Page 1

Shalat Jumat Di Mana? Lihat halaman C8

WASPADA Demi Kebenaran Dan Keadilan

JUMAT, Legi, 8 April 2011/4 Jumadil Awal 1432 H

No: 23470 Tahun Ke-65

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

Terbit 28 Halaman (A1-12, B1-8, C1-8)

Harga Eceran: Rp2.500,-

Jepang Gempa Lagi, 7,4 SR

Ang Ho

Waspada/Rudi Arman


KAPOLDA Sumatera Utara Irjen Pol Wisjnu Amat Sastro menunjukkan foto Acui alias Halim salah seorang tersangka pembunuh pengusaha ikan Kho Wie To bersama istrinya, Dora Halim di Medan, saat paparan kasus di Mapolresta Medan, Kamis (7/4).

Waspada/Rudi Arman

Ayong alias Sun An

TOKYO (Waspada): Jepang kembali diguncang gempa berkekuatan 7,4 SR, Kamis (7/4) malam, dan memicu peringatan tsunami. Gempa susulan ini berjarak kurang dari sebulan setelah gempa sebelumnya yang menghancurkan negara ini. Pembawa acara stasiun berita NHK mangabarkan pada warga di sepanjang garis pantai untuk mengungsi ke daerah yang lebih tinggi dan menghindari bibir pantai. Lembaga Meteorologi Jepang mengeluarkan peringatan tsunami dengan tinggi gelombang hingga dua meter, menyusul gempa berkekuatan 7,4 SR tersebut. Peringatan tersebut dikeluarkan untuk area garis pantai yang telah hancur saat tsunami dan merenggut korban jiwa sebanyak 25.000 orang, dan menimbulkan krisis nuklir di reaktor pembangkit listrik milik Jepang. Petugas di reaktor Fukushima Dai-ichi yang rusak me-

ngaku belum menerima data kerusakan baru yang ditimbulkan dari gempa susulan ini. Operator Pembangkit Listrik Tokyo (Tokyo Electric Power Co.) mengatakan pihaknya telah melakukan evakuasi terhadap dua pekerjanya, serta tujuh orang dari instalasi pembangkit listrik di selatan yang tidak mengalami kerusakan parah. Pejabat berwenang mengatakan, Kamis (7/4), gempa susulan tersebut terjadi di kedalaman 25 kilometer di bawah permukaan laut dan sepanjang kawasan Miyagi. Guncangan gempa ini terasa hingga ke Tokyo, dan mengguncang bangunan-bangunan di kota ini selama satu menit. Di Ichinoseki, kawasan daratan Jepang, bangunan-bangunan berguncang keras, menjatuhkan barang-barang dan menjungkirbalikkan segala perabotan.Namun tidak Lanjut ke hal A2 kol. 7

Motif Pembunuhan Pasutri Persaingan Bisnis Lelang Kapal

2 TERSANGKA, 7 DPO MEDAN (Waspada): Polisi menetapkan dua warga Jakarta sebagai ‘otak’ pelaku pembunuhan terhadap pengusaha ikan Kho Wie To, 36, dan istrinya Dora Halim, 32. Sedangkan tujuh orang termasuk eksekutor masih dalam daftar pencarian orang (DPO) kepolisian.

Kedua tersangka, Sun An alias Anlang, 50, warga kompleks Perumahan Teluk Gong 47, RT 02 RW 08 Jakarta Utara, ditetapkan sebagai otak pelaku pembunuhan. Dia ditangkap di Bagan Siapiapi, Kab. Asahan. Kemudian Ang Ho, 33, warga Citra

5 Blok D3/12 Kel. Kamal, Kec. Kalideres Jakarta, Barat, ditangkap di Hotel JW Marriott, Medan. Keduanya ditangkap Sabtu lalu. Polisi juga telah meminta bantuan NBC (National Central Bureau) untuk melacak kebera-

daan para tersangka yang diduga sudah melarikan diri ke luar negeri. Saksi yang masih diperiksa sebanyak 25 orang. “Motif pembunuhan suami istri itu disebabkan persaingan bisnis,” sebut Kapoldasu Irjen Pol. Wisjnu Amat Sastro saat

memberikan keterangan pers kepada wartawan di Mapolresta Medan, Kamis (7/4) siang. Kapolda didampingi Kapolresta Medan Kombes Tagam Sinaga, Direktur Binmas/Plt Kabid Humas Poldasu Kombes Hery Subiansauri dan Direktur

MEDAN (Waspada): Administrator Bandara (Andban) Polonia menegaskan, keberadaan proyek bangunan Hermes Place Polonia di Jalan Monginsidi mengancam kawasan penerbangan, jika ketinggian bangunan melebihi 15 meter. “Jika ketinggian bangunannya melebihi 15 meter, bangunan Hermes Place Polonia harus dipotong karena mengganggu Kawasan Keselamatan Operasional Penerbangan (KKOP),” kata Adban Polonia Razali Abubakar kepada Waspada, Kamis (7/4). Razali menyatakan kekecewaannya karena banyak bangunan berdiri tidak jauh dari Bandara Polonia mengancam KKOP. Padahal, lanjutnya, KKOP sudah lama merekomendasikan bahwa ketinggian bangunan pada radius 1 Km dari Bandara Polonia Medan tidak boleh lebih 15 meter. Hal itu berdasarkan Keputusan Menteri (KM) Perhubungan No.18/1991 tentang Kawasan Keselamatan Operasional Penerbangan (KKOP), ketinggian bangunan dalam radius lingkaran 1 Km dari Bandara Polonia Medan hanya 15 meter.

JAKARTA (Waspada): Bank Indonesia (BI) Kamis (7/4) membekukan sementara ekspansi kartu kredit Citibank, sehingga tidak bisa menambah nasabah lagi. Langkah itu dilakukan setelah meninggalnya nasabah Citibank, Irzen Octa, paska mengurus tagihan kartu kreditnya. Sebelumnya, regulator perbankan itu juga meminta Citibank untuk menghentikan sementara ekspansi Citigold atau produk bagi nasabah kaya. Alasannya, hal itu terkait dengan dugaan pembobolan dana nasabah oleh mantan karyawan

Lanjut ke hal A2 kol. 1

Fasilitas Taubat Oleh Dedi Sahputra

Tak Ada Prioritas Calhaj 2011 JAKARTA(Antara): Kementerian Agama melalui Direktorat Jenderal Penyelenggaraan Haji dan Umroh (PHU) Slamet Riyanto mengatakan, pihaknya tak akan mengeluarkan kebijakan berupa prioritas bagi calon jamaah haji (Calhaj)pada musim haji 2011 mandatang. Jamaah haji yang sudah

mendaftarkan diri tetap ikut mekanisme yang sudah ada. Tak ada prioritas, misalnya usia lanjut diprioritas lebih awal berangkat menunaikan haji, kata Dirjen Riyanto di Jakarta, Kamis (7/4). Ia mengatakan, jika ada prioritas bagi yang sudah mendaftar, apa lagi untuk usia lanjut,

Sertifikasi Guru Dievaluasi Pemerintah Provinsi Sumut bersama pemerintah kab/ kota sepakat untuk melakukan evaluasi pelaksana sertifikat guru di Sumut. A5

Bencana, “Takdir” Atau Akibat Perbuatan Manusia

Oleh H Syarifuddin Elhayat Oleh Azhari Akmal Tarigan

Mimbar Jumat-C7

Mimbar Jumat-C6

maka akan merusak sistem. Konskuensinya tentu pada calon jamaah haji yang sudah masuk daftar tunggu. “Kita tak ingin merusak sistem yang sudah ada,” kata Slamet, yang didampingi Direktur Pengelolaan Dana Haji Ahmad Junaedi dan Kasubdit Dokumen Haji Sri Lubis.

Alasannya, kata Slamet, jika ada calon haji usia lanjut dapat prioritas berangkat, maka tentunya membawa konsekuensi yaitu adanya tambahan calon haji usia muda sebagai tenaga pendamping bagi calon haji berusia lanjut. Lanjut ke hal A2 kol. 6

WASHINGTON (Waspada): Muammar Khadafi secara langsung memohon pada Presiden Barack Obama untuk menghentikan apa yang disebut pemimpin Libya tersebut sebagai “Perang tak seimbang”, dan mendoakan Obama menang dalam pemilu tahun depan. Permohonan ini ditulis Khadafi dalam sebuah surat sepanjang tiga halaman, yang ditujukan ke pada Obama Intinya, Khadafi memohon kepada Obama untuk membujuk sekutu menghentikan serangan udara yang dipimpin

Norman Tampil Di Bukan Empat Mata


“Berkaca” Dari Bencana

Lanjut ke hal A2 kol. 3

Citibank, Inong Malinda atau Melinda Dee. Menurut Kepala Biro Hubungan Masyarakat BI, Difi A Johansyah, langkah itu dilakukan karena saat ini BI melakukan pemeriksaan pada kedua lini produk tersebut. Produk yang dimaksud adalah kartu kredit dan layanan private banking dengan produk Citigold. “Kami minta Citibank untuk menghentikan ekspansi atau tidak menggaet nasabah baru Citigold dan kartu kredit,” ujarnya di Jakarta, Kamis (7/4). Lanjut ke hal A2 kol. 1

Khadafi Tulis Surat Permohonan Gencatan Senjata Ke Obama


Lanjut ke hal A2 kol. 6

salah satu hotel di Asahan. Setelah itu, mereka kembali ke Medan dan melakukan pertemuan lagi di Hotel Cambridge. Dari Cambridge, para eksekutor bergerak menuju

BI Larang Citibank Gaet Nasabah Baru

Hermes Place Ancam Penerbangan

KECENDERUNGAN manusia adalah berbuat munkar melampaui batas. Ingin jadi pemimpin tapi menyikut saudaranya, mau jadi PNS tapi sogok menyogok merampas hak orang yang lulus ujian, mau kaya tapi memfitnah, mau maju tapi dengan cara menghambat orang lain. Sibuk urusan dunia hingga lupa bersujud kepada-Nya, hidup masih dibayangi kemaksiatan dan lain sebagainya. Tapi kasih sayang Allah SWT meliputi segala sesuatu. Orang yang telah akrab dengan kemaksiatan akan terus menerus diikuti oleh fasilitas taubat agar ia bisa segera kembali kepada Allah. “Hai hamba-hamba-Ku yang melampaui batas terhadap diri mereka sendiri, janganlah kamu berputus asa dari rahmat Allah. Sesungguhnya Allah mengampuni dosa-dosa semuanya”.(QS.39:53)

Reskrim Kombes Agus Andrinto. Sebelum melakukan pembunuhan, sebagaimana dikatakan Kapoldasu, kedua tersangka dan para eksekutor bertemu di Hotel JW Marriott, Medan, kemudian bertemu di


Bocah Tanpa Tangan Menang Kontes Menulis TERLAHIR dengan kekurangan fisik , tidak menghalangi Nicholas Maxim — siswa kelas 5 SD — berkarya dan menerima penghargaan Kontes Menulis Nasional ke-20 di ajang kontes Zaner-Bloser. “Kami menyertakan karyanya karena merasa kagum dengan ketekunannya, mengingat ia menyelesaikan karya itu tanpa mengunakan bantuan alat prostetik,” ujar Cheryl Hasenfus, Kepala Sekolah Dasar Readfield. Lanjut ke hal A2 kol. 2

JAKARTA(Antara): Mabes Polri tidak keberatan Briptu Norman Kamaru, anggota Brimob Gorontalo untuk mengikuti acara salah satu televisi swasta. “Briptu Norman datang ke Jakarta atas undangan Trans 7 dalam acara Bukan Empat Mata (BEM)yang undang Pak Tukul,” kata Kepala Divisi Hubungan Masyarakat (Kadiv Humas) Polri, Irjen Pol Anton Bachrul Alam di Jakarta, Kamis(7/4). Lanjut ke hal A2 kol. 3


Taiwan Desak China Bebaskan Artis Aktivis Ai Weiwei TAIPEH, Taiwan (Antara): Taiwan meminta pada Beijing untuk dengan segera membebaskan artis dan aktivis Ai Weiwei, yang ditangkap sebelum kunjungan yang dijadwalkan ke pulau itu untuk membicarakan pameran. “Dewan Urusan Daratan Rabu (6/4) mendesak pihak China untuk membebaskan Ai Weiwei dan membuat penjelasan yang lebih baik mengenai insiden itu,” kata badan pembuat kebijakan utama Taiwan mengenai China dalam satu pernyataan. Lanjut ke hal A2 kol. 1

NATO, yang disebut sebagai “Perang tidak adil terhadap rakyat kecil di negara berkembang”. “Anda adalah orang yang memiliki cukup keberanian untuk menghentikan tindakan yang salah dan keliru,” tulis Khadafi dalam surat yang dikirim ke Departemen Luar Negeri dan segera diteruskan ke Gedung Putih, menurut seorang pejabat AS yang telah melihat surat tersebut. “Saya yakin bahwa Anda mampu memikul tanggung jawab untuk itu. “Untuk menjaga perdamaian dunia... Persahabatan antara rakyat kita... dan kepentingan ekonomi dan kerjasama keamanan terhadap teror, Anda adalah orang yang tepat untuk mencegah NATO mengurusi Libya untuk selamanya,” tulis Khadafi. Sekretaris pers Gedung Putih, Jay Carney membenarkan bahwa Gedung Putih menerima surat dari Khadafi. Terkait permohonan Khadafi untuk gencatan senjata, Carney untuk saat ini mengabaikan hal itu. Lanjut ke hal A2 kol. 6

erampang Seramp ang - Memang paten la polisi kita - He...he...he...

Shalat Jumat Dimana? Lihat Hal. C5-C8

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

JUMAT, Legi, 8 April 2011/4 Jumadil Awal 1432 H z No: 23470 * Tahun Ke-65

Terbit 28 Halaman (A1-12, B1-8, C1-8) z zHarga Eceran: Rp 2.500,-

Ribuan Massa, Guru Dan Pelajar Demo Aliran Sesat

Pembangunan Gedung Baru DPR Rp1,1 T

Minta Pelaku Dihukum Pancung

SBY Minta Tunda Marzuki Nekat Lanjut

BANDA ACEH (Waspada): Ribuan massa, pelajar tingkat SMP hingga SMU, santri dari sejumlah pesantren di Banda Aceh dan organisasi guru serta organisasi Islam, Kamis (7/4) mendatangi kantor Gubernur Aceh dan Kantor DPRA. Selain minta Pemerintah Aceh memberantas segala penyimpangan aqidah Islamiyah di seluruh wilayah Aceh, mereka juga minta pelaku dihukum pancung. Massa mendesak Gubernur sebagai Kepala Pemerintahan Aceh untuk mengusir semua pelaku penyebar

JAKARTA (Waspada): Rapat konsultasi pimpinan DPR RI memutuskan untuk melanjutkan rencana pembangunan gedung baru DPR RI meski ada penolakan dari dua fraksi lainnya. Keputusan itu tetap diambil meskipun Presiden Susilo Bambang Yudhoyono mengkritik pembangunan itu dan meminta menundanya. “Berdasarkan usulan pengambilan keputusan di rapat konsultasi pimpinan DPR RI, secara mayoritas fraksi-fraksi melanjutkan pembangunan gedung baru,” kata Wakil Ketua DPR RI Anis

ajaran sesat dari kelompok Millata Abraham dan sejenisnya dari bumi Aceh, kecuali mereka secara sadar kembali kepada ajaran yang benar sesuai Al Quran dan Hadist. Massa mulai bergerak dari Masjid Lampriet pukul 08:30 dengan berjalan kaki menuju kantor Gubernur yang berjarak 100 meter dari tempat mereka berkumpul. Massa didominasi pelajar dan guru mengusung poster dan spanduk berisi kecaman terhadap Lanjut ke hal A2 kol 3

Rektor Unsyiah Perintahkan Selidiki Aliran Sesat Di Kampus BANDA ACEH (Waspada): Rektor Unsyiah Prorf. Dr. H. Darni Daud, MA memerintahkan Pembantu Rektor (Purek) III mendeteksi dan menyelidiki aliran sesat yang telah masuk kepada mahasiswa. “Kami sudah perintahkan Purek III menyelidki aliran sesat yang informasinya sudah merambah kalangan mahasiswa di kampus,” ujar Darni Daud kepada wartawan menyikapi informasi adanya mahasiswa yang sudah terpengaruh aliran sesat, Kamis (7/4) di Banda Aceh. Saat ini, kata Darni, penyelidikan

itu sedang didalami terhadap belasan mahasiswa yang ada di Kampus Universitas Syiah Kuala. “Memang sesuai laporan, sudah ada bukti adanya aliran sesat yang mempengaruhi beberapa mahasiswa,” jelasnya. Menurut Rektor Unsyiah ini, aliran sesat itu bukan barang baru di Aceh karena sebelumnya pada tahun 2007, Majelis Permusyawaratan Ulama (MPU) telah mengeluarkan fatwa tentang aliran sesat di Aceh. “Aliran sesat itu bukan hanya Lanjut ke hal A2 kol 7

Matta dalam keterangan persnya usai rapat konsultasi di Gedung DPR RI, Jakarta, Kamis (7/4). Sekjen Partai Keadilan Sejahtera itu menambahkan, dari hasil rapat itu, dua fraksi yakni Fraksi Gerindra dan Fraksi Partai Amanat Nasional menolak untuk diteruskan pembangunan gedung tersebut. “FPAN dan FGerindra tidak setuju untuk diteruskan atau dilanjutkan. Sementara tujuh fraksi seperti FPD, Lanjut ke hal A2 kol 7

SK 44 Terbit, Ratusan Ha Tanah Masyarakat Taput Berubah Status

Waspada/Gito Rolis

RIBUAN massa yang didominasi pelajar, santri, organisasi guru, serta organisasi Islam berunjukrasa minta Pemerintah Aceh memberantas secara tegas segala penyimpangan aqidah Islamiyah di seluruh wilayah Aceh.

TARUTUNG (Waspada): Penerbitan SK 44/2005 tentang kawasan hutan negara di Kabupaten Tapanuli Utara membuat ratusan hektare tanah milik masyarakat Taput berubah status menjadi hutan negara. Kadis Kehutanan Taput Alboin Siregar, kepada Waspada, Kamis (7/4) mengatakan, sedikitnya 101 hektare hutan Taput bertambah masuk kawasan sebelum SK 44/2005. Lokasi itu terdiri dari tanah milik masyarakat, perkantoran pemerintah dan swasta, pemukiman penduduk, gereja, sekolah, pemakaman dan kantor kereside-

nan tapanuli serta bangunan tua yang usianya ratusan tahun masuk jadi kawasan hutan negara SK 44. Ratusan tanah tersebut sampai sekarang masih tetap dikuasai dan diolah masyarakat.Namun yang menjadi persoalan nanti ketika pengurusan sertifikat dan transaksi jual beli mereka akan diperhadapkan dengan SK 44. Alboin menginformasikan, hasil usulan revisi yang direkomendasikan Pemprovsu pada tahun 2010 lalu untuk Taput sekira 59 hektare. “Itu kita tolak, renisi yang kita minta 100 persen,” imbuhnya. (c12)

Rumah Gubernur 40% Calhaj Aceh Dibakar OTK Berusia Lanjut

Kemenag: Tak Prioritas Berangkat, Kecuali Ada Sisa Kuota

BANDA ACEH (Waspada): Rumah milik Gubernur Aceh, Irwandi Yusuf di kawasan Maheng Aceh Besar dibakar OTK (Orang Tak Dikenal), sekira pukul 01:00, Kamis (7/4) dinihari. Menurut Irwandi, OTK menggunakan sebuah mobil, dan satu sepedamotor saat menjalankan aksinya. “Masalah ini sudah saya sampaikan ke polisi,” kata Irwandi kepada Waspada, Kamis pagi. Irwandi mengaku baru mengetahui peristiwa itu satu jam setelah kejadian. Rumah kayu dengan tiga kamar tersebut ludes dilalap api, kerugian ditaksir mencapai Rp500 juta.

JAKARTA (Antara): Kementerian Agama melalui Direktorat Jenderal Penyelenggaraan Haji dan Umroh (PHU) Slamet Riyanto mengatakan, pihaknya tak akan mengeluarkan kebijakan berupa prioritas bagi calon haji pada musim haji 2011 mandatang.

Peralatan yang ikut terbakar di antaranya televisi, perangkat internet serta peralatan dapur. “Masyarakat sempat mengejar pelaku, tapi pelakunya sempat melarikan diri,” ungkap Irwandi. Rumah tersebut, kata Irwandi, berfungsi sebagai tempat musyawarah masyarakat Maheng. Rumah dengan

Kuota haji 2011 untuk haji reguler 194.000 orang, haji khusus 17.000 orang. Riyanto memperkirakan untuk usia lanjut sekitar 40 persen. Jika ada calon haji berusia lanjut 100 r ibu maka akan ada jamaah haji usia muda, dari

Lanjut ke hal A2 kol

dirasuki roh halus yang sudah lama mendiami pekarangan sekolah kami,’’ kata Kepala SMPN1 Lhoksukon, Drs Syarifuddin, kemarin. Terkait kondisi ini, lanjut Syarifuddin, pihak sekolah sudah berulangkali mengundang orang pintar, termasuk dari luar Lhoksukon, guna mengusir roh halus tersebut. Tapi sejauh ini upaya itu belum membuahkan hasil maksimal dan kesurupan masih saja terulang. “Khusus pada saat Ujian Nasional nanti, kami berencana men-standby-kan orang pintar di sekolah, supaya tidak sampai mengganggu proses UN. Sebab jika ada kesurupan, konsentrasi anak-anak pasti terganggu,’’ jelasnya.(cmus)

Motif Pembunuhan Pasutri Persaingan Bisnis Lelang Kapal

Kapoldasu: Dua Tersangka, 7 DPO MEDAN (Waspada): Polisi telah menetapkan dua warga Jakarta sebagai ‘otak’ pelaku pembunuhan terhadap pengusaha ikan di Pelabuhan Belawan, Kho Wie To, 36, dan istrinya Dora Halim, 32. Sedangkan 7 orang termasuk eksekutor masih dalam daftar pencarian orang (DPO). Kedua tersangka Sun An alias Anlang, 50, warga

Komplek Perumahan Teluk Gong 47, RT 02 RW 08 Jakarta Utara, ditetapkan sebagai otak pelaku pembunuhan. Dia ditangkap di Bagan Siapiapi, Asahan. Kemudian Ang Ho, 33, warga Citra 5 Blok D3/12 Kel. Kamal, Kec. Kalideres Jakarta, Barat, ditangkap di Hotel JW Marriott, Medan. Polisi juga telah meminta bantuan NBC/Interpol untuk

melacak keberadaan para tersangka yang diduga sudah melarikan diri ke luar negeri. “Motif pembunuhan suami istri tersebut disebabkan persaingan bisnis,” kata Kapoldasu Irjen Pol. Wisjnu Amat Sastro saat jumpa pers di Mapolresta Medan, Kamis (7/4). Sebelum melakukan pembunuhan, sebagaimana dikatakan Kapoldasu, kedua tersang-

ka dan para eksekutor terlebih dahulu bertemu di Hotel JW Merriott, Medan, kemudian di salah satu hotel di Asahan. Setelah itu, mereka kembali ke Medan dan melakukan pertemuan di Hotel Cambridge. Dari Cambridge, para eksekutor bergerak menuju kediaman korban di Jln. Garu III/ Lanjut ke hal A2 kol 1

BANDA ACEH (Waspada): Prof. Dr. H. Darni Daud, MA membantah mundur dari pencalonan Gubernur Aceh periode 2012-2017, sebagaimana isu yang berkembang di masyarakat. “Sampai sekarang saya belum menyatakan mundur dari calon Gubernur Aceh,” tegas Darni Daud terkait adanya informasi yang diterimanya dari masyarakat, bahwa dirinya mundur dari calon gubernur kepada pers, Kamis (7/4) di Banda Aceh. Dikatakan, bahwa dia orang pertama yang menyatakan mencalonkan diri dan siap maju sebagai Gubernur Aceh sejak tahun lalu, dengan itikat membangun peru-

Oleh: H. Ameer Hamzah Akan Datang suatu zaman manusia berpura-pura alim Keislamannya hanya dinampakkan di masjid saja, tetapi di luar masjid mereka meninggalkan Tuhannya dan mencari iblis sebagai temannya (Prof DR Hamka)

MEDAN (Waspada): Sidang para terdakwa kasus perampokan Bank CIMB Niaga Medan dan penyerangan Mapolsekta Hamparanperak di Pengadilan Negeri Medan, Kamis (7/4) memasuki tahap pemeriksaan saksi. Secara umum para saksi yang dihadirkan Jaksa

JAKARTA (Waspada): Polisi fenomenal, Briptu Norman Kamaru mulai kebanjiran undangan tampil di depan publik. Mabes Polri merestui ‘artis debutan Youtube’ ini untuk menikmati popularitasnya. Norman sudah tampil dan diundang di sejumlah stasiun televise swasta. Mabes Polri merestui aktivitas baru anggota Brimob Gorontalo itu. ‘Kita izinkan,” ujar Kepala Divisi Hubungan Masyarakat Polri Inspektur Jenderal Anton Bachrul Alam, di Markas Besar Polri, Jakarta,

P.SIDIMPUAN (Waspada): Tiga grup band ibukota, Naff, Vagetoz, dan Play Bee Band, ditambah Nadiya Refa Band ‘menggetarkan’ warga Kota Padangsidimpuan lewat ajang Clas Mild Sensasi Hits Sumatera Tour 2011 di kampus III Universitas Graha Nusantara (UGN), Jalan Imam Bonjol,

Lanjut ke hal A2 kol 2

Lanjut ke hal A2 kol 7

Lanjut ke hal A2 kol 3


TERDAKWA kasus terorisme dan perampokan Bank CIMB Niaga Medan, Beben (2 kanan) dikawal petugas kejaksaan usai menjalani sidang lanjutan dengan agenda mendengarkan keterangan saksi, di PN Medan, Sumut, Kamis (7/4).

Sidang Perampokan CIMB

Saksi Tak Kenal Pelaku

bahan. “Jadi saya memberi jawaban sampai saat ini saya belum mundur,” tegasnya. Perubahan yang ingin dilaksanakannya itu, sebut Darni, dari berbagai aspek kehidupan masyarakat termasuk tingkat perekonomian masyarakat, kesehatan, pendidikan keagamaan termasuk pendidikan umum agar masyarakat Aceh terdidik. “Saya tetap maju untuk membawa perubahan yang lebih baik kepada masyarakat,” tegasnya. Hanya saja, aku Darni, sampai saat ini belum ada partai yang mengajaknya untuk dicalonkan sebagai Gubernur Aceh. Lanjut ke hal A2 kol 1

Dana BOS Taput Masuk Rekening Sekolah

Briptu Norman Kebanjiran Talkshow

Zaman Meurenren

Lanjut ke hal A2 kol 2


RUMAH Irwandi rata jadi abu di Maheng, Aceh Besar.

Al Bayan

ZAMAN sekarang zaman edan, kata Bimbo, tetapi almarhum Tgk Ahmad Dewi sering mempelesetkan zaman modern dengan istilah zaman meurenren. Sinonim meureren dalam bahasa Aceh adalah meucuetcuet, meupalet-palet, hana meupat punca, atau dalam

Lanjut ke hal A2 kol 7

Darni Daud Bantah Mundur Dari Calon Gubernur Aceh

Siswi SMPN 1 Lhoksukon Kesurupan Saat Ujian LHOKSUKON, Aceh Utara (Waspada): Tiga siswi kelas III SMP Negeri 1 Lhoksukon kesurupan saat mengikuti ujian akhir semester UAS, Kamis (7/4) sekitar pukul 09:00 pagi. Ke tiga siswi itu Ramayana, 16, dan Desi Safitri, 16, warga Desa Matang Ben Lhoksukon serta Siti Rojan, 16, asal Desa Ceubrek, Lhoksukon. Kendati sempat membuat heboh, peristiwa ini tidak menggagalkan UAS dan sekitar dua jam kemudian, korban kembali pulih setelah dirajah orang pintar. “Kesurupan memang sudah sering terjadi di sekolah ini. Bahkan, pekan lalu korbannya lebih banyak lagi, yakni delapan orang. Kata orang pintar, jiwa mereka

kalangan familinya, sebagai tenaga pendamping. Karena itu ia merasa keberatan jika pihaknya harus mengeluarkan berupa prioritas bagi calon haji usia lanjut.

Waspada/Sukri Falah Harahap

Vokalis Naff, Arda,tampil memukau di hadapan ribuan warga Kota Padangsidimpuan pada Clas Mild Sensasi Hits Sumatera Tour 2011 di kampus III Universitas Graha Nusantara (UGN), Jalan Imam Bonjol, Sihitang, Kamis (7/4).

Konser Tiga Band Asal Jakarta Getarkan Kota P.Sidimpuan

TARUTUNG (Waspada): Manager BOS (Biaya Operasional Sekolah) Dinas Pendidikan Tapanuli Utara Arifin Simamora mengatakan, pada Maret dana BOS untuk semester I Januari–Maret 2011 di Diknas Taput telah direkomendasikan kepada Bank untuk dimasukkan ke rekening masing-masing sekolah. Lanjut ke hal A2 kol 2

Serampang - Beda pendapat presiden dengan dewan janganjangan hanya “trik” saja ! - He.... he....he....

Berita Utama

A2 Siswa SMP, SMA Dan SMK Di Taput Siap Hadapi UN

TARUTUNG (Waspada) : Pelaksanaan Ujian Nasional (UN) untuk tingkat SMA/SMK, SMP negeri dan swasta dan Ujian Akhir Sekolah-Berstandar Nasional (UAS-BN) untuk SD negeri dan swasta akan digelar secara nasional dan serentak. UN SMA/SMK akan dilaksanakan 18-21 April, SMP digelar 25-28 April dan UAS-BN SD pada 10-12 Mei 2011. Persiapan UN dan UAS-BN di Taput untuk tahun 2011 sudah makisimal. “Pembinaan mental siswa telah kita benahi dengan melakukan berbagai kegiatan seperti try out, di sekolah maupun yang dilaksanakan oleh pemkab sejak bulan oktober tahun 2010 hingga menjelang hari H,” kata Kadis DiknasTaput Joskar Lim-bong melalui Kabid Disdakmen Saut Panjaitan, Kamis (7/4) di Tarutung. Katanya, pihaknya optimis bahwa tingkat kelulusan siswa peserta UN dan UAS-BN Taput tahun ini akan meningkat dari tahun-tahun sebelumnya. “Optimisme itu muncul dari bobot kegiatan yang sudah dilaksanakan masing-masing sekolah untukUN dan UAS-BN. Standart nilai kelulusan tahun ini 5,5 dan bidang study diluar UN tidak ada di bawah 4,0 tetap kita hormati dan kita perjuangkan,” kata dia seraya menyebut bahwa kerahasiaan soal/bahan UN/UAS-BN akan dijamin. Tahun ini pelaksanaan UN/UAS-BN berbeda dengan tahuntahun sebelumnya. Dimana nilai Raport siswa juga menjadi syarat pertimbangan untuk penentuan lulus tidaknya peserta UN. Sebab peraturan Mendiknas telah ditetapkan bahwa nilai yang diberikan guru di raport menjadi satu penghargaan. Sehingga bobot raport dalam UN sebesar 40 persen. Nilai raport untuk SMA/SMK yang dinilai di UN adalah pada semester 3,4,dan 5. Untuk SMP sederajat, semester 1, 2, 3 ,4 dan 5. Untuk tingkat SD semesrter 7, 8, 9, 10 dan 11. Menurutnya, bagi peserta UN yang tak lulus ada dua pilihan yang sudah disiapkan pemerintah. Pertama mengulang selama satu tahun dan mengikuti paket A untuk SD, paket B untuk SMP dan paket C untuk SMA/SMK. Dengan ketentuan mengikuti ujian. Panjaitan meminta para pengawas UN/UAS-BN bekerja melakukan pengawasan, jujur, adil agar siswa terbiasa dengan kemampuanya sendiri. Dan kepada para siswa peserta UN diharapkan agar lebih mengoptimalkan waktu yang tersisa untuk mempersiapkan diri menghadapi UN nanti. (c12)

KECAMATAN Huristak termasuk lumbung beras di Kabupaten Padanglawas. Di daerah ini sawah terbentang luas, tanahnya merupakan dataran yang subur, memiliki beberapa sungai, sehingga padi tidak pernah kekurangan air. Tapi itu cerita masa lalu, kini kondisi sudah jauh berubah, karena terjadinya kerusakan hutan/ lingkungan, sehingga tidak ada lagi keseimbangan, maka tidak heran, jika hari sedang hujan kondisi sungai pasti meluap, jika kemarau akan kekeringan. Hal seperti inilah yang menimpa warga Desa Ramba, Gonting Jae, Pulo Gariang, Pasir Lancat Lama, Pasar Lancat Baru, Pasar Bombongan, dan Desa Huristak, Kec. Huristak. Dulu areal persawahan mereka 2.000 hektare, akibat sering irigasi rusak diterjang banjir areal persawahan tidak bisa di airi, ahirnya 500 hektare, dari luasan itu sudah di jadikan pemilik kebun sawit. Kepala Desa Ramba Baginda Hasibuan mengatakan, areal persawahan yang 2.000 ha itu merupakan milik enam desa, dulu hanya menggunakan irigasi tradisi hasil gotong royong petani setiap tahun. Hasilnya cukup memadai, sekitar 5 hingga 6 ton per ha, karena air sungai stabil sangat

jarang terjadi banjir, sehingga sawah tetap memiliki produksi yang normal. Belakangan ini pemerintah membangun irigasi, tapi entah karena konstruksi yang kurang bagus atau faktor lain, petani tidak tahu, namun begitu dibangun, air sungai meluap, bendung alami kerusakan, sehingga air tidak dapat mengairi persawahan. Untuk perbaikan harus menunggu sikap pemerintah setahun dua tahun, ketika itulah areal persawahan banyak yang kekeringan, sehingga petani mengambil kesimpulan mengalihkannya jadi kebun sawit, walaupun hati mereka berat untuk mengalihkannya. Tentang produksi, menurut Hasibuan, sangat menurun jika dibandingkan masa lalu, karena cara pengolahan masih tetap seperti itu, sementara air sering kurang. “Ini otomatis menurunkan penghasilan,” ujarnya. Menurut salah seorang tokoh masyarakat Hamzah Hasibuan, sebenarnya kalau menurut perhitungan dagang, berkebun sawit jauh lebih menguntungkan ketimbang bertanam padi. Tetapi karena sejak masa silam sawah menjadi tumpuan harapan yang diwariskan turun temurun, hingga sekarang kebiasaan itu tidak bisa ditinggalkan. Selain itu warga

ingin tetap ikut berpartisipasi mendukung program nasional, supaya negeri ini tetap menjadi swasembada pangan. Namun kesan warga enam desa itu terkadang Pemkab Padanglawas terkesan kurang mendukung keinginan petani agar daerah itu swasembada pangan. Contohnya Rp300 juta dana APBD 2010 yang digunakan untuk rehap irigasi Aek Parbaungan sebagai sumber air areal persawahan tersebut terkesan sia sia, sebab begitu

selesai dikerjakan sudah rusak, padahal selain APBD petani turut berpartisipasi Rp60 juta. “Diduga rancang bangunan tidak seperti yang dibutuhkan, kemudian pelaksanaan mungkin tidak sesuai dengan bestek, sehingga begitu selesai, terjadi kebocoran di bawah lantai cor bendungan menyebapkan air tidak dapat bertahan, sehingga bangunan itu sia-sia,” ujar Kepala Desa Ramba Baginda Hasibuan. * Syarif Ali Uman

Ribuan Massa ....

hadap aksi mereka,” kata Illiza. Illiza mengatakan, aksi yang dilakukan ini bukan atas nama wakil walikota tetapi dari kesadaran masyarakat dan pelajar se-kota Banda Aceh yang resah akan aliran sesat di Aceh khususnya Banda Aceh. Masyarakat mendesak DPRA menyusun qanun tentang pembinaan dan penguatan aqidah Islamiyah di semua jenjang pendidikan. Dia menambahkan, untuk jajaran penegak hukum segera menindak tegas kelompok Millata Abraham dan nama pengikutnya Mukmin Mubaliq dan sejenisnya yang menyebarkan ajaran sesat, penistaan agama, pendangkalan aqidah, permutadan terhadap siswa, mahasiswa dan masyarakat Aceh. “Kami siap mendukung dan mengawal kebijakan yang telah dan akan dilakukan oleh pemerintah dalam pemberantasan penyebaran aliran sesat oleh kelompok Millata

Abraham,” kata Wakil Walikota Banda Aceh itu. Dalam aksinya massa juga menginstruksikan kepada pemerintah kabupaten/kota agar secara aktif memberantas aliran sesat yang merusak aqidah dan permutadan yang dilakukan kelompok Millata Abraham. Gubernur Aceh, Irwandi Yusuf yang menemui para demonstran di halaman kantornya menyatakan, Pemerintah Aceh telah mengeluarkan Peraturan Gubernur nomor 9 tahun 2011 tanggal 6 April 2011, tentang larangan kegiatan aliran Millata Abraham di Aceh. Para pelaku penyebar aliran itu akan dihukum sesuai aturan perundang-undangan. Irwandi menyebutkan, sanksi yang diberikan kepada pelaku penyebar aliran sesat itu sesuai KUHP, mereka dijatuhi hukuman 5 tahun penjara, yang paling berat sebenarnya mereka akan dihukum oleh rakyat dengan cara di-

asingkan alias diusir. “Kejadian ini merupakan akibat kelalaian kita semua, sekarang kita perlu introspeksi diri terutama orang tua, tokoh masyarakat, dan ulama tentang pengawasan terhadap anak-anak dan penguatan aqidah islam,” ujar Gubernur. Pemerintah Aceh dan pemerintah kabupaten/kota selanjutnya berupaya merehabilitasi dan melakukan pembinaan terhadap siswa, mahasiswa dan masyarakat yang telah menjadi korban aliran sesat secara khusus dan intensif. Sementara aktivitas sekolah mulai dari tingkat SD, SMP, hingga SMU di Banda Aceh diliburkan. Para pelajar dan para guru dikerahkan untuk mengikuti unjukrasa besarbesaran itu. Selama aksi yang berlangsung hingga pukul 12:00 sempat memacetkan arus lalulintas sepanjang jalan T Nyak Arif dan Daud Beureueh. (gto/b32)

Konser Tiga Band ....

Sihitang, Kamis (7/4). Ribuan kawula muda dan orangtua larut dalam tembang-tembang vokalis band tersebut. Sekitar 75 personel Polri, TNI, Satpol PP, dan ditambah 40 petugas keamanan kampus dikerahkan untuk mengamankan lokasi. Group band Play Bee menjadi pembuka dalam pagelaran ini. Tampil dengan busana casual, group band ini berhasil menaikkan semangat penonton. Penonton yang memenuhi bagian depan panggung terlihat sangat terhibur, walaupun lagu-lagu yang dibawakan belum begitu familiar bagi mereka. Usai Play Bee, panitia menampilkan Vagetoz dengan lima lagu hitsnya. Lagu ‘Keha-

diranmu’ sebagai tembang pembuka membuat penonton makin histeris. Apalagi saat Teguh Permana sang vokalis, muncul di atas bus yang berada di samping panggung. Vagetoz mendapat sambutan luar biasa dari penonton, khususnya para wanita. Saat menyanyikan lagu ‘Saat Kau Pergi’, Teguh sempat bercerita tentang makna lagu ini dan mengungkapkan keinginannya mendapatkan seorang gadis Padangsidmpuan sebagai cantolan hati. Ditutup dengan lagu BAM (Betapa Aku Mencintaimu), Teguh mencoba mengajak para penonton untuk ikut bernyanyi. Hasilnya, para penonton tidak berhenti bernyanyi mulai dari awal syair hingga sayair terkhir.

Teriakan penonton masih menggema, terutama saat Naff yang paling ditunggu-tunggu hadir menyanyikan single album yang dulu dan terbaru. Penampilan Ardan, sang vokalis baru Naff sangat ditunggu para penonton wanita, apalagi Arda memiliki wajah ganteng dan ditengah penampilan mendapat peluk cium dari seorang penonton wanita. Naff membuka penampilannya dengan lagu terbaru ‘Tak Butuh Jawaban’. Penonton begitu terpukau, saat Arda mendendangkan lagu itu dari atas bus di samping panggung. Waktu menyanyikan ‘Kau Masih Kekasihku’, Naff berkolaborasi dengan fashion dance. Konser Clas Mild Sensasi Hits Sumatera Tour ditutup dengan lagu terbaru Naff yang

saat ini sedang booming ‘Dosa Apa’ dan mendapat aplaus penonton. Seluruh lagu itu turut dinyanyikan penonton. Rektor UGN Prof Ir Erwin Masyrul Harahap berterimakasih karena kampus III perguruan tinggi yang kini berjuang untuk mendapatkan status negeri itu dijadikan sebagai tempat pelaksanaan Clas Mild Sensasi Hits Sumatera Tour 2011. Kapolres Padangsidimpuan AKBP Andi Syahriful Taufik mengaku sangat bersyukur kesuksesan konser ini karena sejak awal hingga akhir penampilan artis ibukota ini situasi kemananan dan ketertiban tetap kondusif. (a27)

Penuntut Umum ( JPU) di persidangan mengaku tidak kenal dengan terdakwa, hingga tidak bisa menjelaskan sejauhmana keterlibatan para terdakwa. Seperti sidang terdakwa Beben, dua Kepling di Kec. Medan Sunggal yang jadi saksi mengaku tak mengenal terdakwa dan tidak tahu siapa pelaku perampokan di Warnet Yaunet Sunggal miliki Kalpin. “Saya tidak tahu siapa pelaku perampokan itu pak hakim, “ kata Kepling Lingkungan XII Azwansyah menjawab majelis hakim Karto Sirait, JPU, dan Tim Advokasi terdakwa Mahmud Irsad Lubis. Bahkan, Azwansyah mengaku tidak melihat peris-

tiwa itu. Hal serupa disampaikan Kepling Lingkungan XI, Isniyanti. Ia mengaku saat kejadian tidak berada di tempat. “Saya tahu peristiwa itu dari warga beberapa hari kemudian,” ujarnya. Menurut JPU dan kuasa hukum terdakwa, pertanyaan itu diajukan kepada saksi karena selain didakwa kasus perampokan CIMB dan penyerangan ke Mapolsekta Hamparan perak, Beben juga dituduh terlibat perampokan Warnet di Sunggal. “Jadi pemeriksaan perkara terdakwa ini diawali dari perampokan warnet itu baru mengarah ke CIMB dan Hamparanperak, “ tegas Mahmud Irsad. Namun, tambah Irsad, ke-

terangan saksi tidak ada yang komperensif. “Kalau semua saksi keterangan seperti ini kami yakin, klien kami bebas, sebab tidak ada yang mengetahui siapa pelaku perampokan itu,” tegasnya. Sementara pada persidangan terdakwa Surpriyadi, JPU Nilma menghadirkan saksi anggota Polsekta Hamparanperak Bripka M Barimbang.”Saya menyaksikan peristiwa penyerangan itu karena saat itu saya piket pak,” kata Barimbing. Barimbing menjelaskan, sekitar pukul 12:30, enam sepeda motor amsing-masing ditumpangi dua orang. Jumlah keseluruhaan pelaku 12 orang membawa senjata api laras panjang. Namun, saksi mengaku tidak kenal dengan pe-

laku karena mereka saat beraksi memakai sebo (penutup wajah). Menjawab Majelis hakim diketuai Ahmad Guntur , JPU dan Tim Advokasi terdakwa Barimbing mengaku tidak tahu apa motif dari penyerangan itu. “Pastinya akibat dari peristiwa banyak anggota yang trauma dan mengusulkan pindak tugas,” tegasnya. Usai mendengarkan keterangan saksi, sidang dilanjutkan minggu depan. Selain kedua terdakwa di atas, Majelis Hakim PN Medan juga menggelar sidang sejumlah terdakwa seperti Marwan alias Wakgen dan Nibras. Agendanya ada yang eksepsi ada juga pemeriksaan saksi. (m49)

Kehidupan sebagian manusia modern mirip seperti itu, mereka bingung, resah dan gelisah. Jabatannya ada, hartanya banyak, apa juga yang membuat hatinya resah? Rupanya ada yang hilang dari kepribadian mereka. yakni kemanusiaannya yang fitri. Zaman modern (meurenren) telah menyesatkan mereka ke lembah-lembah yang sangat rendah, ke relung-relung duniawi yang sangat hitam.

Kecuali orang-orang yang mendapat hidayah dari Allah yang selamat. Lembah pertama adalah perempuan tabarruj (pelacur, artis yang mendedah aurat). Tingkah mereka merusakkan akhlak bangsa. lembah kedua, harta yang dikumpulkan secara haram (korupsi, mencuri, merampok, ribawi, risywah), sumber haram dapat menutup sinar keimanan. Lembah ketiga jabatan yang diraih secara haram (sogok, menohok teman seiring, menipulasi suara dalam pemilu, merusakkan demokrasi). jabatan

haram akan menghasilkan kepemimpinan yang curang. Relung-relung duniawi yang menyesatkan mereka adalah terjangkit penyakit wahan (cinta dunia dan takut mati). malas beribadah, sombong kepada Allah dan manusia, menghardik anak yatim dan enggan memberi makan fakir miskin. Mereka tidak lagi menemukan kebahagiaan lewat jalur agama, tetapi mereka dapatkan kebahagiaan semu di tempat-tempat hiburan, dansa, nonton aurat, bahkan tingkat bercumburayu dengan wanita

yang tidak halal baginya. Itulah yang disebut oleh Allah dalam Surah al-Alaq ayat 6—7: Jangan begitu: Sesungguhnya manusia itu sungguh keterlaluan, yaitu memandang dirinya serba kecukupan. Jadi; harta dan jabatan yang diperoleh secara illegal akan membawa akibat kepada yang bersangkutan. Hati-hati dengan zaman meurenren ini, jangan sampai tersesat dalam lembah-lembah dan relungrelung yang tidak jelas jalan keluar.

Hutan Taput Aman Dari Illegal Logging

TARUTUNG (Waspada) : Walau banyak kritikan dari berbagai elemen masyarakat terhadap Dinas Kehutanan Pemkab Taput yang dituding lalai dalam tugas pengawasan hutan terkait adanya penebangan liar atau illegal logging, tidak membuat Kadis Kehutanan Taput mundur dari mata publik. Kadis Kehutanan Pemkab Taput Alboin Siregar, Kamis (7/ 4) di Tarutung menyebutkan tidak ada penebangan liar di areal hutan Taput. Hutan di Taput aman dan terkendali dari perbuatn illegal logging. Yang ada penebangan di Taput, kata Alboin, adalah hutan milik masyarakat dengan izin IPKTM (Izin Penguasaan Kayu Tanaman Masyarakat) yang diterbitkan Bupati Taput. (c12)

Kapoldasu: ....

Jln. Akasia I No. 50 Lingkungan VII Kelurahan Durian, Medan Timur, dan membunuh Kho W i e To d a n D o r a Ha l i m dengan cara menembak hingga berkali-kali dengan senjata api. Dijelaskan Kapolda, dari 7 calon tersangka, seorang di antaranya A Cui alias Halim Winata alias Jeckson, 36, diketahui pengusaha UD Malindo Thai Pelabuhan Perikanan Sumatera. “Kediamannya di Kampung Gusti, Jakarta Utara dan Jalan Pinus Cemara Asri Medan telah dicekal agar tidak melarikan diri. Kepolisian juga telah bekerjasama dengan

Darni Daud ....

Karena itu, dia berharap ada partai yang mau meminangnya sebagai calon gubernur. Sebab Darni hendak maju sebagai calon gubernur melalui partai politik. “Kita harap mereka (parpol) mau mendukung kita sebagai calon gubernur,” tandasnya. Soal siapa wakil gubernur, Darni mengatakan tidak bisa menyebutkan saat ini. “Pasangan sebagai wakil gubernur nantilah,” kilahnya. Namun ia menyatakan kriteria Wagub yang akan mendampinginya h a r u s o ra n g y a n g d e k a t dengan masyarakat. (b04)

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport.

1. ......., Bxh2+. 2. RxB, Ke3+. 3. Rg1 atau Rh2, Mg2+mat.

Jawaban TTS: TTS Topik

Mimbar Jumat


1 9 3 4 8 6 7 2 5

6 7 5 2 1 9 4 8 3

3 6 4 9 2 8 5 7 1

5 1 8 7 6 4 9 3 2

9 2 7 1 3 5 6 4 8

8 4 9 3 5 1 2 6 7

Dana BOS Taput ....

Pencairan BOS tahap II, April-Juni, tahap III Juli-September dan tahap IV OktoberDesember juga akan dicairkan dengan sistem yang sama. Kata Arifin, tidak ada lagi alasan kepala sekolah tidak mencairkan dana BOS tersebut. “Itu belum terlambat. Penggunaan dana BOS agar benar-benar dilaksanakan sesuai dengan tujuanya di sekolah,” imbuh dia tanpa merinci berapa jumlah dana BOS untuk Taput tahun ini. (c12)

F A H L A A L AQ A L AH I U Z B U L Zaman Meurenren .... L bahasa Indonesia disebut A kusut. Misalnya benang kusut L A H atau tali kusut.

Jawaban Sudoku: 4 8 2 5 7 3 1 9 6

NCB (National Central Bureau). Selain itu yang menjadi DPO terkait kasus tersebut di antaranya Kepala RT Sinaboi Bagan Siapiapi, anak Sun An yakni Tony (pengantar eksekutor),” sebut Kapolda. Barang bukti yang sudah diamankan, di antaranya mobil Toyota Innova, 4 helm, 7 selongsong senjata kaliber 45, 20 selongsong kaliber 5 milimeter, 10 serpihan proyektil, rekaman CCTV dari Hotel JW Marriott, hotel di Asahan dan Cambrigde. Motif penembakan, sebagaimana dijelaskan jenderal berbintang dua itu karena persaingan bisnis ikan dan kapal ikan di Belawan. Kapoldasu kemudian mengimbau 7 DPO agar menyerahkan diri, sebab cepat atau lambat mereka pasti ditangkap. Ditanya apakah para eksekutor dibayar dengan uang Rp50 juta per orang, Kapoldasu menjawab “begitu lah kira-kira”. (m27/m39/h04)

Saksi Tak Kenal ....

Jawaban Problem Catur:

2 5 6 8 4 7 3 1 9

7 3 1 6 9 2 8 5 4

Huristak Sebagai Lumbung Beras Kini Tinggal Kenangan

aksi pemurtadan dan pendangkalan aqidah. Bahkan mereka memekikkan hukum pancung bagi pelaku penyebaran aliran sesat. Penanggungjawab kegiatan, Ramli Rasyid yang juga Ketua PGRI Aceh, dalam orasinya mengatakan aksi yang dilakukan bukanlah atas perintah dinas maupun pemerintah kota, tapi dari kegelisahan seluruh masyarakat dan elemen lainnya. “Kami minta aparat penegak hukum memberi hukuman seberatberatnya bagi para penyebar aliran yang menistai agama Islam,” ujarnya. Wakil Walikota Banda Aceh, Illiza Sa’aduddin Djamal yang juga turun dalam aksi tersebut mengatakan, kami mengutuk dan menentang keras segala bentuk pemurtadan dan penistaan terhadap agama Islam yang dilakukan aliran Millata Abraham. Ini bentuk keresahan kami ter-

Waspada/Syarif Ali Usman

Seorang warga Desa Gonting Jae memperhatikan bendungan di Sungai Aek yang belum berfungsi di Desa Ramba, Kec. Huristak.

** ** **

WASPADA Jumat 8 April 2011

SBY Minta ....

Namun, Marzuki menegaskan pihaknya masih akan mengkaji ulang besaran biaya pembangunan yang ditaksir Rp1,1 triliun. “Kita sepakati, menanyakan Kementerian Pekerjaan Umum (PU) dalam konteks mahal atau tidak kita tanya Kementerian PU, apakah rencana kita sangat mahal, mahal sudah optimal apa cukup murah,” pungkasnya. (ant/ini/okz)

40% Calhaj ....

Alasannya, kata Slamet, jika ada calon haji usia lanjut dapat prioritas berangkat, maka tentunya membawa konsekuensi yaitu adanya tambahan calon haji usia muda sebagai tenaga pendamping bagi calon haji berusia lanjut. Hanya saja, lanjut dia, jika ada sisa kuota nasional —yang biasanya terjadi setiap tahun— sekitar 2 ribu orang, maka akan didistribusikan ke daerah dengan catatan bahwa yang menjadi prioritas adalah bagi calon jamaah haji yang belum pernah menunaikan ibadah haji dan berusia lanjut. Dan mekanismenya pun diatur sedemikian rupa tanpa mengganggu calon haji yang sudah masuk dalam daftar tunggu, katanya.

Rumah Gubernur ....

kerjasama Pemerintah Aceh, Yayasan Sambinoe, dan Badan Narkotika Nasional. Sementara itu Kepolisian Aceh Besar masih menyelidiki kasus tersebut. “Tujuan dibakarnya rumah itu agar publik menyalahkan Ketua KPA Aceh Besar, Tgk Muharam yang dipecat oleh Pimpinan KPA Pusat Muzakir Manaf pada Rabu (6/4) siang. Saya tahu bukan Muharam pelakunya,” ungkap Irwandi. (b32)

Rektor Unsiyah ....

deteksi lebih awal. Unsyiah mendorong semua pihak, MPU dan pemerintah daerah untuk memberi perhatian serius terkait aliran sesat ini. Menurut Darni, dalam menyikapi aliran sesat ini tidak bisa saling menyalahkan karena semua orang punya tanggungjawab dan peran masingmasing. “Jadi kalau ada orang yang sudah sesat kita luruskan, kalau berdampak hukum ya diproses hukum,” tuturnya lagi. Orang yang terpengaruh aliran sesat tersebut, sebut Darni, ada kemungkinan memang pengetahuannya tentang agama sangat kurang sehingga dengan mudah terpengaruh, apalagi diimingiming uang.(b04)

Briptu Norman ....

Nor man ditunjukan lagi melalui bidang tarik suara. Video dirinya bersama rekan polisinya berduet menyanyikan lagu, tersebar juga di dunia maya. Semula ia akan diberi sanksi karena aksinya itu, apalagai ia memperlihatkan lidahnya yang ditindik. Na m u n , p u b l i k m e n e n tangnya dan memberikan dukungan moral untuk Norman. Tanpa dikomando, aktivis Fa c e b o o k m e n g g a l a n g dukungan sejuta Facebookers mendukung agar Norman tidak dikenai sanksi. Akhirnya, sanksi adminsitratif yang akan dikenakan kepadanya batal. Ia hanya dikenai sanksi berupaya bernyanyi dan berjoget India di hadapan rekanrekannya di halaman Markas Brimob Gorontalo. (ini)

Fraksi Partai Golkar, Fraksi PDIP, Fraksi PKB, Fraksi PPP, Fraksi PKB dan Fraksi Partai Hanura setuju,” kata Anis. Sementara itu, Ketua DPR, Marzuki Alie, mengatakan keputusan rapat konsultasi sudah final sehingga tidak bisa lagi dibatalkan. “Rapat konsultasi memutuskan persoalan gedung tidak akan dibawa ke rapat paripurna,” jelasnya. Jamaah haji yang sudah mendaftarkan diri tetap ikut mekanisme yang sudah ada. Tak ada prioritas, misalnya usia lanjut diprioritas lebih awal berangkat menunaikan haji, kata Dirjen Riyanto di Jakarta, Kamis (7/4). Ia mengatakan, jika ada prioritas bagi yang sudah mendaftar, apa lagi untuk usia lanjut, maka akan merusak sistem. Konskuensinya tentu pada calon jemaah haji yang sudah masuk daftar tunggu. “Kita tak ingin merusak sistem yang sudah ada,” kata Slamet, yang didampingi Direktur Pengelolaan Dana Haji Ahmad Junaedi dan Kasubdit Dokumen Haji Sri Lubis. kontruksi pohon kelapa itu juga pernah didatangi Wali Negara Hasan Tiro. Selain digunakan Irwandi bersama pimpinan KPA/PA untuk rapat, rumah tersebut terakhir digunakan oleh konsultan yang sedang membuat perencanaan pembangunan kawasan Maheng menjadi kawasan Agrowisata. Program pembangunan kawasan Maheng ini adalah

terjadi di satu daerah, tapi juga masuk ke sejumlah daerah seperti kemarin ada di Aceh Barat, kemudian Bireuen dan Aceh Tengah,” sebut Darni yang minta masyarakat berhati-hati menyikapi hal tersebut. Adanya kasus-kasus aliran sesat itu, Darni minta jangan diselesaikan secara emosional tapi disikapi dengan tenang sehingga tidak menimbulkan masalah baru. Juga langkah preventif bagi yang belum terpengaruh dengan aliran sesat itu. Ke depan, katanya, pihak Unsyiah akan memberi pencerahan lebih kritis terhadap pemahaman agama sehingga aliran-aliran sesat itu bisa ter-

Kamis (7/4). Anton menjelaskan, pada prinsipnya tidak ada pelanggaran disiplin dan kode etik profesi yang dilanggar Norman. Aksinya unjuk kebolehan menyanyi dan menari India melalui rekaman video, dinilai sebagai bakat seni yang bernilai positif. Jika kini Norman menjadi populer dengan aksinya tersebut, maka Polri turut memberikan apresiasi. “Yang jelas polisi punya bakat-bakat seperti itu disalurkan, kan bisa menghibur masyarakat,” kata Anton. Sebagaimana diberitakan, rekaman video Briptu Norman Kamaru berjoget India di pos penjagaan polisi, beredar luas di dunia maya. Aksinya itu begitu menggelitik dan menghibur masyarakat. Tak hanya itu, kebolehan

Berita Utama

A2 Raker Dan Silaturahim KAMUS MEDAN(Waspada): Keluarga Abituren Musthafawiyah (KAMUS) menyelenggarakan rapat kerja (raker) pengurus pusat sekaligus pelantikan dan silaturahim akbar di kompleks Pesantren Al-Kautsar Al-Akbar pimpinan Tuan Syech H. Ali Akbar Marbun Jalan Pelajar Ujung, Minggu (10/4). Ketua Umum DPP Kamus DR HM Roihan Nasution, Lc, MA didampingi sekretaris umum Muhammad Nuh Siregar, S.Ag, MA, Lagut Sutan Pulungan, Drs. Irwan Sakti Lubis, Sakban Lubis,S.HI, MA, Juliana Siregar, Amd, Musliadi Nasution, Erwinsyah Lubis, S.HI, dan unsur panitia lain mengatakan raker dan silaturahim nanti mengundang sejumlah tokoh nasional dan pejabat di Sumut, termasuk mudir ponpes Musthafawiyah H. Mustafa Bachri Nasution. Dari kalangan abituren Musthafawiyah, seperti Prof.

DR. HM. Yasir Nasution, Prof. DR. H. Abbas Pulungan, MA, Prof. DR. H. Pagar Hasibuan, MA, DR. H. Maratua Simanjuntak, Drs. H. Imron Hasibuan, Drs H Ali Jabbar Napitupulu dll. Menurut Roihan Nasution, segala sesuatu yang berkaitan dengan pelantikan dan rapat kerja KAMUS telah dipersiapkan dengan matang, dan undangan telah disebarkan kepada seluruh pengurus wilayah provinsi dan kabupaten kota se-Indonesia. Walikota Medan Rahudman Harahap sudah menyatakan akan hadir pada saat panitia beraudiensi diterima Sekda Kota Medan Ir. Saiful Bahri Lubis didampingi Asisten Kessos Drs. H. Musadad Nasution . ‘’Tujuan kegiatan ini adalah untuk mempererat rasa persaudaraan (ukhuwah Islamiyah) di antara sesama abituren sesuai program kerja KAMUS,” ujar Nasution. (m03)

Taiwan Desak ...

dijadwalkan,” kata Lu. Ai telah merencanakan untuk bertemu dengan pembantunya di Hongkong sebelum terbang ke Taipei, menurut Lu. Ai — sangat terkenal di Barat sebagai seorang perancang stadion Olimpiade Bird‘s Nest yang ternama di Beijing — ditahan Minggu di bandara internasional Beijing saat ia bersiap untuk naik penerbangan ke luar negeri, kata isterinya. Stafnya mengatakan dia akan ke Hongkong. Polisi Beijing menolak berkomentar mengenai penahanannya, yang terakhir dalam tindakan keras yang meluas terhadap perbedaan pendapat di China.

“Tuntutan rakyat China pada kebebasan, demokrasi, hak asasi manusia dan pembaruan sekarang meningkat dan kami mendesak pemerintah daratan untuk menghadapi dan menghormati hal itu,” katanya. Ai, yang akan mengadakan pameran solo di Taiwan pada November mendatang, telah diharapkan akan menemui para kurator di Taipeh Fine Arts Museum Rabu, kata Lu Li-wei, jurubicara museum itu. “Pertemuan itu batal karena kami tidak dapat berhubungan dengannya setelah penangkapannya, tapi pameran tersebut akan berlangsung seperti yang

BI Larang ... Difi menjelaskan, meski Citibank diharuskan menghentikan ekspansi sementara, namun pelayanan untuk nasabah lama tetap dibuka. Langkah pembekuan itu, menurut dia, merupakan prosedur standar yang dilakukan BI jika produk suatu bank mengalami masalah. Bank Indonesia sendiri saat ini mempercepat pemeriksaan terkait kasus tersebut. BI juga akan mengevaluasi sistem maupun praktik penagihan yang menggunakan pihak ketiga. Kepala Bidang Humas Polda Metro Jaya, Komisaris Besar Baharudin Djafar menjelaskan, penanganan perusahaan debt collector alias penagih utang berada di bawah Bank Indonesia, bukan kepolisian. BI lah yang memberi izin penggunaan debt collector.

Hermes Place ... “Makin dekat dengan Bandara bangunan harus lebih pendek agar tidak terganggu pergerakan penerbangan di kawasan itu,” ujarnya. Razali menyesalkan Badan Lingkungan Hidup tidak pernah menyertakan Adban dalam analisa mengenai dampak lingkungan (Amdal) terhadap setiap bangunan mewah yang akan didirikan, termasuk Hermes Place Polonia dan CBD. Misalnya, pembangunan pertokoan Central Bussines Distrik (CBD) di eks Lapangan Golf

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 2. RxB, Ke3+. 3. Rg1 atau Rh2, Mg2+mat.

Jawaban TTS: Mimbar Jumat



Jawaban Sudoku: 4 8 2 5 7 3 1 9 6

1 9 3 4 8 6 7 2 5

6 7 5 2 1 9 4 8 3

3 6 4 9 2 8 5 7 1

5 1 8 7 6 4 9 3 2

9 2 7 1 3 5 6 4 8

8 4 9 3 5 1 2 6 7

2 5 6 8 4 7 3 1 9

Polonia, jika diteliti, proyek itu berdampak dan terkait dengan bandara dan keselamatan penerbangan. “Seharusnya Adban dilibatkan dalam proses Amdal sehingga bangunan yang akan didirkan dapat dianalisis terutama melanggar KKOP atau tidak,” ujarnya. Untuk Hermes Place Polonia, lanjutnya, mungkin saat ini belum terganggu terhadap penerbangan karena bangunan itu belum selesai. “Begitupun pihaknya segera cek ke lokasi bangunan,” ujarnya. Bahkan melalui Camat, Lurah dan Kepling dia sudah mengingatkan, pemilik bangunan-bangunan diseputar Bandara Polonia Medan khususnya pada ujung runway 023 bagian utara Bandara harus dipatuhi ketentuan tinggi minimal hanya 10 meter. (m32)

Bocah Tanpa ...

1. ......., Bxh2+.

