada) : Ribuan fans radio yang sehari-harinya disebut G Lover baik yang berusia tua maupun yang muda, Minggu (9/1), merayakan ulang tahun ke-5 Gundaling FM Berastagi di Open Stage Taman Mejuah-juah Berastagi. Acara yang digelar secara sederhana itu untuk memuaskan hati pendengarnya dengan melakukan perpindahan jalur dari frekuensi Gundaling FM yang selama ini pada 95,7 Mhz berpindah ke 96,1 Mhz. Komisaris PT Radio Gundaling Rusli KaroKaro menyebutkan, Radio Gundaling kehadirannya bisa diterima masyarakat yang terdiri dari kaum muda dan usia senja karena siaran yang ditampilkan, berorientasi, hiburan, informasi dan pendidikan. Karena itu ke depan, kata Rusli, Radio Gundaling FM akan terus menambah program barunya yang mampu diterima pendengarnya, baik

di Kabupaten Karo mauupun yang ada di kabupaten tetangga. Proklamasi Surbakti, pria berusia 36 tahun, warga Desa Merdeka yang selama ini dikenal dengan sebutan Bang Pro didaulat mewakili fans yang hadir dalam memberikan pesan dan kesannya mengatakan, selama ini dia beserta istrinya menjadikan siaran Gundaling FM sebagai hiburan dan teman bekerja di ladang dan menjadikannya sebagaibahaninformasisaatsiaranberitadimalam hari. Puncak acara para fans larut bergembira dalamiringankeyboardyangdiselingipenampilan delapan grup band lokal yang tergabung dalam komunitas Gundaling Musik Studio Rental dan grup band papan atas Karo Zigma Band. Sedangkan kegiatan sosialnya dilakukan pemeriksaan kesehatan secara gratis bagi warga yang ditangani para medis dari PT TASLY yang menggunakan teknikTCM (Traditional Chinese Medicine). (a17)


Sumatera Utara

WASPADA Kamis 13 Januari 2011

Danlantamal I: Pulau Berhala Kawasan Wisata Yang Menarik SEI RAMPAH (Waspada): KomandanPangkalanUtamaTNI -AL (Danlantamal) I Belawan Laksamana Pertama TNI Amri Husaini, Selasa sore (11/1) mengadakan kunjungansilaturahmi dengan Bupati Sergai Ir HT Erry Nuradi, MSi dan Wabup Ir H Soekirman di kantor Bupati di Sei Rampah. SebelumnyapadaSelasapagi Danlantamal I Belawan didampingi Asintel Kolonel (L) Agus Irianto, Asops Kolonel (L) Tri SatryaWijaya, Asrena Kolonel (L) Frendy Hotman Saragih, Aslog Kolonel (L) Kasih Prihantoro, Dandim 0204/DS Letkol ArhWawik Dwinanto S.Sos, Danyon Marinir Belawan Mayor (Mar) Benny Sarana dan sejumlah perwira

TNI-AL meninjau Pulau Berhala yang terletak di pantai timur Selat Malaka wilayah KecamatanTanjung Beringin, Kabupaten Sergai. Saat meninjau Pulau Berhala, Danlantamal I Belawan Laksamana Pertama TNI Amri Husaini beserta rombongan lainnya berangkat dari dermaga TPI Desa Pekan Kecamatan Tanjung Beringin dengan menaiki kapal boat KamladankapalboatDinasKanla Pemkab Sergai hingga sampai di bibir Pantai Merdeka, selanjutnya seluruh rombongan berpindah keKapalRepublikIndonesia(KRI) “Telaga Tujoh” untuk berangkat ke Pulau Berhala dan pada sorenya kembali ke daratan Pantai Merdeka. Selama berada di Pulau

Berhala, Danlantamal I Belawan Laksamana Pertama TNI Amri Husaini meninjau Pos Marinir termasuk melihat fasilitas pendukung dan mengadakan pertemuandengansatuanMariniryang mendapat tugas jaga di salah satu pulau terluar di Indonesia yang berbatasan langsung dengan perairan Malaysia itu. Didampingi Danyon Marinir Belawan, Danlantamal I Belawan Laksamana Pertama TNI Amri Husaini minta kepada para Marinir yang mendapat tugas jaga di Pulau Berhala untuk melaksanakan tugasnya dengan penuh tanggungjawab serta tetap waspada dalam mengamankan wilayah perairan NKRI termasuk kawasan Pulau Berhala Kabu-

paten Sergai. Saat mengadakan pertemuan silaturahmi dengan Bupati Sergai dengan rasa optimisnya Danlantamalmenjelaskanbahwa Pulau Berhala selain salah satu pulau terluar milik Indonesia dan memperhatikan potensi serta keindahan alamnya maka ke depan pulau dapat dijadikan sebagai tempat tujuan wisata yang sangat menarik. Dalam kesempatan itu, Danlantamal I Belawan Laksamana TNI Amri Husaini berharap kepada Pemkab Sergai untuk ikut memperhatikan dan terus menambah fasilitas, sarana pendukung di Pulau Berhala termasuk penguatan kapasitas tenaga listrik solarcell yang sudah ada sekarang

Diduga Ada Permainan, Oknum Hakim PA Lubuk Pakam Percepat Sidang MEDAN (Waspada): Sidang kilatyangdidugadilakukanhakim Pengadilan Agama (PA) Lubuk Pakam, Kabupaten Deliserdang membuat heboh instansi itu. Pasalnya Juhni Harahap, 45, yang digugat cerai istrinya Nursiah, 40, wargaBatangkuistidakmenerima putusan hakim PA yang diketuai Muhammad Rajali yang mengabulkan gugatan istrinya tanpa dihadiri Juhnu Harahap selaku pihak tergugat. “Saya menduga ada permainan sehingga hakim sengaja mengabulkan gugatan penggugat,” aku Juhnu Harahap, Rabu (12/ 1). Dengan putusan itu pihak tergugat merasa dizalimi mengingat selama ini pihak tergugat tidak pernah menerima secara resmi surat panggilan dari pihak PengadilanAgamaLubukPakam. “Surat panggilan itu tidak pernah sampai sama saya. Pihak PA Lubuk Pakam hanya mengantar surat ke kantor desa, seolaholah saya tidak berada di tempat aliassudahpindahataumerantau, padahalselamainisetiapharisaya rumah,” aku tergugat. Selain itu pihak PA Lubuk

Pakam sengaja mempercepat sidang dengan 3 agenda. Padahal dalam sidang Kamis (6/1), agenda persidangan adalah proses mendengar jawaban tergugat, namun dilajutkan dengan agenda mendengar keterangan saksi dan selanjutnya agenda putusan Majelis Hakim. “Akibatnya saya yang terlambat datang (sampai ke PA Lubuk Pakam pukul 12:00) sudah menerima putusan. Atas dasar ini saya menduga ada permainan di dalam sidang perceraian itu,” kata tergugat. Tergugat menilai keterlambatannya dimanfaatkan oknum Majelis Hakim PA Lubuk Pakam bersama hakim anggota RP dan M untuk membuat sidang kilat, yang seyogianya agenda mendengarkanjawabantergugat,karena terlambat datang, oknum hakim meneruskan agenda mendengarkan keterangan saksi dan memutuskan mengabulkan gugatan penggugat. Menurut tergugat, sebelumnya pada Rabu (5/1) dirinya datang ke PA Lubuk Pakam ingin mengetahui sampai sejauh mana proses persidangan dirinya, namun pihak PA selalu tertutup

HUT Satpam Ke-30 Diperingati Di Polres Binjai BINJAI (Waspada) : Satuan Pengaman (Satpam) sejajaran Polres Binjai, memperingati ulang tahun ke 30 di lapangan Apel Mapolres Binjai Rabu (12/1). Bertindak selaku inspektur upacara dalam HUT Satpam Kapolres Binjai AKBP Dra Rina Sari Ginting, sedangkan komandan upacara Anwar Sanusi Satpam dari SPBU Stabor, Kecamatan Selesai. Acara peringatan diawali pembacaan prinsip penuntun Satpam oleh Suyadi dari Satpam Bank Mandiri Binjai, Kapolri Jendral Polisi Drs Timur Pradopo dalam kata amanat tertulisnya dibacakan Kapolres Binjai, AKBP Dra Rina Sari Ginting, mengatakan peringatan HUT Satpam setiap tahunnya dilaksanakan, jadi diharapkan tidak sebatas upacara yang bersifat seremonial belaka, tetapi dijadikan momentum untuk introspeksi dan evaluasi terhadap berbagai aspek yang berkaitan dengan eksistensi satuan pengaman sebagai mitra Polri dalam penyelenggarakan fungsi pengaman swakarsa Kegiatan Lomba Dan Bhakti Sosial Dalam menyambut HUT Satpam ke 30 sejajaran Polres Binjai, juga melaksanakan perlombaan sikap tampang yang diselenggarakan Sat Binmas Polres Binjai. Dari hasil perlombaan keluar sebagai juara 1. Nurisan Tarigan anggota Satpam SPBU Stabor, Kecamatan Selesai, juara II. Suyadi anggota Satpam bank Mandiri Binjai, dan juara III. Hendrik Tanjung anggota Satpam PTPN II Tandam Hulu. Sedangkan bhakti sosial, panitia Satpam di bawah koordinator Anwar Sanusi, ketua panitia KBO Sat Binmas Polres Binjai, Iptu Barian, Kanit Binkamsa Ipda Azwar Amir, stap serta anggota satpam melakukan anjangsana ke panti jompo jalan Perintis Kemerdekaan, Kelurahan Cengkeh Turi, Kecamatan Binjai Utara. Di panti ini panitia menyerahkan sembako berupa beras, mi instan dan gula pasir. (a04)

dalam memberikan informasi. “Dengan putusan itu jelas saya akan menyatakan banding,” ujarnya. Ketika dikonfirmasi, Majelis Hakim PA Lubuk Pakam mengatakan, haknya tergugat untuk banding.Denganadanyabanding

itu putusan gugatan cerai itu jelas belum mempunyai kekuatan hukum yang tetap. Dalam hal ini tergugat mohon Pengadilan Tinggi PA Sumut melakukan pemeriksaan terhadap hakim PA Lubuk Pakam. (m30)

danbiladimungkinkandibangun helipad untuk tempat landing/ take off pesawat helikopter. Bupati Sergai Ir. H.T. Erry Nuradi, M.Si dalam pertemuannya dengan Danlantamal menjelaskan bahwa sejak tahun 2005 sampai sekarang Pemkab Sergai terus melakukan pembenahan dan pembangunan berbagai saranafisikdiPulauBerhala.Bahkan setiap tahunnya di kawasan itu dilaksanakankegiatanperingatan hari bumi tingkat Kabupaten Sergaidenganagendamelakukan penanaman berbagai jenis pohon, melepas burung dan satwa, ujar Bupati. Selain Pulau Berhala yang masuk dalam kawasan Kecamatan Tanjung Beringin ungkap Bupati, bahwa panjang pantai timur yang ada di wilayah Sergai mulai dari Kecamatan Pantai Cermin sampai Kecamatan Bandar Khalipah sekitar 95 kilometer. Untuk itu, Bupati Erry Nuradi menyampaikan ucapan terima kasih kepada jajaran Lantamal Belawan yang secara terus-menerus dapat mengamankan kawasan perairan tersebut sehingga para nelayan mendapatkan ketenangan untuk mencari ikan di daerah ini. (a07)

B5

Sergai Peroleh Alokasi Dana PUAP Sebesar Rp 1,1 M SEI RAMPAH (Waspada): Untukmengurangitingkatkemiskinan dan penciptaan lapangan kerja di pedesaan, pemerintah pusat meluncurkan program Pengembangan Usaha Agribisnis Perdesaan (PUAP) yang pelaksanaannya terintegrasi dengan kegiatan Kementerian Pertanian maupun Kementerian/Lembaga lain di bawah payung program Program Nasional Pemberdayaan Masyarakat (PNPM) Mandiri. Hal itu diungkapkan Bupati Serdang Bedagai Ir HT Erry Nuradi, MSi didampingi Wakil BupatiIr H Soekirmanpadaacara penyerahan dana PUAP tahun 2010 kepada Gabungan Kelompok Tani (Gapoktan) Sergai yang dilaksanakan di aula kantor Badan Pelaksana Penyuluhan Pertanian,PerikanandanKehutanan (BP4K) Sergai Desa Sei Rejo Kec. Sei Rampah, Rabu (12/1). Alokasi bantuan langsung kepada petani, menurut Bupati merupakan sebuah pendekatan yang ditempuh untuk pengembangan usaha agribisnis perdesaan dan dalam upaya memperkuat kelembagaan pertanian di desa yang sekaligus diharapkan dapat membantu mengatasi permasalahan petani untuk mengakses sumber permodalan, pasar, teknologi dan organisasi tani sebagai permasalahan mendasar yang harus segera diselesaikan. Kabupaten Sergai menurut Bupati Erry Nuradi setiap tahun-

nya berupaya meningkatkan alokasi bantuan kepada petani termasuk dana PUAP tahun anggaran 2010 yang mencapai Rp 1,1 milyar dan disalurkan kepada 11 Gapoktan dari 11 Desa di empat Kecamatan masing-masing mendapat Rp 100 juta. Dana PUAP yang ditransfer langsung ke rekening masingmasing Gapoktan penerima itu diharapkan bupati dapat dimanfaatkanseoptimalmungkinuntuk membiayai kegiatan-kegiatan petani sesuai rencana usaha yang telah ditetapkan bersama sebelumnya. Kepala BP4K Sergai Ir Hj Leli IA dalam kesempatan itu memaparkan bahwa penetapan Gapoktan penerima bantuan dana PUAP tahun 2010 dilakukan melalui pendekatan bottom up yang bersumber dari beberapa usulan yaknipemerintahdaerah,aspirasi masyarakat dan dari unit kerja lingkup Kementerian Pertanian. Penerima kucuran bantuan dana PUAP 2010 yakni tiga Gapoktan dari Kecamatan Sei Rampah masing-masing Gapoktan Rampah Mandiri Desa Sei Rampah, Sehati Desa Silau Rakyat dan Maju Bersama Desa Simpang Empat. Kemudian empat Gapoktan dari Kecamatan Teluk Mengkudu yaitu Sama Makmur Desa Makmur, Sri Kaya DesaPematangSetrak,TaiSepakat Desa Sei Buluh dan Gapoktan Maju Bersama Desa Pasar Baru.

Selanjutnya dari Kecamatan Sei Bamban dua Gapoktan yaitu Sri Agung Desa Penggalangan, MuaraDesaSeiBamban,dandari KecamatanTanjung Beringin dua GapoktanyaituGapoktanPermai Desa Pematang Cermai, Martabe Desa Pematang Terang. Pada kesempatan yang juga dihadiri Kepala Bakoorluhtan Sumut itu, Bupati Erry Nuradi menyerahkan hadiah kepada tiga PPL PNS terbaik tahun 2010 yakni terbaik I Sukowati dari Desa Lestaridadi Kecamatan Pegajahan, terbaik II Almadias dari Dolok Masihul, terbaik III Syamsul Bahri dari Desa Paya Lombang Kecamatan Tebing Tinggi. Hadiah lainnya juga diberikankepadaempatpetaniberprestasi tahun 2010 masing-masing Boirin untuk bidang pertanian sekaligus petani teladan nasional 2010, Sahat Sinaga bidang perkebunandariKecamatanDolokMasihul,H Teguhbidangpeternakan dariKecamatanTebingTinggidan Muhammad Yamin bidang perikanan dari Kec. Perbaungan. Sementara Gapoktan yang berprestasi pada tahun 2009 dan menerima hadiah masingmasing terbaik I Gapoktan Bangun Mandiri Desa Pulau Tagor Kecamatan Serba Jadi, terbaik II GapoktanTani Keluarga Desa Besar II Terjun, Kecamatan Pantai Cermin, dan terbaik III GapoktanMadani,DesaKutabaru Kecamatan Tebingtinggi. (a07)


B6 1 CM 2 CM

WASPADA

Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000

5 CM 6 CM

Rp. 65.000 Rp. 78.000

7 CM 8 CM

Rp. 91.000 Rp. 104.000

BURSA

ISUZU Panther New Hi Grade Dijual. Tahun 1999. Warna abu-abu metalik. Harga 92Jt. Hub. Perum Deli Indah Marelan. 0812 6086 2574

TOYOTA All New Tahun 96/97 Air Bag. Warna Abu2 metalik. cantik dan original. Harga 73 Jt/Nego. Hubungi: 0812 6415 802

Informasi Pembaca

ISUZU Panther New Hi Grade Thn. 2000. Velg Racing, AC, Dingin Doble, Pajak panjang. Tgl. 16-11-2014. Cat orisinil. Hrg. 82 Nego. Tape, standard. Hub. 0821 68 12 12 17

TOYOTA AVANZA G TH. 2004. W. Silver, BK Panjang, Tape, DVD, Ban Baru. Peminat Hub.

ISUZU Panther Challenger Th. 94. Wrn Merah - Silver Mulus, PS, PW, AC DB, CL, VR, Terawat, Ban 95 % Baru BK Medan Asli. 47Jt. 0813 6141 0990 Fahmi

TOYOTA Kijang Super Commando. Th. 96 W. Silver metalik. AC, Tape, VR, BR, BK Medan, Asli. 1 nama, body kaleng. Mulus. Cat asli. H. Nego. Hub. 0813 9754 5210

AUTOMOTIVE

Bursa Automotive

AC : Air Condition BR : Ban Radial CL : Central Lock ND : Nippon Denso DB : Double Blower

PS PW RT VR EW

: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

BMW 318i M/T Thn. 97 VR 18 Crom silver. Plat B. Rp. 69Jt. Hub. 91144382 CHEVROLET Estate 1.6 LS M/T. Thn. 2006. Hitam, BK Mdn Rp.92Jt. Hub. 9132 7433

DAIHATSU Grandmax PU Th. ‘08. Wrn. Hitam Rp. 57Jt. Jl. SM. Raja No. 200 (Kembar

Ponsel). 0857 6097 8888/7851402 DAIHATSU Espass 95. Warna merah komplit. Harga 29Jt. Pintu Sorong. Hub. 0812 6579 7737 - 061.846 5792

DAIHATSU Feroza Dijual mulus tahun 93. warna biru metalik, pajak panjang. Siap pakai. Hub. 0813 6122 5778 DAIHATSU Hiline 4x4 Pick Up Th. 2000, BK, Biru, AC, TP. Ban Baru. Bantu Kredit. Hub. 7651 6448 DAIHATSU Xenia Xi 2005 1.3 Dijual. Mulus, Jok kulit, sound sistem. MP3, AC, W. Coklat Bagie satu tangan Km. belum sampai 100rb. Harga 106 Jt Nego. Hub. 0812 638 7021 FORD Everest XLT 4x4 M/T Thn. 05. Biru silver, BK Mdn, Ban Baru Rp. 175Jt. Hub. 0812 6594 2789 HONDA Grand Civic Th. 88 warna merah mulus, AC/Tape/ Harga 33 Jt/Nego. Hub. 0882 6168 6501 / 77702406 HONDA City Th. 97 W. Biru metalic. AC, Tape, VR, BR, PS, PW, BK Medan, Body kaleng. Mulus seperti baru. H. Nego 58Jt. Hub. 061.77609041 ISUZU Panther Hi-Sporty Abu-abu met Thn. 97. Asli Mdn, sgt orisinil, mulus, VR, BR, PS, PW, CL, AC DB, RTP. Harga 72Jt. Nego. Hub. 061.6967 9753 ISUZU Panther LDX 91 Coklat Metalik P. Steering, P. Window HP. Tape, Sony, Alarm. Jok Baru, BK Baru, Asli Medan, semua electrik. Hidup, Mulus luar dalam, siap pakai. Harga 45Jt/Nego. Hub. 0812 6568 818/ 77305875

MITSUBISHI Kuda Diesel Thn. 2000 Super Exceed, W. Hitam met. Cantik, mulus, Pkl. Panjang. Hrg. 92Jt. Nego. HP. 0812 6415 8848, 061.77768287

BUNGA

0%

Hubungi Dealer

SUZUKI

ADA JADI MOBIL

JL. JEND. G. SUBROTO 18-20 Depan Air Mancur Petisah Tel. 4522619 - 4146757 MEDAN

TOYOTA Super Kijang Thn. 87 6 Speed Long. W. Hijau met. Depan Grand. AC, VR, Tape, body kaleng luar dalam mulus sekali. J. Jantan. H. 35 Jt. Jl. Kamboja Raya No. 84 Blok 18 Dpn TK. Perumnas Helvetia HP. 0852 6115 3339

TOYOTA Kijang Jantan Th. 93. Cantik, mulus Rp. 48 Jt (Nego). Hub. Panglong Muslim Mandarin. Jl. SM. Raja Sp. Limun 7872284 - 0812 6928 4545

MOBIL DICARI OVER KREDIT

TOYOTA Kijang LGX Diesel. Thn. 2000. Asli Medan, lengkap, mulus, siap pakai. Harga 117 Jt damai. Hub. 0852 9618 4519

L300 PU/ SUZUKI CARRY/ ZEBRA/ DT/ KIJANG/ KONTAN PUN OK H. IPUL: 0812.6038.5555/ SMS NISSAN Sentra ‘91, VR-BR, BPKB 2 nama. Hrg. 26 Jt. (BU/Nego). Hub. 0812 656 44257 Ibu Christa -Pd. Bulan SUZUKI Katana Thn. 96 Dijual. Hitam metalik, BK Medan. Asli, satu nama, mulus dan lengkap Rp. 45Jt/Net. Peminat Serius Hub. 085276302013 TP

SUZUKI Carry Minibus Tahun 96 Dijual. Mulus, warna ungu metalik. Siap pakai. Hub. 0813 7650 1116

SUZUKI Carry Tahun 2002 Dijual. GRV Dobel Blower. Warna biru metalik mulus. Siap pakai. Hub. 0852 2086 3000 APV Type X Thn. 2004. Over Kredit. Warna Merah. DP 23 Jt. Sisa 29Bln x 3 Jt. Hub. 0813 7586 6886 SUZUKI APV Minibus Arena, GX Thn. 2008, GX. Thn. 2008. Warna hitam, Komplit, Tgn.1 Hrg: 120Jt (damai). HP. 0813 7063 3953 SUZUKI Sidekick Drag One Thn. 97, Asli Mdn, AC, Tape, VR, BR, PS, PW, Mulus, siap pakai. Harga 73 Jt. Damai. Hub. 0812 650 8819

TOYOTA Kijang LGX, DSL ‘00. Htm, AC DB, VR, BR, Jok Klt. Rp. 26Jt. Angs: 3,59Jt (langsung BW Plg). Toyota Soluna XLI ‘02, BK Medan asli, silver, AC, RT, VR, BR (baru), DP 16Jt. Angs: 2,23Jt. Hub. 061.76700 976 TOYOTA Kijang Capsul Model LGX New Bensin 1.8 Efi Thn. 2003. Biru Mika, sgt mulus, VR, BR, PS, PW, CL, E. Miror. AC DB, Sound System, DVD, MP3, TV Sentuh, Hrg. 138Jt. Nego. Hub. 0813 7550 1012. Orisinil sekali.