TTS Topik

Sayangnya, menurut Baharudin, Bank Indonesia belum memberikan aturan yang tegas bagi debt collector. “Padahal, sewaktu-waktu debt collector dapat mengancam nasabah,” kata dia. Debt collector, lanjut Bahadurin, merupakan penagih utang yang diberi mandat penagihan melalui surat edaran Bank Indonesia. “Ini hanya perdata.” Namun, urusan itu akan berubah menjadi domain kepolisian bila si penagih utang melakukan tindakan pidana, seperti mengancam, merusak, memukul, dan menganiaya. Baharudin juga menjelaskan, hingga kini kepolisian akan terus melakukan perlindungan masyarakat dari ancaman kekerasan debt collector. Kepolisian juga akan memburu pelaku penganiayaan. “Kami akan mengusut, seperti kasus Irzen Octa,”katanya.(vvn)

7 3 1 6 9 2 8 5 4

Nicholas menulis dengan cara menjepit pulpen atau pensil menggunakan lengan bagian atas dalam mengerjakan karyanya. Atas nama Zaner-Bloser, penyelenggara dan pihak pendidik, Hasenfus menyerahkan piala kepada Nicholas dalam sebuah acara di tempat ia bersekolah di Readfield, Maine, AS. Terinspirasi oleh kemampuannya, Zaner-Bloser memutuskan untuk menambah kategori penghargaan baru dengan namanya: Nicholas Maxim Special Award for xcellent Penmanship. “Saat tim kami melihat karya tulis Nicholas, kami langsung merasa kagum,” ujar Presiden Zaner-Bloser, Bob Page. “Sejak kami memulai penyelenggaraan kontes ini 20 tahun lalu, kami merasa senang karena mendapat respon yang kian baik dari tahun ke tahun, dan Nicholas telah menginspirasi kami untuk mendorong semua siswa ikut berpartisipasi.” Lebih dari 200.000 siswa tengah menunggu pengumuman hasil dari kontes ini. Para pemenangnya akan diumumkan di Konvensi Tahunan Asosiasi Membaca Internasional pada 10 Mei mendatang di Orlando, Florida. Zaner-Bloser memperkirakan lebih dari 2,5 juta siswa telah ikut kontes ini sepanjang penyelenggaraannya. (cnn/rzl)

WASPADA Jumat 8 April 2011

Abang Adik Tewas Tenggelam Di Kolam Tulang Manusia Di Laudah Kabanjahe MEDAN (Waspada): Dua bocah abang adik, Hiskia, 3, dan Cindy, 2, warga Jalan Delitua, Gang Karya, Dusun II, Desa Baru, Kec. Pancurbatu, Deliserdang, tewas tenggelam di bekas kolam ikan di samping rumah, saat kedua orang tua mereka pergi mencari nafkah, Kamis (7/4). Menurut keterangan di lokasi peristiwa, korban pertama ditemukan adalah mayat bocah perempuan Cindy terapung di bekas kolam ikan itu, ketika keluarga korban mencari keberadaan keduanya sekira pukul 11.00. Warga sekitar yang mengetahui segera menuju lokasi dan mencari Hiskia- abang Cindyyang tidak kelihatan setelah

dicari kemana-mana. Lalu, warga melakukan pencarian ke dalam kolam dan menemukan tubuh Hiskia di dasar kolam sudah tidak bernyawa. Selanjutnya, kedua korban dievakuasi ke Puskesmas. Menurut para tetangga, ibu korban Juna Padang, 30, saat kejadian sedang mencari barang bekas diTPA Pembuangan Sampah Desa Namobintang, Pancurbatu, untuk dijual guna memenuhi kebutuhan keluarga. Ayah kedua korban Jati Sinulingga sudah sepekan berada di Tanah Karo bekerja sebagai buruh bangunan. Kelfin Simanjuntak, tetangga korban mengatakan, setiap hari kedua anak tersebut diti-

tipkan ibunya kepada tetangga termasuk kepada dirinya. “Dia memang dititipkan sama saya, tapi tadi saya sempat tinggal sebentar untuk menjemput anak sekolah. Saat saya pulang, kedua anak itu tak saya lihat lagi, padahal sudah saya pesankan sama Hiskia tidak pergi jauh-jauh,” ujar Kelfin. Kapolsek Pancurbatu AKP M Budi Hendrawan, Sik didampingi Kanit Reskrim AKP Faidir Chaniago, SH yang turun ke TKP saat dikonfirmasi membenarkan tewasnya kedua anak tersebut. “Kita masih melakukan penyidikan atas tewasnya kedua anak yang masih balita tersebut,” ujar Budi. (m40)

Serangan NATO Tewaskan 5 Pemberontak Libya AJDABIYAH, Libya (Waspada): Sebuah serangan udara NATO menewaskan sedikitnya lima pemberontak Libya di dekat pelabuhan Brega, Kamis (7/4), ungkap para petugas medis. Selain itu, milisi juga melaporkan pasukan pro-Khadafi menewaskan lima orang lainnya di kubu pemberontak lewat sebuah serangan bombardir dekat Misrata. Sumber Reuters melaporkan, para pemberontak yang terluka dibawa ke rumah sakit di Ajdabiyah, Libya timur. Diungkapkan para pemberontak, mereka terkena serangan udara pada Kamis di luar lokasi pelabuhan yang diperebutkan. “Itu adalah serangan udara NATO terhadap kami. Saat itu kami berada di dekat kendaraan sekitar wilayah Brega,” tegas salah seorang pemberontak yang

terluka, Younes Jumaa. Salah seorang perawat, Mohamed Ali mengatakan, sedikitnya lima pemberontak tewas. “NATO adalah pembohong. Mereka memihak Khadafi,” ujar Salem Mislat, salah satu anggota pemberontak. Belum ada komentar segera dari NATO

Norman Tampil ...

sah-sah saja. “Pemeriksaan terhadap Norman sudah dilakukan dan ternyata itu dilakukan di luar jam dinas,” katanya. Video bertajuk Polisi Gorontalo Menggila diunggah ke Youtube, 29 Maret silam. Video tersebut telah dilihat oleh lebih setengah juta pengguna internet. Dalam video tersebut, Norman tampak sedang asik berjoget dan membawakan lagu India di penjagaan.

Hal ini meluruskan berita sebelumnya beredar bahwa kedatangan Norman ke Jakarta untuk menghadap Kapolri, Jenderal Pol Timur Pradopo. “Jadi Norman datang ke sini bukan menghadap Kapolri, tapi diundang Trans 7 dan silahkan saja, Mabes Polri tidak keberatan,” kata Irjen Anton. Anton mengatakan, aksi yang dilakukan Norman tidak pada saat jam dinas sehingga

2 Tersangka, ... kediaman korban di Jln. Garu III/Jln. Akasia I No. 50 Lingkungan VII Kelurahan Durian, Medan Timur, dan membunuh Kho Wie To dan Dora Halim dengan cara menembak hingga berkali-kali dengan senjata api. Dijelaskan Kapolda, dari 7 calon tersangka, seorang di antaranya A Cui alias Halim Winata alias Jeckson, 36, diketahui pengusaha UD Malindo Thai Pelabuhan Perikanan Sumatera. “Kediamannya di Kampung Gusti, Jakarta Utara dan Jalan Pinus Cemara Asri, Medan telah dicekal agar dia tidak melarikan diri. Selain itu yang menjadi DPO terkait kasus itu di antaranya Kepala RT Sinaboi Bagan Siapiapi, anak Sun An yakni Tony selaku pengantar para eksekutor,” sebut Kapolda. Mengenai barang bukti yang sudah diamankan, di antaranya mobil Toyota Innova BK 1840 DP, mobil Chevrolet Captiva BK 333 TO, 4 helm, 7 selongsong kaliber 45, 20 selongsong kaliber 9 milimeter, 10 serpihan proyektil, rekaman CCTV dari Hotel JW Marriott, hotel di Asahan dan Cambrigde. Motif penembakan, sebagaimana dijelaskan jenderal bintang dua itu, karena persaingan bisnis ikan dan kapal ikan di Pelabuhan Belawan. Dikatakan, tersangka A Cui alias Halim Winata (DPO) dan tersangka Sun An alias Anlang sakit hati kepada keluarga Sarwo Pranoto (orangtua korban) ka-

mengenai hal tersebut. Ini merupakan kedua kalinya dalam kurun waktu seminggu, pihak pemberontak menyalahkan NATO atas kesalahan pemboman atas rekan mereka. 13 orang tewas terkait serangan udara oleh NATO di wiliyah yang sama pada Sabtu lalu. (rtr/rzl)

Rumah Gubernur Aceh Dibakar OTK BANDA ACEH (Waspada): Rumah milik Gubernur Aceh, Irwandi Yusuf di kawasan Maheng, Aceh Besar dibakar OTK (Orang Tak Dikenal), sekira pukul 01:00, Kamis (7/4) dinihari. Menurut Irwandi, OTK menggunakan sebuah mobil, satu sepedamotor saat menjalankan aksinya. “Masalah ini sudah saya sampaikan ke polisi,” kata Irwandi kepada Waspada, Kamis pagi. Irwandi mengetahui peris-

rena pada saat 9 kapal penangkap ikan milik warga Negara Malaysia yang ditangkap Departemen Kelautan dan Perikanan (DKP) pada 8 Desember 2010 yang dititipkan di gudang milik Sarwo, ternyata sebagian (7 kapal) peralatan mesinnya hilang. Sun An juga tidak bisa mengurus ke tujuh kapal itu keluar dari DKP, karena Sarwo juga berambisi mengurus setiap kapal tersebut, sehingga mereka dendam kepada keluarga Sarwo. Terlebih peralatan mesin di tujuh kapal itu banyak yang hilang. Karena itu Sun An merencanakan pembunuhan, karena menganggap pihak Sarwo sebagai penghalang. Mengenai pasal yang dipersangkakan kepada para tersangka, Kapolda menjelaskan, pasal 340 KUHP atau pembunuhan berencana dengan ancaman hukuman mati atau seumur hidup atau selama-lamanya 20 tahun kurungan penjara. Kemudian pasal 338 KUHP tentang pembunuhan dengan ancaman hukuman penjara selama-lamanya 15 tahun. Diminta serahkan diri Kapoldasu mengatakan, semua tersangka yang masuk dalam daftar pencarian orang sudah diketahui identitasnya, karena itu dia mengimbau agar mereka menyerahkan diri, karena cepat atau lambat pasti ditangkap. Ditanya apakah para eksekutor dibayar dengan uang Rp50 juta per orang, Kapoldasu menjawab “begitu lah kira-kira”. Pemberitaan sebelumnya,

tiwa itu satu jam setelah kejadian. Rumah kayu dengan tiga kamar tersebut ludes dilalap api, kerugian ditaksir Rp500 juta. Peralatan yang ikut terbakar di antaranya televisi, perangkat internet serta peralatan dapur. “Masyarakat sempat mengejar pelaku, tapi pelakunya sempat melarikan diri,” ungkap Irwandi. Rumah tersebut, kata Irwandi, berfungsi sebagai tempat musyawarah masyarakat Maheng. Rumah dengan kontruksi pohon kelapa itu juga pernah didatangi Wali Negara Hasan Tiro. Selain digunakan Irwandi bersama pimpinan KPA/PA untuk rapat, rumah tersebut terakhir digunakan oleh konsultan yang sedang membuat perencanaan pembangunan kawasan Maheng menjadi kawasan Agrowisata. Program pembangunan kawasan Maheng ini adalah kerjasama Pemerintah Aceh, Yayasan Sambinoe, dan Badan Narkotika Nasional. (b32) Selasa (29/3) malam pukul 21:30, kedua korban bersama anaknya baru pulang belanja mengendarai Chevrolet Captiva BK 333 TO. Setibanya di depan rumah, korban membunyikan klakson mobil, dan seorang pembantu bernama Aini langsung membuka pintu grasi depan. Tetapi saat korban hendak memasukkan mobil ke dalam grasi, tiba-tiba tiga pria tak dikenal mengendarai sepada motor langsung menghadangnya, dan memberondong mobil korban dengan senjata api. Kedua korban tewas dengan luka tembak cukup parah. Dora Halim mengalami luka tembak di bagian kening dan Kho Wie To mengalami luka tembak di bagian dada dan tubuh lainnya. Sementara, sang pembantu Aini yang saat itu mencoba menyelamatkan anak korban mengalami luka tembak di bagian paha kanan, saat ini masih dirawat di Rumah Sakit Gleni Jalan Listrik. Sementara itu pengacara kedua tersangka Hermansyah, SH, sejak kedua tersangka ditetapkan jadi tersangka terus mendampingi kliennya. “Saat ini saya lagi mendampingi kedua klien saya menjalani pemeriksaan di Polresta Medan,” jelasnya sambil mengatakan, kedua kliennya bukan warga Malaysia. Namun sumber di kepolisian menyebutkan, kalau 4 pelaku penembakan itu merupakan WN Malaysia, yang saat ini melarikan diri ke Malaysia melalui Bagan Siapi-api, Asahan. (m27/m39/h04)

KABANJAHE (Waspada) : Tulang belulang manusia ditemukan seorang warga Kabanjahe Rehulina br Tarigan ,50, saat mengorek tanah untuk dijadikan kolam ikan lele di simpang jalan ke Lau Dah Kel. Padang Mas Kabanjahe,Kamis (7/3) sore. Penemuan itu kemudian diceritakan Rehulina br Tarigan kepada suaminya Agus Purba, 51,diteruskan ke Polres Tanah Karo. Sejumlah anggota Polres Tanah Karo di pimpin Kasat Sersae AKP Hary Azhar Harahap, Sik, turun ke lokasi Namun, setelah digali sedalam satu meter polisi belum menemukan tengkorak atau batok kepala kerangka manusia tersebut. Belum diketahui, apakah jasat manusia yang kini tinggal tulang tersebut sebelumnya di kubur secara utuh atau tidak. Atau mungkin tengkorak kepalanya sudah hancur dimakan usia,mengingat tulang belulang yang ditemukan diperkirakan sudah terbenam puluhan tahun. Rehulina br Tarigan mengatakan, di lokasi tersebut tidak ada kuburan keluarganya. Menurutnya lahan kosong yang sebelumnya ditumbuhi semak belukar itu telah di usahainya sejak beberapa bulan lalu dengan membuat beberapa kolam kecil untuk pemeliharaan ikan lele. Kasat Serse Hary Azhar, belum bisa memastikan tulang belulang manusia tersebut sebagai korban pembunuhan atau tidak. “Kita akan mengadakan

Khadafi Tulis Surat ... “Kebijakan presiden dalam hal ini sudah jelas,” ujar Carney kepada para wartawan yang mengiringi Obama ke New York. Dalam surat yang dikirimkan pada Rabu (6/4), Khadafi mengatakan, negaranya lebih terluka secara moral ketimbang fisik dengan aksi yang dilancarkan NATO. Ia juga menyatakan, masyarakat demokratis tidak bisa dibangun lewat rudal dan pesawat. Bersamaan dengan itu, Khadafi juga berulang kali mene-

Tak Ada Prioritas ... Ia menggambarkan, jika ada calon haji berusia lanjut 100 ribu maka akan ada jemaah haji usia muda, dari kalangan familinya, sebagai tenaga pendamping. Karena itu ia merasa keberatan jika pihaknya harus mengeluarkan berupa prioritas bagi calon haji usia lanjut. Hanya saja, lanjut dia, jika ada sisa kuota nasional —yang biasanya terjadi setiap tahun— sekitar 2 ribu orang, maka akan

Waspada/Basita Bukit

REHULINA Br Tarigan menemukan tulang belulang diduga manusia yag sudah tidak utuh di dekat simpang Lau Dah Kelurahan Padang Mas Kecamatan Kabanjahe Kabupaten Karo,Kamis (7/4) sore. pendalaman ,” ujarnya “Kelihatannya perawakan korban ini tinggi besar,”ujarnya tanpa menyebutkan jenis kelaminnya. Untuk pemeriksaan, petugas

membawa tulang tulang tersebut ke Mapolres Tanah Karo. Sementara itu,untuk pengamanan lokasi, petugas memasang police line.(c09)

Jepang Gempa ...

Paul Caruso, ahli geofisika di Lembaga Survei Geologi AS mengatakan, gempa ini terjadi di lokasi dan kedalaman yang sama dengan bulan lalu. Gempa yang terjadi Kamis itu merupakan gempa paling kuat dari 1.000 gempa susulan yang terjadi setelah gempa berkekuatan 9.0 SR pada 11 Maret lalu. (ap/rzl)

menimbulkan kerusakan parah pada struktur bangunan. Sesaat setelah gempa, semua arus listrik terputus. Kota ini menjadai gelap gulita, namun jalur lalu lintas sekitar terlihat normal dan warga berkumpul di jalan-jalan pada larut malam. gaskan bahwa jaringan al-Qaeda adalah musuhnya. Dalam suratnya, Khadafi menyebut Obama sebagai “anak kami tercinta” dan “Yang Mulia,” dan surat itu ditulis dalam bahasa Inggris kaku dan formal, termasuk banyak ejaan dan kesalahan tata bahasa. “Anak kami tercinta, Yang Mulia, Baraka Hussein Abu oumama, campur tangan Anda adalah nama Amerika Serikat merupakan suatu keharusan, sehingga NATO akhirnya akan menarik diri dari urusan Libya,” tulis Gaddafi. “Libya harusnya didistribusikan ke daerah dengan catatan bahwa yang menjadi prioritas adalah bagi calon jamaah haji yang belum pernah menunaikan ibadah haji dan berusia lanjut. Dan mekanismenya pun diatur sedemikian rupa tanpa mengganggu calon haji yang sudah masuk dalam daftrar tunggu, katanya. Kuota haji 2011 untuk haji reguler sebanyak 194.000 orang haji khusus sebanyak 17.00 orang. Ia memperkirakan untuk usia lanjut sekitar 40 persen.

Fasilitas Taubat ... Allah telah berjanji akan mengganti kejahatan orang-orang yang berdosa dengan kebaikan, asalkan mereka mau segera bertaubat. “…orangorang yang bertaubat, beriman dan mengerjakan amal saleh; maka kejahatan mereka diganti Allah dengan kebaikan. Dan adalah Allah Maha Pengampun lagi Maha Penyayang”.(QS.25:70). Bagi orang yang mau bertaubat Allah akan segera melimpahkan karunianya, dengan merasakan kepadanya kelezatan iman. “Sesungguhnya beruntunglah orang-orang yang beriman, (yaitu) orang-orang yang khusyu’ dalam shalatnya”.(QS 23;1-2) Orang yang beriman itu juga dikaruniai ketenangan hati. “Ingatlah, sesungguhnya waliwali Allah itu, tidak ada kekhawatiran terhadap mereka dan tidak (pula) mereka bersedih hati. (Yaitu) orang-orang yang beriman dan mereka selalu bertakwa”. (QS.10:62-63)

diserahkan kepada Libya dalam bingkai persatuan Afrika. “ Khadafi menyebutkan, negaranya sudah menjadi subjek ketidakadilan tahun 1986, untuk “sebuah agresi langsung militer bersenjata” — kala itu diperintahkan oleh Presiden Ronald Reagan, yang terkenal disebut pemimpin Anjing Gila dari Timur Tengah — serta beberapa sanksi terakhir yang dikenakan oleh AS dan internasional. Meskipun banyak menyatakan keluhan, Khadafi mengatakan ia tidak akan sakit hati terhadap Obama. “Kami lebih disakiti secara moral ketimbang fisik, disebabkan apa yang telah terjadi antara kita baik perbuatan dan kata-kata Anda,” tulis Khadafi. “Meski begitu Anda akan selalu (kami anggap-red) sebagai anak kami meski apa pun yang terjadi. Kami tetap berdoa agar Anda terus menjadi presiden Amerika Serikat. Kami berharap Anda akan memperoleh kemenangan dalam pemilihan baru mendatang. “ Surat, tertanggal 5 April 2011 di Tripoli itu ditandatangani oleh “Mu’aumer Qaddaffi, Pemimpin Revolusi”. (ap/rzl)

Sejatinya, semua orang punya dosa dan kesalahannya masing-masing. Tidak ada manusia yang sama sekali tidak pernah berbuat kesalahan. Tapi tidak semua manusia yang mau bersegera memanfaatkan fasilitas taubat kembali kepada Allah. Padahal ada karunia Allah yang melimpah ruah di balik pertaubatan itu. ”Sekiranya tidaklah karena karunia Allah dan rahmat-Nya kepada kamu sekalian, niscaya tidak seorangpun dari kamu bersih (dari perbuatanperbuatan keji dan mungkar itu) selama-lamanya, tetapi Allah membersihkan siapa yang dikehendaki-Nya”. (QS.24:21) Bagi orang yang memanfaatkan taubat dan konsisten dalam keimanannya, maka dia telah menjadikan Allah sebagai walinya dalam setiap urusannya. “Kamilah Pelindung-pelindungmu dalam kehidupan dunia dan di akhirat; di dalamnya kamu memperoleh apa yang kamu inginkan dan memperoleh (pula) di dalamnya apa yang kamu minta”.(QS.41:31). (Vol.23, 8/4/2011)

Info Parlemen

WASPADA Jumat 8 April 2011


DPR Dorong Penyelesaian Masalah Ahmadiyah

Anggota KomisiVIII DPR RI Hasrul Azwar

JAKARTA ( Waspada): Anggota Komisi VIII DPR RI Hasrul Azwar yang juga Ketua Fraksi Partai Persatuan Pembangunan (PPP) telah mengusulkan untuk membentuk Panitia Kerja (Panja) dalam membahas masalah yang menyangkut Ahmadiyah. Panja ini dalam rangka mendorong penyelesaian masalah Ahmadiyah dengan cara damai dan menghindari konflik.

‘’Polemik yang berkepanjangan antara umat Islam dengan jemaat Ahmadiyah harus segera dicarikan jalan keluar’’ kata Hasrul Azwar, di Jakarta, Senin (4/4). PPP dan Partai Kebangkitan Bangsa telah mengusulkan agar DPR RI membentuk Panja Ahmadiyah. Hasrul menyebut persoalan Ahmadiyah rumit lantaran banyak pemutarbalikan ayat-ayat suci Al-Quran dalam kitab sucinya, Tadzki-

roh. “Kitab Tadzkiroh ini tebalnya 800 halaman. Isinya penuh dengan pemutarbalikan Al-Quran. Karena banyak literaturnya yang bertentangan dengan Islam. Hasrul kembali menekankan solusi terbaik bagi kasus Ahmadiyah yang berkepanjangan adalah dengan membubarkan secara keorganisasian. Secara organisasi, Ahmadiyah harus dibubarkan. Karena pembubaran itu lebih bijaksana

untuk menghndari konflik,’’ tutur Hasrul Azwar. Sebelumnya DPR RI telah memanggil Jemaat Ahmadiyah Indonesia (JAI) pasca insiden Cikeusik. Dalam Rapat itu, pengurus JAI mengaku bagian dari Islam, karena masih berpegang teguh terhadap alQuran dan sunnah. Namun Hazrul tak sepenuhnya percaya. Hazrul menyebutkan bahwa selama ini Tadzkiroh diyakini jemaat Ahmadiyah

Aksi massa menuntut pembubaran Ahmadiyah.

DPR Minta Pelepasan Tanah Di Nagori Bandar Betsy, Segera JAKARTA (Waspada): Anggota Komisi III DPR RI dari Fraksi Partai Gerakan Indonesia Raya (F Gerindra) Martin Hutabarat, SH meminta Menteri Badan Usaha Milik Negara (BUMN), Kepala Badan Pertanahan Nasional (BPN) Sumut, Gubsu, Bupati Simalungun dan Kejaksaan Tinggi Sumut untuk segera memproses keputusan Pansus DPR RI tentang Penyelidikan masalah Pertanahan secara Nasional No 027/RKM/DPR RI/2004. Diantara putusannya merekomendasikan agar tanah seluas 943 Ha yang berasal dari Redistribusi tanah objek Landreform III (Persero) yang terletak di Nagori Bandar Betsy, Kec. Pematang Bandar, Kab. Simalungun, segera dilepaskan sebagai aset PTPN III. ”Keputusan Pansus DPR RI ini harus dilaksanakan dan jangan sampai mengorbankan rakyat lagi,” ujar Martin Hutabarat saat rapat dengar pendapat delegasi anggota DPRD Simalungun dengan Komisi III DPR RI, di Gedung DPR RI Jakarta, Selasa (5/4). Secara khusus, mantu mantan Bupati Simalungun Radjamin Purba, SH, ini meminta Bupati Simalungun berpihak pada kepentingan rakyat, dan mengingatkan pihak PTPN III tidak melangkah terlalu jauh melaksanakan aktivitas penanaman di areal tanah seluas 942 Ha itu. “Kita harapkan kasus tanah di Bandar Betsy ini tidak sampai memancing keributan dengan para petani penggarap yang sudah sejak lama menguasainya,” tegas Martin. Wakil rakyat dari daerah pemilihan Sumut ini menjelaskan, Pansus DPR RI tentang Penyelidikan masalah Pertanahan secara Nasional No 027/RKM/DPR RI/2004 telah membuat keputusan atas tanah seluas 943 di Nagori Bandar Betsy. Dalam keputusan Pansus, katanya, Menteri BUMN dan PTP III diminta untuk mengajukan pelepasan hak atas tanah kepada Badan Pertanahan Nasional. Selanjutnya Kepala BPN diminta untuk menetapkan status tanah, menjadi tanah yang dikuasai langsung oleh Negara untuk segera diredistribusikan kepada petani-petani penggarap yang berhak. Pansus DPR, tambah Martin, juga menugaskan Bupati Kabupaten Simalungun, sesuai dengan kewenangannya segera melaksanakan redistribusi tanah dimaksud, sesuai data dengan data yang telah disepakati berdasarkan daftar pemilik sesuai dengan Putusan Musyawarah 22 Juli 1968. Itu keputusan Pansus, dan harus dijalankan, kata Martin. Namun dengan kedatangan utusan DPRD Simalungun melapor ke Komisi III DPR RI, akhirnya Komisi III akan menyurati Menteri BUMN, Kepala BPN Sumut, Gubernur Sumut, Bupati Simalungun dan Kejaksaan Tinggi Sumut agar memproses keputusan Pansus Pertanahan DPR RI tahun 2004. Utusan DPRD Kabupaten Simalungun yang melaporkan ke Komisi III DPR, Selasa, mempertanyakan maksud dari surat Kejaksaan Tinggi Sumut tertanggal 28 Janari 2011 yang ditujukan kepada Bupati Simalungun, perihal penyelesaian permasalahan areal garapan masyarakat di Perkebunan PTPN III (Persero) Kebun Bandar Betsy dan meminta Bupati membantu PTPN III memfasilitasi pemberian tali asih kepada para penggarap. (aya)

Perlu Pengkajian Ilmiah Penyebab Banjir Medan JAKARTA (Waspada): Ketua F-PPP DPR RI Drs H Hasrul Azwar, MM menyata-kan keprihatinanya atas banjir yang melanda Kota Medan beberapa hari lalu. Hal itu dikatakan Hasrul kepada Waspada di Gedung DPR RI Jakarta, Selasa (5/4). Untuk itu Hasrul meminta Walikota Medan segera melakukan kajian ilmiah untuk mencari tahu apa penyebab hingga Medan mengalami kebenjiran besar seperti itu. Wakil rakyat dari daerah pemilihan Sumut ini pun menyakini ada enam penyebab terjadinya banjir yang melanda Kota Medan, yakni tingginya curah hujan, terjadinya pendangkalan sungai, tidak berfungsinya drainase, berkurangnya daerah serapan air, tidak berfungsinya kanal pengendali banjir, dan adanya penggundulan hutan. Menurut Hasrul, daerah tangkapan air di Kota Medan idealnnya 30 persen dari luas wilayah, namun saat ini keadaannya tidak ideal, apa lagi makin tumbuhnya gedung- gedung bertingkat. Disamping melakukan pengkajian, Hasrul juga menyarankan agar Walikota Medan kembali mengajak seluruh masyarakat Kota Medan melakukan gotong royong. ”Kerahkan seluruh Lurah untuk mengajak warga kota Medan melakukan gotong royong,” kata Hasrul Azwar Harahap. (aya)

Jemaat Ahmadiyah Indonesia (JAI) dalam Rapat Dengar Pendapat Umum (RPDU) di Gedung Dewan Senayan belum lama ini. sebagai kitab sucinya, bukan al-Quran. “Tidak ada solusi lain. Ahmadiyah harus dibubarkan. Tobat kembali kepada Islam,” tandas Hasrul. Meski kini ada fenomena bertobatnya beberapa pengikut Ahmadiyah dan bersyahadah, namun secara organisasi, Ahmadiyah harus dibubarkan. Hasrul menekankan, alasan pembubaran adalah karena Ahmadiyah telah melakukan penistaan agama, dalam hal ini penistaan terhadap agama Islam. Dia membantah, bahwa upaya untuk membubarkan Ahmadiyah karena tidak adanya toleransi. Karena Rasulullah Muhammad SAW juga mengajarkan toleransi dengan umat yang berbeda agama. ‘’Tapi ini, mereka mengaku Islam, namun ada rasul lain selain Rasululah Muhammad SAW. Ini adalah penistaan terhadap agama Islam. Untuk itu Ahmadiyah harus dibubarkan secara organisasi,’’ tegas Hasrul. Jadi setidaknya ada beberapa hal menyangkut Ahmadiyah, yaitu mereka mengaku Islam tetapi rasulnya berbeda yakni Mirza Ghulam Ahmad, kitab sucinya juga berbeda yakni Taz-

Menkes: Waspadai Pengunaan Antibiotik JAKARTA (Waspada): Menteri Kesehatan Endang Rahayu Sedyaningsih meminta masyarakat waspada terhadap penggunaan antibiotik untuk pengobatan. Jika tidak digunakan secara rasional, antibiotik bukannya membunuh tapi malah menimbulkan resistensi. “Penggunaan antibiotik yang tidak diperlukan, bukannya menyehatkan malah melemahkan sumber daya manusia. Karena itu masyarakat perlu tahu apa arti resistensi antibiotik akibat penggunaan antbiotik berlebih, supaya bisa mewaspadai penggunaannya,” kata Menkes Endang Rahayu dalam seminar menyambut Hari Kesehatan Sedunia (HKS) yang ke-60 di Balai Kartini, Jakarta (7/4). Peringatan HKS tahun ini mengambil tema ‘Gunakan Antibiotik Secara Tepat’. Resistensi antibitotik adalah perubahan kemampuan bakteri, hingga menjadi kebal terha-

dap antibiotik. Resistensi terhadap antibiotik terjadi akibat berubahnya sifat bakteri sehingga tidak lagi dapat dimatikan atau dibunuh. Keampuhan obat pun menjadi melemah atau malah hilang. “Pada akhirnya, bakteri yang resistensi terhadap antibiotik berkembang biak dan menjadi lebih berbahaya. Bukan tidak mungkin Indonesia bisa menjadi negara dengan pandemi resistensi antibiotik,” kata menkes. Saat ini penggunaan antibiotik di masyarakat Indonesia memang terkesan sembarangan. Dengan mudahnya, masyarakat bisa membeli berbagai jenis antibiotik di apotik dan toko obat, tanpa resep dokter. Dosis dan penggunaan-nya pun jelas tidak rasional. Kondisi itu diperparah dengan pemberian resep obat dan antibiotik di puskesmas dan klinik-klinik kesehatan yang tidak rasional. “Memang cukup sulit menertibkan penggunaan obat antibiotik yang rasional ini. Tapi

kita akan siapkan pedoman, data-data terpilah dan payung hukum supaya kuat implementasinya di lapangan. Bahkan ada kemungkinan kita lakukan uji petik penggunaan antibiotik di seluruh daerah di Indonesia,” kata Endang. Iwan Dwiprahasto dari Fakultas Kedokteran Universitas Gadjah Mada pernah melakukan survei terhadap pengobatan diare dan infeksi saluran pernafasan atas (ispa) di sejumlah puskemas, RS dan klinikklinik kesehatan di Sumatera Barat, Kalimatan Timur, Jawa Timur dan NTT. “Hasilnya, lebih dari 90 persen pengobatannya tidak efektif. Di situ terdapat resep penggunaan antibiotik yang tidak rasional. Artinya, penggunaan antibiotik tidak diperlukan, tapi tetap diresepkan,” kata Iwan. Menurut Iwan, dokter tidak disarankan memberi antibiotik untuk jenis penyakit seperti diare, flu, batuk, masuk angin,

demam, pilek dan sakit tenggorokan. Bahkan di RS penggunaan antibiotik harus berdasar pada pola kuman yang telah ditentukan komite farmasi RS yang bersangkutan. “Jadi kalau kita kena sakit tenggorokan, misalnya, jangan langsung minta antibiotik. Komunikasikan dulu dengan dokter bahwa kita mendukung penggunaan obat yang rasional,” imbuh Iwan. Kepala Perwakilan WHO di Indonesia Khanchit Limpakarnjanarat mengatakan, resistensi antibiotik tidak hanya mengancam Indonesia tapi juga 11 negara lain di kawasan Asia Tenggara. Untuk menghambat perkembangannya, masyarakat diminta sadar akan penggunaan obat yang rasional. “Kami sangat antusias dan siap melakukan kampanye massif guna mencegah masyarakat menjadi korban dari ketidaktahuannya akan bahaya resistensi antibiotik,” tandas Khanchit. (dianw)

Giliran Politisi Artis Tolak Gedung Baru DPR JAKARTA (Waspada): Giliran politisi artis di DPR RI menyatakan menolak pembangunan gedung baru DPR. Dia adalah anggota Fraksi PKB DPR RI Gitalis Dwi Natarina yang populer dikenal dengan namanya Gita KDI menyampaikan penolakannya kepada wartawan di Jakarta, Selasa (5/4). Selain menyampaikan sikap kritisnya, Gita ternyata tak pelit dengan profesinya dan bahkan masih mau mendendangkan beberapa bait lagu dangdut Rhoma Irama yang berjudul ‘Ibu” di hadapan wartawan. “Saya selaku pribadi tidak perlu dibangun gedung baru, karena tidak nyambung dengan kepentingan rakyat. Kalau mau renovasi tidak masalah. Tidak etis mengeluarkan biaya triliunan rupiah di tengah rakyat dilanda bencana. Saat ini banyak bencana, lebih baik dana pembangunan itu dikonversi memperbaiki gedung SD yang banyak roboh,” ujar Gita yang datang sendirian dengan penampilan khasnya berjilbab kecoklatan. Berdasarkan pengalamannya

baru sebulan menempati gedung DPR RI, menurut Gita, gedung itu masih layak dipergunakan oleh para anggota DPR RI. Menjawab pertanyaan wartawan dia menyatakan tidak takut berbeda sikap dengan fraksinya, kalau nanti sanksinya direcall. ”Saya menyuarakan aspirasi dari konstituen yang baru saya kunjungi kemarin. Kalau terkait hal ini saya di’recall’ saya tidak takut, saya siap,” ujarnya. Dia mengatakan, sampai sekarang belum mengetahui sikap Fraksi PKB DPR RI terkait pembangunan gedung baru. “Mudah-mudahan sikap politik saya tidak berbeda dengan dengan sikap fraksi,” katanya. Dia mengatakan, sebelum bersikap terkait rencana pembangunan gedung baru, dirinya terlebih dahulu melakukan kunjungan dan menyerap aspirasi konstituen di Kabupaten Garut dan Kota Garut serta Tasikmalaya. “Aspirasi konstituen saya, mereka tidak mengetahui apa maksud pembangunan

gedung baru,” katanya. Gita dilantik menjadi anggota DPR RI pada 2 februari 2011. Dia menggantikan Cecep Syarifudin yang meninggal dunia. Gita KDI kini menjadi anggota Komisi IX DPR yang membidangi kesehatan dan tenaga kerja. Nama Gita KDI dikenal masyarakat setelah menjuarai kontes dangdut periode kedua di TPI. Permainan Politik Parpol Pengamat Politik dari Universitas Indonesia, Arbi Sanit mengatakan polemik gedung baru merupakan permainan politik dari partai-partai politik yang ada di DPR. Isu itu menjadikan Partai Demokrat target utamanya, sebab disadari bahwa kader partai Demokrat tidak matang dalam berpolitik, dan permainan ini sangat strategis karena melibatkan banyak pihak, seperti yang pernah terjadi pada kasus Bank Century dimana Partai Demokrat dikerjain beramai-ramai.

“Ini permainan politik saja untuk menghajar Partai Demokrat sebagai partai terbesar beramai-ramai untuk menghancurkan Demokrat pada pemilu 2014 nanti,” ujar Arbi kepada wartawan di Gedung DPR, Jakarta, Senin (4/4). Menurut Arbi, ketidakmatangan itu bisa dilihat bagaimana Ketua DPR yang juga Wakil Ketua Dewan Pembina Partai Demokrat dihajar habis-habisan oleh anggota-anggota lainnya, bahkan oleh kader-kader Partai Demokrat sendiri yang tidak memahami permainan politik fraksi-fraksi lainnya. Kalau masyarakat mau jujur, menurut Arbi, justru Marzuki Alie yang polos membela keputusan bersama DPR, sehingga bisa dikesankan Marzuki Alie sendiri yang ngotot membangun gedung tersebut. Arbi mengatakan, Marzuki yang bisa dikatakan masih awam permainan politik semacam ini juga mau saja membela keputusan bersama, sementara yang lain sudah bermanuver liar. (j07/aya)

kiroh. ‘’Oleh karenanya Ahmadiyah telah melakukan penistaan agama,’’ katanya. Penistaan agama itu telah diatur dalam Perpres No.1/1965. Karena negara berkewajiban untuk menjaga dan melindungi kemurnian ajaran Islam sebagai agama mayoritas warga negara RI sesuai amanat konstitusi. Sebaliknya, kemurnian akidah Islam, pelecehan terhadap HAM, penciptaan konflik di tengah kehidupan berbangsa dan bernegara. Pembiaran Ahmadiyah, berarti pelanggaran terhadap Konstitusi Negara RI yang telah menjamin untuk menjaga agama-agama yang diakui dari segala bentuk penistaan. Pembicaran Ahmadiyah juga berarti penghancuran tatanan rumah tangga umat Islam sehingga terjebak secara formal sistematis dalam perkawinan tidak sah dengan golongan Ahmadiyah. Selain itu, sejalan dengan Fatwa Majelis Ulama Indonesia (MUI) Tahun 1980 dan Tahun 2005, sekaligus sejalan pula dengan Fatwa Rabithah ‘Alam Islami (RAI) Tahun 1974 dan Keputusan Organisasi Konferensi Islam (OKI) tahun 1985. Bahkan sejalan dengan si-

kap Lembaga-lembaga Fatwa di seluruh dunia Islam, baik Sunni maupun Syi’ah. Tindakan negara melarang Ahmadiyah tidak bertentangan dengan Resolusi HAM PBB, karena dalam Konvenan Internasional tentang Hak Sipil dan Politik, Pasal 18 ayat 3, yang termuat dalam Lembar Fakta HAM PBB (Fact Sheet - UN Centre for Human Rights) No. 15, dengan tegas dan jelas memberikan hak kepada Negara untuk melakukan pembatasan hukum yang diperlukan untuk melindungi keselamatan, ketertiban, kesehatan atau moral umum, atau hak asasi dan kebebasan orang lain. Bahkan, pada 26 Maret 2009, Dewan HAM PBB di Jenewa-Swiss menetapkan bahwa Penistaan Agama adalah Pelanggaran HAM. Itulah sebabnya, seluruh Dunia Islam telah secara resmi melarang Ahmadiyah di negeri-negeri mereka. Bahkan di Singapura saja, yang bukan negeri Islam, Ahmadiyah tidak disebut Islam dan pemakaman Ahmadiyah dipisahkan dari pemakaman umat Islam. Dan tak satu pun dari negeri-negeri tersebut yang divonis sebagai Pelanggar HAM.(PR) Adv

MK Didesak Tetapkan Pasangan Bosur JAKARTA (Waspada): Tokoh agama dan masyarakat Tapanuli Tengah (Tapteng) desak Mahkamah Konstitusi (MK) agar arif dan bijaksana dalam memutuskan dan menetapkan kemenangan pasagan Raja Bonaran Situmeang dan Syukran Tanjung (Bosur) sebagai Bupati dan Wakil Bupati terpilih Tapteng priode 2011 – 2016, segera dapat dilantik tanpa berlarut-larutnya kasus sengketa pilkada. Desakan tersebut diungkapkan Ketua Nahdalatul Ulama (NU) Kabupaten Tapteng, Syafwanuddin Cane kepada wartawan di Jakarta, Selasa (5/4). Menurut Cane, adanya pengaduan pasangan Dina Mariana Boru Samosir dan Hikmal Batubara terhadap pasangan Bosur ke Mahkamah Konstitusi (MK) telah membuat masyarakat kecewa dan menyakitkan perasaan rakyat. “Di mana hasil pilkada telah dimenangkan pasangan Bosur pada 12 Maret 2011 secara demokrasi dan transparans. Karena itu kami mendesak dan berharap kepada MK agar arif dan bijaksana dalam memutuskan pilkada Tapteng tanpa adanya pilkada ulang lagi,” kata Cane. Dikatakan Cane, Pilkada Tapteng telah berjalan sesuai peraturan dan perundang-undangan serta berlangsung aman dan lancara sesuai cita-cita dan amanah serta harapan rakyat. “Rakyat telah memilih sesuai hati nurani. Maka itu, rakyat sedang berdoa menunggu pasangan Bosur dilantik,” kata Cane. Dikatakan tokoh agama Tapteng ini, kemenangan pasangan Bosur diperoleh dan diraih dengan kerja keras serta kepercayaan penuh masyarakat Tapteng yang menginginkan perubahan. “Berkat doa dan pengharapan rakyat khususnya dari rakyat kecil seperti petani miskin, tokoh agama dan masyarakat luas yang ingin adanya perubahan Tapteng memenangkan Bosur,” tutur Cane. Tidak dapat dipungkiri, katanya, kemenangan pasangan Bosur juga didukung oleh pihak lainnya termasuk pihak parpol pendukung. “Doa orang-orang yang tertindas dan teraniaya itu sangat makbul, makanya pilkada dimenangkan Bosur,” kata Cane. Hal senada juga dikatakan Ketua GP Ansor Tapteng Sawi Sigalingging, bahwa pengaduan ke MK dari pasangan Dina Mariana Boru Samosir dan Hikmal Batubara merupakan upaya penggagalan Pilkada Tapteng yang tidak mengakui kemenangan Bosur. “Itukan pasangan yang ingin menerapkan kembali triknya yang gagal agar Pilkada diulang,” kata Sawi. Dikatakannya, tidak ada alasan untuk menggagalkan Pilkada Tapteng karena pengawasan super ketat dari Polri, TNI, Parpol dan LSM dan murni kehendak rakyat. “Masyarakat pemilih Bosur rela berkorban memenangkan Bosur sebagai bukti jalannya kampanye Bosur bisa dilakukan atas biayanya dari sumbangan warga sendiri dengan memenangkan secara bersih dan hati nurani. Apakah MK harus menggagalkan kemenangan pasangan Bosur ini? Rakyat dengan ikhlas menyumbang Rp1.000 hingga Rp2.000 untuk kemenngan pasangan Bosur,” katanya. Aktivis Gerakan Rakyat Penyelamat Negara (Gerphan) Indonesia Ribu Simatupang juga berharap MK arif dan bijaksana menyikapi pilkada Tapteng. “Karena saat ini warga menanti dan segera bisa bertemu dengan pasangan Bosur untuk mengubah kehidupan Tapteng yang lebih baik lagi,” kata Simatupang. Menanggapi aksi demo yang dilakukan Gerakan masyarakat Cinta Keadilan (GMCK) di Jakarta beberepa waktu lalu saat sidang di MK sedang berlangsung, Dewan Presidium Koalisi Masyarakat Nauli untuk Demokrasi (Komando) Sibolga Tapteng, Dedy Sutomo Simanjuntak, menuding aksi itu hanya untuk mengalihkan isu pilkada Tapteng. “Aksi demo terkesan sengaja didesain untuk merusak citra Bonaran Situmeang sebagai Bupati Tapteng terpilih, sementara Pilkda di daerah itu telah berjalan aman, tertib dan sukses. Semestinya setiap calon yang ikut pilkada Tapteng dapat legowo menerima kekalahan, sebab kalah dan menang adalah konsekwensi logis dalam setiap pertandingan atau siap kalah siap, siap menang,” kata Simanjuntak. (j02)

Medan Metropolitan


WASPADA Jumat 8 April 2011

PKS Curigai Penekanan Terhadap Gatot MEDAN (Waspada): Meski sikap sembilan pimpinan fraksi di DPRD Sumut belum melunak terhadap Pj Gubsu Gatot Pujonugroho, namun pimpinan dewan menganggap persoalan disharmoni Gatot-Syamsul sudah selesai. Sedangkan bagi Partai Keadilan Sejahtera (PKS) gejolak tersebut dicurigai sebagai penekanan terhadap Gatot. Kemarin, Waspada berbicara dengan sejumlah anggota dewan. Di antaranya Wakil Ketua DPRD Kamaluddin Harahap dan Ketua Fraksi Partai Golkar (FPG) Hardi Mulyono. Sebelumnya, Waspada juga berbicara dengan Ketua Fraksi Partai Keadilan Sejahtera (FPKS) Hidayatullah. Lewat telepon selular, Waspada mempertanyakan sikap pimpinan sembilan fraksi yang sangat keras terhadap Pj Gubsu. Salah satunya pimpinan fraksi memboikot pertemuan silaturahim Pj Gubsu di gedung dewan Jumat minggu lalu. Kesannya, pimpinan sembilan fraksi bukan mendamaikan konflik Syamsul Arifin dengan Gatot Pujonugroho malah membawa konflik itu ke lembaga dewan. Hardi Mulyono membantah sinyalemen itu. Sebaliknya, para pimpinan fraksi berkeinginan agar kedua pejabat itu

menghilangkan kesan disharmoni diantara mereka. Kata Hardi, ada dua hal yang dituntut pimpinan fraksi-fraksi kepada Gatot Pujonugroho, yakni menghilangkan disharmoninya dengan Syamsul Arifin. Caranya dengan Gatot mendatangiSyamsulArifin.‘’Yang kedua kita ingin Pj Gubsu tidak membuat resah SKPD,’’ kata Hardi. Berbagai upaya, lanjutnya, telah ditempuh pimpinan fraksi untuk menyatukan kembali kedua tokoh ini. Mereka sudah berkali-kali menemui Syamsul Arifin, juga sudah bertemu dengan Dirjen Otda Depdagri. ‘’Kita juga sudah berusaha menemui Gatot untuk berdiskusi, tapi belum direspon,’’ tambah Hardi. Kamaluddin Harahap menambahkan sudah tidak ada lagi disharmoni antara Syamsul Arifin dengan Gatot Pujonu-

groho dalam konteks penyelenggaraan pemerintahan di Sumut. Katanya, begitu Gatot menerima SK tentang Pj Gubsu harusnya saat itu pula disharmoni berakhir. ‘’Kalau disharmoni dalam konteks perasaan, saya tidak tahu,’’ katanya. Karenanya, Kamaluddin Harahap meminta semua pihak untuk mengakhiri polemik ini. ‘’Sudahlah... itu sudah selesai. Ke depan bagaimana kita mendorong agar pemerintahaan berjalan efeksif. Kalau terus begini, kasihan rakyat,’’ katanya. Ketua FPG Hardi Mulyono, menyebutkan disharmoni Syamsul-Gatot belum selesai. Karena Syamsul Arifin, belum diberhentikan secara penuh sebagai Gubsu. Penghentiannya masih sementara. Potensi disharmoni keduanya ke depan masih sangat mugkin terjadi. ‘’Gubsu masih non aktif. Kalau nanti dia diputuskan tidak bersalah bagaimana? Makanya, sejak sekarang kita berharap Gatot mengakhir disharmoninya. Ada sesuatu di balik penekanan Sebelumnya, Ketua FPKS Hidayatullah kepada Waspada mencurigai ada sesuatu di balik ‘penekanan’ pimpinan fraksi kepada Pj Gubsu. Dia menduga

sikap itu muncul karena keresahan sejumlah kepada Satuan Kerja Perangkat Daerah (SKPD). Kata Hidayatullah, aneh rasanya kalau pernyataan Pj Gubsu yang menyatakan akan mengevaluasi SKPD ditanggapi negatif. Padahal itu merupakan sesuatu yang lumrah. Disebutkan Hidayatullah, selama ini Gatot, tidak pernah terlibat dalam pengambilan keputusan di internal. Karenanya sangat wajar kalau ke depan dia melakukan evaluasi untuk mengukur keberhasilan kerja jajarannya. ‘’Lalu, apanya yang aneh,’’ kata Hidayatullah. Seperti disebutkan Pj Gubsu di media, menurut Hidayatullah, evaluasi yang akan dilakukan Gatot sangat terukur, yakni dengan berpedoman pada serapan APBD. Dia menyarankan, seyogianya evaluasi dilakukan per triwulan. Dewan saja, kata Hidayatullah, selalu melakukan evaluasi terhadap SKPD. Tidak jarang terjadi, hasil rapat dengar pendapat dengan mitra kerjanya, dewan mengeluarkan rekomendasi peberhentian SKPD karena dinilai tidak berhasil. ‘’Jadi, mengapa Plt Gubsu yang akan melakukan evaluasi tidak boleh. Aneh…,’’ kata Hidayatullah. (m12)

Sembilan Fraksi Kekanak-kanakan MEDAN (Waspada): Aktivis Forum Aktivis 98 Sumut menyesalkan reaksi berlebihan dan kekanak-kanakan 9 Fraksi DPRDSU terhadap kebijakan Pj Gubsu yang mengevaluasi menyeluruh proses rekrutmen dan kinerja SKPD yang tidak sesuai prosedur dan menghambat proses pembangunan. ‘’Alasan Pj Gubernur harus berkoordinasi dengan Syamsul Arifin dan alasan tidak mempunyai wewenang mengganti SKPD sarat dengan muatan politis, mengada-ada,” kata Ketua Forum Aktivis 98 Sumut Muhammad Ikhyar Velayati Harahap, Rabu (6/4), dalam acara diskusi bulanan Forum Aktivis 98 dengan tema: “Peran Serta Masyarakat Dalam Mendukung Pemerintahan Bersih Di Sumut” di Jalan Rakyat. Katanya, kalau melihat teks

dan subtansi dari UU 32 tahun 2004 pasal 31 sebagai landasan dalam menjalankan roda pemerintahan daerah, terlihat jelas bagaimana posisi, tugas, wewenang serta kewajiban seorang wakil kepala daerah yang menggantikan posisi gubernur apabila menjadi terdakwa kasus korupsi. Kemudian, pasal 34 ayat 1 dan 2 dijelaskan bahwa wakil gubernur yang menggantikan kepala daerah yang sedang dalam posisi sebagai tersangka kasus korupsi, maka wakil gubernur tersebut harus melaksanakan tugas dan kewajiban sebagai kepala daerah sebagaimana mestinya Ikhyar menambahkan, tugas, wewenang dan kewajiban gubernur terpilih melalui Pilkada maupun Pj Gubernur yang menggantikan posisi

gubernur dalam pasal 25 terdiri dari 7 poin, yaitu a.Memimpin penyelenggaran pemerintah daerah berdasarkan kebijakan yang di tetapkan bersama DPRD, b.Mengajukan rancangan Perda, c.Menetapkan Perda yg di setujui DPRD, e.Menyusun dan mengajukan rancangan Perda tentang APBD kepada DPRD untuk di tetapkan bersama, f.Mengupayakan terlaksananya kewajiban daerah, g.Mewakili daerahnya di dalam dan di luar pengadilan, h.Melaksanakan tugas dan wewenang lain sesuai dengan peraturan perundang-undangan. Sementara kewajiban gubernur terpilih maupun Pj Gubernur ada dalam pasal 27 ayat 1 yang terdiri dari 11 poin yang mengatur komitmen terhadap NKRI, meningkatkan

kesejahteraan rakyat, ketertiban masyarakat, kehidupan demokrasi, pertanggung jawaban keuangan serta yg paling krusial adalah “melaksanakan pemerintahan yang bersih”. Kewajiban gubernur atau Pj gubernur juga tertuang dalam pasal 27 ayat 2 yang terdiri dari 5 point yang mengatur tata cara pelaporan kepada DPRD maupun kepada Presiden. Forum Aktivis 98 Sumut, lanjutnya, sebagai pelaku sejarah reformasi mengingatkan seluruh elemen masyarakat untuk menghempang restorasi program dan kekuatan lama baik di parlemen maupun di eksekutif. Berkaitan itu, Forum Aktivis 98 Sumut berencana menggagas pertemuan yang dinamakan “Ngobrol Bareng Gubernur di Kedai Kopi”. (m07)

Listrik Belum Masuk Daerah Pinggiran

Jamaah Umroh Gema Jaya Bentuk Pengajian

MEDAN (Waspada): Sebanyak 2,7 juta warga Sumatera Utara masih hidup dengan sumber penerangan utama bukan listrik. Jumlah warga yang belum menikmati listrik ini mencapai 21 persen dari total jumlah penduduk 12.985.075 jiwa berdasarkan sensus 2010. Jutaan warga yang belum menikmati listrik itu umumnya berada di daerah kepulauan dan wilayah terpencil yang kurang padat populasi penduduknya. Banyaknya jumlah warga yang belum menikmati listrik itu menunjukkan rasio elektifikasi di Sumut sampai akhir 2010 baru mencapai 79 persen. Karenanya, untuk mengatasi masalah ini Badan Perencanaan Pembangunan Daerah (Bappeda) Sumut sudah memogramkan pembangunan bidang energi kelistrikan pada awal 2012. “Awal 2012 nanti sudah direncanakan percepatan pembangunan PLTA Asahan III di Kabupaten Asahan dan PLTA Sarulla III di Kabupaten Tapanuli Utara,” ucap Kepala Bappeda Sumut, Riadil Akhir Lubis, Rabu (6/4). Selain itu, lanjut Riadil, pembangunan bidang energi kelistrikan di Sumut pada awal 2012 juga akan dimulai melalui pengembangan desa mandiri energi. Program ini dilakukan melalui pembangunan pembangkit listrik dari sumber energi terbarukan. Pembangunan pembangkit listrik dari sumber energi terbarukan itu antara lain melalui pembangunan Pembangkit Listrik Mini Hydro (PLMTH) sebanyak dua unit dan Pembangkit Listrik Tenaga Surya (PLTS) sebanyak 500 unit.(m28)

MEDAN (Waspada): Jamaah umroh Gema Jaya yang baru kembali dari menunaikan ibadahnya ke Makkah dan Madinah membentuk satu kelompok pengajian dan koperasi. Pimpinan Gema Jaya Hj. Ariany Sinulingga ketika membentuk kelompok pengajian itu di rumahnya di Jalan Murni, Kel. Sudirejo, Kecamatan Medan Sunggal, Rabu (6/4), mengatakan setelah kembali dari menunaikan ibadah, jangan kita lantas bubar begitu saja. Mari kita bentuk jalinan silaturahmi agar kita tetap bersatu sebagaimana yang kita lakukan selama di tanah suci. Ariany Sinulingga lebih lanjut mengatakan agar jalinan silaturahmi ini lebih kuat lagi dengan membentuk semacam koperasi. Ariany Sinulingga menyerahkan dana Rp500 ribuuntuk disetorkan ke bank dan mendapatkan buku tabungan. Nikah massal Setelah melaksanakan serangkaian kegiatannya, seperti sunat massal beberapa bulan lalu, penyerahan bantuan untuk pembangunan Masjid Agung Kabanjahe, Ariany Sinulingga kali ini ingin melaksanakan idenya untuk menyelenggarakan nikah massal, demikian menurut Hj. Ridha br Tarigan yang siang itu menjadi protokol acara. Menurut Hj. Ariany, bagi mereka yang ingin ikut dalam nikah massal itu dapat mendaftarkan diri ke kantor PT Panca Mulia Jaya di Jl. Gatot Subroto simpang Barat No. 102 H Medan. (m10)

Mahasiswa Ma’had Aly As-Sunnah Dalami Dakwah Ke Waspada MEDAN (Waspada): Mahasiswa Pesantren Ma’had Aly AsSunnah di Jalan Medan -Tanjung Morawa Km 13 Gang Darmo, Kamis (7/4), mengunjungi Bumi Warta Harian Waspada untuk mendalami pengetahuan dakwah melalui media cetak. Rombongan yang datang terdiri dari Pembantu Direktur (Pudir) I Pesantren Yayasan Ar Risalah Al Khairiyah Ma’had Aly As Sunnah Mujahid, Kepala Program Pendidikan Pengkaderan Da’i Fakhrurrozi, Bagian Administrasi Drs Edi Suheri, Sekretaris Umum Shalihin dan 31 mahasiswa calon da’i, diterima Kepala Humas Harian Waspada H Erwan Effendi. Dalam kesempatan tersebut, Kepala Program Pendidikan Pengkaderan Da’i Fakhrurrozi menjelaskan kunjungan yang

kasihan pada anaknya, Friska, yang baru masuk harus kalangkabut sendirian mencari tempat melepas penat dan syoknya karena sekolah diliburkan hingga 3 hari, sedangkan dia tidak memiliki sanak saudara tempat mengadu di Medan. Lain halnya dengan teman-temanya yang dijemput orangtua di hari kejadian, sehingga tidak perlu panik. Sedangkan anaknya kemarin harus menumpang pada teman untuk menginap sehari sebelum Ida datang. “Mu n g k i n k a m i a k a n menginap di penginapan saja,” ungkapnya kepada Waspada. Berbeda halnya dengan Silalahi, 50, warga Labuhan Batu yang menjemput anaknya, Nurhayati dan tinggal sementara di tempat sanak saudara, sehingga tidak terlalu panik. Hal itu dibenarkan Herlena, staf dosen yang mengungkapkan mahasiswa diliburkan selama 3 hari pasca robohnya gedung dan asrama, dan mahasiswa diizinkan untuk pulang. Namun Kamis (7/4), mahasiswa harus kembali dan melanjutkan aktivitas seperti biasanya. Bagi yang ikut praktik kerja lapangan (PKL) akan diberangkatkan

menuju kota atau desa yang telah ditetapkan sebelumnya. Sedangkan bagi mahasiswa yang merasa kehilangan, untuk melaporkannya pada panitia yang telah ditunjuk. Begitu pula bagi mahasiswa yang ingin membawa pulang barang juga harus melapor pada panitia. “Tidak ada perubahan, hanya pengunduran hari saja bagi mahasiswa tingkat 3 yang akan

PKL,” ujarnya. Risda, 21, mahasiswa tingkat 3, mengungkapkan akan berangkat PKL pada Kamis ke Paya Bakung dan Kelumpang, Binjai, dan telah mempersiapkan semua peralatannya. “Sebelumnya saya menginap di rumah karena rumah saya dekat dari sini, kemudian diberi informasi PKL tetap dilaksanakan di tempat yang telah ditempatkan

dilakukan sebanyak 31 mahasiswa calon da’i ke Harian Waspada untuk mendalami pengetahuan dakwah melalui media cetak. Menurutnya, pengetahuan tersebut sangat dibutuhkan para mahasiswa yang merupakan calon da’i agar dapat menyampaikan dakwah secara lebih luas ke tengah masyarakat sehingga tidak hanya terbatas pada penyampaian secara langsung melalui lisan. “Program dakwah untuk calon da’i secara lisan langsung kepada masyarakat akan dilakukan dengan melakukan kunjungan ke berbagai daerah terpencil di beberapa daerah di Sumatera Utara khususnya yang berpenduduk muslim,” ujarnya. Dalam kesempatan tersebut, Kabag Humas Harian Was-

pada H Erwan Effendi menjelaskan di dalam menyajikan beritanya Harian Waspada lebih bersifat nasionalis religius dan sesuai dengan moto demi kebenaran dan keadilan. Berita yang disajikan kepada pembacanya harus sesuai dengan kode etik jurnalistik dengan selalu menjaga keseimbangan berita agar informasi yang disampaikan kepada masyarakat berguna untuk mencerdaskan dan menambah pengetahuan masyarakat. Dalam menyampaikan berita bersifat religius, lanjutnya, Waspada selalu lebih mengutamakan berita bersifat dakwah dalam bentuk opini yang gerasal dari karya tulis masyarakat dan pemerhati ilmu agama serta berita-berita kegiatan bersifat ibadah, sebutnya.

Berita bersifat religius tersebut lebih banyak ditampilkan pada halaman khusus Mimbar Jumat yang terbit setiap Jumat, tuturnya. Dalam mengisi halaman Mimbar Jumat tersebut, Harian Waspada menerima semua pihak yang mengirimkan karyanya tulisnya dalam bentuk naskah melalui surat yang dikirim hingga melalui email agar memudahkan masyarakat yang menyampaikan opininya. Dalam kesempatan itu, Erwan Effendi juga mengajak rombongan mahasiswa ke dapur redaksi lantai IV guna melihat proses editing dan pembuatan berita sambil menjelaskan proses penentuan penerbitan berita yang layak ditampilkan pada halaman yang sesuai.(m40)

50 Anak Alami Gangguan Mata Akibat Internet MEDAN (Waspada): Masih sangat minim orangtua yang memberikan perhatian serius terhadap masalah kesehatan mata anak-anak setelah berjamjam duduk di depan komputer untuk bermain internet. Bahkan dari 50 siswa sekolah dasar di Medan, mengalami masalah serius pada kesehatan matanya akibat terlalu lama berselancar di dunia maya. Hal ini disampaikan Ketua Badan Kerjasama Organisasi Wanita (BKOW ) Sumut Ny Zakaria Siregar, Rabu (6/4), saat berlangsungnya diskusi “Pola Asuh Keluarga terhadap Anak

Mencegah Penyalahgunaan Internet”. Diskusi yang diprakarsai Naya Kids Foundation diikuti kalangan perempuan dari berbagai profesi. Diantaranya, Paud, psikolog, perhimpunan wanita bank, perwakilan perguruan tinggi serta awak media dengan moderator Rika Yoez. Ny Zakaria Siregar menyebutkan penemuan terhadap 50 anak yang mengalami gangguan mata akibat bermain internet di salah satu sekolah dasar di Medan oleh tim dokter yang melakukan pemeriksaan mata bagi anak SD, terkait kegiatan sosial yang mereka

lakukan belum lama ini membuktikan bahwa, banyak sekali dampak buruk yang diakibatkan oleh penggunaan internet. “Ini termasuk masalah serius yang perlu perhatian oleh pemerintah, para guru maupun orang tua,” kata Ny Zakaria sembari menam-bahkan hasil pemeriksaan mata bagi 100 anak, 50 orang di antaranya memang mengaku sangat sering bermain internet untuk mengerjakan tugas dari sekolah. Peserta diskusi lainnya memberikan saran kepada pihak sekolah, orangtua maupun pemerintah agar

memberikan perhatian terhadap masalah ini. Diharapkan melakukan antisipasi lebih awal dengan cara memeriksakan kesehatan mata anak, karena hal itu adalah aset mereka untuk mencapai cita-cita. Sebelumnya panitia penyelenggara Anum Saskia mengatakan, kegiatan diskusi ini digelar oleh Naya Kids Foundation berkaitan dengan peringatan dua tahun wafatnya almarhumah Onaya Siti Kadarsih atau yang dikenal dengan Naya Miraza tokoh perempuan dan pemerhati anak di Sumatera Utara pada12 April mendatang. (m37)

BC Diprapid Kasus Penyitaan Truk MEDAN (Waspada): Kantor Wilayah Bea dan Cukai Sumut dipraperadilankan di Pengadilan Negeri Medan karena diduga menyita barang seorang pemilik angkutan, Jhon Maju ,tanpa alasan jelas. Selain mempraperdilkan Kantor Bea dan Cukai, pengugat juga menetapkan Kepala Kantor Pengawasan dan Pelayanan Bea dan Cukai Tipe Madya Pabean Belawan sebagai pihak tergugat II. Pada sidang perdana, Kamis (6/4) di PN Medan, Majelis Hakim tunggalYuffery F Rangka

menunda persidangan karena pihak tergugat II tidak hadir. “Untuk tergugat II, surat kuasanya besok harus sudah ada. Sehingga persidangan ini bisa berjalan,” ujarnya. Kuasa Hukum Penggugat Muslim Muis menyesalkan tidak adanya kepatuhan para tergugat, dimana hanya tergugat I saja yang baru memberikan kuasa, sedangkan tergugat II belum memberikan kuasa. Padahal perkara ini, lanjutnya, menggunakan persidangan cepat yang hanya tujuh kali digelar sidangnya sampai

putusan. Menurut Muslim, penyitaan kendaraan milik penggugat mengakibatkan proses distribusi barang menjadi terhambat. Pada mulanya pemohon menerima orderan untuk mengangkut sejumlah barang dari Kota Pekan Baru ke Medan berupa240KotakSirup,185KotakBan. Dalam truk merek Keikok dan Selendang Ban sebanyak 75 goni. Sebagai pemilik angkutan barang penuntut/pemohon sepakat untuk melaksanakannya sesuai dengan perjanjian yang telah disepakati.

Maka, pada hari senin tanggal 30 januari 2011 Mobil Truk Fuso Tronton dengan Nomor Polisi BK 8278 XT yang dikenderai oleh sopir Dewan Sihombing berangkat dari Pekan Baru menuju Medan dengan membawa barang-barang orderan di atas. Namun, tanpa diduga sebelumnya, saat sedang berada di Jalan Tanjung Morawa tiba-tiba personel tergugat memberhentikan Truk Fuso Tronton tersebut. Lalu, memeriksa berkas-berkas dan menggeladah seluruh barang yang ada di atas truk tersebut. (m49)

DM Dan Hipertensi Picu Gagal Ginjal

Nasib Mahasiswa Akbid Senior Tidak Jelas MALANGNYA nasib mahasiswa Akademi Kebidanan “Senior” Medan yang terlunta-lunta. Kebanyakan mahasiswanya dari daerah tidak tahu mau kemana karena gedung asrama mereka telah roboh. Orang tua yang jauh di kampung dipaksa datang untuk menjemput anakanak mereka agar pulang atau membawa kembali dari asrama yang tak mungkin lagi dijadikan tempat bernaung itu. Ida, warga Sialangbuah, salah satu orang tua mahasiwa Akbid Senior yang menyemput anaknya, Selasa (5/4), tungganglanggang mencari persinggahan sementara karena asrama anaknya diliburkan dan tidak bisa ditempati pasca robohnya gedung Asrama Akbid Senior di Jalan Bahagia Pasar I, Kelurahan Titi Rante, Kecamatan Medan Baru, Minggu (3/4) malam. Dia yang berbicara pada warga menanyakan tempat atau indekos yang bisa ditumpangi untuk beberapa hari. “Saya bingung entah mau kemana, walaupun sebenarnya anak saya bilang tidak apa menginap di tempat temannya, tapi saya segan,” ungkapnya. Dia mengungkapkan sangat

Waspada/Muhammad Thariq

PARA mahasiswa Ma’had Aly As-Sunnah dan berfoto bersama di dapur redaksi Waspada.

KSGH Rasyida Peringati World Kidney Day

sebelumnya. Jadi saya ke asrama untuk mengambil barang yang bisa dibawa, “ ungkapnya. Sementara itu, Anju, 21, salah seorang warga mengungkapkan aroma gedung itu bau kotoran dan dikerubuti lalat. “Mungkin hal itu terjadi karena pipa WC yang bocor. Pasalnya gedung yang roboh itu terdapat beberapa kamar mandi,” ujarnya. * Silfa Humairah

Waspada/Surya Effendi

GEDUNG Akbid Senior yang dibangun di kawasan Sungai Babura Medan roboh.

MEDAN (Waspada): Organisasi kesehatan dunia (WHO) melaporkan, kasus diabetes mellitus (DM) tipe 2 mengalami peningkatan cukup pesat di kawasan Asia Tenggara, termasuk Indonesia. Saat ini, jumlah penderita diabetes di Indonesia mencapai 8,4 juta jiwa dan akan meningkat menjadi 21,3 juta jiwa pada tahun 2030. “Kondisi ini telah menjadikan Indonesia berada di urutan empat jumlah penderita diabetes di dunia setelah India, China dan Amerika Serikat,” kata Direktur Klinik Spesialis Ginjal dan Hipertensi (KSGH) Rasyida Prof. dr. Harun Rasyid Lubis, SpPD-KGH kepada Waspada di ruang kerjanya, Rabu (6/4). Selain itu, lanjut Harun, hasil survei Kementerian Kesehatan dan Riset Kesehatan Dasar (Riskesdas) menyebutkan prevalensi hipertensi di Indonesia sudah mencapai di atas 30 persen dari jumlah penduduk dewasa. Meningkatnya jumlah kasus diabetes dan hipertensi tersebut tidak terlepas dari pola hidup masyarakat yang kerap mengkonsumsi jenis makanan cepat

saji (fast food) serta enggan melakukan aktivitas olahraga secara teratur. Dampak selanjutnya, para penderita diabetes dan hipertensi tersebut berpotensi mengalami kerusakan ginjal. Jika ginjal sudah mengalami kerusakan lebih dari tiga bulan, maka kerusakan selanjutnya tidak bisa dihindari lagi sehingga penderitanya harus menjalani terapi cuci darah. “Penyakit gagal ginjal ini tidak memiliki gejala awal yang khas. Akibatnya, banyak kasus gagal ginjal yang ditemukan setelah ginjal pasien tersebut sudah mengalami kerusakan sekitar 10 hingga 60 persen. Padahal, kerusakan ginjal hanya 10 persen saja, sudah dianjurkan untuk cuci darah,” tambah. Menurut Harun, setidaknya ada 700-800 kasus gagal ginjal yang ditemukan di Kota Medan. Bahkan, penyakit gagal ginjal ini tidak hanya diderita kelompok masyarakat lanjut usia (lansia), tetapi sudah dialami kelompok usia muda. “Barubaru ini, kita menemukan kasus gagal ginjal pada seorang wanita berusia 23 tahun,” tambahnya. Terkait dengan Hari Ginjal

Sedunia (World Kidney Day), kata Harun, KSGH Rasyida melaksanakan bakti sosial pemeriksaan ginjal gratis untuk masyarakat. Kemudian, digelar acara syukuran karena KSGH Rasyida telah berdiri selama 15 tahun dan sudah mendapatkan sertifikat ISO 9001:2008. Acara syukuran yang digelar di KSGH Rasyida Jln. DI Panjaitan No. 144 Medan baru-baru ini, turut dihadiri Pj. Gubsu Gatot Pujonugroho, Walikota Medan Drs. H. Rahudman Harahap,WakilWalikota Drs. Dzulmi Eldin, Sekda, Kadis Kesehatan, mantan Walikota Medan Drs. Abdillah, Ak, MBA dan pejabat lainnya. Harun menjelaskan, KSGH Rasyida didirikan pada 10 November 1995 berkat dukungan alm. Raja Inal Siregar dan dr. Masrul Siregar yang saat itu menjabat sebagai Gubsu dan Kakanwil Depkes Sumut. Kemudian KSGH Rasyida diresmikan oleh Ketua DPRDSU M. Effendi Ritonga dengan kapasitas lima mesin cuci darah dan lima tempat tidur. Kini, KSGH Rasyida telah memiliki 30 mesin cuci darah dan 30 tempat tidur. (m25)

Medan Metropolitan

WASPADA Jumat 8 April 2011


Banjir Belum Kering Di Sei Mati BELAWAN (Waspada): Dampak pecahnya tanggul dan meluapnya Sungai Deli, Jumat lalu, masih dirasakan warga di Kelurahan Sei Mati, Kecamatan Medan Labuhan. Jalan dan rumah warga masih tergenang air diperparah dengan buruknya sistem drainase di sana yang belum mendapat perbaikan oleh Pemko. Pantauan Waspada, kemarin, kawasan terparah tergenang air adalah Lingkungan II dan III. Air setinggi 30 cm. Memang kawasan itu, kata warga, menjadi langganan genangan air, tetapi dampak luapan Sungai Deli pada peristiwa Jumat lalu genangan air lama menyusut. Siswa-siswa yang hendak pergi dan pulang sekolah terpaksa membuka

sepatu karena jalanan terendam. Warga telah bermohon agar Pemko membangun parit yang baru dan memperbaiki riol tumpat tetapi belum juga terealisasi. “Sejak Abdillah hingga Rahudman menjadi Walikota, parit dan riol belum juga diperbaiki. Kami sudah jenuh mengadu,” ucap Indah, warga Lingkungan II yang halaman rumahnya masih terendam. Kesal dengan hal itu, warga sekitar bulan Desember lalu membangun paret baru. Namun karena kurang memadai parit itu kembali tumpat. “Kami sudah relakan sebagian tanah kami dijadikan paret tapi pemerintah sepertinya tidak perduli untuk memperbaikinya,” kata Mahmudin, nazir musalla setempat. (h03)

Normalisasi Sungai Mendesak

Waspada/Rustam Effendi

SISWA terpaksa mengangkat sepatu saat melintas di Jalan Tunda Lingkungan II Kelurahan Sei Mati, Kec. Medan Labuhan akibat pemukiman mereka masih terendam banjir.

Anggota DPRD Medan Bantu Korban Banjir BELAWAN (Waspada): Anggota DPRD Kota Medan dari Fraksi PAN HT Bahrumsyah membantu 600 KK korban banjir di Kecamatan Medan Labuhan, Minggu (3/4). Bantuan berupa minuman mineral, roti dan sembako lainnya diserahkan secara simbolis kepada petugas Posko di Pajak Rambe, Lingkungan VI dan disaksikan Ketua Ranting PAN Kelurahan Martubung, Ahmad Dani. “Bantuan ini diberikan karena prihatin dengan nasib korban banjir. Semoga bantuan ini bisa meringankan sebagian beban mereka,” ujar Bahrum seusai memberikan bantuan. Terkait banjir menghantam Medan Labuhan dan sekitarnya, Bahrum meminta PT Agro Jaya Perdana memberikan ganti rugi kepada warga sebab banjir yang melanda daerah ini berbeda dengan yang lain. Diduga ada unsur kelalaian dari perusahaan tersebut karena mereka melakukan pengorekan di benteng Sungai Deli. Luapan air dengan mudah menerobos benteng. Akibatnya rumah warga terendam pada Jumat lalu. (h03)

Waspada/Rustam Effendi

ANGGOTA DPRD Kota Medan dari Fraksi PAN HT Bahrumsyah memberikan bantuan secara simbolis kepada pengurus posko banjir warga Pajak Rambe Lingk 6 Kel Martubung Kec Medan Labuhan, Minggu (3/4).

Reuni FU IAIN Sumut Sukses MEDAN (Waspada): Reuni Fakultas Usuluddin (FU) 85 Institut Agama Islam Negeri (IAIN) Sumut berlangsung hikmad dan sukses di Hotel Garuda Citra Medan, Minggu (3/4). Menurut Wirman L Tobing, Rabu (6/4), kegiatan berlangsung pukul 11.00 hingga 17.00 itu dihadiri sekira 100 alumni antara lain Hasyimsyah Nasution (Dekan FU), Sutan Nafsan Nasution (anggota DPRD Labuhan Batu), Suryadi, Syahmenan Lubis. Dekan FU Hasyimsyah Nasution dalam ceramahnya menekankan para alumni pentingnya merajut silaturrahim serta menggalang ukhuwah Islamiyah. Sebab, dengan modal itu akan bisa membangun FU lebih baik ke depan. Di samping itu, Dekan juga berharap para alumni harus bisa menjaga nama baik almamater denga menjaga kualitas dan kuantitas. Dekan berharap para alumni yang sukses dapat membantu pertumbuhan fakultas yang semakin baik. Sementara itu, Wirman L Tobing, dosen FU yang juga ketua Gepenta (Gerakan Nasional Peduli Anti Narkoba danTawuran) Sumut meminta pemerintah khususnya Pemprovsu dan kabupaten/ kota menerima alumni FU IAIN menjadi pegawai. (m26)

MPI Bukan Pengemis MEDAN (Waspada): Ketua Umum Dewan Pimpinan Nasional Masyarakat Pancasila Indonesia (Ketum DPN MPI) Meher Ban Shah mengatakan anggota MPI tidak boleh melakukan tindakan yang meresahkan masyarakat dan aparat. Penegasan ini disampaikan Meher Ban Shah didampingiWakil Sekretaris Jenderal Arief Haryadian seusai memberikan Surat Keputusan Pelaksana Tugas Ketua Dewan Pimpinan Provinsi Masyarakat Pancasila Indonesia Sumut dari Bukhari Barus kepada Plt Ketua DPP MPI Sumut Bobby Octavianus Zulkarnain, Rabu (6/4) di Medan. Dia meminta Plt Ketua DPP MPI Sumut agar meningkatkan etika dan rasa persaudaraan. Satu hal yang harus diingat jangan membuat proposal untuk meminta sumbangan, karena MPI tidak pernah bermimpi warganya menjadi pengemis. Plt Ketua DPP MPI Sumut Bobby Octavianus Zulkarnain mengatakan, jabatan merupakan amanah besar dari Ketua Umum dan berjanji akan membuat DPP MPI Sumut lebih berarti dan bermanfaat untuk membela kepentingan masyarakat yang tertindas. (m39)

Sertifikasi Guru Dievaluasi MEDAN (Waspada): Pemerinta Provinsi Sumatera Utara bersama pemerintah kabupaten/ kota sepakat untuk melakukan evaluasi pelaksanaan sertifikasi guru di Sumut. Karena setelah beberapa tahun dilakukan sertifikasi terungkap hasilnya belum terukur dan memang belum pernah dilakukan evaluasi terhadap guruguru yang sudah mengikuti sertifikasi tersebut. “Selama ini para guru yang sudah mengikuti sertifikasi tidak menunjukkan peningkatan dalam kualitas mengajar, bahkan sama dengan guru-guru yang belum mengikuti proses sertifikasi . Tidak ada evaluasi dan hasil yang ingin dicapai secara terukur,” kata Kepala Dinas Pendidikan Kota MedanHasan Basri dalam diskusi kelompok jajaran pendidikan pada Musrenbang di Convention Hotel Tiara Medan, kemarin. Hasan Basri yang mengusulkan agar perlu dilakukan evaluasi terhadap pelaksanaan sertifikasi guru tersebut menyatakan, fokus sertifikasi sepertinya hanya pada peningkatan kesejahteraan guru, karena ada tunjungan bagi yang sudah disertifikasi. “Kesejahteraan guru sangat penting, namun hasilnya tidak kalah penting,” tegasnya. Diskusi tersebut mendapat perhatian dari pimpinan Satuan Kerja Perangkat Daerah (SKPD) dengan moderator Arjoni Munir. Hadir Kepala Badan Diklat Provsu Mungkur, Ka Badan Perpustakaan, Arsip dan Doku-

mentasi (BPAD) Sumut, Nurdin Pane, SE, MAP, Kadispora Provsu Drs. Sutanto, Kepala Bappeda Provsu Riadil Lubis, Ketua Komisi E DPRD Sumut E Simamora, Wakil Ketua, Ana br Pulungan dan Safar Siburian. Hasan Basri mengusulkan agar Dinas Pendidikan Sumut menyiapkan formula dan target yang terukur dari pelaksanaan sertifikasi. Hal ini untuk menghasilkan guru-guru yang merupakan tulang punggung dalam peningkatan kualitas pendidikan yang baik dan memang ahli di bidangnya masing-masing. Segera siapkan formula Sementara itu, Kepala Dinas Pendidikan Sumut Syaiful Syafri mengakui jika selama ini belum pernah dilakukan evaluasi terhadap hasil sertifikasi tersebut. Namun demikian, katanya, pihaknya segera akan menyiapkan formula dan mekanisme pelaksanaan evaluasi tersebut mulai tahun 2012 nanti. “Memang selama ini, sertifikasi lebih menekankan pada peningkatan kesejahteraan guru. Akan tetapi, ke depan-

nya hal itu akan menjadi perhatian kami, tentunya dengan melakukan evaluasi terhadap program sertifikasi ini,” katanya. Kecewa Dalam pertemuan itu, Syaiful Syafri juga membahas terlambatnya penyaluran dana Bantuan Operasional Sekolah (BOS) ke sekolah-sekolah. Syaiful juga kecewa masih ada Kadis Pendidikan kabupaten/ kota yang tidak hadir antara lain, kadis pendidikan Tapteng, Samosir, Labuhan Batu dan Karo. Ketidakhadiran kadis pendidikan kabupaten/kota menjadi catatan khusus dan teguran sehingga ke depan tidak terulang lagi. Selain itu, pada Musrenbang, sejumlah masukan dari dinas pendidikan kabupaten/ kota antara lain anggaran untuk rehabilitasi ruang kelas, rehabilitasi laboratorium, pendirian perpustakaan, penguatan sarana dan prasarana SMK, serta meminta pengurangan dana sharing dari daerah serta pendidikan bagi kepala sekolah dan calon kepala sekolah. Selain dihadiri pejabat birokrat, Musrenbang kelompok bidang pendidikan ini juga dihadiri guru besar, profesor dan doktor antara lain Prof. Dr. Effendi Napitulu, MPd, Prof. Dr. Mustsyuhito Solin, MPd, Dr. Parapat Gultom, MENG, Dr. Ir. Indra Nasution, Dr. Phil Ichwan Azhari, dan Drs. Murbanto Sinaga, MA yang juga dihadiri pejabat eselon III Dinas Pendidikan Sumut. (m41)

BNPT berkomitmen melakukan pencegahan terorisme dengan cara melakukan sosialiasi tentang bahaya terorisme kepada masyarakat.“Soal terorisme adalah masalah bersama dan harus ditanggulangi bersama,” ujarnya. Pada kesempatan itu, Anwar memaparkan sejumlah program dan upaya yang dilakukan BNPT dalam menanggulangi terorisme di Indonesia. Salah satunya adalah pemberian pemahaman kepada kalangan akademik atau kampus yang kerap dijadikan sasaran pengkaderan terorisme. Berdasarkan penelitian yang dilakukan BNPT, menurut Anwar, kalangan mahasiswa saat ini

justru menjadi target pengkaderan terorisme. “Anggapan kalau selama ini mereka banyak di pesantren ternyata tidak benar,” ujarnya. Kunjungan Sanusi bersama Direktur Penindakan BNPT, Suhemi dan Kepala Bagian Keuangan BNPT, Rachmat bertujuan untuk menyampaikan rencana sosialiasi penanggulangan terorisme yang akan digelar pada 28 April 2011 di Medan. Acara ini juga bertujuan mensosialisasikan keberadaan serta tugas dan fungsi BNPT secara kelembagaan. Acara ini nantinya akan dihadiri para kepala daerah di Sumut, lembaga penegak hukum dan tokohtokoh masyarakat. (m28)

Reuni Alumni SMPN Kambes Sukses BELAWAN (Waspada): Setelah 30 tahun tidak bertemu, 300 orang alumni SMPN Kambes tahun 1981 dan 1982 menggelar reuni di taman hiburan Siombak Jalan Pasar Nippon Kelurahan Paya Pasir, Kecamatan Medan Marelan, Minggu (27/3). Ketua Panitia Reuni AKP Edy Safari mengatakan reuni berlangsung sukses meski persiapan panitia tiga bulan. “Saya bangga acara ini berlangsung sukses,” katanya didampingi Sekretaris Eri Suriati Harahap Bendahara Khairul Akmal. Dalam kesempatan itu Kepala SMPN Kambes, sekarang SMPN 5 Medan mengatakan proses belajar mengajar di sekolah itu telah berlangsung sekitar 50 tahun dengan jumlah alumni sekitar 15 ribu siswa yang telah banyak berprestasi. “SMPN ini sekolah tertua di Medan Utara,” katanya. Selanjutnya, Kepsek yang baru beberapa bulan menjabat di sekolah itu mengaku perihatin dengan kondisi SMPN 5. “Fasilitas sekolah kita sekarang butuh bantuan dan alumni sangat diharapkan selama tidak dipaksa,” harapnya. (h03)

LPJKD Sumut ini mengkhawatirkan kondisi yang akan lebih berbahaya karena adanya penyempitan alur sungai akibat berdirinya puluhan bangunan-bangunan dan gedung pencakar langit yang tidak memperhatikan alur sungai di Kota Medan. Terkait masalah itu diperlukan segera upaya normalisasi sungai terutama Sungai Babura, Sungai Tuntungan, dan Sungai Baderah serta berbagai aksi penghijauan di sana-sini. “Idealnya alur sungai sebaiknya harus berbentuk Trapesium (berbentuk seperti kuali), supaya sungai tersebut mampu menampung debit air yang besar,” ujarnya. Sementara itu, Ketua LSM-PERINTIS Hendra Silitonga menambahkan Pemprovsu harus segera mensosialisasikan dan merealisasikan program normalisasi sungai, karena program tersebut sebagai salah satu bentuk antisipasi dan meminimalisir banjir di Kota Medan. (csf)

Antisipasi Banjir

Otoritas Bandara Polonia Perlebar Kanal Runway MEDAN (Waspada): Otoritas Bandara Polonia memperlebar dua meter lagi kanal kiri kanan landasan pacu (runway) pada area Bandara Polonia Medan. Hal itu dilakukan untuk mengantisipasi banjir luapan Sungai Babura dan Sungai Deli. “Selain memperbesar, kanal juga akan diperdalam 1 meter agar mampu menampung debit air,” kata GM AP-II Bandara Polonia Medan melalui Humas AP-II H. Firdaus, kepada Waspada, Kamis (7/4).Sebelumnya, Jumat (1/4), kiri kanan runway Bandara tergenang air luapan Sungai Babura. Menurut Firdaus, pelebaran maupun pendalaman kanal kiri kanan landasan pacu segera dikerjakan. “Gorong-gorong juga diperlebar dengan tetap memasang jerejak besi pada pinggir Jalan Adi Sucipto untuk mencegah orang-orang mencoba menyesup ke pesawat pada unjung runway 023,” ujarnya. Sementara banjir yang terjadi Jumat (1/4) belum mengganggu pergerakan penerbangan baik take off maupun landing di bandara itu. “Air yang masuk ke kawasan avron bandara

hanya berimbas pada sisi bahu kiri dan kanan runway (shoulder runway),” ujarnya lagi. Firdaus membenarkan terjadi banjir seminggu lalu akibat gorong-gorong pada bagian utara ujung runway 023 terpaksa dibongkar ketika itu, terhambat deras banjir dari Sungai Babura yang mengalir ke arah Sungai Deli akibat tersumbat-sampah terbawa air yang sangkut digorong-gorong ketika itu. “Dengan diperbesar dan diperlebar, mudahmudahan Bandara Polonia Medan terhindar dari gangguan banjir, sebelum bandara itu pindah ke lokasi baru Bandara Kualanamu,” ujarnya. Sementara solusi mencegah kemacetan arus lalu lintas di pintu masuk Bandara Polonia, pihak AP-II juga sedang menata jalan masuk ke area bandara, disamping akan menutup satu pintu masuk ke arah terminal internasional. Pengguna kenderaan membayar karcis masuk hanya saat keluar bandara. Dengan demikian diharapkan tidak mengganggu arus penumpang akibat pembayaran karcis parkir yang masuk ke Bandara Polonia. Petugas hanya memberikan tanda parkir saat masuk dan membayar saat keluar bandara. (m32)


KEPALA Pusham Unimed Majda El Muhtaj (kanan) memaparkan HAM tentang kesehatan dalam diskusi publik memperingati Hari Kesehatan Dunia 2011, di Fakultas Ilmu Sosial Unimed, Kamis (7/4).

Mahasiswa Target Pengkaderan Terorisme MEDAN (Waspada): Badan Nasional Penanggulangan Terorisme (BNPT) pada tahun ini akan memfokuskan programnya pada pencegahan terorisme. Walau demikian, penindakan tindak pidana terorisme tetap berjalan. Hal ini diungkapkan Kepala Biro Umum BNPT Anwar Sanusi ketika audensi dengan Pelaksana Tugas (Plt) Sekretaris Daerah Sumatera Utara (Sumut) Rachmadsyah di Kantor Gubernur di Medan, Selasa (5/4). Menurut Anwar, masalah terorisme tidak bisa ditanggulangi hanya dengan penindakan sebagaimana dilakukan pemerintah dan penegak hukum selama ini. Atas dasar inilah

MEDAN (Waspada): Survei dari sebuah lembaga swadaya masyarakat menyebutkan penghijauan di bantaran sungai sangat penting untuk mencegah banjir besar yang melanda Kota Medan. Hal itu disampaikan Pembina LSMPERINTIS Robinson Sijabat kepada wartawan terkait banjir yang melanda Kota Medan, Minggu (3/4). Dia mengungkapkan, banjir besar yang terjadi terakhir Jumat lalu, pernah terjadi beberapa kali yakni tahun 1956, 1972 dan terakhir 2002, dimana sejumlah kawasan dan jalan protokol Kota Medan terendam air hingga setinggi 1 sampai 2 meter. Justru banjir ini akan semakin sering terjadi akibat penggundulan hutan di hulu DAS sungai, periode banjir semakin kecil dan skala banjir akan semakin besar. Robinson Sijabat yang juga anggota DP


KEPALA Biro Umum BNPT Anwar Sanusi dan stafnya berfoto bersama Plt Sekdaprovsu Rachmadsyah seusai pertemuan di Kantor Gubsu, Selasa (5/4).

45 Persen Masyarakat Medan Beli Obat Tanpa Resep MEDAN (Waspada): Direktur Eksekutif Jaringan Kesejahteraan/Kesehatan Masyarakat (JKM) Indonesia Dr. H. Delyuzar Sp.PA (K) mengatakan, 45 persen masyarakat Medan membeli obat sendiri di Apotek tanpa resep dari dokter. “Ini disebabkan pendidikan kesehatan di Kota Medan yang belum memadai di masyarakat dan menjadi tantangan tersosialisasinya bahaya resistensi obat terutama antibiotik,” kata Delyuzar pada Diskusi Publik dengan tema “HAM Atas Kesehatan; Menyoal Obligasi Negara Dalam Menanggulangi Penyakit-penyakit Menular Melalui Resistensi Obat” yang diselenggarakan Pusat Studi Hak Asasi Manuia (Pusham) Unimed bekerjasama dengan Dinkes Sumut dalam rangka memperingati Health Day 2011, di Fakultas Ilmu Sosial Unimed, Kamis (7/4). Delyuzar mengatakan, persentase tersebut diperoleh dari survey yang dilakukan oleh JKM Indonesia di Medan dari 200 sampel. Dari survey tersebut, lanjutnya, hanya 35% yang mengetahui cara makan obat antibiotik yang benar. Sebagian besar masih memakan obat antibiotik secara sembarangan, berhenti kalau sudah merasa lebih enak atau merasa sembuh. Bahkan, lanjutnya, 45 persen dari sampel tersebut tercatat makan obat dengan membeli sendiri tanpa resep. Menurutnya, di samping perlunya pendidikan kesehatan bagi masyarakat, tapi fungsi pengawasan apotek menjadi hal paling utama. Delyuzar yang juga sebagai Wakil Ketua Pokja Kolaborasi TB/HIV Sumut mengatakan, tantangan kesehatan di Kota Medan yakni pengobatan Tuberculosis (TB). “Dengan demikian semua orang mendapatkan dan mengkonsumsi antibiotik tanpa indikasi yang tepat dan berisiko terjadinya obat antibiotik,” jelasnya. Kebijakan perlawanan obat Kepala Pusat Studi HAM Unimed, Majda El Muhtaj mengatakan, tahun ini WHO menetapkan tema “Hari Kesehatan Sedunia Tahun 2011 “Combat Drug Resistance; No Action

Today, No Cure Tomorrow” (Lawan Resistensi Obat; Tidak Bertindak Hari Ini, Maka Tidak Ada Penyembuhan Esok), Menteri Kesehatan RI langsung mengeluarkan kebijakan soal resistensi obat. “Saya baru dengar kabar hari ini, menteri mengeluarkan kebijakan baru soal perlawanan obat,” ucap Majda seraya menyebutkan, terkait dengan elemen HAM atas kesehatan harus didasarkan pada ketersediaan, keterjangkauan, keberterimaan dan kualitas. Menurutnya, hal yang kerap menimbulkan pelanggaran HAM kesehatan yakni soal keterjangkauan yang melingkupi non diskriminasi seperti fasilitas kesehatan. “Fasilitas kesehatan, barang dan jasa harus dapat diakses oleh semua, terutama oleh masyarakat yang marginal atau masyarakat yang tidak terlindungi oleh hukum dan dalam kehidupan nyata tanpa diskriminasi,” jelasnya. Majda mengatakan kondisi ini sudah melanggar HAM kesehatan seseorang dimana dalam undang-undang tepatnya pada pasal 25 ayat 1 Duham 1948 disebutkan setiap orang berhak atas taraf hidup yang menjamin kesehatan. Manakala dimensi yang mempengaruhi keterjaminan hak kesehatan masyarakat tidak terpenuhi, maka pelanggaran HAM atas kesehatan masyarakat dipastikan terjadi. Gizi buruk, flu burung, busung lapar, demam berdarah, dan beragam fenomena degradasi kesehatan masyarakat membutuhkan kajian dan proteksi secara baik, maksimal dan bertanggungjawab. Sementara itu, Kepala Bidang Pelayanan Jaminan Kesehatan Masyarakat Dinkes Sumut Agustama mengatakan, penggunaan obat yang tidak rasional menyebabkan resistensi. Misalnya, dalam satu resep ada dua obat yang memiliki fungsi sama, selain itu penggunaan injeksi yang tidak sesuai. “Obat yang mengalami resistensi untuk TB, dampak pengobatannya lebih mahal dan lebih sulit. Untuk mengantisipasi, gunakan antibiotik dengan resep dokter,” sarannya. (m41)

Medan Metropolitan


WASPADA Jumat 8 April 2011

DPRD: Penertiban Parkir Lebih Mendesak Ketimbang Helm Ruas Jalan Di Depan Sekolah Sengaja Ditutup MEDAN (Waspada): Penegakan disiplin lalu lintas yang diterapkan jajaran Poldasu diawali dengan mewajibkan pengendara sepedamotor dan beca bermotor (betor) menggunakan helm standar SNI mendapat sambutan positif dari berbagai pihak. Namun kalangan anggota DPRD Kota Medan berpendapat, penertiban parkir berlapis jauh lebih mendesak ketimbang mewajibkan penggunaan helm standar SNI. “Langkah pihak kepolisian mewajibkan pengendara sepedamotor dan betor menggunakan helm standar SNI, dinilai sangat bagus. Namun, alangkah lebih baik jika mengutamakan penertiban parkir berlapis yang menjadi sumber kemacetan dan kesemrawutan lalu lintas,” kata Ketua Komisi A DPRD Kota Medan Ilhamsyah ketika dihubungi Waspada, Kamis (7/4). Saat ini, menurut Ilhamsyah, kondisi perparkiran di Kota Medan tidak tertata lagi. Bahkan, di lokasi tertentu seperti di depan sekolah, sering terlihat parkir berlapis tiga dan empat sehingga terjadi kemacetan lalu lintas. Bahkan, kondisi parkir yang semrawut berpotensi menyebabkan kecelakaan lalu lintas. “Parkir yang semrawut ini sangat berisiko. Contohnya, di Jln Kesawan.Terkadang ada mobil yang mundur tiba-tiba untuk mencari lokasi parkir, tanpa ada juru parkir yang memberikan aba-aba. Jika kita melaju kencang, maka bisa terkejut, bahkan menabrak mobil itu. Karena itu, saya menilai penertiban parkir sangat mendesak,” ucapnya. Contoh lain di Jln Kejaksaan yang selalu dipadati kendaraan roda empat sehingga selalu terjadi kemacetan. Bahkan sering terlihat parkir berlapis tiga sehingga kawasan itu menjadi

langganan macet. Anggota DPRD Kota Medan lainnya Surianda Lubis menilai, langkah pihak kepolisian menindak pengendara sepedamotor dan betor yang tidak menggunakan helm standar SNI sangat tepat.“Namun, penataan parkir di kota ini jauh lebih penting. Diharapkan kedua agenda tersebut bisa dilaksanakan secara bersamaan. Tapi yang jelas agenda tersebut jangan setengah hati,” kata Surianda. Ditutup Sementara itu, kondisi lalu lintas di Kota Medan semakin semrawut karena sejumlah ruas jalan digunakan untuk kepentingan pribadi yakni antar jemput siswa sekolah tertentu seperti di Jln. Perintis Kemerdekaan depan sekolah Methodist, Jln. Thamrin depan sekolah Sutomo dan lain-lain. Bahkan, ada ruas jalan yang sengaja ditutup dan dijadikan satu arah untuk kepentingan antar jemput anak sekolah. Pemandangan seperti ini sering terlihat di Jln. Dr. Cipto depan Yayasan Singapore Piaget Academy dan Batari School, serta Jln. Bandar Baru depan sekolah Winfield. Pantauan Waspada di lapangan, Rabu (6/4), Jln. Dr. Cipto yang selama ini dua arah, sering kali dijadikan satu arah pada siang hari setelah kedua

Pencuri Emas Dan Jurtul Togel Ditangkap BELAWAN (Waspada): Dua pencuri emas dan seorang penulis judi toto gelap (togel) diringkus petugas Polsekta Medan Labuhan dari lokasi berbeda. Kedua tersangka Prap, 34, dan SW, 32, warga Desa Durian, Kota Tebing Tinggi, ditangkap warga saat mencuri 5 gram emas dengan modus pura-pura sebagai pembeli di Toko Mas Rico Kelurahan Titi Papan, Kecamatan Medan Deli, Kamis (7/4). Menurut informasi di Mapolsek Medan Labuhan, pagi itu Toko Mas Rico didatangi kedua tersangka. Tanpa merasa curiga, pemilik toko Asimir, 59, dan istrinya Susi, 38, melayani keduanya, Namun, saat pemilik took lengah kedua tersangka mengambil emas seberat 5 gram. Kepada petugas, tersangka mengaku aksi pencurian itu telah direncanakan mereka sebelumnnya. Jurtul Sehari sebelumnya, petugas Polsekta Medan Labuhan juga meringkus seorang jurtul togel berinisial Su, 34, dari warungnya di Gang Labu Lingkungan X, Kelurahan Terjung Kecamatan Medan Marelan, Rabu (6/4). Dari tersangka Su, polisi menyita 3 buku dan dua rekap bertulis angka tebakan, alat tulis dan uang Rp394 ribu sebagai barang bukti. Tersangka mengaku menyetir hasil penjualan togel itu kepada bandar bermarga Nainggolan, 40, warga Kelurahan Pekan Labuhan, Kecamatan Medan Labuhan. Kanit Reskrim Polsek Labuhan AKP M Octavianus S, saat dikonfirmasi membenarkan pihaknya melakukan penangkapan terhadap pencuri emas dan penulis togel. “Ketiga tersangka dijerat pasal 363 dan 303 KUHP,” katanya. (h03)

Tiga Pohon Durian Hilang, Salimin Ngaku Rugi Rp10 Juta MEDAN (Waspada): Salimin Sembiring warga Jln. Bakti, Desa Baru, Kecamatan Pancurbatu mengaku mengalami kerugian Rp10 juta, setelah tiga pohon durian berusia belasan tahun yang sedang berbuah hilang dari ladangnya. Dalam pengaduannya di Polsekta Pancurbatu, Selasa (5/4), Salimin menduga ketiga pohon durian yang sedang berbuah tersebut dicuri kawanan penjahat dengan cara memotong batangnya. Menurut Salimin, ada enam batang pohon durian berusia belasan tahun yang ditanam orangtuanya di areal perladangan Desa Baru. Saat itu, seluruh pohon tersebut sedang berbuah. Dalam sepekan, Salimin hanya beberapa kali mendatangi perladangan durian tersebut. Peristiwa pencurian pohon durian itu baru diketahui pada Minggu (3/4) sekira pukul 13:00. Saat itu, Salimin yang mendatangi ladang tersebut, tidak menemukan lagi tiga pohon durian miliknya. “Dari ketiga pohon yang hilang bersama buahnya tersebut, saya mengalami kerugian berkisar Rp10 juta,” ujar Salimin. Kanit Reskrim Polsekta Pancurbatu AKP Faidir yang dikonfirmasi Waspada mengatakan, pihaknya sedang melakukan penyelidikan terhadap kasus tersebut.(m40)

Burung Jalak Hilang, Cici Lapor Polisi MEDAN (Waspada): Tidak senang burung jalak milik suaminya hilang, Cici Suharsih, 43, warga Jln. Karya Jaya, Gg Eka Murni, Kelurahan Gedung Johor, Kecamatan Medan Johor melaporkan tetangganya ke polisi, Selasa (5/4). Saat ditemui wartawan di Polsekta Delitua, Cici mengatakan, burung yang sudah dipelihara selama tujuh tahun itu diketahui hilang pada Senin (4/4) dinihari sekira pukul 04:00. Cici mengaku sempat melihat pelaku yang mengambil burung tersebut dari kandang di dalam rumahnya. Namun, Cici sengaja tidak berteriak karena merasa takut. Namun identitas pelaku diketahui bernama P, 20, yang bermukim tidak jauh dari rumahnya. Kemudian, Cici ditemani sejumlah warga mendatangi P dan mempertanyakan tentang burung jalak tersebut. Namun, P mengatakan, tidak ada mengambil buruk jalak tersebut. Akhirnya, Cici bersama warga menemukan burung jalak tersebut di dalam rumah P. “Tapi kondisi kaki burung itu sudah patah,” ujar Cici. Kendati burung jalak tersebut ditemukan di dalam rumahnya, namun P tetap bersikeras tidak mengakui perbuatannya. Akhirnya, Cici bersama sejumlah warga melaporkan kasus tersebut ke Polsekta Delitua. Kanit Reskrim Polsekta Delitua AKP S Sembiring yang dikonfirmasi wartawan membenarkan adanya laporan tersebut. “Hingga kini kasusnya masih dalam penyelidikan,” ujarnya.(m40)

sekolah tersebut berdiri di kawasan itu. Akibatnya, banyak pengendara kendaraan bermotor yang hendak menuju Jln. Mongonsidi harus memutar arah ke Jln. Ir. H. Juanda. Banyak kendaraan terjebak karena dari persimpangan Jln. Dr. Cipto – Jln. Ir. H. Juanda tidak ada tanda-tanda jalan tersebut dijadikan satu arah. Namun, beberapa meter dari persimpangan terlihat plang di tengah jalan bertuliskan “Satu Arah”. Akibatnya, kendaraan yang datang dari Jln. Ir. H Juanda menuju Jln. Mongonsidi tidak bisa melintas. Bahkan, banyak kendaraan roda empat yang parkir di depan sekolah tersebut. Anehnya, setiap saat terlihat sejumlah personel dari Dinas Perhubungan Kota Medan berada di lokasi itu. “Sepertinya Dishub menerima upeti dari pihak sekolah sehingga memberikan fasilitas khusus. Jalan untuk masyarakat umum saja bisa ditutup dan dijadikan

satu arah. Padahal, selama ini jalan tersebut terdiri dari dua arah,” kata seorang pengendara sepedamotor Rahmad, 47, warga Jalan Mongonsidi Medan. Ketua Fraksi PAN DPRD Kota Medan Ahmad Arif ketika dikonfirmasi terkait persoalan tersebut mengatakan, kuat dugaan pihak Dinas Perhubungan ada menerima ‘upeti’ dari sejumlah sekolah yang mendapatkan fasilitas khusus berupa parkir berlapis hingga menutup ruas jalan. Diminta kepada Pemko Medan agar mengembalikan jalan tersebut menjadi dua arah. “Dinas Perhubungan harus obyektif dalam bekerja. Jangan ada pilih kasih terhadap kelompok-kelompok masyarakat tertentu. Jangan sampai kelompok masyarakat tertentu mendapat fasilitas khusus dan merugikan orang banyak,” tegas Arif. Hal senada dikatakan Surianda Lubis. Menurutnya pembangunan jalan di Kota Medan

menggunakan dana APBD. Jadi, jangan sampai Dishub Medan memberikan fasilitas khusus terhadap sekolah-sekolah tertentu. “Kita minta Dishub membongkar semua jalur khusus yang ada di depan sekolah tertentu. Jangan sampai hakhak pengguna jalan terabaikan karena adanya perlakuan khusus terhadap kelompok masyarakat tertentu. Jln. Dr. Cipto tersebut harus dikembalikan menjadi dua arah,” tegasnya. Kepala Dinas Perhubungan Kota Medan Armansyah Lubis ketika dikonfirmasi Waspada mengaku tidak mengetahui adanya penutupan ruas Jln. Dr. Cipto yang menghubungkan Jln. Ir. H. Juanda dengan Jl. Mongonsidi. “Saya tidak tahu itu. Sayaakanturunkelokasiituuntuk menertibkan parkir yang mengganggu kemacetan di tempat tersebut. Tapi saya kira plang itu bukan milik Dishub, nanti akan saya cek,” katanya. (m50)

Wartawan Gadungan Ditangkap Ngaku Bisa Urus Kasus Narkoba MEDAN (Waspada): Seorang wartawan gadungan yang melakukan penipuan sebesar Rp14.750.000 dengan modus mengaku bisa mengurus kasus narkoba di Polda Sumut, akhirnya ditangkap dan diserahkan ke Polresta Medan. Tersangka Muhammad Abdi Royan Lubis, 38, warga Jln. Karya Jaya, Medan Johor ditangkap korbannya Elmi Lubis warga Jln. Medan Area Selatan dan wartawanTV One dari lokasi pemandian Danau Alam Jaya Tuntungan, Rabu (6/4) malam. Informasi yang diperoleh Waspada di Polresta Medan, Kamis (7/4), kasus penipuan itu bermula ketika abang kandung korban bernama Budi Lubis ditangkap anggota Sat Narkoba Poldasu dalam kasus narkoba. Kemudian korban bertemu dengan tersangka yang mengaku wartawan TV One dan bisa mengurus abang korban agar bebas. Mendengar ucapan tersangka, korban merasa yakin dan meminta pertolongan ke-

padanya. Lalu tersangka meminta uang Rp30 juta dengan alasan untuk biaya pengurusan di Poldasu. Namun korban tidak memiliki uang sebanyak itu dan akan menyediakannya dengan cara menyicil kepada tersangka. Pada pertemuan pertama, Elmi memberikan uang sebesar Rp1 juta kepada tersangka. Kemudian, mereka bertemu sebanyak lima kali dan korban menyerahkan uang kepada tersangka dengan total Rp14.750.000. Setelah hari yang dijanjikan tersangka, ternyata abang korban tidak juga keluar dari tahanan. Lalu, korban menghubungi tersangka melalui telefon dan menagih janjinya. Namun tersangka menghindar dan enggan mengangkat telefon selulernya. Selanjutnya, korban menghubungi kantor biro TV One di Medan guna menanyakan kebenaran tersangka. Namun pihak TV One menyatakan tidak ada wartawannya bernama

Abdi. Akhirnya, korban dan pihak TV One bekerjasama untuk menjebak tersangka. Saat itu, tersangka diminta datang ke kawasan pemandian di Danau Alam Jaya Tuntungan, untuk mengambil sisa uangnya agar genap menjadi Rp 30 juta sepertiyangdimintasebelumnya. Mendengar akan mendapat uang dari korban, tersangka bergegas datang ke Danau Alam Jaya Tuntungan. Setibanya di lokasi, tersangka langsung ditangkap pihak TV One bersama anggota Reskrim Polresta Medan. Untuk pengusutan lebih lanjut, tersangka dibawa ke Polresta Medan dan korban membuat pengaduan. Sementara itu, tersangka mengaku terpaksa melakukan penipuan karena tidak memiliki pekerjaan. Sedangkan uang yang diterimanya dari korban telah habisuntukmenutupikebutuhan keluarganya. “Saya sangat menyesal dan tidak akan mengulanginya lagi,” ujarnya sambil menundukan kepala. (m39)

Anggota TNI Ringkus Pencuri Sepedamotor MEDAN (Waspada): Anggota TNI-AD Jepersom Pasaribu, 31, penduduk Jln. Beringin Raya, Asrama Den Intel, meringkus tersangka pencuri sepedamotor Yamaha Mio di Jln. Matahari Raya, Kelurahan Helvetia Tengah, Kecamatan Medan Helvetia, Rabu (6/4). Dari tersangka DW, 29, penduduk Jln. Setia Bangun, Desa Sunggal Kanan, Kecamatan Sunggal, Kabupaten Deliserdang, disita barang bukti Yamaha Mio BK 2063 XD dan lainnya. Informasi Waspada peroleh di lapangan, sebelumnya korban Yatim, 33, karyawan panglong Pelita Jaya penduduk Jln. Gaperta, Kelurahan Helvetia, Kecamatan Medan Helvetia, di-

suruh majikannya mengantarkan bon bahan bangunan ke Jln. Matahari Raya dengan mengendarai sepedamotor. Sesampainya di tujuan, Yatim memarkirkan sepedamotornya dengan kondisi kunci kontak tetap tergantung, sedangkan dia memberikan bon tersebut kepada orang yang dituju. Tiba-tiba tersangka DW menghampiri sepedamotor itu dan langsung melarikannya. Melihat hal itu, korban mengejarnya sembari meneriaki maling. Saat bersamaan melintas anggotaTNI-AD Jepersom Pasaribu mengendarai sepedamotor dan langsung memboncengYatim lakukan pengejaran. Ketika di tikungan jalan, ter-

sangka bersama sepedamotor hasil curiannya itu terjatuh dan langsung diringkus Jepersom Pasaribu dan korban. Selanjutnya tersangka bersama barang bukti kejahatannya diserahkan ke Polsekta Medan Helvetia. Dalam kasus itu, David, 47, pengusaha panglong Pelita Jaya penduduk Jln. Mayor, Kelurahan Pulo Brayan Kota, Medan Barat, telah membuat laporan pengaduan. Kapolsekta Medan Helvetia Kompol Sutrisno Hadi S, SH, SIK melalui Kanit Reskrim AKP Zulkifli Harahap, SH, mengatakan, tersangka masih menjalani pemeriksaan dan sepedamotor Yamaha Mio diamankan sebagai barang bukti . (m36)

BC Masih Tahan 117 Truk Impor Bekas BELAWAN (Waspada): Bea dan Cukai Belawan masih menahan 117 truk impor bekas milik PT Belawan Indah untuk keperluan berbagai pemeriksaan dokumen. “Truk-truk itu masih diperiksa di gudang importer,” kata Kepala Seksi Penyelidikan dan Penindakan (Kasi P2) KPPBC Madya Pabean Belawan Devid saat dihubungi Waspada, Rabu (6/4). Menurut Devid, proses pemeriksaan truk impor bekas

berjalan lama dan belum bisa dioperasikan. Sebelumnnya, Jumat (25/ 2), dokumen Pemberitahuan Impor Barang (PIB) 117 unit truk impor bekas asal Singapura masuk ke Belawan untuk diproses di Kantor Pengawasan dan Pelayanan Bea dan Cukai (KPPBC) Madya Pabean Belawan. Setelah pemeriksaan PIB dilanjutkan pemeriksaan nomor rangka dan fisik truk. Sesuai Permen Departemen

Perdagangan No 63 tahun 2009 yang diperpanjang dengan Permenperindag No 58 tahun 2010, pemerintah membuka peluang impor barang modal bukan baru seperti truk bekas. Pantauan Waspada, kemarin, sebanyak 117 unit mobil bekas beserta sparepart dan head truk milik PT Belawan Indah (BI) Grup itu sudah tidak berada lagi di dalam gudang dan di dermaga serta lapangan parkir gudang 210 Pelabuhan Belawan. (h03)

Waspada/Rustam Effendi

SEBANYAK 117 unit truk bekas milik PT Belawan Indah (BI) grup masih tertahan di dalam dan parkir gudang 210 Pelabuhan Belawan. Foto diambil Senin (21/3).

Waspada/ME Ginting

SEBUAH plang bertuliskan “Satu Arah” berdiri di Jln. Dr. Cipto dekat Yayasan Singapore Piaget Academy dan Batari School. Foto diambil, Rabu (6/4).

Guru SD Cabuli Enam ABG Di Jembatan Kanal MEDAN (Waspada): Oknum guru SD berstatus pegawai negeri sipil (PNS) diserahkan warga ke Polsekta Delitua karena diduga mencabuli enam anak baru gede (ABG) berusia antara 13 sampai 16 tahun di bawah jembatan kanal Jalan Brigjen Zein Hamid, Medan. Menurut informasi di Polsek Delitua, Rabu (6/4), tersangka SL, 39, warga Jalan Jamin Ginting Gg Katamuli, Kelurahan Kwala Bekala, Medan Johor, diduga telah melakukan perbuatan cabul terhadap keenam anak laki-laki yang masih dibawah umur yakni HS, 16, warga Jalan Brigjen Zein Hamid, A, 16, warga Jalan Brigjen Zein Hamid, AK, 13, warga kanal, AFL, 16, warga kanal, FS,14, warga kanal dan Z, 14. Tersangka oknum guru mencabuli ke enam anak itu dengan memberikan imbalan uang Rp10 ribu kepada para korban. SL yang telah memiliki satu anak tersebut diamankan setelah dipergoki warga akan melakukan perbuatan

cabul terhadap salah satu korban, Selasa (5/4). Sebelumnya warga yang sudah mendengar informasi tindak tanduk tersangka, langsung mengamankan SL yang mengendarai sepedamotor membonceng salah satu calon korbannya saat melintas ke arah bawah jembatan kanal. Ketika diinterogasi warga, korban mengakui perbuatan cabul tersangka SL. Merasa terpojok tersangka akhirnya mengakui perbuatannya, sehingga warga memboyong SL ke Polsek Delitua. Kepada polisi, tersangka mengakui perbuatannya karena merasa senang melakukan hubungan intim dengan anak laki-laki dengan cara oral seks. Kanit Reskrim Polsek Delitua AKP Semion Sembiring yang dikonfirmasi wartawan membenarkan pihaknya menahan SL dan para korban telah membuat laporan pengaduan. (m40)

Dua Jambret Babak Belur Dihajar Massa MEDAN (Waspada): Dua pria, warga Medan, luka parah dihajar massa usai menjambret kalung emas milik seorang remaja putri di Jalan Cemara Medan Timur, Kamis (7/4) sekira pukul 12:00. Dalam kondisi babak belur, kedua tersangka MY, 33, dan JR, 30, dievakuasi ke Polsekta Medan Timur, sedangkan korbannya Putri Sabrina Yuma, 17, warga Jalan Cemara Medan, telah membuat laporan pengaduan. Informasi yang diperoleh di kepolisian menyebutkan, siang itu korban Putri sedang berjalan kaki menuju rumahnya. Persis di depan Pajak Ikan Jalan Cemara, tiba-tiba korban didekati oleh kedua pelaku yang mengendarai sepedamotor Mio dan pura-pura menanyakan alamat seseorang. Saat korban lengah, tiba-tiba tersangka MY menjambret kalung emas yang melingkar di leher korban dan melarikan diri ke arah Jalan Pancing. Sementara korban langsung berteriak jambret.

Sial, kedua jambret terjebak kemacatan arus lalulintas di depan Pajak Ikan Cemara. Warga yang mendengar teriakan korban langsung meringkus kedua tersangka dan langsung menghajarnya hingga babak belur. Kedua pelaku terselamatkan dari amukan warga, setelah petugas Reskrim Polsekta Medan Timur datang ke lokasi mengamankan. Namun, dari kedua pelaku, polisi belum menemukan kalung emas hasil jambretan karena keburu mereka buang, sedangkan sepedamotor Mio yang digunakan untuk aksi kejahatan disita sebagai barang bukti. “Kedua pelaku jambret masih diperiksa sedangkan barang bukti berupa kalung emas masih dicari petugas karena sempat dibuang pelaku. Barang bukti yang disita berupa sepedamotor Mio yang digunakan untuk melakukan penjambretan,” jelas Kanit Reskrim Polsekta Medan Timur AKP Nimrot Aprwin Simanjuntak kepada Waspada. (h04)

Satpam PTPN II Gagalkan Pencurian Sawit MEDAN (Waspada): Lima centeng dan dua Satpam PTPN II Kebun Bandarkhalifah, Kecamatan Percut Seituan, menggagalkan aksi pencurian kelapa sawit (ninja sawit) di lahan perkebunan tersebut, Rabu (6/4) sekira pukul 23:30 WIB. Informasi yang diperoleh di Polsekta Percut Seituan mengatakan, satpam dan centeng kebon itu, Rabu malam, melakukan patroli rutin di kawasan perkebunan tepatnya di Jalan Pasar I Kebon Bandarkhalifah. Dari kejauhan, mereka mendengar suara becak bermotor (betor) lalu melacak keberadaannya. Merasa curiga, anggota satpam Suyetno dan keenam rekannya mencari arah suara becak itu. Namun, belum sempat menyergap, kedatangan mereka tercium dua pelaku pencurian sawit yang langsung melarikan diri masuk ke dalam kebun dan hilang ditelan kegelapan malam. Sedangkan betor dan tandan buah sawit hasil curian ditinggalkan begitu saja oleh kedua

pencuri itu. “Kami lagi patroli malam, tiba-tiba mendengar suara becak yang tak berapa jauh dari tempat kami, lalu kami mencari arah suara itu sambil mengendap-endap, tapi ketahuan juga sehingga mereka langsung lari dan tak terlihat lagi. Jumlah mereka ada dua orang,” beber Suyetno usai membuat pengaduan ke Polsekta Percut Seituan, Kamis (7/4) sekira pukul 11:00. Menurutnya, karena tak menemukan keberadaan kedua pencuri itu, mereka lalu membawa 35 tandan sawit yang berada di atas becak barang bermotor tanpa plat polisi yang ditinggalkan pelaku ke Pos jaga kebun PTP II. Baru Kamis siang, dilaporkan ke Polsekta Percut Seituan sekaligus bersama barang bukti becak dan sawit hasil curian. “Barang bukti 35 tandan sawit sudah disita sedangkan pelaku pencurian keburu melarikan diri,” jelas Kanit Reskrim Polsekta Percut Seituan AKP Anthony Simamora. (h04)

Polisi Dinilai Pilih Kasih Gerebek Judi Micky Mouse MEDAN (Waspada): Penggeberekan judi yang dilakukan petugas Judi Susila Polresta Medan di Yuki Plaza Sukaramai, Sabtu (2/4) malam lalu, dinilai warga sebagai tindakan pilih kasih. Pasalnya, sejumlah warnet yang selama ini disinyalir membuka praktek yang tak jauh dari Yuki Sukaramai sama sekali tidak dirazia. Warga juga menyebutkan razia tersebut diduga dilakukan karena persaingan bisnis sesama pengelola judi warnet berkedok game on-line tersebut, sekaligus memanfaatkan program kerja aparat kepolisian dalam memberantas segala bentuk perjudian di Kota Medan. “Seharusnya warnet-warnet yang dirazia tidak hanya di Yuki Plaza Sukaramai karena banyak warnet di komplek Asia Mega Mas dan di Jalan Asia yang tidak digerebek. Ada apa ini,” ujar A Lai, 45, warga Jalan AR Hakim Medan, kepada Waspada, Rabu (6/4). Menurut A Lai, saat menyaksikan razia di satu warnet Yuki Plaza tersebut, dirinya heran karena polisi tidak merazia lokasi warnet lainnya yang lokasinya terbiang masih berdekatan.“Saya pikir, setelah merazia diYuki Plaza, mereka terus bergerak ke Komplek Asia Mega Mas, ternyata

tidak. Polisi terus membawa beberapa orang pemain, penjaga dan pegawai warnet tersebut ke Polresta Medan,” tutur A Lai lagi. Dia mengharapkan agar aparat kepolisian merazia semua lokasi warnet yang disinyalir membuka praktek judi on-line sehingga tidak menimbulkan kecumburuan sosial. Apalagi sempat terdengar selentingan kalau razia judi karena persaingan sesama pengelola bisnis ilegal tersebut. Sementara itu, Lukas ,35, seorang tukang parkir di komplek Asia Mega Mas juga menyebutkan hampir setiap malam pecandu judi game on-line tersebut terlihat ramai sejak siang hingga larut malam. “Rata-rata mereka etnis Tionghoa dan mainnya berjam-jam baru pulang,” jelas Lukas yang setiap malam malamnya mengutip uang parkir di beberapa warnet di komplek Asia Mega Mas. Menurutnya, pasca penggerebekan yang dilakukan petugas Polresta Medan beberapa waktu lalu di lokasi judi warnet tersebut sempat membuat omsetnya menurun. “Setelah dirazia polisi, beberapa hari kemudian pengunjung warnet menurun. Kini, pengunjung ramai kembali,” jelasnya. (h04)


WASPADA Jumat 8 April 2011

07:00 Daripada Mandi 0 9 : 0 0 D A H S YAT Weekend 11:00 Infotainment INTENS 12:00 Seputar Indonesia Siang 12:30 Film Keluarga : Home Alone 2 15.00 Kabar Kabari 15.30 Sirkus Indonesia 17:00 Seputar Indonesia 17.30 Silet 18.30 Mega Sinetron Putri Yang Ditukar 20.15 Mega Sinetron Anugerah 22:30 BOM: Romeo Must Die


07:00 Inbox 09:00 Liputan 6 Terkini 09:03 Hot Shot 10:00 SCTV FTV Pagi 12:00 Liputan 6 Siang 12:30 SCTV FTV 14:30 Status Selebriti 15:00 Get Married The Series 17:00 Liputan 6 Petang 17:30 Uya Emang Kuya 18:30 Islam KTP 21.00 Pesantren & Rock n Roll 22.30 Liputan 6 Terkini 22:33 Musik Spesial Karnaval 2011

07.00 Animasi Spesial 08.30 Santapan Nusantara 09.00 Layar Spesial 11.00 Jendela 11.30 Sidik Kasus 12.00 LAyar Kemilau 13.30 Cerita Siang 15.00 Baitul Gaul 16.00 Lintas Petang 16.30 Just For Laughs Gags 17.00 Zona Juara 18.00 Tawar Tawaran Tawa 19.00 Supergirl 20.30 Sinema Utama KEluarga 22.00 Sinema Pilihan 23.30 BPL :

07.00 Ripley’s Believe It Or Not 08.00 My Loely Pet 10.00 Motomax 11.30 Topik Siang 12.00 Klik! 14.30 Kampiun Sepakbola Nasional 15.00 Djarum Indonesia Super League 2010-2011 17.30 Apa…Apa…Apa? 18.30 Djarum Super League 2010-2011 21.00 Sinema 23.00 World Most Amazing Video 00.00 Topik Malam

07.00 Sinema Keluarga 09.00 KiSS Plus 10.00 Arti Sahabat 12.00 FTV Siang 14.00 Fokus 15.00 Liga Premier Indonesia 17.00 Cintaku Melati 18.00 Dia Anakku 19.00 Nada CInta 20.00 Cinta Fitri Season 2 21.00 Gebyar BCA 22.00 Dancing With The Star 00.00 Liga Italia Serie A

07.05 Editorial Media Indonesia 08.05 Agung Sedayu 09.30 Fashion Gallery 10.30 Metro Xin Wen 11.05 Oprah Winfrey 12.05 Metro Siang 13.30 Metro Expedition 14.30 Destroyed In Second 16.05 Super Nanny 16.30 Metro Highlights 17.05 Metro Hari Ini 18.05 Metro Hari Ini 19.05 Metro Files 20.05 Metro Exposed 21.05 Top Nine News 21.30 World Cinema 22.05 World Cinema 23.30 Metro Sports

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan


07.30 Kuliner Pilihan 08.00 Gula Gula 08.30 Koper Dan Ransel 10.00 Ala Chef 11.00 Insert 12.00 Hidup Ini Indah 12.30 Ngulik 13.00 Peppy The Xplorer 14.00 Bioskop Keluarga 16.00 Gaul Bareng Bule 16.30 Investigasi Selebriti 17.00 Reportase Investigasi 18.15 Termehek Mehek 19.00 Bioskop TRANS TV 23.00 Bioskop TRANS TV 01.00 Sinema Dinihari

08.30 Enterpreneur 09.00 Property Agung 09.30 Tinju Legendaris 10.30 Soccer One 11.00 Prediksi 12.00 Kabar Siang 13.00 Damai Indonesiaku 15.00 WBO Asia Pasific Championship 16.00 eMKa Files 16.30 Tahukan Anda 17.00 Tepi Jaman 19.00 Warisan Dunia 20.00 Apa Kabar Indonesia 21.00 Bumi Dan Manusia 22.00 Kabar Malam 23.45 Liga Spanyol

08.30 The Penguin 09.00 Mong 10.00 Tamu Gokil 10.30 Kungfu Chef 11.00 Ngemix Kuliner 11.30 Kuliner Lebay 12.00 Kanjeng Mami 13.00 Gus Muh 14.00 One Cubed 14.30 Petualangan Panji 15.00 Ill Feel 15.30 Fokus Selebrity 16.30 Berita Global 17.00 Spongebob 18.00 Super Hero Kocak 19.00 Big Movies 21.30 Big Movies

07.30 Selamat Pagi 08.30 Cooking Paradise 09.30 Suamiku Hebat 10.00 Happy Holiday 11.30 Redaksi Siang 12.00 Selebrita Siang 12.30 Si Bolang Jalan Jalan 13.00 Buku Harian Si Unyil 14.00 One Stop Football 15.00 Basecamp 16.30 Redaksi Sore 17.30 Tahu Rasa 18.00 Benar-Benar Unik 18.30 Wara Wiri 19.00 Gara Gara Magic 21.00 Pas Mantab 22.00 Scary Job 22.30 Pemberani **m31/G

Reva Band Berharap Tak Sekedar Lewat

Pangeran William bersama Kate Midleton/ant/rtr

PERSAINGAN antar band pendatang baru belakangan masih tetap sengit dan samasama punya mimpi dan asa menggebu, memicu Reva band mencoba memberikan alternatif warna baru di industri musik nasional. Band dibentuk di Yogyakarta,27Juli2007silam digawangi Edwin (vokal), Gusti (gitar), Evan (Keyboard), Dniel (bas) dan Abdhu (drum) ini, mengadu peruntungan dengan melansir album perdana bernuansa Pop Alternatif bertajuk Cerita Kita produksi Shelmer Records. “Butuhpergulatandanproses kreatif panjang tiga tahunan sebelum Reva menemukan format bermusik pop alternatif. Nah, dengan mengusung warna baru cenderung bergenre Britpop, kami punya mimpi dan

asamenggebumeninggalkanjejak sukses pada gumintang musik Indonesia,” papar Gusti, pentolah Reva band kepada Waspada di MU Café Jakarta, baru-baru ini. Menurut gitaris yang produktif menciptakan lagu ini, pihaknyamemangtakinginburuburu masuk dapur rekaman, kendati cukup banyak tawaran dari beberapa produser sejak tahun lalu. “Kami sadar, tak gampang menembus pasar musik industri nasional yang setiap hari terus dijejalibandpendatangbaru.Kini, dengan mengandalkan singel CepatPulangsekaligusmemberikan sederet alternatif bunyi berkualitas yang enak didengar dan memanjakan telinga penikmat musik, kami berlima berharap debut perdana ini tak sekedar lewat alias begitu saja dilupakan

penikmat musik,” tandas Gusti seraya menjelaskan makna panji Reva merupakan kepanjangan dari Replay dan Value. Atau memberi nilai baru dalam hidup atau hidup kembali. “Berangkat dari filosofi tersebut, kami berharap Reva band mampu eksis dan berkibar. Hingga kelak menjadi salah satu band legendaris,” harapnya. Produser Shelmer Record - Henri Siregar menambahkan, ditopangkemampuanmusikalitas dan pengalaman manggung cukup mumpuni, pihaknya berani menghadirkan Reva band ke masyarakat. “Musik mereka berbeda, asyik dan enjoy didengar. Namun, tetap memiliki kualitas beat yang rancak dan berpotensi membuat penikmat musik bergoyang,” tandas Henri setengah berpromosi. * (AgusT) Play Bee diabadikan di Garuda Plaza Hotel, usai menikmati durian party akhir pekan lalu dalam rangkain tur Sumateranya bersama Naff, dan Vagetoz

2 Miliar Orang Saksikan Pernikahan William

Play Bee Kompromi Pasar

SEORANG menteri Inggris mengatakan Rabu (6/4) bahwa lebih dari seperempat populasi dunia berharap bisa menyaksikan tayangan siaran televisi pernikahan kerajaan Inggris pada bulan ini antara pangeran William dan Kate Middleton. Seperti dikutip dari Reuters juru bicara perdana menteri Inggris David Cameron mengatakan dua miliar orang akan menyaksikan pernikahan itu. Menteri Kebudayaan Jeremy Hunt mengatakan persiapan untuk perayaan tanggal 29 April itu diharapkan dapat berjalan dengan baik. “Menteri kebudayaan itu mengatakan (pernikahan itu) tampaknya akan menjadi acara global terbesar yang disaksikan sekitar dua miliar orang di seluruh dunia,” kata juru bicara itu. Beberapa laporan memperkirakan bahwa acara itu akan disaksikan 2,5 miliar orang. Jumlah yang sama juga dicapai ketika digelar pemakaman putri Diana tahun 1997. Ada sekitar 6,9 miliar orang di dunia, berdasarkan data dari laman biro sensus AS.(ant)

Reva Band

Madonna Tak Diperiksa FBI


JURU bicara Madonna, Selasa (5/4) mengatakan penyanyi itu maupun badan amal ia dukung di Malawi tak diperiksa biro penyelidik federal Amerika Serikat,FBI. Menurut beberapa laporan media tanpa sumber, badan amal pendidikan internasional didukung penyanyi tersebut, Success for Kids, sedang diselidiki agen-agen Biro Penyelidikan Federal di Los Angeles karena adanya dugaan penyimpangandankegiatanyangmencurigakan. Laporan itu beredar setelah berita lain pada Maretbahwa badanamallainyangjugadidukung Madonna, Raising Malawi, telah membatalkan rencana untuk membangun sekolah buat anak perempuanmiskindiMalawikarenapenanganan yang kacau. Dewan pengurus yayasan amal tersebut dibubarkan. “Dalam beberapa hari belakangan sejumlah

desas-desus liar dan sama sekali dusta mengenai kedermawanan Madonna — disebarkan para pemilik lahan di Internet (blogger) dan tabloid— telah bermunculan di Internet,” kata juru bicara Lis Rosenberg. “Baik Madonna maupun Rasing Malawi tidak diperiksa FBI atau IRS (lembaga pajak AS). Patut disayangkanorangtelahmemilihuntukmengatakan banyak hal tentang Raising Malawi dan Madonna, padahal itu tidak benar.” Liz Rosenberg mengatakan penyanyi itu tetap terikat komitmen dan memusatkan perhatian pada apa yang terjadi dalam membantu anak-anak di Malawi. Ia belum menanggapi permintaan komentar mengenai badan amal Success for Kids. Jejaring badan amal tersebut menyatakan Madonna adalah pemimpin Dewan Direktur lembaga itu.(ant)

AKHIRNYA Play Bee-grup band yang baru merilis album perdananya ‘Bintang Terang’ denganberathatiharusmengikuti selera pasar dengan mengaransir ulang lagu milik penyanyi Malaysia Saleem atas permintaan produsernya. Bagi Play Bee, mengaransemen ulang lagu lama yang pernahhits,tentumenjaditantangan tersendiri. “Kita merasa tertantang mengubah musik lagu Hakekat Sebuah Cinta milik grup bandMalaysiaitu,walaupuntidak secara menyeluruh,” ujar Irul gitaris Play Bee Band bersama Ravon (vokal), Elle (gitar I), Ryo (bass) dan Aris (drum) saat menikmati durian party di Garuda Plaza Hotel (GPH), usai tampil

bersama Naff,Vagetoz dan Nadia Reefa Band di Sensasi Hits Clas Mild. Irulmenyebutkan,tantangan tersebut menjadi pelecut lebih menghadirkan Hakekat sebuah Cinta dengan kemasan baru menjadi menarik hingga diharapkan semakin membuat penggemar musik semakin bergairah. Selain Play Bee, acara durian party di Garuda Plaza Hotel tempat pendukung acara Sensasi HitsTour Sumatera bersama Clas Mild menginap juga dihadiri Naff dan Vagetoz. Play Bee sendiri sebagai pendatangbaru,selainmenampilkan hits milik Saleem, juga mempersembahkan lagu sendiri ada

sekitar sembilan lagu dikerjakan dalam balutan warna pop rock. Irul dan kawan-kawan yakin merekabisameramaikanindustri permusikan tanah air.Walaupun diakuinya persaingan sejak awal 2000-an semakin berat, apalagi band-band yang muncul selalu menghadirkan karya bagus dan kerap diterima masyarakat. “Tetapi, sejak berdiri 2008 lalu kamimeyakinibisamensejajarkan diri dengan band lain, asalkan mampu menghasilkan karya terbaik,” ucap Irul. Karakteristik suara Ravon lebih mengarah ke classic rock, syair lagu juga gampang dicerna serta tema-tema yang lucu mereka berharap mampu meraup pangsa pasar.(m19)