KREDIT VIA:

TOYOTA Kijang Super Th. 94. W. Abu2 metalic. AC, DBL, PW, PS, VR, BR, CL, BK Medan. Dashboard sedan. Body kaleng. Jamin mulus. H. Nego. Hub. 061.6991 1187

MITSUBISHI Kuda GLS Solar Thn. 1999. Biru BK Mdn Asli, lengkap, siap pakai. Hrg. 77/damai. HP. 0812 6545 1974

TOYOTA BARU Innova, Fortuner, Yaris, Vios, Altis, Camry, Rush, Avanza. Hub. 0813 7043 7766

Hadiah GPS + K.FILM V.KOOL + PARKING SENSOR

0852 7698 6997 / 061.7534 0199

TOYOTA Kijang Grand Extra Thn. 92. Warna abu2 met lengkap, BK Asli Medan (BK Pilihan). Mulus, siap pakai. Harga Rp. 63 Jt Nego. Hub. 6625188 / 0813 6214 8312

T OYO TA K i j a n g Innova Tipe G, 2005, Bensin Biru Metalik. 0812 65 777 800

9 CM Rp. 126.000 10 CM Rp. 140.000

TIMOR DOHC ‘97 warna hitam. Ijection, lengkap, AC, PS, PW, Velg Racing. 0821 60909150 Nego. DIJUAL

Carry Pick Up ‘06, Body Kaleng, sehat, w Hitam, BK Medan Kota. HP. 0812 6041 4216

VOLKSWAGEN PROMO

New VW-Golf TSi CBU Germany, Ready Stock. DP Mulai Rp. 90 Jt-an. Masih banyak type yang lain. 0821 6090 9150

DIJUAL VW Combi (Brazil) tahun 1982. Warna biru, siap pakai Hub. ANTO. 06176294338 Jl. Karya Wisata Ujung, Doorsmeer Jasa Prima. Harga Nego.

BURSA

BUTUH DANA BUTUH DANA CEPAT

1 Hari Cair Bunga Rendah, Dan Terjamin (Dlm/Luar Kota). Spesialis Leasing BPKB Mobil, Truk, Spd. Mtr. Terima Mobil yang masih kredit, over leasing. Dan Bantu Pelunasan BPKB. Hub. S8F Finance 061-8445716 - 0813 7044 6633

DANA EXPRESS SHM, SK Camat 1 Hari Clear 0813 6229 0001 0812 6095 5531 (Henrik) DANA CEPAT Dengan Jaminan BPKB Mobil, Sp. Motor, Taksi, Angkot dan Betor semua tahun. Syarat ringan - Proses cepat. Hub. (061) 7633 6525 - 0812 6081 3010

BURSA

SEPEDA MOTOR TIGER W. Hitam Th. 2009. Type GL. Motor cantik & Km. sedikit (BU). Hub. 0852 6161 9092

MINI & EFEKTIF IKLANKAN PRODUK ANDA

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

Pelanggan Yang Terhormat

FAX.4561347 Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput

HARGA BELUM TERMASUK PPN 10%

BURSA

ALAT MUSIK

BURSA

ALAT PESTA

HA TI-HA TI terhadap penipuan yang HATI-HA TI-HATI mengatas namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk membeli produk anda, TI-HA TI apabila anda ingin dan HA HATI-HA TI-HATI melakukan transaksi jual beli melalui transfer.

BURSA

MATERIAL

ELEKTRONIK

AC

AC

AC

CUCI AC, ISI FREON, BONGKAR PASANG. REPARASI, KULKAS, MESIN CUCI Hub. DIFA SERVIS 0813 9735 7061 061-69644786

CUCI + B. PASANG

KULKAS, DISPENSER, M. CUCI HUB. MAJU TEKNIK Tel. 7030118, Flexi 76750084

BARU 100% / GARANSI

Murah hanya Rp. 2090.000 + Pipa + Breket. (Stock Terbatas) NB: Bersedia Bongkar Pasang, Service, dll. Hub. TOKO SUMATERA JAYA G. Subroto 401 Medan Tel. 061-4143670 / 061.77555550

AC

PRATAMA TECHNIK

REPARASI/SERVICE AC SPLIT, WINDOW/CENTRAL, DISPENSER, MENGECAT KULKAS/ JUAL BELI AC BEKAS, DLL

HP. 0812 6053 690

7352833 0812 6064 9333

AHLI TOSHIBA, SONY,POLYTRON, LG,TV CINA

TV

JVC, Sharp, dll. Siap di tempat. Garansi JAYA 08137071 3504 - 76333944 RIDWAN0812 6303 4400, 77621674

BURSA

ELEKTRONIK PROJECTOR HANDICAM, CAMER, FAX, PRINTER

Handicam Sony Hi-8 = 1 Jt. Sony HDD 3,5Jt. JVC Mini DV1,5Jt. DVD 2 Jt. Camera 5 Mp - 12Mp 500rb - 1,2Jt/Fax, Printer= 600rb Projector LCD =3Jt

AC, KULKAS, M. CUCI, STABILIZER, GENSET

Jual AC Bermacam Merek 1/2, 3/4, 1,1 1/2, 2Pk-1,3Jt2 Jt. Kulkas 1 Pt - 2 Pt=600rb- 1,2Jt. 2 Pt -Jumbo - 2 Jt. Prejer 5 rak = 1,2Jt, 6 rak SOCES 1,8Jt. M. Cuci 1 Tb- 2 Tb= 600rb- 1,2 Jt. M. Cuci Baru =2,2Jt (1 tb 9 kg)Genset 3000 w. 2,5Jt, Stabilizer 3000w, 10.000w. Hub. UD. SENANG HATI: 4517509 - 77073637. Jl. Sekip 67 A (Jual & Beli) Cash/Credit

AC

PEMASANGAN DEPOT AIR MINUM ISI ULANG STANDAR DEPKES

15 Jt s/d 38 Jt (Nego)

RINALDI: (061) 685.0456 MOBILE 0813.6214.3160

Tel: 4525462 - Fax. 4151359

DIBELI HARGA TINGGI TV, LCD, Kulkas, M. Cuci, Handycam, DSLR, Laptop, LCD Projector, Laptop, PS 1, 2, 3, H. Theater, Sound System, dll. Hub. CV. MARKET, Telp. 7632 4682 - 0812 65393000 S. Budi T. Sari No. 424 B Psr. IV Dkt BNI

PELUANG USAHA

Pemasangan Depot Air Minum Isi Ulang paling murah Sesuai kemampuan anda 1. Depot RO 40 s/d 400 Galon/ hari 2. Depot Air Mineral/ Pegunungan 3. Jual alat-alat depot isi ulang Terima siap untuk jualan

BARU “HARGA” SPECIAL -

PELUANG USAHA

JL. YOS SUDARSO KM. 15,5 NO. 121 MEDAN

061-4576602. Terimakasih

SER VIS SERVIS

BERKUALITAS

CV. MITRA INTERNUSA

silahkan hubungi kami di

SERVICE

TERMURAH

AIR MINERAL DAN SISTEM RO JUAL ALAT-ALAT DEPOT ISI ULANG

Segala akibat yang terjadi diluar tanggujawab PT. Harian WASPADA. Apabila anda mencurigai sesuatu,

!! TOYOTA 100% BARU !!

AVANZA, RUSH, INNOVA, FORTUNER, YARIS, VIOS, ALTIS, CAMRY, HILUX. DP + BUNGA RINGAN. Hub. 0813 7512 7297 - (061) 7795 1428

11 CM Rp. 165.000 12 CM Rp. 180.000

Kamis, 13 Januari 2011

PANASONIC - LG MITSUBISHI - AUX SAMSUNG - DAST GENERAL - FUJI CHANGHONG - DAIKIN SHARP PLASMA CLUSTER

SEWA FLOOR STANDING HUB: 3 Pk Jln. Sutomo No. 139 C. & 5 Pk

TOKO SUPER ELECTRONIC

UD. RIZKY ABADI JAYA

Simp. Gandho

TEL. 061-7347810 - 7360741 TEL. 77982281 medan INSTALASI & PEMASANGAN SERVICE, REPARASI AC - KULKAS

ATAP & DINDING EURODEK

FD

KIRIMKAN... DATA IKLAN ANDA DALAM BENTUK

ALUMINIUM ZINC - AZ - 150

Jl. Veteran Psr. 10 (dpn Mesjid Al-Hidayah) Helvetia Telp. (061) 685.7558 HP. 0813.7580.8866

BURSA

CD PAGAR EURO GALVANIS

Hub. 8219951 Jl. Setia Budi No. 2

DIGITAL

Keterangan lebih lengkap silahkan hubungi:

HILANG/TERCECER

* Format: JPG - TIFF (Photoshop)

HILANG Surat Tanah SK Camat a/n. Alm. Ilyas. Yang beralamat Jl. Setia Luhur Gg. Supir. Luas 10x14M.

TELPON : 061 - 4576602 FAX : 061 - 4561347

WC WC

KONSTRUKSI

ANDA TUMPAT - SEDOT

R

BURSA

HILANG BPKB Asli No. 37640268 BK 1929 HH Dan KTP A/n. H. HASROEL HARAHAP. Alamat Jl. Pelita II No. 72 Medan.

HILANG / TERCECER

Surat Tanah yang dikeluarkan oleh Kel. Pulo Brayan Kota, Kec. Medan Barat, Tgl. 20 April 1983 yang terletak di Jalan Pertempuran Lk. VII d/h Lr. IX Kel. Pulo Brayan Kota, Kec. Medan Barat. An. KISNO. Bagi yang menemukan Hub. 4145589 (Eddy)

Ingin Promosikan Produk Anda Harian

WASPADA Media yang Tepat untuk Iklan Anda

EUROMESH BAJA U-50

R

KOLOM PRAKTIS EURO R BAJA U-50 SIAP PAKAI LEBIH PRAKTIS & HEMAT DARI BESI BETON

PRODUKSI:

PT. REZEKI PRIMA JAYA ABADI

Jl. Sutomo No. 436 Medan 20231 (samping Bank Maspion) Telp. (061) 452.2588 - 415.7504 - 455.7204 - 455.71494 Fax. (061) 415.7504 SUMUT - INDONESIA

BURSA

PELUANG USAHA

IFA DASYAT !!!! AYO SEGERA GABUNG !

RAIH BONUS UANG, PERJALANAN WISATA, MOBIL, RUMAH PRODUK LENGKAP: BAJU, TAS, SEPATU, AKSESORIES, COOK WARE, KOPI, DLL HUBUNGI MELAWATI JL. PAHLAWAN NO. 7 TG. MORAWA MEDAN (SUMUT) TELP:(061) 794.7364 0819.601.5795 0812.654.8425 (061) 7638.8063 0813.6229.7935 MENCARI MEMBER DI SELURUH INDONESIA

TUMPAT/ SAL. AIR

845.8996 0812.631.6631

Bergaransi/ Setia Luhur 160 F Jl. Brayan Medan

8442246 WC 08126427 1725

Tumpat Sedot

Telp.:

ADI

Ada Garansi

WC 0813 6147 0812 WC 0812 60444275 Setia Budi

JL. SETIA BUDI

Hub. TUMPAT / SEDOT WC/GRANSI

Ingin Promosikan Produk Anda Harian

WASPADA Media yang Tepat untuk Iklan Anda


Agenda

WASPADA Kamis 13 Januari 2010

07:00 Si Doel Anak Sekolahan 09:00 Dahsyat 11:00 Intens 12:00 Seputar Indonesia Siang 12:30 Sergap 13:00 Sinema Siang 15:00 Kabar Kabari 16:00 Bedah Rumah 17:00 Seputar Indonesia 17:30 Bisik Bisik Menantu 18.00 Dia Jantung Hatiku 19.30 PUtri Yang Ditukar 22.30 AFC Asian Cup 2011 01.30 Seputar Indonesia Malam

CATATAN

07:15 Inbox 09:03 Halo Selebriti 10:00 SCTV FTV 12:00 Liputan 6 Siang 12:30 SCTV FTV 14:30 Status Selebriti 15:00 Uya Emang Kuya 17:00 SL Liputan 6 Petang 17:30 Uya Emang Kuya 18:00 Islam KTP 19.30 Bintang Untuk Baim 21:00 Arini 22.30 SCTV FTV 00.30 Liputan 6 Malam

07.30 Layar Pagi 09.30 Cerita Pagi 10.30 Di Antara Kita 11.00 Sidik 11.30 Lintas Siang 12.00 Layar Kemilau 13.30 Cerita Siang 14.30 Starlite 15.00 Layar Spesial 16.30 Lintas Petang 17.30 Animasi Spesial 18.00 The Garfield Show 19.30 Sinema Spesial 20.30 Sinema Utama Keluarga 22.00 Hot Music 00.30 Lintas Malam

07.00 Land Before Time 07.30 Bima Sakti 08.00 Sinema Pagi 10.00 KAbut Cinta 11.30 Topik Siang 12.00 Klik! 13.00 Mantap 14.00 Aku Manusia Biasa 17.00 Topik PEtang 17.30 Super Family 19.30 Super Deal 2 Milyar 21.00 Pengejar Rahasia 22.00 Ekspedisi Merah 23.0 World Most Amazing Video 00.00 Topik Malam

07.00 Sensasi Artis 07.30 FTV Pagi 09.30 FTV Drama 11.30 Patroli 12.00 FTV Siang 14.00 Happy Song 15.00 KiSS 15.30 Fokus 16.30 Bread Love and Dreams 18.00 Arti Sahabat 19.00 Dia Anakku 20.00 Taxi 2 21.00 Marisa 22.00 Mega FTV 00.00 Angling Dharma 01.00 Fokus Malam

07:05 Bedah Editorial Media Indonesia 08:05 Eleven Show 09:05 Eleven Show 10:05 Eleven Show 11:05 Green Lifestyle 13:05 Oasis 13:30 Jakarta Jakarta 14:05 Sports Club 14:30 Metro Xin Wen 15:05 Bisnis Hari Ini 15.30 Public Corner 16:05 Discover Indonesia 16:30 Metro Realitas 17:05 Metro Hari Ini 18:05 Suara Anda 19.05 Suara Anda 20:30 Genta Demokrasi 21:05 Top Nine News 21:30 Destroyed In Second 22:05 Provocative Proactive 23:05 Inside 23:30 Metro Sports

B7 07.30 Rangking 1 08.30 Musik Derings 10.00 Suami Suami Takut Istri 11.00 Insert 12.00 Reportase Siang 12.30 Jelang Siang 13.00 Bingkai Berita 13.30 Online 14.30 Extravaganza Pilihan 16.00 Kejar Tayang 17.00 Reportase Sore 18.00 Jika Aku Menjadi 18.45 Sketsa 19.15 Suara Indonesia Bersama Yamaha 20.15 Bioskop Trans TV 22.30 Realigi 23.30 Bioskop Trans TV 01.30 Reportase Malam

06.30 Apa Kabar Indonesia 11:00 Menyingkap Tabir 11:30 Kabar Keadilan 12:00 Kabar Siang 13:30 Nuansa 1000 Pulau 14.00 Yang Terlupakan 15:00 Kabar Pasar 16:00 KAbar ++ 17:00 Renungan Hari Ini 17.30 Kabar Petang 19:30 Satu Jam Lebih Dekat 20:30 Apa Kabar Indonesia Malam 23:30 Kabar Arena 01.00 Kabar Malam

08.00 Fanboy & Chum Chum 08.30 Vicky & Amp Amp 09.00 Back At The Banyard 09.30 Obsesi 10.30 Miracle 11.30 Taubat 12.00 Awas Ada Sule 13.00 Momon 14.00 American Funniest 14.30 Petualangan Panji 15.00 Hand Made 15.30 Miracle 16.00 Obsesi 17.00 The Penguin Of The Madagascar 17.30 Spongebob 18.30 Mong 20.00 B 13 - U 22.00 Kabaret Show 23.00 Breaking The Magician Mode 00.00 Global Malam

07.30 Selebrita Pagi 08.00 Tom & Jerry 09.00 Scooby Doo 10.00 Mariam Mikrolet 11.00 Rahasia Sunnah 11.30 Redaksi Siang 12.00 Selebrita Pagi 12.30 Si Bolang 13.00 Laptop Si Unyil 14.30 Dunia Bintang 15.30 Koki CIlik 16.00 Jejak Petualang 16.30 Redaksi Sore 17.00 Asal Usul Fauna 18.00 Selebrita Sore 18.30 Pintu Kejutan 19.30 On The Spot 20.00 OVJ 22.00 Bukan Empat Mata 23.30 Masih Dunia Lain

**m31/B

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

Dokter Michael Jackson Akan Hadapi Tuntutan Pembunuhan

Album Baru Britney Dapat Acungan Jempol Penggemarnya Singel baru Britney Spears, Hold It Against Me diluncurkan sehari lebih awal dari jadwalnya pada Senin (10/1), dan memicu pemutaran gencar di radio serta acungan jempol dari penggemar bahkan pengeritiknya. Versi awal trak klub dansa itu bocor di Internet pekan lalu, dan Britney memberi tahu penggemarnya melalui Twitter untuk menunggu sentuhan akhir, diluncurkan melalui gelombang udara sehari sebelum peluncuran dijadwalkan pada tengah malam Selasa. Hold It Against Me adalah singel pertama dari ratu pop itu dalam lebih dari satu tahun dan peluncuran akhir dari album baru Britney Spears, dijadwalkan pada Maret. Peluncuran lagu baru itu dilakukan setelah satu tahun

BURSA

PENDIDIKAN INGIN LULUS PTN ?

Di UMB-PTN/ SNMPTN 2011 IKUTI SEGERA...!!! PROGRAM INTENSIVE 2011 Untuk alumni SMA/ SMK

agar lulus testing ke PTN melalui USM ITB, SIMAK, UI, UM UGM, UMB PTN, SNMPTN, USM UNDIP, STAN, STT TELKOM, dll Tahun 2011 Mulai belajar: Senin, 17 Januari 2011 Daftarkan sekarang juga

Di BT/ BS MEDICA

Jl. Bantam No. 12 Medan Telp. (061) 457.8058 Jl. Iskandar Muda No. 19B Medan Telp. (061) 415.9280 Belajar pagi hari: Jl. Bantam No. 12 Medan Belajar pagi atau sore hari: Jl. Iskandar Muda No. 19B Medan

BURSA

LOWONGAN DIBUTUHKAN: Gadis/ Janda Muslim, Untuk jaga anak/ orang tua/ PRT di Medan, Gaji 700 Rb s/d 1,2 Jt/ bln, Mendapat bonus 50 Rb tiap bulan Hub. YAYASAN BERSINARI Jl. Sekip Ujung No. 19C Telp. (061) 7636.3421/ 0812.6553.5559

TUKANG PANGKAS

Dibutuhkan Tkg pangkas berpengalaman, Penghasilan 2,5 Jt/ bln Hub. 0812.6090.213 Flexi (061) 7771.5106 TAHUN 2011

Jl. Ser dang Gg. Belimbing No. 2D MedanTelp. (061) 7784.1353. Butuh Karyawan Tetap. Dengan gaji 1 Jt/ bln bersih disediakan mess sebagai TENAGA PENJUAL ATK

DICARI GURU

Yayasan Pend. Darul Hikmah/ Tk. Melati untuk Guru SD, TK/ RA Hub. 0813.9796.0600 (061) 836.5626

DIBUTUHKAN

Sebuah lembaga pendidikan membutuhkan beberapa orang Staf Pengajar (English Teacher), persyaratan: 1. Pria/ wanita max. 30 tahun 2. Pendidikan min D3 3. Pengalaman min 1 tahun 4. Mampu menggunakan komputer Lamaran lengkap diantar ke: GRAND EDUCATION CENTRE Jl. Kapten Muslim No. 227B Helvetia Medan Telp. (061) 845.2872

DIBUTUHKAN

1 Org Sekretaris Kantor, Diutamakan S1 Hukum dan S1 Fisip, Perempuan, Usia: 35 sampai 40 tahun atau SMA sederajat Lamaran + Foto copy Ijazah, DRH, KTP, Pas photo 4x6: 2 lbr Antar langsung ke kantor Jl. Ahmad Yani VII No. 4 Medan Kampus Musi HP. 0852.9673.3744

LOWONGAN KERJA

Kami Perusahaan BUMN membutuhkan Tenaga Kerja Professional yang ulet, jujur bisa bekerja sama team, serta type pekerja keras untuk ditempatkan pada posisi: 1. TENAGA LAPANGAN 2. ACCOUNTING Syarat: - Pendidikan min. D3 Akuntansi (2) - Pendidikan min. SPP/ SPMA, D3 (Pertanian), S1 Sarjana Pertanian (1) - Usia min. 18 tahun, maks. 30 tahun (1, 2) - Berpenampilan menarik - Siap ditempatkan di wilayah Sumut dan Aceh Kirimkan dokumen lamaran anda dengan melengkapi berkas: - Surat lamaran, curriculum vitae (Daftar Riwayat Hidup) - Pas photo, Foto copy KTP, Kartu Keluarga - Photo copy Transkrip nilai dan Ijazah, Sertifikat/ Piagam terkait Lamaran ditujukan via pos ke:

d/a PsG

Kawasan Industri Medan Star Tanjung Morawa Jl. Pelita Raya No. 60 F Tanjung Morawa Deli Serdang Medan Indonesia Lamaran paling lambat 25 Januari 2011

bebas-drama bagi Britney setelah album hitnya 2009 Circus, menandai kembalinya penyanyi tersebut ke panggung musik setelah satu tahun kemerosotan karir dan pribadi. Tommy Chuck, direktur program stasiun radio Florida 93,3 WFLZ, mengatakan kepada MTV.com bahwa stasiun itu telah memutar singel tersebut setiap jam pada Senin. “Reaksinya sangat luar biasa. Facebook dan Twitter, orangorang senang Britney balik lagi (mereka) berterima kasih kepada kami karena memutar lagu tersebut, memberi tahu kami betapa mengagumkannya dia, dan semua staf siaran menyukainya. Itu adalah singel yang kuat, dan itu akan jadi hit besar buat dia,” kata Tommy Chuck.

Blogger selebriti Peres Hilton mengatakan secara antusias, “Kami kira itu terdengar seperti penggebrak !!!!!”. Kebanyakan penggemar Britney tampak sependapat. “Aku sudah meninggal dan pergi ke surga musik !!! Terima kasih Britney!! Sudah tiba waktunya lagu 2011 ini jadi kesayanganmu!!!” begitu komentar Fernando, di dalam komentar di jejaring resmi penyanyi tersebut. Britney meluncurkan album pertamanya pada 1999 dan terus jadi fenomena di seluruh dunia. Ia sejak itu telah menjual lebih dari 100 juta album di seluruh dunia dan oleh majalah Forbes pada 2010 dimasukkan ke dalam jajaran enam selebritis paling berpengaruh dan tangguh di dunia.(ant)

DICARI

RUMAH DIJUAL CEPAT

Operator Warnet + Office Boy, Lamaran diantar ke: Jl. Sakti Lubis No. 27

DICARI PENGURUS RT

2 Dewasa, 1 Anak Lk, Bersedia belajar masak dan Bhs. Inggris, Sabtu setengah hari, Minggu libur, Diutamakan Muslim Wanita, Berastagi 0852.7057.7646

BLUE BIRD MEMBUTUHKAN

189 Pengemudi, Komisi, Bonus, Insentif, Mess, Mobil New Limo, dll, Syrt: 23 50 thn, SIM & KTP, Tdk bertato/ bekas tato, Segera dtg/ kirim lamaran ke: Jl. Kapt. Muslim No. 92 Medan Telp. 7637.5840 - 844.2345

DICARI SUPIR (MUSLIM)

Memiliki SIM 25 - 45 thn Hubungi: RSU. Sufina Aziz Jl. Karya Baru No. 1 Sei Agul Medan

VACANT POSITION

Job Title : TAM Field Officer (TFO) Department: Operations - Medan General Job Descriptions: - Melakukan rekrut baru panel TAM - Melakukan instalasi people meter pada televisi panel TAM - Membina hubungan baik dengan panel TAM Job Requirements: - Minimal lulusan SMK Teknologi/ STM Jurusan Audio Video/ Elektronika - Usia maksimal 28 tahun - Terampil dalam hal instalasi, setting peralatan, maintenance dan perbaikan peralatan audio video - Bersedia bekerja dilapangan - Memiliki kemampuan berkomunikasi yang baik dan mampu bekerja sama dalam team - Mampu bekerja dibawah tekanan Apabila anda memenuhi kualifikasi diatas, silahkan kirimkan Curriculum Vitae, Surat Lamaran, fotocopy KTP, Fotocopy ijazah dan fotocopi Surat Keterangan Kelakuan Baik, ditujukan kepada: Jl. Brigjen. Katamso Gg. Perdamaian No. 11 Kel. Sei Mati Kec. Medan Maimun Medan 20159 TELP: (061) 414.6408 Lamaran ditutup hari Sabtu tanggal 18 Januari 2011 Cantumkan kode posisi TFO (MDN) Di sudut kanan amplop

BURSA

PROPERTY

Informasi Pembaca Bursa Property

GR : Garasi KM : Kamar Mandi KP : Kamar Pembantu KT : Kamar Tidur SHM: Sertifikat Hak Milik

LB LT RM RT

: Luas Bangunan : Luas Tanah : Ruang Makan : Ruang Tamu

Luas Tanah 194m² (SHM), LB. (10x15), KT 3, KM 3, Garasi, RS, Air PAM, Listrik, PLN, Telp alamat Jl. Jermal III No. 35 Medan Denai, Harga nego, TP Hub. 0819.7330.3330 / 0812.6540.7992

RUMAH DIJUAL

2 Km Tidur, 1 Km Mandi, Air PAM, Listrik, Sertifikat Hak Milik, Ls. Tanah 10x20m, Comp. Veteran L. Dendang, Blok A No. 10 Jl. Kapt. Batu Sihombing Hub Telp. 738.0744 (Lisa) TANAH TANAH Siap bangun Ukuran 15x27m, SHM, Pagar tembok keliling Jln aspal di Pematang Johar Labuhan Deli, ±10menit dari Simpang Cemara Asri Sampali Hub. 0813.9760.8506 (TP)

TANAH DIJUAL

Britney Spears/blogspot.com AMANAH UMROH Izin Usaha : 503/1099.SK.HO/SL/NT/08 JADWAL HARGA UMROH TAHUN 2011 / 1432 H

PROGRAM TANGGAL UMROH REGULER 9 HARI 1, 4, 14, 25 MARET 1, 11, 22 APRIL UMROH REGULER 14 HARI 9 , 23 MARET 8, 22 APRIL UMROH + CAIRO 12 HARI 16 MARET, 21 APRIL UMROH + TURKEY 12 HARI 22 MARET, 19 APRIL UMROH + AQSHO 11 HARI 25 MARET, 26 APRIL

Harga Ekonomis Fasilitas Paket Bisnis

RUMAH TAMAN SETIA BUDI II DIJUAL LT. 180m, LB. 110m, KMT 3. 4x3, 3x3, 6x6, KMD 3, Gudang 3x4 atas, List 2200 AC 3, Kitchen, Mobil bisa 2 Hub. 0813.9601.2398

Tiap Hari Sabtu Pkl : 14.00-16.00 WIB Minggu Pkl : 09.00-11.00 WIB Manasik Haji di mulai Tgl. 20 Februari 2011 Daftaran segera ke kantor Pusat Multazam Medan Jl. Titi Papan/ Pertahanan No. 10 Sei Sikambing Medan Telp. (061) 457.6116 - 7731.3385 HP. 00813.6137.2321 - 0812.6495.8456

MBAK ALIN

BERSEDIA DIPANGGIL HUB. 0813.7739.9508

TANAH DIJUAL

Seluas 270m² (15x18m), SHM, Lokasi Komplek Taman Perkasa Indah (TPI) Blok I No. 12 Peminat hub. (061) 7710.0489/ 0812.6343.044

PIJAT CAPEK, LULUR DAN TERAFY ALAT VITAL Hub. MBAK VINA 0813.9772.8637

TANAH DIJUAL

“H. MOHD. RAWAL”

HP. 0821.6733.5238

Ciri2 Ambeyen: Disekeliling Dubur Ada Benjolan Seperti Daging Tumbuh/Jerawat, Gatal, B.A.B Keras, Keluar Darah Segar. Susah Duduk Seperti Ada Yang Mengganjal. Duduk Serba Salah. Nyeri (Ngilu). Dubur Seperti Luka, Solusinya Datang dan Berobatlah ke

SPECIALIST AMBEYENT TANPA OPERASI PUTUS SAMPAI KE AKAR2NYA DIJAMIN TDK SEMBUH UANG KEMBALI GARANSI

1. Uk. 10x20m Jl. Eka Warni Baru, Medan Johor, 700 Rb/m Sertifikat 2. Uk. 6x22m & Uk. 8x21m Jl. Pertahanan Gg. Pisang, Patumbak 400 Rb/m, SK Camat

“MINYAK BULIN” (BULUS + LINTAH ASLI)

MUJARAB: 100% DIJAMIN PUAS, MANTAP & PERMANENT BIKIN ALAT VITAL PRIA JADI BESAR - PANJANG - KOKOH - BEROTOT DAN TAHAN LAMA BAHKAN USIA 70 TAHUNAN TETAP MACHO. BUKTIKAN ! (HANYA Rp. 150.000/ BOTOL) TERSEDIA: KAPSUL HERBAL BIKIN TAHAN LAMA & KUAT SEX SEMALAM SUNTUK DAHSYAT AMAN UTK JANTUNG (Rp. 20.000/ KAPSUL) JAMINAN GARANSI ALAMAT PRAKTEK:

Ingin Promosikan Produk Anda Harian

WASPADA Media yang Tepat untuk Iklan Anda

BAMBANG AL-AZIZ/ KONSULTASI SPIRITUAL HP. 0813.7084.7253 - (061) 7737.7370

JL. SELAMAT NO. 35A SM. RAJA MEDAN CAB: TEBING TINGGI JL. PULAU IRIAN NO. 5

TERAPY ALAT VITAL TERBESAR DAN TERPERCAYA IZIN DINKES NO. 037/DRHP/1973/12JULI/73

PERNAH HADIR DI JOHOR MALAYSIA PERNAH HADIR DI LIVE TOP NEWS METRO TV

SEBAGAI PENGOBATAN TERBAIK MASTER OF KEJANTANAN DAN KEROHANIAN TERAPY NYATA DAN LUAR BIASA, BESAR, PANJANG, LANGSUNG DITEMPAT DAN BERGARANSI UNTUK SELAMANYA 100% ALAMI. METODE PENGURUTAN DISEKITAR ALAT VITAL MELALUI TO-TOK URAT URAT KEJANTANAN. KAMI TIDAK MENGGUNAKAN VACUM, SEPERTI SUNTIK SILIKON, DLL. JANGAN SALAH INFORMASI, DISINI TEMPATNYA, HANYA DGN WAKTU 25 MENIT KAMI AKAN BUKTIKAN ALAT VITAL ANDA MENJADI JUMBO DAN TAHAN LAMA: BAGI ANDA YG KECEWA DITEMPAT LAIN, KAMI SIAP MEMBANTU ANDA (TIDAK TERBUKTI JANGAN BAYAR). RAHASIA TERJAMIN UNTUK SEMUA AGAMA, MEMBUKA AURA, KARIR DAN JABATAN, JUGA MENGOBATI KENCING MANIS, LEMAH SYAHWAT, DLL HUB. H. ANDI BERSAMA H. ZAENAL 0812.2764.4325 - 0858.6119.7008 JL. SM. RAJA MASUK AMALIUN DEPAN HOTEL MELATI GG. PADUAN TENAGA NO. 11

Ingin Promosikan Produk Anda Harian

WASPADA Media yang Tepat untuk Iklan Anda

“H. MHD. RAWAL”

KEBUN SAWIT DIJUAL

PUSAT:

Jl. Prof. H.M. Yamin S.H No. 251 A Simpang Pahlawan Tel.(061) 4563067 Cabang I

Luas 2 Ha, Harga 125 Jt, Surat SHM, Lokasi Selat Beting dekat Ajamu Hub HP. 0812.628.9146 0812.6308.6611

BURSA

PERABOT SPESIALIS REPERASI KURSI

Sofa, Jepara, K. kantor, Ganti kulit/ kain + Busa cat ulang perabotan, Murah dan garansi. NB. Tempahan sofa minimalis Hub. 7740.5997 (Anto)

TANAH MURAH

Di Awal Tahun anda bisa punya sebidang tanah hanya dgn Rp. 14 Jt-an dgn uk. 6x18m² langsung di potong Rp. 2,5 jt + Gratis biaya surat, Tinggal 5 Kavling dari kavling, Promo ini berlaku s/d Tgl. 18 Januari 2011

TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.6802 - 661.8116 - 7653 2188

SPRING BED DIJUAL MURAH

Lokasi siap bangun Dijamin bebas banjir alamat: Jl. Karya Psr. V Sei Mencirim Diski Hub. 0813.6112.2791 / 7746.7719 - 7707.2611

Spring Bed 6 kaki 2 lapis Rp. 1.100.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun

MINI & EFEKTIF

Hub Telp. (061) 661.6802 - 661.8116 - 7653 2188

IKLANKAN PRODUK ANDA

BURSA

BURSA

KESEHATAN

TRAVEL/ WISATA

OBAT KUAT PERKASA

- PIL DAHSYAT --> Spontan Keras, kuat & T. lama - SPRAY AJAIB --> Tahan berulang² (Tdk kebas) - VAKUM SPORT --> 1x Pompa Spontan Bsr, Pjg *juga Ada Aneka Kondom & Kebutuhan P/W Hub. 0813.6199.1823 - (061) 7764.1003 Pesan Antar

Jl. Bunga Harum (Benteng) No. 26 Suka Jadi Telp. 0761-45368 -HP. 0812 6568 700 Pekan Baru Telp. (0761) 45368 HP. 0812.656.8700 Cabang II: Komp. Perhub. Laut Jl. Baruna II/II Telp. 0765 36906 HP. 0852 6201 0594, 0812 60311 695 Dumai

SPECIALIST MATA TANPA OPERASI Dapat disembuhkan sampai tuntas Segala jenis mata seperti mata: - Katarak, Plus, Minus, Glaucoma - Mata Merah, Berair, Bengkak, dll

Khusus yg mau masuk angkatan minus jarak pandang +/- 7 Meter B/W (buta warna), juga dapat di sembuhkan sampai tuntas, Insya Allah Hub. IBU FARIDA AKRAM Jl. Prof. H.M. Yamin S.H (Serdang) No. 251 A Tel.(061) - 4563067 Mdn Izin Depkes R.I Terdaftar web: ffaridar aridar awal.com aridara

JL. KLAMBIR V NO. 152 KP. LALANG MEDAN

KLINIK TERAPY MAK EROT YANG TERUJI DAN TERBUKTI

Dengan H. TEJA SAEFUL

Cucu Asli Mak Erot Bersama

A. Ust OTONG

BILA anda ingin perkasa ingat jangan sampai salah masuk carilah yang benarbenar pewaris ilmu Mak Erot Sejati, karena keahlian H. Teja Saeful sudah tidak diragukan lagi dalam menangani keluhan seputar alat vital bahkan pengobatan H. Teja Saeful, sudah terkenal Indonesia dan kota-kota besar di Indonesia, sudah ribuan pasien tertolong dipengobatan Mak Erot ini yang aman tanpa efek samping, bahkan dimanca negara sekalipun pengobatan Mak ERot sudah tidak diragukan lagi keberhasilannya. INGAT untuk Kaum Pria janga nsampai Anda terhina Kaum wanita karena kondisi alat vital yang kurang sempurna Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041 KONSULTASI UMUM: KHUSUS PRIA: - Buka Aura - Ejakulasi dini - Cari Jodoh - Impotensi - Sesama jenis - Memperbesar “Alvit” - Pelaris - Memperpanjang “Alvit” - Memikat lawan jenis - Keras dan tahan lama dll - Besar PYDR KHUSUS WANITA: - Ingin punya keturunan - Memperkencang & memperbesar payudara - Mengobati keputihan dll

DIJAMIN 100% Hanya Tempat Kami Klinik Mak Erot Jl. Laksana No. 55J masuk dari Jl. Amaliun Yuki Simpang Raya Medan (Praktek Tetap) HP. 0812.4038.333

RUKO 2½ TKT DIJUAL

Jl. Galang/ Bangau No. 24 HP. 0813.6226.1439

Di Bimbing sampai ke Tanah Suci 1. Umroh Reguler 9hr, 13 dan 14hr Maret - April 2. Umroh dan Arbain di Madinah 20hr: 18,5 Jt 3. Umroh Plus Mesir - Bulan Maret 4. Umroh Plus Turkey - Bulan April 5. Umroh Plus Aqsha - Bulan April 6. Umroh Plus Indah Kashmir 7. Umroh Plus Dubai 8. Umroh Paket Promo 10 orang Gratis 1 ONH Plus/ Khusus Thn 2011 Tempat manasik Haji di Mesjid Agung Jl. P. Diponegoro Medan

KUSUK & LULUR

RUMAH/ TANAH DIJUAL

RUMAH DIJUAL

UMROH & MANASIK HAJI BERSAMA “MULTAZAM”

Uk. 14x65m dan Rmh Semi Permanen (SHM), Hrg 140 Jt Lokasi Jl. Baru Sei Mencirim dekat SMPN 3 Sunggal Hub. 0811.659.235

Jl. Durung/ Makmur 122, LT. 14x38, SHM/ BPN/ PAM/ PLN/ Telkom, 800 Jt/nego, dkt Kampus Unimed/ UMA/ IAIN/ MMTC Pancing Hub. 0812.6316.8788 - 0852.9600.6090

Di Jl. Bambu No. 52 Psr. 4 Helvetia Timur, LT. 223,60m², LB. Atas (11x3)m² bawah (12x11)m² + Garasi 2 mbl, KT 4, KM 3, dkt Mesjid, Fasil, PLN, PAM, Telp, Surat Camat, Harga 350 Jt, Untuk Muslim Hub. (061) 7753.4590

USD 2.300 USD 2.600 USD 2.800

Khusus bagi jema’ah dari luar kota nginap di Hotel Madani Gratis OFFICE: Gedung Gelora Plaza Lt. 1 Jl. S.M. Raja No. 4 / 18 Medan Telp. 061- 7326981, 0811647795 Fax. 061-7326981

RUMAH DIJUAL

RUMAH DIJUAL

USD 1.750

NB: untuk perubahan type kamar menjadi : Triple menambah USD 50 Double menambah USD 100 AKOMODASI HOTEL BERBINTANG HOTEL MADINAH: DALLAH TAIBA, Setaraf ***** HOTEL MAKKAH : JAWHARAT ANFAL, AL BUSTAN, Setaraf **** HOTEL JEDDAH : AL AZHAR *****

Jl. Eka Resmi Kompleks Spring Ville No. 6 HP. 0812.603.3027

SHM, Ex praktek dokter gigi Jl. Pinang Baris No. 182-D Simpang Tiga Pekan Sunggal, Harga 550 Jt/nego Hub. 0852.6264.3818 - 0813.9655.5389

HARGA USD 1.575

SEORANG hakim, Selasa (11/1), memerintahkan dokter pribadi Michael Jackson untuk menghadapi pengadilan dengan tuntutan menghilangkan nyawa orang secara tak sengaja dalam kasus dugaan pembunuhan terhadap penyanyi itu dengan menggunakan obat penenang melebih dosis. dr Conrad Murray dan Michael Jackson/ C o n r a d M u r r a y newsone.com membantah tuduhan tersebut, dan mengatakan ia cuma mengobati icon musik pop itu karena ia menderita insomnia, ketika Michael meninggal pada Juni 2009, sebagaimana dikutip dari AFP. Surat izin praktek medis Dr Conrad di California juga dibekukan. Dokter tersebut akan menghadapi proses pengadilan pada 25 Januari, demikian putusan hakim Pengadilan Tinggi Los Angeles setelah enam hari proses pemeriksaan pra-pengadilan. Dalam proses itu, bukti diajukan bahwa Dr Conrad Murray berusaha menutupi bukti mengenai obat yang ia berikan kepada bintang tersebut beberapa saat sebelum kematiannya.(ant)

BURSA

BUSANA & ASESORIS

KONVEKSI KAOS Menerima Tempahan:

ˆ KAOS OLAH RAGA SEKOLAH KAOS PILKADA PROMOSI

CEPAT DAN EKONOMIS

Jl. Amal Luhur Gg. Kuini No. 129J (061) 847.5648 / 0811.659.235 Mdn

KLINIK TRADISIONAL ALAT VITAL DARI PELABUHAN RATU CISOLOK BANTEN DITANGANI LANGSUNG

A. AMARUDIN

TERAPI KEJANTANAN DENGAN MENGGUNAKAN TOTOK SYARAF DAN DIBERIKAN RAMUAN/ JAMU HASILNYA PERMANEN. TANPA EFEK SAMPING BEBAS USIA, BEBAS PANTANGAN DAN AGAMA REAKSI LANGSUNG DI TEMPAT MEMILIH UKURAN YG SUDAH DI SIAPKAN DARI NO (1) S/D (3)

MENGOBATI PRIA

+ BESAR : 3, 4, 4, 4, 4, 5, 5, 5, 6 CM + PANJANG : 13-14-15-16-17-18-19-20 CM - IMPOTENSI - LEMAH SYAHWAT - KURANG KERAS/ LOYO - MANI ENCER/ EJAKULASI DINI - DIABETES/ KENCING MANIS - TDK PNYA KETURUNAN - MENANGANI PROBLEM ASMARA, DSB ALAMAT: JL. SM. RAJA DEPAN GARUDA PLAZA GG. KELUARGA SAMPING KLINIK BUNDA NO. 31A HP. 0812.6057.6444

Jangan Lewatkan Interaktif langsung dengan PASAK BUMI di DELI TV Setiap Sabtu Malam Pkl. 22.30 Wib (Live)

Call Center: 0818 090 73481

KLINIK

PUTRA PASUNDAN RAJANYA PENGOBATAN ALAT VITAL ANDA GAGAL DITEMPAT LAIN...???