Surat Cinta Elizabeth Taylor Dilelang Sebuah koleksi surat cinta pertama ditulis mendiang ElizabethTaylor di kala muda dikabarkan akan dijual melalui lelang. Seperti dikutip dari laman BBC, sebanyak 66 surat ditulis aktris lawas itu ditujukan kepada kekasih pertamanya, Wiliam Pawley, anak mantan duta besar AS, Ketika itu Liz Taylor berusia 17 tahun. Surat itu dibuat antara Maret dan November 1949. Surat-surat itu memberikan gambaran awal ketika Elizabeth mulai menuju kepopulerannya di Hollywood. Aktris itu meninggal pada usia79tahundiLosAngelesbulan lalu setelah ia mengidap penyakit hati. Dalam sebuah surat tertanggal 28 Maret, Elizabeth menulis, “Saya ingin hati kami saling memiliki lewat keabadian.” “Saya ingin kita selalu menjadi kekasih, bahkan setelah kita menikah selama 75 tahun

dan setidaknya memiliki selusin cucu,” Dalam surat lainnya ia mengatakan kepada Pawley ia sepenuhnya yakin bahwa, kekasihnyaituadalahsatusatunya “priadiduniainiyangpernahsaya cintai.” Di bulan September, aktris itu menulis mengenai pengembalian cincin pertunangannya diminta kekasihnya, tetapi engganmunculuntukmengakhiri hubungannya dan mengatakan “saya tahu dengan seluruh hati dan jiwaku bahwa ini bukan akhir dari hubungan kita.” Pemenang Oscar itu kemudian tercatat pernah menikahi tujuh laki-laki. Koleksi -koleksi surat itu dikumpulkan dua tahun lalu dari Pawley, yang kini sudah pensiun, ujar juru bicara lelang RR. “Kami jarang menemui koleksi sekaya ini, surat surat itu

Elizabeth Taylor/ dalamkondisiaslinya,”ujarBobby Livingston. “William Pawley secara jelas menyukai surat -surat itu selama bertahun tahun” Lelang online itu akan dilakukan pada 12 dan 19 Mei 2011.(ant)

A8 Luar Negeri Dubes Jepang Di Abidjan Diselamatkan Pasukan Prancis ABIDJAN, Pantai Gading (AP): Pasukan Prancis dengan mengenakan kacamata malam turun dari helikopter untuk menyelamatkan Dutabesar Jepang untuk Abidjan dan tujuh orang lainnya, kata Menteri Luar Negeri Prancis Kamis (7/4), pada saat orang kuat Pantai Gading masih bersembunyi di bunker bawah tanah di tengah pertempuran di kota itu. Pasukan Sekutu dengan presiden yang diakui internasional Pantai Gading Alassane Ouattara telah menggempur gerbang rumah kediaman Laurent Gbagbo namun takut akan membunuh pemimpin yang membangkang itu dan para pendukungnya. Kira-pkira 46 persen dari Pantai Gading memilih Gbagbo dalam pemilihan November yang menyebabkan kekacauan politik di negara tersebut. Gbagbo telah membuat satu seni untuk tetap berkuasa selama beberapa tahun pada akhir masa mandatnya dan kini dia menghadapi selubung, perang setiap harinya, bahkan setiap jamnya. “Dia tidak akan menyerah,” kata Meite Sindou, seorang jurubicara pembantu Ouattara, orang yang diakui sebagai presiden yang terpilih secara demokratis Pantai Gading. “Kami terpaksa memilih dia.” Pasukan yang bersekutu dengan presiden Pantai Gading yang diakui internasional mengatakan mereka berencana akan mengkonsolidasi pasukan Kamis dan menyerang lagi kompleks di mana Gbagbo masih bersembunyi di bunkernya dan menolak untuk menyerah. Serangan udara telah menimbulkan lobang-lobang di tamannya dan merusak depot persenjataan dan para pejuang telah mengepung rumah itu dan menggempur ger-

bangnya. Dutabesar Jepng untuk Pantai Gading mengatakan, Rabu, dia dan 12 orang telah bersembunyi di sebuah ruangan setelah rumahnya diserang oleh “tentara bayaran”, yang menembakkan roket dan meriam dari bangunan itu. “Tak ada keraguan, mereka adalah serdadu bayaran. Mereka masuk rumah saya pagi hari ini, menembakkan RPG (roket). Saya sendiri dan sekitar 12 orang mengunci diri di dalam ruangan yang memiliki pintu tahan peluru,” kata Okamura Yoshifumi. Rumah Yoshifumi berada di pinggiran utara Cocody di Abidjan, tempat rumah Gabgbo dikepung oleh pasukan yang setia pada presiden Ouattara, yang berusaha untuk memaksanya (Gbagbo) menyerahkan kekuasaan. “Antara pukul 09:00 dan 14:00 mereka menembakkan senapan mesin, meriam, RPG dari rumah saya. Saya tidak tahu ke arah mana mereka menembak karena saya mengunci diri. Itu (serangan) dahsyat,” kata diplomat tersebut. “Ada empat orang, agen keamanan dan tukang kebun, yang telah hilang. Ada banyak darah di rumah ini, peluru di mana-mana. Saya tidak tahu apakah keempat orang itu masih hidup. “Mereka menjarah, mencuri apa saja yang bernilai di rumah ini. Mereka pergi seki-

Polisi Malaysia Menangkap Lagi 76 Tahahan Yang Lari KUALA LUMPUR, Malaysia (AP): Kepolisian Malaysia mengatakan Kamis (7/4) mereka telah menangkap lagi 76 imigran ilegal yang melarikan diri dari satu pusat tahanan dalam satu kerusuhan beberapa hari lalu. Kepala Polisi Negri Sembilan Osman Salleh mengatakan pihak berwenang masih melakukan pencarian atas 33 tahanan lainnya yang melarikan diri dari fasilitas itu Senin lalu. Sebagian besar imigran yang melarikan diri itu berasal dari Myanmar yang seyogyanya dideportasi setelah ditahan karena memasuki Malaysia secara ilegal. Kira-kira 1.000 tahanan di pusat penahanan itu membakar blok sel tahanan dan meruntuhkan pagar rumah tahanan dalam kerusuhan menyusul pembakaran tersebut. Para pejabat mengatakan mereka frustrasi dengan apa yang mereka anggap tahanan itu terlalu padat dan banyak tahanan yang ditahan dalam periode panjang. Osman mengatakan Kamis banyak dari yang membobol tahanan itu berusaha bersembunyi di hutan dan desa-desa terdekat.(m10)

Pecandu Narkoba Habiskan AS$320 Miliar Pertahun MEXICO CITY, Mexico (Antara/RIA Novosti-OANA): Sekitar 284 juta pecandu narkotik dan obat-obatan terlarang di seluruh dunia menghabiskan AS$320 miliar per tahun guna membeli narkoba secara ilegal, kata Kepala Kepolisian Federal Mexico. Berbicara dalam konferensi internasional terkait pengendalian narkoba di Cancun pada Rabu (6/4), Menteri Keamanan Publik Mexico, Genaro Garcia Luna, mengatakan ganja merupakan jenis obat terlarang yang paling banyak dikonsumsi secara luas, dengan 119 juta pengguna di seluruh dunia. Sekitar 53 juta orang menggunakan amphetamin, 22 juta orang tergantung pada opium dan obat-obatan sejenis, dan sekitar 19 juta orang merupakan pengguna kokain, kata pejabat itu. Garcia Luna menegaskan penyelundupan narkoba dan kejahatan yang berhubungan dengan narkoba merupakan ancaman serius bagi Mexico, yang menjadi pusat transit narkoba di Amerika Latin. Presiden Mexico Felipe Calderon menyatakan perang terhadap kejahatan terkait narkoba sebagai prioritas utama kepemimpinannya setelah menjabat pada 2006. Tingginya pendapatan dari perdagangan narkoba telah mengganggu upaya pemerintah itu.

tar pukul 14 tapi mereka di depan rumah. Saya takut mereka akan datang lagi,” katanya. Minta bantuan Banyak wartawan asing dan diplomat senior dari Jepang, Israel dan India meminta bantuan Amerika Serikat, Rabu, untuk melarikan diri dari lingkungan permukiman yang dikepung di ibukota Pantai Gading, Abidjan, kata pejabat AS. William Fitzgerald, wakil pembantu menteri luar negeri untuk urusan Afrika, bahwa sekitar 20 wartawan yang terperangkap di hotel Novotel di lingkungan tempat tinggal itu “telah mendekati kami, dan sejumlah misi lain yang terle-

tak di lingkungan Cocody telah mendekati kami”. Dia mengatakan orangorang dalam misi-misi yang mengatakan “bahwa mereka perlu dievakuasi” itu dari lingkungan tempat tinggal Cocody, tempat duta besar Jepang, duta besar atau kuasa usaha Israel dan duta besar India. Dubes Jepang untuk Pantai Gading sementara itu mengatakan pada AFP, Rabu, bahwa dia dan 12 orang telah bersembunyi di sebuah ruangan setelah rumahnya diserang oleh “tentara bayaran”, yang menembakkan roket dan meriam dari bangunan itu. Fitzgerald menuturkan

bahwa para diplomat AS telah menyampaikan permintaan mereka, yang dibuat dalam 24 jam terakhir, kepada Misi PBB di Pantai Gading (UNOCI) dan pasukan Licorne Prancis yang telah mengerahkan tentara di negara itu dan dapat mengevakuasi mereka. “Kami (AS) tidak memiliki pasukan di wilayah itu (Pantai Gading). Kami pada gilirannya kemudian akan berkoordinasi dengan UNOCI dan Licorne,” kata Fitzgerald. Dia menambahkan bahwa para wartawan dan diplomat itu dapat dievakuasi ke pangkalan Licorne, di antara tempat-tempat lainnya. “Situasi keamanan, khu-

WASPADA Jumat 8 April 2011

Bom Ditemukan Di Dalam Mobil Di Moskow Pusat

susnya di lingkungan tempat tinggal Cocody, memburuk, di mana anda memiliki dua pasukan yang berhadapan, satu terhadap yang lainnya. Menjadi jauh lebih sulit untuk mengoperasikan kedutaan besar,” katanya. Dia mengatakan dia memperoleh informasinya dari kedutaan besar AS di Pantai Gading. Permintaan evakuasi itu terjadi ketika pasukan yang setia pada presiden yang diakui masyarakat internasional Alassane Ouattara mundur dari serangan akhir di bunker orang kuat Laurent Gbagbo setelah menemui perlawanan hebat dari militernya. (m10)

MOSKOW, Rusia (Antara/Xinhua-OANA): Polisi menemukan sebuah bom di dalam mobil di pusat Moskow Kamis (7/4), menurut sumber penegak hukum kepada media setempat. Bom itu, yang berkekuatan 400 gram TNT, ditemukan di dalam sebuah limosin Mercedes Benz yang dihentikan di jalan Kutuzovsky, satu jalan yang digunakan oleh para pejabat Kremlin, kata kantor berita RIA Novosti mengutip sumber itu menjelaskan. Bom itu penuh dengan kepingan besi dan sekrup, dan sopir yang ditahan memiliki pistol, kata laporan itu. Media lokal melaporkan bahwa perangkat peledak lain juga ditemukan di satu mobil di barat daya Moskow pada Kamis.

Militer Tangkap 100 Wanita Di Desa Tepi Barat NABLUS, Palestina (Antara/AFP): Tentara Israel menyerbu satu desa dekat Nablus Kamis (7/4), menangkap lebih dari 100 wanita saat mereka memburu pembunuh satu keluarga Israel, kata pejabat setempat. Ratusan tentara memasuki desa Awarta segera setelah tengah malam dan menerapkan jam malam setelah mereka mulai mengumpulkan para perempuan, kata kepala pemerintah setempat, Tayis Awwad. Mereka terus melakukan pencarian dari rumah ke rumah pada malam hari, katanya. Sumber keamanan Palestina membenarkan informasi yang sama. Pihak militer telah melakukan beberapa kali pencarian di desa selama empat pekan terakhir, menangkap sejumlah warga desa setelah pembunuhan atas satu keluarga pada bulan lalu yang tinggal di dekat tempat pengungsian Itamar. Namun operasi pencarian pada Kamis menjadi yang pertama mereka menangkapi para perempuan, kata Awwad. Sejak 11 Maret, desa yang terletak di selatan Nablus itu telah menjadi pusat pencarian besar-besaran setelah pembunuhan mengerikan yang terjadi atas sepasang warga Yahudi dan tiga orang anak mereka yang masih kecil, salah satunya bayi, saat mereka tidur di rumah mereka dekat tempat penampungan Itamar.

Pengebom Bunuhdiri Tewaskan Polisi Pakistan


SEORANG polisi berjalan dekat satu kendaran yang porak-poranda setelah satu serangan bom bunuhdiri di Quetta, Pa-

kistan, Kamis (7/4). Seorang pengebom bunuhdiri menabrakkan kendaraannya yang sarat bahan peledak ke rumah seorang perwira senior kepolisian di Quetta, baratdaya Pakistan, yang menewaskan sekurang-kurangnya satu orang dan mencederai empat orang, termasuk dua anak-anak, kata polisi.

Pemberontak Libya: Serangan NATO Kenai Pasukannya AJDABIYA, Libya (AP): Para pejuang pemberontak menyatakan serangan udara NATO menghantam pasukan mereka Kamis (7/4) dalam suatu tindakan yang nampaknya sebagai satu kekeliruan yang makin meningkatkan kemarahan tentang buruknya koordinasi dengan militer Sekutu dalam usaha melumpuhkan pasukan Libya. Sekurang-kurangnya dua pemberontak tewas dan lebih dari satu lusin cedera, demikian kata seorang dokter. Serangan itu — dekat garis depan di luar kota pelabuhan minyak sebelah timur, Brega — merupakan peristiwa kedua kalinya serangan udara NATO terhadap pasukan pemberontak dalam kurang dari satu pekan dan mengundang kecaman dari para pejuang yang berjuang menentang militer Moammar Khadafi yang lebih besar dan berpengalaman. “Jatuhlah, jatuhlah NATO,” teriak salah seorang pejuang ketika lusinan kendaraan mereka meluncur menuju ke timur ke arah kota yang dikuasai pemberontak di Ajbadiya. Di Brussels, seorang pejabat NATO mengatakan Sekutu akan melihat klaim terakhir pemberontak namun dia tidak


WARGA Palestina melakukan survei kerusakan di lokasi — yang diduga sebagai terowongan penyelundupan — yang digempur pesawat Israel malam sebelumnya di Rafah di selatan Jalur Gaza Kamis (7/4). Empat terowongan dijadikan sasaran oleh militer Israel yang mengatakan terowongan itu digunakan oleh militan untuk menyelundupkan senjata dari Mesir ke Gaza. Tidak ada laporan tentang korban.

punya informasi lebih lanjut. NATO ‘sangat berhati-hati’ dalam serangan-serangan udaranya di Libya karena pasukan pemerintah mulai menggunakan warga sipil sebagai tameng manusia, demikian dikemukakan wakil panglima operasi NATO, Rabu. “Pasukan Libya semakin sering beralih ke taktik nonkonvensional, membaur dengan lalu-lintas jalan raya dan menggunakan warga sipil sebagai tameng bagi pergerakan maju mereka,” kata Laksamana Muda Russell Harding pada jumpa pers. “Pasukan NATO secara khusus berhati-hati untuk menghindari pencederaan pada warga sipil yang berada sangat dekat dengan pertempuran, seringkali karena taktik pasukan pemerintah,” katanya di pangkalan utama yang mengawasi operasi Pakta Pertahanan Atlantik Utara (NATO) di Libya. Perwira tinggi Angkatan Laut Kerajaan Inggris itu mengatakan, pasukan Libya yang menggunakan taktik ini bergerak ke timur “menuju Ajdabiya, yang menimbulkan anca-

man langsung bagi kota itu dan daerah luarnya ke Benghazi.” “Untuk menanggapi hal itu, NATO mengupayakan serangan-serangan langsung terhadap pasukan yang bergerak maju dan rantai perbekalan logistik dan amunisi mereka,” kata jendral itu. “NATO juga menggunakan serangan-serangan udara operasi untuk memutuskan rute pemasokan utama antara Ajdabiya dan Misrata,” katanya, menunjuk pada kota berpenduduk 500.000 orang di Libya barat yang dikepung oleh pasukan Khadafi selama lebih dari sebulan. Mengenai kontroversi bahwa serangan-serangan NATO berpihak dalam konflik di Libya, dia mengatakan, “Kami akan menyerang setiap pasukan yang bermaksud mencederai warga sipil.” Harding menambahkan, lebih dari 100 jet tempur dan pesawat pendukung NATO saat ini telah dikerahkan, serta selusin kapal perang yang semuanya beroperasi di bawah komando NATO. Wakil Menteri Luar Negeri Libya, Khaled Kaim, menuduh Inggris mengebom sebuah la-

dang minyak di Al-Sarir di wilayah tenggara negara itu. “Pengebom tempur Inggris menyerang ladang minyak Al-Sarir, membunuh tiga penjaga di tempat itu dan melukai beberapa orang lainnya yang sedang bekerja di ladang minyak tersebut,” kata Kaim dalam konferensi pers Rabu (6/ 4). Serangan udara tersebut merusak lokasi dan terutama pipa penyalur yang menghubungkan Al-Sarir ke pelabuhan Tobruk, yang berada di bawah kendali pemberontak, katanya menambahkan. Sebuah kapal tanker bertolak dari Tobruk Rabu membawa pengiriman pertama minyak sejak pemerintah pemberontak memenangkan pengakuan dari beberapa negara. Kapal tanker itu merapat sehari sebelumnya dalam rangka memuat kiriman minyak mentah Libya senilai AS$100 juta untuk diekspor, yang pertama sejak serangan udara koalisi internasional dimulai pada 19 Maret dan dimaksudkan untuk membiayai perjuangan pemberontak terhadap kekuatan pemimpin Moammar Khadafi. (m10)

PM Qatar: Negara Teluk Harapkan Saleh Mundur DOHA, Qatar (Antara/ AFP): Negara-negara Teluk yang memimpin upaya mediasi untuk mengakhiri krisis politik di Yaman berharap mencapai kesepakatan dengan Presiden Ali Abdullah Saleh agar presiden yang diperangi itu berhenti, kata PM Qatar Kamis (7/4). Anggota Dewan Kerja Sama Teluk (GCC) “berharap untuk mencapai kesepakatan dengan Presiden Yaman untuk mundur,” kata Sheikh Hamad bin Jassem al-Thani menurut kantor berita QNA. Para menteri luar negeri dari GCC pada Minggu setuju memulai kontak dengan pemerintahYaman dan oposisi, “dengan ide-ide untuk mengatasi arus situasi”. Suratkabar harian Qatar, Al Arab mengatakan, usulan negara-negara Teluk yang disampaikan kepada partai-partai Yaman menyerukan agar Saleh turun dan mengalihkan kekuasaan kepada satu Dewan

Nasional Sementara yang terdiri tokoh-tokoh politik dan suku. Kedua pihak telah menerima undangan untuk mengadakan pembicaraan di ibu kota Saudi Riyadh, namun tanggal pembicaraan tersebut belum diungkapkan. Menurut petugas medis dan saksi mata, sekitar 125 orang telah tewas dalam aksi kekerasan di Yaman terhadap para demonstran, yang diluncurkan demonstrasi secara nasional pada akhir Januari sampai menggeser Saleh, yang berkuasa sejak 1978. Kelompok GCC terdiri atas Bahrain, Kuwait dan Arab Saudi dengan Oman, Qatar dan United Arab Emirates. Al Qaida rebut Lodar Sementara itu, kelompok al Qaida berpangkalan di Yaman merebut kendali sepetak daerah ratusan kilometer dari kota Lodar di provinsi Abyan, Yaman Selatan sampai ke kota

Rodhom provinsi tenggara Shabwa, dekat pelabuhan gas Balhaf, menurut sumber dekat kelompok itu kepada Xinhua. Dua kepala suku adat setempat mengkonfirmasi alQaida di Jazirah Arab (AQAP) mendirikan pos pemeriksaan dan kamp-kamp militer darurat di daerah Maeen, di kota Lodar, Abyan sampai ke daerah Ain Ba-Mabad di kota-kota Shabwa yakni Azzan dan Rodhom, di mana pelabuhan gas Balhaf berada. Mereka mengatakan kepada Xinhua dengan syarat tak disebut namanya bahwa AQAP juga menyita jalan pesi-sir dari Al-Awas di Abyan ke Al-Haibala di Shabwa, di pantai Laut Arab. Abyan, sekitar 480 km sebelah selatan ibukota Sanaa, merupakan kubu pertahanan penting kebangkitan kembali sayap al Qaida sering melakukan serangan terhadap keamananYaman dan personil militer sejak 2009.

QUETTA, Pakistan (Antara/AFP): Seorang pelaku pengebom bunuhdiri menargetkan petugas senior polisi di Pakistan Baratdaya, yang diganggu gerilyawan, menewaskan seorang polisi Kamis (7/4), dan melukai lima orang lainnya termasuk dua anak-anak. Penyerang menabrakkan mobil sarat bahan peledak ke dalam rumah seorang petugas senior investigasi di dekat sebuah markas polisi di Quetta, ibu kota provinsi Baluchistan. “Para polisi yang bertugas tewas dan lima orang lainnya lukaluka. Itu adalah serangan bom mobil bunuh diri,” kata Daud Juneju, kepala polisi Quetta kepada AFP. “Petugas dan keluarganya aman, tapi rumah itu rusak parah. Dan pembom bunuh diri mencoba untuk menghantam rumahnya,” tambahnya. Yang terluka termasuk dua anakanak sekolah, katanya. Baluchistan yang miskin berbatasan dengan Afghanistan dan Iran, yang didera oleh pemberontakan yang dilancarkan oleh suku Baluch etnis dalam upaya mendapatkan otonomi yang lebih besar dari pemerintah federal dan bagian yang lebih besar keuntungan dari sumber daya alam.

‘Salah Tembak’ Menewaskan Dua Tentara NATO Di Afghanistan KABUL, Afghanistan (Antara/Xinhua-OANA): Dua prajurit Pakta Pertahanan Atlantik Utara (NATO) tewas menyusul insiden ‘salah tembak’ di selatan Afghanistan, kata Pasukan Bantuan Keamanan Internasional (ISAF) dalam keterangan persnya, Kamis (7/4). Namun, keterangan pers tersebut tidak memberikan rincian lebih lanjut terkait insiden “salah tembak” itu, dengan hanya menyebutkan tim penyidik dari Komando Bersama ISAF tengah melakukan penelusuran terkait insiden itu. “Sebuah penyelidikan resmi akan memperjelas situasi yang mengakibatkan terjadinya insiden itu,” kata keterangan pers itu. Keterangan pers itu juga tidak mengungkapkan kewarganegaraan korban tembak, dengan mengatakan hal itu merupakan kebijakan ISAF untuk menunda prosedur identifikasi dan menyerahkannya kepada otoritas nasional yang berwenang.


PARA PENDUDUK mencari barang-barang yang dapat didaur ulang dari air laut yang dipenuhi puing-puing setelah kebakaran menghanguskan kira-kira 500 rumah di desa pantai di Malabon City, di utara Manila, Filipina, Kamis (7/4). Kebakaran itu, yang diduga disebabkan oleh satu ledakan tabung gas, mulai terjadi sebelum Kamis fajar. Tidak ada korban dilaporkan namun sekurang-kurangnya 3.000 penduduk kehilangan tempat tinggal.Regu pemadam kebakaran kesulitan memadamkan api karena rumahrumah yang ada di lokasi itu terlalu rapat dan terbuat dari bahan yang mudah dilalap api.


Pembobol Markas Polisi Curi Seragam Dan Radio LONDON, Inggris (Waspada): Para penyidik mengatakan Rabu, (6/4), pihaknya sedang memburu komplotan pencuri yang membobol salah satu markas mereka. Komplotan pencuri berhasil menggasak beberapa baju seragam dan peralatan radio milik polisi. Insiden ini terjadi di markas polisi Uddingston, tak jauh dari Glasgow, yang diperkirakan terjadi Selasa (5/04) dinihari saat markas tersebut tutup. “Kasus pembobolaan ini tidak menyangkut ancaman keselamatan publik maupun petugas,” ujar jurubicara kantor polisi Strathclyde. Namun dia menolak mengomentari kenekatan para pencuri yang berani membobol markas mereka. (rtr/rzl)

Luar Negeri

WASPADA Jumat 8 April 2011


Pelaut Tua Arungi Samudera Atlantik Dengan Rakit UNTUK mewujudkan hayalannya di waktu kecil, seorang pria berusia 85 tahun bersama tiga temannya yang juga sudah berusia paruh baya akhirnya berhasil mengarungi Samudera Atlantik selama dua bulan hanya dengan menggunakan rakit. “Banyak orang bilang perjalanan ini gila,” kata Anthony Smith pada AP ketika tiba di St. Maarten, Pulau Karibia. “Tapi kenapa mesti dibilang gila. Apalagi yang bisa dilakukan orangtua seusia saya?” Mantan pelaut asal Inggeris yang periang ini mengaku, keputusannya untuk menyeberangi lautan luas hanya dengan rakit, tidak semata untuk mewujudkan impian kanak-kanaknya, tapi sekaligus untuk meningkatkan perhatian penduduk dunia pada lingkungan dan untuk membukti-

kan bahwa orangtua juga bisa melakukan petualangan yang menurut orang berbahaya. Perjalanan Anthony bersama tiga temannya juga ditujukan untuk mengumpulkan uang bagi kelompok nir laba Inggeris, WaterAid, yang menyediakan air minum bagi masyarakat di negara miskin. Hebatnya, perjalanan itu digagas setelah Anthony mendapatkan musibah – ditabrak mobil yang membuat panggulnya retak. “Dari kecelakaan itu saya dapat uang ganti rugi,” cetusnya. “Dan uang ganti rugi itu saya habiskan untuk membuat rakit.” Perjalanan diawali dari Pulau Canary, Spanyol, setelah cuaca buruk membuat petualangan mereka tertunda selama sebulan lamanya. Rakit yang mereka naiki dilengkapi dengan makanan termasuk jeruk, alpokat, kentang, kol dan labu. Setelah roti yang mereka beli di toko habis dimakan, pakar pelayaran David Hildred

mulai membuat roti dengan menggunakan oven kecil. Hildred, seorang insinyur sipil yang tinggal di British Virgin Islands, Karibia, diminta memperbaiki kemudi rakit yang mengalami kerusakan tiga hari menjelang perjalanan. Rakit tersebut berlayar dengan kecepatan 4 knot, di mana ke empat orang di atasnya saling bergantian mengawasi jalannya rakit ketika yang lainnya sedang main kartu. Rakit itu dibuat dengan empat pipa sepanjang 12 meter untuk memasok air, tujuh pipa berisi pasokan air segar, ditopang dengan tiang sepanjang 12 meter dan layar selebar 37 meter persegi. Dua kemudi menjadi stir, dilengkapi dengan centerboard dan dua dayung. “Saya rasa semua orang yang ikut dalam petualangan ini menikmati perjalanan ini,” ujar Anthony. Suatu saat, mereka menyaksikan ikan paus bermainmain di dekat rakit mereak dan

rombongan ikan mahi-mahi mengikuti rakit mereka hampir sepanjang perjalanan, kata awak John Russell (61) dari Inggeris. “Kehidupan liar di samudera luas sangat fantastic,” ujar John. “Tidak ada yang mesti ditakutkan. Kami semuanya orang-orang tua.” Di tengah perjalanan melintasi Samudera Atlantik, Anthony merayakan ulangtahun ke 85 dengan kue coklat yang dimasak dokternya, Andrew Bainbridge, di atas rakit. Sebenarnya, mereka berniat mengakhiri perjalanan mereka di Bahama, namun angin kencang dan arus laut yang tidak bersahabat memaksa mereka untuk memilih St. Maarten sebagai tempat berlabuh. “Tentu saja perjalanan ini sukses,” cetus Anthony dengan senyum bahagia. “Coba berapa banyak orang yang Anda kenal berhasil menyeberangi Samudera Atlantik dengan rakit?” Syafri/AP

Rakit yang dinaiki Anthony Smith bersama tiga rekannya dalam mengarungi Samudera Atlantik.

Keluarga China Di Asia Borong ‘iPad 2’ Untuk Sesajen

Kembali Ke Pelukan Majikan Setelah 3 Minggu Terbawa Tsunami

GADGET buatan Steve Jobs memang tiada duanya, mengundang histeria massa. Begitu Apple menyatakan mengeluarkan iPad 2 pada awal Maret lalu, ratusan orang sudah antre di depan toko Apple sejah pagi buta, ingin membelinya. Khususnya bagi warga China di Asia termasuk Hong Kong, Malaysia dan lainnya,

SEEKOR anjing yang diselamatkan dari atap rumah yang terbawa hanyut di lepas pantai timur-laut Jepang lebih dari tiga pekan setelah gempa dan tsunami, bersatu kembali dengan majikannya. Si pemilik mengenali anjing itu dari laporan televisi hari Jumat mengenai penyelamatan anjing tersebut. Pemilik wanita dan anjing yang berusia dua tahun yang dipanggil Ban itu bersatu kembali dalam suasana emosional di satu pusat pemeliharaan hewan tempat ajing itu dijaga. “Kami tidak akan pernah membiarkan dia pergi,” kata si pemilik yang tidak mau disebutkan namanya seperti dikutip seorang petugas penampungan hewan. Ban ditemukan oleh awak Pengawal Pantai Jepang di atas atap yang terhanyut hampir 2 kilometer dari Kesennuma, di prefektur (kabupaten) Miyagi, salah satu daerah pantai timur-laut Jepang yang paling berat dilanda tsunami. Atap gedung itu diduga lepas dari bangunan induknya dan dibawa air yang surut ke laut setelah tsunami dahsyat pada tanggal 11 Maret. Ban langsung melompat dan menggerak-gerakkan ekornya sewaktu pemiliknya muncul, kata laporan media setempat. “Saya senang bisa bersatu lagi setelah mereka terpisah oleh bencana,” ujar To-

‘iPad 2’ pun laku. Tapi uniknya, bukan untuk mahluk hidup tapi untuk roh nenek moyang! Keluarga-keluarga yang anggota keluarganya meninggal kini punya kebiasaan baru: mengorbankan iPad 2 ke arwah. Tentu bukan iPad 2 yang asli. Melainkan gambar atau foto iPad 2. Inilah bagian dari ritual Festival Ching Ming. Ko-

munitas Cina di pelosok Asia membakar harta benda terutama barang-barang mewah seperti mobil-mobilan atau tas dari desainer ternama seperti Louis Vitton, Gucci, dll. “Beberapa pelanggan saya ingin mempersembahkan arwah keluarga mereka dengan barang-barang lux. Dan anehnya, iPad termasuk ke dalam

Kejanggalan Perangko William Dan Kate BERITA ini mungkin agak mengejutkan, tapi Pangeran William dan Kate Middleton telah ‘berpisah’ kurang sebulan dari jadwal mereka mengikat tali pernikahan. Tapi, jangan keburu negatif dulu, ‘perpisahan’ itu hanya terjadi pada perangko bergambar pasangan yang akan menikah tanggal 29 April mendatang. Kantor Pos Selandia Baru secara resmi mengeluarkan perangko baru dan dijual di Pulau Pasifik Selatan untuk memperingati pernikahan pasangan kerajaan Inggeris itu. Perangko yang dipasarkan minggu lalu itu, berupa perangko ganda – dengan gambar sang pangeran di satu sisi, dan calon pengantinnya di sisi lain dan ada garis terputus-putus di tengahtengahnya (foto). Tentunya, perangko bergambar Will dan Kate bisa dikoyak (dipisahkan). Lucunya pula, harga perangko bergambar Will beda dengan harga perangko bergambar Kate. Perangko Will dijual seharga 3,4 dolar Selandia Baru dan perangko Kate harganya 2,4 dolar Selandia Baru. Diperkirakan, perangko pernikahan tersebut akan segera menjadi barang koleksi dan pastinya bakal diincar oleh para filatelis. Redaktur Gibbons Stamp Monthly, Hugh Jefferies, menyebut insiden perangko itu ‘memalukan’ dengan mengatakan, perangko itu tidak didisain dengan benar. Dia mengatakan Istana Buckingham pastinya telah menyetujui disain perangko itu, tapi mereka mungkin tidak diberitahu tentang adanya garis terputus-putus di tengahnya. “Siapapun yang mendisain perangko ini layak dilempari telur mukanya,” geram Jefferies. “Memang mereka tidak berniat untuk menunjukkan bahwa pasangan ini mudah dipisahkan, tapi disainnya sangat janggal.” “Mereka adalah pasangan yang serasi, dan perangko tersebut sebenarnya bagus, cuma garis pemisah di tengah itu saja yang tidak tepat tempatnya.” Kejadian ini bukan yang pertama kali dilakukan lembaga per-posan Selandia Baru. Maret lalu, akibat kesalahan yang memalukan 2.000 koleksi perangko Will dan Kate terpaksa ditarik dari pasaran. Perangko yang ditarik itu, membuat kesalahan dalam tanggal lahir William. Di perangko tertulis 21 Mei 1982, padahal yang benar adalah 21 Juni 1982.Syafri/cnn

Hari Paling Popular Untuk Rampok Bank MENURUT data statistik pemerintah AS, pembobolan bank di kawasan selatan dan barat negara itu paling sering terjadi pada hari Jumat pagi. Para perampok berhasil melarikan rampokan senilai 43 juta dolar dalam 5.546 perampokan bank, pembobolan serikat simpan pinjam dan lembaga keuangan lainnya di seluruh penjuru negara itu, demikian statistik yang dikeluarkan FBI. Kawasan selatan memimpin dalam peristiwa perampokan itu, di mana terjadi 1.790 perampokan bank, diikuti ka-

wasan barat dengan 1.691 kasus. California mengalami peristiwa perampokan paling banyak dengan 805 kasus perampokan, disusul Texas dengan 464 kasus. North Dakota, di mana terjadi dua kali perampokan, sebagai kawasan paling sedikit menghadapi peristiwa kriminal itu. Secara keseluruhan, ada 5.628 laporan kejahatan bank – 5.546 perampokan itu ditambah dengan 74 pembobolan, 8 pencurian, dan 13 pemerasan terhadap lembaga keuangan. Catatan itu memperlihatkan menurunnya kasus pe-

rampokan dari tahun 2009, ketika dilaporkan 6.065 kasus perampokan bank, kata FBI. FBI tidak mau berspekulasi kenapa terjadi penurunan sebanyak itu, kata jubir Denise Ballew. Sebagian besar perampokan itu terjadi di konterkonter bank dan melibatkan catatan berisai permintaan uang dan ancaman senjata, demikian statistik tersebut. Hampir semua rampokan bernilai 43 juta dolar itu dalam bentuk uang tunai, dan hanya sekitar 8 juta dolar yang berhasil ditemukan kembali, kata FBI. Syafri/reuters

barang-barang yang dibakar itu,” kata pemilik toko perlengkapan ritual, Jeffrey Te. “Saya hanya bisa memberi mereka gambar-gambar iPad edisi pertama,” kata Te sembari menunjuk ke rak lemarinya. Di rak itu berjejer sederet ‘gadget’ mewah untuk dibakar bagi para roh di alam baka, seperti iPhone 4, iPad, Samsung Galaxy Tab. Secara khusus, Te mengimpor 300 replika iPad siap bakar untuk festival ini. Dan hebatnya, seluruh replika iPad 2 itu sudah ludes, dibakar. Te kini memesan replika baru lagi. “Ini merupakan barang paling laris tahun ini,” ujar Chan, pemilik toko di Hong Kong, sambil menunjukkan iPads hitam yang dijual seharga HK$25 atau sekira Rp 27 ribu. “Ini merupakan produk teknologi teranyar. Pelanggan tua dan muda menyukainya karena ini merupakan model terbaru,” ujar Chan. Tingkat permintaan yang tinggi untuk barang tersebut juga terjadi di China dan Taiwan. (blogspot/afp/rzl)

2 Miliar Akan Saksikan Perkawinan Pangeran WilliamKate Middleton SEORANG menteri Inggris mengatakan, lebih dari seperempat penduduk dunia diperkirakan akan menyaksikan siaran televisi mengenai perkawinan kerajaan bulan ini antara Pangeran William dan Kate Middleton. Juru bicara Perdana Menteri David Cameron mengatakan jumlah 2 miliar orang itu diberikan oleh Menteri Kebudayaan Jeremy Hunt dalam penjelasan singkat pada satu pertemuan cabinet Rabu (6/4). Pada kesempatan itu ia juga mengatakan persiapan bagi perkawinan 29 April tersebut berjalan baik. “Menteri Kebudayaan ... mengatakan (perkawinan itu) mungkin akan menjadi acara global besar yang akan ditonton oleh sekitar dua miliar orang di seantero dunia,” kata juru bicara tersebut. Sekitar 750 juta orang dikatakan telah manyaksikan ayah William, putera mahkota Pangeran Charles menikah dengan mendiang Puteri Diana pada 1981. Sementara beberapa laporan memberi kesan bahwa sebanyak 2,5 miliar orang telah menyaksikan pemakaman Diana pada 1997. Ada sekitar 6,9 miliar orang di dunia ini, menurut hitungan laman Internat Biro Sensus Amerika Serikat.(ant)


Ban kembali ke kepelukan majikannya setelah 3 minggu terbawa arus tsunami yang melanda Jepang. shihiro Suzuki, kepala pusat Dia mengatakan, pusat kucing yang terpisah dari pepenampungan hewan seperti penampungan tersebut men- milik mereka setelah tsunami. dikutip oleh kantor berita Kyodo. jaga 19 anjing dan beberapa (bbc/rzl)

Masalah Tikus Rusak Pariwisata? TENTU saja tidak seorang pun suka tikus, kata seorang pejabat kota ketika menuntut agar anggaran 1,5 juta dolar AS yang disediakan untuk membantu menangani apa yang ia sebut masalah tikus yang mengerikan di Manhattan, Amerika Serikat, diberlakukan kembali. Melihat hewan kecil perusak berkeliaran di jalanan dan saluran terowongan bawah tanah adalah pemandangan yang tak menyenangkan buat wisatawan, kata pemimpin Manhattan Borough Scott Stringer. “Mereka tak mau datang ke sini dan menikmati liburan bersama tikus New York City,” kata Scott kepada Reuters.

Dalam menuntut dikembalikannya anggaran untuk membasmi tikus kepada Departemen Kesehatan, Scott mengatakan pengurangan dana memaksa dilakukannya pemutusan hubungan kerja dengan 57 pekerja Pengendali Hama. Akibatnya tahun lalu terjadi peningkatan 1,5 persen keluhan dan merusak daya tarik New York sebagai kota tujuan wisata, katanya. Selain menjadi masalah bagi dunia pariwisata, kehadiran tikus tersebut juga jadi masalah keselamatan publik. “Buat saya, ini tak bisa diterima karena hewan pengerat sangat berbahaya bagi anakanak dan kualitas kehidupan kota ini,” kata Stringer. Ia menyatakan pemoto-

ngan anggaran tersebut “tak masuk akal” sebab program pengendalian hama di kota itu setiap tahunnya mengumpulkan sebanyak 6 juta dolar AS dari denda yang dikutip dari para pemilik gedung karena pelanggaran kesehatan yang berkaitan dengan hama. “Mengapa memotong anggaran untuk program yang sesungguhnya menghasilkan uang buat kota ini?” kata Stringer. Jika pemotongan anggaran tidak dihentikan dan pengendalian hama tidak ditingkatkan, maka masalah pengendalian tikus akan bertambah parah, katanya. Namun wanita jurubicara Departemen Kesehatan kota tersebut Susan Craig mengatakan pemutusan hubungan

kerja “tidak mempengaruhi kemampuan lembaga itu dalam menanggapi keluhan mengenai tikus”. Kota tersebut telah menyesuaikan pemotongan anggaran dengan melakukan pengendalian hama secara lebih menyeluruh untuk menanggapi keluhan masing-masing warga, katanya. “Pendekatan baru yang kami lakukan memungkinkan kami untuk menangani lebih baik masalah tikus, lebih baik dalam memberi tahu pemilik tanah mengenai perkembang biakan hama dan lebih baik dalam menggalang kerjasama dengan perumahan yang saling berdekatan untuk menangani masalah tikus secara serentak,” katanya. Syafri/reuters

Pengantin Baru Dibuntuti Bencana Alam PROSES bulan madu bagi pengantin baru memang tidak selamanya lancar-lancar saja, apalagi bencana alam selalu membuntuti kemana pun mereka melangkah. Seperti dialami pasangan asal Stockholm, Stefan dan Erika Svanstrom serta bayi mereka memulai perjalanan bulan madu pada 6 Desember lalu. Sesaat setelah berangkat, pengantin baru ini tiba-tiba terdampar di Munich, Jerman, akibat badai salju terparah yang melanda kawasan Eropa.

Namun ini hanya permulaan saja! Tak lama setelah itu, mereka meneruskan perjalanan bulan madu ke Australia dan terjebak badai cyclone di Cairns, serta disusul banjir dahsyat di Brisbane, dan hampir saja terkurung dalam kebakaran hutan di Perth. “Kami nyaris tidak selamat,” ujar Stefan, mengenang saat ia dan keluarganya dievakuasi dari Cairns dan terpaksa bernaung selama 24 jam di lantai gedung shopping center bersama 2.500 orang lainnya. “Pohon-pohon bertumbangan, ranting dan

dahan berserakan di jalanjalan.” Sesaat sebelum tiba di Selandia Baru, gempa kuat mengguncang Christchurch dan Tokyo. “Guncangannya sangat mengerikan dan kami sempat menyaksikan langit-langit gedung berjatuhan. Rasanya gedung-gedung seperti bergerak maju mundur,” ujar said Stefan, yang juga pernah selamat dalam tsunami dahsyat yang melanda kawasan Asia Tenggara tahun 2004 lalu. Pada 29 Maret, pasangan pengantin baru ini kembali ke Stockholm setelah keadaan sedikit

mereda pada kunjungan terakhir mereka di China. Kejadian aneh ini pertama kali dirilis suratkabar Stockholm Expressen. “Saya mengerti bahwa setiap pernikahan pasti mengalami prahara, namun saya rasa kami telah melewati sebagian besar dari itu semua.” Sebagai pasangan pengantin baru “Kami merasa telah menjalani prahara lebih dari yang seharusnya dialami dalam sebuah pernikahan, namun yang lebih penting lagi adalah kami tetap tegar menjalani ini semua.” ujarnya. (ap/rzl)



WASPADA Jumat 8 April 2011

Raja Matik Masih Milik Eko ‘The Red’ MEDAN (Waspada): Eko ‘The Red’ (foto), pembalap andalan Honda Intrac Enduro, mencatatkan sejarah pada Kejurnas Motoprix putaran kedua pekan lalu di lapangan Lanud Medan. Dia menjuarai kelas yang pertama kali dilaksanakan di Motoprix, yakni MP7 kelas matik 130 cc terbuka untuk wilayah Sumatera Utara. Keberhasilan ini kembali mengukuhkan Eko sebagai Raja Balap Matik, melengkapi suksesnya meraih juara umum matik race sepanjang tahun 2010 dengan menggunakan Honda BeAT. Sebagai debutan Kejurnas Motoprix, The Red tampil memukau. Pembalap muda berusia 21 tahun itu tidak kesulitan menaklukkan lintasan yang bersebelahan dengan lapangan udara Polonia tersebut. Dari awal hingga akhir lap, Eko bersaing ketat dengan sesama pembalap Honda Zanmet Pranata dari Tim Honda Tomat Merah.


Sama-sama memanfaatkan settingan maksimal Honda BeAT, keduanya terus memimpin race sejak awal perlombaan. “Saya berusaha keras untuk memimpin di depan Zanmet Pranata, jadi tak boleh melakukan kesalahan. Di setiap tikungan dan kesempatan perlu perhitungan yang tepat untuk menutup gerak dan terus memacu Honda secara baik,” ungkap Eko. “Karena sama-sama menggunakan Honda BeAT, cukup beralasan jika kekeliruan sedikit dapat merubah hasil akhir. Settingan Honda BeAT milik Zamed Pranata juga tidak kalah galak,” ujarnya lagi di Medan, Kamis (7/4). Sukses Honda menempatkan dua pembalap di posisi teratas MP7 Motoprix memberikan catatan awal yang cukup baik bagi merk yang baru mulai tahun ini mengikuti kegiatan balap secara penuh. Menjadi kampium dengan mengalahkan pembalap dari daerah lain juga menjadi prestise tersendiri.

“Keberhasilan Honda BeAT merebut juara pertama MP7 menjadi catatan awal yang sangat baik bagi Honda pada kesempatan pertama mengikuti Kejurnas Motoprix,” tutur Gunarko Hartoyo, Promotion Manager CV Indako Trading Co selaku main dealer Honda di Sumatera Utara. “Kami yakin tim Honda Intrac Enduro dapat memberikan yang terbaik di kelas lain jika tidak terdapat kesalahan teknis yang menimpa tim kami. Keterlambatan penyiapan Honda balap kami dari rekanan yang baru dapat kami terima dua hari sebelum balapan juga mengurangi progress tim,” tambah Gunarko. Tahun lalu Honda berhasil meraih dua gelar berharga, yakni Juara Umum IMI Sumut Matik Race dan Juara Umum kedua Pemula Kejurda LA Light Road Race atas nama Eko ‘The Red’. (adv)

Webber Tekad Bayar Kegagalan SEPANG, Malaysia (Waspada): Mark Webber gagal unjuk gigi pada seri perdana gelaran balap mobil Formula Satu GP Australia di Melbourne, dua pekan lalu. Namun pembalap Red Bull ini menyimpan asa tidak akan mengulang kegagalan sekaligus membayarnya di Malaysia, Sepang, Minggu (10/4) ini. Saat tampil di Albert Park, Webber tercecer di posisi lima. Pembalap Australia itu mengaku ada, beberapa masalah yang mempengaruhi kinerja mobil, termasuk problem di sasis. Tapi dia enggan menjelaskan secara spesifik apa yang terjadi dengan mobilnya di Melbourne. “Ada beberapa masalah yang kami alami dan tidak membantu situasi kami menjadi lebih baik.Sayasudahtidakinginmem-

bicarakan Melbourne dan saatnya kita bicara tentang GP Malaysia,” jelasnya, Kamis (7/4). Webber sangat yakin, masalah yang dialaminya pada seri perdana sudah selesai. Kini, tuntutan aerodinamis dari sirkuit Sepang akan cenderung menguji kekuatan dari sasis Red Bull Racing RB7. “Kami melakukannya dengan baik di Sepang tahun lalu. Ada masalah dengan suhu panas pada sirkuit nanti. Ini akan berpengaruh pada kondisi ban, tapi kami belum tahu bagaimana balapan nanti,” beber Webber. Ditambahkan, Red Bull


Andalan Red Bull, Mark Webber, diwawancarai wartawan mancanegara di Sepang, Kamis (7/4). Racing juga akan menggunakan sistem KERS di Malaysia. Pasalnya, karakter Sepang yang lurus dan panjang, bisa menyulitkan Webber dan Vettel bila ti-

dak dapat menggunakan meningkatkan kecepatan mobil. Tergantung cuaca Rekan satu timnya Sebastian Vettel, pemenang GP Aus-

tralia lalu, kembali difavoritkan keluar sebagai pemenang GP Malaysia. Hasil impresif yang ditorehkannya pada seri pembuka jelas meningkatkan kepercayaan diri. Sepang pun pernah ditaklukkan Vettel pada musim lalu yang merupakan kemenangan perdananya. Apalagi, dia juga berpeluang mendapat amunisi tambahan dengan menggunakan KERS di Malaysia. “Malaysia adalah trek pertama sesungguhnya yang akan kami jalani, karena Australia merupakan sirkuit semi jalanan,” ungkap Vettel. “Namun di sana panas dan hujan setiap hari, pertanyaannya kapan dan seberapa besar? Ini akan menjadi balapan rumit,” tandas pembalap asal Jerman ini. (ys/as/m47)

Hornets Amankan Playoffs NEW ORLEANS, AS (Waspada): New Orleans Hornets mengamankan tiket playoffs dengan menghabisi harapan

Houston Rockets. Kepastian ini diraih Chris Paul cs setelah mereka bangkit dari defisit 17 poin untuk mencetak kemenangan 101-93 atas Houston pada pertandingan kandang, Kamis (7/4) pagi WIB. Pemain Houston Kevin Martin dan Kyle Lowry dalam posisi prima ketika mendapatkan tiga poin pada awal kuater pertama. Mereka berhasil memasukkan lima dari delapan usaha lemparannya ketika membawa Rockets memimpin 38-21. Rockets hanya membuat 33 poin pada dua kuarter berikutnya dan seperti membiarkan Hornets merajalela menguasai

permainan di New Orleans, AS. Kedua tim bergantian memimpin sampai enam kali pada kuarter keempat. Hornets lantas mengambil alih pimpinan lewat dua lemparan bebas yang dilakukan Chris Paul, sehingga tuan rumah unggul dengan sisa waktu 4:16. Trevor Ariza menyusul melakukan tembakan bebas serta satu lemparan sembari melompat (dunk) dan New Orleans mengamankan enam poin terakhir dari garis lemparan bebas. Martin menyumbang 21 poin kepada Rockets dan Luis Scola serta Goran Dragic masing-masing mengoleksi 16 poin. (m15/ant/rtr)

Hasil lainnya, Kamis (7/4) AP

GUARD Hornets Chris Paul (3) mengatasi jepitan pemain Rockets Brad Miller (52) dan Courtney Lee (5).

Indiana vs Washington Philadelphia vs NY Knicks Toronto vs Cleveland Charlotte vs Orlando Detroit vs New Jersey Minnesota vs Phoenix

136-112 92-97 96-104 102-111 116-109 98-108

Semua Pereli Papan Atas Sumut Berlaga Langkat Rally 2011 MEDAN (Waspada): Ajang balapan ‘Langkat Rally 2011’ yang berlangsung 9-10 April nanti akan menjadi arena persaingan para pereli top Sumatera Utara. Hingga Kamis (7/4), semua pereli Sumut sudah terdaftar tampil dalam even dua hari penuh, yang mengambil lokasi lomba di kawasan perkebunan Maryke dan Turangie di Kabupaten Langkat tersebut. Pimpinan Perlombaan Elwin Siregar mengatakan di Medan, pihaknya memastikan even dengan label kejurda itu diikuti setidaknya 22 peserta. Jumlah potensial bertambah, karena beberapa nama masih belum mendaftar. “Dengan jumlah perserta ini, telah memperlihatkan bahwa Sumut tetap merupakan gudang para pereli di tanah air,” ucap Elwin, didampingi Sekum Panpel Prihatin Kasiman dan Ketua Harian IMI Sumut John Lubis. Dari deretan kompetitor Grup N atau kelas N4, tim Bla Bla Bla menurunkan wakil terbanyak, yakni empat peserta atas nama Ijeck dan Doddy, keduanya di atas mobil Subaru Impreza. Juga Harun Nasution dan Kiky Desky, menggeber Mitsubishi Lancer Evolution.

Di Grup GR 2 (kelas GR 2.2), tim Twenty menempatkan tiga pereli, masing-masing Arjun Kumar, Haris Abdillah serta pereli berpengalaman Harry Jonggi Pasaribu. Tim Suzuki Spectra Indocafe yang mengandalkan Eddy WS, memimpin starting list yang dikeluarkan di antara peserta kelas GR 2.1 kemarin. Eddy bersama navigator Syariful Adil, dengan rekor pemegang gelar nasional N-16 2006 dan 2007 serta GR 2 di 2010, bahkan mendapat nomor start kecil karena menempati unggulan ketujuh. Juga ada Robby Harahap dan Ahmad Taufik Harahap dari MMRT, serta wakil Net Motorsport masing-masing Dian AP dan Dodi Sutanto. Menurut Elwin, Langkat Rally 2011 memulai kegiatan Jumat (8/4) pagi ini. Diawali scrutineering bagi mobil peserta di SPBU H Anif Jl Cemara Medan, serta temu pers pada pukul 16.00Wib di tempat sama. “Start reli dimulai Sabtu pagi dari alun-alun kantor bupati Langkat, di Stabat dan akan dilepas Bupati H Ngonesa Sitepu, didampingi Muspida Tk II serta Ketua KONI Sumut dan Ketua IMI Sumut,” papar Elwin. Setelah start, para peserta kemudian harus menempuh 9

Grass Roots Kwarta Manajemen MEDAN (Waspada): Kwarta Manajemen akan menggelar sosialisasi Grass Roots (akar rumput) kepada pemain usia 10-12 tahun yang tergabung dalam sekolah sepakbola se-Sumatera Utara. Pelaksanaannya dua tahap, pertama pada 1 Mei 2011 dan kedua pada 8 Mei. Parhelatannya di lapangan Beo Kwarta Law Dendang. “Pihak penyelenggara akan membatasi hanya mengundang 12 pelatih dan siswa sekolah sepakbola untuk mengikuti sosialisasi Grass Roots,” kata Pembina Kwarta Manajemen Adrian Ach-

Engsin di Medan, Kamis (7/4). Didampingi koordinator sosialisasi Grass Roots, Selamet Riyadi dan Lilik Suheri, dia mengatakan bahwa sosialisasi ini tidak dikenakan biaya. “Dari pelaksanaan sosialisasi ini nantinya diharapkan pemain usia muda mendapat tambahan ilmu yang dimanfaatkan dalam mendukung karir sepakbolanya ke depan,” jelas Engsin. Pelaksanaannya akan dikoordinir Selamet Riyadi dan Lilik Suheri, mantan pemain PSMS yang sudah mengikuti pelatihan lisensi A nasional dan

SS (Spesial Stages/treyek) berjarak tempuh total 122,6 km. Kelas yang diperlombakan Grup N, Grup GR 2, Grup N 15, Grup S, dan Grup J (jip). (m47)

Walcott Disangka Hamilton LONDON (Waspada): Memiliki label sebagai pemain top, ternyata tidak membuat striker Arsenal Theo Walcott (foto kiri) mudah dikenali orang. Beberapa kali bintang muda Arsenal itu malah salah dikenali, sehingga disangka sebagai pembalap McLaren Lewis Hamilton (foto kanan). “Saya sedang di mobil ketika ada orang yang datang ke saya mengatakan, ‘Anda tidak beruntung di balapan kemarin’,” cerita Walcott pada Arsenal TV Online, yang dikutip Kamis (7/4). “Lalu saya bilang, ‘Apa?’ Tiba-tiba dia datang lagi dan bilang,’Maaf, saya kira kamu Lewis Hamilton’,” tambah winger Inggris tersebut. Lain lagi ceritanya soal kejadian dua pekan lalu. Saat itu, seseorang kembali menghampiri Walcott dan berkata, “Lewis, saya bisa minta tanda tangan Anda?” “Saya bukan Lewis, kawan,” jawab Walcott. Orang tersebut langsung melihatnya dengan seksama untuk berkata, “Oh, kamu Theo Walcott!” Secara fisik, Walcott dan Hamilton memang hampir mirip. Sama-sama berasal dari Inggris, berkulit agak hitam, potongan rambuk cepak, memiliki senyum manis, dan bintang olahraga. (m15/vvn)


Wozniacki Nikmati WTA Charleston CHARLESTON, AS ( Waspada): Petenis nomor satu dunia Caroline Wozniacki, Rabu (KamisWIB), melaju ke putaran ketiga turnamen tenisWTA Charleston di South Carolina, Amerika Serikat. “Saya merasa enak main di atas lapangan tanah liat, ini amat menakjubkan. Selalu menakjubkan bila bermain di sini,” kata unggulan utama itu, setelah menggulung pemain kualifikasi dari AS Irina Falconi 6-1, 6-1. Tahun lalu,Wozniacki terpaksa mundur pada semifinal melawan petenis RusiaVera Zvonareva, karena cedera pada pergelangan kakinya. “Terkadang saya masih membayangkan kejadian itu. Rasanya amat menyakitkan berhenti di tengah turnamen,” ungkapnya. “Tapi sebaliknya, ini merupakan turnamen yang saya sukai dan saya nikmati. Saya suka bermain di lapangan ini,” tambah Wozniacki. Juara di Dubai dan Indian Wells itu tidak mendapat perlawanan berarti dari petenis

peringkat ke-128 Falconi, yang belum pernah berhadapan dengan petenis nomor satu. Wozniacki merupakan satu dari tiga pemain 10 besar dunia yang ikut dalam turnamen tersebut. Pemain nomor lima dunia, Samantha Stosur, unggulan kedua dan juara bertahan, mengalahkan petenis Austria Patricia MayrAchleitner 6-1, 6-2. “Saya kira laga ini amat berharga, karena di sini saya meraih gelar tahun lalu dan saya harus mempertahankannya,” tekad Stosur. Petenis nomor delapan dunia Jelena Jankovic, unggulan ketiga dan juara di tempat sama pada 2007, juga melaju. Jankovic mengalahkan petenis Austria Tamira Paszek 6-2, 6-3. Unggulan ketujuh Nadia Petrova dari Rusia mengalahkan pemain Rumania Edina Gallovits 6-1, 6-1. Unggulan 10 Daniela Hantuchova (Slowakia) ikut lolos setelah mengatasi Evgeniya Rodina (Rusia) 6-0, 6-1. (m15/ap/afp)


WASPADA Jumat 8 April 2011


Hentikan Segera LPI Idris, SMeCK Dukung Opsi FIFA MEDAN (Waspada): FIFA memerintahkan Komite Normalisasi untuk menyelesaikan permasalahan Liga Primer Indonesia (LPI). Opsinya ada dua, yang pertama segera membawa LPI ke dalam kendali PSSI dan kedua segera menghentikan kompetisi LPI. PSMS Medan melalui Sekretaris Umum Idris SE mendukung penuh warning dari FIFA itu. “Sebaiknya LPI segera meleburkan diri ke PSSI,” saran Idris di Medan, Kamis (7/4). “Tapi kalau mereka menolaknya, segera hentikan kegia-

tannya demi keselamatan persepakbolaan nasional dari sanksi yang dijatuhkan FIFA bila intruksinya dilanggar,” tambah Idris. Ketua SMeCK Hooligan Nata Simangunsong sependapat dengan Idris. Malah dia mene-

Bintang Medan Bertekad Pecahkan Mitos Tandang Waspada/Hamdani

VAQNER Luis de Olivera dan kawan-kawan harus terus berpesta untuk membawa PSMS Medan lolos babak delapan besar Divisi Utama Liga Indonesia 2010/2011.

Sapu Bersih Sisa Laga PSMS MEDAN (Waspada): Manajer tim PSMS Medan Idris SE menegaskan,skuadnya harus bisa sapu bersih sisa empat laga ke depan untuk lolos delapan besar Divisi Utama Liga Indonesia. “Khusus untuk dua laga kandang menghadapi Persiraja Banda Aceh dan PSAP Sigli 12 dan 17 April, PSMS harus bisa meraih hasil maksimal,” ujar Idris SE di Medan, Kamis (7/4). PSMS dengan nilai 36 menghuni peringkat empat Grup I di bawah PSAP, Persiraja dan Persih Tembilahan. Jika mampu sapu bersih, berarti Ayam Kinantan mengumpulkan 48 poin. Perjuangan untuk itu disadari manajemen cukup berat, tetapi tidak ada jalan lain bagi skuad pelatih Suharto, H Edy Syahputra dan Donny Latuperissa harus tercapai. “Itu kalau mau melempangkan jalan ke Liga Super pada kompetisi tahun depan,” ujar pengusaha kapal dan distributor semen tersebut. Pengalaman selama ini harga diri para pemain PSMS sangat tinggi ketika menjamu Persiraja maupun PSAP. Semangat dan fanatisme

Klasemen Grup I PSAP Persiraja Persih PSMS Persipasi Persita Persikabo PSLS Persitara PS Bengkulu Pro Titan PSSB Persires

21 21 21 20 20 20 20 20 20 19 19 20 21

13 14 12 11 10 9 8 6 7 6 3 3 1

5 3 47-16 2 5 40-23 1 8 29-31 3 6 29-22 4 6 31-18 6 5 27-16 4 8 28-26 7 7 21-19 4 9 25-32 5 8 16-23 6 10 18-25 6 11 15-24 3 17 10-61

44 44 37 36 34 33 28 25 25 23 15 15 6

MEDAN (Waspada): Bintang Medan bertekad memecahkan mitos tidak pernah menang pada partai tandang, saat melakoni laga menghadapi Bandung FC di Bandung, Sabtu (9/4). Demikian pelatih Bintang Medan Michael Feichtenbeiner di mes stadion Kebun Bunga Medan, kemarin. Harapan itu wajar, setelah selama ini Bintang Medan hanya meraih sekali seri ketika dijamu Medan Chiefs di stadion Baharuddin Siregar Lubukpakam beberapa waktu lalu. Selebihnya, selalu berujung kekalahan. “Tentu saja kemenangan menjadi harapan kami. Rekor di laga tandang sangat tidak bagus. Kami ingin memperbaikinya, khususnya menghadapi Bandung FC,” ujar Feichtenbeiner usai membawa skuadnya latihan di Lapangan Thamrin Graha Metropolitan (TGM). Michael selain terus membenahi mental bertanding juga tengah menggeber persiapan teknik skuadnya. Dia bakal mengandalkan kemampuan fisik yang dimiliki pemain sebagai daya penggedor pertahanan lawan. “Selama ini kami berupaya mengejar perolehan gol cepat di babak pertama dengan menyerang. Tapi kebobolan lebih dulu melemahkan mental pemain,” jelasnya. “Jadi untuk pertandingan nanti, kami akan mengintensifkan pola bertahan dengan counter attack, baru babak kedua menyerang,” katanya lagi. (m17)

para pemain akan melebihi saat menghadapi tim lain. “Sekarang tinggal pelatih dan para pemain itu sendiri untuk menjaga kondisinya. Kalau soal teknis, saya optimis PSMS akan mengalahkan keduanya,” tegas Idris. (m17)

GM Cerdas Barus Juara Zulkhairi, Pitra Tembus 20 Besar BANDA ACEH (Waspada): Pecatur andalan Aceh MN Zulkhairi (foto), sukses menembus kelompok elit 20 besar dalam ajang Telin Chess International Tournament 2011 di Graha Citra Caraka Jakarta, setelah menumbangkan MF Hanny Marentek di babak terakhir atau babak IX, Kamis (7/4). Dalam kejuaraan catur yang diikuti 110 peserta dari dalam dan luar negeri itu, GM Cerdas Barus tampil sebagai juara dengan 7,5 MP (match point). Di babak terakhir, kemarin, pecatur andalan Sumatera Utara itu menundukkan pecatur Pelatnas SEA Games MI Irwanto Sadikin untuk memastikan duduk di peringkat pertama. Sedangkan pecatur Georgia, GM Merab Gagunashvili tampil di urutan kedua dengan 7 MP setelah menang atas pecatur Pelatnas SEA Games Indonesia lainnya, Tirta Chandra Purnama. Pecatur tunarungu asal Percasi Kota Sabang, Zulkhairi, yang sebelumnya sempat merosot ke peringkat 22, melonjak dengan menduduki posisi 16 besar mengumpulkan 6 MP. Pecatur Sumut MN Pitra Andika yang turut menoreh poin 6 MP namun kalah perhitungan solkov dari Zulkhairi, harus puas berada di peringkat 18. Di babak terakhir, Pitra menyerah dari pecatur andalan tanah air, GM Susanto Megaranto. “Alhamdulillah, Zulkhairi berhasil

(Indonesia/7,5 MP) (Georgia/7 MP) (Vietnam/7 MP) (Filipina/7 MP) (Indonesia/7 MP) (Singapura/6,5 MP) (Indonesia/6,5 MP) (Indonesia/6,5 MP) (Indonesia/6,5 MP) (Indonesia/6,5 MP). (Jabar/6 MP) (Jatim/6 MP) (Indonesia/6 MP) (India/6 MP) (Jawa Barat/6 MP) (Aceh/6 MP) (Jatim/6 MP) (Sumut/6 MP) (Jabar/6 MP) (Jabar/5,5 MP)

memenuhi ambisinya masuk dalam jajaran elit 20 besar dan sekaligus menjadi pecatur terbaik di Sumatera pada kejuaraan ini,” lapor Manajer Tim Catur Aceh, T Ardiansyah. Atas keberhasilannya, MN Zulkhairi berhak atas hadiah berupa dana pembinaan senilai USD 500 atau sekira Rp4,4 juta. (b07)

dalam setiap kegiatan LPI. “Kalau nanti masih terdapat juga para pengurus PSMS menjadi perangkat di kompetisi LPI, SMeCK siap di depan untuk mengusirnya dari kota Medan,” ancam Nata. Sikapnya ini semata-mata untuk menyelamatkan persepakbolaan nasional, agar tidak mendapat hukuman dari FIFA. Tapi bila sebaliknya mereka bersedia dilebur ke PSSI, SMeCK juga siap mendukungnya. Sekretaris PSMS Drs Agus Sriono menegaskan, PSMS tidak

pernah memberi fasilitas kepada tim peserta LPI asal Medan. “Mereka di stadion Kebun Bunga Medan membiayai diri sendiri terhadap keperluannya, seperti catering maupun peng-gunaan mes, listrik dan air,” jelas salah satu Kabag di Pemko Medan itu. Sebelumnya, FIFA meminta Komite Normalisasi yang dipimpin mantan Ketua Umum PSSI Jenderal Purn Agum Gumelar supaya segera mengajak pihak LPI untuk segera melebur ke PSSI dan apabila menolak segera dihentikan. (m17)

Pemko Siap Stop APBD Buat PSMS Tunggu Keputusan Resmi Mendagri Langkah Berikut Merger Bintang Medan MEDAN (Waspada): Komisi Pemberantasan Korupsi (KPK) menemukan indikasi pelanggaran dalam pengelolaan Anggaran Pendapatan dan Belanja Daerah (APBD) selama beberapa tahun, yang dikucurkan pemerintah daerah ke klub-klub sepakbola. KPK menilai hal ini sangat berpotensi terjadi praktek korupsi. Pemerintah Kota (Pemko) Medan pun menyatakan akan menghentikan alokasi anggaran APBD ke tim sepakbola PSMS melalui KONI Medan. Namun penghentian dana APBD itu akan dilakukan setelah tercapainya kesepakatan bersama KPK dan Menteri Dalam Negeri (Mendagri). WakilWalikota Medan Dzulmi Eldin, menegaskan dukungannya dan Pemko Medan akan memberlakukan itu menunggu keputusan resmi dari Mendagri. “Kita akan sesuaikan dengan keputusan atau arahan dari Mendagri, sesuai keputusan bersama yang disampaikan dengan KPK,” jelas Eldin, Kamis (7/4).