N

Kami memberi bukti bukan janji, alat vital besar dan panjangditempat, no suntik, no silikon dan bukan bahan kimia, murni tradisional, ramuan alami dan Do’a, dijamin paten dan permanen tanpa ada efek samping bebas pantangan. Untuk semua usia, ras dan agama. Untuk Pria: Besar dan panjang disesuaikan dengan ukuran yang di inginkan, dijamin joss, menjadikan alat vital keras, kuat, tahan lama, menyembuhkan impotensi, ejakulasi dini, lemah syahwat, lemah karena diabetes dan mengatasi ereksi, loyo dan kurang gairah, kembali perkasa menangani bekas suntik/ silikon, mani encer, plek cur, mati total, spilis, mandul, ingin punya keturunan, dan menangani yang gagal ditempat lain. Untuk Wanita: (Bisa berdarah lagi) menghilangkan keputihan becek, bau tidak sedap, ingin menceng-kram, wangi. Buktikan disini (Bergaransi) HP. 0812.8481.8889 Alamat praktek: Jl. SM. RAJA SAMPING UISU MASUK JL. SEMPURNA 300M NO. 49 MEDAN

BIANGNYA TERAPI ALAT VITAL PRIA/ WANITA

Bersama: H.M. ABIDIN KEJATI NO.B: 002/DSPS/01/2011

Master of kejantanan dan kerohanian Kini hadir di kota Medan pengobatan nyata luar biasa kami siap membantu. Anda jangan salah informasi disini, yang pasti 25 menit kami akan buktikan alat vital menjadi jumbo dengna metode perguruan di sitar alat vital melalui totok urat-urat kejantanan, kami tidak menggunakan vakum, silikon, dll. Bagi anda yang kecewa di tempat lain kami siap membantu anda sampai puas dan tidak mengumbar janji belaka, dijamin tidak ada efek samping, bebas untuk semua agama, bukan janji tapi bukti di tempat. Penanganan: - Besar, panjang, keras, kuat dan tahan lama, kencing manis, L. syahwat, diabetes - Membentuk payudara kenyal dan montok - Penglaris, karir/ jabatan - Pengasihan dan memisahkan PIL/ WIL - Pasang susuk/ gurah vagina HATI-HATI JANGAN SALAH INFORMASI, PERCAYAKAN PADA AHLINYA YANG PALING EFEKTIF DAN RASIONAL Alamat: Jl. SM. Raja, masuk Amaliun Hotel Melati Kamar 144

HP. 0821.6033.3007


Opini

B8

Aceh Sepintas Lalu

TAJUK RENCANA

Untuk Tekan Kemiskinan Turun Pengemis Dianggap Tak Miskin

B

ank Dunia mengungkapkan pertumbuhan ekonomi di Indonesia melambat. Sementara jurang kaya-miskin kian lebar. Ini fakta sekaligus tantangan yang cukup berat bagi pemerintah SBY-Boediono. Pertumbuhan melambat karena faktor domestik seperti gangguan yang berhubungan dengan cuaca terhadap pertanian. Akibatnya, pertumbuhan ekonomi di Indonesia pada 2010 dari 6,0 persen turun menjadi 5,9 persen. Namun pemerintah membanggakan angka kemiskinan turun dari 14,2 persen pada 2009 menjadi 13,3 persen pada 2010. Atau penduduk miskin Indonesia turun dari 32 juta jiwa menjadi 31,02 juta saja pada 2010. Nah, validkah data itu? Kalau ditanya kepada BPS tentu valid, tapi bagaimana dengan kenyataannya di lapangan, pasti bertolak belakang. Masalahnya, kemiskinan semakin mengentas, melebar. Tidak hanya di daerah tapi juga perkotaan. Tidak sulit mendapakan keluarga yang hanya makan sekali dalam sehari, atau mengonsumsi ubi, tiwul, nasi aking saat ini. Memang kalau ukuran miskin dilihat dari penghasilan Rp5 ribu sehari sebagaimana dikatakan Kepala BPS Rusman Heriawan bahwa angka Rp5.000 tersebut mencerminkan bagaimana seseorang itu bisa memenuhi kebutuhan dasarnya berupa makanan pokok. Atau mampu mengeluarkan uang dalam jumlah yang sama untuk mencukupi 2.100 kalori dari asupan makanannya sehari, lantas dianggap tidak miskin lagi. Hal itu jelas menggelikan. Sebab, ribuan abang beca, pengojek mampu menghasilkan uang sampai Rp10 ribu sehari, bahkan lebih. Mereka bisa mengeluarkan uang sampai di atas Rp5 ribu sehari untuk makan. Mereka pun bisa memperoleh bahan makanan dari mana-mana dengan jumlah di atas 2.100 kalori. Sehingga kalau pemerintah menganggapnya tidak miskin, pastilah data BPS tidak valid. Meragukan! Sebab, ukuran miskin tidak sebatas itu. Banyak sekali tolok ukurnya yang seharusnya dipenuhi pemerintah, seperti perumahan yang layak, kesehatan yang terjangkau, pendidikan yang murah dll . Oleh karena itu kita pantas menggugat Intisari pemerintah yang kelihatannya ‘’hakkul yakin’’ penduduk miskin Indonesia hanya 31,02 juta jiwa? Kita benar-benar tak yakin. Apalagi kalau Perlu upaya pengentasan melihat jumlah data keluarga miskin yang mencapai 19-20 juta keluarga, kalau kemiskinan dengan kerja bisa dikalikan empat orang satu keluarga, total keras pemerintah menyi- orang miskin Indonesia sudah mencapai di 80 juta jiwa. Pantas kalau terjadi apkan program pro-rak- kisaran rebutan sembako, zakat, BLT di mana-mana. yat kecil. Kita pun ‘’hakkul yakin’’ kalau sebenarnya data BPS itu jauh dari kebenaran, di mana jumlah orang yang hidup miskin sebenarnya jauh lebih besar. Apalagi kalau kita memasukkan orang yang mendekati garis kemiskinan, maka jumlahnya akan lebih besar lagi. Atau parameternya ditingkatkan di atas Rp5 ribu sehari untuk makan, apalagi kalau mau menggunakan parameter yang lebih layak dan manusiawi sedikit saja, maka jumlah penduduk miskin Indonesia —gabungan mereka yang berada di bawah garis kemiskinan dan mereka yang mendekati garis kemiskinan—bisa meningkat sampai 50 persen lagi. Kondisi Indonesia memang aneh. Negaranya kaya sumber daya alam yapi rakyatnya mayoritas hidup dalam kemiskinan, bertahun-tahun tidak mengalami perubahan. Paling yang berubah mereka yang hidupnya kelas menengah dan kelas atas saja. Bahkan, kalau melihat data Forbes, penduduk Indonesia yang kaya semakin kaya dan yang miskin semakin terjepit. Buktinya, dari 40 orang penduduk Indonesia yang kaya, kalau ditotal jumlah kekayaannya mencapai 71 miliar dolar atau Rp640 triliun. Dan 16 persen dari mereka berkutat di bidang pertambangan batubara dan perkebunan kelapa sawit. Dari laporan Asia-Pasific Wealth Report 2010 terungkap, jumlah populasi orang kaya di Indonesia mencapai 24.000 orang. Artinya, jumlah orang berduit di Indonesia meningkat 28,3% dibanding tahun sebelumnya yang hanya 19.000 orang. Angka pertumbuhan orang kaya di Indonesia lebih besar ketimbang Thailand yang hanya 19,6%, Korea Selatan (21,2%), Jepang (20,8%), dan negara lainnya (11,1%). Harapan kita pemerintah SBY –Boediono memperhatikan tingkat kesejahteraan rakyat kelas bawah untuk menekan angka kemiskinan yang sebenarnya. Membuka lapangan kerja dan menyosialisasikan program KB di kalangan bawah. Sehingga angka kemiskinan benar-benar turun. Bukan yang sengaja ditekan-tekan dan diakalakali agar menurun untuk meningkatkan citra pemerintah semata, sehingga paramaternya semakin ‘’absurd’’ karena bisa saja seseorang itu mampu menghasilkan dan mengonsumsi makanan seharga Rp5 ribu seharinya, seperti pengemis yang semakin ramai di jalanan, anak-anak terlantar dan pengamen jalanan, tapi sejatinya mereka tergolong miskin. Kasat mata mereka miskin dan kalau tidak ada upaya pemerintah pusat dan daerah merekalah korban kezaliman penguasa dan menjadi penduduk miskin permanen (absolut). Oleh karena itu, kita mendukung upaya untuk merevisi dan dilakukan pendataan ulang yang menggunakan parameter lebih manusiawi dan cermat agar data BPS tidak mendua, dapat digunakan, sehingga Wakil Presiden RI Boediono sampai menyatakan perlu penyeragaman penggunaan data kemiskinan oleh seluruh pemerintah provinsi dan daerah mulai diterapkan pada 2012.+

APA KOMENTAR ANDA SMS 081265134674

Faks 061 4510025

Face Book username: smswaspada

08126326xxx Yth, Bapak Walikota Medan mohonlah diperhatikan jalan di Jalan Tunggal Kelurahan Sidorame Timur Kecamatan Medan Perjuangan sekarang ini sudah sangat parah, jembatan kecil yang menghubungkan Jalan Perjuangan dan Jalan Tunggal ada lubang yang semakin hari semain besar. Sudah hampir 20 tahun daerah kani belum dapat perbaikan. 0811600xxx Bapak Kapolresta Kota Medan, Kenapa togel masih ada beredar di Medan, kan katanya sudah dilarang. 0819423xxx Kepada Komisi Penyiaran, mohon diperhatikan tayangan di televisi yang muatannya semaikin tidak mendidik.Waspada tanggal 12 Januari 2011 di halaman pertama menurunkan berita “2000 anak Medan bawah umur terjebak prostitusi”. Ini adalah salah satu akibat dari siaran televisi yang tidak mendidik. Kalau sudah begini siapa yang mau bertanggungjawab? KPI yang punya wewenang memantau penyiaran sudah seeharusnya bertindak. 0812612xxx Horas. Katanya Kualanamu mau dipakai mulai 2012, tapi sampai sekarang jalan untuk ke sana belum juga nampak, bagaimana ini..? Apakah yang diucapkan pejabat-pejabat itu cuma di mulut saja tanpa ada fakta di lapangan. Tolong, jangan berikan masyarakat impian yang kosong saja. 0813620xxx PLN Kenapa pemadaman ada lagi, pikirkan juga peralatan kami yang jadi rusak karena hidup mati hidup mati…Kalau kami lambat bayar kalian putus, tapi kalau kalian matukan lampu seenaknya tanpa pemberitahuan, fair la kalian PLN 06177383xxx Pak Wali Wali, kenapa kanal banjir yang di Titi Kuning enggak berfungsi? Medan banjir lagi banjir lagi… Kalau begini terus ganti aja namanya dari kota Medan menjadi kota Banjir. 0812604xxx Kepada Komisi Penyiaran Indonesia Daerah (KPID) Sumatera Utara, harap ditertibkan persoalan frekuensi siaran yang “berselemak”. Banyak frekuensi nganggur tak dipakai tapi takjuga diserahkan kepada pihak lain yang membutuhkan. KPID di Sumut dibentuk tugas utamanya adalah untuk ini salah satunya, yakni menertibkan frekuensi. Ada yang punya frekuensi tiga sampai lima buah, tapi tidak dipergunakan, hanya disimpan saja dan dibisniskan miliaran rupiah. Inikan namanya tidak benar. Harap KPID Sumut menunjukkan kinerjanya. 0828765xxx Pak wali, sekarang ini banyak lampu lalulintas yang tak berfungsi, sehingga kemacetan lalu lintas semakin menjadi-jadi, Lampu pengatur lalu lintas dipersimpangan RS Malahayati malah bikin bingung, mohon dipeintahkan KADISHUB Medan untuk mengatasinya. 0818987xxx Yth, Walikota Medan Perhatian ke Wilayah Medan Utara yang katanya tahun 2011 akan giat dilakukan pembangunan jangan sebatas janji doang aja, kami tunggu kenyataan dilapangan pak.

WASPADA Kamis 13 Januari 2011

(Catatan Perjalanan Aceh 2010) Oleh Zulkifli Hamid Paloh Dari sisi kemiskinan, Aceh adalah yang paling miskin di Sumatera, sementara anggaran Aceh adalah yang terbesar di Sumatera

H

iruk-pikuk tahun 2010 telah kitaakhiri.Pestakembangapi, rekreasi, doa bersama, dan sejumlah harapan yang lebih baik pun didambakan setiap orang di berbagai belahan dunia, tak terkecuali di bumi Aceh Serambi Makkah. Berbagai peristiwa penting telah terjadi dengan segala kenangan, antara indah dan pahit, dukungan dan kontroversi pada tahun 2010, dan kini kita sudah memasuki harihari pada tahun 2011, tahun kerja keras dan semangat baru. Tulisan ini merupakan bagian dari refleksi Aceh 2010 (reflect-bahasa inggrisyang artinya menggambarkan, membayangkan, dan mencerminkan suatu opini/pendapat) terhadap apa yang telah dicapai dan apa yang belum, hingga akhirnyamelahirkanikhtiarbaruyanglebih serius dalam pembangunan Aceh ke depan. Pertama, dari aspek perencanaan, Aceh telah memiliki rancangan dokumen perencanaan yang cukup baik, dokumen Rencana Pembangunan Jangka Panjang Aceh tahun 2005-2025 (RPJPA) dan RencanaTataRuangdanWilayahAceh(RTRW) tahun 2010-2030. Kedua dokumen ini sedang menunggu untuk menjadi Peraturan Daerah - Qanun - oleh DPRA. Bahkan menurut Direktorat Jenederal Bina Pembangunan Daerah Kemendagri, rancanganRPJPAcehakanmenjadimodel bagidaerahlaindiIndonesia,karenamerupakan RPJPD pertama di Indonesia yang sudah sesuai dengan Permendagri Nomor 54Tahun2010.Artinya,adaharapanbahwa arah dan landasan pembangunan Aceh jangkapanjangtelahtersemaidenganbaik, tinggal tunggu implementasi dan komitmenolehpara pengambil kebijakan untuk setia pada peta jalan pembangunan Aceh. Kedua, dari sudut anggaran, Aceh kembali ikut dalam agenda jam tayang kejar serapan anggaran yang tinggi. Lihat saja realisasi keuangan Anggaran Pendapatan Belanja Aceh (APBA) tahun 2010 hinggaposisi30Desember2010mencapai Rp6,1triliunatauhanyamampumenyerap

anggaran87,7persendaritotalpagusenilai Rp7,64triliun,atauterdapatsisaAPBA2010 sekitar Rp1,527 triliun. Sedangkan realisasi fisik atau pekerjaan fisik dilaporkan sudah 97,81 persen dikerjakan (Serambi Indonesia, 4/1/2011). Coba dibandingkan dengan posisi pada pertengahan Oktober 2010, daya serapnya baru mencapai 54,72 persen atau senilai Rp4,179 triliun dengan realisasi fisik baru 67,20 persen dari target 77 persen. Bayangkan, dalam hitungan tiga bulanan, SKPA harus menghabiskan dan mempertanggungjawabkan secara administratif senilai Rp3,45 triliun lagi.Tentu ini tidak gampang, dan sangat berpotensi untuk diselewengkan, atau setidaknya realisasifisikakanberkualitas rendah. Keterlambatan pengesahan APBA Tahun 2011 juga akan terulang kembali, sehingga kontraktor dan pelaksana kegiatandilapanganakansangatsenangdengan mekanisme kerja “kebut sebulan untuk proyek satu tahun”. Ketiga, dari sisi birokrasi, tahun 2010 ditandai dengan pengangkatan Sekretaris DaerahAceh(Sekda)baru,TeukuSetiaBudi (menggantikan Husni Bahri TOB) yang memasuki pension. Sekda baru, sebelumnya dikenal sebagai sosok yang mempunyai integritas tinggi. Gubernur pun telah memberikan delapan tugas prioritas kepada Pak Setia Budi, yang membutuhkan dukungan berbagai pihak sebagai harapan terhadap reformasi birokrasi. Tugas berat Pak Sekda, antara lain menyelesaikan rancangan qanun, menyukseskan Pilkada Gubernur, Bupati/ Walikotatahun2011,menyelesaikanbeberapa turunan pelaksanaan UUPA yang selama ini belum tuntas: 1) Rancangan

Peraturan Pemerintah (RPP) Pengelolaan Bersama Migas Aceh, 2) RPP Kewenangan Pemerintah Aceh yang Bersifat Nasional di Aceh, 3) RPP Pelimpahan Kewenangan Pemerintah Kepala Dewan Kawasan Sabang, dan 4) Rancangan Perpres tentang Penyerahan Kanwil Badan Pertanahan Nasional dan Kantor Pertanahan Kabupaten/Kota di Aceh menjadi Perangkat Daerah, dan berbagai hal lainnya. Hal ini tentu tidak mudah, karena Aceh akan berhadapan dengan Jakarta (Pusat) yang dengan tidak begitu legowo akan menyerahkan “kewenangan empuk”nya kepada Aceh serta berbagai tantangan inter- nal lainnya. Keempat, Peranan DPRA dalam hal legislasi “sangat mandul”. Sejak dilantik 31 September2009hinggakini, kabarnya Dewan Perwakilan Rakyat Aceh (DPRA) baru menghasilkan sebuah qanun, yaitu Qanun APBA 2010. Sementara dari sekitar 80 buah rancangan Qanun tahun 2009-2014, pada tahun 2010 terdapat 21 rancangan qanun prioritas dan 10 di antaranya sangat prioritas untuk diselesaikan pada tahun 2010, kenyataannya DPRA yang didominasi oleh partai lokal Aceh hanya mampu memproduksi 1 qanun saja. Sungguh sangat“impoten” tentunya di tengah harapan rakyat Aceh yang begitu tinggi kepada anggota 69 orang anggota DPRA yang dihuni oleh 33 Partai Aceh, 10 Partai Demokrat,Golkar8kursi,PAN5kursi, PKS 4 kursi, PPP 4 kursi, PDA 1 kursi, Partai Patriot 1 kursi, PKB 1 kursi, PKPI 1 kursi dan PBB 1 kursi. Kehadiran tenaga ahli dan capacity building DPRA sangat diperlukan, dengan dilantiknya Sekwan baru DPRA Dr. Iskandar A. Gani pada 23 Desember 2010 (setelah jabatan Sekwan kosong sekitar 8 bulan), diharapkan menjadi amunisi barubagianggotaDPRAagarsemakinkuat dalam melaksanakan tugas-tugas dan fungsi dewan, terutama dalam hal fungsi legislasi.

Kelima, perkembangan ekonomi. Aceh mengalami pertumbuhan ekonomi yang cukup tinggi (pada triwulan III 2010 mencapai 6,2 persen-BPS), walaupun distribusi dianggap masih rendah. Ekonomi biaya tinggi juga dianggap sebagai salah satu penghambat kesejahteraan masyarakat, dimana inflasi di Aceh (Banda AcehdanKotaLhokseumawe)masihyang tertinggidiIndonesia-yangdisumbangkan olehberas,cabaimerah,ikantongkol,emas perhiasan, dan tarif dasar listrik. Bahkan pada November 2010 inflasi Kota Lhokseumawe merupakan yang tertinggi di Indonesia sebesar 2,64 persen dari 66 kota yang dihitung IHK-nya. Hal ini diperparah lagi oleh ketergantungan pasokan sembilan bahan pokok dari luar Aceh, terutama dari Sumatra Utara, Medan, di mana terdapat delapan jenis komoditikonsumsimasyarakatAcehdengan nilai mencapai Rp11, 6 triliun masih didatangkan dari luar Aceh (BI Banda Aceh). Sungguh, belum ada solusi brilian untuk menangani ketergantungan ini. Keenam, kemiskinan di Aceh masih sangat tinggi, mencapai 861.850 jiwa atau sebanyak 20,98 persen dari total jumlah penduduk 4.486.570 jiwa (hasil sensus BPS 2010), Angka tersebut turun sebesar 0,82 persen bila dibandingkan tahun 2009 lalu. Meskipun angka kemiskinan di Aceh menurun, namun Aceh ternyata masih termasuk dalam daerah dengan jumlah penduduk miskin terbanyak, yakni menduduki peringkat 7 nasional. Papua masih bertengker pada peringkat pertama dengan persentase penduduk miskin mencapai 36,80 persen, disusul Papua Barat 34,88 persen, Maluku 27,74 persen, Gorontalo 23,19 persen, NTT 23,03 persen, NTB 21,55 persen, dan Aceh (Bappenas, 2010). Artinya, dari sisi kemiskinan, Aceh adalah yang paling miskin di Sumatera, sementara anggaran Aceh adalah yang terbesar di Sumatera. Kondisi ini sungguh sangat ironis, memilukan, serta paradoks antara harapan dan kenyataan. Ketujuh, potret politik Aceh di penghujuung 2010 diwarnai dengan kegelisahan karena belum jelasnya peluang bagi calon independen untuk bertarung dalam Pemilukada Tahun 2011, namun kegundahan tersebut berubah dan menjadi kado indah bagi para pengusung agar calon independen (Bersambung ke hal B 9)

Merestrukturisasi Bangunan Al Washliyah (Sumbangan Pemikiran Menjelang Muswil XI Al Washliyah Sumut) Oleh Dedi Iskandar Batubara, SSos, SH, MSP Muswil kali ini tidak boleh melahirkan virus penghambat yang akan mencelakai perjalanan organisasi ke depan hanya dikarenakan proses pemilihan

S

etelah tertunda lebih dua tahun pasca berakhirnya masa bakti Pimpinan Wilayah Al Washliyah Sumatera Utara (2003-2008), akhirnya Musyawarah Wilayah XI sebagai media konsolidasi organisasi Insya Allah siap dilaksanakan 28-30 Januari 2011 di Asrama Haji Medan. Penundaan ini sebenarnya bukan tanpa sebab. Secara konstitusional, keberadaan PimpinanWilayah berada di bawahPengurusBesar.Akibattertundanya pelaksanaan Muktamar XX AlWashliyah yang baru dapat digelar 23-25 April 2010 di Jakarta, agenda konsolidasi organisasi dalam bentuk MusyawarahWilayah (Propinsi), Musyawarah Daerah (Kota/Kabupaten),Musyawarah Cabang (Kecamatan) dan Musyawarah Ranting (Kelurahan/ Desa) juga mengalami penundaan. Syukurnya, penundaan tersebut telah disikapi secara arif dengan diterbitkannya surat Pengurus Besar yang isi pokoknya memperpanjang periodesasi kepengurusan Al Washliyah di semua tingkatan sampai terlaksananya Muktamar XX. Tidak tepat untuk kembali melakukan perdebatan tentang inkonsistensi masa bakti kepengurusan yang tentu saja bukan menjadi keinginan seluruh stakeholder Al Washliyah, dan tidak terpuji juga bila mengurai sebab-musababnya. Hal terpenting yang harus segera dilakukan adalah merestrukturisasi bangunan AlWashliyahyangtelahberusia80tahuninidengan kebijakan yang lebih berorientasi kepada pengembangan organisasi dan pengabdian kepada umat sesuai khittah, shibgoh dan wijhah Al Washliyah. MomentumMuswilXIinipentingbagi AlWashliyahSumateraUtarauntukmelanjutkan segala aktifitas organisasi dengan merealisasikan program strategis demi pengembangan organisasi dan pengabdian kepada umat di masa datang. Sebagai organisasi sosial kemasyarakatan Islam terbesar di Sumatera Utara yang kiprah dan gerak juangnya sudah teruji dan terbuktisejakerasebelumkemerdekaansampai saat ini, tidak produktif jika harus berdebat pada hal-hal yang tidak menguntungkan bagi masa depan organisasi. Sudah saatnya organisasi melahirkan ide dan gagasan cemerlang untuk mengimplementasikanamalittifaqAlWashliyah secara modern, komprehensif, berkesinambungan, terukur dan terencana. Kebiasaanmusyawarahyangterkadanglebih terkonsentrasi kepada pemilihan ketua tidak boleh melengahkan para pimpinan organisasi untuk fokus pada hal yang lebih penting yaitu pelaksanaan program organisasi pasca Muswil yang lebih konstruktif.

Bukan menganggap pemilihan ketua tidak penting, karena Muswil sesuai amanatAD/ARTjelasmemilikiwewenang memilih pengurus baru—disamping mengevaluasi pertanggungjawaban pengurus lama dan menetapkan program kerja 5 tahun mendatang yang tidak keluar dari garis besar program organisasi hasil MukatamarAlWashliyahXX.NamunMuswil kali ini tidak boleh melahirkan virus penghambat yang akan mencelakai perjalanan organisasi ke depan hanya dikarenakan proses pemilihan. Namun keyakinan saya begitu kuat, hal itu tidak akan terjadi, karena tradisi menghargai yang paling ‘alim (banyak ilmunya), tawadhu’ (rendah hati), wara’ (meninggalkan hal-hal yang tidak berfaedah) serta tidak ambisius sudah dibuktikan oleh AlWashliyah dalam musyawarah-musyawarahnya di semua tingkatan. Meskipun tidak juga bisa dipungkiri, selalu adadeviasidarikeidealanyangdiharapkan. Program strategis Adalah sebuah keniscayaan bagi Al Washliyah Sumatera Utara yang telah memiliki struktur organisasi sampai ke tingkat Ranting (Kelurahan/Desa) untuk segera melakukan konsolidasi dan membenahi perangkat organisasi, baik yang sudah ada, belum sempurna atau belum ada sama sekali. Harus disiapkan agenda konkrit dan waktu yang jelas untuk konsolidasi ini.Tidakbolehlagikonsolidasidilakukanhanya saatadapestapolitik(pilpres,pileg,pilkada, dsb),ataukepentinganlainnyayanghanya bersifat insidentil dan sesaat. AlWashliyah adalah organisasi yang memperhubungkan, (washilah) itu artinya secara internal tidak boleh ada hubungan yang terputus antara pimpinan yang diatas dengan yang dibawahnya, pimpinan dengan anggotanyadanpimpinandenganlingkungan sekitarnya. Kemudian,saatinikemajuanteknologi semakin pesat dan hampir tidak ada aktifitas tanpa melibatkan teknologi. Sebagai organisasi Islam terbesar ketiga di Indonesia, seharusnya AlWashliyah juga sudah menjalankan sistem adminitrasi modern dengan penggunaan sarana teknologi guna pendataan organisasi. Namun harus diakui, Al Washliyah Sumut sampai hari ini masih belum maksimal menyelenggarakan sistem administrasi yang professional dan modern tersebut, sehingga ketika ada para peneliti yang mencoba melakukan research tentang AlWashliyah sering berhadapan dengan masalah tidak tersedianya data yang memadai. Saya terkesan dengan ide yang pernah

disampaikanSdra.IsmedBatubara(dosen UNIVA) tentang pendirian AlWashliyah Her-ritage, yang selanjutnya diharapkan menjadi pusat data dan budaya AlWashliyah. Sebagaitempatlahirdanberkembangnya AlWashliyah, Sumatera Utara sudah seharusnyasegeramelakukanpembenahansecaraseriusterkaitdatabaseorganisasi. Dan pendirian Al Washliyah Herritage mungkin bisa jadi salah satu solusinya. Menurut data Majelis Pendidikan dan KebudayaanAlWashliyahSumateraUtara, saat ini terdapat 627 unit sekolah/madrasah Al Washliyah dari mulai TK sampai SLTA. Juga terdapat 7 panti asuhan di bawahMajelisAmalSosial,kantor/sekretariat organisasi, tanah, gedung, serta masih terdapatasetlainnyayangsecarakeseluruhan perlusegeramendapatlegalisasiorganisasi pasca keluarnya hak paten AlWashliyah dari Kementrian Hukum dan HAM RI. Bahwa aset-aset tersebut adalah milik organisasi yang berasal dari infaq, hibah dan sadaqah para pendahulu, dan sudah menjadi kewajiban pengurus organisasi untuk menjaga dan merawatnya. Keterlibatan Majelis Asset pada konteks ini sangat diperlukan, langkah konkrit mulai dari upaya pendekatan dan bahkan bila diperlukan menempuh langkah hukum harus dilakukan untuk memperjelas harta organisasi. Meskipun sudah ada Sistem Pendidikan Al Washliyah yang menjadi acuan pelaksanaan sistem kependidikan di semua tingkatan dalam lembaga pendidikanAlWashliyah,sepertinyaaturantersebut belum terlaksana secara maksimal. SDM yang kapabel, inkonsistensi penerapan aturan, tidak adanya sanksi bagi yang tidak patuh adalah sederet per-solan yang terus menjadi pekerjaan rumah yang tak kunjung selesai. Harus segera dilakukan gerakan yang sinergis semua elemen terkait untuk kejelasan status kepemilikan. Dan membangun kesepahaman dengan pemerintah melalui Kementrian Agama dan Kementrian Pendidikan Nasional untuk mengatur alur birokrasi dan komunikasi antara pihak sekolah dengan pemerintah dan organisasi. Tidak boleh ada sekolah/madrasah yang menggunakanlambangAlWashliyahsementarapada praktiknyasamasekalitidakberhubungan denganorganisasi.Matarantaipemanfaatan organisasi untuk kepentingan pribadi dengan menggunakan lambang AlWashliyah harus segera dihentikan. Secara khusus kaderisasi formal menjadi tugas dan tanggung jawab Ikatan Putera Puteri Al Washliyah (IPA) dan Himpunan Mahasiswa Al Washliyah (HIMMAH). Dua organisasi bagian ini harus selalu aktif melakukan kaderisasi, karena hanya lewat kaderisasi akan lahir generasi militant yang memahami secara utuh khittah perjuangan organisasi. Mengelola PW Al Washliyah Sumut dengan wilayah tugas yang sangat luas serta kompleksitas permasalahan yang ada serta diikuti dengan kewajiban meng-

implementasi program kerja, tentu saja memerlukanbiaya.Ketersediaananggaran yang cukup akan memperlancar pelaksanaan tugas-tugas organisasi. Dengan sejumlah asset yang ada, seyogyanya organisasi dapat dijalankan dengan baik. Namun, mekanisme pengelolaan sumber keuangan yang belum tertata secara baik membuat organisasi lebih sering mengharapkan bantuan pihak ketiga dalamaktifitasnya.MeskipunhalitudiperbolehkanAD/ART,tentuakanlebihmaksimal bilaorganisasisecaramandirimampumemenuhi kebutuhannya sendiri dan melepaskan secara perlahan ketergantungan terhadap pihak ketiga. Dalam kaitan meneguhkan eksistensi organisasi, hal lain yang perlu dilakukan adalah membangun komunikasi dengan pihak-pihak eksternal, baik itu di dalam negeri maupun di luar negeri. Para pengurus organisasi harus sedapat mungkin mengakses hubungan seluas-luasnya dengan berbagai pihak, karena hal tersebut akanberdampakposistifbagipemahaman mereka tentang kinerja dan amal usaha AlWashliyahdanpadagilirannyaakanmemudahkan pimpinan organisasi melakukan pengembangan. Inilah beberapa poin pemikiran menjelang Muswil XI AlWashliyah Sumut. Semoga bermanfa’at. Selamat Bermusyawarah ! Wassalam bil ma’af Penulis adalah Aktivis Al Washliyah

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Pelayanan kesehatan gratis harus diwujudkan - Jangan cuma wacana * Garuda siap datangkan wisatawan ke Sumut - Garuda didadaku, he...he...he * Jalan tol menunjang ekonomi daerah - Tol Tebingtinggi tak jaleh juga

oel

D Wak


Aceh

B10

WASPADA Kamis 13 Januari 2011

Irwandi Dapat Pujian Dubes AS

Logica2 Dukung Peningkatan Pelayanan Dasar BANDA ACEH (Waspada): Pemerintah Aceh bekerjasama dengan Logica2, menggelar lokakarya pemenuhan Standar Pelayanan Minimal (SPM) untuk meningkatkan pelayanan dasar pendidikan di enam kabupaten di Aceh. Enam kabupaten terpilih yang ditetapkan dengan SK Gubernur Aceh tersebut, masing-masing Kab. Bireuen, Pidie Jaya (Pijay), Aceh Timur, Aceh Tamiang, Aceh Tengah dan Aceh Barat Daya (Abdya). Kegiatan itu digelar 12-13 Januari 2011 di Banda Aceh dengan tujuan adanya kesamaan persepsi Pemerintah Aceh (Dinas Pendidikan) dengan Pemerintah Kabupaten mengenai indikator pencapaian SPM bidang pendidikan dasar di kabupaten. Dalam relis Logica2, disebutkan pemerintah telah menetapkan bidang pendidikan dasar merupakan salah satu urusan wajib yang diserahkan kepada pemerintah kabupaten/kota dalam meningkatkan pelayanan dasar. (b04)

ADF Sosialisasikan Proyek Terapan Senilai Rp41,5 M BANDA ACEH (Waspada): Aceh Development Fund (ADF) mensosialisasi Proyek Teknologi Ramah Lingkungan untuk Industri Proses Perikanan (Terapan) senilai Rp41,5 miliar, kepada pihak-pihak yang terlibat dalam program yang akan dilaksanakan di Kab. Pidie Jaya dan Bireuen. Kegiatan orientasi proyek dan penguatan manajemen program Terapan sebagaimana relis yang diterima Waspada, diikuti sekitar 50 orang yang terlibat dalam proyek yang dilaksanakan ADF bersama konsorsiumnya, Fakultas Teknik Unsyiah, LSM Bina Masyarakat (BIMA) dan LSM An-Nisa. ”Kegiatan selama dua hari ini digelar guna mensosialisasi tujuan program Terapan kepada semua komponen yang terlibat dalam implementasi nantinya di lapangan,” sebut Afrizal Tjutra, Direktur Eksekutif ADF pada pembukaan kegiatan itu, Selasa (11/1) di Banda Aceh. Afrizal menambahkan, pihaknya memperoleh dana hibah dari MDF melalui KPDT senilai Rp41,5 miliar lebih. Pihaknya bangga karena ADF menjadi satu-satunya lembaga lokal yang dipercaya MDF dan Bank Dunia untuk melakukan proyek peningkatan ekonomi masyarakat di Aceh. Sementara Ketua Unit Manajemen Proyek Fasilitas Pembiayaan Pembangunan Ekonomi Aceh (PMU AEDFF), Prof Dr. Ir. Amhar Abubakar, MSc yang membuka kegiatan itu mengatakan, ini adalah orientasi proyek dan penguatan manajemen yang pertama digelar oleh lembaga pelaksana proyek AEDFF.(b04)

Maling Curanmor Kambuhan Gol Lagi BIREUEN (Waspada): Tersangka pencurian sepeda motor (curanmor) kambuhan, Saifuddin bin Baharuddin alias Din,23, asal dari Kecamatan Nisam, Kabupaten Aceh Utara,yangdisebut-sebutpernahditangkapduakalibeberapa waktu lalu terkait kasus yang serupa, kini gol lagi. Dia juga diduga kuat melakukan kasus yang sama. yaitu melarikan sepmor Yamaha Mio Soul milik warga Bayu, Aceh Utara. Namun, kali ini, dia tertangkap anggota Polres Bireuen setelah terjaring dalam razia yang digelar di Kecamatan Peusangan, Selasa (11/1). Demikian diungkapkan, Kapolres Bireuen AKBP H.R Dadik Junaedi Supri Hartono melalui Kasatreskrim AKP Khairul Saleh,SH SIK, Rabu (12/1). “Sepmor Mio diduga hasil curian itu, diamankan dalam razia, karena ada memiliki surat . Saat diperiksa diakui, baru dia ambil dikawasan Aceh Utara,” kata Kasatreskrim kepada wartawan usai apel HUT Satpam di depan Mapolres setempat, kemarin. Menurutnya, karena kasus kali ini dilakukan di Aceh Utara, maka tersangka atau kasusnya akan dilimpahkan ke Aceh Utara. Namun, sebelumnya dikembangkan untuk ditahu apakah ada terlibat kasusu lainnya di wilayah hokum Polres Bireuen.” Kita periksa dulu di sini apakah ada korban lainnya dari kejahatannya di Bireuen, sedangkan kasus yang kita tangkapnya kali ini lokus deliktinya (lokasi kejadian-red) di wilayah hukum Polres Aceh Utara. setelah itu, kasusnya akan dilimpahkan kesana,” jelas Kasatreskrim Polres Bireuen, AKP Khairul Saleh. (amh)

Warga Keluhkan Kerusakan Jalan Reuleut – Krueng Mane MUARA BATU, Aceh Utara (Waspada): Jalan Kabupaten Aceh Utara sepanjang lima kilometer yang menghubungkan Reuleut – Krueng Mane rusak parak. Akibatnya, jalan yang kerap dilintasi para petani dan mahasiswa itu, sulit dilalui. Kepala Mukim Bungkah, Kecamatan Muara Batu, Aceh Utara, Adnan kepada wartawan, Rabu (12/1) menjelaskan, jalan tersebut menghubungkan Krueng Mane dengan kawasan Kampus Unimal (Reuleut). Selain itu Jalan Reuleut – Krueng Mane juga melintasi Bandara Malikussaleh, sehingga jalur tersebut dinilai sebagai jalan strategis. Menurut dia, jalan hot mix tersebut dibangun sekitar satu tahun lalu. Namun karena sering dilintasi truk, sehingga sekarang dipenuhi dengan kubangan. “Kami prihatin dengan kondisi jalan ini. Saat ratusan warga yang ingin berpergian harus mencari jalan lain,” kata Adnan. Kerusakan diduga juga karena pembangunan badan jalan tidak disertai dengan pembangunan saluran air. “Akibatnya bila hujan, badan jalan tergenang air hingga beberapa hari,” tambahnya. Ketika dilintasi kendaraan, genangan air menjadi kubangan. Apalagi jalan tersebut merupakan jalan alternatif untuk lalu lintas jalur Banda Aceh – Medan, sehingga setiap kali terjadi genangan, kerusakan semakin parah.(b17)

Waspada/Zainal Abidin

Salah satu ruas jalan Reuleut – Krueng Mane di Kecamatan Muara Batu, Aceh Utara yang mengalami rusak parah, Rabu (12/1).

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu):

Garuda Indonesia GA 146 Jakarta/Medan

Lion Air

JT 304 Jakarta JT 396 Jakarta/Medan

Sriwijaya Air

SJ 010 Jakarta/Medan

Air Asia

AK 305 Kuala Lumpur *

FireFly

Berangkat (flight, tujuan, waktu):

15:45 GA 147 Medan/Jakarta

16:20

11:35 JT 397 Medan/Jakarta 20:00 JT 307 Jakarta

06:40 12:15

12:55 SJ011 Medan/Jakarta

13:25

12:20 AK 306 Kuala Lumpur *

FY 3401 Penang ** 14:10 FY 3400 Penang “” * Setiap Senin, Rabu, Jumat dan Minggu. ** Setiap Selasa, Kamis dan Minggu.

12:45 14:30

Waspada/Jaka Rasyid

Gubernur Aceh, Irwandi Yusuf dan Dubes Amerika Serikat untuk Indonesia, Scot Marciel berbicang usai pertemuan resmi kedua pihak di Ruang Kerja Gubernur Aceh. Selasa (11/1) sore.

TPA Terpadu Pidie Jaya Resahkan Warga MEUREUDU (Waspada): Bau busuk dari tumpukan sampah Tempat Pembuangan Akhir (TPA) Kabupaten Pidie Jaya kian meresahkan ribuan warga Desa Tuah Lada, Kecamatan Bandar Baru dan sekitarnya. Keluhan ini sudah berulang kali disampaikan tokoh masyarakat setempat kepada camat Bandar Baru dan instansi terkait, namun belum juga ditanggapi serius. Akibatnya, warga Desa Tuah Lada dan warga sekitar Kemukiman Langgien, kian hari mulai jenuh dengan sikap Pemkab Pidie Jaya yang kurang peduli dengan nasib mereka. Desa Tuan Lada, letaknya tidak terlalu jauh dari pusat ibu kota Lengputu, Kecamatan Bandar Baru, Pidie Jaya dan hanya terpaut satu kilometer saja. Desa tersebut juga merupakan daerah litasan menuju Desa Jijim, tempat lokasi tertembaknya mantan Panglima Gerakan Aceh Merdeka (GAM) beberapa tahun silam. Di daerah itu juga terdapat komplek TNI AD. Selain itu, kawasan desa tersebut juga hampir setiap menit digunakan warga untuk bepergian ke kebun, dan sebalikn ya warga Jijim dan sekitarnya juga menggunakan jalur yang melintasi desa Tuah Lada untuk bepergian ke pusat pemerintahan Bandar Baru dengan segala urusan dan kepentingan warga. Namun jalur tersebut kini ternodai, akibat Tempat Pembuangan Akhir (TPA) Pemkab Pidie Jaya yang terletak persis di pinggir jalan lintasan Desa Jijim dengan Bandar Baru. TPA tersebut kini sudah menebarkan bau tidak sedap yang dapat mengancam kesehatan masyarakat Desa Tuah Lada. Karena lokasi TPA itu terletak persis di tengah-tengah perkampungan warga. Buruknya pengelolaan sampah tersebut membuat Desa Tuah Lada dan sekitarnya terlihat jorok. Serangga semisal lalat hampir tiap hari mengerumuni ru-

mah-rumah warga. Tidak hanya itu, akibat bau tidak sedap dari tumpukan sampah yang hampir setiap jam dibuang ke TPA tersebut, juga mengundang hewan-hewan liar semisal babi hutan, anjing serta hewan ternak milik warga berdatangan ke tumpukan sampah tersebut untuk mencari makanan. “Kami sudah sering mengeluhkan persoalan sampah ini, tetapi Pemkab Pidie Jaya melalui instansi terkait masih saja melakukan pembuangan sampah ke desa kami ini. Jadi kami bingung sekarang mau mengadu kemana lagi” kata Imum Meunasah Desa Tuah Lada, Tgk. Said Jamaluddin, kepada Waspada, beberapa waktu lalu. Kata dia, sejak Pemkab Pidie Jaya membuat Tempat Pembuangan Akhir (TPA) di Desa Tuah Lada, telah menyebabkan pencemaran lingkungan. Ribuan warga DesaTuahLadadansekitarnyamengeluhkan

bau sampah yang menyengat. Pembangunan TPA terpadu tersebut tidak layak dibangun di desa tersebut. Sebab letaknya di lintas jalan kabupaten serta masih dalam perkampungan penduduk. Buruknya pengelolaan sampah di TPA terpadu Desa Tuah Lada juga telah menyebabkan air dalam sungai memerah dan bila terkena badan manusia akan gatal-gatal. Kepala Kantor Lingkungan Hidup (KLH) Pidie Jaya Muhammad Gade, kepada Waspada, mengakui sudah beberapa kali mendapat laporan dari masyarakat setempat terkait aroma tak sedap yang bersumber dari lokasi TPA desa Tuah Lada, Langgien, Kecamatan Bandar Baru. Namun sampai saat ini pihaknya belum dapat berbuat apapun disebabkan belum mendapat lokasi yang tepat untuk dilakukan pembuangan. (b20)

Waspada/Muhammad Riza

RESAHKAN WARGA: Bau busuk di Lokasi Tempat Pembuangan Akkhir (TPA) Terpadu, Kabupaten Pidie Jaya sudah sangat mengganggu ketentraman warga Desa Tuah Lada, Kecamatan Bandar Baru, Pidie Jaya. Lokasi TPA terpadu ini berada berdekatan dengan perkampungan warga dan persis di pinggir jalan Jijim.

Terkesan Manajemen Waspada BIREUEN (Waspada): Harian Waspada didirikan di tengah-tengah rakyat dimasa-masa awal kemerdekaan oleh alm. H. Mohd Said tujuannya untuk membebaskan rakyat dari penjajahan, namun seiring perkembangan zaman, harian ini sekarang ini telah mampu membawa rakyat ke alam yang penuh dengan kemerdekaan. “Seandainya almarhum H. Mohd Said masih hidup, betapa bahagianya beliau melihat perkembangan oplahoplahnya yang dicetak dengan mesinmesin cetak modern dan dapat di upload melalui internet dimanapun kita berada di belahan dunia ini,” kata Kabag Humas Mahasiswa Universitas Almuslim (Unimus) Peusangan, Bireuen, Zulkifli S.Kom, kepada Waspada, Rabu (12/1) mengomentari peringatan Ultah Waspada ke 64 yang baru diperingati Selasa. Seandainya ayahanda H. Mohd Saiad masih hidup, lanjut Zulkifli, mungkin hampir setiap hari akan tersungging senyuman kebahagiaan dan kegembiraan di raut wajahnya. Betapa tidak koran yang dilahirkan dimasa masa kemerdekaan tepatnya pada tanggal 11 Januari 1947dan hanya bermodal dengan sebuah peralatan mesin tik tua kini dengan peralatan modern dan canggih telah merambah sampai belahan dunia. Harian Waspada yang dilahirkan 64 tahun yanga lalu yang dulu hanya dibisa dibaca oleh kalangan-kalangan tertentu sekarang sudah bisa dibaca mulai dari rakyat jelata dipelosok-pelosok desa sampai diujung dunia melaluiWeb Site www. waspada.com.“Saya pribadi sangat terkesan dengan manajemen harian Waspada. Walaupun pengelolaannya terdiri dari unsur keluarga tetapi tetap mengedepankanprinsip-prinsipprofesional,”ujarZulkifli yangpernahmendapatpelatihanjurnalistik selamasatubulandikantorharianWaspada Medan beberapa waktu lalu. Zulkifli mengaku, banyak pengalaman dan ilmu yang didapatkan selama

magang di kantor berita Waspada itu, selain ilmu jurnalistik juga ilmu manajemen pengelolaan yang cukup profesional. “Karena profesional itulah makanya menurut penilaian saya, Waspada tetap eksis sampai sekarang. Padahal banyak tantangan dan halangan yang menghadang perkembangan sebuah surat kabar baik tantangan bidang politik, hukum dan ekonomi. Tetapi dengan manajemen keluarga yang profesional itulah mungkin Was-

pada bisa bertahan sampai sekarang”. “Dan pada kesempatan hari ulang tahun ini saya mengharapkan agar barisan Redaksi tetap terus merapatkan barisan tanpa henti untuk mengevaluasi diri baik di jajaran redaksi, wartawan dan agen-agen di daerah serta juga nara sumber yang telah banyak membantu informasi-informasi bagi wartawan di lapangan,” sarannya. Mengenai isi berita selama ini sudah cukup bagus baik yang berhubungan dengan rakyat di pedesaan maupun pejabat di perkotaan dan informasi-informasi pembangunan, dan ini sudah cukup berimbang tapi perlu diperluas lagi isi rubrik pendidikan baik tingkat SLTA maupun berita universitaria agar tidak hanya menjangkau sekolah-sekolah yang ada di Sumatera Utara tapi juga yang ada di Provinsi Aceh. Dan tentang halaman olah raga Aceh agar tidak dipisah dengan halaman berita Aceh lainnya. Dan akhirnya Selamat hari jadiWaspada yang ke-64, beritamu tetap kami nantikan setiap pagi Demi Kebenaran Dan Keadilan. Jayalah Harian Waspada. Demikian Zulkifli. (amh)

Rancangan Anggaran Aceh Utara Abaikan Usulan Masyarakat ACEH UTARA (Waspada): Usulan masyarakat Aceh Utara melalui kegiatan musyawarah perencanaan pembangunan (Musrembang) diabaikan dalam anggaran tahun ini. Hal ini terbukti dalam RAPBK yang telah disahkan tidak tertampung usulan yang dikumpulkan dari seluruh kecamatan di kabupaten dimaksud. Fraksi Gabungan DPRK Aceh Utara, dalam pendapat akhirnya terhadap RAPBK Aceh Utara tahun 2011 menegaskan, fakta di lapangan Musrembang hanya sebagai bumbu penyedap. “Hal ini terbukti hasil Musrembang selalu diabaikan dan tidak tertampung di RAPBK,” tegas Satari, dari Fraksi Gabungan beberapa waktu lalu. Fraksi ini juga meminta Bupati Aceh Utara untuk segera memperbaiki sistem Musrembang menjadi data base. Selain itu juga perlu menampung dan menetapkan kegiatan prioritas sesuai kebutuhan masyarajat yang diperoleh dari Musrembang di tingkat bawah. Pada kesempatan yang sama Fraksi Partai Aceh (F-PA) juga meminta, APBK mengutamakan usulan dari hasil Musrembang kecamatan berdasarkan skala prioritas. “Dan usulan kecamatan yang tidak tertampung agar diprioritaskan pada tahun berikutnya,” sebut Katua F-PA, Abdul Mutaleb.(b17)