Ketua Umum PSMS Medan itu menambahkan, jika dalam surat tersebut sesuai dengan arahan KPK diminta menyetop alokasi APBD ke klub sepakbola di daerah, maka dia mengaku siap melaksanakannya. Sebab, hal itu baginya merupakan aturan yang sudah dirancang pemerintah pusat untuk daerah dan bukan berarti membiarkan klub sepakbola di daerah tenggelam. “Sekarang ini bukan berbicara mau ke mana dibawa. Tapi ini aturan dan harus dilaksanakan. Kita memang dapat memahami bersama manajemen klub sepakbola di Indonesia atau di daerah itu seperti apa,” tegasnya. “Tapi daripada menjadi temuan, lebih baik kita stop. Kita siap menyetop bantuan APBD Pemko Medan yang setiap tahunnya diberikan ke PSMS mulai 2012 nanti, jika memang itu ditegaskan dalam peraturan atau keputusan Mendagri,” katanya lagi. Menanggapi itu, Vice President Liga Primer Indonesia (LPI)

Region Sumatera dan Aceh, Avian Tumengkol, menilai bahwa langkah yang diambil Pemko Medan untuk menghentikan bantuan APBD ke PSMS sudah tepat. Menurut Avian, langkah itu akan mendorong persepakbolaan daerah di Medan dan Sumatera Utara menjadi lebih mandiri dan profesional. “Khususnya bagi PSMS Medan. Saya yakin kejayaan PSMS akan kembali bangkit dan bersuara di persepakbolaan nasional kita seperti dulu. Dan untuk mensukseskan ini, kita harus bersama-sama mencari solusi terbaik,” tegas Avian. Dia juga menuturkan, salah satu langkah berikut yang bisa diambil oleh Pemko Medan atau PSMS adalah merger dengan Bintang Medan FC yang saat ini berlaga di LPI. “Karena dengan merger ini, PSMS akan menjadi klub yang mandiri dan profesional. Dengan manajemen yang didukung oleh SDM yang profesional pula,” tambah Avian. (rel)

Bah Jambi Lolos 8 Besar Union Cup

20 Besar Telin Chess International 1. GM Cerdas Barus 2. GM Merab Guganashvili 3. GM Dao Tien Hai 4. GM Eugenio Torre 5. MI Liu Dede 6. GM Zhang Zhong 7. MI Irwanto Sadikin 8. MF Wahono Awam 9. MI Halay Taufik 10. GM Susanto Megaranto 11. MN Johan Gunawan 12. MN Sutarno 13. GM Ardiansyah 14. GM Dibyendu Barua 15. MI Salor Sitanggang 16. MN Zulkhairi 17. Tirta Chandra Purnama 18. MN Pitra Andika 19. MN Novita Anjas 20. Sugeng Prayitno

gaskan seandainya pihak LPI tidak mau meleburkan diri ke PSSI sebagai induk organisasi sepakbola Indonesia, kegiatannya dihentikan saja karena berarti ilegal. “SMeCK Hooligan siap di depan untuk mengusir Bintang Medan dari Medan kalau mereka masih mengikuti kegiatan LPI. Itu jika LPI tidak mau melebur ke PSSI,” tambah ketua fans berat Ayam Kinantan tersebut. Dia juga meminta pengurus PSMS tidak melibatkan diri atau bersedia lagi menjadi perangkat


PSLS MENANG. Pemain PSLS Ervin (16) coba menahan aksi pemain Persires Rengat Mirza Daiwokas (77) dalam laga Divisi Utama Liga Indonesia 2011 di Stadion Tunas Bangsa, Lhokseumawe, Kamis (7/4). PSLS menang telak 4-1.

India, Tiongkok Buka Peluang BINJAI (Waspada): Kesebelasan India dan Tiongkok membuka peluang merebut gelar juara turnamen sepakbola segitiga antar etnis diadakan Persatuan Olahraga Lansia (Porlansia) Binjai memperebutkan Piala Dan Dim 0203 Langkat. Tiongkok membuka peluang juara setelah mengalahkan Indonesia 3-1, Kamis (7/4). Kemenangan itu membuat Tiongkok hanya membutuhkan hasil seri untuk merebut gelar juara saat menghadapi juara bertahan India pada Sabtu (9/4) besok. Berbeda dengan India yang sebelumnya hanya unggul 2-1 atas Indonesia, mereka harus memenangkan pertandingan jika ingin mempertahankan gelar juara. Manajer Tim Tiongkok, Awang didampingi Alex mengaku peluang timnya merebut juara sangat terbuka . “Kita berharap seluruh pemain bisa tampil maksimal,” ucap Awang. Tim Tiongkok pada pertandingan besok akan diperkuat Awang, Asen, Iwan Karo-karo, Alex, Hasan, Indra Jaya, Amran dan lainnya. Sedangkan India akan menurunkan pemain di antaranya Puspom, M Nazli, Raju, Anton dan Rizaldi. (a04)

P. SIANTAR (Waspada): PS PN 4 Bah Jambi lolos delapan besar turnamen sepakbola Union Cup setelah di babak penyisihan terakhir mengalahkan PS Patmi 50 Batubara 3-2 di Lapangan TS Mardjans Saragih, Kodim 0207/Simalungun, Kamis (7/4). Meski kalah, PS Patmi tetap lolos bahkan menjadi juara pool B karena unggul produktivitas gol dibandingkan Bah Jambi. Sedangkan kemenangan Bah Jambi itu mengakibatkan PS 122/TS Pematangsiantar harus

tersingkir. Pertandingan antara PN 4 Bah Jambi dan Patmi 50 Batubara berjalan dalam tempo sedang. Terlebih para pemain PS Patmi 50 tidak terlalu ngotot meraih kemenangan karena sudah pasti lolos delapan besar. Empat gol PN 4 Bah Jambi diborong striker Gunawan Manurung menit 11, 45, 65 dan 75. Gol balasan Patmi dicetak pemain tengah Hendra menit 24 dan Ricky Silaban menit 25. Tim lainnya yang lolos ke babak delapan besar dari pool

A, yakni PS Pemko Tanjungbalai dan PS Harapan Jaya. Pool C meloloskan PS TGM Medan dan Gumarang FC Medan. Untuk pool D, melaju ke babak delapan besar adalah Persetara Labuhanbatu Selatan dan Tebingtinggi FC. Turnamen memperingati HUT ke-140 Kota Pematangsiantar itu akan menggelar babak delapan besar di lapangan yang sama, mulai Minggu (10/4), mempertemukan PS Pemko Tanjungbalai dengan Gumarang FC Medan. (a30)


TINJU SELEBRITIS. Artis Rafi Ahmad (kanan) berusaha menaklukkan Echa dalam pertandingan ujicoba jelang Celebrities Fight di sasana Pertina Kompleks Gelora Bung Karno, Senayan, Jakarta, Kamis (7/4). Sejumlah selebriti di antaranya Didi Riyadi, Mario Lawalatta, Rafi Ahmad dan Samuel Rizal, mempersiapkan diri jelang “Celebrities Fight” yang menjadi pertandingan tambahan sebelum laga utama antara Chris John melawan Daud Jordan pada Minggu (17/4) mendatang.

Problem Catur Hitam melangkah, mematikan lawannya tiga langkah.

Jawaban di halaman A2.




1. Gangguan kesehatan akibat virus dsb. (Baca 40 kali sebelum shalat Subuh dan usapkan ke bagian yang sakit: Bismillahirrahmanirrahim, alhamdulillahi rabbil aalamiin, hasbunaallaahu wa ni’mal wakiil tabaarakallaahu ahsanul khaaliqibna, wa laa hawla wa laa quwwata illa billaahil ‘aliyyil ‘azhiim). 5. Surat Al Quran, obat berbagai macam penyakit. (Baca dengan khusu’ dalam hati 7x, dan jika belum sembuh, baca 70x, dijamin sembuh. HR dari Jabir Abdullah al-Anshari dan Imam Shadiq). 7. Surat Al Quran ke-65, ayat 23nya mujarab untuk banyak rezeki dan hajat dunia. (Dibaca setiap Selasa dengan membaca shalawat sebelum dan sesudahnya masing-masing 3x). 10. Makhluk yang membuat orang jadi lupa dengan menutup katup kebenaran pada hatinya. (Akan terbuka dengan membaca shalawat kepada Nabi Muhammad dan keluarganya). 11. Bacaan lazim ketika hendak menaruh barang agar tidak lupa dimana diletakkan. 13. Produk lebah yang disebut QS An-Nahl ayat 68-69 sebagai obat berbagai penyakit. 14. Permohonan kepada Allah, biasa dilakukan seusai shalat, antara lain minta kesembuhan. 15. Sulit tidur. (Doa Rasulullah mengatasinya: Allahumma

gharaatin nujuumu wa hada’atil ‘uyuun, wa anta hayyul qayyuum, laa ta’khudzuka sinatun wa laa naum, yaa hayyu yaa qayyuum ahdi’ lailii wa anim ‘aynii). 16. Berdosa dikerjakan (memakan babi dsb). 17. Bacaannya La haula wa laa quwwata illa billahil ‘aliyyil ‘azhiim, artinya: tiada daya upaya dan tiada kekuatan melainkan dengan Allah yang Maha Tinggi dan Maha Agung.


1. Ganjaran Tuhan atas perbuatan baik. 2. Binatang yang pernah menyengat Rasulullah dan diobatinya sendiri dengan garam plus doa sebagai penawar bisa. 3. Sudah lama hidup, penyakit yang tidak bisa disembuhkan menurut hadis. 4. Al-_____, salah satu surat Al Quran, selain An-Nas, yang diturunkan untuk menyembuhkan Rasulullah dari simpul sihir dukun Yahudi. 6. Lawan kata No. 16 Mendatar. 7. Malu, cela, yang harus ditutup. 8. Saya (untuk merendahkan diri). 9. Salah satu pintu masuk bandara bagi penerbangan jemaah haji atau umrah. 12. Tentara Allah. 13. Status Abu ‘Ash bin Rabi’ bin Abdul ‘Uzza bagi Rasulullah. 14. Penyiaran ajaran agama.

Sudoku Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tidak ada keterlibatan matematika, hanya membutuhkan pertimbangan dan logika. Tingkat kesulitan: sangat sulit (*****), bisa diselesaikan dalam waktu kurang dari 20 menit. Jawabannya lihat di halaman A2 kolom 1.

2 7 2 4 5 8 9 5 2 9 8 2 3 5 1 2 6 4 9 2 8 7 5 6 5 9 8






Jumat 8 April 2011

Pep Tak Mau Terusik Real


BOMBER Barcelona David Villa (bawah) ditimpa bek Shakhtar Donetsk Yaroslav Rakytskyy di Stadion Camp Nou, Kamis (7/4) dinihari WIB.

BARCELONA (Waspada): Entrenador Barcelona Pep Guardiola tak mau terusik kemungkinan jumpar Real Madrid pada semifinal Liga Champions mendatang. Pelatih muda itu belum mau memikirkannya, kendati timnya sudah menggilas Shakthar Donetsk 5-1 pada leg pertama perempatfinal di Camp Nou. “Kami harus bermain di Donetsk lebih dulu. Setelah itu baru kami akan memi-

Pesta Barca Salah Shakhtar BARCELONA, Spanyol (Waspada): Barcelona mengambil langkah besar untuk maju ke semifinal Liga Champions dengan membantai Shakhtar Donetsk 5-1 di Camp Nou.

Penyelesaian klinis dalam laga leg pertama perempatfinal, Rabu (Kamis WIB) tersebut, menunjukkan perbedaan kelas di antara kedua tim. Namun menurut bek Shakhtar Yaroslav Rakitskiy, pesta gol El Barca bisa terjadi karena salah timnya sendiri. Semua itu berawal dari gol cepat Andres Iniesta menit kedua.

“Gol cepat itu membuat kami terpukul. Keberuntungan memayungi Barcelona, tapi hasil akhir murni kesalahan kami yang tidak bisa fokus,” sesal Rakitskiy, seperti dilansir Goal, Kamis (7/4). Pencetak satu-satunya gol bagi The Miners itu bertekad untuk menuntut balas pada leg kedua di Donetsk. “Kami akan menganalisa kesalahan

Barcelona vs Shakhtar Donetsk 5-1 Barcelona (1-4-3-3): Victor Valdes; Dani Alves, Gerard Pique, Sergio Busquets, Adriano Correia (Maxwell 77'); Xavi Hernandez, Javier Mascherano, Seydou Keita; David Villa (Pedro Rodriguez 70'), Andres Iniesta, Lionel Messi. Shakhtar (1-4-3-1-2): Andriy Pyatov; Darijo Srna, Mykola Ischenko, Yaroslav Rakitskiy, Ravzan Rat; Tomas Hubschman (Eduardo 83), Henrik Mkhitaryan, Douglas Costa; Jadson (Fernandinho 70'); Willian (Alex Teixeira 75'), Luiz Adriano. kemudian menunjukkan hasilnya di Donbass Arena. Kami ingin meraih kemenangan di kandang,” tegas Rakitskiy. Iniesta membawa El Catalan unggul lebih dulu, tetapi Shakhtar menyia-nyiakan se-

jumlah peluang bagus untuk menyamakan kedudukan. Justru Daniel Alves dan Gerard Pique menambah keunggulan Barca. Rakitskiy membalaskan satu gol bagi klub Ukraina ter-

Chelsea vs Manchester United 0-1 Chelsea (1-4-4-2): Petr Cech; Jose Bosingwa (John Mikel Obi 78), Branislav Ivanovic, John Terry, Ashley Cole; Ramires, Frank Lampard, Michael Essien, Yuri Zhirkov (Florent Malouda 70'); Didier Drogba (Nicolas Anelka 70'), Fernando Torres. United (1-4-4-2): Edwin van der Sar; Rafael da Silva (Luis Nani 51'), Nemanja Vidic, Rio Ferdinand, Patrice Evra; Antonio Valencia, Michael Carrick, Ryan Giggs, Park Ji-sung; Javier Hernandez (Dimitar Berbatov 78'), Wayne Rooney.

Pujian Selangit Rooney LONDON ( Waspada): Wayne Rooney mencetak gol paling bernilai, Rabu (Kamis WIB), ketika Manchester United menaklukkan Chelsea 10 pada leg pertama perempatfinal Liga Champions. Berkat gol Rooney menit 24, The Red Devils pun merebut kemenangan pertama di markas London Blues. Rooney pun mendapat pujian selangit dari bosnya, Sir Alex Ferguson. “Rooney tampil luar biasa. Dia membuat kami hanya butuh hasil imbang untuk bisa lolos ke semifinal dan kami yakin menang saat main di Old Trafford pada leg kedua nanti,” papar Ferguson dalam thesportreview. Ditambahkannya, striker Inggris itu kini lebih rajin dan teratur menciptakan gol, sehingga membawa keburuntungan bagi Setan Merah MU. “Ini akan menjadi penting bagi kami,” beber Sir Fergie. Setelah membukukan gol ke gawang Petr Cech, dia bereaksi menyalurkan perasaannya dengan berteriak ke arah kamera di belakang gawang Si Biru. Padahal, Rooney baru dikecam sekaligus dihukum FA karena bereaksi tak wajar setelah mencetak hatrik saat United mengalahkan West Ham 42 di Liga Premier, Sabtu lalu. “Dia pemain paling bermutu, dia menunjukkan tingkat kecerdasannya,” sanjung bek MU Rio Ferdinand kepada televisi olahraga ITV. Namun Ferdinand yang belum pulih dari cedera parah, sungkan berandai-andai menatap semifinal. Dia yakin, The Blues bisa saja melakukan pembalasan pada leg kedua di Old Trafford, 12 April mendatang. “Masih berimbang, tetapi ini merupakan hasil amat bagus bagi kami. Gol pada laga tandang juga menjadi sangat berarti,” beber bek sentral Inggris tersebut Pesta gol Barcelona ketika membantai Shakthar Donetsk 5-1 pada malam yang sama di Camp Nou, menunjukkan permainan dan produktivitas tingkat tinggi perempatfinal Liga Champions. Apalagi sehari sebelumnya, Real Madrid pun mencetak empat gol ke gawang Tottenham Hotspur. FC Schalke malah membuat sensasi saat mempermalukan penyandang gelar Inter Milan 5-2 di San Siro, Kendati di London hanya terjadi gol tunggal, namun jalannya laga cukup mendebarkan. Juga membuat penonton tidak beranjak dari tempat

duduk mereka, karena kedua tim sama-sama berusaha menunjukkan permainan terbaiknya. United yang menundukkan Chelsea melalui tendangan penalti pada final 2008 di Moskow, tampil tanpa Ferdinand yang istirahat lebih dari dua bulan karena cedera. (m15/ant/afp/itv)


BINTANG kemenangan MU Wayne Rooney bergaya merayakan golnya ke gawang Chelsea di Stamford Bridge, London, Kamis (7/4) dinihari WIB.

sebut. Tapi Seydou Keita segera meresponnya untuk tim tuan rumah dan Xavi Hernandez memastikan pesta El Blaugrana. Dalam duel berat sebelah tersebut, tidak ada kejutan dalam susunan pemain inti yang diturunkan entrenador Barca Pep Guardiola. Pedro Rodriguez menjadi pemain cadangan, sehingga Iniesta didorong menempati posisinya dan Keita mengisi lapangan tengah. Barca-Shakhtar terakhir kali bertemu pada Piala Super Eropa 2009. Waktu itu pasukan Pep baru mencetak satusatunya gol menit 115. Tapi kali ini mereka langsung unggul hanya dua menit setelah laga dimulai lewat Iniesta. Tim tamu yang diasuh Mircea Lucescu berusaha menjawab tekanan Barca dengan permainan menyerang pula dipimpin striker Luiz Adriano. “Kami tidak pantas menderita kekalahan ini,” kata kapten Shakthar Darijo Srna. “Seperti ada yang tak biasa dalam duel tadi, tapi kami merasa bermain lebih baik daripada di London. Hanya saja lawan yang dihadapi juga berbeda,” tambah bintang Kroasia tersebut. (m15/goal/afp/espn)

kirkan laga melawan Real Madrid,” dalih Guardiola, seperti dikutip dari Goal, Kamis (7/4). Peluang melakoni semifinal antar klub Spanyol bertajuk El Clasico sangat memungkinkan terjadi. Sebab Barca sudah mengantungi kemenangan besar, begitu pula El Real yang pada etape sama membantai Tottenham Hotspur 4-0 di Santiago Bernabeu. “Hasilnya memang seperti itu, namun Shakhtar sebuah tim yang dilatih oleh pelatih berpengalaman. Saya masih takut tersingkir,” tutur Guardiola. Playmaker Barca Xavi Hernandez pun berpandangan demikian. “Akan menjadi mo-


PELATIH Barca Pep Guardiola (kiri) sibuk memberi instruksi kepada Xavi Hernandez cs saat menjamu Shakhtar di Camp Nou. men yang sangat bersejarah dan kami siap untuk menantang Real Madrid,” jelas Xavi kepada Marca. “Sepakbola memang penuh tantangan dan kejutan. Tapi masih ada satu laga lagi yang harus kami mainkan,” tegas bintang tim nasional

Spanyol tersebut. Xavi juga mengaku sangat puas dengan sukses timnya membantai Shakhtar. “Benarbenar laga yang sempurna dan luar biasa. Ini merupakan langkah besar untuk melaju ke semifinal,” ujarnya lagi. (m15/goal/rtr)

Ancelotti Tetap Yakin LONDON (Waspada): Manajer Carlo Ancelotti belum mau mengubur mimpinya mempersembahkan gelar Liga Champions untuk kali pertama bersama Chelsea. Dia tetap yakin, kendati pasukannya kalah 0-1 ketika menjamu Manchester United (MU) pada leg perempatfinal di Stamford Bridge, London. “Kami akan bermain lagi di Old Trafford, itu memang menjadi laga yang tidak mudah. Tapi musim lalu di saat yang sama, kami menang di sana dan bisa merebut gelar,” ucap Ancelotti melalui Reuters, Kamis

(7/4). Kedua tim akan duel lagi pada leg kedua di Old Trafford, 12 April mendatang. The Blues harus mampu menang setidaknya dengan skor 2-1 untuk mewujudkan optimisme Ancelotti. “Secara umum kami telah bermain bagus. Walaupun sempat tertinggal 1-0, kami mampu bangkit dan mengendalikan permainan,” klaim pelatih asal Italia itu. Dia pun menuding wasit Alberto Undiano Mallenco telah membuat kesalahan, karena tidak memberikan hadiah penalti setelah Patrice Evra terlihat melakukan pelanggaran kepada Ramires di kotak


terlarang MU. “Seharusnya wasit memberikan hukuman,” tegas Ancelotti. “Kami bekerja keras dan punya peluang untuk tendangan penalti di akhir laga serta menyentuh mistar gawang di babak pertama. Kami punya beberapa peluang dan tidak layak kalah,” katanya menambahkan. Masuknya striker Nicolas Anelka menggantikan posisi Didier Drogba sebagai tandem Fernando Torres juga telah menambah dahsyat tekanan Si Biru terhadap Si Setan Merah. Hanya karena kegemilangan kiper MU Edwin van der Sar, semua peluang gol London Blues akhirnya semua sirna. Tetapi, itu menjadi sumber keyakinan Ancelotti bahwa skuadnya mampu melakukan pembalasan pada leg kedua. “Jelas kami tahu akan susah menang di sana (Old Trafford). Tapi kami punya kepercayaan diri,” ujarnya. ARSITEK Chelsea Carlo Ancelotti (kiri) yakin dapat menaklukkan manajer MU Sir Alex Ferguson (kanan).

Sumatera Utara

WASPADA Jumat 8 April 2011

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:30 12:43 12:31 12:38 12:37 12:34 12:31 12:26 12:33 12:33

‘Ashar 15:34 15:44 15:35 15:39 15:40 15:42 15:36 15:32 15:38 15:36

Magrib 18:36 18:50 18:36 18:44 18:43 18:39 18:36 18:32 18:39 18:39



Shubuh Syuruq


19:44 19:58 19:45 19:53 19:52 19:47 19:45 19:40 19:47 19:47

04:58 05:10 04:58 05:04 05:04 05:03 04:59 04:54 05:01 05:00

05:08 05:20 05:08 05:14 05:14 05:13 05:09 05:04 05:11 05:10

L.Seumawe 12:36 L. Pakam 12:29 Sei Rampah12:28 Meulaboh 12:40 P.Sidimpuan 12:28 P. Siantar 12:29 Balige 12:29 R. Prapat 12:25 Sabang 12:43 Pandan 12:30

06:22 06:35 06:23 06:29 06:29 06:27 06:23 06:19 06:25 06:25

Zhuhur ‘Ashar 15:38 15:34 15:33 15:44 15:35 15:34 15:35 15:32 15:45 15:37




Shubuh Syuruq


Zhuhur ‘Ashar




Shubuh Syuruq


18:42 18:35 18:34 18:46 18:32 18:34 18:33 18:30 18:50 18:34

19:51 19:43 19:42 19:54 19:41 19:42 19:42 19:39 19:58 19:43

05:03 04:57 04:56 05:07 04:56 04:56 04:57 04:54 05:09 04:58

05:13 05:07 05:06 05:17 05:06 05:06 05:07 05:04 05:19 05:08

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:30 12:31 12:41 12:34 12:31 12:37 12:26 12:36 12:29 12:28

18:34 18:36 18:47 18:39 18:36 18:43 18:31 18:41 18:34 18:34

19:43 19:45 19:56 19:47 19:45 19:52 19:39 19:50 19:42 19:42

04:58 04:59 05:07 05:02 04:58 05:04 04:54 05:04 04:57 04:56

05:08 05:09 05:17 05:12 05:08 05:14 05:04 05:14 05:07 05:06

Panyabungan 12:26 Teluk Dalam12:33 Salak 12:31 Limapuluh 12:27 Parapat 12:29 GunungTua 12:26 Sibuhuan 12:26 Lhoksukon 12:36 D.Sanggul 12:30 Kotapinang 12:24 AekKanopan 12:26

06:28 06:21 06:21 06:32 06:21 06:21 06:21 06:18 06:34 06:23

15:37 15:37 15:42 15:40 15:35 15:40 15:31 15:41 15:36 15:33

06:23 06:24 06:32 06:26 06:23 06:29 06:18 06:28 06:22 06:20

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

Nasabah Bank Di T. Tinggi Kembali Korban Rampok, Rp 25 Juta Raib TEBINGTINGGI (Waspada): Sepulang mengambil uang dari bank, seorang nasabah bank kembali menjadi korban perampokan. Uang yang disimpan dari dalam bagasi sepeda motornya sebesar Rp 25 juta raib seketika saat parkir di warung untuk membeli makanan di Jalan Veteran Kota Tebingtinggi, Kamis (7/4) sekira pukul 10.00. Korban Mincu alias Iwi,45, warga Jalan Jenderal Sudirman, Kota Tebingtinggi langsung melapor ke Mapolres Tebingtinggi. Dalam laporannya kepada petugas, pengusaha gas elpiji ini mengatakan baru saja mengambil uang dari bank BRI Cabang Tebingtinggi di Jalan Sutomo sebesar Rp 25 juta. Uang dikatakannya untuk keperluan mengembangkan bisnis usaha, lalu disimpan dalam bagasi sepeda motor Suzuki Shogun BK 23870 ON yang dikendarainya. Sebelum pulang ia sempat singgah membeli makanan di warung Jalan Veteran. Sampai di rumah ketika hendak mengambil uang yang diletakkan di dalam bagasi sepeda motor, ia terkejut bagasi sudah tidak terkunci dan uang di dalamnya sudah raib. Petugas yang mendapat laporan kejadian langsung terjun melakukan olah TKP dan memanggil petugas parkir di kawasan JalanVeteran untuk dimintai keterangan. Zainal Saragih, 39, petugas parkir di sana mengatakan, saat kejadian ia sempat melihat mobil Toyota Kijang jantan parkir di dekat sepeda motor korban. Salah seorang penumpang mobil tersebut sempat menukarkan uang kepadanya, namun tidak mengetahui kejadian hilangnya uang dalam bagasi sepeda motor tersebut. Hingga kini korban dan saksi petugas parkir masih dimintai keterangan di Satuan Reskrim Polres Tebingtinggi. Kapolres Tebingtinggi, AKBP Drs. Robert Harianto Watratan, S.Sos ketika dikonfirmasi melalui Kasat Reskrim AKP Lili Astono membenarkan kejadian tersebut. Dikatakan pihaknya tengah melakukan menyelidiki dan mendalami kasus itu dengan meminta keterangan korban dan saksi. (a11)

Karyawan PTPN 4 Adolina Temukan Mayat PERBAUNGAN (Waspada): Karyawan PTPN4 Adolina, Supriono,35,menemukanmayatwanitatanpaidentitasdiperkirakan berusia70tahundiBlokACAfdelingIIIPTPNIV,Adolina,Perbaungan di Dusun Pondok Niur, Desa Adolina, Kec. Perbaungan, Kab.Sergai, Kamis (7/4) sekira pukul 08:15, saat melakukan pemupukan kelapa sawit di kebun itu. Mayat mengunakan kaos warna hitam rok panjang bermotif kotak-kotak warna merah dan Posisi terlentang. “Kita belum mengetahui identitas korban dan mayatnya dibawa ke RS Pirngadi Medan untuk otopsi, diperkirakan mayat sudah dua Minggu,” jelas Kapolsek Perbaungan melalui Kanit Reskrim Ipda LB Sihombing. (c03)

Waspada/Andi Nasution

PLT Gubsu Gatot Pujo Nuggroho, ST menyerahkan tunggul kecamatan terbaik 2010 tingkat Sumatera Utara kepada Camat Kutalimbaru yang kini Camat Tanjungmorawa Zainal Abidin Hutagalung di Lapangan Alun-alun Pemkab Deliserdang, Lubuk Pakam, Kamis (7/4).

Kutalimbaru Kecamatan Terbaik Sumut LUBUK PAKAM (Waspada): Kecamatan Kutalimbaru, Kabupaten Deliserdang yang ditetapkan sebagai kecamatan terbaik tingkat Provinsi Sumatera Utara 2010 menerima tunggul kecamatan terbaik dan penghargaan dari Plt Gubsu Gatot Pujo Nugroho, ST di Lapangan Alun-alun Pemkab Deliserdang, Lubuk Pakam, Kamis (7/4). Tunggul kecamatan terbaik itu diterima Camat Kutalimbaru yang kini sebagai CamatTanjungmorawa Zainal Abidin Hutagalung, diawali penyerahan seperangkat pakaian adat Melayu dari tokoh masyarakat Melayu Deliserdang kepada Plt Gubsu Gatot Pujo Nugroho, ST, disaksikan Muspida Sumut diantaranya Pangkosek Hanudnas III Marsekal Pertama TNI AU Bonar H Hutagaol,Wadan Lantamal Kolonel Marinir Suprayogi, Danlanud Kol Penerbang Taufik Hidayat SE, Bupati Deliserdang Drs H Amri Tambunan beserta Wabup H Zainuddin Mars, Ketua TP PKK Ny Hj Anita Amri Tambunan, Muspida Deliserdang diantaranya Ketua DPRD Hj Fatmawati, Dandim 0204/DS Letkol Arh Wawik Dwinanto, Ketua Pengadilan Negeri Lubuk Pakam Suharjono, SH, MH, Ketua Pengadilan Agama Deliserdang Dra Hj Neliati, SH,WakilWalikota Medan Drs Dzulmi Eldin, MSi,WakilWalikota Tanjung Balai Rolel Harahap, Danbrig 7/RR, para pejabat Pemkab Deliserdang, Camat Terbaik Tingkat Kabupaten/Kota se-Sumut, para Kades, Ketua TP PKK Desa, OKP, Pramuka dan pelajar serta masyarakat Kutalimbaru. Selain itu, Plt Gubsu juga menyerahkan piagam penghargaan, piala dan dana kepada Kecamatan Kutalimbaru sebagai terbaik I, Kecamatan Datuk Bandar, Tanjung Balai terbaik II, Kecamatan Barumun, Kabupaten Padang Lawas terbaik III, Kecamatan Medan Selayang, Kota Medan harapan I, Kecamatan Medang Deras, Kabupaten Batu Bara harapan II, dan Kecamatan Rahuning, Kabupaten Asahan harapan III, serta diserahkan juga kepada juara di tingkat Kabupaten dan Kota se-Sumut. Sementara, Danramil 02/Kutalimbaru Kapt Arh Ibrahim dan Kapolsek Kutalimbaru AKP Bambang Rubianto, SH juga menerima penghargaan khusus berupa piagam dan piala atas peran sertanya dalam pelaksanaan pembangunan di Kecamatan Kutalimbaru yang berhasil meraih Kecamatan Terbaik I untuk tingkat Provinsi Sumut 2010. Plt Gubsu Gatot Pujo Nugroho, ST dalam sambutannya mengatakan,dalammendukungpercepatanimplementasiotonomi daerah, kecamatan sebagai bagian integral birokrasi pemerintahan di daerah punya peranan yang strategis, dimana camat sebagai perangkat daerah mempunyai kekhususan dibandingkan dengan perangkat daerah lainnya dalam pelaksanaan tugas pokok dan fungsinya untuk mendukung azas desentralisasi. Usai penyerahan tunggul, Plt Gubsu Gatot Pujo Nugroho, ST didampingi Muspida Sumut, Bupati Deliserdang Drs H Amri Tambunan, Wabup H Zainuddin Mars dan Ketua TP PKK Ny Hj Anita Amri Tambunan beserta rombongan mengunjungi gedung Dekranasda Deliserdang untuk melihat hasil produk asli khas Deliserdang dan kerajinan tangan. (c02)

B1 Zhuhur ‘Ashar 15:35 15:42 15:37 15:32 15:35 15:34 15:34 15:37 15:36 15:31 15:32




Shubuh Syuruq

18:31 18:38 18:36 18:32 18:34 18:31 18:30 18:42 18:35 18:29 18:31

19:39 19:46 19:45 19:41 19:43 19:39 19:39 19:50 19:43 19:37 19:40

04:55 05:02 04:59 04:55 04:57 04:55 04:55 05:02 04:58 04:53 04:54

05:05 05:12 05:09 05:05 05:07 05:05 05:05 05:12 05:08 05:03 05:04

06:20 06:27 06:24 06:19 06:22 06:19 06:19 06:27 06:22 06:17 06:19

Kasus Perampokan Bersenpi Di Simalungun Belum Ada Terungkap P.SIANTAR (Waspada): Kasus perampokan bersenjata api (bersenpi) khususnya mobil truk dibarengipenganiayaanterhadap pengemudi dan kerneknya serta mengakibatkan kerugian materil mencapai ratusan juta rupiah di wilayah hukum Polres Simalungun, khususnya di sepanjang Jalinsum Pematangsiantar-Parapat-Perdagangan-Medan sejak tahun 2010 hingga saat ini belum ada yang terungkap. Sesuai catatan yang ada, sebanyak delapan kasus perampokan bersenpi di sepanjang Jalinsum itu dalam tahun 2010 terdiri perampokan terhadap korban Aladin Saragih, 40, sopir, warga Nagori Pematang Raya, Kecamatan Raya, Simalungun di jalan umum Pematangsiantar-Perdagangan, Nagori Pematang Sahkuda pada Minggu (9/5/2010) pukul 03:00. Tersangka perampok bersenpimenggunakanmobilToyota Kijang Kapsul memepet mobil truk Colt Diesel BK 9102 TN dikemudikan korban, menodong pakai senpi dan menutup mata dan mengikat kedua tangan korban serta kerneknya. Sesudah dianiya, korban dan kerneknya dibuang di areal perkebunan kelapa sawit di Nagori Bandar Tinggi serta membawa kabur mobil truk serta HP Nokia milik korban. Kejdian berikutnya yakni perampokan terhadap korban Edi Supandi, 27, wiraswasta, dan kerneknya Julianto Sinaga, 30, keduanya warga Pandan Hilir, Pasar IV, Kecamatan Hamparan Perak, Kabupaten Deli Serdang di Jalinsum PematangsiantarParapat, Nagori Dolok Parmonangan pada Rabu (12/5/2010) pukul 03:30. Modusnya sama, dimana mobil Toyota Avanza digunakan tersangka perampok menyalib mobil truk dikemudikan Edi Supandidantersangkaperampok memecahkan kaca depan mobil truk serta menggeledah kedua

korban dengan ancaman senpi dan membawa kabur uang tunai Rp465.000,SIMB1Umum,STNK sepeda motor dan KTP. Perampokan terhadap korbanMangihutPakpahan,33,sopir dan kernetnya Jimmi Saragih, keduanyawargaSimalungun,terjadidiJalinsumPematangsiantarMedan, Km 12, Nagori Batu Silangit pada Kamis (4/11) pukul 05:00. MobilToyota Avanza tersangka perampok menyalib colt diesel BK 9057 TN dikemudikan Mangihut. Dengan todongan senpi, Mangihut dan Jimmi diikat di pohon rambung serta truk dibawa kabur. Korban Helmot, 30, sopir, warga Simalungun dirampok di Jalinsum Pematangsiantar Parapat, Nagori Pondok Bulu pada Rabu (17/11) pukul 05:00. Mobil tersangka perampok menyalib mobil Mitsubishi L300 dikemudikan korban dengan alasan mobil korban menyenggol mobil mereka. Korban selanjutnya diikat kedua tangannya dan dibuang di Aek Nauli sesudah uang tunai Rp 15 hasil penjualan ayam milik tokenya diambil tersangka perampok. Perampokan lainnya berlanjut dalam tahun 2011 dan terjadi terhadap korban Muhammad Amin Bin Usmann, 60, sopir dan kernetnya Ibrahim, 30, keduanya warga Kabupaten Aceh Timur dijalanumumLimapuluh-Perdagangan, Nagori Perlanaan pada Rabu (19/1) pukul 02:00. Tersangka perampok yang menggunakan mobil Toyota KIjang Innova sengaja mencegat colt diesel BL 9006 PB bermuatan getah 4 ton. Muhammad dan Ibrahim diikat kedua tangan mereka dengan ancaman senpi dan dibuang di perkebunan kelapa sawit di Nagori Kerasaan serta tersang perampok membawa kabur mobil truk bermuatan getah. Korban Armi, 50, sopir, kernetnya Suprapto, 52, dan Zulfan, 32, ketiganya warga PIR Pangka-

lanbrandan, Kabupaten Langkat dirampok di Jalinsum Pematangsiantar-Medan, Nagori Bandar Jambu pada Senin (14/ 2) pukul 02:00.Para tersangka perampok menggasak colt diesel BK 9012 BM bermuatan getah bernilai Rp 200 juta. Perampokan yang terjadi baru-baru ini dialami dua karyawan pabrik kelapa sawit PT Prima Sauhur Lestari Kerasaan, Toni, 29, dan Budi, 31, di jalan umum Panombean pada Selasa (5/4) pukul 09:00. Akibat perampokan itu,sebanyakRp83jutayangakan digunakan membeli buah kelapa sawit dibawa kabur tersangka perampok. Modus perampokan diawali dengantembakansenpikejendela kaca depan mobil yang dikemudikan korban hingga korban ketakutan dan membuat mobil terberam. Kesempatan itu digunakan dua tersangka perampok yang menggunakan sepeda motor RX King menggasak uang Rp 83 juta serta melarikan diri. Imbau kerjasama Kapolres Simalungun AKBP Drs Marzuki, MM melalui Kasubbag Humas AKP Sulaiman Simanjuntak dan Kasat Reskrim AKP Nasrun Pasaribu, SIK, Kamis (7/4) menyatakan semua kasus perampokan itu masih tetap dalam penyelidikan melalui razia dan patroli serta mengimbau kerjasama seluruh lapisan masyarakat untuk menciptakan situasai yang aman dan kondusif di wilayah Simalungun dan tidak menjadi korban perampokan. Selain itu, secara khusus masyarakat diminta agar aktif berperan serta bekerjasama dengan petugas kepolisian dalam menggalakkan Siskamling di setiap nagori (desa) yang ada, waspada selalu kepada setiap tamu atau warga yang belum dikenali serta didata identitasnya dan segera melaporkannya ke RT/RW setempat dalam waktu 1x24 jam. (a30)

Perampok Bersenpi Gasak Uang Toke Sawit DOLOKMASIHUL (Waspada): Perampok bersenjata api menggasak gudang kelapa sawit milik Bahtiar di Desa Kuala Bali, Kec.Serbajdi, Kab.Serdang Bedagai, Rabu (6/4) pagi. Dalam perampokan itu pemilik gudang mengalami kerugian Rp104 juta. Menurut keterangan yang Waspada peroleh, pagi itu Bahtiar baru saja sampai di gudang miliknya. Karena belum sarapan, Bahtiar pergi mencarinya di salah satu warung di kawasan itu dengan meninggalkan kasir sendirian dalam gudang.

Diperkirakan, saat Bahtiar menuju warung kopi, empat pria yang mengendarai dua sepeda motor Yamaha RX King datang, dan dua di antaranya masuk ke gudang. Sementara, dua tetap menunggu di sepeda motor dan dualagiturunmenghampirikasir. Keduaperampokituawalnya meminta uang pada kasir, namun kasir tidak melayaninya sebab tidak ada izin dari Bahtiar. Karena tidak diberi maka kedua perampok itu mengancam kasir dengan menodongkan senjata api ke kepala kasir. Senjata geng-

gam itu jenis FN. Karena merasa ketakutan sang kasir akhirnya mengeluarkan uang Rp104 juta yang baru dititipkan Bahtiar. Setelah mengambiluangitukeempatnyakeluar dari gudang dan langsung tancap gas melarikan diri. Peristiwa itu yang kedua kali dialami Bahtiar setelah beberapa bulan lalu terjadi perampokan terhadap dirinya sehingga mengalami kerugianRp 200 juta. Kasubbag Humas Polres Sergai AKP Zulkarnain Siregar ketika dikonfirmasimembenarkan. (a08)

Ribut Saat Main Voli, Seorang Tewas RANTAUPRAPAT (Waspada): Karem Laoli alias Ama Rudi,36,karyawanSKUPT Mujur Lestari itu tewas ditikam teman sekampungnya di Afdeling 3 Dusun Sitangko, Desa Tanjung MuliaKec.KampungRakyat,Kab. Labusel. Korban merupakan warga perum karyawan PT Mujur Lestari Afd 3 Dusun Sitangko Desa Tanjung Mulia, Kec Kampung

Rakyat, Kab. Labusel teman satu dusun dengan pelaku EL alias Ama Boy, 35 yang juga karyawan di kebun itu. KapolresLabuhanbatuAKBP Roberts Kennedy melalui Kasubag Humas AKP MT. Aritonang kepada Waspada, Kamis (7/4) melalui telefon mengungkapkan itu.MenurutKasubag,kekisruhan antara sesama pemain voli yang masih tinggal satu kampung itu

terjadi Rabu (6/4) sekira pukul 17:00 diduga berawal dari tidak senangnya pelaku EL. Korban dibawa ke RSU Rantauprapatuntukdivisiumsementara pelaku usai membunuh melarikan diri. Petugas masih melakukan pengejaran terhadap pelaku dan tiga saksi yaitu Masriani Gulo,29, Agustinus Zendrato alias AmaTuti31,danDerismanNduru, 30, sudahdiperiksapetugas.(a17)

Waspada/Abdul Hakim

MOBIL dibakar massa yang terlibat bentrok di Kel. Pekan Batangserangan Kab. Langkat kemarin.

Tiga Peleton Polisi Masih Berjaga Di Lokasi Bentrok Belum Ada Tersangka Yang Ditahan STABAT (Waspada): Pasca bentrok dua kelompok massa di Batangserangan Kab. Langkat, Selasa (5/4) malam, hingga Kamis (7/ 4) kini aparat Polres Langkat dibantu Brimob masih disiagakan dilokasi untuk mengantisipasi bentrok susulan. ‘’Personil Polri yang terlibat dalam pengamanan disana berjumlah 85 orang dibantu puluhan aparat Brimob,’’ kata Kabag Ops Polres Langkat Kompol Dedy Supriadi, Kamis (7/4). Mengingat peluang bentrok susulan terjadi pada malam hari, aparat mulai disiagakan sejak sore hingga pagi. Sementara itu informasi yang diperoleh dari Kanit Jahtanras Polres Langkat Iptu Edi Sukamto, Kamis, belum ada tersangka yang ditahan. Dua orang masih diperiksa sebagai saksi. ‘’Kami masih berusaha menetralkan situasi di lapangan agar bentrok tidak terulang,’’ ujarnya. Sementara itu salah seorang warga Desa Karya Jadi Kec. Batangserangan yang ditemui di Mapolres Langkat mengatakan, pasca bentrok mereka tidak berani keluar desa pada malam hari karena takut disangka musuh kemudian diserang. ‘’Meskipun desa kami jauh dari Kel.

Pekan Batangserangan tempat lokasi pembakaran mobil, banyak jalan-jalan desa yang belum dapat sembarangan dilintasi karena situasi masih mencekam dan kedua kelompok yang bertikai masih saling intip,’’ katanya. Ketua LSM Informasi Indonesia R Sitepu yang bermukim di Batangserangan, menuturkan tahu persis permasalahan hingga terjadi bentrok. ‘’Selama ini ada kesan aparat kepolisian tutup mata untuk memberantas maraknya praktik pencurian getah milik PTPN II Batangserangan hingga dikuasai pihak-pihak yang tidak berwenang. Tidak berlebih jika dikatakan di Batangserangan mafia lebih ditakuti daripada polisi, hal itu kenyataan. Kapoldasu perlu mempertimbangkan jabatan Kapolsek Padangtualang AKP Azhari,’’ katanya kepada sejumlah wartawan kemarin. ‘’Karena itu kita meminta aparat kepolisian mengambil sikap tegas dan tidak pilih kasih untuk menindak siapa yang bersalah melanggar hukum. Jika permasalahan ini tidak menjadiperhatiankhusus,bentrokkemungkinan sewaktu-waktu akan terus terjadi,’’ duganya. (a03)

Ada Unsur Politis, DPRD Dan Masyarakat Tolak Pengangkatan Kepling TEBINGTINGGI (Waspada): Dinilai sarat kepentinganpolitikmenjelangpemungutansuara ulangPilkadaTebingtinggi,DPRDdanmasyarakat menolak Peraturan Walikota No.6 Tahun 2011 tentang Tata Cara Pengangkatan Kepala Lingkungan. Bahkan, banyak di antaranya meminta pemilihanKeplingkembalipadamodelsebelumnya. Masyarakat di Link.02, Kel. Bandar Utama, Kec. T.Tinggi Kota, misalnya telah mengirimkan surat penolakan atas sejumlah calon Kepling yang mendaftar, kepada lurah dan camat setempat. Menurut tokoh masyarakat Link.02, Samboji TS, penolakan itu dilakukan, karena calon Kepling yang maju tidak disenangi warga. Bahkan, ujar Samboji, ada kesan lurah setempat berupaya memaksakan oknum tertentu sebagai Kepling. “Kita juga melihat prosesnya sarat kepentingan politis,” tegas dia. Dari pantauan, sejumlah lingkungan juga mulai mengalami gejolak, karena memandang pengangkatanKeplingtanpapemilihanlangsung, saratkepentinganpolitik.Misalnya,diKel.Bagelen, T.Tinggi Lama dan Mandailing. Sementara itu, DPRD Kota Tebingtinggi melayangkan surat kepada Pj Walikota Drs H Eddy Syofian, MAP, dan meminta proses pengangkatanKeplingyangtengahberlangsungdihentikan. Melalui surat No.170/336/DPRD/2011 tanggal 01 April 2011, perihal Penundaan Sosialisasi Perwa No.6/2011 ditandatanganiWakil Ketua Chairil Mukmin Tambunan, SE, menyatakan rapat DPRD tanggal 31 maret 2011, memutuskan sosialisasi Perwa ditunda/dihentikan. Alasannya,

Perwa itu belum dikonsultasikan dengan DPRD, sehingga dikhawatirkan pelaksanaannya tidak bisa dipertanggung jawabkan. Ketua Fraksi PKPB DPRD Kota Tebingtinggi H. Syamsul Bahri alias Ujang, tegas meminta Perwa No.6 Tahun 2011 itu dibatalkan. Menurut Ujang, Perwa itu telah merusak nilai-nilai demokrasi yang mulai tumbuh di tengah-tengah masyarakat melalui sistem pemilihan langsung sebelumnya. Anggota DPRD itu juga menuding, Perwa itu digunakan sebagai kendaraan politik petinggi PemkoTebingtinggi untuk pemungutan suara ulang Pilkada. “Saya tegaskan Perwa itu harus dibatalkan dan kembali ke sistem sebelumnya melalui pemilihan langsung,” ujar H Syamsul Bahri. Kepala Badan Pemberdayaan Masyarakat dan Pemerintahan Kelurahan (BPMPK) Drs H Nizar Rangkuti, mengatakan Perwa itu bertujuan untuk mengantisipasi terpilihnya sosok Kepling yang tidak kredible. Namun, jika faktanya ada Parpol yang coba memanfaatkan situasi itu, wajar jika masyarakat menolak. Gejolak itu, ujar Nizar, memang harus disikapi pihak kelurahan dengan penjaringan yang jujur tanpa memiliki agenda lain. Perwa No.6 Tahun 2011 merupakan revisi dariPerwaNo.2Tahun2003yangmengamanatkan pemilihan langsung Kepling. Dari berbagai keterangan, salah satu Parpol dan Ormas yang mendukung petinggi Pemko dipemungutansuaraulangPilkada,telahmenyusupkan kadernya untuk menjadi Kepling, melalui kerjasamadenganlurahdancamat.Daripantauan di beberapa lingkungan, faktanya memang demikian.(a09)

Pensiunan Janda PNS Itupun Naik Kursi Roda…. NENEK berusia 70 Tahun ini masih lincah, mengurus cucu dan hobbynya membuat jajanan kue, namun Sabtu (19/3) sekira pukul 16.15 bangkit dari tidur di depan TV ingin berudhuk sholat Ashar, si nenek jatuh terduduk. Pensiunan Janda PNS Dinas Pertanian Kabupaten Asahan dengan penghasilan sekira Rp1 juta dari negara inipun tidak bisa bergerak.ZulEmbri,SHpengurus OP Ladon 89 Asahan/TanjungbalaidanSuburpegawaiRSHAbdulmanan Simatupang kebetulan sedang tidak jauh dari kediaman si nenek, bergerak cepat, memanggil ambulans dan membawanya untuk rawat inap di RS H

Waspada/Rasudin Sihotang

ZAHARA SITI,70 dan anak cucu, diapit Bustami CP dan Hendri Syahputra sedang mencoba kursi bantuan Parlindungan Purba, anggota DPD RI, Kamis (7/4).

Abdulmanan Simatupang. Zahara Siti,70, ibu dari delapan anak, 20 cucu dan satu cicit inihanyabisaberdoadanmengerang. Dengan pelayanan Askes Kelas II-B di RS.H.Abdulamanan SimatupangKisaran,hasilrotgent menunjukkan si nenek mengalami patah tulang pada pangkal paha kiri, dan terkilir bahu kiri. “Saya rekomendasikan obat untukmerekatkankembalitulang patahsetuaini,tapihanyamukjizat yang bisa memulihkan 100 persen kembali,” ujar dr Herwanto, SpB, Dirut RS H Abdulmanan Simatupang, seperti ditirukan salah seorang anaknya kepada Waspada, Kamis (7/4). Istri dari almarhum Nanoi Nehe,38tahunmengabdidiDinas Pertanian Asahan, mulai dari pegawai Balai Benih Rawang (sekarang SPP Pertanian Asahan) tahun 1958, Mantri Tani/PPK

Kecamatan Buntupane/Mandoge tahun 1960 sampai tahun 1985, pensiun dalam posisi tugas di Sekretariat Bimas Dinas Pertanian Kabupaten Asahan tahun 1988, sempat rawat inap empat malam diVIP RS.H.Abdulmanan Simatupang. “Sedihtidakbisabuatkuedan mengejar-ngejar cucu yang lasak lagi,” ujar Zahara Siti kepada Bustami CP utusan Parlindungan Purba anggota DPD RI dan Ketua Pengprov Percasi Sumut Kamis (7/4) di kediaman si nenek, jalan Sutami LingkunganVIII Kelurahan Kisaran Baru. Bustami CP yang juga pengurus INTI (Indonesia Tionghoa) Asahan dan Ketua Pengkab Perbasi Asahan didampingi Hendri Syahputra pengurus harian DPD Partai Golkar Asahan menyerahkan satu unit kursi roda kepada Zahara Siti sumbangan Parlin-

dungan Purba. “Kemarin saya beritahu Pak Purba, tadi malam kursi rodanya tiba di Kisaran. Pak Purba respon dengan kondisi begini dan siap membantukegiatanmasyarakat,” ujar Bustami CP.SiNenek dibantu anak anaknya mencoba naik ke kursi roda, kemudian didorong ke tepi jalan. Si Nenek tersenyum, entah apa yang ada dalam benaknya. “Terimakasih kepada Pak Parlindungan Purba, semoga tetap sehat wal afiat sekeluarga, banyak rezeki dan sukses dalam karirdantugas.Mudah-mudahan saya cepat pulih dan kursi roda ini saya serahkan kepada yang membutuhkan,” ujar si nenek terharu. Pensiunan Janda PNS itupun naik kursi roda, Insya Allah hanya untuk sementara. Rasudin Sihotang

Sumatera Utara

B2 Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir

Wartawan Kota Medan: Umum: Zulkifli Harahap, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, David Swayana, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Dedek Juliadi, Hajrul Azhari Ritonga, Syahrial Siregar, Khairil Umri Batubara. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebing Tinggi: Muhammad Idris, Abdul Khalik. Pematang Siantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Pakpak Bharat: Arlius Tumanggor. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Asahan: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun. Kuala Simpang: Muhammad Hanafiah, Hasanul Hidayat. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, Agusni AH, H. Samsuar. Lhoksukon: Musyawir. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin. Takengon: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Ali Amran. Blangkejeren: Bustanuddin, Wintoni. Bener Meriah: Irham Hakim. Singkil: Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan Waspada dilengkapi dengan kartu pers. Tidak dibenarkan menerima uang dalam bentuk apapun. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan: hitam-putih Rp. 33.000,-, berwarna Rp. 90.000,Ukuran kolom: 40,5 mm. E-mail Iklan: Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

LSM Bisukma Gelar Latihan Wirausaha Tingkat SMP Di Tarutung MEDAN (Waspada): Spirit membangun bona pasogit kembali diwujudkan LSM Bisukma dengan memperluas penyelenggaraan pelatihan entrepreneurship kepada siswa SMP se-Tapanuli Utara pada 8 dan 9 April 2011 di aula Diknas Taput. Hal ini disampaikan Ketua Umum LSM Bisukma Sumatera Utara Ir Erikson Sianipar MM didampingi Ketua Pelaksana Drs Wesly Sianipar, Drs. Jumian Situmorang, Sekretaris Umum Linna Indyarti,SS, David Ginting,SE, Bendahara Linda C Sinaga, SE dan Koordinator Area Serdang Bedagai Drs Darwis Effendi Siahaan, Rabu (6/4) di Sekretariat Jalan H.M.Djoni No. 50L Medan. Dijelaskannya,kegiataninidengantema‘Sumut Entrepreneurship Challenge’ 2011 menjadi sumber spirit bagi LSM Bisukma dalam upaya terus mendorong terjadinya perubahan pola pikir dan sikap masyarakat Sumatra Utara menuju masyarakat yang cerdas dan sejahtera. Dikatakan,LSMBisukmayangsudahmenyelenggarakanpelatihan 650 siswa SMA/SMK serta para guru SMA/SMK se Sumatera Utara, memperluas pesertanya sampai dengan siswa -siswi SMP dengan harapan jiwa entrepreneurship sudah tertanam lebih awal. Pelatihan direncanakan dilaksanakan dua angkatan kepada 350 siswa. Diharapkan Bupati Tapanuli Utara dapat membuka pelatihan dan direncanakan peserta pelatihan ke-1000 akan diberikan tanda khusus oleh Plt.Gubernur Sumatra Utara Gatot Pujo Nugroho. Padapelatihanini,LSMBisukmamenggandengHATIUSUMedan dengan menghadirkan Ir Buchari, Mkes dan DR Ir Rosdanelly Hasibuan. (m34)

Jumat 8 April 2011

Jalan Negara Simpang Tiga Rawan Laka Lantas


Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini dan Artikel: Dedi Sahputra. Redaktur Edisi Minggu & Akhir Pekan: Hendra DS. Redaktur Berita: H. Akmal AZ, H. Halim Hasan. Redaktur Kota Medan: Muhammad Thariq. Redaktur Sumatera Utara: M. Zeini Zen. Redaktur Aceh: Rizaldi Anwar. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: Edward Thahir. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Armin R. Nasution. Redaktur Agama: H. Syarifuddin Elhayat. Kalitbang: H. Akmal AZ. Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumut), Aji Wahyudi (Aceh). Asisten Redaktur: David Swayana (Kota Medan, Infotainmen); Irwandi Harahap (Kota Medan); Feirizal Purba, Diurna Wantana (Sumatera Utara); H.T. Donny Paridi (Aceh); Armansyah Thahir (Aceh, Otomotif); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); Hj. Ayu Kesumaningtyas (Kesehatan).


KABANJAHE (Waspada): Jalan negara tepat di depan masjid agung pom bensin simpang tiga Kabanjahe kondisinya memperihatinkan bahkan terlihat dari setiap pengendara ekstra hati hati saat melintas di jalan negara. Sebagaimana pantauan, Kamis (7/4), terlihat kondisi jalan negara Kabanjahe- Sidikalang yang merupakan jalan utama tepat berada di bibir kota Kabanjahe persis di persimpangan jalan Masjid Agung dan SPBU, kondisi jalan terlihat berlubang-lubang hingga para pengendara yang melintasi jalan harus waspada. Salah seorang warga Posmawati br Sinurat,34, yang tinggal tepat di pinggir jalan itu mengatakan kepada Waspada, di lokasi ini sering terjadi kecelakaan bahkan beberapa kali warga yang hendak menyeberangi jalan ini hampir tersenggol kendaraan yang melintas gara-gara kendaraan hendak mengelakkan beberapa lubang. Kemudian di persimpanag jalan utama antara Kabanjahe Sidikalang tepantya di depan Masjid agung memiliki empat persimpangan yang letaknya sangat berdekatan hendaklah segera diperhatikan. Di jalan itu terlihat beberapa lubang yang menganga bahkan kedalamnya mencapai 25 centimeter dan lebarnya mencapai satu meter lebih yang ada di persimpangan bahkan di sepanjang jalan Kabanjahe-Sidikalang. Mereka berharap Pemkab Karo untuk dapat memperhatikan dan melakukan perbaikan di sepanjang jalan Kabanjehe Sidikalang tepatnya di depan Masjid Agung dan SPBU simpang tiga Kabanjahe. (c10) Waspada/Micky Maliki

TERLIHAT lubang yang rnenganga di jalan simpang tiga tepatnya di depan Masjid Agung dan SPBU Kabanjahe sering terjadi laka lantas. Foto direkam, Kamis(7/4).

Terkait Larangan Pengembalaan Ternak

Warga 7 Nagori Layangkan Surat Protes PT Sipef SIMALUNGUN (Waspada): Protes warga terhadap manajemen perusahaan perkebunan kelapa sawit PT Sipef Bukit Maradja, Kec. Gunung Malela, Kab. Simalungun masih terus berlanjut. Setelah sehari sebelumnya (Rabu,6/4)melaluiaksiunjukrasa, warga berhasil ‘mengusir’ alat beratdanmenghentikankegiatan penggalian parit. Kini protes semakin menguat dari tujuh nagori (desa) yang ada di sekitar kebun milik PMA (Perusahaan Modal Asing) itu. Proteswargadilakukanmelalui surat tertulis yang ditujukan kepada Bupati Simalungun dan Ketua DPRD Simalungun yang

ditandatangani Ketua LPMN, Ketua Maujana serta Pangulu (Kepala Desa) dari ketujuh nagori. Bahkan surat protes warga didukung dan turut ditandatangani Wakil Ketua DPRD Simalungun, Julius Silalahi. Ketujuh nagori dimaksud antara lain Nagori Sahkuda Bayu, PamatangAsilom,Lingga,Bandar Siantar, Marihat Bukit, Bukit Maraja dan Pamatang Gajing. Dalam surat dari masing-masing nagori senada menyatakan keberatannya atas penggalian jalan dan pelarangan pengembalaan ternak di areal kebun PT Sipef. Melalui surat itu juga, warga berharap Bupati Simalungun, JR Saragih dan Ketua DPRD Simalu-

ngun dapat membantu agar masyarakattetapdapatmengembalakan ternaknya di areal PT Sipef. “Selamainimasyarakatsudah sangat terbantu dengan memelihara ternak. Justru itu mereka sangat keberatan apabila dilarang mengembalakan ternak di areal kebun Sipef,” tegas Suyatno, pangulu nagori Sahkuda Bayu. Sedangkan menyangkut pengerukan atau penggalian badan jalan berbatasan antara nagorinagori dengan perkebunan Sipef yang lebarnya sekitar 3 meter dengankedalaman4meterdikhawatirkan dapat menimbulkan kecelakaan bagi pejalan kaki dan pengendara sepedamotor yang

selalumelintasdarijalanitu.Bukan hanya itu, akibat pengerukan itu juga dapat mengakibatkan banjir di sekitar jalan dan lingkungan masyarakat, serta menyulitkan ternak warga melintas dari galian itu, tambah Suyatno. Asrul Lubis, manajer PT Sipef Bukit Maraja menyatakan, penggalian parit yang dilakukan pihaknya untuk pengamanan areal tanaman kelapa sawit milik PT Sipef dari aksi pencurian dan gangguan ternak warga. Menurutnya, pihak perusahaan selama ini banyak mengalami kerugian dariaksipencuriandangangguan ternak yang merusak tanaman. (a29)

Polsek Dolok Masihul Tahan Dua Tersangka Pencabulan DOLOKMASIHUL(Waspada): Polisi Polsek Dolok Masihul menciduk dua tersangka pencabulan anak bawah umur, MI alias Is, 21, dan LGN, 23, Senin (4/4) subuh. MIaliasIs,wargaDesaSenensen, Kec.Kemuning, Kab.Indra Giri Hilir, Provisni Riau dan LGN, warga Desa Singgogo, Kec.Kotari, Kab.Serdang Bedagai. Sedangkan korban adalah warga Kec.Sei Suka, Kab. Batubara. Selain menangkap tersangka polisi juga mengamankan pakaian dalam dan satu sepeda motor tanpa plat nomor polisi. Keterangan Waspada peroleh, Selasa(5/4), awalnya korban dan tersangka telah lama berkenalan melalui HP. Setelah berkenalan MI alias IS sudah lima kali

datang ke rumah korban. PadaharikejadianMIpermisi kepada orangtua korban agar mereka diberikan izin untuk pergi ke rumah orang tua MI di Lubuk Pakam. Saat itu permohonan MI dikabulkan orang tua korban maka merekapun berangkat denganmengendaraisepedamotor. Begitu sampai di Kota Tebingtinggi MI bertemu dengan temannya LGN dan mereka berencana berboncengan tiga menuju Dolok Masihul. Namun karena takut ditangkap Polantas maka LGN dan korban disuruh MI naik bus dan dianaiksepedamotordanmenunggu di Simpang Belidaan, Desa Firdaus, Kec.Sei Rampah.

Setelah LGN dan korban turun dari bus di Simpang Belidaan lalu mereka berangkat ke arah DolokMasihulberboncengantiga. Sesampainyadiarealperkebunan kelapa sawit PTPN III Kebun Sarang Giting, Desa SarangTorop, Kec.DolokMasihul,MImenyuruh LGN dan korban untuk turun dari sepeda motor, tetapi korban menolak. Karena menolak lalu MI memukul dan mendorong korban hingga terjatuh ke tanah dalam posisi terlentang. Saat itu lah di hadapan LGN busana korban dibuka paksa oleh tersangka lalu mencabulinya. Setelah kejadian itu, MI kembali membonceng korban dan mengantarkannya ke rumah orang tua korban di Kec.Sei Suka.

Sedangkan LGN pulang ke rumahnya. Begitu sampai di rumah, korban menceritakan hal yang terjadi. Mendengar pengakuan anaknyamakaorangtuabersama keluarganyalangsungmenangkap MI dan membawanya ke Mapolsek Dolok Masihul, untuk membuat laporan pengaduan. Setelah membuat pengaduan MI lalu ditahan Polsek Dolok Masihul. Sementara temannya LGN ditangkap petugas saat menderes getah di kampungnya, Selasa(5/4) pukul 11:00. Kasubbag Humas Polres Serdang Bedagai AKP ZN.Siregar yang dikonfirmasi Waspada, Selasa (5/4) membenarkan dan kedua tersangka masih diperiksa di Mapolsek Dolok Masihul.(a08)

Polres Samosir Gandeng Masyarakat Bansos Kandepag Samosir Rp239 Juta SAMOSIR (Waspada) : Dalam upaya pemberantasan kegiatan ilegal, Kapolres Samosir AKBP Drs EP Sirait melakukan pertemuan dengan camat, tokoh agama, masyarakat, adat dan pemuda, di Aula Polres Samosir, Senin (4/4). Kapolres mengatakan kesepakatan yang dilakukan dengan masyarakat,sebagaitindaklanjutkesepakatanyangsudahdilakukan Kapolres Samosir dengan seluruh Kapolsek. Selain kesepakatan ini, pihaknya juga melakukan operasi Giat Rutin Kepolisian untuk mengatisipasi gangguan keamanan di Samosir. Tokoh masyarakat Pangururan,Tumpak Situmorang menyatakan sangat setuju dengan program Kepolisian Samosir. (c11)

SAMOSIR (Waspada) : Tahun 2010, Kandepag Samosir menganggarkan Bantuan Sosial sebesar Rp239.400.000 yang diperuntukkan dengan sasaran Bantuan Guru-guru sekolah minggu sekira Rp 500.000/tahun, Bantuan operasional Pengawas Pendidikan Guru Agama Katolik dan Kristen Rp 35 juta, penyuluh agama non PNS Kristen, Katolik dan Islam Rp 88,6 juta. Selanjutnya bantuan sosial untuk lembaga pendidikan sebesar Rp 118 juta: Guru honor katolik dan Kristen sebesar Rp 38 juta. Bantuan penyusunan silabus KTSP Guru PNS Agama Kristen dan Katolik sebesar Rp 80 juta. Kakandepag Kab Samosir Drs Folulu Laia kepada Waspada, Kamis (7/4) menyebutkan jumlah penganut agama di Samosir yakni Kristen (76.531 orang), Katolik (58.552), Islam (1.7460), Agama lain/parmalim (331). (c11)

Mutasi 8 Pejabat Kemenag Karo KABANJAHE (Waspada) : Delapan pejabat Kantor Kementerian Agama (Kemenag) Kabupaten Karo di mutasi.Acaranya berlangsung di Aula H Sulaiman Tarigan Kantor Kemenag Karo, JalanPahlawanUjung,Kabanjahe, Senin (4/4). Kedelapan pejabat tersebut adalah Atas Siregar sebelumnya Kepala Kantor (KUA) Kec Merek menjadi Kepala KUA Kec Tigapanah menggantikan M. Nur Chaniago yang juga dilantik sebagai Kepala KUA Kec Kabanjahe. Kemudian, Muhammad Syawal yang sebelumnya staff KUA Kec Simpang Empat dipro-

mosikan menjadi Kepala KUA Kec Kutabuluh menggantikan Fahmi Sahuddin Tarigan yang dipindah tugaskan menjadi Kepala KUA KecSimpangEmpat. Said Saleh Adri, yang sebelumnya staff KUA Kec Kabanjahe dipromosikanmenjadiKepalaKUA Kec Merek. Ahmad Joni yang sebelumnya sebagai guru Madrasah Tsanawiyah Negeri (MTsN) KabanjahedilantikmenjadiKepalaMTsN Kabanjahe menggantikan Lawan Ginting. Sementara, Ahmad Jais, yang sebelumnya Kepala KUA Simpang Empat pindah tugas ke Kementerian Agama Kab

Batubara. Kepala Kankemenag Kabupaten Karo, Drs MardinalTarigan, MA dalam sambutannya mengatakan,mutasimerupakanhalbiasa pada suatu instansi, termasuk Kementerian Agama, guna memberikan penyegaran yang menghasilkan kontribusi bagi instansi yang dinamis dan produktif. Mutasi berguna untuk memberikan penyegaran baru dalam mengemban tugas melayani masyarakat agar lebih optimal dalam bertugas sebagai pegawai negeri sipil (PNS). Dikatakannya, mutasi baik

dalampromosipejabatbarumaupun pergantian jabatan mempunyaiindikasipositifbagisuksesnya reformasi birokrasi.Tentunya semangat dan kontribusi pejabat baru akan menjadi lecutan pemicu kinerja yang lebih baik. Kepada pejabat yang baru dilantik, Mardinal berpesan, agar memiliki empat hal yang mesti ditanamkan oleh setiap pejabat struktural, masing-masing kompetensi,yaitukemampuandalam mengemban amanah dan kepribadian yang bisa menjadi teladan bagi diri sendiri, keluarga dan masyarakat.(c09)

CPNS Pemkab Simalungun Diklat Di Rindam I/BB SIMALUNGUN (Waspada): 205 Calon Pegawai Negeri Sipil (CPNS) Pemkab Simalungun formasi 2010 mengikuti pendidikan dan pelatihan (Diklat) teknis fungsional dan kepemimpinan di Rindam I/BB. Diklat dibuka Dan Rindam I/BB Letkol Inf. Edy Tri Waluyo didampingiWakil Bupati Simalungun Hj. Nuriaty Damanik, Senin (4/4). Dan Rindam I/BB mengatakan, Diklat teknis dan fungsional ini mempunyai arti dan nilai yang sangat penting bagi para CPNS di Pemkab Simalungun, karena

hal ini menunjukkan kerjasama antara TNI khususnya Kodam I/BB dengan Pemkab Simalunguntelahterwujuddalampelaksanaan pendidikan. “Kerjasama ini diharapkan dapat memberikan semangat yangberartidalammeningkatkan SDMakanmemilikikemampuan sesuai dengan tuntutan tugas dan tagungjawab sebagai abdi negara gunamendukungpeningkatakan kinerjadiKabupatenSimalungun, disisilainsebagaibuktinyatauntuk kesiapanpenyelenggaraandalam upaya bela negara”, kata Edy. Dikatakannya, pendidikan

merupakan salah satu proses untukmembentukkaraktermanusia agarmemilikikualitasmental,fisik dan disiplin yang lebih baik sesuai dengan tuntutan tugas yang akan di hadapi. Ada tiga sasaran yang ingin dicapai dalam pendidikan ini yakni mental, fisik dan disipilin. Dalam kesempatan tersebut, Kepala BKD Kabupaten Simalungun Jan Sardion Purba mengatakan, jumlah CPNS dari pelamar umum yang lulus 2010 sebanyak 218, namun saat ini yang mengikuti Diklat 205 dan yang belum dapat mengikuti 13 karena ber-

halangan. Diklat ini dilaksanakan mulai, Senin (4/4) hingga Kamis (7/4) bertujuanantaralainuntukmembentuk jiwa korsa tinggi sebagai PNS dan dalam menciptakan kerjasama yang baik serta untuk saling mengenal antar sesama CPNS. Hadir dalam kesempatan itu para pejabat jajaran Pemkab Simalungun dan Rindam I/BB serta para pelatih. Pembukaan Diklat tersebut di diawali pembacaan janji dan penyematan peserta didik secara simbolis. (a29)

Pengutipan Gaya Preman Di Pemandian Karang Anyer SIMALUNGUN(Waspada):Pengutipan uangkepadapengunjung di pemandian Karang Anyer,Kecamatan Siantar, Simalungun belakangan ini semakin meresahkan. Seperti yang terjadi Minggu (3/4), sejumlah pengunjung yang menggunakan sepeda motor dihadang tiga sampai enam laki-laki. Kejadian itu sekitar seratus meter setelah melintasi pintu gerbang masuk ke daerah pemandian tersebut. “Mereka minta uang.Tidak jelas,itu uang apa, karena mereka tidak mengenakan identitas sebagai petugas pemandian ini,” tutur seorangpengunjungyangmengakuSyahputra,wargaPematangsiantar. Pantauan Waspada, besarnya uang diminta dari pengunjung terlihat tidak ada patokan, sesuai dngan berapa besar yang diberikan pengunjung. Ada kalanya, dari sebuah mobil oknum pengutip mendapatkan Rp 10 ribu dan dari lainnya mereka menerima Rp20 ribu. (c16)

Komisi C DPRD Pakpak Bharat Study Banding Ke Bali SALAK (Waspada): Komisi C DPRD Kabupaten Pakpak Bharat yang diketuai oleh Midun Angkat didampingi Budparhubmansih, Dinas Pendidikan, Disnakertrans, Dinkes dan Distanbaru-baru ini study banding ke Kabupaten Bangli, Provinsi Bali. Kegiatan itu merupakan agenda kerja dari DPRD itu yang bertujuan untuk meningkatkan wawasan dan juga untuk melihat kemajuan dari pada daerah yang telah dikunjungi baik itu sistem dari pada pemerintahannya,pendidikan,pertanian,kesehatandanlainsebagainya guna diimplementasikan di Kabupaten Pakpak Bharat. Hal tersebut dikatakan Sekretaris Dewan (Sekwan) DPRD Pemkab Pakpak Bharat Jalan Berutu, Rabu (6/4). ”DPRD bukanlah pelaksana pembangunan. Tetapi, hasil study bandingnantinyadiharapkansupayadiimplementasikandiKabupaten Pakpak Bharat,” ungkap Jalan.(a37)

Sosialisasi PBM No. 9 Dan No. 8/2006 Di P. Siantar P. SIANTAR (Waspada): Peraturan Bersama Menteri (PBM) Agama Nomor 9 dan Dalam Negeri Nomor 8 tahun 2006 tidak mengatur aspek doktrin agama yang merupakan kewenangan masing-masing agama. “Melainkan hal-hal yang terkait dengan lalu lintas para pemeluk agama yang juga WNI ketika mereka bertemu dengan sesamaWNI pemeluk agama yang berlainan dengan mengamalkan ajaran agama mereka,” kata Ketua Forum Komunikasi Umat Beragama (FKUB) Sumut Dr H Maratua Simanjuntak saat pembukaan sosialisasi PMB Nomor 9 dan Nomor 8 tahun 2006 dan dialog KUB di aula SMK Negeri 1 Kota Pematangsiantar, Rabu (6/4). FKUB dibukaWakilWalikota sekaligus Ketua Dewan Penasehat FKUB Koni Ismail Siregar serta dihadiri Kapolres Pematangsiantar AKBP Alberd TB Sianiparm, Ketua MUI Pematangsiantar HM Ali Lubis, Ketua PGI Sumut Pdt. WTP Simarmata. Ketua Panitia Pdt. R. Napitupulu menyebutkan peserta sebanyak 90 orang terdiri para tokoh agama dari agama Islam, Protestan, Katolik, Hindu, Budha dan Khonghucu serta tokoh masyarakat.(a30)

PBI Siantar-Simalungun Siap Bantu Petugas P.SIANTAR (Waspada) : Perhimpunan Bidan Indonesia (PBI) Pematangsiantar-Kabupaten Simalungun menyatakan siap memberikan bantuan tenaga dengan petugas Dinas Keluarga Berencana di masyarakat. “Selama ini, para bidan yang berhimpun di PBI juga sudah berbuat kepada masyarakat.Maka jika petugas dari dinas keluarga berencana di daerah ini mau membuka diri bersama kami, kami siap,” kata Ketua PBI Pematangsiantar-Kabupaten Simalungun Lia Fadhila Siregar, Rabu (6/4) kepada sejumlah wartawan di Pematangsiantar. Dia katakan, selama ini PBI banyak memberikan penyuluhan dan kegiatan sosial ke masyarakat miskin yang memang membutuhkan pengetahuan dalam hal yang berhubungan dengan kesehatan wanita khususnya kaum ibu.(c16)

Ka SMKN 1 Tidak Tahu Uang Komite Untuk Apa KABANJAHE (Waspada) : Puluhan orang tua murid SMK Negeri 1 Kabanjahe, meminta kepala sekolah itu menurunkan buang komite dari Rp500 ribu per tahun, menjadi Rp25 per bulan. Kedatangan para orang tua siswa ke SMKN 1 Kabanjahe, Selasa (5/4) disambut Kasek Drs Andrian Barus untuk menyelesaikan permasalahan yang diangap memberatkan itu. Selama ini dibayar dengan jumlah bervariasi mulai Rp500 per tahun untuk murid Kelas 1, Rp250 ribu Kelas 2, dan Kelas 3 Rp230 ribu. “Uang komite sudah disepakati Rp25 ribu per bulan, untuk semua murid tanpa terkecuali, dengan batas pembayaran tanggal 15,” terang Barus. Sementara saat ditanya Waspada, uang komite untuk apa saja, dan apa hasil untuk sekolah atas komite tersebut, Kasek tidak bisa menjawab. Sedangkan pembayaran uang komite oleh 720 murid. (c19)

Pelantikan Pengurus DPC PD Simalungun Akan Dihadiri Anas Dan Ibas SIMALUNGUN (Waspada): Ketua Umum DPP Partai Demokrat, Anas Urbaningrum dan Sekjen Edhi Baskoro, dijadwalkan akan menghadiri pelantikan pengurus DPC Partai Demokrat Kab. Simalungun, yang akan digelar di Pamatang Raya, Kec. Raya,16 April 2011 mendatang. Ketua Panitia pelantikan pengurus DPC Partai Demokrat Kab. Simalungun, Julius Silalahi didampingi Sekretaris Pardomuan Nauli Simanjuntak kepada wartawan mengatakan acara pelantikan akan dihadiri sekitar 10.000 ribu kader dan simpatisan partai Demokrat dari 31 kecamatan se- Simalungun. “ Persiapan-persiapan sudah kita lakukan sejak pekan ini dan acara pelantikan pengurus DPC Partai Demokrat Kabupaten Simalungun akan dihadiri sekitar 10.000 massa yang merupakan kader dan simpatisan partai dari 31 kecamatan,” ujar Julius. (a29)

WASPADA Jumat 8 April 2011

Sumatera Utara

Mobil Tak Bertuan Resahkan Warga Perbaungan

Petani Dambakan Irigasi TANJUNGBALAI (Waspada) : Petani Kota Tanjungbalai saat ini mendambakan pembangunan irigasi untuk mengairi persawahan mereka yang selama ini hanya mengandalkan air hujan dan pemompaan. “Tanah disini cukup subur untuk persawahan, namun kami terkendala pada ketersediaan air sehingga banyak warga mengalihkan lahannya untuk kebun sawit,” ungkap Hendri Manik saat memanen padinya di Km IX, Kel. Sijambi, Kec. Datukbandar, Kota Tanjungbalai, Rabu (6/4). Dikatakan, kendala besar yang dihadapi petani saat ini hanya masalah ketersediaan air dimana beberapa tahun terakhir curah hujan tidak stabil akibat cuaca yang tidak menentu. Untuk itu, petani berharap agar pemerintah hendaknya membangun sistem irigasi untuk mengairi sekitar 300 hektare lahan persawahan se-Kecamatan Datukbandar agar kuantitas dan kualitas produksi padi Tanjungbalai dapat ditingkatkan. (a32)

Badan Penanggulangan Bencana Asahan Siaga KISARAN (Waspada): Antisipasi menghadapi cuaca ekstrim, Badan Penanggulangan Bencana Kabupaten Asahan melakukan koordinasi dan pengawasan di beberapa titik bencana. Hal itu diungkapkan Kepala Badan Penanggulangan Bencana Kabupaten Asahan K Sinaga didampingi Kasi Sarana Zulkarnain, Rabu (6/4). Menurutnya, ada beberapa titik yang sering terjadi bencana, seperti angin puting beliung, seperti di Kecamatan Pulaubandring (26/3) dengan kerugian mencapai Rp15 juta, dengan merusak dua rumah penduduk. Kemudian di Kecamatan Airbatu (27/3), sedangkan pada Desember 2010, Kecamatan Kisaran timur dengan merusak sejumlah rumah dan Gedung Universitas Muhammadiyah dengan total kerugian mencapai puluhan juta. Sedangkan untuk banjir, meluapnya Sungai Belidah, Kecamatan Seidadap dan merendam sejumlah rumah dengan ketinggian air mencapai 90 cm dan merendam 16 kk atau 70 jiwa, namun bencana itu telah usai dan bantuan sembako telah disalurkan kepada korban bencana.(a15)

Marka Jalan Kotapinang Tak Dipatuhi KOTAPINANG (Waspada) : Lebih kurang tiga bulan dipasang, rambu-rambu di pusat kota Kelurahan Kotapinang, Kecamatan Kotapinang, Labusel tak dipatuhi warga yang melintas. Kondisi itu mengakibatkan, sampai saat ini kondisi lalu lintas di pusat kota masih semraut. Pantauan, Rabu (6/4) berbagai jenis kendaraan masih bebas keluar masuk dari berbagai ruas jalan tanpa mempedulikan ramburambu yang ada. Padahal, di setiap mulut persimpangan sudah terpasang marka jalan yang mengatur arus dan jenis kendaraan yang melintas. Jalan Ahmad Yani, harusnya jalan tersebut satu arah menuju Jalan Jenderal Sudirman, namun praktiknya, setiap hari pengendara masih melintas melawan arah dari Jl Jenderal Sudirman, sehingga menyebabkan kemacetan karena aktivitas lalulintas di kawasan itu cukup padat. Di Jl. Prof HM Yamin SH, setiap hari truk roda 10 hingga 12 bermuatan bebas melintas dan parkir di kawasan ini. Padahal di mulut persimpangan jelas terpasang marka bahwa jalan tersebut golongan IIIC dan di bagian lain jalan itu tertulis tanda larangan masuk khusus truk dan bus. Ibrahim, Kepala Dinas Perhubungan Labusel yang dikonfirmasi mengatakan, saat ini rekayasa lalu lintas dan marka yang sudah dibuat beberapa waktu lalu itu belum dapat diterapkan. Pasalnya, mereka masih perlu melakukan sosialisasi sebelum masyarakat merasakan imbas dari perubahan arus lalu lintas. (c18)

Polisi Ringkus Karyawan Gelapkan Sepeda Motor TANJUNGBALAI (Waspada) : Petugas Polsek Datukbandar, Polres Tanjungbalai meringkus seorang diduga menggelapkan sepeda motor milik koperasi di Aeknabara, Rantauprapat, Selasa (5/4). Informasi dihimpun, tersangka AD alias Denis, 24, warga Jalan H Adlin, Lingk.V, Kel. Gading, Kec. Datukbandar merupakan seorang karyawan sebuah koperasi serba usaha (KSU) di Tanjungbalai telah menggadaikan sepeda motor Jupiter Z dengan No.Pol. BK 2538 IBmilikmajikannyayangdiberikankepadatersangkauntukkelancaran kerja. Mendapat laporan pemilik kendaraan, petugas kemudian melakukan penyelidikan dan pencarian tersangka yang sebelumnya sempat kabur ke luar daerah untuk menghilangkan jejak. “Namun kepolisian tidak tinggal diam dan terus melakukan pengejaran hingga akhirnya menangkap tersangka di Labuhanbatu saat menumpang bus umum dari Pekanbaru tujuan Medan,” kata Kapolres Tanjungbalai AKBP Puja Laksana melalui Kasubbag Humas AKP Y Sinulingga. (a32)

Lahan Sawit Dirampas SEIBALAI (Waspada) : Nasib malang menerpa HM Nur, 77, pensiunan guru, warga Desa Sei Balai, Kec. Sei Balai, Batubara tanaman sawit seluas 24 hektare sudah diusahai sejak 1998 di Desa Mahato Sakti Kec. Tambusai Utara Kab.Rokan Hulu, Riau dirampas paksa sekelompok orang. Muhd Nur yang terserang stroke itu, Rabu (6/4) menceritakan malapetaka kebun sawitnya dirampas paksa komplotan preman di Riau. Berawal tahun 1998 dia bersama keluarganya membeli lahanseluas24hektarediRT12,RW04DesaMahatoSaktiKec.Tambusai Utara Rokan Hulu, Riau dijadikan tanaman sawit. Selama 9 tahun diusahai berjalan lancar. Tanpa jelas sebabnya pada 29 Mei 2007 datang sekelompok preman bermarga Slh, Smj, Mn, Tbn, Sbr membawa parang mengancam,mengintimidasi dan melarang penjaga kebunnya. Tak sampai disitu komplotan Slh cs bertindak brutal membakar tanaman sawit. Hari itu 5 Juni 2007 melapor ke Kades Mahato Sakti (Somali), ke Polsek Tambusai Utara diterima Kanitserse Bripka AgusWandi dan di BAP. “Tragisnya pengaduan kami tidak dipedulikan, walau berulangkali menanyakan ke kanit dijawab ‘masih sibuk’ sementara komplotan preman itu semakin ganas mendodos sawit kami,” kata Muhd Nur. Bahkan korban sudah membuat laporan ke Polres Rokan Hulu,Kapolda Riau, Kapolri ternyata sudah hampir 4 tahun tidak jelas hasil proses dilakukan Polsek Tambusai Utara. Karena pengaduan tak digubris polisi,pihak Slh Cs berhasil mendapatkan surat keterangan tanahdiduga palsudari Kades Mahato, desa pemekaran dari Mahato Sakti bulan Agustus 2007 setelah 3 bulan kebun sawit dirampas. “Walau sudah 4 tahun kami mengharapkan Kapolda Riau,Kapolri dapat membantu menegakkan hukum atas tindakan komplotan Slh Cs merampas paksa kebun sawit kami,” harap Muhd Nur. (a12)

Kapolda Sumut Didesak Tertibkan Penyelundupan Pakaian Bekas TANJUNGBALAI (Waspada) : Kapolda Sumut Irjen Pol Wisjnu Amat Sastro didesak menertibkan penyelundupan atau peredaran pakaian bekas di wilayah Kec. Tanjungbalai, Kab. Asahan dan Kota Tanjungbalai. “Penyelundupan pakaian bekas kembali marak di sekitar kawasan jembatan Sungai SilauTanjungbalai pada pukul 04:00-06:00. Barangbarang luar negeri itu masuknya bukan melalui Tanjungbalai saja, tapi juga di Bagan Asahan, Kec. Tanjungbalai, Kab. Asahan melalui angkutan kapal jenis rambo,” ungkap aktifis LSM M Roby MA, Rabu (6/4). Untuk itu, Roby mendesak agar tim penyelidik Polda Sumut segera mengusut bahkan membongkar sindikat pengiriman barangbarang ilegal atau pakaian bekas yang terjadi di Kota Tanjungbalai dan Asahan. Kapolres Tanjungbalai AKBP Puja Laksana ketika dikonfirmasi, Rabu (30/3), mengaku tidak akan memberikan toleransi terhadap masuknya pakaian bekas di wilayah hukumnya. (a14/a15/a31/a32)


Waspada/Edi Saputra

SEORANG pengendara terjatuh saat melintasi mobil tak bertuan jenis Taft GT BK 1758 LE warna hitam di jalan alternatif Lingkungan IV, Kelurahan Tualang Kec. Perbaungan. Foto direkam Kamis (7/4).

Aster Panglima TNI Di Simalungun:

Kuatkan Karakter, Kepribadian Dan Ketahanan Nasional SIMALUNGUN (Waspada): Globalisasi yang masuk ke Indonesiatanpadisadarimenawarkan nilai-nilai budaya baru yang bisa menggeser nilai-nilai budaya nasional. Nilai-nilai yang baru itu, akan membentuk identitas baru yang bisa berdampak negatif pada generasi bangsa. Hal ini diungkapkan Aster Panglima TNI Mayjen TNI AY Nasutionsaatmemberikankuliah umum di Aula Universitas SimalunguntentangKomunikasiSosial TNI Dengan Komponen MasyarakatDalamRangkaMembangun Karakter Bangsa Guna Memperkuat ketahanan Nasional, Kamis (7/4). “Globalisasi yang masuk bisa melindasi semuanya jika tidak memliki karakter, kepribadian, ketahanan nasional yang kuat. Jangansalahkan globalisasi.Seharusnya, globalisasi yang masuk kita harus membuka diri terhadap segala bentuk perubahan

yang lebih baik tanpa harus kehilangan identitas diri yang baik, dan konstruktif bagi pembangunan bangsa,” kata AY Nasution. AY Nasution mengaku prihatinatasbanyaknyagenerasibangsa yang melakukan tawuran, perusakan fasilitas umum dan lainnya.Menurutnya,haldisebabkan tidak adanya karakter, kepribadian dan ketahanan nasional. “Ketahanan nasional harus juga dimulai dari ketahanan pribadi, ketahanan keluarga, ketahanan lingkungan. Konsepsi ketahanan nasional akan sulit dilaksanakan jika pemerintah dan rakyat tidak kompak, kegigihan dan keuletan masyarakat juga penting,” jelasnya. Dijelaskannya,karakterbangsa yang baik akan mampu mewujudkan ketahanan nasional yangkuat.“Pertumbuhanpenduduk yang kualitas SDM rendah danlemahkarakternyajugaharus disalahkan,” tegasnya.

Sebelum memberikan ceramah kepada ribuan mahasiswa Universitas Simalungun, masyarakat dan ormas-ormas, Aster Panglima TNI juga memberi arahan kepada 290 tenaga penyuluh KB yang terdiri dari Koramil, Babinsa, dan anggota Polres Simalungun di Makorem 022/Pantai Timur. Dalam arahannya, dia menekankan kepada prajurit untuk melakukan delapan wajib TNI. Di antaranya, bersikap ramah tamah terhadap rakyat, bersikap sopan santun terhadap rakyat, menjunjung tinggi kehormatan wanita, menjaga kehormatan diri dimuka umum, senantiasa menjadi contoh dalam sikap dan kesederhanaannya, tidak sekali merugikan rakyat, tidak sekali-kali menakuti dan menyakiti hati rakyat dan menjadi contoh dan memelopori usaha-usaha untuk mengatasi kesulitan rakyat sekelilingnya.(h02/a30)

Dugaan SPPD Fiktif DPRD Asahan

Kejaksaan Akan Periksa Mantan Ketua Fraksi KISARAN (Waspada): Dugaan Surat Perintah Perjalanan Dinas (SPPD) fiktif di sekretariat DPRD Asahan anggaran 20072008 yang merugikan Rp 1 miliar lebih, Kejari Kisaran melakukan pendalaman kasus dan akan memanggil sejumlah mantan ketua Fraksiuntukdimintaiketerangan. Hal itu dikemukakan Kasi Intel Kejari Kisaran Rudhy Parhusip, ditemui Waspada setelah menerima mahasiswa yang berunjukrasa, Kamis (7/4). Menurutnya, dalam masalah itu ditemukan penyimpangan penggunaantiketpesawat,karena dalam laporan yang dipakai Garuda, sedangkan faktanya Lion Air. Oleh sebab itu dilakukan pendalaman dengan mempelajari dokumenyangada,sehinggabisa direncanakan pemanggilan sejumlah anggota dewan untuk dimintai keterangan. “Saat ini kita

merencanakan pemanggilan mantan ketua fraksi, untuk mengetahui apakah perjalanan mereka itu memang benar ada atau hanya sekedar fiktif belaka,” ungkap Rudhy. Dalam penyidikan lanjut Rudhy, Kejari sangat teliti dan berhati-hati sehingga tidak merugikan siapapun. Rudhy mengakui kasus ini cukup rumit, karena melibatkan 45 anggota dewan, sehingga diperlukan kematangandatasebelumdilakukan pemanggilan. “Sebelumnya sewaktu masalah masih di intel, kami telah melakukan wawancara kepada anggota dewan. Memang ada beberapa perjalanan yang dilakukan mereka, dan ada juga yang tidak. Kami terus menyusurinya, sehingga masalah ini terkuak dengan jelas,” jelas Rudhy. Dugaan SPPD fiktif itu terjadi,

jelas Rudhy disebabkan adanya penyalahgunaanwewenang,dan lemahnya pengawasan dalam pengelolaankeuangansekretariat DPRD Asahan, hal itu terbukti, saat melakukan pemeriksaan terhadap Mantan Kabag Keuangan DT (tersangka penyalahgunaan anggaranmakanminumanggota dewananggaran2007),mengakui pada saat itu, dia tidak difungsikan.” ungkap Rudhy. Sementara, sejumlah mahasiswayangberunjukrasadidepan Kejari Kisaran, menuntut agar masalah ini diusut tuntas dengan memeriksa 45 anggota dewan periode 2004-2009 serta mantan Ketua DPRD Asahan B Hs, yang terindikasi yang mengesahkan SPPDfiktifitu.Sertapeningkatkan pengawasan dalam pengelola keuangan di Sekretariat DPRD sehingga hal itu tidak kembali terjadi. (a15)

Peluncuran Djalaluddin Pane Foundation

Sumut Siap Songsong Era Baru Pengelolaan Wakaf Berbasis Bisnis Sosial MEDAN (Waspada): Sumatera Utara, khususnya Kota Medan berpeluang mengembangkanpotensiwakafdanbisnissosial secara produktif sebagai sumber dana abadi yang memberdayakan ekonomi masyarakat dan memperkuatketahanannasional. Hal ini diungkapkan dua pengusaha asal Medan Herludiansyah Pane dan Debby F. Pane pada peluncuran Djalaluddin Pane Foundation (DPF), pekan lalu. “Dibanding Jakarta dan Surabaya,SumateraUtaradanMedan masih relatif tertinggal dalam hal pengelolaan wakaf secara produktif serta bisnis-bisnis sosial, padahal potensi bisnis serta jumlah masyarakat mampu disini cukup besar,” ujar Dewan PembinaDPFyangjugadikenalsebagai ustadz ternama ibukota Wahfiudin Sakam. Diharapkan kehadiran DPF dapat menjadi pionir pengelola wakaf asal daerah yang mampu mengelola aset wakafnya secara berkesinambungan dan melahirkan banyak manfaat bagi lingkungannya. Pada kesempatan peluncuran Djalaluddin Pane Foundation (DPF) diselenggarakan pula seminar bertajuk“Wakaf & Bisnis Sosial: Potensi Ekonomi yang Terabaikan, Jenjang Karier yang Tersembunyi” menghadirkan sejumlah tokoh dari Jakarta, yaitu

wirausaha bisnis sosial Erie Sudewo, Prof Dr H Fathurrahman Djamil, MA, Ketua Divisi PengelolaanWakaf BadanWakaf Indonesia dan dimoderatori ustadz Wahfiudin Sakam. Pendiri DPF Herludiansyah Pane atas nama keluarga besar Djalaluddin Pane mengatakan, tujuan terselenggaranya seminar itu untuk membangkitkan kesadaran warga Sumatera Utara dalam mengoptimalkan dana wakaf sebagai sebuah potensi ekonomi yang dapat digarap secara profesional dan menjadi jenjang karier yang layak diperhitungkan bagi generasi muda. “Selain mengelola, DPF juga berupaya mencetak sumber dayainsanicalonpengelolawakaf yang profesional dan amanah melalui program pelatihan Djalaluddin Pane Social Business Entrepreneurship Academy, “ jelasnya. Dalam seminar yang dihadiri para tokoh masyarakat Medan, kalangan pengusaha, pelajar dan kalangan mahasiswa itu dikemukakan, pengelolaan dana wakaf masa kini tidak saja harus dilakukansecaraprofesional,akantetapi juga diselaraskan dengan budaya transparansi serta akuntabilitas. Indikator keberhasilan sebuah yayasan pengelola wakaf terletak pada kinerja usaha bisnis sosialnya. “Semakinproduktifwakafnya

maka semakin besar pula peluangnyauntukmengangkatderajat kehidupan sosial masyarakat sekitarnya,” ujar Prof Dr H Fathurrahman Djamil MA, Ketua Divisi Pengelola Badan Wakaf Indonesia yang juga dikenal sebagai Guru Besar Hukum Islam Fakultas Syariah UIN Syarif Hidayatullah Jakarta. “Saat ini bekerja sebagai amil zakat atau pengelola lembaga sosial sudah bukan lagi profesi kelas dua, banyak figur-figur sukses lahir dari lembaga ini, mereka berpenghasilan secara profesional, namun terlatih jujur dan amanah “ tambah Erie Sudewo, peraih penghargaan Social Enterpreneur dari lembaga terkemuka Ernst &Young pada tahun 2009, memotivasi generasi muda Medan agar bersemangat untuk memajukan lembaga wakaf seperti DPF. Selain berfungsi sebagai nadzir wakaf (pengelola wakaf) aset dan harta yang diwakafkan Alm Kolonel CPM (Purn) Dr H Djalaluddin Pane, SH, pendiri Herfinta Group -perusahaan perkebunankelapasawitdiSumatera Utara-DPFjugamengembanmisi memajukan pendidikan kewiraswastaan berbasis nurani ihsani dan teknologi serta memberikan pelayanan sosial yang edukatif dan produktif kepada kaum mustadh’afin (berpihak kepada kaum lemah). (m43)

PERBAUNGAN (Waspada): Mobil jenis TaftGTBK1758LEwarnahitamyangditinggalkan pemiliknya terparkir ditengah jalan alternatif di Lingkungan IV Kelurahan Tualang menuju Desa Lubuk Cemara, Suka Jadi dan Kuta Galoh Kec. Perbaungan , Kamis (7/4) sekira pukul 06:00 mengahambat jalan sehingga meresahkan warga tersebut. Akibatnya warga yang akan melintasi jalan tersebut mengalami kesulitan bahkan, kendaraan roda tiga dan empat tidak bisa melintas, sehingga puluhan truk galian C yang beroperasi di sekitar lokasi menghentikan kegiatannya. “ Sejak pagi sekitar pukul 07:30 mobil itu terparkir di tengah jalan tanpa ada pemiliknya sehingga menyulitkan kami melintasinya terlebih yang membawa barang yang roda depan tidak ada dengan posisi pelak terdongkrak,” jelas Sutrisno,38, warga Desa Suka Jadi yang setiap hari melintasi jalan itu. Hal senada diungkapkan Ida ,45 ,Warga Desa KelurahanTualang yang merasa heran terhadap

mobil yang parkir di tengah jalan itu sejak pagi sekitar pukul 06:00 hingga sore hari, padahal sebelumnya ada dua pria membuka ban depan dan dibawa menggunakan sepeda motor jenis Honda Vario, namun hingga saat ini orang itu belum kembali, akibatnya pengguna jalan sangat terganggu, imbuhnya. Kaur Pembangunan Desa Kota Galuh, Jali ,31, didampingi warga sekitar Gino,35, kepada Waspada membenarkan. “Diduga kuat akibat persainganantarpengusahagaliancantaraoknum itudenganpengusahagaliancasalKec.Pegajahan, yang akhirnya mendapatkannya karena direkomendasipihakdesadandisinyalirmobilitusebagai upaya agar truk tidak bisa melintas, mengingat pengerjaan pengorekan baru memasuki hari kedua,’’ sebut keduanya. Pantauan Waspada hingga berita ini dikirim, Kamis(7/4)sekirapukul17:00mobil masihberada di lokasi dengan posisi tetap di tengah jalan alternatif itu. (c03)

Penggunaan Hak Interplasi Terlalu Dini RANTAUPRAPAT (Waspada): Penggunaan Hak Interplasi DPRD Kabupaten Labuhanbatu terkait penggunaan anggaran Dana Alokasi Khusus(DAK)BidangPendidikantahunanggaran 2010 terlalu dini. Pasalnya, menurut sejumlah elemen masyarakat dan tokoh pemuda yang ada di kabupaten penghasil karet dan sawit, belum ditemukan kebijakankepaladaerahyangpentingdanstrategis serta berdampak luas pada kehidupan masyarakat, daerah dan negara. Menurut Koordinator Forum Pemerhati Pembangunan (FPP) Labuhanbatu Drs Zulham Abdul Fattah Nasution menjawab wartawan, Kamis (7/4) di Rantauprapat mengatakan keheranannya. “Kita harus tahu dulu mana kebijakan bupati yang berdampak tidak baik dilingkungan masyarakat. Hal senada dikatakanWahyu Saragih Ketua Pimpinan Cabang (PC) Angkatan Muda Ka’bah (AMK). Akibat niat penggunaan hak interplasi, para wakil rakyat terkesan tidak mendukung adanyapembangunan.Sebab,kondisiyangham-

pirsamajugaterjadidisebagianbesarkabupaten/ kota lainnya. Sebelumnya, Kamis (7/4) dari 40 anggota DPRD Kabupaten Labuhanbatu, 27 orang setuju untuk menggunakan hak interplasi, 10 menolak dan 1 orang abstain. Sementara Fraksi Golkar dan P3 menolak penggunaan hak itu, sedangkan Fraksi PDI-Perjuangan, Demokrat, Ampera, Hanura dan Bintang Keadilan sepakat untuk hak tersebut. Menurut perwakilan pengusul hak Interplasi Dahlan Bukhori, penggunaan DAK Bidang Pendidikan 2010 banyak menuai permasalahan. Pejabat Pembuat Komitmen (PPK) Dinas Pendidikan Labuhanbatu Syamsul Bahri S ketika dikonfirmasi wartawan melalui selular mengatakan DAK tahun 2010 tidak berkaitan dengan kebijakan bupati. “Itu sudah diatur dalam Permendagri, Permendiknas untuk Juknis. Kalau ada diduga ketidak sesuai dengan Juknis sebagaimana yang disampaikan pengusul, itu hanya bersifat tekhnis dan kayaknya tidak perlu diinterplasi,” jawab Syamsul. (a17)

Komisi C Minta Kejari Serius Tangani Rubuhnya Gedung DPRD TANJUNGBALAI (Waspada) : Komisi C DPRDKotaTanjungbalaimemintapihakKejaksaan selaku penyelidik agar serius menangani kasus rubuhnya konstruksi bangunan atap serta rusaknya lantai jembatan gedung dewan yang belum difungsikan. DemikianKetuaKomisiCHjArtatididampingi Sekretaris Hakim Tjoa Kian Lie beserta anggota, Nessy Ariani Sirait, Said Budi Syafril, Kamiluddin dan Encen Sitorus saat rapat kerja komisi dengan agenda mendengarkan penjelasan Kadis PU AbdulAzizsertaPejabatPelaksanaTeknisKegiatan (PPTK) Mulkan terkait ambruknya bangunan itu di gedung DPRD, Kamis (7/4). Dalam penjelasannya, Abdul Aziz berdalih robohnya bangunan itu disebabkan terjadinya hujan lebat disertai angin kencang sehingga konstruksi tidak kuat menahan hingga akhirnya ambruk pada malam Jumat (1/4) sesuai laporan yang diterimanya dari PPTK. Selain itu, Abdul Aziz mengaku lemahnya kontrol pengawasan terhadap pekerjaan pemasangan besi angker ke balok turut menjadi penyebabnya. Dijelaskannya, kasus proyek senilai Rp834. 784.00 yang dikerjakan CV Rezky Anugerah Persada dan juga telah menerima pembayaran 100 persenitutengahditanganipihakKejaksaanNegeri Tanjungbalai dengan memanggil panitia tender MS, kemudian dilanjutkan dengan pemeriksaan PPTK dan terakhir pemanggilan terhadap

dirinya selaku Kepala Dinas. Ditambahkan Aziz, saat ini pihaknya telah memasukkan CV RAP ke daftar buku hitam (black list) akibat kelalaiannya, disamping dirinya juga akan bertanggungjawab terhadap kelanjutan pembangunan dengan memperbaiki kerusakan dan melakukan pengujian terhadap kondisi konstrusi bangunan sebagai garansinya. SaatKomisiCkembalibertanyatentangbahan bangunan yang digunakan pada kolom balok telah sesuai dengan bestek, Abdul Aziz terlihat ragusehinggamelemparkanpersoalanitukepada PPTK untuk menjawabnya. Dalam jawabannya, Mulkan juga berdalih, besi dan bahan bangunan lainnya telah sesuai dengan bestek. Namun Aziz langsung menimpali seraya memohon maaf kepada Komisi C untuk tidak bisa memberikan jawaban secara detail karena persoalan itu sedang ditangani pihak kejaksaan. “Kalau saya memberikan jawaban, itu namanya saya mendahului, jadi kepada pimpinan rapat biarlah kita tunggu hasil pemeriksaan penyidik kejaksaan,” kata Aziz. Di akhir rapat, pimpinan mengingatkan agar Dinas PU perlu melakukan pengujian sebelum perbaikan bangunan roboh itu, sekaligus meneliti kekuatannya untuk menopang bangunan yang akan dilanjutkan pada tahap berikutnya sehingga hal-hal yang tidak diinginkan dapat dihindari. (a32)

Sita Alat Berat Warga, Mantan Kapolsekta Kutalimbaru Digugat MEDAN (Waspada): Mantan Kapolsekta Kutalimbaru AKP Bambang Rubianto digugat pemilik alat berat, Radius Ginting di Pengadilan NegeriMedan,Rabu(6/4). Pengugatmengajukan gugatan melalui kuasa hukumnya Abdi Nusa Tarigan. “Selain mantan Kapolsekta Kutalimbaru, Kapolri, Kapoldasu , Kapolresta Medan, juga digugat,“ kataTarigan kepada wartawan di Pengadilan Negeri Medan. Radius menggugat Rp633 juta atas nama tergugat I dan Rp1 miliar tergugat II. “Gugatan inidilayangkanagarterjadipembelajaranterhadap oknum polisi yang hendak melakukan penyitaan agar sesuai prosedur, “ kata Tarigan . Tariganmengatakan,gugatandiajukankarena penggugat menyita dua unit alat berat jenis escavator/beko dari satu tempat di wilayah hukum Polsek Kutalimbaru berdasarkan surat perintah penyitaan nomor SP.Sita/13/VII/2010 tanggal 12 Juli 2010. “Surat itu menyebutkan penyitaan terhadap empat unit alat berat yang berkaitan dengan tindak pidana melakukan penambangan secara tidak sah atas nama tersangka Simon Sembiring alias Kaporlop dan bukan atas nama saya,” kata Tarigan. MenurutTarigan, penyitaanitudidugadilakukan AKP Bambang Rubiato saat menjabat Kapolsek Kutalimbaru. Namun, penyintaannya tidak

sesuai dengan surat penyitaan. “Penyitaan juga dilakukan pada jam dua malam dan ketika itu alat berat tidak beroperasi. Ini bukan penyitaan lagi namanya tapi sudah perampasan, “ beber Tarigan. Akibat penyitaan itu, dirinya mengalami kerugian sebesar Rp 633 juta terhadap tergugat I karena sewa satu unit alat tersebut sebesar Rp1,5jutaperharidanPolsekKutalimbarumenyitanya selama 211 hari. Selain itu, katanya, dirinya juga menggugat kerugian immaterial senilai Rp 1 miliar terhadap tergugat II untuk pemulihan kedudukan, harkat dan nama baik. “Jadi, jumlah keseluruhan gugatan ini sebesar Rp1,633miliar,kamijugamengusulkanPNMedan menetapkan sita jaminan atas harta tergugat I yakni satu unit rumah tempat tinggal berupa tapak tanahnya di Jalan Budi Pembangunan II nomor 8 Kelurahan Pulo Brayan Kecamatan MedanBarat, “ katanya. Bambang Rubianto melakukan penyitaan terhadap dua unit alat berat milik Radius dan telah disidangkan di PN Lubuk Pakam. Dalam persidangan tersebut, Radius dinyatakan tidak bersalah dan divonis bebas . Persidangan yang diketuai oleh Denny L Tobing ,SH menyatakan, dakwaan penuntut umum terhadap terdakwa, Radius Ginting alias Bintara tidak dapat diterima danbarang bukti yang disita berupa dua unit alat berat dikembalikan ke Radius. (m49)

Muscab Partai Demokrat Sergai 11 April SEIRAMPAH (Waspada): Musyawarah Cabang (Muscab) ke II Dewan Pimpinan Cabang (DPC) Partai Demokrat Kab.Serdang Bedagai (Sergai) priode 2010-2015 akan digelar 11 April mendatang di resort Theme Park Pantai Cermin Kec.Pantai Cermin. Demikian dikatakan oleh Ketua Organizing Comitte (OC) Muscab, Labuhan Hasibuan Sag didampingi Ketua Stearing Comitte (SC) Drs Hartoyo, Rabu (6/4) di Sei Rampah. Labuhan menambahkan, selaku panitia telah mengupayakan persiapan semaksimal mungkin pelaksanaan Muscab ini guna memilih Ketua dan komposisi kepengurusan DPC Partai Demokrat Sergai ke depan. “ Muscab DPC Demokrat Sergai ke II akan

dihadiri unsur pengurus DPP , DPD Sumut dan DPC Sergai dan sejuml;ah undangan dengan jumlah peserta 20 orang, 17 peserta Ketua PAC se Sergai, satu dari DPC, satu dari DPD serta satu suara dari DPP dan seluruh peserta berhak dipilih dan memilih kandidat Ketua DPC “ imbuh Hartoyo. Wacana yang berkembang dilapangan ada dua nama Kandidat Ketua DPC Partai Demokrat priode 2010-2015 yang berpeluang yakni H Azmi Y Sitorus yang menjabat Sekretaris DPC Partai Demokrat Sergai priode 2005-2010 yang juga Ketua DPRD Sergai, kemudian Labuhan Hasibuan, SAg yang saat ini Anggota DPRD Sergai dari Fraksi Demokrat yang juga dikenal sebagai aktifis Islam. (c03)

Sumatera Utara

B4 Hari Pekan, Pasar Gunungtua Langganan Macet

MEDAN (Waspada) : Suplemen makanan Taburia akan membantu tumbuh kembang anak secara optimal. Selain itu, akan meningkatkan daya tahan tubuh pada balita,mencegah anemia akibat kekurangan zat besi dan meningkatkan nafsu makan balita. Demikian disampaikan Peneliti Taburia dari Pusat T2K dan Kementerian Kesehatan, Nufri Ardiansyah saat menjadi narasumber pada acara Workshop Advokasi Dan Forum Jurnalis Taburia di Hotel Garuda Citra Medan, Rabu (6/4). Dijelaskan, Multi vitamin taburia tidak bisa dicampur dengan minuman, seperti susu,teh dan air, karena akan mengumpal dan tidak larut. Selain harus dimakan sampaio habis,taburia juga jangan dicampur dengan air panas, karena lemak yang terkandung zat besi akan rusak,sehingga mengakibatkan tidak enak Lebih lanjut Nurfi menjelaskan, setiap bungkus 1 gram Taburia mengandung 80-120 persen Angka Kecukupan Gizi (AKG) ratarata anak usia 6-59 bulan. Taburia juga akan mencegah balita mengalamikurangdarahyangmengakibatkanterhambatnyapertumbuhan dan menurunnya daya tahan tubuh, sehingga cepat sakit. Selain itu, kurang darah pada balita menyebabkan terhambatnya perkembangan atau gerak balita dan kurangnya kecerdasan anak. (c15)

Ernawati Panusunan Siregar Tetap Ketua Pengajian Akbar Al-Iklas Paluta MEDAN (Waspada): Ny Ernawati Panusunan Siregar tetap ketua pengurus Pengajian Akbar Al-Iklas Kabupaten Padanglawas Utara periode 2008-2011. Hal itu diungkapkannya, Rabu (6/4) berdasarkan ADRT yang telah ditetapkan pada SK Bupati Padanglawas Utara tentang pengangkatan Ketua Pengajian Akbar Al-Iklas Padanglawas Utara Nomor 451.1/1939/2008 untuk masa bakti 2008–2011 terhitung Desember 2008. Dalam penyampaiannya pada acara menghadiri pertemuan beberapa waktu lalu, sangat terkejut tiba-tiba datang surat undangan dengan perihal acara Pemilihan Ketua Pengajian Akbar Al-Iklas Kab. Padanglawas Utara periode 2011-2013. Dan yang lucunya lagi, surat undangan tanpa nomor dan stempel Pengajian Akbar Al-ikhlas Paluta kemudian yang Ironisnya tanpa berkoordiansi dengan ketua yang masih aktif, lalu saya dianggap apa. Begitu disampaikan Ny Ernawati Panusunan Siregar di hadapan para pengurus Pengajian Akbar Al-ikhlas Paluta lainnya. “Perlujugauntukkitaketahuibahwaperkumpulaniniberdasarkan Islam dan Pancasila serta UUD 1945, bahwa pemilihan ketua ini sepertiya rekayasa dan ketua baru tersebut sangat kental bernuansa politik dan sangat mencederai tatanan asas dan norma-norma agama Islam, dan kepada oknum yang menjadi biang kerok kisruhnya internal pengurus Pengajian Akbar Al-ikhlas Paluta supaya cepatcepat istikomah sebab perbuatan itu akan merusak dan sangat bertentangan dengan AD/ART Bab III Sifat dan Fungsi yaitu, pada huruf a; bahwa Pengajian Akbar Al-ikhlas Paluta adalah merupakan wadah berhimpunnya anggota pengajian wirit yasin dan pengajian ibu-ibu dari setiap kecamatan di wilayah Kabupaten Padanglawas Utarabukanperwiritankepentingankelompokataugolongantertentu. Ketua perwitan Pengajian Akbar Al-ikhlas Paluta menyatakan, sampai detik ini saya masih tetap pengurus perwitan Pengajian Akbar Al-ikhlas Paluta yang Sah dan berkekuatan hukum karena dipilihataudiangkatmejadiketuaPerwiritanberdasarkanmusyawarah dan mufakat hal itu sesuai dengan BabVI poin 2 bahwa masa jabatan pengurus terpilih selama 3(tiga) tahun sejak terpilih atau ditetapkan dan dapat dipilih kembali dalam pemilihan berikutnya.(m18)

PANYABUNGAN (Waspada): Empat warga DesaTabuyung, Kecamatan Muara Batang Gadis, Kabupaten Mandailing Natal, Kamis (7/4) sekira pukul 02:00 dianiaya segerombolan orang tidak di kenal (OTK). Korban pengeroyokan masing-masing, Zarubaton,50, Nur Asmi,60, Zulham,25, kini dirawat di RSUD Panyabungan. Sementara korban atas nama Masdalifah tidak sempat dirawat karena hanya mengalami luka ringan saja. Nur Asmi korban paling parah mengalami luka robek di bagian kepalasepanjang10cmdanbibirpecah,kinibelum sadarkan diri di RSUD Panyabungan. Menurut korban, Zarubaton, sekelompok orang di tengah malam masuk ke rumah mereka lewat pintu belakang dan langsung melakukan pemukulandenganmenggunakansenjatatumpul secara membabi buta. Korban tidak bisa berbuat apa-apa saat kejadian kecuali hanya berteriak minta tolong, dan hanya pasrah jadi bulan-bulanan penjahat. Waspada/Sori Parlah Harahap

PARKIR angkutan pedesaan dan beca bermotor yang tidak teratur membuat jalur lintas Pasar Gunungtua setiap hari pekan Rabu dan Sabtu selalu langganan macet.

Warga Batangtoru Resahkan Lokalisasi BATANGTORU (Waspada): Sejumlah warga Dusun Huta Onas Desa Sipenggeng, Kec. Batangtoru,Kab. TapanuliSelatan merasa resah akibat lemahnya penegakan hukum terhadap keberadaan warung remang-remang (lokalisasi) di daerah mereka. Sejumlahwargayangtakmau disebut namanya, kepada Waspada mengakui, keberadaan warung remang-remang di desa meraka sudah puluhan tahun lamanya berdiri kokoh. Warga mengaku tidak berani mengusir pemilik warung Nurcahaya Boru Tanjung, karena suaminya seorang petugas di LP Salambue Kota Padangsidimpuan. ‘’Kami tak berani mengusir pemilik warung itu, suaminya seorang penegak hukum, nanti dipenjarakannya pula kami,

apalah kami warga desa biasa ini, dekking pun tak ada, selain itu, siapa pula yang berani mengusirnya, uang dan relasinya banyak’’, ungkap warga di sebuah warung di desa itu, Kamis (7/4). Ketua Umum PMII PSPTapsel (Persatuan Mahasiswa Islam Indonesia Padangsidimpuan-TapanuliSelatan)KobolNasution, menyayangkan keberadaanlokalisasiyangdidugasudah lama. ‘’Harapan kami dari elemen Mahasiswa PMII, agar penegak hukum dan Pemerintah Kabupaten Tapanuli selatan jangan berdiam diri untuk penertiban terhadaptempat-tempatmaksiat, apalagidiDesaSipenggengsudah menjadi preseden buruk bagi warga Batangtoru sekitarnya, sehingga dua orang pelayan warung tersebut dalam dua hari

Ribuan orang dari berbagai golongan dan daerah saling bertarung mengadu nasib di tengah hutan mengambil batu emas dari kedalaman 25 meter, bahkan kabarnya kini ada yag mencapai 50 meter. MeskidikawasanTNBGyang merupakanpenyeimbangekosistem dan salah satu paru-paru dunia internasional, tambang liar terus berjalan tanpa mampu dihentikan pemerintah setempat karena alasan kemanusiaan. Bahkan, setiap sosialisasi dan pendekatan pihak berkompeten dilakukan tidak menuai hasil positif.Ituterjadikarena kekurang dewasaan pemerintah dan kecemburuan sosial masyarakat erat kaitannya dengan keberadaan PT Sorikmas Minning bergerak di bidang tambang, juga memiliki areal kontrak karya di areal TNBG yang nota bene berlangsungnya kegitan penambangan liar saat ini. Situasi itu menimbulkan pertanyaan besar dalam benak masyarakat.KenapaPTSMMbisa mengadakan aktifitas di kawasan TNBG?, sedangkan masyarakat, jangankan untuk menambang, untuk megolah areal kebun mereka yang turun temurun dari

nenekmoyangmenjadikepemilikan tidak pasti, akibat keputusan pemerintah tentang penetapan luas TNBG 108.000 hektare. Satu sisi, pemerintah mendatangkan investor menambah PAD notabene untuk masyarakat juga. Namun di sisi lain, masyarakat merasa justru dikorbankan demi kepentingan pengusaha. Kondisi yang situasional inilah diduga menjadi dilema dan momog dalam diri masyarakat, yang berujung pada krisis kepercayaanterhadapkebijakanpemerintah. Dalam kondisi demikian, Pemda Madina terjebak izin yang diberikan pemerintah pusat kepada PT SMM untuk ekplorasi. Ditambah lagi batas TNBG yang hingga hari ini sejak diresmikan Presiden RI masa pimpinanMegawatitahun2005silam tidak pernah tuntas. Lagi-lagi hal itumenambahsikafdandijadikan senjata bumerang oleh elemen masyarakat terhadap pemerintah. Kesimpulannya, tambang legal dan ilegal berada dalam lokasi yang sama. Perbedaannya, perusahaan memiliki izin resmi karena didukung kekuatan finansial dan restu penguasa dalam kekuasaan . Sedangkan masyarakat pemilik wilayah yang merasa di paksa pemerintah jadi penonton dan gigit jari, mencoba ambil peran dengan kekuatan apa adanya meskitanpaaturanresmi.Tujuannya tidak lain sama-sama mencari keuntungan dan memenuhi hasrat kepuasan batin. Karenanya tidak heran, kalau Desa Hutajulu, tepatnya kawasan Kecamatan Hutabargot 24 jam tidak pernah sepi dari aktifitas penambang. Kata lainnya daerah itu tidak pernah tidur. Bahkan suasana bising mesin galundung tidak saja di Hutabargot, melainkan menjalar di kawasan Kecamatan Panyabungan Ibu Kota

berturut-turut meninggal di kamar warung pemiliknya tersebut dan dimakamkan di desa Sipenggeng, sehingga warga menjadi resah’’, ujar Kobol Nasution. Hal senada juga disampaikan Ketua Fraksi Demokrat DPRD Tapsel, MuhammadYakub Harahap, dia mengharapkan agar Tapsel menjadi kota yang bersih dari kemaksiatan, sehingga citra Tapsel dimata daerah lain tidak dipandang sebelah mata dengan mekarnya tempat-tempat yang kurang terpuji. ‘’Harapan kita Kabupaten Tapanuli selatan menjadi daerah yang berwibawa, beriman dan bersihdarikemaksiatan,sehingga pembangunan mental spritual di tengah-tengah masyarakat dapat terwujud sesuai dengan peradatan Dalihan Natolu (Peradatan Tapsel),’’ papar politisi itu. (c13)

Provost Polres P. Sidimpuan Ditarget 2 Kasus Togel Per Minggu P.SIDIMPUAN (Waspada): Kepala Seksi Profesi dan Keamanan(KasiPropam)atausebelumnya dikenal sebagai Komandan Provost Polres Padangsidimpuan, Ipda Rudi Siregar, dalam waktu dekat akan menandatangani kontrak kerja pemberantasan toto gelap (togel). ‘’Akan menangani personil Polri yang terlibat atau membackingitogeldansejenisnya.Kita akan memberi target 2 kasus per minggu kepada Kasi Propam,’’ kataKapolresAKBPAndiSyahriful Taufik, Kamis (7/4). Disebutkan, kontrak kerja ini dibuat setelah Kapolres banyak menerima laporan masyarakat tentang keterlibatan anggota Polri dalam togel. Baik sebagai pemasang, bandar, maupun mem-

backingi togel. ‘’Tolonginformasikankepada saya jika ada menemukan atau mengetahui anggota Polri terlibat togel. Kita akan berikan tindakan tegas dan identitas pelapor akan dirahasiakan,’’ ujar Kapolres. Didampingi Wakapolres, KompolMaradolokSiregar,Kabag Ops, Kompol Edison Sitepu, Kabag Renc, Kompol Darwin Daulay, Kapolres menyebut penanda tanganan kontrak kerja dengan Kasi Propam dilakukan paling lambat dalam minggu ini juga. Ditanya sudah sejauh mana hasil daripada kontrak kerja dengan para perwira pimpinan satuandanbintarapimpinanunit. Kapolres menyebut cukup bagus. Sejak Senin (4/4) sudah 6

Mungkinkah Melegalkan Penambangan Liar Di Madina? SEJAK merebaknya praktik tambang liar di kawasan Taman Nasional Batang Gadis (TNBG) wilayah Desa Hutajulu, Kecamatan Hutabargot, Kabupaten Mandailing Natal bulan April 2010 lalu, telah banyak membawa paradigma baru di tengah masyarakat yang mampu menyedot perhatian banyak orang di dalam dan luar daerah Madina.

Jumat 8 April 2011

4 Warga Tabuyung Dianiaya OTK

GUNUNGTUA (Waspada) : Pasar Gunungtua di Kecamatan Padang Bolak, Kabupaten Padanglawas Utara dan juga merupakan jalur lintas menuju Kabupaten Labuhan Batu Selatan (Labusel) selalu menjadi langganan macet, terutama pada hari pekan yakni Rabu dan Sabtu. Pengamatan Waspada, Rabu (6/4), pasar Gunungtua yang merupakan pusat perbelanjaan warga Kecamatan Padang Bolak ini setiap hari pekan yakni Rabu dan Sabtu selalu langganan macet. Pasalnya, selain areal pasarnya sempit juga terminal angkutan pedesaan dan beca bermotor tidak di atur lahan parkirnya, sehingga membuat jalur lintas tersebut sering macet. Seperti yang dituturkan Firdaus Harahap, warga setempat, kondisi ini sepertinya tidak pernah diperhatikan pejabat terkait. “Pejabat terkait terkesan tutup mata akan persoalan ini. Bayangkan saja, setiap hari pekan Pasar Gunungtua selalu macet hingga antrean satu kilometer di simpang empat,” ujarnya. Dikatakannya, kemacetan disebabkan oleh kendaraan yang sembarangan parkir ditambah aktivitas yang sangat sibuk saat pekan berlangsung. Untuk itu, kata Firdaus, diminta kepada Dinas Perhubungan Kabupaten Padanglawas Utara agar menangani kemacetan itu. (a35)

Taburia Dapat Membantu Tumbuh Kembang Anak


Waspada/Sarmin Harahap

KEGIATAN penambangan liar di Desa Hutajulu, Kecamatan Hutabargot, Mandailing Natal. Madina. Ratusan lubang penambang, ratusan galundung beroperasi, dan ribuan liter air raksa sudah tumpahruahkesungai,dansawah yang sudah jelas menjadi ancaman lingkungan dan kesehatan masyarakat. Efek negatif akibat tambang di ketahui masyarakat. Tapi tuntutan kesejahteraan sepertinya telah membutakan pikiran mereka yang hanya berfikir sesaat, dan dampak di hari esok dibahas nanti saja yang kerap diistilahkan REBELS(ResikoBelakanganSaja). Sedangkan sisi positifnya, terbukanya kawasan tambang liar menjadi peluang kesempatan kerja yang sangat luas bagi masyarakat. Bisa dikatakan tidak ada lagi yang menganggur saat ini. Dikaji dari peluang lapangan kerja, pemerintah bisa melihat langsung betapa masih tingginya angkakemiskiandiMadina.Seharusnya, kegiatan tambang liar menjadicontohnyatabagipemerintah untuk membuka lapangan kerja dengan memanfaatkan Sumber Daya Alam (SDA) yang

melimpah ruah. Lalu timbul pertanyaan, mungkinkahkegiatanpertambangan liar dilegalkan di Madina? Hemat penulis, kalau pemerintah mengacu pada pasal 33 UUD 1945 berbunyi” bumi dan air dipelihara oleh negara. Dan di pergunakan sebesar-besarnya untukkemakmuranmasyarakat”. Menjadi dasar untuk melegalkan usaha tambang liar. Sebaliknya,jikatambangilegal itudilegalkanpemerintah,masyarakatpun harus taat terhadap kesepakatan bersama aturan dan kewajiban mulai dari perizinan hingga pemasaran hasil tambang harus sesuai mekanisme. Jika masyarakat tidak mau dilegalkan sesuai aturan kesepakatan bersama di maksud, warga masyarakat pun harus rela dikenakansanksihukumpidanaketika tertangkap, dan terbukti melakukan penambangan liar dan perusakan lingkungan sesuai undangundang nomor 32 tahun 2009, pasal98ayat1,penjarapalinglama 10 tahun dan denda Rp10 miliar. Sarmin Harahap

tersangka judi togel yang kita amankan dari 5 tempat berbeda di Kota Padangsidimpuan. Namunbelumadayangberstatus bandar togel. ‘’Ada kendala yang kita alami untukmenangkapbandar.Karena begitu juru tulis atau sub agennya ditangkap, si bandar langsung tahu dan kabur. Tapi yakinlah kita sangat optimis bisa menangkap para bandar togel itu. Karena kita jauh lebih senang bisa menangkap kakap daripada teri,’’ kata Kapolres. (a27)

Mungkin karena teriakan korban, pelaku akhirnya kabur. Pengeroyokan di Desa Tabuyung baru diketahui pihak Polsek Muara Batang Gadis dari warga 5 jam setelah kejadian, tepatnya sekira pukul07:00.DanselanjutnyamelaporkankePolres Madina. MuspikaMuaraBatangGadis langsungmembawa korban ke RSUD Panyabungan guna mendapatkanperawatanintensif.KorbantibadiRSUD Panyabungan, Kamis (7/4) sekira pukul 14:00. Kapolres Madina, AKBP. HirbakWahyu Setiawan,SIkdidampingiKasatReskrim,AKP.Sarluman Siregar yang datang melihat kondisi korban mengatakan, sampai saat inipihaknyamasihmelakukan penyelidikan motif kejahatan. Pihaknya berjanji akan terus mengusut tuntas kasus tersebut. Para tersngka nantinya tertangkap akandikenakanpasal170KUHPdenganancaman penjara di atas 5 tahun. (c14)

PTPN IV Dinilai Tak Beri Kontribusi Kesejahteraan Masyarakat Madina Humas PTPN IV: Tudingan Tak Mendasar MEDAN (Waspada) : PTPN IV dituding tidak memberikan kontribusi signifikan bagi pembangunanKabupatenMadina.Bahkandinilaimenyengsarakan masyarakat di daerah itu. “Untuk apa perusahaan besar ada di daerah itu kalau hanya menyengsarakan rakyat. Lebih bagus dia di usir aja,” kata Irwansyah Nasution, tokoh pemuda Madina di Medan, Kamis (6/ 4). Menurut yang Wakil Ketua DPD II Nasional Demokrat (Nasdem) itu, kondisi ini diketahui setelah dirinya menerima banyak pengaduan dari masyarakat Madina dan Pantai Barat. “Kalau begini terus, kita khawatir bisa terjadi konflik horizontal di Madina,” tegasnya. Dijelaskan,dari28.000hektareizinlahanperkebunan yang diberikan kepada PTPN IV yang diperuntukan kebun inti seluas 18.000 hektare dan plasma (rakyat) seluas 10.000 hektare, namun PTPN IV hanya membangun dan memprioritaskan pengelolaan kebun inti. “Seharusnya ini sejalan. Apalagi dana untuk mengelola kebun tersebut bersumber dari APBN

melalui dana revitalisasi senilai Rp298 miliar ada diperuntukkanuntukitu,”katanya.AnehnyaPTPN IVmemberikanhakkelolaterhadapkebunplasma kepada mayoritas masyarakat luar Madina (bukan putra daerah) bukan kepada warga Madina. Untuk itu, tambahnya, diharapkan pemerintahsegeramempertimbangkandanmengevaluasi izin kebun tersebut. “Setidaknya pemerintah segera menentukan sikap sebelum terjadi konflik di Madina,” tegas Irwansyah. Di tempat terpisah, tokoh pemuda Madina lainnya yang juga Sekretaris PDIP Madina Anas S Lubis menilai, kondisi ini terjadi karena Pemkab Madina lebih berpihak kepada pengusaha atau investor dari pada rakyat. Kabag Humas PTPN IV Lidang Panggabean mengatakan, keberadaan proyek kami di Madina tentumemberikandampakpositifbagimasyarakat. Jadi, menurut kami, tudingan itu tidak mendasar. Terbukti saat ini, perusahaan membangun kebun plasma untuk masyatakat seluas 2.059 hektare. Belum lagi, lanjutnya, multiplier effect (belanja operasional kebun), pemanfaatan tenaga kerja lokal dan lain-lain. (m49)

Pemkab Palas Diminta Waspada Tangani Persoalan PTPN IV SIBUHUAN (Waspada) : Komisi A DPRD Padanglawas Erwin Hamonangan Pane mengingatkan Pemkab Padanglawas supaya lebih waspada dalam menyelesaikan permasalahan berkepanjangan antara PTP Nusantara IV unit Kebun Sosa dengan masyarakat Sosa hinga saat ini masih belum ada penyelesaian. DemikianWakil Ketua Komisi A DPRD Palas ErwinHamonanganPanekepadawartawan,Rabu (6/4) menyusul persoalan antara perusahaan milik BUMN yang beroperasi di wilayah Sosa sejak tahun 80-an itu sampai sekarang belum ada penyelesaian secara tuntas. Bahkan ada indikasi, konflik berkepanjangan itusepertinyadipeliharaolehoknumpejabatPTPN IV agar tidak ada penyelesaian. Seperti persoalan kebun plasma masyarakat Desa Hutarajalamo seluas 500 Ha yang sampai saat ini belum ada realisasi, padahal sebelumnya menurut perjanjian di notaris Indra Syarif Halim selambatnya tahun 2004 kebun plasma dengan tanaman yang menghasilkan diserahkan kepada masyarakat, namun sampai sekarang tidak ada

realisasi. Begitu juga dengan masalah dengan masyarakat 17 desa di Kecamatan Sosa, bahkan belakangan Pemkab Palas turut memfasilitasi penyelesaian. Dimana pihak PTPN IV bersedia memberikan kompensasi Rp15 miliar kepada masyarakat 17 desa. Namun banyak warga yang menolak, bahkan ada warga yang bersedia membayar Rp30 miliar asal pihak PTP N IV mau meninggalkan lokasi afdeling I, II dan afdeling III unit kebun Sosa seluas 2.116 hektare. SelainsanggupmembayarRp30miliarkepada warga juga bersedia memberikan lahan kepada masyarakat untuk pemukiman seluas 100 hektare, 5 hektare untuk kepentingan fasilitas umum dan 5 hektare untuk tanah wakaf perkuburan. “Hal ini membuktikan tidak adanya iktikad baik pihak PTPN IV untuk bekerjasama dengan masyarakat, apalagi terkesan dipeliharanya konflik berkepanjangan dengan masyarakat di wilayah Sosa baik dengan masyarakat 17 desa maupun masyarakat Hutaraja Lama yang hingga kini tidak kunjung ada penyelesaian,” katanya. (a32)


WASPADA Jumat 8 April 2011


Gap Kaya-Miskin Melebar RI Di Ambang Kehancuran


asalah kesenjangan (gap) si kaya dengan si miskin semakin memprihatinkan, terutama di perkotaan. Bahkan, hal itu dikemukakan langsung Presiden Susilo BambangYudhoyono (SBY) kemarin. Menurutnya, masih banyak gedung dan bangunan, terutama milik pemerintah, baik pusat dan daerah, tergolong mewah. Ada kecenderungan, di areal gedung mewah berdiri, kemiskinan di sekitarnya juga relatif tinggi. Pembangunan rumah dinas, gedung perkantoran berikut pemberian fasilitas mobil dll kepada para pejabat memang perlu, namun harusnya selektif dan proporsional. Artinya, jangan sampai pembangunan gedung memakan biaya ratusan miliar rupiah tapi tidak dibarengi dengan peningkatan kinerja. Bahkan, untuk merawatnya saja tidak mampu. Kantor Gubsu di Jl. Pancing bisa dijadikan contoh kasus betapa bangunan megah itu menjadi ‘’mubazir’’ karena dibangun asal jadi oleh pejabatnya di masa lalu sarat KKN. Sama halnya dengan penggunaan mobil dinas super mewah, sepertinya tidak diperlukan karena menghabiskan anggaran sangat besar. Cukup yang sederhana saja, jenis Kijang misalnya. Yang penting fungsinya, bukan gengsi. Namun fakta di lapangan pengadaan mobil mewah semakin gencar dilakukan para pejabat di pusat maupun daerah (provinsi, kabupaten-kota). Mobil mewah bertabur di kantor-kantor pemerintah, juga di gedung dewan tak ubahnya pameran mobil mewah. Hemat kita, boleh saja pejabat pemerintah membangun kantor dan fasilitas mewah, asalkan kinerjanya meningkat sehingga kehidupan maupun pelayanan kepada masyarakat semakin baik dan optimal. Kalau tingkat kesejahteraan dan kemakmuran rakyat semain tinggi, tidak akan ada yang keberatan maupun protes dengan bangunan gedung mewah, rumah pejabat mewah, mobil mewah diberikan kepada para pejabat negara di pusat maupun daerah. Yang tidak adil dan selalu dikritik masyarakat dan media massa adalah pejabatnya bermewah-mewah dengan uang negara, sementara rakyatnya semakin miskin dan Intisari terpinggirkan, seperti terlihat di sejumlah kota besar termasuk Kota Medan. Bangunan kumuh tumbuh di mana-mana pertanda keJika kesenjangan se- senjangan sosial semakin melebar. Kelompok makin melebar pertanda kaya makin kaya, sementara rakyat miskin semakin termarjinalkan. Itu terbukti dengan Indonesia di ambang ke- terpinggirkannya etnis pribumi di daerah perkotaan karena tidak mampu bersaing hancuran. dengan etnis pendatang, khususnya dari kalangan China yang menguasai bidang perekonomian/modal. Fenomena kehidupan di kota besar: Rumah-rumah penduduk lama milik pribumi terjual, dibeli pengembang, dan disulap menjadi ruko dengan pembeli dari kalangan pedagang keturunan. Hampir 90 persen bangunan ruko di Kota Medan dihuni China dengan model bangunan seperti ‘’kandang harimau’’ sehingga sulit bagi petugas untuk melakukan pendataan, apalagi menyukseskan program KB. Tidak heran kalau jumlah penduduk China semakin bertambah banyak saja di Kota Medan, kini sudah menduduki populasi terbesar di Indonesia. Setelah jumlah penduduk etnis Jawa dan Batak populasi terbesar ketiga di Kota Medan adalah etnis China. Ekspansi etnis China membuat warga pribumi semakin terdesak jauh ke pinggiran karena kalah bersaing. Dalam Pilkada Walikota Medan tahun lalu, kandidat Sofyan Tan nyaris menang. Dari 10 calon Walikota Medan yang maju mendaftar, Sofyan Tan lolos ke putaran kedua (final) berhadapan dengan Rahudman Harahap. Kalau saja menggunakan sistem pemilihan distrik Sofyan Tan-lah yang tampil sebagai pemenang dalam satu putaran karena kuatnya dukungan kekerabatan etnis China di hampir semua kecamatan. Rahudman tertolong karena para ulama mendukungnya ‘’mati-matian’’ sehingga mampu merebut kemenangan dengan sekitar 65 persen suara sah atas Sofyan Tan. Menyahuti statement Presiden SBY di mana gedung-gedung megah berdiri, angka kemiskinan di sekitarnya juga relatif tinggi kiranya menjadi perhatian para pejabat dan pihak terkait lainnya. Harus dicarikan solusinya agar gap kaya-miskin tidak semakin parah di masa mendatang. Jika diabaikan, kondisi itu ibarat menyimpan ‘’bom waktu’’ yang pasti akan meledak pada saat ada pemicunya. Banyak faktor penyebab mengapa kemiskinan semakin meningkat, sekalipun pemerintah mengklaim jumlah rakyat miskin sudah semakin kecil di kisaran 19 juta jiwa saja (2010), tapi kalau melihat fakta dan kondisi riil di lapangan, setiap pembagian sembako terjadi musibah akibat rebutan, dan melihat daftar BLT konon mencapai 21 juta rumah tangga miskin, maka jumlah rakyat miskin tidak akan jauh dari 80 juta jiwa saat ini. Jika BBM dinaikkan nanti jumlah penduduk miskin semakin mengerikan dan itu pertanda Indonesia di ambang kehancuran akibat sulitnya lapangan kerja, krisis ekonomi, penyalahgunaan jabatan, disorientasi, dan demoralisasi. Begitulah kalau pemerintah tidak bekerja dengan benar. Pendelegasian wewenang lewat Otonomi Daerah tak berhasil, malah mengakibatkan korupsi semakin merajalela. ]Begitupun kita memberi apresiasi buat SBY yang berani bicara benar, tidak lagi mengejar pencitraan. Mudah-mudahan ada perubahan yang lebih baik agar rakyat kecil tidak semakin kehilangan hak-haknya, menjadi tumbal globalisasi oleh para pejabat, konglomerat maupun kebijakan ‘’neoleb’’.+


Faks 061 4510025


+6285261360527 Pak Wali & jajaran Pemko Medan,apakah tidak malu memiliki Stadion Teladan? Stadion yang dulu kebanggaan Kota Medan & mempunyai sejarah yang besar kini hilang sudah. Stadionnya seperti tidak terurus. Apalah gunanya membuat taman disekitar stadion,lebih bagus Stadionnya yang drenovasi. Tamannya pun dibuat asal jadi. Gimana ini pak dengan janji Bapak.... +6287867028166 Kepada Bapak PU yang terhormat, tolong lah pak di bersihkan gang Morneng jalan Mandala Denai, wassalam, +6281990531471 Kami warga Tanjung Gading Inalum merasa resah dan terzolimi. sejak pertengahan Bulan Maret kami mengkonsumsi air PAM Tanjung Gading yang dicampur dengan air limbah MCK dan Rumah Sakit yg telah didaur ulang. apakah mereka para pimpinan PT.inalum tidak berfikir kalau limbah tersebut biangnya nazis dan sumber penyakit. kepada siapa kami harus mengadu !... pimpinan PT. Inalum harus bertanggung jawab kalau shalat kami tidak syah karena kami berwuduk dengan air yang telah dicampur dengan nazis berat. +6281263429736 Saya sangat setuju bahwa Kab. Palas kabupaten tertinggal di Sumut dan terkesan tidak punya planning pembangunan terutama menyangkut jalan dan sarana yang langsung bersentuhan dengan rakyat, kebetulan saya orang Sibuhuan juga, dan saya sudah beberapa kali pulang dalam 2 thn ini tapi tdak ada perbaikan. Terkesan Bupati seperti menganggap dirinya masih sebagai camat ya hanya berkutat dengan birokrasi dan bukan cari investor untuk membangun daerah. +628126453376 Bapak Bupati Labura yth, kami masyarakat Wonosari Lk.1 Aek Kanopan bermohon kepada bapak agar memperhatikan kondisi Gang makmur Wonosari Lk.1 AekKanopan (padat penduduk) kiranya diperbaiki karena tidak adanya drainase/parit sehingga kalau hujan badan jalan gang becek persis seperti kubangan kerbau. masyarakat sudah berulang kali bergotong royong melalui swadaya menimbun badan jalan dengan batu perton namun tetap saja gang tersebut becek. jalan-jalan ke Ledong Barat pergi berjalan dihari Jum,at apa gunanya Bupati hebat kalau tidak dekat sama rakyat, kharisma sudah jadi pejabat..kharisma kecil dari rakyat, kalau kharisma sudah besar jangan lupa sama rakyat...terima kasih.