BANDA ACEH (Waspada): Duta Besar Amerika Scot Marciel untuk Indonesia memuji Gubernur Aceh Irwandi Yusuf sebagai seorang pemimpin yang peduli pada pendidikan dan berjuang agar masyarakat Aceh dapat lebih makmur. “Seperti halnya pemimpin Aceh saat ini, yang selalu ingin generasi Aceh cerdas dan dapat membangun Aceh,” ungkap Dubes kepada wartawan usai bertemu Gubernur Aceh Selasa (11/1) sore. Tak sekedar memuji, Scot berjanji membantu mewujudkan harapan Irwandi dengan berupaya kuat mengundang perusahan Amerika untuk berinvestasi di Aceh agar putra-putri Aceh memiliki lapangan kerja. Dubes juga berkomitmen untuk membantu mempromosikan pariwisata Aceh.“Saya berusaha agar perusahaan-perusahaan Amerika Serikat (AS) dapat berinvetasi di Aceh, dan saya akan sampaikan kepada masyarakat Amerika tentang pariwisata Aceh,” kata Scot Marciel. Scot menilai masyarakat Aceh adalah masyarakat yang kuat setelah melewati berbagai tantangan (bencana dan konflik), dan kehadirannya di Aceh untuk menjalin hubungan baik. Terkait soal pembangunan 13 kilometer ruas jalan yang dibiayai oleh Pemerintah AS lewat USAID, Scot berupaya agar ruas jalan itu akan rampung di bangun akhir tahun 2011. Scot juga berupaya meningkatkan bantuan perekonomian untuk masyarakat Aceh, selain pihaknya juga menginginkan terjadinya pertukaran mahasiswa yang lebih banyak lagi, baik mahasiswa AS yang belajar ke Aceh begitu juga sebaliknya. Tahun 2012 Pemerintah Aceh mengirim sekitar 30 mahasiswa untuk belajar di berbagai Universitas di Amerika, tahun sebelumnya ada sekitar 15 mahasiswa mendalami ilmu di Negeri Paman Sam itu. Hubungan Amerika dan Aceh telah terjadi sekian lama, malah Konjen AS di Medan memfasilitasi terbentuknya organisasi alumni Amerika sejak tahun 2002 silam.(b32)

Dubes AS: Masih Ada Hambatan Investasi BANDA ACEH (Waspada): Duta Besar Amerika Untuk Indonesia, Scot Marciel menyebut masih ada hambatan dalam investasi di Aceh. Tidak secara rinci, namun Dubes mendengar masukan dari masyarakat Aceh tentang iklim investasi tersebut. Karenanya investor Amerika belum mau berinvestasi di Aceh. Scot menyebut, sejauh ini investasi Amerika juga ada di Indonesia. Di Aceh, perusahan Amerika yang berinvestasi adalah ExxonMobil. Dubes yang baru di Indonesia menyebut kehadirannya ke Aceh ingin menjalin persahabatan, dan hubungan saling menghormati. Dubes juga berharap Indonesia terutama Aceh lebih makmur lagi, karenanya Amerika membantu Aceh dalam bidang lingkungan, berupa bantuan 160 juta dolar dan penguatan ekonomi masyarakat Aceh dengan membantu petani kopi. Selain itu, Scot menyebut sedapat mungkin makin banyak masyarakat Aceh yang menjalani pendidikan di Amerika, begitu juga sebaliknya. Pertukaran pelajar ini menurut dubes dapat mempererat hubungan ke dua negara. Kunjungan Scot ke Aceh selain bertemu alumni Amerika di Aceh, juga bertemu Gubernur Aceh, berpidato di hadapan dosen dan mahasiswa Fakultas Keguruan dan Ilmu Pendidikan. (b32)

Rencana Pembangunan Kantor Penanggulangan Bencana ACEH UTARA (Waspada): Ir. Syahbuddin Usman, Sekdakab Aceh Utara baru-baru ini kepada Waspada mengatakan, dalam tahun 2011, Pemkab setempat akan membangun kantor penanggulangan bencana daerah dan Rumah Sakit Umum (RSU) di Lhoksukon. Ke dua jenis bangunan itu dibangun dengan Anggaran Pendapatan Belanja Negara (APBN) tahun 2011. Proses tender paling lambat dilaksanakan pada bulan Februari. Selain itu, pada tahun 2011, Pemkab Aceh Utara juga akan memindahkan Dinas Kependudukan dan Catatan Sipil, serta merampungkan rehab bangunan Bachelorcamp sebagai pusat administrasi Pemkab Aceh Utara. “Pelan-pelan kita berbenah untuk pulang ke Lhoksukon. Dari dari kemarin, kita telah berhasil memindahkan delapan dinas dan kantor yakni Pemadam Kebakaran, Cipta Karya, Bina Marga, Dinas Kesehatan, Bachelorcamp, RSUD, dan kantor penanggulangan bencana. Kalau tidak ada halangan, dalam tahun ini, rehabitasi bachelorcamp selesai kita laksanakan. Untuk rehab gedung tersebut menghabiskan anggaran sedikitnya Rp500 juta,” kata Syahbuddin Usman. Kata Syahbuddin, Aceh Utara kesulitan untuk mendapatkan dana pemindatahan pusat administrasi ke Lhoksukon dari Pemerintah Pusat, karena pemekaran yang dilakukan di Lhokseumawe dan Aceh Utara berbeda dengan daerah lainnya. Biasanya, yang pindah adalah daerah yang dimekarkan. “Tapi kali ini lain, yang pindah induk. Maka kita sulit untuk mendapatkan biaya pemindahan administarasi, karena Aceh Utara dianggap memiliki gedung. Sementara Lhokseumawe gampang melaksanakan pembangunan apa saja,” katanya. Begitupun, pihaknya telah mengusulkan dana pembangunan kantor pusat administrasi ke pusat pada tahun 2010, begitupun, hingga kini belum ada respon. Begitupun, secara bertahap dan dengan kondisi yang ada, pusat administrasi akan dipindahkan ke Lhoksukon. Menjawab Waspada, jika semua persiapan telah dilaksanakan, maka tidak tertutup kemungkinan, pendopo dan kantor Bupati Aceh Utara akan dijual ke pihak lain, begitu juga dengan RSUD Cut Mutia. Sementara asset lainnya yang berada di Lhokseumawe yakni Reklamasi Pusong, StadionTunas Bangsa, Gedung DPRK dan beberapa asset lainnya. “Rumah Sakit Umum Cut Mutia akan kita jual dan tidak tertutup kemungkinan akan kita kelola secara swasta, dan pendapatannya dijadikan sebagai PAD Aceh Utara,” kata Syahbuddin Usman. (cmun)

Atasi Banjir Muspika Jeumpa Gerakkan Gotong Royong BLANG BLADEH Bireuen (Waspada): Hujan deras yang melanda kawasan pergunungan Kecamatan Jeumpa pekan baru lalu, mengakibatkan perkampungan penduduk dan areal persawahan Kecamatan Jeumpa Bireuen terendam banjir kiriman. Camat Jeumpa Drs H Jailani MM didampingi Danramil 01/Bireuen Kapten Arh Ronald Samosir dan Kapos Polsek Jeumpa Aiptu Kasdin yang ditemui saat sedang mengkoordinir kegiatan ini mengatakan, gotong royong massal masyarakat membersihkan saluran pembuangan di kawasan Desa Teupok yang sudah tersumbat tertimbun lumpur kiriman. Gotong royong massal yang digerakkan Muspika Kecamatan Jeumpa, kata Camat, melihatkan sekitar 700 warga dari 7 desa untuk membersihkan saluran-saluran pembuangan di kwasan Desa Blang Bladeh, Glumpang Payong, Abeuk Tingkeum dan Cot Gadong untuk mengatasi agar perkampungan penduduk dan areal persawahan yang sedang mulai ditanami tidak lagi terendam banjir. Dua buah saluran pembuangan yaitu Alue Sibujai kawasan Desa Teupok dan saluran Ganefo perbatasan Desa Glumpang Payong – Blang Bladeh, kondisinya sudah tersumbat belasan tahun dan sangat membutuhkan bantuan alat berat dan tidak mungkin pembersihannya dilakukan dengan tenaga manusia. Jika kedua saluran pembuangan vital di Kecamatan Jeumpa selesai dibersihkan genangan banjir kiriman dari pergunungan Kecamatan Jeumpa akan lancar terbuang ke pantai Kula Jeumpa dan Kuala Lakmana, tidak tersumbat lagi menerobos perkampungan penduduk dan areal peresawahan, Gotong royong massal yang digerakkan Muspika Kecamatan Jeumpa akan terus berlanjut sampai tuntas untuk mencegah para petani sawah yang sedang melakukan musim tanam di areal sawah seluas 1.377 hektar tidak lagi terendam banjir kiriman. Danramil 01/Bireuen Kapten Arh Ronal Samosir kepada Waspada mengatakan, Koramil Bireuen bersama unsur Muspika siap membantu sepenuhnya mengatasi banjir di Kecamatan Jeumpa. Diharapkan, dinas terkait Pemkab Bireuen sangat perlu membantu alat berat beko untuk dilakukan pengerukan kembali alur dan saluran pembuangan yang sudah tersumbat lumpur kiriman. Masyarakat Blang Seupoueng dan sekitarnya sangat berharap agar Pemkab Bireuen dapat segera memprioritaskan rehab jalan tersebut untuk menunjang kelancaran perekonomian rakyat. (b16)


Opini

WASPADA Kamis 13 Januari 2011

Tarahhim, Azan Dan Kaset Ayat-Ayat Suci Entah karena mantan kesultanan sebagaimana kesultanan-kesultanan yang ada di dunia dan di Indonesia, dihubungkan dengan hubungan diplomatik dan budaya-budaya yang bernuansa Islam (Arab). Sejak di zaman dahulu di Tanjungpura Langkat, ada yang namanya Tarahhim. Tarahhim dikumandangkan sebelum masuk Shalat Subuh, kira-kira pukul 16.30Wib, klos (Stop), barulah kira-kira pukul 17.00 digemakan azan shalat fardhu Subuh. Kira-kira iramanya,“AssalatuWassalam Mualaih,”dst-nya, dikumandangkan dari Masjid Azizi,Masjid terbesar dikota itu. Mendengarnya,hati kita sangat pilu sekali.Apalagi dibawakan oleh atok-atok,yang dikala itu saya masih berusia muda. Sampai sekarang masih ada cara-cara Tarahhim di sana yang tentu saja jauh beda dengan yang dibawakan atok-atok di zaman itu. Didaerah lain, ada itu Azan pertama, klos (stop), baru Azan kedua yang menandakan telah masuk waktu Shalat Subuh. Disini, ditempat saya bermukim, atau ditempat-tempat lain mantan kesultanan juga,, caranya dengan menyetel kaset ayat-ayat suci Al Qur’anul Karim sampai masuk waktu shalat Fardhu Subuh, barulah suara azan dikumandangkan. Semua metode-metode itu bagus,tidak ada salah-salahnya.Telah tercipta kata dan makna “Bagus”, tentu ada pula kata dan makna,“Terbagus”. Terserah bagi kita yang menanggapinya. Kita harapkan bangunnya hamba-hamba Allah SWT dari tidurnya bukanlah karena faktor bunyi dan bunyi, tapi disebabkan oleh faktor niat-niat yang telah ditanamkan sebelumnya untuk mengerjakan perintah-perintah Allah Swt. Tertarikkah dengan cara-cara Tarahhim? Datanglah ke kota Tanjungpura Langkat, ?Syukur Alhamdulilllah”, kalau sudi pula mempelajarinya, sekalian jangan lupa dodolnya, buat oleh-oleh. Semoga Allah Swt bersama kita, hamba-hamba yang diridoinya. Amin Ya Rabbal Allamin. Syahruddin Medan

Kantin Kejujuran Setelah pita digunting, segenap hadirin bertepuk tangan. Kantin kejujuran di salah satu sekolah telah diresmikan. Kata sambutan diberikan oleh Kepala sekolah yang dilanjutkan dengan Bapak yang mewakili Dinas Pendidikan. Tidak ketinggalan Ketua OSIS memberikan sedikit harapan. Acara ditutup dengan doa oleh guru agama Islam. Kantin kejujuran menjual berbagai keperluan sarana perasarana pembelajaran. Buku, pulpen dan berbagai alat tulis kantor. Ada juga beberapa kue kering atau roti kemasan. Semuanya barang dengan label harga pasaran. Tak perlu teransaksi penjualan, setelah mengambil yang diperlukan siswa cukup memasukkan uang seharga label pada kotak yang telah disediakan. Jual beli kantin kejujuran dianjurkan pejabat atasan dan dikelola oleh Koperasi sekolah. Bagi sekolah yang melaksanakan akan mendapat apresiasi plus oleh pejabat atasan. Pada bulan pertama sampai bulan ketiga kantin kejujuran mengalami kerugian. Namun kantin tetap dijalankan. Evaluasi laba semester dan pertahun masih mengalami defisit, namun demi pendidikan kejujuran kantin tetap dijalankan. Setelah dua tahun berjalan operasional kantin kejujuran terpaksa dibawa ke rapat tahunan koperasi sekolah. Setelah melalui perdebatan panjang akhirnya Kantin Kejujuran tak dapat dipertahankan. Ketua Koperasi menyampaikan kebocoran dana kantin yang tinggi menerpa aset yang lain. Defisit kantin dapat merobohkan koperasi. Defisit yang tinggi mengharuskan kantin segera ditutup.“Dalam koperasi tak ada laba hayalan...!” demikian ketua koperasi menutup argumentasi dengan nada yang tinggi. Singkat cerita kantin kejujuran ditutup karena siswa tidak jujur. Kejujuran adalah sesuatu yang diperoleh siswa sejak balita, sesuai pertumbuhan kejujuran senantiasa didapat dari orang disekitarnya. Sampai usia sekolah kejujuran didapat dari guru disekolah. Kejujuran dapat juga diperoleh disepanjang jalan bahkan dihutan, karena berbagai hewan juga ada yang menunjukkan kejujuran. Semua yang diperoleh disimpan rapi buat masa depan. Namun terkadang ada juga yang keluar dari simpanan, karena sedikit yang diperoleh atau karena banyak yang berkeluaran akhirnya seorang anak tak lagi memiliki kejujuran. Nada Sukri Pane Hamparan Perak

Kita Butuh Negarawan,Bukan Politisi Oleh Fajar As Kendati seorang tokoh telah menjadi menteri, wakil presiden, presiden, dan anggota DPR, tokoh tersebut tidak termasuk negarawan

D

i Indonesia, merupakan kebiasaan untuk melakukan perbuatan sesuka hati membangun kosakata, membuat arti kata dan bahasa yang sangat jelas bertentangan dengan struktur bahasa Indonesia. Pada sisi lain, di Indonesia telah langka ahli bahasa Indonesia yang benarbenar ahli dalam arti sebenarnya. Bukan semata karena telah menyandang gelar akademis. Pada sisi lain lagi, gelar akademis di Indonesia banyak yang sangat diragukan mutunya, dan telah menjadi rahasia umumdimanagelarakademisyangtinggi, ada yang lahir dari pekerjaan pihak-pihak yang disewa. Kelihatannya para pejabat tingginegaratermasukparaMenteri,Wakil Presiden, Presiden, dan para Anggota Dewan Perwakilan Rakyat (DPR) tidak pernah berkonsultasi dengan ahli bahasa Indonesia yang bermutu prima yang memang masih dimiliki oleh Indonesia kendati jumlahnya telah langka, ketika menciptakan undang-undang dan peraturan. Salah satu perbuatan sesuka hati membangun arti kata yang dilakukan oleh elit puncak Indonesia terutama oleh para politisi yang terlihat amatiran, adalah kata negarawan.Dengancarayangsembarangan, bila seseorang telah menjadi Menteri, Wakil Presiden, Presiden, dan para politisi praktis yang telah menjadi anggota DPR, maka tokoh tersebut telah dinyatakan sebagai negarawan. Negarawan dalam arti yang benar adalahtokohyangsangat-sangatistimewa dan sangat-sangat terbatas jumlahnya. Justru Indonesia, terutama setelah wafatnya Sukarno dan Hatta, telah sedemikian rupakekosongannegarawan.Kekosongan negarawanlahyangmenjadiakardaritidak putus-putusnya krisis Indonesia, yang mengakibatkan timbulnya debat kusir tidak berkesudahan. Marilah kita mencermati ciri-ciri utama negarawan. Kendati seorang tokoh telah menjadi menteri, wakil presiden, presiden, dan

anggota DPR, tokoh tersebut tidak termasuk negarawan. Bangsa besar India memiliki dua tokoh negarawan besar yaitu Mahatma Gandhi dan Pandid Jawaharlal Nehru. Mahatma Gandhi tidak pernah menjadi Menteri, atau Perdana Menteri, atau Presiden, akan tetapi kenegarawanan Mahatma Gandhi sangat menonjol. Pandid Jawaharlal Nehru menjabat Perdana Menteri dalam masa panjang dan kenegarawanannyajugasangat menonjol. Bangsa besar India saat ini sedang mendapatkan calon negarawan besar yaitu Man Mohan Singh,dimanakon-sep dan kerja brilyan tokoh inilah yang mendorong India menjadi calon superpower dunia.Perludicatat, tidak ada satu tokoh pun Presiden India yang dalam mutu negarawan. Bangsa besar China dalam masa China modern pasca perang dunia kedua memiliki dua tokoh negarawan besar yaitu Mao Zedong, dan Deng Ziaoping. Kedua tokoh ini dalam menjalankan kenegarawanannya pada umumnya bertindak di belakang layar, tetapi sangat efektif mengendalikan administrasi negara. Bangsa Singapura memiliki seorang negarawan yaitu Lee KuanYew, dan Bangsa Malaysia memiliki seorang negarawan yaitu Mahathir bin Mohamad. Kedua tokoh ini berbuat mengendalikan langsung administrasi negara dalam masa-masa melakukan perubahan, dan pembaruan menyeluruh di Singapura dan Malaysia.

Foliopini

dedisahputra@yahoo.com

Gayus Lagi “…jadikan saya staf ahli Kapolri, staf ahli Jaksa Agung, atau staf ahli Ketua KPK. Saya janji dalam waktu 2 tahun Indonesia bersih,” kata terdakwa mafia pajak Gayus Halomoan Tambunan. Anda jangan tertawa atau senyumsenyum dulu, dengarkan lagi apa katanya: “Saya tak hanya akan menangkap kakap, tapi paus dan hiu saya tangkap… yang terjadi sekarang, ikan teri seperti saya, Arafat, Sri Sumartini, Alif Kuncoro, Humala, dan Maruli, ditangkap,” lanjut Gayus dalam duplik setebal 20 halaman di ruang Sidang, PN Jakarta Selatan. Hebat ya dia. Lihatlah wajah seriusnya ketika mengucapkan permintaan itu. Dengan kumis yang melebati bibir, Gayus berseru sambil sesekali memandang ke arah ketua majelis hakim. Sebagai teri, kelihatannya Gayus lebih merasa menjadi korban ketimbang menjadi pelaku kejahatan. Sebagai ikan teri pula—dia bisa menangkap hiu—tentu Gayus ini sangat luar biasa. Kalau memang inilah kemampuan Gayus, saya kira bukan lagi staf tapi dia cocok diangkat jadi Kapolri, Jaksa Agung, Ketua KPK atau jadi presiden aja sekalian. Oh, please..,saya tidak menulis ini dengan main-main, ngelulu apalagi dengan ketawa-ketiwi. Saya masih tetap serius, seserius Gayus ketika berujar di depan hakim, seserius aparat yang mengeluarkan Gayus dari tahanan, seserius SBY ketika menyatakan akan memberantas korupsi. Hanya saja yang masih belum jelas bagi saya adalah; apakah fragmen Gayus ini adalah sebuah peristiwa moral, peristiwa hukum, peristiwa budaya, peristiwa politik, peristiwa teologi atau hanya peristiwa opera. *** Di negeri ini predikat koruptor bukanlah aib yang mesti ditutupi. Lihatlah Jefferson S.Rumajar,Walikota Tomohon, Sulawesi Utara yang juga terdakwa korupsi. Di dalam penjara dia melantik pejabat eselon III. Dia mengambil sumpah ke 28 pejabat itu, yang salah satu isinya adalah sumpah tidak korupsi. Kepada wartawan dia mengatakan; apa yang dilakukannya adalah demi berjalannya pemerintahandidaerahnya.Jangansampaipembangunan di daerah mandek. Lihatlah, betapa mulia perilaku pejabat koruptor itu. Meski di penjara, tapi dia masih sempat ngurusi rakyatnya. Para pejabat koruptor memang begitu, betapa cintanya mereka kepada daerahnya. Saking cintanya hingga semua urusan tetap dikendalikannya, setiap surat tetap harus dibubuhi tandatangannya, tak peduli surat itu harus terbang ke Jakarta, masuk ke dalam penjara

lalu kembali lagi ke daerahnya. Tak peduli berapa duit yang dihabiskan untuk perjalanan suratsurat tersebut. Karena itu tak terlalu berarti dibanding besarnya cinta mereka kepada rakyat. Karena cintanya jugalah para pejabat koruptor itu melakukan mutasi pejabat di daerahnya. Keluarbiasaan-keluarbiasaan ini hanya dimiliki negeri kita, karena kalau di negeri orang, gak bakalan bisa menyamai apalagi melebihi. Belum apa-apa mereka sudah akan mengundurkan diri, keok. Jangankan ketika statusnya terdakwa ataupun tersangka yang mendekam di tahanan, bahkan ketika dicurigai saja mereka sudah mengundurkan diri. Loyo-lah pokoknya. Gak asyik, gak punya mental fighter, gak cinta sama rakyatnya. *** Ketika mengantar anak sekolah kemarin pagi, sepe-damotor di depan saya dike-mudikan perempuan paruh baya dengan rambut terurai. Di bahunya melilit kain panjang diselempangkan melintang. Di bagian bawah ketiaknya mendekam Batita dalam kain gendongan itu. Di boncengan belakang ada dua anak kecil yang saya taksir umurnya sekitari 6 tahun atau kurang. Mereka meluncur tajam di persimpangan tanpa lampu laulintas itu. Saya tidak tahu apakah dia sedang sangat terburu-buru atau sedang kebelet BAB ketika menerobos arus kendaraan yang melintang di depannya. Nyaris sebuah sepedamotor menghantam kendaraan mereka. Tapi perempuan itu hanya nyengir kuda merespons plototan pria di kendaraan yang nyaris menabrak tadi. Tak ada raut wajah penyesalah sama sekali, apalagi perasaan bersalah. Karena kesalahan seperti itu sudah jamak dilakukan—sebesar apapun perilakunya itu merugikan orang. Inilah yang saya sebut dengan bangsa pemilik mental pecundang itu. Kesalahan dibuat beramai-ramai, korupsi dibagi rata hingga menyebar ke segala penjuru—hingga kesalahan itu tersimpan nyaman tak tersentuh. Hukum jadi tak berdaya, hanya bisa geleng-geleng. Karena menggeleng pun, kesalahan masih berlangsung, maka kemudian hukum malah mengangguk-anggukkan kepala. Jadi kalau Anda merasa tidak bersalah ketika seenaknya berkendaraan di jalanan tak peduli besarnya bahaya yang Anda ciptakan— buang sampah di parit hingga banjir meluberluber; atau ketika menyikat hak orang hingga orang kecewa, sedih bahkan menderita—maka Anda tidak berhak merasa heran apalagi merasa lucu ketika Gayus berkampanye untuk jadi staf ahli saat statusnya terdakwa koruptor.(Vol.243, 13/1/2011)