Kedai Kopi Dan Ruang Publik Oleh Budi Agustono Kedai kopi bermetamorfosis menjadi ruang publik baru dalam mempertemukan banyak orang untuk bermacam aktivitas


i kota Medan banyak dijumpai kedai kopi, terutama yang berdekatan dengan pasar rakyat. Pada awal 1980-an malah jauh sebelum itu, selain di sekitar pasar rakyat, kedai kopi sering dijumpai di pinggir jalan yang berdekatan dengan pertokoan atau pusat perbelanjaan moderen. Di sekelilingnya menjadi tempat mangkal atau berkumpulnya para penarik beca bermotor atau sopir taksi yang menunggu penumpang memakai jasa mereka. Biasanya kedai kopi menyediakan makanan ringan (kue) dan koran lokal untuk menarik pelanggannya. Setiap pagi sampai mendekati siang hari kedai kopi tiada hentinya dikunjungi pelanggannya yang datang silih berganti. Saat duduk menikmati kue sembari menyeruput teh dan kopi panas mereka membaca koran lokal. Dari koran lokal inilah para penjual, pembeli, penarik beca dan sopir taksi yang berasal dari latar belakang kelompok etnik yang berbeda mendapat informasi tentang keadaan perkembangan masyarakat, termasuk situasi politik nasional dan keadaan politik lokal aktual. Di kedai kopi inilah orang berkumpul membincangkan, mendiskusikan, dan berdebat tentang isu aktual dengan memakai referensi koran lokal yang disediakan pemilik kedai kopi. Sering kali karena permbicaraan antar mereka tidak terorganisir dan tidak terarah, dan terkadang hanya berdebat kusir, omongan mereka ini disebut coffee stall talk, obrolan atau cakap-cakap warung kopi. Tentu saja cakap-cakap kedai kopi jauh dari ilmiah. Begitupun banyak juga diskusi-diskusi yang diselenggarakan mahasiswa di kampus-kampus tidak berbeda dengan cakap-cakap kedai kopi. Namun di atas semua itu, bertaburannya kedai kopi di berbagai tempat di kota Medan ini menjadi media tempat ngerumpi, melakukan transaksi dagang, dan media interaksi sosial antar warga. Dalam konteks ini kedai kopi menjadi arena ruang publik berinteraksinya warga untuk membicarakan berbagai hal yang terkait dengan perkembangan aktual sosial politik bangsa. Ketika bangsa ini di bawah rezim otoriter, kedai kopi disadari atau tidak mentransformasikan diri menjadi ruang publik yang tidak dapat dikontrol oleh

kekuasaan. Di kedai-kedai kopi warga dengan bebas mendiskusikan dan mencibir kehadiran negara yang memandang rakyat sebagai musuh utamanya. Di masa rezim otoriter ini warga tidak dibolehkan membicarakan politik lantaran politik hanya dianggap urusan pengelola kekuasaan. Mengingat begitu ketatnya cengkeraman kekuasaan menyebabkan tidak ada lagi ruang untuk mempertanyakan kekuasaan. Pada masa itu di tengah sempitnya ruang gerak rakyat menggugat kekuasaan, kedai kopi dimanfaatkan warga sebagai media membicarakan politik, termasuk berbagai rumor politik yang berkembang saat itu. Mereka yang menikmati sajian di kedai kopi bukanlah orang sembarangan. Mereka, para penikmat kopi itu, berasal kalangan menengah atas yang menghabiskan waktunya dengan berkongkow-kongkow di tempat yang berpendingin udara itu. Mereka yang menyeruput kopi dapat menaikkan gengsi sosialnya di tengah masyarakat kota Medan yang masih tertindih kemiskinan. Belakangan bersamaan dengan makin melebarnya jaringan internet menembus gedung perkantoran moderen, hotel dan plasa, banyak kalangan menengah atas ini menikmati fasilitas internet ini dengan berfacebook ria sembari menikmati kopi. Meski jaringan internet telah dinikmati publik perkotaan, mereka yang berkongkow-kongkow tetap tetap dianggap orang berpunya. Demokrasi Kedai kopi tidak saja sebagai ruang publik yang mempertemukan banyak orang dari bermacam latar belakang, tetapi juga ia, bersamaan dengan bertumbuhnya bisnis kulner, menjadi arena lahan bisnis. Setelah kedai kopi di sekitar pasar tradisional dan pinggiran jalan, lalu dibukanya kedai kopi di ruang berpendingin udara (pusat perbelanjaan moderen dan hotel berbintang). Belakangan

ini di sekitar kota Medan, terutama di kantong-kantong bisnis menengah baru bermunculan kedai kopi seperti Kopi Thiam Ong, Republik Kopi, dan Keude Kupie Ulee Kareng. Nama Kopi Thiam Ong mengingatkan publik kepada nama yang sama di Singapura. Kopitiam (kedai kopi) di Singapura mulai bertumbuhan di pertengahan abad ke sembilan belas bersamaan dengan mengalirnya migran Tionghoa yang bekerja sebagai buruh perkebunan di negeri ini. Kopitiam perlahan-lahan menjadi ruang publik yang menyatukan para buruh untuk mengobrol dan membicarakan lingkungan pekerjaan sekaligus sebagai tempat berkumpulnya buruh dari asal daerah yang sama. Setelah berkembang bersamaan dengan membanjirnya migrasi orang Tionghoa ke Singapura kopitiam menjadi tempat transaksi bisnis yang terkait perkebunan, termasuk tempat bertemunya para samseng, preman, di masa itu. Kopintiam di Singapura tidak hanya menjual kopi dan kuliner Tionghoa, tetapi juga beriringan dengan berduyun-duyunnya arus migrasi ke negeri ini, mempekerjakan karyawannya dari negara lain. Di sini dapat dilihat kopitiam tidak saja sebagai ruang publik, tetapi juga menjadi kecambah multikulturalisme di negeri ini. Dalam kaitan itu, jika ada nama kedai Kopi Thiam Ong Medan asal usulnya dapat dirunut dari Singapura. Kopi Thiam Ong Jalan Mansur yang bernuansa kultur Tionghoa ini cukup unik karena menyiapkan berbagai macam jenis kopi dari berbagai daerah yang setiap harinya menyajikan kopi dari wilayah yang berbeda-beda. Jika hari ini disediakan kopi Mandailing, besok berganti kopi dari daerah lain. Demikian pula dengan makanan tampak lebih menyajikan cita rasa kelas menengah kota. Ada Republik Kopi yang juga menyajikan kopi dari berbagai daerah yang terus bertukar setiap harinya. Tidak jauh dari sini ada lagi Keude Kupie Ulee Kareng. Nama kedai kopi ini tentu saja mengingatkan nama yang sama di sebuah daerah Ulee Kareeng, di Banda Aceh. Setelah Aceh dihantam tsunami yang menewaskan ratusan ribu korban jiwa dan menga-

lirnya bantuan dolar dari berbagai negara untuk merehabilitasi pembangunan fisik, lembaga donor internasional, pekerja sosial dan aktivis ornop dunia dan lokal berdatangan ke Banda Aceh. Sesudah penat bekerja mereka memerlukan tempat untuk berkumpul, mengobrol sembari mendiskusikan banyak hal tentang rehabilitasi masyarakat Aceh. Salah atu tempat kongkow-kongkow yang populer di Banda Aceh adalah keude kupie Ulee Kareeng. Karena menjadi tempat terbangunnya jaringan-jaringan sosial baru, Ulee Kareeng memproduksi ruang publik yang sebelumnya tidak pernah terjadi dalam masyarakat Aceh. Dalam kaitannya dengan terciptanya ruang publik ini, kehadiran keude kupie Ulee Kareeng di Jalan Setia Budi ini cukup menarik diamati karena selain menyediakan fasilitas internet (Wifi) untuk memanjakan pelanggannya, juga menyajikan makanan (kue) timpan, kue tradisional Aceh, martabak, dan mie Aceh yang banyak dinikmati warga kota Medan. Fasilitas internet dan sajiam makanan khas merupakan daya tarik siapa saja untuk mendatangi kedai kopi ini. Kopi Thiam Ong, Republik Kopi, dan Keude Kupie Ulee Kareng telah bermetamorfosis menjadi ruang publik baru dalam mempertemukan banyak orang untuk bermacam aktivitas mulai dari ngobrol (online), membahas situasi politik kontemporer sampai menjadi tempat transaksi bisnis. Jika di kedai kopi di sekitar pasar rakyat dan pinggir jalan segmen pasarnya dari kalangan orang kebanyakan, di Starbucks dan Kopitiam Killeney dengan pelanggannya dari kelas mene-ngah atas, di ketiga kedai kopi ini, mereka yang bertandang menikmati kopi latar belakang pembelinya lebih beragam dan egaliter tanpa didominasi kelas tertentu. Kehadiran Kopi Thiam Ong, Republik Kopi, dan Keude Kupie Ulee Kareeng telah melahirkan ruang publik baru di kota Medan. Pada abad pertengahan abad ke sembilan belas di Eropa bermunculan cafe-cafe yang menghasilkan ruang publik yang menjadi tempat berseliwerannya pembicaraan tentang demokrasi dari kelas menengah kota. Persolannya, apakah dengan kehadiran ruangruang publik baru di kota Medan dapat mendorong bergulirnya demokrasi lokal dan tata kelola pemerintahan yang bersih, akuntabel, dan transparan di kota yang di masa kolonial ini populer dengan sebutan Tanah Deli ini? Penulis adalah Staf Pengajar Jurusan Sejarah Fakultas Sastra USU

Masa Depan PSSI Di Tangan Agum Dkk Oleh Sofyan Harahap Sikap profesional menjadi kata kunci, apalagi kalau tahun depan (2012) pemerintah dan KPK sudah sepakat menutup kran dana untuk PSSI khususnya digunakan oleh LSI yang selama ini mayoritas masih memanfaatkan dana APBD


abarmenggembirakandatangdari FIFA yang menunjuk Agum Gumelar sebagai Ketua Komite Normalisasi PSSI yang akan menangani tugas-tugas dari induk organisasi sepakbola itu hingga digelarnya kongres bulan depan guna mencari pengganti Nurdin Halid. Penunjukan Agum yang juga pernah menjabat Ketua Umum PSSI periode 19992003 diyakini dapat diterima mayoritas pihak yang bertikai di dalam tubuh PSSI Pusat maupun Pengprov di seluruh Indonesia.Sebab,Agumselamainidikenalcukup netral dan sudah berpengalaman membina sepakbola dan cabang olahraga lainnya, termasuk memimpin KONI Pusat pasca lengser dari PSSI. Dan Agum tidak berpihak pada kelompok-kelompok yang bertikai, seperti kelompok Nurdin dan kelompok anti-Nurdin. FIFA tentunya sudah menseleksi sejumlahtokohyangdapatmenengahikonflik danfriksiberkepanjangandiorganisasiPSSI, sampai-sampai kongres di Pekan Baru pada 26 Maret lalu mengalami kegagalan, karena sikap pengurus lama (Nugraha Besoes Cs) secara sepihak membatalkan kongres karena menilai aparat keamanan ikut campur sehingga suasana kongres menjadi tidak kondusif. Kita sebut sepihak karena PSSI mengakusudahberkomunikasidenganutusan dari FIFA dan AFC yang sengaja diundang, tapi hal itu malah dibantah utusan FIFA Frank van Hattum dan Alex Soosay (Sekjen AFC) bahwa mereka sangat ingin pergi ke lokasi kongres tapi dihalangi pengurus PSSI. Dengan begitu, kembali terbuka kebohongan pengurus PSSI setelah sebelumnya juga melakukan sejumlah kebohongan termasuk merekayasa Statuta FIFA untuk keuntungan kelompok Nurdin Halid semata. Profil Agum Bagi penggemar sepakbola di tanah air nama Agum Gumelar tentu sudah tak asing lagi. Kiprahnya dalam sepakbola cukup signifikan, meskipun dalam kepengurusannya PSSI juga belum bisa mencetak prestasi sebagaimana diinginkan masyarakat. Namun, di bawah kepengurusan Agum tidak terjadi konflik apalagi dualisme kepengurusan seperti di masa Nurdin saat ini. Profil LetjenTNI (purn) Agum Gumelar yang lahir di Tasikmalaya 65 tahun lalu, pernahbertugasdiMedansebagaiKasdamI/BB.Tentusajaiabukannamabarudidunia sepakbola dan olahraga nasional. Mantan Komandan Jenderal Kopassus dan Menko Polkam di era Gus Dur ini pernah menjabat sebagai Ketua Liga Amatir PSSI dan Ketua Liga Indonesia (1993-1995). Puncaknya, dia

menjabat Ketua Umum PSSI periode 19992003 dan Ketua Umum KONI periode 20032007. Bahkan sampai saat ini Agum masih tercatat sebagai Ketua Kehormatan PSSI. Kini, di pundak Agum bersama tujuh tokoh sepakbola dari berbagai daerah masa depan sepakbola Indonesia dipertaruhkan. Agum dengan anggotanya: Joko Driyono (CEO PT Liga Indonesia), Sukawi Sutarip (Ketua Umum Pengprov PSSI JawaTengah), Siti Nurzannah (Sekretaris Yayasan PS Arema), FX Hadi Rudyatmo (Ketua Umum Pengcab PSSI Solo), Satim Sofyan (Ketua Umum Pengprov PSSI Banten), Syamsul Ashar (Ketua Umum Persik Kediri), dan Dityo Pramono (Perwakilan PSPS Pekanbaru) diharapkan segera mengadakan rapat untuk mengumpulkan bahan, membuat formula yang tepat agar jalannya kongres nanti benar-benar kredibel di mata anggota PSSI, penggemar sepakbola, dan juga di mata pemerintah. Sikap tegas FIFA Pasca kongres PSSI Pekan Baru yang berakhir dengan kerusuhan, baik kubu Nurdin maupun anti-Nurdin sudah membuat laporan ke FIFA.Tapi, masukan dari utusan FIFA dan AFC-lah yang kelihatannya dijadikan acuan. Sebelumnya, Komisi Banding PSSI pimpinan Prof Tjipta Lesmana sudah menganulirputusanpencalonanNurdinHalid, Nirwan Bakrie, Arifin Panigoro, dan George Toisutta. Keempatnya dinilai bermasalah untuk memimpin PSSI sesuai peraturan PSSI/FIFA. Dan putusan Komisi Banding PSSI itulah yang kelihatannya menjadi pegangan FIFA, sehingga dalam suratnya Selasa (5/4) dengan tegas FIFA menyatakan, keempat calon ketua umum PSSI itu tidak boleh dipilih. Berarti, tamat sudah kediktatoran Nurdin untuk bisa memimpin PSSI lagi. Imbasnya, juga dirasakan oleh tiga kandidat ketua umum lainnya, mereka juga terganjal untuk bisa dipilih, karena dicalonkan saja sudah tidak bisa, konon pula untuk dipilih. Kalau masih tetap dipaksakan oleh peserta kongres, terutama dari kelompok KPPN (Komite Penyelamat Persepakbolaan Nasional) pastilahjalannya kongres akanrusuh dan pasti pula FIFA tidak akan menerima hasilnya bila tidak sesuai dengan arahan yang sudah diberikan FIFA untuk kemajuan sepakbola Indonesia. Tampak jelas kalau FIFA sudah mengambillangkahtegasterkaitkisruhditubuh PSSI. Dalam situs resminya pula FIFA menyatakan mengambilalih Komite Eksekutif PSSI. Keputusan FIFA itu mengacu pada pasal 7 paragraf-2 pada Statuta FIFA untuk membentuk Komite Normalisasi dan mengambilalih Exco PSSI dan sifatnya final.

Menurut hemat saya, sikap tegas FIFA itu menguntungkan buat sepakbola Indonesia. Pasca kerusuhan kongres Pekan Baru saya meramalkan FIFA akan menjatuhkan skorsing dengan mengambil data dari laporan Nugraha Besoes Cs, tapi ternyata tidak, sehingga kebijakan pemerintah lewat Menpora membekukan kepengurusan Nurdin dan Besoes dianggap tepat. Tak pelak lagi sikap FIFA itu disambut hangat oleh banyak pihak, termasuk Menpora Andi Mallarangeng yang beberapa hari sebelumnya sudah membekukan dan tidak mengakui lagi kepengurusan PSSI. Sebaliknya, posisi Nurdin dan Besoes semakin tersudutkarenaFIFAdengantegasmenyatakan kepemimpinan PSSI di bawah kepemimpinan Nurdin dianggap gagal mengontrol persepakbolaan Indonesia dengan baik. Bergulirnya Liga Primer Indonesia (LPI) sebagai liga tandingan selain Liga Super Indonesia (LSI) yang diakui FIFA, menjadi salah satu dasar FIFA membuang Nurdin dan Besoes. FIFA berpendapat bahwa kepemimpinan PSSI sudah kehilangan ‘’power’’ dan ‘’wibawa’’ sehingga ditolak oleh masyarakat penggemar sepakbola di Indonesia lewat aksi unjuk rasa. PSSI juga dianggap tak bisa mengorganisir kongres yang mana tujuannya untuk mengadopsi’’ electoral code’’ dan membentuk Komite Pemilihan. Atas dasar itu, FIFA datang dengan kesimpulan tegasmemvoniskepemimpinanNurdindan Besoes pun kehilangan kredibilitas. StatemenFIFAtugasKomiteNormalisasi PSSI (Agum Cs) menyelenggarakan pemilihan berdasarkan electoral code FIFA dan Statuta PSSI sebelum 21 Mei 2011. Komite Normalisasi ini nantinya tidak duduk dalam sebuah posisi di PSSI di periode 2011-2015. Dan menyangkut keberadaan LPI, FIFA tegas menyatakan LPI harus di bawah naunganPSSI.JikatidakmakaFIFAmeminta PSSI menghentikan liga itu sesegera mungkin, atau FIFA mengambil tindakan tegas berupa skorsing terhadap sepakbola Indonesia. Jauhkan dari politik Menjadi pelajaran buat semua ‘’stakeholders’’ sepakbola Indonesia untuk belajar dan mengambil hikmah dari‘’carutmarut’’ kepemimpinan bergaya otoliter Nurdin Halid dengan cara menjadikan orang-orangnya dalam kepengurusan di daerah-daerah sehingga kalau kongres berjalanlancarNurdinpastimenangmutlak. Sikap keras dari tokoh anti-Nurdin patut diacungi jempol dengan mengusung reformasi dan revolusi di tubuh PSSI. Pertanyaannya: Mengapa Nurdin sampai berlaku seperti itu? Menurut saya, karena Nurdinsudahtidakbisamembedakandunia sepakbola yang menjunjung sportivitas dengan dunia politik yang sarat dengan kepentingan pribadi dan kelompok. Nurdin terlihat sekali memanfaatkan parpol seakan Golkar lah yang mengurus sepakbola. MemangkalauNurdinmampumembawaTimnas PSSI berprestasi pastilah Golkar mendapatkan keuntungan, namanya terangkat, sehinggaberpotensimemperolehdukungan suara pada Pemilu dan Pilpres mendatang. Tanpa prestasi, loyo, di level Asia Tenggara

saja tidak mampu juara sekalipun main di kandangpolitisasiNurdinpungagal.Apalagi kalau main di luar kandang sekalipunTimnas sudah dilatih Alfred Riedl dengan bayaran mahal. Di sinilah kita tegaskan bahwa peranan Agum dkk menjadi menentukan, penting dan menentukan. Di tangan Agum dkk masa depan sepakbola Indonesia dipertaruhkan. Segeralah bentuk panitia kongres dan pilihlah kepengurusan yang benar-benar profesional,bukanpartisan,sehinggasistem pembinaandankompetisiberjenjangdapat berjalan dengan benar, termasuk menampung aspirasi kelompok yang mendukung LPI untuk masuk dalam kompetisi sah di bawah naungan PSSI nantinya. Pasti bakal muncul banyak calon alternatif. Tak mengapa, asal Agum Cs tegas mengamankan perintah FIFA. Jauhkan kompromi!Sikapprofesionalmenjadikatakunci, apalagi kalau tahun depan (2012) pemerintah dan KPK sudah sepakat menutup kran dana untuk PSSI khususnya digunakan oleh LSI yang selama ini mayoritas masih memanfaatkan dana APBD.Tanpa profesional, sepakbola kita (PSSI) sulit bangkit mengejar ketertinggalannya, dan bakal banyak klub yang mati karena kekurangan dana akibat tidak mampu mendapatkan sponsor dan menjual pertandingan yang bermutu.+ Penulis adalah wartawan Waspada

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di Media manapun.Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Bangunan Hermes Place diduga penyebab banjir - Makanya jangan cepat kali izin keluar * Plt Gubernur jangan One Man Show - Apalagi Show of Force! * Dishub tak dukung tertib lalu lintas - Kalau tertib, mungkin tak ada kerja


D Wak


WASPADA Jumat, 6 April 2011 BURSA

LOWONGAN DICARI SEGERA Tenaga konsultan/ SPG Produk Soya, dtg lgsg interview bw: FC KTP + Materai 6000 ke Medan Fair Plaza Lt. 3 P No. 90 (Melilea) di samping Mister Baso Hub. Pak Gandi (0813.6174.1964) Pkl. 13.00-18.00 WIB

DIBUTUHKAN Gadis/ Janda untuk Muslim/ Non dipekerjakan Jaga anak gaji 700 s/d 1,2 Jt/ bln Hub. Yayasan Bersinar I Telp. (061) 7636.3421


Tk. Pangkas yang berpengalaman, Muslim, Jujur & Rapi & Disiplin Fas: U. jaminan + Silet Hub. Pangkas Family Jl. Raya Menteng 260 HP. 0813.6172.6123

DICARI TK. PANGKAS Hub. Miniatur Pangkas Jl. Yos Sudarso Glugur HP. 0813.6223.6135


Syarat: 1. Pria, usia max 27 thn 2. Menguasai wilayah Medan sekitarnya 3. Memiliki sepeda motor/ SIM C 4. Pendidikan SLTA Lamaran diantar langsung ke: Jl. Sei Padang No. 141 Medan Up. Bpk. Didin/ Ibu Tina


BAG. STAFF ADMINISTRASI Syarat: 1. Wanita, usia 20 - 28 thn 2. P e n d i d i k a n m i n . S M A a t a u sederajat (diutamakan menguasai Akutansi) 3. Menguasai Ms. Office 4. Dapat bekerja full time Kirimkan surat lamaran lengkap anda langsung ke:

CV. MAJU JAYA MAKMUR Jl. Notes No. 30 Ayahanda Telp. 6999.5140 Paling lambat 1 minggu dari tanggal terbit


Sumitomo Metal (SMI) Electronics Devices (M) Sdn. Bhd. (SMIED), Bayan Lepas, Penang, memerlukan Operator Pengeluaran, dengan ketentuan sbb: Persyaratan: 1. Wanita, umur 18 - 26 tahun 2. Pendidikan SMU/ SMK/ sederajat 3. Belum menikah, belum pernah kerja di Malaysia 4. Sanggup kontrak kerja 2 tahun 5. Mendapat izin orang tua Gaji & Fasilitas: 1. Gaji pokok : RM 380/ bulan 2. Tunjangan kemahiran : RM 200/ bulan 3. Tunjangan shift : RM 144/ bulan 4. Asrama + Fasilitas lengkap 5. Sistem kerja 4-2 memberi kesempatan lembur banyak 6. Penghasilan :RM 1000 - 1750/ bln Pra seleksi : Setiap hari kerja Interview majikan : 11 & 12 April 2011 - Membawa fotocopy KTP, Ijazah dan KK 1 lbr - Pasfoto warna 3x4cm: 1 lbr Hubungi langsungi:

PT. TIMURAYA JAYA LESTARI (izin Menakertrans No: KEP/788/MEN/2006) Jl. AH. Nasution, Komp. Tenaga Asri, No. 1, Smp. Pos - Medan (Samping Bank Mandiri/ Indomaret) Telp. (061) 822.7419 Hotline: 0813.6159.5866


SHM, LT. 6x15, LB. 6x12 Lokasi Jl. Bajak 4, AC, 2 KM, 2 KT, Kodya Medan, Aman, Tenang, Satpam 24 jam Peminat serius hub. 0821.6563.5231


Uk. 11x22, RT 1, KT 3, KM 3, R. Sholat 1, Dapur, Garasi besar Jl. Gatsu depan Kodam I BB, H. Nego Hub. 0812.6477.946 - (061) 847.3165

TANAH Dijual Dijamin Murah !!! (B.U) di Tengah Kota, Lokasi Krakatau Jl. Pasar 3 Gg. Melati Hanya 575 Rb/ mtr, Uk. 25x31mtr Hub. (061) 7643.4406




- Tipe 45 - Sertifikat - Lokasi Jl. Medan - Binjai Km. 5 Perum. Bukit Mas No. 34C Bisa menghubungi HP. 0813.7577.7440

Lamaran kami terima paling lambat tanggal 18 April 2011



Informasi Pembaca Bursa Property

GR : Garasi KM : Kamar Mandi KP : Kamar Pembantu KT : Kamar Tidur SHM: Sertifikat Hak Milik


: Luas Bangunan : Luas Tanah : Ruang Makan : Ruang Tamu


GR, KM 3, KT 3, Ruang sholat, LB. 9x15,5m LT. 10x30m, Psr. 1 Marelan HP. 0812.649.7447 RUMAH Baru dijamin murah, Model 2 KM, KT, SHM, Minimalis di Jl. Purwosari Krakatau, Hrg Rp. 220 Jt/damai Hub. 0852.6285.3118

RUMAH MURAH -> 0852.6271.6566






Segala akibat yang terjadi diluar tanggujawab PT. Harian WASPADA. Apabila anda mencurigai sesuatu,

SDR. SITI ASYURA HP: 0813.9692.9759 SDR. NAZLIANA HP: 0813.6156.6738 SDR. SRI ASPIATI HP: 0816.313.3165 WASSALAM, PANITIA

No. 12 Jl. Kawat VII Tanjung Mulia, LT/ LB. 54/ 48, SHM, Harga Rp. 85 Jt/nego Hub. Lilik 0813.9712.1194 Duki 0812.657.4202, MT


silahkan hubungi kami di

IZIN USAHA: 503/1099.SK.HO/SL/NT/08



Hub. 0821.6563.6044


Ruko Lt. 1, Lokasi strategis Jl. Amaliun No. 44 (sebelah Indomaret) max 2 thn






HOTEL JEDDAH : AL AZHAR (5*) JARAK HOTEL KE MESJID ±60 METER Khusus bagi jema’ah dari luar kota nginap di Hotel Madani Gratis Offic: Gedung Gelora Plaza Jl. SM. Raja No. 4/18 Medan Telp. (061) 7326981, 081375031889 - 085262133488



Jl. Pertahanan Gg. Madrasah No. 10, 2 LT, 4 KT, 3 KM, 1 Ruang Sholat, Keramik (SHM) Uk. 10x21m Hub. 0813.7012.7227


WC 0812 642 71725



2 Pintu Kios Thp 1


Blk A 320-321





Lokasi Hock


MENJUAL PECI TEMPAHAN Berbagai Model dan Warna Jl. Prof. H.M. Yamin SH. No. 344/Jl. Serdang Depan Gg. Sado Medan

Strategis Hub. 0811.640.105








25 MEI 2011 PROMO 16,5 JT NET 01 JUNI 2011 01 JUNI 2011 25 JUNI 2011 25 JUNI 2011 10 JULI 2011 10 JULI 2011 30 JULI 2011 30 JULI 2011 15 AGUSTUS 2011

Segera Mendaftar ke: JL. DR. MANSYUR NO. 9B


TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.6802 - 661.8116 - 7653 2188



Hub. 0821.6563.6044

Hub Telp. (061) 661.6802 - 661.8116 - 7653 2188

Dengan Sistematis Trading (Robot) tanpa analisa teknikal dan fundamental yang rumit dapat melakukan buy dan sell di semua mata uang secara kontinyu 24 jam dengan profit yang konsisten Hub. Mr. Wam 0852.7012.5480

Spring Bed 6 kaki 2 lapis Rp. 1.150.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun

MEJA BILIARD DIJUAL Dijual Meja Biliard 7 kaki sebanyak 5 unit lengkap dgn bola dan stik, 95% baru Harga Penawaran Rp. 6 Jt/ set Harga nego Hub HP. 0857.6122.7787


Depot Air Isi Ulang Kondisi masih Ok




1. Pemasangan Depot Air Minum Dengan Sistem Filtrasi & RO

Rp. 14 Jt s/d 38 Jt

3. M e n y e d i a k a n S p a r e P a r t & Perlengkapan Depot Air Minum 4. Menyediakan RO Rumah Tangga


Jl. Kapt. Muslim No. 53-D Medan Telp. (061) 8457879 Jl. Serdang No. 368 B Medan Telp. (061) 453.2484 - 77839790 HP. 0812 600 5410



> 300M²


> 400 KVA










WC WC 0813 6147 0812 WC WC JL. SETIA BUDI






0812 60444275


Setia Budi


Hub. 8219951 Jl. Setia Budi No. 2





2. Air Pegunungan 6700 s/d 7000 Liter Rp. 230.000 / Tangki




WASIR/ AMBEIEN Garansi 10 Hari Sembuh Tanpa Operasi Hubungi Spesialist Wasir


Jl. Brigjend. Katamso No. 683C Medan ( ± 50m dari Simpang Pelangi) HP. 0852.9751.4253 - 0812.6050.0881


Jl. Gatot Subroto Medan Ada Garansi

Mau Menjual Rumah, Tanah, Kendaraan, Barang Kerajinan Tangan atau Barang Dagangan Lain? Ya Tentu...Pasang Iklan di... Surat Kabar Tercinta:



Untuk informasi lebih lengkap hub

TEL. (061) 4576602 FAX. (061) 4561347

CALL CENTER: (021) 9862000 0878 8200 0020




* Format: JPG - TIFF (Photoshop)

Jl. Pinang Baris (Depan Apotik Sundari), Sertifikat Luas Tanah 198m² Hub: 0813.6213.4907

Jadikan Pria Jadi Idaman Para Wanita

(Sebelah Cikal USU) Medan Telp. (061) 8222800 (Hunting) - (061) 77477888




09 Mei 29 J un, 15 J ul Jun, Jul 18 Mei & 27 J un Jun 24 J un Jun 26 J un Jun 01 Agt 15 Agt 22 Mei

Media yang Tepat untuk Iklan Anda

UMROH PAKET HEMAT RP. 13,5 JT a’ Mi’ un Isra’ Mi’rr aj di Masjidil Aqso 27 J Jun 13H U + Isr

TELPON : 061 - 4576602 FAX : 061 - 4561347



ALAMAT KELINIK TETAP: Jl. SM. Raja Masuk ke Jl. Utama No. 18 Medan Dari Toko Roti Majestik ±100meter Izin Kejaksaan: B/DSP.5/12/2008 Izin Dinkes: No. 448/0649/I/2008 HP. 0812.6388.7999 Buka setiap hari


09H Umr oh dan Ziar ah Umroh Ziarah 11H Umr oh + Bahr ain (Hr g=R e guler) Umroh Bahrain (Hrg Re 11H Umr oh + Cair o Ale xandria Umroh Cairo Alexandria 12H Umr oh + Tur key Umroh urk 15H Umr oh + Dubai & Mar oco Umroh Maroco 11H Umr oh R amadhan Awal Umroh Ramadhan 17H Umr oh R amadhan Akhir Umroh Ramadhan 10H Span yol & Tur key Muslim Tour Spany urk

Panjang: 13, 14, 15, 16, 17, 18, 19, 20 cm Besar: 3,5. 4,5. 5. 5,5. 6 diameter Memperkeras, Tahan lama Ejakulasi dini, Mani encer Impotensi, Lemah syahwat Diabetes, kencing manis/ batu

Ingin Promosikan Produk Anda Harian

Juga melayani problem asmara, mempercepat jodoh, pengasihan, penglaris, buka aura, pasang susuk, dll

Orang Bijak akan memilih Penyelenggara Umroh yang Berizin

Keterangan lebih lengkap silahkan hubungi:

Dijual tanah dgn ukuran 11x28,05m (308,55m²) terletak di Jl. Bendungan II Kelurahan Bangun Mulia Kec. Medan Amplas (±700m dari kantor POLDASU) Hubungi 0812.604.3307 - (061) 6991.7030



TELP. (061) 457.6116 - 451.2319 0813.6137.2321 - 0812.6495.8456

Jl. Jamin Ginting No. 119 Pancur Batu 20353 Phone: (061) 7780.3003 Fax. (061) 836.2060 Mobile: 0812.605.8936 E-mail:


Terapi keperkasaan seksualitas Pria hasil permanen tanpa efek samping, alami, bebas pantangan, untuk semua usia Hasil langsung reaksi ditempat, cukup satu kali berobat

GELORA INDAH Tour & Travel











061-4576602. Terimakasih



Siap huni Uk.13x30m, SHM Lokasi Jl. Mustafa Glugur Darat Hub. 0852.6267.7735

Mari bergabung, berkembang dan meniti karir bersama kami di Aerofood ACS Medan (Garuda Indonesia Group) sebagai:

Bagi yang berminat, segera datang dengan membawa lamaran lengkap ke Bagian Personalia: Aeroffod ACS Bandara Polonia Medan Telp. (061) 453.8481 / 456.7946 dengan melampirkan: 1. Daftar Riwayat Hidup 2. Fotocopy Ijazah Terakhir 3. Fotocopy KTP yang masih berlaku 4. Pasfoto ukuran 2x3 sebanyak 3 lembar (dasar merah) 5. Fotocopy Sertifikat Penghargaan/ kecakapan lain (bila memiliki) 6. Surat keterangan dari kepolisian (SKCK)




Komplek Taman Alamanda Indah Blok D No. 19 Kel. Tj.Selamat Kec. Medan Tuntungan (Sunggal), LT. 170m², 1½ Tkt, 4 KT, 2 KM, Carport Harga Rp. 400 Jt/nego TP, No SMS Hub HP. 0812.6972.897 - 0878.9069.2662

Pelanggan Yang Terhormat

HA TI-HA TI terhadap penipuan yang HATI-HA TI-HATI mengatas namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk membeli produk anda, TI-HA TI apabila anda ingin dan HA HATI-HA TI-HATI melakukan transaksi jual beli melalui transfer.


LOWONGAN KERJA A. Sous Chef Hot Kitchen B. Sous Chef Pastry Bakery C. Cook D. Supervisor Cleaning Service E. Staff Accounting F. Chief Engineering Dengan persyaratan sebagai berikut: 1. Usia maksimum 35 tahun 2. Pendidikan minimal D III 3. Menguasai masakan Indonesia Food, western dan Chinese (A) 4. Menguasai produk pastry (bakery (B) 5. Mempunyai kemampuan memimpin yang kuat (A/ B/ D) 6. Mempunyai inisiatif, kreatif, jujur dan dapat bekerja sama 7. Menguasai kelistrikan, Tekhnik pendingin khusus chiller Freezer (F) 8. Menguasai Ms. Office (A/ B/ D/ E/ F)


KENANGA CITI HOTEL My Residence in Medan

Jl. Sisingamangaraja No. 82 Medan Telp. (061) 734.2106


Gelar terapi alat vital paling spektakuler langsung besar dan panjang di tempat no suntik/ silicon, terapi aman tanpa efek samping, asli tradisional, bebas pantangan, untuk semua usia, ras dan agama. Cukup satu kali pengobatan khasiatnya luar biasa dijamin...!!! Puas, paten dan permanen untuk selamanya Terapinya aman serta bebas pantangan, metode terapi dan teknik dasar pengurutan untuk membetulkan simpul syaraf kejantanannya disempurnakan dengan sarana supra natural/ do’a, yang sudah di pandukan melalui ramuan khusus untuk menambah keperkasaan dan juga ukuran yang diinginkan. Cukup satu kali pengobatan khasiatnya luar biasa. Dijamin joss!!! Dan keahliannya luar biasa... Langsung besar dan panjang ditempat, disesuaikan dengan ukuran yang di inginkan: panjang 15 cm diameter 3 cm, panjang 17 cm diameternya 4 cm, panjang 20 cm diameternya 5,5 cm. Sanggup melakukan hubungan secara berulang-ulang tanpa obat kuat/ doping, dijamin faten..!!!









Kami memberi bukti bukan janji, alat vital besar dan panjangditempat, no suntik, no silikon dan bukan bahan kimia, murni tradisional, ramuan alami dan Do’a, dijamin paten dan permanen tanpa ada efek samping bebas pantangan. Untuk semua usia, ras dan agama. Untuk Pria: Besar dan panjang disesuaikan dengan ukuran yang di inginkan, dijamin joss, menjadikan alat vital keras, kuat, tahan lama, menyembuhkan impotensi, ejakulasi dini, lemah syahwat, lemah karena diabetes dan mengatasi ereksi, loyo dan kurang gairah, kembali perkasa menangani bekas suntik/ silikon, mani encer, plek cur, mati total, spilis, mandul, ingin punya keturunan, dan menangani yang gagal ditempat lain. Untuk Wanita: (Bisa berdarah lagi) menghilangkan keputihan becek, bau tidak sedap, ingin menceng-kram, wangi. Buktikan disini (Bergaransi) HP. 0812.8481.8889 Alamat praktek: Jl. SM. RAJA SAMPING UISU MASUK JL. SEMPURNA 300M NO. 49 MEDAN



Setelah sukses di propinsi di Papua, kini hadir di kota Medan, pengobatan nyata luar biasa, bila anda ingin perkasa, ingat jangan salah informasi disini yang pasi ±30 menit kami akan buktikan alat vital menjadi besar dan perkasa. Dengan metode pengurutan disekitar alat vital melalui totok urat-urat kejantanan. Kami tidak mengumbar janji belaka. Tdk ada efek samping, bebas utk semua agama. Bukan janji tapi bukti ditempat Penanganan khusus pria: - Memperbesar, panjang, keras, kuat dan tahan lama - Kencing manis, diabetes, L. syahwat - Ejakulasi dini/ impotensi Khusus Wanita: - Memperbesar/ kencang payudara - Ingin punya keturunan/ gurah vagina - Ingin kembali perawan/ keputihan Konsultasi umum - Ajian semar mesem/ buka aura - Penglaris/ penghasihan/ cari jodoh - Pasang susuk, karir/ jabatan


Alamat praktek: Jl. Amaliun Gg. Santun No. 11 HP. 0821.6655.3222 - 0821.6655.1222




Menyembuhkan impotent, lemah syahwat, kencing manis, raja singa, loyo, ejakulasi dini, cepat keluar, siplis, lemah syahwat, dll, dijamin normal kembali !!! batas usia 80 thn. Terapi alat vital Bapak Haryono sudah puluhan tahun menangani keluhan pria, terapinya nyata, hasilnya luar biasa, tidak disuntik/ silicon aman tanpa efek samping, beliau pakar kenjantanan asli asal Banten. Yang paling pertama menemukan cara terapi tradisional dan hasil ditempat. Ilmunya sudah dipatenkan. Menangani bekas suntik, silicon, ingin cepat dapat keturunan, sperma encer adn menangani yang gagal dari tempat lain. ditangni secara tuntas untuk penanganan serahkan pada ahlinya bergaransi dan sudah teruji dan terbukti Khusus Umum, menangani masalah seperti menaklukkan hati melalui senyuman dan kerlingan, membuat orang yg diinginkan simpatik dan jatuh hati, membuka aura pesona kecantikan/ ketampanan anda, juga masalah rumah tangga lainnya, cepat dapat jodoh PIL/ WIL, mengembalikan keharmonisan suami istri

Alamat Praktek tetap: Jl. SM. Raja/ Yuki Simp. Raya masuk Jl. Amaliun Gg. Kesatuan No. 4 HP. 0813.7660.6663 NB. MOBIL BISA MASUK/ GARASI



Melayani berbagai macam keluhan antara lain:


- Panjang: 13 - 16 - 19 - 22 cm - Diameter: 3.5-4-4.5-5-5.5-6cm - Kuat dan tahan lama - Ejakulasi dini, sphilis/ Raja singa - Mani encer - Lemah syahwat, diabetes, impoten, dl KHUSUS WANITA: - Memperbesar, payudara, terapi perawan/ virgin, kista, lemah kandungan, kanker payudara, ingin mempunyai keturunan, dll PRIA & WANITA Ingin cepat dapat jodoh, penghasilan disegani atasan, menyatukan & memisahkan PIL/ WIL, Puter giling, juga melayani pasang susuk, dll --> Bergaransi, hasil permanen alami tanpa efek samping, langsung reaksi ditempat Alamat: Jl. SM. Raja dekat Taman Makan Pahlawan No. 130B Medan samping Show Room AUTO 2000. Dibelakang bengkel tambal ban

HP. 0813 8042 6253



Cucu Asli Mak Erot Bersama


BILA anda ingin perkasa ingat jangan sampai salah masuk carilah yang benarbenar pewaris ilmu Mak Erot Sejati, karena keahlian H. Teja Saeful sudah tidak diragukan lagi dalam menangani keluhan seputar alat vital bahkan pengobatan H. Teja Saeful, sudah terkenal Indonesia dan kota-kota besar di Indonesia, sudah ribuan pasien tertolong dipengobatan Mak Erot ini yang aman tanpa efek samping, bahkan dimanca negara sekalipun pengobatan Mak ERot sudah tidak diragukan lagi keberhasilannya. INGAT untuk Kaum Pria janga nsampai Anda terhina Kaum wanita karena kondisi alat vital yang kurang sempurna Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041 KONSULTASI UMUM: KHUSUS PRIA: - Buka Aura - Ejakulasi dini - Cari Jodoh - Impotensi - Sesama jenis - Memperbesar “Alvit” - Pelaris - Memperpanjang “Alvit” - Memikat lawan jenis - Keras dan tahan lama dll - Besar PYDR KHUSUS WANITA: - Ingin punya keturunan - Memperkencang & memperbesar payudara - Mengobati keputihan dll

DIJAMIN 100% Hanya Tempat Kami Klinik Mak Erot Jl. Laksana No. 55J masuk dari Jl. Amaliun Yuki Simpang Raya Medan (Praktek Tetap) HP. 0812.4038.333





B6 1 CM 2 CM


Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000


AUTOMOTIVE Informasi Pembaca


Bursa Automotive

: Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower


: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

CHEVROLAT Aveo Thn. 2004. Hitam, BK Mdn, lengkap, siap pakai. Bisa tukar tambah. Hrg. 80Juta/damai. Hub. 0812 65451974 DAIHATSU Feroza Th. 95. S. Edition, w. Hijau/ silver, lengkap, AC, Tape, DVD, VCD, VR, BR, C. Lock. H. 52Jt/Nego. Jl. Medan Area SLT Gg. Gelas No. 4. HP. 0812 6561 4679/TP.

DAIHATSU Sirion M/T Thn. 2008 Hitam. BK Mdn asli Rp. 115Jt. Hub. 0853 6034 8028 “HANYA BUAT PEMAKAI LANGSUNG” Daihatsu Taft GT (4x4) 1986. W. biru gelap. AC, CD, Tape, Remot, C. Lock, Free Lock. Ban - Velg Boss Baru. Body mesin gardan - Porsneling sangat bagus. (dijamin tidak kecewa). 0821 6796 5667 (Daerah Setia Budi Tj. Rejo)

DAIHATSU Taruna Dijual. Th. 2000. Warna biru, CSX. Harga 80jt. Nego. Hub. 0813 61681 655

5 CM 6 CM

Rp. 65.000 Rp. 78.000

DAIHATSU Taruna CSX Thn. 2000 W. biru/silver met. lengkap. sehat, mulus, original. Jarang pakai. Harga 86Juta. Hub. 08527060 9048 DIOVER KREDIT (BU) HONDA CRV-07. New balik DP 82Jt. Abu2 metalik, lengkap/mulus, 1 tangan dari baru. Sudah 13x bayar x 8Jt. Sisa 35bln. 8 Jt/bln. Hub. 0813 7536 3710


W. Hitam, AC, Tape, VR, BR, BK Mdn,sgt mulus, original. Sehat. Harga 77 Jt/ damai. Hub. 0813 7618 8118

ISUZU Panther Pick Up 2003. W. biru Dongker, BK Medan, aC, Tape, Balik DP 25Jt. Angsuran 2.300.000 x 24 bulan. Hub. 0812 6477 946


Cicilan 2.4Jt

SONNY - KIA. HP. 0813.8723.8734

MITSUBISHI KUDA GLS, DIESEL W. Silver thn. 2000. Kondisi mulus. Lengkap. Harga 78Jt/Nego. Hubungi 0813 7062 7371

DAIHATSU Zebra Pick Up 1.0 Thn. 89. BK Medan, pajak panjang. Kondisi siap pakai. Harga: Rp. 13Jt/ Nego. Hub. 0813 6130 1393

BUS 26 SEAT MITSUBISHI PS 120 Thn. 2006. AC Nippon Denso, Karoseri Cipta Karya, BK Medan, warna putih kombinasi. Ex Bus sekolah. Hub. 0812 648 01848

# ASTRA DAIHATSU TERBARU # Memberikan Kepuasan Pelanggan Ready : Xenia, Terios, Pick Up, Luxio, Sirion Cash/Kredit. DP Ringan, Cicilan murah, data dijemput. Hubungi Ahmad Arif. SM. Raja 0812 6005 2465 - 061.7627 7692

MITSUBISHI 100% BARU Angs Rp. 3 Jt-an...bawa Pulang L300, (Ready Stock)...Pajero, T120SS L200 Triton, Cold Diesel 74, 73 dan 71 PS. Serius Hub. 0812 653 3319 dan 081 370 765 319


MAZDA Vantrend Thn. 97 Akhir Medan asli, Velg Racing, B. Radial. Lengkap, Power Window, AC, Tape, warna hijau tua. Hub. 0853 6130 8954. Harga Nego.

New Xenia VVTi...............................DP 10 Jt-an New Terios TS....................................DP 15 Jt-an Gran Max PU & MB...........................DP 10 Jt-an Dapatkan diskon & MB...................DP 10 Jt-an Dapatkan Diskon & hadiah Hub. Gery 0813 7694 1988 / 061-77722561


DAIHATSU Espass Thn. 97/98. Rolling Door. W. Biru metalic. AC, VR, BR, sangat mulus. Bk 1 tahun lagi. Harga ( 35,5 Jt) Nego. Hub. 0821 6604 1073 DAIHATSU PAKET PROMO - New Xenia Li DP 12 Jutaan....Angs. 3 Jutaan - Terios DP 18 Jutaan...Angs. 4 Jutaan - Pick Up Gran Max DP 8 Jtaan...Angs. 2 atau 3 Jtaan - Luxio DP 6 Jutaan....Angs. 3 Jutaan. Buruan Beli, Proses Cepat & Data Dijemput Hub. TEDDY CAPELLA 0812 6325 656 / 77884663


Gran Max Pick Up DP 9 Jt-an Angs. 3 Jt-an Xenia 10 Deluxe DP 12 Jt-an Angs. 3 Jt-an Terios TS Xtra DP 18 Jt-an Angs. 4 Jt-an Luxio D DP 6 Jt’an Angs. 3 Jt-an Sirion Type D DP 8 Jt-an Angs. 4 Jt-an Hub. ERWIN HP. 0812 63154132 - 061.77402067

7 CM 8 CM

Rp. 91.000 Rp. 104.000

DEALER RESMI SUZUKI MOBIL PU 1.5 DP 4 Jt-an Angs. 3.272.000,APV GX Arena DP. 10 Jt-an Angs. 4.058.000,Splash GL DP 4 Jt-an Angs. 3.839.000,Swift ST DP 6 Jt-an Angs. 4. 484.000,SX4 DP 9 Jt-an Angs. 5.161.000,Hub. 0812 654 0809 / (061) 77722121

SUZUKI Carry MB Thn. 1988. Alexander BK Mdn Asli VR. BR. Tape, AC. Warna abuabu Met. Peminat Hub. 0821 6641 5998

SUZUKI CARRY THN. 87 Warna merah metalik, Tape, Harga 17/Nego. HP. 0813 7700 4074 SUZUKI Swift ST M/T Thn. 2008. Biru met. Plat BL Rp. 127 Jt. Hub. 0812 6477 3715

TOYOTA Kijang Jantan Thn. 91. W. Abu-abu BK Medan, Hrg. 40Jt. Net. Hub. 0813 6101 2299 TOYOTA Avanza G ‘04 BK Medan - Merah Maron. Toyota Capsul 01 Silver. mulus. BK Medan. Hub. 4142161 - 0852 9608 9687

# TOYOTA 100% BARU # Avanza DP 21Jt-an....Innova, Yaris, Fortuner, Vios Bunga Ringan Hub. 061-7787 5227 atau 0815 304 2382

TOYOTA Rush Type G Thn. 2007. Warna merah maron tangan pertama. Plat Medan Hrg. Nett. 163Jt. Hub. HP. 0853 60411 733 (Arpan)

MERCY C 180 M/T Thn. 97. Hitam, BK Mdn asli, BPKB Duplikat Rp. 70Jt. Hub. 0852 7538 3218

TOYOTA Kijang Innova E Tahun 2008, Cat Silver Metalik, Harga 163 Juta Nego. Hubungi Damiyadi. Tel. 061-77524343 atau 8364140



9 CM Rp. 126.000 10 CM Rp. 140.000

11 CM Rp. 165.000 12 CM Rp. 180.000

silahkan hubungi kami di

061-4576602. Terimakasih

DIJUAL AVANZA G 2007 T.P. Hitam met, mulus, BK Mdn, 1 tgn dari baru. Ext.2010, hrg Rp. 133 Jt. Hub. 0812 6085 310, 061-7790 3717

KIRIM MOBIL MED AN OKT MED AN MEDAN MEDAN Melayani semua kendaraan mobil. Ekonomis, Aman & Terjamin. 061-77771067 - 0813 7562 6150 - 0878 6953 3882. Medan - JKT. Perunit Mobil Rp. 3,5 Jt.

TOYOTA SE Salon 1986. Mulus/ sehat/Original. Lengkap/Nego. Hub. 0811 645 957 (TP) - 061.77721957


TOYOTA Kijang LSX Tahun 2002 wrn biru. Mika BK Medan, sangat mulus. Siap pakai. Hub. 0813 9610 1939 TOYOTA Kijang Jantan Long 88/ 89. W. Hijau M, VLR, Jok kulit. Power ST, AC, S. Lock, H. 33Jt. K. HOBART. HP. 0813 6134 1261 TOYOTA Corona, Ex Salon ‘86. Silver, asli Mdn. Pjk panjang. AC Dingin, PS, PW, CL, VR, BR, Cat mulus. Rp. 22,5Jt/ Nego. Serius. HP. 0852 6014 7507

New Grand Livina, New Nissan March, X-trail, Nissan Terano, sudah bisa dipesan El Grand. DP rendah + Bunga ringan + Cash Back Hub. 0852 7033 7739 (Mili) 061.7532 0709

Ready: Avanza, Innova, Fortuner, Altis, Vios, Yaris. Full Cash Back. Full Hadiah. Hub. Budi 0821 6060 4998 / 061-69699882

TOYOTA Kijang LSX Diesel Thn. 97. W. Merah, BK Medan. Siap pakai. Hrg. 90Jt. Net. Hub. 0813 6101 2299

Dapatkan Nissan Ready Stock Plus cash back menarik. Grand Livina, X Trail, March, Serena DP 10 %. Kredit hingga 5 tahun. Hub. ICHSAN 0852 9693 2711


T. Altis Thn. 2001 Hitam, Mls, Ex Cewek. Kembali DP 55 Jt. Sudah Bayar 14 bln. Sisa 34 bln per bulan 2.879.000. Hub. 0821 684 70222 Ibu Novy

TOYOTA Kijang Commando 93/94. Long Asli Medan, AC, TP, VR, D. Sedan, 5 Speed. W. Abu2 tua. Cat asli Rp. 58 Jt. Nego. Hub. 0813 6084 0653 Khs. Pakai.

OPEL Blazer ‘97. W. silver, orisinil, BK Medan, cantik, mulus, lengkap, siap pakai. H. 49Jt Nego. Hub. 0812 6477 946

TOYOTA Kijang Thn. 1984. Minibus, Mesin halus, cat, mulus, body kaleng, sudah model Kijang Jantan. Jok kulit, VR, BR (Kondisi 85%). BK Medan asli. Tinggal pakai. Harga Rp. 24 Juta/damai. Hub. HP. 0816 3131 312

TOYOTA Kijang Super Th. 1988. W. Hitam metalic, 6 speed Medan, asli. H. 35Jt. Nego. HP. 0813 7031 0953


RENTAL MOBIL MURAH 1 Hari Rp. 250.000. Hubungi: 061 664 77734, 0852 9616 6601. Maaf Tanpa Perantara.


SEPEDA MOTOR KAWASAKI Ninja Thn. 2006. Mulus sekali, w. hitam. Udah Krum semua, cocok untuk anak muda. H. 16.500.000 Net, Garang dipakai. Hub. 0812 6477 946

YAMAHA Jupiter MX Thn. 2007 Dijual Cepat. Velg, warna merah silver mulus. Kondisi sehat. Harga Rp. 7 Juta Nego. Hub. 0852 7630 3879

HONDA GL Pro Neo Tech 97 Dijual. Kondisi Mesin Sehat (Standart) Body Mulus. Dijamin Puas. Harga Rp. 9 Jt. (Khusus Bagi yang Serius). Hub. 0813 7546 5222

SUZUKI Smash Thn. 2005. Warna hitam, kondisi sehat, mulus. Harga Rp. 3,7 Juta Nego. Hub. 0853 6093 5632





BUTUH DANA Jaminan Apa Saja. Sertifikat Tanah Mobil & Sp. Motor. Segala tahun. Hub. 061.8222 774 HP. 0816.314.1807


Telah tercecer Asli Surat Keterangan sebagai pedagang No. 329 L. Terbuka a/n. NURAISYAH SITOMPUL dan No. 332 L. TErbuka a/n. AMIRIL MUKMININ SIMATUPANG Pasar Desa Lalang Medan disekitar Jalan Klambir V


BPKB Sp. Motor Suzuki no: 2456816 BK 2427 AMI a/n. SYAHDAN alamat Jl. Gurilla no: 1 Medan yang menemukan mohon dikembalikan.



BPKB Sp. Motor Yamaha BK 3148 IT a/n. Chairil alamat Jl. HM. Yamin Gg. Obat No. 23. Medan. yang menemukan mohon dikembalikan.


BPKB Mobpen Honda/CR-V BK 388 SY a/n. SYAMSINAR alamat Jl. Bukit Barisan II no: 49-A Medan yang menemukan mohon dikembalikan.


TERCECER Surat Pernyataan Melepaskan. Hak atas tanah No. 593.83/340/Mdn/2001. a/n. IR. R. HARAHAP/ AINAH. Tgl. 14 Juni 2001. Antara Jl. Jermal Ujung XV s/d Jl. Jend. A.H. Nasution Tgl. 20/02/2011

1 Hari Cair Bunga Rendah, Dan Terjamin (Dlm/Luar Kota). Spesialis Leasing BPKB Mobil, Truk, Spd. Mtr. Terima Mobil yang masih kredit, over leasing. Dan Bantu Pelunasan BPKB. Hub. S8F Finance 061-8445716 - 0813 7044 6633








Jual AC Baru/Bekas, 1/2, 3/4, 1,1 1/2, 2Pk-1,3Jt-2 Jt. Kulkas 1 Pt - 2 Pt=600rb- 1,2Jt. 2 Pt -Jumbo - 2 Jt. Prejer 5 rak = 1,2Jt, 5 rak SOCES 1,5Jt. M. Cuci 1 Tb- 2 Tb= 600rb1,2 Jt. M. Cuci Baru= 2,2 Jt (1 tb 9 kg). Genset 3000 w. 2,5Jt. 8.000w= 4,5jt, Stabilizer 3000 watt, Pompa Air.


TV LCD LG 42” P. Sonic= 7Jt. Samsung= 5Jt. 32”LCD LG Samsung =3Jt. 42” LCD P. Sony Wega=4,5Jt, 42” Toshiba= 3Jt, 29” Flat Baru LG=2,1Jt, 29” Bekas 1 Jt1,7Jt. 14-21=300rb - 650rb. 17” LCD Monitor 1Jt, 22”=1,5jt, PSP 1,4Jt . PS1=400rb, PS 2=800rb - DVD Cina 200rb, Ampli / Mixer/spk BMB/DVD Portable = 700rb

LAPTOP, HANDYCAM, CAMERA, PROJECTOR, HDD Handicam Sorry Hi-8=1Jt, Mini DV=2Jt, DVD/HDD=3Jt, Camera 5 Mp - 12 Mp 500rb - 1,2Jt. Printer=600rb. LCD Projector Acer/Toshiba=3Jt.