Kolom foliopini dapat juga diakses melalui http://epaper.waspadamedan.com

Bangsa Inggris memiliki seorang negarawan besar yaituWinston Churchill, dan Ratu Inggris kendati di posisi Kepala Negara, total tidak dalam posisi negarawan. Seluruh negara maju memiliki negarawan, dan negarawan inilah yang berfungsi memberi inspirasi dan panduan bernilai mulia kepada seluruh rakyat di negerinya. Fakta menunjukkan, tidak ada satu bangsa yang bangkit perkasa oleh karena kepemimpinan banyak tokoh. Justru seorang negarawan dengan kejelian dan ketepatan pemikirannya berhasil memberi inspirasi dan panduan kepada seluruh rakyat di negerinya untuk bergerak bangkit menuju keperkasaan. Ciri khas Ciri-ciri khas dari seorang negarawan itu adalah, Pertama, memiliki kemampuan yang sangat cemerlang dan jeli; lebihmerupakanbakatyang terpadu dengan keberanian melawan arus dan bertekad melakukanperubahan dan pembaruan struktural, Kedua, berusaha memasuki hal-hal yang total baru, memilih menjadi pelopor atau pionir, Ketiga, karena yang dikemukakan adalah yang total baru, maka konsep yang dikemukakan menjadi mengejutkan dan meragukan pihak-pihak yang masih berpikir dalam pola lama. Keempat, mampu menawarkan solusi yang tuntas, mampu menawarkan reformasi total yang positif dan konstruktif, mampu menawarkan revolusi yang konstruktif, mampu menawarkan konsep dan aksi menghentikan krisis besar yang melanda satu bangsa atau beberapa bangsa. Kelima,mampumenawarkanharapan dan peluang nyata, mampu membangun harga diri yang nyata dan bernilai tinggi. Keenam, berani menghadapi risiko berten-

tangan dengan rezim dan atau kekuatan yang berkuasa. Ciri politisi Politisi praktis, para ahli (teknokrat), dan sejenisnya adalah dalam ciri-ciri khas, yakni, Pertama, kemampuan normal, maksimal mendekati cemerlang, tidak dalam posisi melawan arus, tidak berani mempelopori prubahan dan pembaharuan structural. Kedua, terpaku kepada hal-hal rutin pola lama. Ketiga, konsep yang dikemukakan adalahhal-hallamayangtelahberlangsung. Keempat, yang ditangani adalah hal-hal biasa, aksinya tidak menghasilkan reformasi, terutama tidak revolusioner, dan total tidak menghentikan krisis, dan pasti mengecewakan masyarakat luas. Kelima, terbatas menawarkan jargon dan retorika yang tidak berguna. Keenam, tidakberanimenghadapirisikobertentangan dengan kekuatan yang berkuasa. (Bagi Bangsa Indonesia dalam proses perjuangannya, kekuatan yang berkuasa itu adalah penggerakneoliberalisme/makroekonomi neoklasik yang dipimpin Amerika Serikat). Dapat disimpulkan, tokoh-tokoh IndonesiayangmunculpascaSukarnodan Hatta tidak satu pun dalam kaliber negarawan. Soeharto, BJ Habibie, Gus Dur, Megawati Sukarnaputri, Susilo BambangYudhoyono dan Boediono, hanya terbatas di posisi politisi praktis maksimal di posisi (teknokrat), dan birokrat biasa dan karena itu adalah kesia-siaan belaka bila mengharapkan para tokoh ini dapat berhasil melakukan perubahan dan pembaruan total dan struktural. Demikian juga posisi Prabowo Subianto, Wiranto, Aburizal Bakrie, Surya Paloh, SriSultanHamengkubowonoX,AniYudhoyono, Anas Urbaningrum, Rizal Ramli, dan segenap tokoh puncak Indonesia saat ini yang memiliki ambisi besar menjadi PresidenNegaraKesatuanRepublikIndonesia, bukanlah tokoh yang dibutuhkan Bangsa Indonesia dalam proses mewujudkan hakhak absolut seluruh rakyat, menjadikan negara Indonesia yang terkemuka pembangunan perekonomiannya, mewujudkan pasti pelaksanaan prinsip Pancasila, Undang-UndangDasarNKRI,danProklamasi Kemerdekaan tanggal 17 Agustus 1945. Penulis adalah Pengamat Ekonomi – Politik Internasional

Perspektif Membangun Kota Medan Oleh Drs H.Rahudman Harahap, MM

Dedi Sahputra

B9

Peran serta warga Satuyanginginsayasampaikanadalah

pentingnya peran serta setia warga kota dalam proses pembangunan. Peran serta ini seperti dalam bentuk dukungan pada bentuk-bentukkebijakanyangberakardari kesamaan pendapat tentang tujuan pembangunan di atas. Kita mengenal istilah transisi dalam konteks kependudukan. Makna dari istilah ini mengacu pada suatu proses pergeseran dari suatu keadaan dimana tingkat kelahiran dan kematian tinggi menjadi rendah. Hal ini disebabkan banyak faktor, seperti perubahan pola berfikir, meningkatnya jenjang pendidikan masyarakat, serta perubahan ke arah positif tingkat sosial ekonomi masyarakat, juga disebabkan membaiknya gizi masyarakat akibat dari pertumbuhan pendapatan masyarakat. Dalam kondisi seperti ini, biasanya tingkat pertumbuhan penduduk mulai menurun. Dalam kondisi ini pula akan terjadi suatu tingginya tingkat kesadaran masyarakat dan tingkat partisipasi masyarakat dalam setiap kebijakan publik yang mendorong pembangunan. Inilah yang terjadidinegara-negaramajupadaumumnya. Pada akhir proses transisi ini, baik tingkat kelahiran maupun kematian sudah tidak banyak berubah lagi, akibatnya jumlah penduduk juga cenderung untuk tidak banyak berubah, kecuali disebabkan faktor migrasi atau urbanisasi. Poin penting yang ingin saya sampaikan dalam uraian ini adalah pencapaian pada kondisi transisi ini. Bahwa masa transisisepertiinihanyabisadicapaidengan kesamaan persepsi tentang transisi itu sendiri. Kesamaan persepsi ini akan melahirkan dukungan yang kuat pada kebijakan yang mengakar pada tujuan kesejahteraan rakyat. Bahwauntukmewujudkanrakyatyang sejatera, maka dibutuhkan peran serta rakyat itu sendiri untuk ikut mendukung kebijakan pembangunan yang mengarah kepada tujuan tersebut. Di alam demokrasi sekarang, peran serta tersebut ditumbuhkan oleh kesadaran dari masing-masing warganya. Sedangkan di negara sosialiskomunis seperti di China, dukungan itu dipaksakan dari pemerintah kepada rakyatnya.Intinyaadalahbahwadukungan iwarga adalah sesuatu yang wajib bagi keberhasilan pembangunan suatu daerah, apakah dipaksakan atau tumbuh dari

RancanganQanunWaliNanggroeversi DPRA juga telah menimbulkan kontroversi antara setuju dan menolak. Lihat saja isi salah satu pasal yang penuh kontroversi yaitu Pasal 5 draf Qanun itu menyebutkan,WaliNanggroeadalahlembagatertinggi dalam sistem kehidupan dan peradaban di Aceh. Dengan kewenangan menguasai semuaasetAcehdidalamdandiluarnegeri, menandatangani kontrak bisnis dengan pihak luar negeri, bahkan bisa membubarkan parlemen serta memberhentikan gubernur serta wakil gubernur. Sungguhsangatbesarkewenangannya dan tentu posisi ini akan sangat prestisius, bahkan isi pasal ini dianggap akan sangat banyak benturannya dengan undangundang dan peraturan perundang-undangan lainnya, hal ini merupakan sebuah eksperimendemokrasialaAcehyangsangat berani dari inisiasi DPRA (Kompas, 3/1/ 2011). Sepintas lalu damai Aceh telah bersemi

dan mekar, tapi sesungguhnya bara api dendam, potensi konflik dan kekerasan masihterpendampadasebagiankelompok masyarakat (eks-kombatan, petani, dan nelayan) yang belum mendapatkan kue damaipembangunan.Potensikonflikpada pemilukada 2011 pun masih cukup tinggi jika para elit ingin memaksakan keinginannya dengan menghalalkan segala cara untuk menakhodai Aceh tahun 20122017. Tapi, pengalaman Aceh dalam pilkada tahun 2006 yang berlangsung sukses dan damai telah menjawab keraguan banyak kalangan bahwa rakyat Aceh tidak bisa berdemokrasi dalam kondisi damai, maka tahun 2011 saya juga sepakat dengan prediksi bahwa pemilukada akan sukses dan berlangsung dengan penuh demokratis. Sepintas lalu, Aceh masih dipandang sebagai propinsi yang penting dan sangat menentukan dalam ranah perpolitikan,

Dukungan warga adalah sesuatu yang wajib bagi keberhasilan pembangunan suatu daerah

S

aya berkeyakinan bahwa seluruh masyarakat kota Medan dan berbagai elemen yang melingkupinya memiliki persamaan pendapat untuk menjadian kota ini menjadi lebih baik. Rakyatnya lebih sejahtera, tata tertib ditegakkan, berbagai infrastruktur menunjang kemudahan-kemudaan warga kota dan segala kebutuhan mendasar warga bisa terpenuhi dengan mudah. Keyakinan ini harus menjadi keyakinan kita bersama untuk mewujudkan secara bersama pula apa yang kita ingin capai. Karena ini adalah modal utama dalam kehidupan sosial masyarakat di alam yang demokratis seperti sekarang ini. Hanya saja dalam aplikasinya, dalam menjalankan berbagai aturan yang ada; perspektif orang dalam melihatnya sering berbeda.Suatuhalyangdianggapbaikoleh yang kelompok tertentu, belum tentu dianggap sama oleh kelompok lain. Ada interest,adakepentingandanadadinamka yang mempengaruhi perspektif itu. Hal ini adalah sesuatu yang wajar yang sangat pantas di era sekarang ini, di mana kebebasanpendapatdanberekspresitelah menemukan jalannya. Apa yang perlu kita lakukan secara bersama adalah menjaga perspektif-perspektifyangmunculitutetap dalambingkaipersamaanpendapatuntuk tujuan kota Medan ke depan seperti yang diuraikan di atas. Karena perspektif yang dibiarkan berlangsung secara liar hanya akan menimbulkan berbagai hal yang kontra produktif bagi pembangunan daerah ini. Kedudukan Medan Medan kita adalah ibukota provinsi, suatu otonom yang memiliki fungsi serta kedudukan yang penting juga strategis. Medan sering dinilai sebagai barometer pembangunan secara nasionah, sebagai komparasipembangunandanpenyelenggaraan pemerintahan daerah. Medan kaya akan elemen yang membentuknya. Dari segi etnis, kota Medan

Aceh... (Lanjutan dari hal B 8)

(perseorangan) diberi kesempatan bertarung dalam Pemilukada Aceh 2011, hal ini diketahui pada 30 Desember 2010 setelah Mahkamah Konstitusi (MK) mengabulkan permohonan uji materi (judicial review) Pasal 256 Undang-Undang Nomor 11Tahun2006tentangPemerintahanAceh (UUPA), dimana disebutkan bahwa Pasal 256 UUPA yang mengatur calon perseorangan kepala daerah itu bertentangan dengan UUD 1945 dan saat ini tidak mempunyai kekuatan hukum. Pertarungan menjadi calon gubernur, bupati/walikota akan semakin ramai karena selain dari partai politik, calon perseorangan pun dapat maju hanya dengan mengandalkan dukungan KTP 3 persen dari jumlah penduduk yang tersebar di 11 atau 12 kabupaten/kota di Aceh.

dihuni oleh sangat beragam etnis yang kemudian dalam perjalannya menuju peleburan pada identitas budaya masyarakat kota Medan.Terjadi proses akulturasi budaya di mana identitas kebudayaan etnisitas menuju kea rah identitas warga Medan yang sangat spesifik. Posisi geografis, Medan juga sangat strategis,yangberbatasanlangsungdengan Selat Malaka di bagian Utara. Posisi ini menguntungkankarenaberbatasansecara langsung dengan kota-kota di Negara tetangga yang relatif lebih maju. Secara demografis Medan memiliki pangsa pasar barang/jasa yang relatif besar. Jumlah penduduk kota berdasarkan sensus penduduk terakhir yang dilakukan di tahun 2010 ini mencapai sekitar 2,3 juta jiwa. Fakta ini mengukuhkan posisi Medan sebagai kota terpadat penduduknya di provinsi ini. Medan sejak lama telah menjadi‘kiblat’bagipendudukSumateraUtara. Medanadalahpasaryangsangatbesarbagi berbagai produk ekonomi. Kota Medan sangat potensial berkembang menjadi pusat perdagangan dan keuangan regional/nasional. Sedangkan secara administratif, Medan berbatasan dengan Kabupaten Deliserdang, di sebelah Barat, Selatan dan Timur. Sepanjang wilayah Utara nya berbatasan langsung dengan Selat Malaka, yang merupakan salah satu jalur lalu lintas laut terpadat di dunia. Sedangkan Deliserdang merupakan salah satu daerah yang kaya dengan Sumber Daya alam (SDA), khususnya di bidang perkebunan dan kehutanan. Maka jelas sudah, Medan adalah kota yang teramat penting dalam peta wilayah Sumatera Utara bahkan secara nasional. Medan adalah kota yang kaya berbagai varian yang melatarbelakanginya. Itu semua berarti Medan memiliki potensi untuk berkembang pesat dan menjadi daerah yang maju dan sejahtera.

kesadaran. Teori kesejahteraan rakyat Dalam pandangan teoritis tentang negara, kita mengenal peran Negara atau dalam hal ini pemerintah daerah dalam pembangunan, termasuk peran kesejahteraan. Ada lima hal yang meliputinya, pertama, peran ekstraksi, yakni mengumpulkan sumberdaya, misalnya memperoleh devisa dari ekspor, eksploitasi sumberdaya alam, menarik pajak warga, atau menggali pendapatan asli daerah. Kedua, peran regulasi, yakni melancarkan kebijakan dan peraturan yang digunakan untuk mengatur dan mmengurus barang-barangpublikdanwarga.Ketiga,peran konsumsi, yakni menggunakan (alokasi) anggaran negara untuk membiayai birokrasi agar fungsi pelayanan publik berjalan secara efektif dan profesional. Keempat, peran investasi ekonomi, yakni mengeluarkan biaya untuk meningkatkan pertumbuhan ekonomi (GNP, GDP dan PDRB) dan membuka lapangan kerja bagi warga. Kelima, peran distribusi sosial, yakni negara mengeluarkan belanja untuk membiayai pembangunan sosial atau kebijakan sosial. Kita mengenal konsep welfare state (negara kesejahteraan). Dalam konsep ini negara berusaha membebaskan warganya dari ketergantungan pada mekanisme pasar untuk mendapatkan kesejahteraan (dekomodifikasi) dengan menjadikan hak setiap warga sebagai ”alasan utama” kebijakan sebuah negara. Sampaidisinisayakirasudahdemikian tergambar betapa tugas berat pemerintah mensejahterakan rakyatnya harus mendapat dukungan penuh dalam setiap kebijakannya. Penutup Saya tidak bermaksud menafikan munculnya perspektif-persektif beragam dalam membangun kota Medan. Iklim demokrasi telah mensyaratkan hal tersebut. Tetapisekalilagibingkaikesatuanpendapat akan tujuan Medan yang lebih sejahtera mesti kita kedepankan untuk menumbuhkan peran serta aktif masyarakat, juga mendukung berbagai kebijakan pemerintah daerah dalam rangka mewujudkan tujuan pembangunan itu. Penulis adalah Walikota Medan

keamanan, sejarah dan aspek lainnya bagi Indonesia, tetapi sesungguhnya, ada pendapat yang mengatakan bahwa pemerintah pusat (Jakarta) menganggap bahwa Aceh sudah kurang“seksi” (daya tarik) lagi. Sebagian dari tokoh Jakarta yang saya temui di Den Haag, Belanda, mengeluarkan pernyataan tersebut yang cukup mengejutkan saya. Sebagian dari mereka menganggap Aceh telah mendapatkan segalanya dari buah perdamaian. Kenyataannya, menurut saya, Aceh mesti harus terus diperhatikan pemerintah pusat, lembaga donor internasional dan pihakpihak lainnya, karena banyak hal sebenarnya berawal dari Aceh menuju Indonesia yang lebih baik. Selamat bekerja keras pada 2011! Penulis adalah Penerima Awards Talent for Governance dari The Hague Academy for Local Governance, Netherlands. E-mail: zul.h.aceh@gmail.com


Aceh

B12

WASPADA Kamis 13 Januari 2011

Maling Babak Belur Dihajar Masa LANGSA (Waspada): Dua kawanan maling yang selama ini leluasa menjalankan aktifitasnya dan telah meresahkan warga Gampoeng Paya Pelawi Kecamatan Birem Bayeun Aceh Timur, dilaporkan babak belur dihajar massa setelah tertangkap tangan berusaha melarikan hasil curiannya. Kapolres Langsa AKBP Yosi Muhamartha melalui Kapolsek Birem Bayeun, Aceh Timur (wilayah hukum Polres Langsa-red) Ipda Suparwanto kepada wartawan, Rabu (12/1) menyebutkan, kedua tersangka yang diamankan warga yaitu WP, 24, warga Medan, Sumut dan ZA, 21, warga setempat yang merupakan residivis kasus yang sama. Dijelaskannya, kedua tersangka diciduk warga sekira pukul 06:00 Wib, saat berusaha melarikan 5 Kg getah karet milik warga yang berhasil dicurinya di jalan Negara. Dari hasil introgasi warga, diketahui selain mencuri getah, ternyata kedua maling tersebut pada waktu yang sama sebelumnya juga telah

menjarah peralatan perbengkelan mobil milik Zulkifli, 28, di desa tersebut. “Karena marah dengan aksi kedua tersangka, apalagi selama ini sudah sangat meresahkan, maka beberapa warga sempat membogem tersangka di TKP. Untung petugas yang menerima informasi dari masyarakat langsung ke TKP dan mengamankan tersangka ke Mapolsek,” sebut Suparwanto. Selain mengamankan kedua tersangka, petugas juga ikut mengamankan barang bukti berupa 5 Kg getah karet milik warga dan peralatan perbengkelan milik korban yang berhasil dilarikan oleh tersangka sebelumnya. Lanjutnya, dari hasil pemeriksaan sementara pihaknya, diketahui tersangka Zainal Abidin ternyata residivis kasus pencurian yang belum lama keluar dari LP.“Ternyata dia belum jeradenganhukumansebelumnya,makaberani mencuri lagi,” sebut Suparwanto lagi seraya menambahkan kini kedua tersangka masih diamankan di Polsek untuk proses hukum.(ts)

Warga Keluhkan Suara Bising PLTD Langsa Lama LANGSA (Waspada): Suara bising yang ditimbulkan dari akitifitas Pembangkit Listrik Tenaga Diesel (PLTD) di Gampong Langsa Lama, Kecamatan Langsa Lama, Kota Langsa, mulai menuai keluhan dari masyarakat di sekitar lokasi, Selasa (11/1). Warga mengeluhkan suara bising tersebut yang sangat menganggu pendengaran terutama pada malam hari,” Jangankan anak kecil, orang tua saja susah tidur pada waktu malam, karena suara bising mesin tersebut,” ujar Ramlan, salah seorang warga. Warga khawatir suara bising tersebut dapat menganggu pendengaran terutama anakanak, “Setiap hari mereka mendengar suara bising tersebut sehingga harus bicara keraskeras, kalau begini selalu bisa merusak pendengaran mereka,” keluh Ramlan. Mereka meminta pihak perusahaan Listrik Negara (PLN) Langsa agar mengupayakan

meredam suara bising tersebut, sehingga tidak menganggu waktu istirahat dan aktifitas warga. Sementara itu Kepala PLN (Persero) Cabang Langsa, Baharuddin SE yang ditemui usai beraudiensi Dengan anggota Dewan Perwakilan Rakyat Kota (DPRK) Langsan kemarin mengatakan pihaknya terus berupaya untuk mencari cara meredam suara bising tersebut. “Para teknisi kita terus berupaya untuk mencari cara meredam suara bising tersebut, paling tidak kita upayakan meminimalisir suara dulu, saat ini kita mengupayakan memperbanyak menanam pohon di sekitar komplek PLTD ,” katanya. Baharuddin mengatakan beroperasinya PLTD Langsa tersebut merupakan salah satu jalan untuk mengatasi kekurangan daya listrik yang selama ini terus dihadapi oleh warga kota. (b25)

Rentetan Suara Senpi Kejutkan Warga PEUREULAK, Aceh Timur (Waspada): Rentetan suara letusan senjata api di lokasi staging Pacific Oil & Gas di Kecamatan Ranto Peureulak, Kab. Aceh Timur, kejutkan warga, Jumat (7/1) sekira pukul 00:30. Bahkan, menjadi perbincangan hangat disejumlah kalangan dan masyarakat setempat. Rentetan suara senjata yang diperkirakan terdengar sebanyak sembilan kali tersebut, diduga keras dilakukan Orang Tidak Dikenal (OTK). Hingga kini pihak kepolisian setempat masih menyelidiki kasus tersebut. Menurut informasi yang diperoleh Waspada, keheningan malam yang sedang dinikmati warga di kawasan Ranto Peureulak tiba-tiba dikejutkan dengan letusan senjata api. Diperkirakan, tembakan tersebut diarahkan ke lokasi staging Pacific Oil & Gas. Tetapi dipastikan tidak ada korban, karena arah tembakan diperkirakan dilepaskan secara

membabibuta. Disebut-sebut, pelaku, yang belum diketahui identitasnya itu, berjalan kaki ke sebuah bukit yang selama ini dikenal dengan sebutan ‘Buket Kopasus”. Buket tersebut terletak persis diperbatasan Mata Ie dengan kawasan Benteng, Kecamatan Ranto Peureulak. Setelah terdengar letusan senpi, pelaku diduga langsung melarikan diri menghilang di kegelapan malam. Keesokan hari ini, warga menjadikan perbincangan hangat terkait letusan senjata api yang membuat warga sangat terkejut itu. Kapolres Aceh Timur AKBP Drs Ridwan Usman kepada wartawan membenarkan terkait informasi letusan senjata api dalam wilayah hukumnya, persisnya di kawasan Ranto Peureulak. “Tapi, dari laporan yang kita terima tidak ada korban sama sekali, dan pelaku juga belum jelas. Ini sedang kita selidiki,” katanya singkat. (cmad)

Muhammad H. Ishak Kembali Raih Penghargaan Waspada DO’A dan usaha yang selama ini dikerahkan dalam pengabdiannya bekerja, ternyata tidak sia-sia. Motivasi dan dukungan serta iringan restu ibu dan istri dalam bekerja mengeringkan keringatnya setelah mendapat dua penghargaan istimewa dari PT Harian Waspada, 11 Januari 2011. Muhammad anak ke lima dari pasangan H. Ishak dan Hasmiyah. Putra ke lima tujuh bersaudara itu kembali membanggakan Aceh, khususnya Aceh Timur, setelah tahun lalu juga diberi penghargaan teristimewa sebagai Wartawan Produktif Aceh dan Penghargaan Khusus pada HUT Waspada ke 63. Setahun setelah mendapat penghargaan Wartawan Produktif dan Penghargaan Khusus, alumni STAIN Zawiyah Cot Kala Langsa itu kembali dipanggil ke pentas kehormatan pada puncak peringatan HUT Waspada ke 64 di Hotel Danau Toba, Medan, sebagai penerima PenghargaanTerbaik dan Penghargaan Khusus dari PT Harian Waspada. Dua penghargaan itu tak hanya membanggakan Aceh dan Aceh Timur, tetapi juga menghilangkan lelah sang istri—Raudhatul Jannah, S.PdI, dalam mengiringi langkah suaminya bekerja tanpa mengenal teriknya matahari dan dinginnya suasana malam hari. “Saya ikhlas suami mengabdi di Waspada, apalagi dia peduli dan cinta lingkungan serta kerap menulis mambantu masyarakat miskin dalam

mendapatkan kesehatan,” kata istrinya saat ditemui Waspada disela-sela HUT Waspada di Medan. Melihat latar belakang pendidikannya, Muhammad yang lahir di Idi Cut, 7 April 1983 itu menamatkan SDN Seuneubok Teungoh Idi Cut tahun 1995, kemudian SMPN Darul Aman Idi Cut tamat tahun 1998 dan SMUN Darul Aman lulus tahun 2001. Meski niatnya masuk Unsyiah Banda Aceh, namun biaya keluarganya sangat minim, apalagi adikadiknya saat punya keinginan melanjutkan pendidikan ke Universitas, sehingga Muhammad masuk ke STAIN Zawiyah Cot Kala Langsa dan berhasil menyelesaikan studinya Pendidikan Agama Islam (PAI) di tahun 2006. Awal 2007, dia mulai berbakti di Harian Waspada Wilayah Idi dan sekitarnya. Setelah diasuh dan diajar penulisan sebuah berita oleh seniornya, Agusni AH dan H. Ibnu sewaktu magang. Dia resmi menjadi Kontributor Waspada untuk Wilayah Aceh Timur Januari 2008.“Sejak itulah saya mengabdi. Terimakasih Ibu, Istri, Abang dan adik serta teman di Aceh, Sumut dan Medan yang se Media dan temanteman wartawan lain di Aceh, yang telah memotivasi saya dalam bekerja. Saya harap kekompakan terus terjalin sepanjang hayat dikandung badan. Alhamdulillah…,” ujar Muhammad, putra, almarhum H. Ishak itu. Munawardi Ismail

GAMBA GEUTANYO > Neu poto keujadian meunarek ngon kamera HP 3,2 mega piksel, kirem ngon MMS keu 08192110147. Peugot nama dan alamat jih. Na imbalan pulsa 20 ribee keu poto nyang di peuteubit.

WARGA BERBURU BABI HUTAN

Puluhan Warga Desa tempok Teungoh,Kecamatan IDI TIMU,Kabupaten Aceh Timur dan di bantu beberapa warga Desa sekitar kecamatan tersebut,lengkap dengan Tombak untuk berburu babi hutan(Celeng),dalam satu hari setidak nya 15 babi hutan yang mati, selama ini hama babi sudah meresahkan masyarakat karena menganggu tanaman warga. Pengirim Munawir sazli, Aceh Timur, 0813970987xx

Waspada/Sudarmansyah

Anggota DPRK Abdya dalam kunjungan kerja ke lapangan, Selasa (11/1), menemukan beragam permasalahan dan ketimpangan terhadap penggunaan anggaran APBK tahun 2010.

Anggota DPRK Abdya Temukan Proyek 2010 Bermasalah BLANGPIDIE (Waspada): Hasil kunjungan lapangan anggota DPRK Aceh Barat Daya (Abdya) yang berlangsung pada Selasa (11/1) kemarin menemukan beragam permasalahan yang terjadi di daerah tersebut. Hasil tersebut langsung diungkapkan oleh Wakil Ketua DPRK Abdya Elizar Lizam,SE.Ak bersama beberapa anggota DPRK lainnya kepada wartawan di ruang kerjanya Rabu (12/1). “Ada beragam permasalahan yang terjadi dengan anggaran APBK Abdya, seperti yang kita temukan kemarin di lapangan, dimana proyek 2010 hingga saat ini tidak memiliki bentuk alias tidak sesuai dengan kontrak kerja. Ini membuktikan bahwa penggunaan anggaran di daerah sarat dengan masalah,” ujar Elizar Lizam,SE, Wakil Ketua DPRK Abdya. Elizar Lizam yang turut didampingi anggota DPRK lainnya seperti Ketua Komisi-C M.Nasir, Zaman Akli, Fakrurrazi Adami, H.RS Darmansyah,SE, Jufri Hasan dan Tgk.Idris mengungkapkan, temuan lainnya yang dinilai sarat dengan penyimpangan yaitu adanya aset milik daerah seperti Traktor

yang digunakan dilahan sawit pribadi Bupati Akmal Ibrahim, kondisi tersebut dianggap sebagai bentuk penyalahgunaan kekuasaan yang harus diusut tuntas oleh aparat hukum. “Dalam perjalanan saat kunjungan lapangan kemarin, hasil temuan dan laporan masyarakat menyebutkan adanya aset daerah di lahan sawit pribadi Akmal Ibrahim, saat itu kita memangturunsecarakhususatas permintaan masyarakat,” timpal Jufri Hasan, anggota DPRK Abdya yang berasal dari PAN. Selain itu, Zaman Akli, Anggota DPRK Abdya dari Partai Aceh (PA), dalam kesempatan itu juga menyebutkan bahwa proyek pembangunan Pabrik Kelapa Sawit (PKS) yang telah dilakukan peletakan batu pertama di daerah desa Gunung Damarinda beberapa waktu yang lalu juga dianggap sarat dengan masalah.Dana otonomi khusus (otsus) yang mendanai proyek tersebut telah dicairkan mencapai 20 persen (20%), tetapi pada kenyataannya di lapangan tidak ditemukan hasil apapun selain perusakan aset yang telah dibangun sebelumnya di lokasi Gunung Samarinda.“Laporan dari

masyarakat menyebutkan bahwa lokasinya telah dipindahkan, namun saat kita mengecek ke lokasi yang baru tidak kita temukan apapun selain hanya pembersihan lahan, ini jelas sebuah bentuk penyimpanganyangsaratdengan masalah dan kita himbau agar aparat berwenang dapat mengusut tuntas, apalagi dana yang digunakansebesar20persentelah diserap habis,” sebut Zaman Akli. Kunjungan lapangan yang dilakukan anggota DPRK Abdya yang terdiri dari Elizar Lizam, SE.Ak, H.RS Darmansyah,SE, Afdal Jihad,S.Ag, M.Nasir, Samsul Bahri, Zaman Akli, M.Najib, S.Pd, Arjuna Putra,SE, Jufri Hasan, juga mempertanyakan sumberdana yang digunakan oleh salahsatu proyek yang dinilai bermasalah ke dinas terkait. Namun kenyataannyapihakdinassetempat malah mengaku tidak tau samasekaliterhadappermasalahan dan sumberdana tersebut. “Plt kepala dinas yang kita hubungi malah mengaku tidak tau terhadap kondisi tersebut dan juga sumberdananya. Apa mungkin ada dana siluman di daerah ini sehingga seorang pejabat di dinas aja tidak tau,” timpal Fakrurazi Adami. (sdp)

Polres Aceh Tengah Musnahkan Knalpot Racing TAKENGEN (Waspada): 76 Unit knalpot racing yang tidak sesuai dengan spek kendaraan roda dua dimusnahkan Polres Aceh Tengah. Barang-barang tersebut merupakan hasil tilang Satlantas selama dua bulan terakhir. “Knalpot ini hasil razia Satlantas Aceh Tengah, dan telah memiliki kekuatan hukum, makanya dimusnahkan,” kata Kapolres Aceh Tengah, AKBP Edwin Rachmat Adikusomo, didampingi Kasatlantas, AKP M. Nazir, menjawab Waspada, di Mapolres Aceh Tengah, Rabu (12/1) pagi. “Diamankannya barang tersebut, karena selama ini keberadaannya sangat mengganggu ketertiban umum. Knalpot racing kerap membuat warga yang melaksanakan shalat merasa kurang nyaman. Bahkan masyarakat ada yang mengaku tidak dapat istirahat karena suara bising yang dikeluarkannya,” sebut Edwin. Upaya Satlantas Polres Aceh Tengah, bukan saja merazia knalpot yang tidak sesuai standar, namun menindak pelanggar yang tidak menggunakan helm dan kelengkapan surat kendaraan. “Razia yang dilakukan, bukan saja persoalan SIM atau kelengkapan surat kendaraan. Namun kami juga kerap menjaring pengendara yang tidak memakai helm. Biasanya yang terkena tilang, pengguna roda dua yang berboncengan, karena mereka hanya memakai satu helm,” tambah AKP. M. Nazir. Pantauan Waspada dalam kesempatan itu turut hadir Kepala Induk II, PJR dari Lhokseumawe, AKP. Naharuddin, dalam kunjungannya ke Polres Aceh Tengah, dalam rangka kerja sama membantu penertiban berlalu lintas di sana. “Kerja sama ini merupakan instruksi dan program Kapolda Aceh,” sebut Naharuddin. Dirgahayu Satpam Sebelumnya, di Mapolres Aceh Tengah dilaksanakan peringatan hari jadi Satpam ke - 30. Dalam kesempatan itu Kapolres Aceh Tengah, AKBP Edwin Rachmat Adikusomo, menyampaikan amanat Kapolri Jenderal, Drs. Timur Pradopo, di hadapan puluhan anggota Satpam Aceh Tengah. “Seiring perkembangan perekonomian nasional, jaminan keamanan menjadi hal yang dominan dalam menciptakan iklim investasi di negara kita,” sebut Kapolri. “Dalam mengemban amanah tersebut, Polri tentunya tidak dapat berjalan sendiri. Pada sisi lain, Polri masih terbatas sumber daya manusianya yang secara kuantitas belum sebanding dengan ratio jumlah penduduk Indonesia,” sebut Timur. Untuk itu, pinta Kapolri, Satpam merupakan mitra Polisi yang mengemban fungsi Kepolisian terbatas dalam membantu Polri dalam melaksanakan tugas pokoknya di lingkungan tempat tugas. (cir)

Waspada/Mansurdin

Aksi teaterikal yang dipertontontan oleh KOMPAS yang mengisyarakat Kekuasaan penuh sang Wali yang tercermin pada Raqan wali Nanggroe yang mendapat penolakan tegas dari masyarakat Aceh Singkil Rabu (12/1)

Mahasiswa Demo DPRK Singkil, Tolak Ranqan Wali Nanggroe SINGKIL (Waspada): Seratusan mahasiswa yang tergabung kedalam Kualisi Masyarakat Peduli Aceh Singkil (KOMPAS) menggelar aksi demo damai didepan gedung DPRK Singkil Rabu (12/1) Singkil Utara guna menyampaikan aspirasi penolakan dengan tegas Rancangan Qanun Wali Nanggroe Pantauan Waspada di lapangan, sebelum memasuki halaman gedung DPRK Aceh Singkil, para mahasiswa yang menyanyikan lagu – lagu sindiran ciptaan Iwan fals terhadap wakil rakyat di sana. Mereka juga membawa kerenda mayat yang bertuliskan musibah terhadap seluruh rakyat Aceh apabila Qanun Wali Nangrroe disyahkan. Selain itu, mereka juga mengadakan pembakaran ban bekas dipinggir badan jalan serta berorasi sebelum memasuki halaman kantor DPRK setempat. Aksi unjuk rasa damai dengan koordinator Muhammad

Ishaq itu, juga sempat mencuri perhatian dari pihak keamanan Polres Aceh Singkil yang ikut mengamankan jalannya aksi, serta masyarakat dan PNS yang menyaksikan langsung unjuk rasa tersebut. Dalam pernyataan sikapnya yang dibacakan dihadapan Ketua DPRK Aceh Singkil Putra Ariyanto, SE serta unsur Muspida Aceh Singkil dan anggota DPRK setempat KOMPAS melalui Muhammad Ishaq selaku koordinator aksi serta Ridwan Koordinator Lapangan dengan tegas menolak RaqanWali Naggroe. Karena, dinilai terlalu prematur untuk dijadikan sebuah qanun karena bertentangan dengan Pancasila dan UUD 1945 serta sistim tata negara di Indonesia. Selain itu, Kompas juga meminta DPR Aceh dan Pemerintah Aceh untuk membatalkan RaqanWali Nanggroe karena dinilai mengangkangi demokrasi

dan menghambur – hamburkan uang rakyat, serta meminta kepada DPRK Aceh Singkil untuk membuat pernyataan sikap yang sama yang akan diteruskan kepada DPRA dan Pemerintah Aceh dan kepada masyarakat Kompas juga menghimbau untuk tetap menjaga perdamaian. Menanggapi pernyataan sikap Kompas tersebut, Ketua DPRK Aceh Singkil Putra Ariyanto, SE menyampaikan dukungan penuh terhadap penolakan Raqan Wali Nanggroe. “Apabila bertentangan dengan Pancasila, UUD 1945 dan sistim demokrasi di Indonesia maka DPRK Aceh Singkil adalah lembaga yang pertama menolak Raqan Wali Nanggroe, “ ujar Putra lantang. Putra juga menyebutkan, apa yang menjadi sikap Kompas adalahmerupakansikapbersama masyarakat Aceh Singkil.“Untuk itu aspirasi masyarakat Aceh Singkil wajib kami sampaikan,” katanya menambahkan. (cb02)

Waspada/Irwandi MN

Kapolres Aceh Tengah AKBP Edwin Rachmat Adikusumo, menyaksikan knalpot yang akan dimusnahkan.

PASANG IKLAN MINI ACEH Hub:

0651-22385 0645-42109

RUMAH MINIMALIS DIJUAL

Lok asi Asri dan nyaman, Jln. Ekawarni, Medan Johor, uk. tanah 8 x 19m, bangunan 8 x 13m, 2 km tdr, ada garasi, PLN, PAM. Harga Rp 275 jt. Yang berminat. Hub. 0812 608 68606


Aceh

WASPADA Kamis 13 Januari 2011

B11

Wakil Ketua DPRK Pidie Jaya:

Harian Waspada Memberi Kesadaran Berpolitik Dan Bernegara

Waspada/Sudarmansyah

Puluhan aktifis mahasiswa yang tergabung dalam Ikatan Mahasiswa Muhammadiyah (IMM) Aceh Barat Daya (Abdya) menggelar aksi simpatik berupa pembagian lilin serta menyalakan obor di siang hari.

Warga Keude Baro Puluhan Tahun Hidup Tampa Listrik BLANGPIDIE (Waspada) : Puluhan aktifis mahasiswa yang tergabung dalam Ikatan Mahasiswa Muhammadiyah (IMM) Cabang Aceh Barat Daya (Abdya) pada Rabu (12/1) pagi melakukan aksi simpatik dan teatrikal yang dipusatkan di simpang Ceurana kota Blangpidie. Aksi digelar dalam rangka keprihatinan terhadap kondisi yang dialami oleh Warga Keude Baro Kecamatan Kuala Batee yang sudah puluhan tahun hidup dalam ‘kegelapan’ karena ketiadaan aliran listrik. Menurut mereka, apa yang dialami oleh warga Keude Baro tersebut lebih menyerupai pada masa ‘penjajahan’ kolonialis Belanda. “Disaat orang-orang mulai menikmati internet, atau bahkan hidup penuh gemerlapan dengan terang benderang, ada puluhan KK saudara kita yang berada di desa Keude Baro keca-

matan Kuala Batee masih hidup dalam kegelapan karena tidak adanya listrik. Di mana tanggung jawab pemerintah dan pejabat negeri ini, kenapa mereka masih tutup mata terhadap kondisi tersebut,” teriak Julida Fisma, salahseorang aktifis diacara aksi pagi itu. Aksi yang mendapat perhatian luas dari masyarakat tersebut mendapat pengawalan ketat dari personil Polres Abdya. Puluhan mahasiswa yang telah berkumpul di pekarangan Mesjid At-Taqwa Blangpidie sejak pukul 9.30 pagi tersebut, langsung bergerak ke bundaran simpang Ceurana dan membentangkan beberapa poster yang berisi kritikan terhadap PLN (Perusahan Listrik Negara) serta pemerintah setempat. Beberapa mahasiswa juga membagibagikan lilin yang diikat dengan pita warna hitam sebagai lam-

bang keprihatinan terhadap permasalahan listrik yang masih dialami oleh warga di Abdya saat ini. Selain itu, ada juga aksi teatrikal yang dilakukan oleh mahasiswa berupa penutupan mata dengan kain hitam serta menyalakan obor yang mereka sebut sebagai bentuk ‘tutup matanya’ para pejabat di daerah Abdya terhadap permasalahan yang sedang dialami oleh masyarakat saat ini. “Para pejabat di sini hanya sibuk dengan masalah politik serta kepentingan mereka belaka, padahal masih banyak masalah dan kepentingan rakyat yang harus mereka lihat. Seperti masyarakat di desa keude baro, sudah hampir puluhan tahun tidak pernah menikmati listrik, semoga pintu hati para pemimpin di negeri ini bisa terbuka dan melihat keadaan rakyatnya,”

ujar Ade Alkausar, salahseorang orator aksi hari itu. Terkait aksi tersebut, Manager PLN Blangpidie, Bakhtiar,ST yang dihubungi Waspada mengakui bahwa persoalan yang terjadi di desa Keude Baro Kecamatan Kuala Batee tersebut sudah masuk agenda prioritas PLN sejak tahun 2010 lalu, hanya saja hingga saat ini proses pengadaan tiang listrik untuk mensuplai arus ke daerah tersebut belum terealisasi. Diharapkannya pada tahun 2011 ini anggaran serta proses pelaksanaannya akan segera terwujud. “Kita berharap tahun ini sudah dapat diatasi, karena memang sudah kita prioritaskan sejak tahun lalu (2010), dan kita juga bisa memahami dengan aksi yang dilakukan oleh adikadik mahasiswa tersebut, ini juga keprihatin bagi kita semua,” ujar Bahktiar. (sdp)

KEHADIRAN Harian Waspada sebagai surat kabar Nasional yang terbit di daerah Sumatera Utara dalam pemberitaannya memberi kesadaran berpolitik dan bernegara bagi masyarakat. Sepanjang sejarah telah memenuhi fungsinya sebagai media komunikasi yang profesional dan akrab dengan rakyat. Ketua DPRK Pidie Ir. H. Sulaiman Ary mengemukakan pendapatnya saat menjawab pertanyaan Waspada di kamar kerjanya Kantor DPRK setempat, Rabu (12/1), sehubungan Peringatan Hari Jadi ke-64 Harian Waspada pada 11 Januari 2011. Kita sangat memerlukan media komunikasi seperti Waspada yang lebih akrab dengan rakyat, karena itu kita bangga pada Hari Jadi Harian Waspada ke-64, kata Nyak Man (panggilan akrab Sulaiman Ary) yang juga Ketua DPD Partai Amanat Nasional (PAN) Kabupaten Pidie Jaya dan ia mengharapkan keakraban yang terjalin antara Waspada dengan lembaga wakil rakyat dan seluruh lapisan masyarakat di Kabupaten Pidie Jaya bahkan di seluruh Aceh terus dibina untuk masa mendatang. Ia menilai Harian Waspada telah banyak berbuat untuk daerah Pidie Jaya dari kabupa-

Lapangan Merdeka Langsa Kembali Kumuh LANGSA (Waspada): Lapangan Merdeka Langsa yang telah dialih fungsi menjadi taman kembali diramaikan para pedagang mainan dan penyedia jasa mainan anak-anak. Kondisi ini, sesuai pengamatan Selasa (11/1), menjadikan taman kembali kumuh. Kondisi tersebut sangat disayangkan oleh sejumlah kalangan, karena dana yang digunakan untuk mengubah lapangan tersebut mencapai miliaran rupiah menjadi sia-sia . “Kalau begini jadinya sama saja, lapangan ini kembali kumuh, tidak indah seperti yang diharapkan, pembangunan amburadul h ditambah pemandangan seperti ini,” keluh Rustam, seorang warga kota. (b25)

ten baru ini pisah dari kabupaten induknya (Pidie), media ini telah berjasa sangat besar untuk menyampaikan informasi tentang pemekaran Pidie Jaya. “Saya banyak berterima kasih kepada Waspada yang banyak sekali memberitakan mengenai Pidie Jaya, “katanya, seraya menambahkan sebelum media atau harian lain beredar di Aceh, tapi Harian Waspada sudah berkiprah dan memberikan banyak kontribusi di daerah ini sejak zaman revolusi. Menurutnya, peranan Harian Waspada dalam mendorong kemajuan Pidie Jaya dengan meningkatkan peran sebagai media kontrol sosial dari berbagai sektor dinilai cukup

besar. Yang paling penting banyak kebijaka-kebijakan yang dilakukan baik oleh jajaran eksekutif maupun legislatif dikutip dengan rapi dan baik. “Untuk masa mendatang diharapkan dapat berbuat lebih banyak dalam mengetengahkan terobosan-terobosan yang sedang dan akan digerakkan dan kembangkan di daerah ini,” kata Nyak Man. Ir. H. Sulaiman Ary, selaku Wakil Ketua DPRK Pidie Jaya, dan pada periode lalu menjabat sebagai Ketua DPRK Pidie Jaya, mengaku fanatik terhadap Harian Waspada. Sejak lama ia mengaku sudah berlangganan banyak surat kabar nasional dan majalah termasuk koran daerah lainnya. Tetapi

tanpa membaca Waspada, rasanya kurang lengkap, ucapnya. Kehadiran Harian Waspada di daerah Pidie Jaya atau Aceh umumnya mempunyai andil yang penting dalam pembangunan daerah. Melalui informasi/ pemberitaan yang disajikan, membuka daerah ini ke daerah luar dan keterbelakangan daerah itu selama ini akan pupus dan menjadi daerah maju. Terakhir Nyak Man mengharapkan Harian Waspada betul-betul menjadi harian yang berbobot pada tingkat nasional, bahkan dapat dibaca di negaranegara lainnya. “Saya kira, sambil belajar hal ini bisa dikembangkan, “ katanya. (b21)

Waspada, Kamis 13 Januari 2011  

waspada daily

Read more
Read more
Similar to
Popular now
Just for you