Hub. 4517509 - 69677449 - 7680 4949, Jl. Sekip 67 A (Jual & Beli)


KOMPUTER Tv Lcd baru=1,1Jt, Tv LCD 32”=3 Jt. * Tv 29” LG + Hom = Thr 5 spk=2 Jt Camera Pulpen Dgital = 599rb, - Cctv 279rb - Mesin Fotocopy color New + Prin canon = 779rb - Projector @ 2,5Jt Komputr P4 + 17” LG 1 Jt (P4 + Lcd 1.3Jt) ( LCD=595rb) Ps2=775 Latop 1.9Jt (Warnet: cas/krdit) Tel. 6999-7936. Jl. Rantang 20s


ALAT MUSIK KEYBOARD & PIANO Keyboard Technick KN-7000 Kondisi 85% Plus Rp. 25Jt. Piano Yamah Clavinova LVP - 405 Rp. 18 Jt. Hub. CV. MARKET. Telp. 7632 4682 0812 6539 3000



Isi Freon - Cuci - Perbaikan Bkr Pasang dan Spare Parts AC - KULKAS - MESIN CUCI Hub.061-7797 2065 0813 6149 7921




Servis Kulkas, M. Cuci. Hub. MANDIRI TEKNIK 061-7676 4660 0812 6557 521





REPARASI AC, KULKAS, MESIN CUCI Kompor Gas, Dispenser H & C TV, M. Pompa Air Sanyo

Hub. SURYA TEKNIK SERVICE Telp.66482216 - 0813 7589 8757- 0812 1671 84742 Siap Ketempat


Cuci AC, Isi Obat/Freon Bongkar Pasang AC Hub. 0813 7536 4412


7767 7220



HP. 0812 6053 690 7352833 0812 6064 9333





Hadiah Parking Sensor + Kaca Film Solar Gard Kredit 1 s/d 4 tahun Bisa Tukar Tambah


Hubungi Dealer



JL. JEND. G. SUBROTO 18-20 Depan Air Mancur Petisah Tel. 4522619 - 4146757 MEDAN

TERCECER 1 (Satu) Buah BPKB Asli. STNK BK 3830 UF a/n. JONNY TJA. Alamat Jl. Gn. Krakatau No. A3 B Medan. TERCECER Telah tercecer Asli Surat Keterangan sebagai pedagang No. 331. Terbuka a/n. EVA SARTIKA SEMBIRING. Pasar Desa Lalang Medan disekitar Jalan Klambir V

DANA EXPRESS SHM, SK Camat 1 Hari Clear 0813 6229 0001 0812 6095 5531 (Henrik)


Mesin 1500cc, 6 Piston, 2 Karburator, Hitam Metalic, Mewah, Full music, Full Accesories. STNK a/n. Pembeli 2016, Siap Touring Hubungi: 0813 96891 700

Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput


Pelanggan Yang Terhormat

Segala akibat yang terjadi diluar tanggujawab PT. Harian WASPADA. Apabila anda mencurigai sesuatu,


IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

HA TI-HA TI terhadap penipuan yang HATI-HA TI-HATI mengatas namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk membeli produk anda, TI-HA TI apabila anda ingin dan HA HATI-HA TI-HATI melakukan transaksi jual beli melalui transfer.

Jumat, 8 April 2011

Surat Izin Pemakaian Tempat Berjualan No. 511.3/2411/SIHS/ PDPKM/2010. Psr. Sambas Medan. an. TEN KIM LENG

HILANG Sertifikat Rumah a/n. NOVA RIZKI HUSIN, yang bertempat di Jl. Azalea I No. 88D. Comp. Cemara Asri. Luas 120M2.

1 (Satu) SK Tanah Lurah. a/n. SULAIMAN Lokasi. Gang Onto Kesumo. Jl. Kilang Padi dalam. Lk. 27 Kel. Tanjung Mulia. Kec. Medan Deli Medan.


Satu BPKB Sepeda Motor, BK 3254 IK Honda / NF 125 TR. Thn. 2008. a/n. IRAWATI. Jl. Gajah Mada dlm 66 Mdn. No. Rangka: MHI JB91178 K191520 TERCECER Surat Tanah dibuat diatas kertas segel tahun 1970. Pada tgl. 12 Februari 2011. An. MAMPE TA M B U N . Ya n g t e r l e t a k d i HAPOLTAHAN Dsn 17 Kec. Desa Sei Banban, Kec. Sei Banban, Kab. Serdang Bedagai. Seluas +/- 3206 M2. Tercecer disekitar Desa Sinar Sabungan Kec. Lumban Julu Kab. To b a S a m s o s i r . B a g i y a n g menemukan antar ke Balai Desa Sei Bamban, akan diberikan hadiah sepantasnya.


Surat Tanah yang dikeluarkan Notaris Paijan SH. Tgl. 31-88-1992. Nomor 274/1992. Sebidang Tanah terletak di Kec. Tj. Beringin Kab. Serdang Bedagai Desa Sukajadi Luas +/- 20.000M. Yang tercecer disekitar Tj. Morawa. Pada tgl. 26 Januari 2011. An. R.S. Selamet. Bagi yang menemukan antar ke Balai Desa Sei Bamban. Akan diberi hadiah sepantasnya.



Ekonomi & Bisnis


BI Larang Citibank Himpun Dana Besar JAKARTA (Waspada): Bank Indonesia (BI) melarang sementara waktu penghimpunan dana nasabah kaya Citibank melalui produk Citigold. Langkah itu merupakan prosedur standar dilakukan BI jika terdapat produk perbankan bermasalah. Menur ut Kepala Biro Humas BI Difi A Johansyah, prosedur standar BI itu dilakukan untuk melakukan cease and desist order (CDO). CDO adalah perintah dikeluarkan otoritas perbankan untuk melakukan pembinaan terhadap bank guna perbaikan terhadap kegiatan operasionalnya, setelah melakukan pertimbangan berbagai pihak. Hal itu dilakukan agar pemeriksaan kasus tersebut bisa lebih fokus. “Pada saat Citibank melaporkan ke BI, kami larang Citibank menggaet nasabah Citigold,” ujar dia di Jakarta, Kamis (7/4). BI, menurut Difi, mempercepat pemeriksaan terhadap bank asing terbesar itu. Namun, BI tidak bisa memeriksa rekening nasabah bermasalah, karena itu merupakan hak aparat hukum serta Pusat Pelaporan

dan Analisis Transaksi Keuangan (PPATK). BI pun memeriksa pengawasan internal dan manajemen risiko Citibank. Meski demikian, dia tidak bisa mengatakan hingga kapan penghentian penghimpunan nasabah baru Citigold itu. “Jangan terlalu lama juga. Ini dilakukan untuk konsolidasi terkait keperluan pemeriksaan, sehingga tidak meluas” ujarnya. Seperti diketahui, dalam Rapat Kerja BI dengan Komisi XI, Gubernur BI Darmin Nasution mengatakan timbulnya permasalahan di Citibank terutama dipicu tidak diterapkannya pengawasan internal yang baik. Hal itu tercermin dari tidak adanya supervisi atasan, tidak dijalankannya proses rotasi karyawan, dan tidak terdapat proses konfirmasi kepada nasabah. Peluang terjadinya fraud semakin terbuka dengan adanya kepercayaan nasabah kepada petugas bank berlebihan. Hal itu ditunjukkan nasabah dengan menyerahkan formulir kosong untuk transfer/pindah buku/tarik tunai telah ditandatangani. Terhadap penyimpangan tersebut, BI melakukan melakukan beberapa tindakan supervisi, antara lain memanggil chief country officer dan pejabat terkait, dan menyampaikan surat pembinaan kepada bank untuk menyelesaikan masalah tersebut. “BI juga melakukan perbaikan internal kontrol bank

dengan menghentikan penghimpunan nasabah baru citigold,” kata Darmin. Sorotan terhadap Citibank mencuat setelah adanya laporan mengenai dugaan penggelapan dana nasabah sekitar Rp17 miliar oleh mantan Relationship Manager Citibank, Inong Malinda atau Melinda Dee. Dia diduga mengaburkan transaksi dan pencatatan tidak benar terhadap slip transfer penarikan dana pada beberapa rekening nasabahnya. Bank Indonesia (BI) menya t a k a n a k a n m e re vi si beberapa ketentuan, terutama peraturan-peraturan berkaitan dengan kartu kredit. BI juga mengingatkan pentingnya edukasi pada masyarakat, kalau kartu kredit bukan sebagai pendapatan melainkan utang. Direktur Penelitian dan Peraturan BI, Wimboh Santoso mengatakan BI telah mengatur tentang penggunaan jasa penagihan, yakni ada di Peraturan BI No 11, terakhir direvisi tahun 2009. Intinya, ialah dalam melakukan kerja sama dengan pihak ketiga untuk penagihan kartu kredit. “Ya, nanti kita lihat. Perlu direview beberapa ketentuan, terutama peraturan-peraturan berkaitan dengan kartu kredit,” kata Wimboh di Hotel Borobudur, Kamis (7/4). Wimboh menuturkan, mengenai tenaga outsourching direkrut pihak perbankan,

pertama, harus ada perjanjian formal antara bank dengan pihak lain tersebut dan pihak lain ini berupa perusahaan. Di situ juga diatur oleh pihak ketiga, ialah kartu kredit boleh ditagih oleh pihak ketiga ialah kalau kartu kredit yang kolektibilitasnya diragukan dan macet. “Dalam melakukan penagihan, pihak lain tersebut harus tidak boleh bertentangan dengan peraturan perundang-undangan yang ada. Dan semua harus ada dalam koridor,” ujar Wimboh. Cara penagihannya, dia mengatakan, dilakukan dengan cara sama dengan cara pena-gihan yang dilakukan bank. Dan ketentuannya, apabila ada hal-hal di lapangan tidak sesuai, bank yang harus bertanggung jawab. Wimboh juga menghimbau, agar bank dapat lebih hatihati lagi mengenai peraturanperaturan yang terkait approval dengan kartu kredit. “Jangan sampai masyarakat pola konsumtifnya terlalu tinggi karena credit card. Jika pendapatannya tidak cukup, jangan kasih plafon tinggi,” kata dia. BI juga mengingatkan bahwa edukasi kepada masyarakat pemakai kartu kredit penting. “Karena kartu kredit, bukan pendapatan melainkan utang yang harus dibayar. Tentunya, rule of the game juga memang harus tahu, bahwa nantinya ada suku bunga dan lain sebagainya,” kata Wimboh. (vvn)

68 Ribu Ton Beras Impor Antri Masuk Belawan MEDAN (Waspada): Pemerintah telah memutuskan mencabut izin impor beras terhitung akhir Maret 2011, seiring dengan diberlakukan keputusan itu, sebanyak 68 ribu ton lebih beras luar negeri antri masuk Pelabuhan Belawan. Wakil Menteri Pertanian Bayu Krisnamurthi dalam kunjungan kerja ke Sumut di gudang Bulog Divre Sumut baru baru ini menjelaskan pemerintah memutuskan untuk mengakhiri impor beras karena sudah terpenuhi dari datangnya masa panen raya di dalam negeri . Selain itu Bayu juga menjelaskan, kebijakan pengimporan beras merupakan keputusan untuk menambah stok pangan nasional yang tidak dapat terpenuhi akibat terjadinya kegagalan panen seiring dengan datangnya musim yang tidak mendukung peningkatan produksi padi di tanah air. Sejak pemerintah mengeluarkan kebijakan mengimpor beras dari luar negeri, stok pangan nasional sudah cukup banyak kini telah mencapai 1,6 juta ton. Dari jumlah ini pemerintah menilai stok pangan saat

ini sudah cukup sehingga tidak perlu untuk mengimpor lagi. Pemerintah selanjutnya mengeluarkan keputusan untuk menyetok pengimporan beras terhitung sejak 31 Maret 2011, Sehingga secara nasional sejak saat itu tidak ada lagi impor beras masuk ke seluruh daerah d i t a n a h a i r, j e l a s B a y u Krisnamurthi. Namun kenyataannya menjelang keputusan pemerintah itu diberlakukan terlihat Rabu (7/4), tendensi pengimporan beras khususnya ke kawasan Sumatera Utara melalui Pelabuhan Belawan mengalami peningkatan cukup tajam, seolah olah terkesan pengimporan didrop secara besar besaran sebelum izin impor di tutup. Pemerhati masalah sosial di Belawan M Adnan Noor mengakui adanya kesan seperti itu, karena jumlah kapal masuk ke pelabuhan pintu gerbang ekonomi terbesar kawasan Sumatera itu terlihat seperti menderu dalam kurun waktu singkat. Akibatnya terlihat kapal pengangkut beras dalam jumlah cukup banyak antri di perairan Lampu I, pintu masuk

kolam pelabuhan. Sebagai masyarakat Sumut, M Adnan Noor mengharapkan kapal kapal pengangkut kebutuhan makan sehari hari masyarakat daerah ini tidak mengalami kendala baik saat menunggu di perairan Lampu I merupakan kawasan Selat Malaka hingga selesai membongkar muatannya, karena jumlahnya cukup banyak. Sementara itu data prarencana penyandaran kapal yang dikeluarkan Pelabuhan Cabang Belawan PT Pelabuhan Indonesia I (Persero) terlihat, jumlah kapal yang antri menunggu izin sandar di dermaga pelabuhan memang terlihat banyak, tidak seperti biasanya. Dalam data itu tercantum ada sembilan unit kapal bermuatan beras impor dari luar negeri. Kondisi kapal pengangkut beras milik Negara (Bulog) ini sudah terkatung katung (lego jangkar) di perairan Lampu I sejak awal Maret 2011, namun karena jumlahnya cukup banyak tidak semua kapal terlayani untuk sandar di dermaga yang juga melayani kapal kapal muatan barang lainnya. Kapal

yang belum mendapat izin sandar terpaksa bersabar terkatung katung di perairan pintu alur hingga mencapai setengah bulan lamanya. Dalam daftar laporan muatan kapal dari pihak agen pelayaran kepada petugas Pusat Pelayanan Satu Atap Pelabuhan Belawan terdata jumlah beras hasil pertanian luar negeri dimuat di sembilan kapal itu sangat banyak diperkirakan mencapai 68.000 ton lebih. Kepala Perum Bulog Divre Sumut Muchtar Saad dalam penjelasannya saat menerima kunjungan wakil menteri pertanian membenarkan jumlah stok beras impor yang tersimpan di gudangnya sudah cukup banyak bahkan bisa menyangga beras hingga akhir tahun ini. Menurut Muchtar, berdasarkan perhitungan hingga 26 Maret, jumlah stok beras di gudang Perum Bulog Divre Sumut telah mencapai 99.021 ton dan jumlah ini akan semankin bertambah banyak jumlahnya karena masih ada beberapa kapal pengangkut beras impor akan memasuki Pelabuhan Belawan. (m35)

16.800 Ton Daging Impor Masuk Sumut MEDAN (Waspada) : Untuk memenuhi kebutuhan konsumsi daging di Sumatera Utara hingga Maret 2011, sebanyak 16. 800 ton daging impor dari Australia masuk Sumatera Utara diantaranya daging sapi, bebek, tulang, dan jeroan. Kabid Budidaya Dinas Peternakan Sumut Sudirman Pulungan di Medan, Kamis (7/ 4) menyatakan meski sebanyak 16.800 ton daging impor dari Australia memenuhi pasar lokal namun hal tersebut dirasakan masih minim. “Untuk jumlah telah disesuaikan dengan rekomendasi pemerintah pusat untuk dilakukan impor sebagai penutup kekurangan dari produksi daging lokal. Dan tentunya importir tidak bisa lebih dari ditetapkan,” ujarnya. Untuk daging impor yang telah masuk tersebut, lanjutnya, berasal dari perusahaan importir PT Sukanda Djaya hingga Maret 2011 sebanyak 16.610 ton daging. Sedangkan realisasi pengiriman daging impor dari perusahaan tersebut ditahun 2010 sebanyak 48.976 ton. Kemudian dari perusahaan UD Multi Jaya Abadi mengirim daging bebek impor sebanyak 72 ton dan PT Mujuras ADHB sebanyak 118.367 kg untuk daging, tulang dan jeroan. Sementara untuk sapi ternak impor hingga sekarang, dikatakan Sudirman belum ada yang masuk dari tiga perusahaan impor yakni PT Lembu Andalas Langkat yang tahun lalu telah mengirim sebanyak 12.056 ekor dari rekomendasi diberikan sekitar 19.400 ekor, PT Agro Giri Perkasa tahun 2010 telah merealisasikan pengiriman 17.119 ekor dari rekomendasi 21.000 ekor dan PT Eldira Fauna yang juga telah mengirim seba-

nyak 6.570 ekor dari rekomendasi 9.000 ekor sapi. Serta PT Agro Culture Farm sebanyak 685 ekor dari rekomendasi 3.000 ekor. “Empat perusahaan importir tersebut belum ada mengirim sapi impor ke Sumut. Tapi surat rekomendasi nya sudah ada, jadi tinggal menunggu waktu masuknya saja. Untuk PT Lembu Andalas Langkat tahun lalu sebanyak 35% atau 4.380 ekor dikirim memenuhi kebutuhan konsumsi di Aceh,” kata Sudirman. Dikatakannya, saat ini sasaran populasi ternak di Sumut tahun 2011 yakni mencakup sapi potong sebanyak 423.936 ekor atau naik dari tahun lalu sebanyak 412.670 ton. Sapi perah sebanyak 2.898 ekor dan naik dari sebelumnya 2.642 ekor. Untuk ternak kerbau sebanyak 159.281 ekor dan juga mengalami kenaikan dari tahun 2010 sebanyak 158.741 ekor. Ternak kambing sebanyak 681.706 ekor atau naik dari sebelumnya 653.101 ekor serta ternak itik sebanyak 2.101.702 ekor. Sedangkan sasaran -daging ditahun 2011, untuk sapi ternak sebanyak 14.936 ton, daging kerbau sebanyak 5.725 ton, kambing 2.887 ton dan itik sebanyak 1.118 ton. “Ini sasaran produksi ternak dan daging di Sumut. Upaya peningkatan jumlah ini dilakukan dengan berbagai program seperti sarjana masuk desa, lembaga masyarakat mandiri, bantuan langsung masyarakat serta penyebaran ternak dari propinsi ke daerah berpotensial,” jelasnya. Tahun ini, memang pihaknya mentargetkan penambahan populasi sapi sebanyak 15 persen akan diperoleh dari bantuan-bantuan pemerintah

di Kabupaten Deli Serdang, Langkat, Kisaran dan Kabupaten Simalungun. Menurut Sudirman, impor daging memang masih terus dilakukan karena kebutuhan masih belum cukup yakni berkisar 215 ekor perhari pemotongan. Jadi, kalau tidak dibantu dengan sapi impor, maka semua populasi sapi lokal akan habis dan program swasembada daging 2014 terkendala untuk dicapai. Apalagi, dalam mengembangkan sektor peternakan memerlukan investasi besar. Men-

dapatkan bibit sapi berkualitas saja bisa mencapai Rp50 juta per ekor dan itupun menampakkan hasil dalam proses yang lama sekitar lima tahun. “Swasembada daging bukan berarti Indonesia tidak lagi mengimpor sapi dari luar negeri. Namun angka dikurangi yakni hanya berkisar 30 persen saja dengan kualitas nomor satu untuk memenuhi kebutuhan wisatawan di Indonesia. Kalau Indonesia sudah bisa memenuhi kebutuhan 70 persen saja, maka itu sudah swasembada,” tuturnya. (m38)

Humbahas Canangkan Penanaman Durian Monthong DOLOKSANGGUL (Waspada): Bupati Humbang Hasundutan (Humbahas) canangkan penanaman pohon durian jenis monthong di desa Aek Godang Aerban - Kecamatan Onan Ganjang, Rabu (6/4) diikuti berbagai elemen masyarakat setempat. Pencanangan itu ditandai dengan penanaman perdana bibit pohon durian monthong oleh Bupati Humbahas Maddin Sihombing, Sekdakab Martuaman S Silalahi, Ketua Tim Penggerak PKK Humbahas Rosma Napitupulu dipandu Jhon Harlen Sitompul, Dinas Pertanian Humbahas dan Bupati LIRA Humbahas Lundu Maranala Lumbanbatu. Bupati Humbahas menyebutkan prospek durian monthong di daerah PAPATAR (Pakkat, Parlilitan dan Tarabintang) dan sebagian Kecamatan Onan Ganjang sangat menjanjikan. “Jika tanaman ini dibudidayakan, akan dapat mendongkrak perekonomian masyarakat ataupun petani desa. Hanya saja

para petani perlu mempedomani cara bercocok tanam yang benar. Semua tanaman harus dirawat sehingga pada waktunya dapat membuahkan hasil yang memadai,” ujar Maddin. Dia katakan, ujicoba penanaman pohon durian jenis monthong dan budidaya tanaman holtikultura lainnya di Humbahas merupakan bagian dari program di sektor pertanian. Kedepan semua lahan tidur yang ada harus kita olah menjadi lahan pertanian produktif. Karenanya, kita berupaya untuk membangun infrastruktur jalan ke sentrasentra pertanian didaerah ini. “Saya mengajak masyarakat agar menanamkan budaya kerja keras. Hanya dengana kerja keras kita dapat memanfaatkan potensi yang ada di kabupaten ini,”ujar Bupati. Jhon Harlen Sitompul menjelaskan, durian monthong itu berasal dari Thailand yang merupakan tanaman genjah dan mampu berproduksi umur 4 – 5 tahun. (a21)

WASPADA Jumat 8 April 2011

BNI Komit Biayai Industri Sumut MEDAN (Waspada): Bank Negara Indonesia (BNI) siap menyalurkan pembiayaan kepada 5 sektor industri unggulan yang ada di Sumatera Utara (Sumut). Kelimanya adalah industri pengolahan nonmigas, perdagangan besar dan eceran, perkebunan, bangunan/konstruksi dan pengangkutan. Direktur Utama (Dirut) PT BNI Tbk, Gatot M Suwondo, mengatakan hal itu dalam Seminar BNI Region Economic Outlook 2011 dengan tema Prospek Potensi Daerah dan Strategi Pembiayaan BNI Tahun 2011, di Medan, Kamis (7/4). Gatot mengatakan, kelima sektor industri unggulan Sumut ditetapkan setelah BNI melakukan riset pemetaan industri unggulan dan di anggap potensial dibiayai. “BNI berkomitmen memberikan pembiayaan kepada industri-industri potensial serta mengembangkan value chain business model untuk melakukan pengembangan bisnis dan penetrasi ke dalam industri,” jelasnya. Pemerintah, tuturnya, juga telah menetapkan wilayahwilayah di Indonesia menjadi enam koridor ekonomi, yakni koridor ekonomi Sumatera, Jawa, Kalimantan, SulawesiMaluku Utara, Bali - Nusa Tenggara dan Papua-Maluku. Untuk koridor Sumatera akan difokuskan menjadi sentra produksi dan pengolahan hasil bumi serta lumbung energi nasional. Koridor Jawa sebagai pendorong industri dan jasa nasional. Koridor Kalimantan pusat produksi,pengolahan hasil tambang dan lumbung energi nasional. Koridor Sulawesi-Maluku Utara sebagai pusat produksi dan pengolahan hasil pertanian,perkebunan, serta perikanan nasional. Koridor Bali-Nusa Tenggara sebagai pintu gerbang pariwisata nasional dan pendukung pangan nasional. Serta koridor

Waspada/Armin Nasution

SEMINAR BNI Region Economic Outlook 2011 dengan tema Prospek Potensi Daerah dan Strategi Pembiayaan BNI 2011 di Medan yang dihadiri berbagai kalangan kemarin. Papua-Maluku sebagai pengolahan sumber daya alam yang melimpah. Namun, kunci keberhasilan tersebut tergantung kepada pembangunan dan pengembangan 3 bidang utama infrastruktur primer, yakni infrastruktur dasar mencakup ketersediaan sarana transportasi udara (bandar udara), darat (jalan raya, jalan tol) dan laut (pelabuhan laut) yang memadai. Kemudian infrastruktur kelistrikan yang sangat dibutuhkan untuk mendukung pengembangan industri agar bisa bekerja pada level kapasitas produksi optimal dan infrastruktur telekomunikasi untuk memudahkan komunikasi antar daerah dan antarpulau. “Untuk itu BNI siap mendukung program pemerintah dalam memajukan perekonomian nasional dengan prioritas

dan fokus utama BNI adalah pembiayaan pembangunan infrastruktur,” jelasnya. Pemimpin BI Medan Nasser Atorf mengatakan hingga Desember 2010, perbankan di Sumut telah menyalurkan kredit hingga Rp88,55 triliun. Nilai tersebut meningkat di akhir Februari 2011 yang mencapai Rp 91,05 triliun. Terdiri dari kredit modal kerja Rp 46,77 triliun, kredit investasi Rp Rp 1 8 , 4 2 t r i l i u n d a n k re d i t konsumsi Rp 25,86 triliun. Infrastruktur Dalam seminar tersebut Wakil Ketua Umum Bidang Investasi dan Kerjasama Ekonomi Internasional Kadin Sumut, Jonner Napitupulu mengatakan, meskipun perekonomian Sumut di tahun ini tetap tumbuh, namun diperlukan kebijakan atau terobosan untuk menciptakan

iklim investasi yang kondusif dan peningkatan kualitas infrastruktur. Untuk mendukung kondusifitas iklim investasi itu, perlu dihilangkan berbagai penyebab ekonomi biaya tinggi. Seperti birokrasi yang belum efisien dan efektif, pelaksanaan one stop service perizinan, ketidakpastian hukum, ketenagakerjaan, infrastruktur dan percepatan pengesahan tata ruang dan UU Pembebasan Lahan. Pengamat Ekonomi asal Sumut Jhon Tafbu Ritonga mengatakan, berbagai komoditas ekspor Aceh dan Sumut dibutuhkan banyak negara. Hal ini akan mendorong terciptanya pertumbuhan ekonomi sehingga menjadi peluang bagi perbankan akibat adanya pertumbuhan kemampuan menabung dan permintaan pinjaman. (m06)

PLTH Dibangun Di Taput Harga Beras Mulai Normal Di Pidie TARUTUNG (waspada): Untuk ketersediaan Energi Listrik di PT PLN untuk menutupi keterbatasan listrik di Sumut, khususnya di wilayah Taput, pemerintah bersama BUMN dan BUMD telah banyak membuat terobosan baru melalaui pembangunan pembangkit listrik baru. Sejalan dengan program ketersedian arus listrik tersebut, tahun 2011 ini dua pembangkit listrik berkapasitas 2x5.00 MW akan dibangun di Taput. Demikian disampaikan oleh Sekdakab Taput Sanggam Hutagalung, pada acara pembahasan pembangunan dua proyek PLTM berkekuatan 2x5.00 MW di gedung balai data atas Pemkab Taput, Rabu 6/4 dihadiri oleh masyarakat, pimpinan instansi, asisten II Setdakab O Silalahi, pihak pemrakarsa proyek dan konsultan. Kedua proyek pembangkit listrik tersebut masing-masing Batangtoru-3 Pearaja, kecamatan Pahae Julu, kab. Taput sebesar 2x5.00 MW, oleh PT. Berkah Alam Lestari Energi (BALE). Batangtoru -4 Pearaja, kecamatan Pahae Julu,kab. Taput, berkapasitas 2x5.00 MW,

oleh PT Indah Alam Lestari Energi (IALE). Luas areal pembangunan dua perusahaan pembangkit listrik berkapasitas kecil tersebut sekira 35 ha. Pihak PT BALE dan IALE dalam forum tersebut dihadapan puluhan peserta rapat mengatakan kontrak PT dengan masyarakat selama 25 tahun dan seterusnya proyek akan diserahkan kepada memerintah daerah untuk dikelola. Menurut mereka, langkah awal pembangunan PLTM yang sudah dilaksanakan dan terpenuhi yakni ijin prinsip dari Bupati Taput, Ijin lokasi PLTMH Ijin pembebasan lahan, upaya pemantauan lingkungan, upaya pengelolaan lingkungan. Dijadwalkan proyek tersebut harus sudah terlaksana tahun 2012 dan siap operasi. Kakan Lingdup Pemkab Taput, selaku ketua mediator pembangunan proyek tersebut Ipen Hutagalung, SH Rabu 6/ 4 kepada Waspada, mengatakan kesiapan pemerintah menyambut pembangunan pembangkit listrik tersebut. Pemkab bersama masyarakat agar benarbenar memberikan pandangan positif untuk mendukung program tersebut, katanya. (c12)

Harga Terong Belanda Di Berastagi Naik BERASTAGI (Waspada) : Harga buah di Berastagi berangsur mulai naik, terutama buah terong Belanda dari harga semula Rp12 ribu menjadi Rp16 ribu per kg. Kenaikan harga tersebut disebabkan petani Kabupaten Tanah Karo berangsur memasuki habis buah (terck). Pasca kenaikan harga tersebut diakui sejumlah pedagang pasar buah di kota Berastagi, namun sejumlah pedagang mengakui kalau buah mungil berwarna merah kehitaman tersebut terasa mulai naik memasuki bulan April ini. Disusul dengan buah kelapa yang naik menjadi Rp35.00 per buah dari harga sebelumnya Rp2000. “Atas kenaikan buah simungil (Terong Belanda), dapat dimaklumi sejumlah pedagang yang selalu menawarkan kepada wisatawan saat berkunjung ke daerah sejuk. Kenaikan harga tersebut disebabkan petani mulai mengalami musim treck,” terang Lina br Manulang

kepada Waspada, Rabu (6/4) di pasar buah Berastagi. Sementara untuk harga buah lainnya masih tetap bertahan, seperti strawberry per bungkus kecil Rp10 ribu, jeruk Rp12 ribu per kg. Apel malang Rp18 ribu per kg hingga Rp22 ribu. Begitu juga dengan harga buah lainnya. Kenaikan harga tersebut juga disusul dengan kelangkahan buah kelapa oleh sejumlah pedagang di pasar Berastagi. Menurut pedagang pemasok buah berasal dari Kabupaten Deli Serdang jarang masuk ke Tanah Karo. Sehingga mengakibatkan kenaikan harga yang ditawarkan sejumlah pedagang kepada pembeli. Hingga sampai saat ini harga kelapa per bijinya mencapai Rp35.00 sampai Rp5000 tergantung besar dan kecilnya buah. Dari harga sebelumnya Rp25.00 hingga Rp4000 per biji. (c19)

MEUREUDU (Waspada): Harga beras secara berangsur terus menurun menyusul panen raya sebulan terakhir. Saat ini harga jual sudah normal di kisaran Rp100.000 per sak (15 kg) dari sebelumnya Rp150.000 per kg. “Saat ini semua daerah memasuki musim panen raya. Makanya harga beras sudah kembali ke harga normal,” kata Zakaria, pedagang di Beureunuen, Kab. Pidie kepada Waspada, Kamis (7/4). Dia sebutkan saat ini harga beras berbagai jenis dan merek terus mengalami penurunan, rata-rata antara Rp20.000 hingga Rp30.000 per sak (15 kg), tergantung jenis/merek dan daerah asal beras. Untuk beras lokal cap Rajawali, asal Blang Bintang dan jenis lainnya yang sebelumnya dijual Rp130.000 per sak menjadi Rp110.000, beras cap rantang dari Rp130.000 menjadi Rp115.000.

BI Sosialisasi Tindak Pidana Perbankan KOTA LHOKSEUMAWE (Waspada): Zulfan Nukman, Pemimpin Bank Indonesia (BI) Lhokseumawe, Kamis (7/4) kepada Waspada mengatakan, selama tiga bulan pertama 2011, telah berkali-kali terjadinya kejahatan perbankan, yakni bobolnya rekening nasabah Citibank dan berbagai kasus lainnya di tingkat nasional maupun Aceh. Agar tindak kejahatan dapat dihilangkan di dunia perbankan, Bank Indonesia (BI) Lhokseumawe, Kamis (7/4) menggelar kegiatan sosialisasi tindak pidana perbankan (Tipibank) diikuti oleh seluruh perbankan yang ada di wilayah kerja BI Lhokseumawe. Kegiatan tersebut berlangsung di Aula BI setempat. “Kasus-kasus kejahatan tersebut telah menyudutkan perbankan dan terus menggerogoti kredibilitas perbankan. Dalam tiga bulan ini terdapat beberapa pengaduan nasabah, mulai dari penyalahgunaan kredit, sengketa angunan kredit, pemblokiran rekening yang berujung pada somasi, uang

Harga Emas Di Medan Jenis

Kadar 99%





24 Karat

90 s/d 93%


Emas Putih

75 %

22 Karat




20 s/d 35%


yang diduga palsu. Kondisi ini membuat kami perihatin. Akhir-akhir ini jumlah kasus terus meningkat,” kata Zulfan Nukman prihatin. Diingatkan kembali, perbankan adalah industri yang sebagian besar sumber dana berasal dari masyarakat dan industri ini mengandalkan basis kepercayaan masyarakat. Karena itu, BI sangat serius dalam memberikan pengawasan dan perlindungan nasabah. Harusnya, bank memiliki internal control seperti GCG, manajemen resiko, anti money laundering. Karena itu harus dipahami, pertahanan pertama terhadap kemungkinan terburuk berada ditangan bank. “Tentunya semua pertahanan dibuat bank akan menjadi tidak berarti jika terdapat kolusi, baik sesama pegawai bank dan nasabah atau melibatkan orang di luar pegawai bank dan nasabah. Selain itu juga terjadinya penyalahgunaan wewenang petugas bank, kelemahan SOP, kelalaian dan kurang kehati-hatian,” kata Zulfan menegaskan. (cmun)

Valuta Asing Di Medan


London Murni

Selain harga beras, juga harga gabah mengalami penurunan drastis. Menurut petani, harga gabah kering panen ke agen hanya Rp2.800 hingga Rp3.000 per kg. Sebelumnya Rp3.400 sampai Rp3.500. Dia katakan akibat merosotnya harga penjualan gabah membuat petani kehilangan semangat mengikuti musim tanam padi berikutnya. Menurut petani, anjuran Kepala Badan Ketahanan Pangan dan Penyuluhan (BKPP) Provinsi Aceh Salman Ishak menganjurkan petani menyimpan padi untuk cadangan konsumsi itu sangat baik dan tepat. Tetapi bagi petani sulit untuk menerapkannya. Sebelumnya, Salman Ishak mengatakan, salah satu upaya agar krisis pangan (beras) teratasi, masyarakat harus membiasakan diri menyimpan p a d i ( g a b a h - re d ) u n t u k cadangan keluarga masa tiga bulan.(b21)

Rp310.000 (m38)

Mata Uang



Dolar AS Dolar Australia Franc Swiss Poundsterling Inggris Dolar Hongkong Yen Jepang Dolar Singapura Euro Ringgit Malaysia

9.140 8.226 8.620 14.068 1.169 104,50 6.679 11.825 2.870

8.890 8.054 8.454 13.783 1.148 101,50 6.445 11.063 2.800


WASPADA Jumat 8 April 2011


Antisipasi Aliran Sesat, Bupati Abdya Keluarkan Surat Edaran BLANGPIDIE (Waspada): Rentannya penyusupan serta peredaran aliran yang menyimpang dari akidah Islam yang saat ini mulai marak di Aceh, dinilai harus ditangani secara serius. Aceh Barat Daya (Abdya) merupakan salah satu daerah yang juga dinilai rentan dan berpotensi masuknya pemahaman dan ajaran yang menyimpang dari akidah Islam tersebut. Terhadap permasalahan ini, Bupati Akmal Ibrahim, SH menginstruksikan Dinas Syariat Islam Abdya agar melakukan upaya menghidupkan kembali pengajian di masjid dan meunasah seluruh kecamatan dan desa. “Pak Bupati sudah mengeluarkan surat edaran tersebut,” ungkap Kepala Dinas Syariat Islam Abdya, Drs. H. Marnus, dalam temupers kepada wartawan di Balai PWI Abdya, Rabu (6/4). Dilanjutkan Marnus, Surat Edaran Bupati Abdya no: SE.450/222/2011 kepada seluruh Camat mencantumkan empat (4) butir poin

utama berisi tentang pengawasan, pelarangan dan tindakan tegas terhadap adanya upaya penyimpangan akidah. Kemudian melakukan koordinasi dengan aparat penegak hukum serta melakukan pembinaan kembali terhadap warga masyarakat dengan menghidupkan majelis taklim serta pengajian agama pada setiap mesjid dan meunasah. “Surat edaran Bupati tersebut upaya antisipasi maraknya berbagai penyimpangan terhadap akidah yang saat ini terjadi di Aceh. Seperti aliran Millata Abraham serta beberapa aliran lainnya dengan pemahaman yang bertolak belakang dengan akidah islam. Kita dari Dinas Syariat Islam berinisiatif dan berkewajiban melakukan pengawasan terhadap pengaruh tersebut melibatkan masyarakat secara aktif. Namun demikian sejauh ini di Abdya masih belum kita dapatkan adanya informasi terhadap penyimpangan maupun ajaran sesat tersebut,” ujar Kepala Dinas Syariat Islam Abdya.(sdp)

Mayat Ditemukan Di Sungai SUBULUSSALAM (Waspada): Jajaran Polres Aceh Singkil bersama sejumlah warga menemukan sesosok mayat terapung di alur sungai Kota Subulussalam, Selasa (5/4) petang. Mayat itu kemudian dievakuasi ke Puskesmas Penanggalan untuk visum. Kapolres Aceh Singkil AKBP Helmi Kwarta melalui Kapolsek Penanggalan Iptu Detis Mayer Silitonga, Selasa (5/4) malam, di Puskesmas Penanggalan bersama Plt. Camat Penanggalan Yudi Mulyanto, SH mengatakan, mayat itu ditemukan warga saat memancing di Lae Kombih. “Kita mendapat laporan dari warga pegawai PDAM, Suhadi sekira pukul 16:30 saat memancing,” terang Detis. Razia Kace Terkait penemuan mayat tersebut, Kapolsek Iptu Detis, Rabu (6/4) menyebut telah memeriksa seorang saksi, Santi, 25, pelayan kafé di Dusun Buluh Didi Desa Tanjung Mulia Kec. Sitellu Tali Urang Jehe (STTUJ) Kab. Pakpak Bharat, sekira 23 km dari Kota Subulussalam. Korban Lutfi Afandi Harahap, 39, penduduk Desa Kelapa Gading Kec. Bambel, Aceh Tenggara dikabarkan pernah bermukim

di Blok VI Kec. Gunung Meriah, Aceh Singkil. Dari keterangan saksi, sebut Detis, Sabtu (3/4) sekitar pukul 23:00 korban yang telah dikenal saksi dikabarkan datang dari Rimo Kec. Gunung Meriah, Aceh Singkil mengendarai mobil. Sesampai di Buluh Didi, korban mampir di kafe tempat saksi bekerja. Korban memesan kopi. Namun saat itu terdengar isu ada razia di kafé, menyebabkan pengunjung termasuk korban lari menyelamatkan diri seperti ke gunung dan ke bawah (baca: seputaran arus sungai). Setelah kondisi aman semua pelanggan kembali ke café, kecuali korban. Saksi mengaku sempat melakukan pencarian, namun tidak berhasil. Tiga hari kemudian, korban akhirnya ditemukan warga, Selasa (5/4) sore telah menjadi mayat. Polisi belum dapat menyimpulkan motif kematian korban karena masih dalam penyelidikan. ”Kalau keluarga korban keberatan, kita akan lakukan otopsi untuk proses penyelidikan dan tetap berkoordinasi dengan kepolisian Pakpak Bharat,” kata Iptu Detis.(b33)

H.M. Arsyad Sundusin, SH Ketua PN Banda Aceh BANDA ACEH (Waspada): Ketua Pengadilan Tinggi Banda Aceh Hj. Rooslya Hambali, SH atas nama Ketua Mahkamah Agung RI melantik dan mengambil sumpah H. Muhammad Arsyad Sundusin, SH selaku Ketua Pengadilan Negeri Banda Aceh. Pelantikan Ketua PN Banda Aceh yang berlangsung di ruang utama sidang PN Banda Aceh, Kamis (7/4), sesuai Surat Keputusan Mahkamah Agung RI No.02/Dju/SK/Kp.04.5/ II/2011, tertanggal 21 Februari 2011, yang ditandatangani Direktur Pembinaan Tenaga Teknis Peradilan Umum Ny. Siti Nurdjanah, SH, MH. H. Muhammad Arsyad Sundusin, SH dilantik sebagai Ketua PN Banda Aceh menggantikan Abdul Fattah, SH, MH yang kini telah dipromosi sebagai hakim tinggi di Pengadilan Tinggi Pekan Baru beberapa waktu lalu. Bersamaan itu, usai pelantikan M. Arsyad Sundusin dilanjutkan dengan pelantikan dan pengambilan sumpah Wakil Ketua Pengadilan Negeri Banda Aceh. Wakil Ketua Pengadilan Negeri Banda Aceh H. Taswir, SH, MH dilantik dan diambil

sumpah oleh Ketua PN Banda Aceh. Sebelum menjabatWakil Ketua PN Banda Aceh H. Taswir, SH, MH menjabatWakil Ketua Pengadilan Negeri Gresik. Ketua Pengadilan Tinggi Banda Aceh Hj. Rooslya Hambali, SH dalam arahan singkatnya meminta kepada pejabat yang baru dilantik, ini dapat memberikan peran yang lebih besar dalam membangun peradilan khususnya di PN Banda Aceh ini. Prosesi pelantikan Ketua dan Wakil Ketua Pengadilan Negeri Banda Aceh berlangsung meriah. Kedua pejabat hukum ini sebelumnya dipeusijuk dengan cara adat oleh Majelis Adat Aceh Kota Banda Aceh. Dalam acara itu juga disuguhkan berbagai macam tarian khas Aceh. Turut hadir dalam proses pelantikan tersebut, Walikota Banda Aceh, Kapoltabes Banda Aceh, Dandim 0101/AB, Ketua Mahkamah Syar’iyah Kota Banda Aceh, Ketua MPU Banda Aceh, Ketua PTUN Banda Aceh, para Ketua PN seluruh Aceh, para hakim di Aceh, kalangan advokad di Aceh dan ratusan undangan lainnya. (b06)

Waspada/Muhammad Hanafiah

Hj. Dewi Budiarti Teruna J. Said, aktivis lingkungan hidup dari Waspada Green didampingi Lora Hendra DS dan Lina Tengku Tam serta kader-kader Partai Golkar pada acara penjelasan tentang pentingnya memelihara lingkungan hidup, khususnya persoalan menyangkut bank sampah dan daur ulang sampah yang berlangsung di Sekretariat DPD Partai Golkar Kabupaten Aceh Tamiang, Kamis (7/4).

Lahan Diserobot, Warga Kecam Pemegang HGU NAGANRAYA (Waspada): Ratusan Kepala Keluarga (KK) dari desa Kaye Uno, Kecamatan Darul Makmur, NaganRaya, mengecam sikap perusahaan pemegang Hak Guna Usaha (HGU) perkebunan kelapa sawit yang dituding telah menyerobot lahan milik mereka. Akibatnya, ratusan warga kini terancam kehilangan pekerjaan. Selain itu, sikap perusahaan yang menyerobot secara sepihak juga dinilai terlalu arogan. Sikap itu disinyalir karena adanya ‘backing’ dari pihak tertentu terhadap perusahaan. “Kita sangat sayangkan sikap perusahaan yang terkesan arogan seperti itu, saat ini malah perusahaan sudah mensuplai pekerja ke lapangan, sehingga

seluruh tanaman milik warga yang sebelumnya mengolah lahan di sana saat ini sudah diobrak-abrik, kondisi seperti ini jelas kita sesalkan,” ungkap Zakaria, salah seorang aktifis LSM di Nagan Raya yang menghubungi Waspada, Kamis (7/4). Lokasi yang saat ini mulai ‘memanas’ akibat konflik lahan itu berlokasi di Desa Kaye Uno, Pulo Kruet hingga ke seluruh kawasanTripa di Kemukiman Seuneuam, dua perusahaan pemegang HGU yaitu PT. AAL dan PT. GSM yang dituding melakukan penyerobotan di sana, terkesan tak menghargai hak milik warga yang mengklaim telah memiliki dan mengolah lahan di areal yang dipersengketakan itu sejak puluhan tahun lalu. Bahkan upaya dialog yang sempat dilakukan perusahaan beberapa waktu lalu hingga kini masih belum ditemukan kata kesepakatan yang dianggap bisa diterima kedua pihak (perusahaan dan masyarakat).

Lahan Milik Rakyat Camat Darul Makmur, H.Effendi, yang dihubungi Waspada terkait permasalahan itu juga mengungkapkan keheranannya atas sikap perusahaan yang dinilai terlalu arogan. Dia yakini lahan yang dipersengketakan perusahaan dan warga di kawasan Tripa, khususnya daerah Desa Kayee Uno itu memang milik masyarakat. Fakta itu diungkapkan Camat Darul Makmur dengan adanya beberapa titik lokasi pedesaan yang sudah sejak lama berada di sana dan sempat dilakukan perubahan ketika munculnya konflik di Aceh. Begitu pun dia memastikan lokasi itu milik masyarakat, sehingga perusahaan yang baru memegang izin HGU sejak belasan tahun lalu itu semestinya mengukur ulang lokasi agar tak merugikan masyarakat. “Di sana sudah ada desa sejak lama yang bernama Kayee Uno, di lokasi itu bisa kita lihat

Kapolda Kunjungi Simeulue SIMEULUE (Waspada): Meski terlambat sekira 40 menit dari jadwal Kamis (7/4) siang, Kapolda Aceh Irjen Iskandar Hasan dan Nyonya serta rombongan tiba di pulau itu. Kapolres Simeulue AKBP. Drs. Parluatan Siregar kepada Waspada beberapa hari lalu menginformasikan Kapolda akan berada di Simeulue hingga, Minggu (10/4). Dalam kunjungan kerja di pulau itu, jenderal bintang dua tersebut dijadwalkan melakukan sejumlah rangkaian kegiatan. Diantaranya, penyuluhan Harkanbtibmas, silaturahmi dengan tokoh masyarakat peninjauan Personil Mapolres, Mapolsek, dan acara penyerahan bantuan ke beberapa fakir miskin dan anak yatim serta melakukan perobatan missal. Kemudian peresmian sebuah masjid, panen perdana padi di KecamtanTeluk Dalam. Terakhir melepas atlet lari-K 10 KM purta dan putri memperebutkan piala bergilir Kapolda Aceh Iskandar Hasan serta uang pembinaan. Pantauan Waspada di lapangan, Kapolda Aceh yang melakukan kunjungan kerja dengan masa waktu cukup spesial, tiga hari empat malam disambut suka cita Muspida dan masyarakat setempat. Selain beberapa hari sebelumnya masyarakat di sana bergotong

royong membersihkan lingkungan masingmasing. Saat Kapolda tiba di Bandara Lasikin, nyaris seluruh petinggi Muspida plus Simeulue menyambut kedatangan petinggi polisi itu. Diantaranya Bupati Darmili, Wakil Bupati, Sekda, sementara dari legislatif, ketua, wakil ketua dan para anggota serta Dandim Letkol Inf. Tono dan Nyonya. Kemudian Ketua Pengadilan Negeri Sinabang, Endang Makmun,SH. Ketua Majelis Adat Aceh (MAA) Kabupaten Simeulue, Jailani. Kajari Sinabang, diwakili Deddy, SH. Kakadepag Simeulue, Dra. Mirati Ibnu Aban mewakili Ketua Mahkama Syariah Sinabang dan sejumlah tokoh masyarakat Simeulue lainnya. Saat mengunjungi Mapolres, Kapolda disambut disambut dengan tarian gelombang dan budaya Simeulue, Rangkul. Hingga berita ini dikirim ke redaksi dijadwalkan Kapolda diantaranya temu ramah dengan semua lapisan di gedung DPRK Simeulue sekitar pukul 00:14 WIB. Sementara hari ini, Jum’at (8/4) sebagaimana undangan Bupati Darmili yang diterima Waspada, Kapolda akan melakukan sejumlah agenda kerja termasuk satu agenda selingan panen perdana padi di Teluk Dalam. (cmr)

jejak dan fakta tentang keberadaan desa lama, seperti tanaman besar yang sudah ditanam sejak puluhan tahun,” jelas H. Effendi, Camat Darul Makmur. Pihak perusahaan pemegang HGU dari PT. GSM melalui manajernya Ari Susanto, ketika dihubungi Waspada sempat membantah. Dia menyebutkan, di lahan itu tidak ada permasalahan dengan pihak perusahaan. Tetapi menurutnya, di lokasi itu hanya masuk HGU dari PT. SPS II. Namun ketika Waspada menyebutkan Desa Kayee Uno yang juga dipertegas dengan statemen Camat Darul Makmur, sudah menjadi lahan garapan masyarakat sejak puluhan tahun lalu, Manajer GSM Ari Susanto langsung menutup pembicaraan dengan menyebutkan alasan saat ini sedang rapat.“Tak ada kita (GSM) di situ pak, di sana PT. SPS II. Mohon maaf ya, saya sedang rapat,” elak Ari Susanto. Penelusuran Waspada ke kawasan itu beberapa waktu lalu sempat menemukan bebe-

rapa persoalan yang muncul dan kini mulai mencuat akibat keberadaan HGU. Selain timbulnya konflik lahan antara masyarakat dan pemegang HGU, beberapa lokasi rawa Tripa yang masuk ke dalam Kawasan Ekosistem Leuser (KEL) juga ditemukan kerusakan yang cukup parah, areal hutan gambut di kawasan itu, kini telah berubah menjadi areal perkebunan kelapa sawit. Akibatnya, beberapa desa di seputar areal Tripa kini menjadi langganan banjir. Bahkan beberapa waktu lalu sempat merendam kawasan tersebut selama beberapa hari yang menyebabkan belasan KK harus mengungsi. “Kita menuntut pihak pemerintah agar meninjau ulang dan menutup HGU, karena masyarakat selama ini menjadi korban akibat keberadaan HGU tersebut, selain perusakan alam yang juga sangat parah, jika terus dibiarkan, maka tak mustahil rawa Tripa ini akan hilang,” keluh Ibduh, Keucik Sumber Bakti.(sdp)

Penyair Nasional Pukau Warga Bireuen


Kawasan hutan gambut di kawasan rawa Tripa terlihat rusak parah akibat penebangan yang dilakukan aktivitas pembukaan lahan kelapa sawit milik perusahaan pemegang HGU di sana. Tampak beberapa tanaman di sana tumbang setelah ditebang, bahkan sempat menimbulkan asap besar akibat pembakaran yang dilakukan para pekerja di lokasi tersebut. Foto direkam beberapa waktu lalu.

BIREUEN (Waspada): Penyair nasional Fikar W. Eda bersama sejumlah penyair Aceh lainnya, Rabu (6/4) malam tampil membaca puisi-puisinya di caffe Beng Kupi pada pergelaran seni yang bertitel ‘Bireuen Dalam Puisi’ hingga membuat pengunjung terpukau. Tak hanya warga yang menikmati lantunan puisi itu, namun sejumlah tokoh masyarakat Bireuen, Mustafa A. Glanggang, Amiruddin Idris, dan Dandim 0111/Bireuen, Letkol Inf Reza Pahlevi juga terlihat memberikan aplaus ketika Fikar W. Eda akan beranjak turun dari panggung. Pada acara yang diselenggarakan Fokus-PB, Ceurana Aceh Instituts, Beng Kupi, Pemda Bireuen itu, turut disaksikan Bupati Bireuen, Nurdin Abdul Rahman, serta sejumlah kepala dinas lainnya. Selain Fikar W.Eda, penyair nasional yang tampil yakni LK-Ara, Hasbi Burman (Presiden Rex). Sementara sejumlah penyair lokal yang tampil Sujiman A Musa, Mustafa A Glanggang, Arif Andepa, Razuardi Ibrahim. Di sela-sela kegiatannya, Ketua Fokus-PB, Said Fajri, SH antara lain mengatakan, kegiatan itu bertujuan menggalakkan kesenian di kalangan masyarakat dan generasi muda terutama seni puisi. “Jadi ajang ini juga sebagai unjuk kebolehan para senima kita di Bireuen,” papar Said Fajri, SH. (cb03)

Pemkab Abdya Fungsikan Ratusan Ha Lahan Terlantar

Waspada/Muhammad Rapyan

BEBERAPA anggota DPRK Simeulue, mulai dari kanan Ketua Komisi D, M. Andi, Sekretaris Komisi C, Rahmad SH, Ketua BK DPRK Simeulue, Sardinsyah dan sejumlah pejabat Simeulue lainnya tampak menyambut Kapolda Irjen Iskandar Hasan dengan didampingi Kapolres AKBP Parluatan Siregar di Bandara Lasikin, Sinabang, Kamis (7/4).

BLANGPIDIE (Waspada): Tim Terpadu Pengelolaan Pembangunan Daerah Terlantar dan Pesisir (T2PPDTP) Aceh Barat Daya (Abdya) yang dibentuk Bupati Akmal Ibrahim sebulan lalu, menemukan fakta banyaknya lahan terlantar dan rusak paska gempa dan tsunami Aceh sejak 2004. Selain itu ketiadaan saluran irigasi dan rusaknya drainase yang sudah ada membuat ratusan hektar lahan di beberapa kecamatan dan kawasan pesisir Abdya tidak dapat dimanfaatkan. Ketua T2PPDTP Abdya, Lukman, SE yang dihubungi Waspada, Kamis (7/4) mengungkapkan, hasil temuan di lapangan menunjukkan ada 300 ha lahan terlantar dan rusak yang hingga kini belum bisa dimanfaatkan. Kondisi tersebut menyebabkan perekonomian masyarakat khususnya di

daerah pesisir ikut terpengaruh. Terhadap kondisi tersebut T2PPDTP menyiapkan beberapa program sehingga permasalahan lahan terlantar dan rusak di Abdya dapat segera teratasi. “Kita menemukan ratusan hektar lahan tidak bisa digarap dan dimanfaatkan masyarakat. Padahal lahan tersebut bisa menjadi aset untuk mendongkrak ekonomi masyarakat. Permasalahan utama lahan tersebut terlantar, akibat ketiadaan saluran irigasi dan sumber air. Beberapa saluran irigasi yang ada juga rusak parah sehingga tidak lagi berfungsi, seperti di Kec. Manggeng, kita harus membuat drainase baru hingga mencapai 2 km. Dengan kondisi seperti ini kita sangat berharap Pemerintah Provinsi Aceh dapat membantu dan memberi dukungan sehingga bisa memulihkan kembali lahan yang rusak dan terlantar,” jelas

Lukman. Sementara Kepala Dinas Pertanian dan Peternakan Abdya, H. Zainuddin, SP juga menyebut, permasalahan ini lebih diakibatkan karena faktor ketiadaan saluran irigasi serta sumber air yang masih sangat minim. Padahal lahan tersebut sempat produktif sebelum terjadinya bencana Gempa Tsunami Aceh beberapa tahun lalu. Namun demikian Pemkab Abdya melalui dinas pertanian bersama T2PPDTP melakukan upaya rehabilitasi serta penggarapan kembali lahan tersebut sehingga bisa produktif. Tercatat ada 300 ha lahan terlantar mulai diupayakan pemulihan dengan membangun beberapa saluran irigasi baru. Tapi proses itu dipastikan mengalami hambatan karena minimnya alokasi dana yang dimiliki Pemkab Abdya sehingga dibutuhkan dukungan provinsi.(sdp)


BUPATI Abdya Akmal Ibrahim yang populer dengan program Adu Carong (Acong) selama ini dikenal sangat fokus mengembangkan kawasan pertanian di Abdya. Terlihat ketika Bupati Akmal Ibrahim turun langsung ke lapangan meninjau kondisi persawahan yang dikembangkan dengan pola ‘Acong’ di Kec. Manggeng.



WASPADA Jumat 8 April 2011

Masyarakat Kecewa Penalti Dana DAU Pemkab Bireuen Rp120 M

Pemko Sabang Bantu Korban Kebakaran SABANG (Waspada): Pemko Sabang melalui dinas terkait menyerahkan bantuan masa panik bagi korban kebakaran di Jalan Untung Soropati Jurong (Lingkungan) M. Thaib Gampong Kuta Ateuh, Kec. Sukakarya, Sabang. Kabag Humas‘Pemko Sabang Reza Ferdian, Rabu (6/4) mengatakan, bantuan masa panik itu berupa peralatan dapur, makanan ringan dan sejumlah uang diterima Anima, 43, dan Anggi, 26, sebagai pemilik rumah. Bantuan merupakan wujud kepedulian pemerintah daerah dan diharap dapat membantu meringankan beban para korban.(b29)

Erosi Krueng Preumbeu Kian Parah, Dua Rumah Ambruk MEULABOH (Waspada): Erosi Krueng (sungai) Peurembeu di Desa Puuk Kec. Kaway XVI, Aceh Barat semakin mengganas dan mengancam sejumlah bangunan. Pantauan Waspada, hingga Kamis (7/2), erosi Krueng Preuembeu mengakibatkan dua rumah warga ambruk dan masuk sungai. Erosi juga mengancam bangunan masjid karena terkikis derasnya aliran sungai Peureumbeu dan mengancam badan jalan menghubungkan Meulaboh-Geumpang (Pidie). Samsudin, 30, warga Pu’uk mengatakan tanggul pengaman yang dibangun pemerintah beberapa tahun lalu untuk mencegah rubuhnya bangunan di sekitar Krueng Peureumbeu tak mampu menahan erosi. “Memang tujuan awal itu, tapi tanggulnya juga ikut rubuh sekarang. Padahal baru tahun lalu dibangun, tapi pembangunan tak sesuai kondisi sungai,” katanya. Selain tak sesuai kondisi sungai, kata Samsudin, tanggul yang dibangun terkesan asal-asalan sehingga tak berfungsi baik. Dikatakan, sebagian besar warga Peureumbeu dengan jumlah 65 Kepala Keluarga kini cemas. “Sekarang erosi semakin mendekati perkampungan, kalau batang kelapa memang sudah banyak yang tumbang. dua rumah itu ambruk saat banjir dan hanya meninggalkan bekas,” ujarnya.(cak)

Hendak Diselundupkan Ke Medan 25 Ton Minah Bersubsidi Ditangkap PEUDAWA, Aceh Timur (Waspada): Setelah akhir tahun lalu, jajaran Kepolisian Resort Aceh Timur, kembali mengamankan 25 ton minyak tanah (minah) bersubsidi di lintasan jelan negara persisnya di kawasan Paya Gajah, Kecamatan Peureulak Barat, Rabu (6/4) sekira pukul 02:50 dinihari. “25 Ton minah bersubsidi ini ditangkap saat hendak diselundupkan ke Medan, Sumatera Utara, dengan menggunakan satu truk tanki Mitsubishi Hercules BK 8642 LO berwarna merah hijau,” ungkap Kapolres Aceh Timur, AKBP Drs Ridwan Usman kepada Waspada, Kamis (7/4) di Idi. Menurut Ridwan Usman, sebelum truk pengangkut minah bersubsidi itu ditangkap, polisi sempat terjadi kejar-kejaran, disebabkan truk tanki berisi minah hendak kabur dan mengelabui petugas. Namun setelah diperiksa kelengkapan dokumennya, ternyata 25 ton minah itu tidak memiliki dokumen. Dalam penangkapan kali ini, sambung Ridwan Usman, polisi juga mengamankan seorang sopir berinisial, Suk Bin Km, 40, bersama rekannya DT, 51. Keduanya tercatat penduduk asal Tandem Hulu, Kabupaten Binjai, Sumatera Utara. Keduanya kini diamankan di Mapolres, guna pemeriksaan lebih lanjut. Ridwan Usman didampingi Kasat Reskrimnya, AKP Priyo Utomo, SH, S.Ik, mengatakan, penangkapan itu berawal dari informasi masyarakat dan kecurigaan polisi, saat melihat mobil yang sedang melintas di kawasan jalan negara Medan-Banda Aceh, dini hari. Berdasarkan informasi dan kecurigaan itu, sambung Ridwan Usman, polisi membuntuti dan mengejar mobil guna dilakukan pemberhentian. “Pada saat kita hentikan dan kita tanya sopir yang selanjutnya kita periksa, ternyata berisi sekitar 25 ton minyak tanah bersubsidi yang hendak diselundupkan ke Medan,” katanya. Berdasarkan penyelidikan sementara, lanjut Ridwan Usman, minyak tanah itu berasal dari Kec. Matang Geulumpang Dua (Bireuen) dan akan dibawa ke Medan (Sumatera Utara) yakni ke kawasan Marelan. “Untuk sementara kita akan amankan dan selanjutnya akan diselidiki,” kata Kapolres Ridwan Usman seraya menandaskan, pihaknya mengharapkan masyarakat menginformasikan jika mengetahui adanya penimbunan dan penyelundupan minah bersubsidi.(cmad)

Waspada/Muhammad H. Ishak

BERBAHAYA Pedagang keliling sedang membawa barang dagangannya di lintasan jalan negara Medan – Banda Aceh, persisnya di kawasan Tanoh Anoe Idi Rayeuk, Aceh Timur, Kamis (7/4). Meski berbahaya terhadap pengguna jalan lainnya, namun kondisi tersebut sudah sering terjadi dan tidak penertiban dari instansi terkait.

Warga Sergai Ditangkap Di Jambo Aye PANTONLABU, Aceh Utara (Waspada): SA, 54, asal Desa Gunung Kataran Dusun I, Tebing Tinggi, Kecamatan Gunung Kataran, Kabupaten Serdang Bedagei, Sumatera Utara, ditangkap aparat Polsek Tanah Jambo Aye, Aceh Utara, Jumat (1/4) petang. Lelaki itu diciduk di salah satu rumah warga di Desa Geulumpang Umpueng Unoe, Kec. Tanah Jambo Aye, atas sangkaan melakukan penipuan berkedok iuran koperasi fiktif. Total uang yang berhasil dikumpulkan SA dikabarkan senilai Rp1,5 juta. “Target utama SA masyarakat desa pedalaman. Dia menawarkan kredit lunak dari koperasi, mulai Rp1 juta hingga Rp10 juta. Namun sebelum kredit itu keluar, calon penerima kredit dimintai uang Rp300 ribu dengan dalih biaya pendaftaran. Karena kredit tak kunjung cair, para korban curiga dan melaporkan kasus ini ke polisi,” kata Kapolres Aceh Utara AKBP Farid BE melalui Kapolsek Tanah Jambo Aye, Iptu Mardan P, kemarin. Didampingi Kanit Reskrimnya Brigadir Zunaidi, Kapolsek menambahkan, jumlah korban penipuan yang dilakukan SA diduga mencapai belasan orang. Namun yang sudah membuat pengaduan resmi ke Mapolsek baru lima orang, yakni Basri, 40, H. Marzuki, 58, Saipuddin, 48, Adi, 35 dan Saipundin, 40, kelimanya warga Desa Geulumpang Umpung Unoe. “Para korban mengaku seperti dihipnotis. Meski baru sekali jumpa, mereka langsung percaya seolah sudah kenal lama dengan pelaku. Para korban baru merasa linglung dan bingung, setelah pelaku pergi. Untungnya, pelaku kembali lagi dan berhasil kita tangkap,” tandas Kapolsek.(cmus)

Waspada/Muhammad Riza

BEBERAPA bocah korban banjir bandang Tansge di Desa Rantau Panyang terlihat sedang menyelamatkan barang -barang bekas terjangan banjir beberapa waktu lalu. Foto direkam Rabu (6/4).

Sukseskan UN Anggaran Digeser SUBULUSSALAM (Waspada): Menyadari kalau Ujian Nasional (UN) menjadi persoalan penting dan strategis, forum sepakat menggeser sejumlah plot anggaran di lingkungan Disdik Budpora ke dalam ujian negara (UN). Hal itu terungkap dalam sidang dengar pendapat jajaran Dinas Pendidikan Kebudayaan Pemuda dan Olahraga (Disdik Budpora) dan para kepala SMA/ MA/SMK se-Kota Subulussalam dengan Ketua Komisi D H. Ansari Idrus Sambo dan anggota Ir. HM Sugito, Asisten I H. Rusdi Hasan, S.IP, SH, Kadis PPKKD Drs. H. Salbunis, MAP, Kadis Disdikbudpora Nuryahat, S.Pd, Kepala MPD Tgk Maskum dan Ketua ICMI Orda Subulussalam dr. H. Syahyuril. Kesepakatan ini juga tak terlepas dari keluhan hampir selu-

ruh kepala sekolah terkait anggaran dan sejumlah persoalan UN, saat sidang dengar pendapat digelar. Seperti yang disampaikan Kadis Dikbudpora, kalau kontribusi pemerintah terhadap UN dinilai cukup memadai dengan adanya BOS, dana operasional UN di tingkat SLTA kecil, bahkan sepekan menjelang UN (18/4-red), dana belum cair. Karenanya pemerintah daerah disugesti untuk peduli dengan persoalan UN. Demikian Ketua Komisi D DPRK Subulussalam H Ansari Idrus Sambo menjawab Waspada, Kamis (7/4) terkait kesimpulan akhir sidang dengar pendapat, Rabu (6/4) di Gedung Pertemuan DPRK setempat. “Persoalan UN adalah persoalan nasional, sukses UN menjadi salah satu indikator keberhasilan siswa dan daerah sehingga semua pihak diminta serius mensukseskannya,” terang Ansari. Dikatakan, subsidi dengan standar Rp200ribu/siswa

digunakan untuk semua hal yang berkaitan dengan UN, seperti pembayaran honor guru pembimbing les, try out, re-medial, hari H UN dan sebagainya, diharapkan dapat lebih memotivasi siswa dan guru. Menjawab sumber anggaran untuk itu, H Ansari menyebutkan, tetap dari anggaran dinas terkait yang telah diplotkan sebelumnya. “Karena mendesak dan penting, demi suksesnya UN dinas terkait diminta menggeser mata anggaran tertentu kepada kepentingan UN sebagai prioritas,” sebut Ansari yang pra kesepakatan itu telah ditempuh jalur musyawarah dengan jajaran Pemko Subulussalampadasidangdengar pendapat di sana, Rabu lalu. Seperti yang disampaikan Drs. Sahmudin, M.Sc, Kepala SMAN Simpang Kiri, UN 2011 amat berat. Karenanya, ada sejumlah tahapan yang harus dilaksanakan dan membutuhkan banyak anggaran. Bagi para

guru yang bidang studinya diUN-kan, terang Sahmudin, diberikan pelatihan prediksi soal-soal untuk menganalisa standar potensi kelulusan, remedial (penambahan jam belajar-red), try out I, pengayaan dan try out II sampai akhirnya siswa siap menghadapi UN. Menyoal besarnya anggaran pendidikan, Kepala SMA Unggul Subulussalam,Sukri,S.Pdmenilai kalauperanorangtuasiswasangat diperlukan sehingga DPRK disarankan membuat qanun. Lalu, biaya operasional standar Rp92ribu/siswa/bulan menjadi salah satu indikator yang perlu mendapat perhatian dari yang selamainiRp33ributakmemadai. Sumber dinas terkait, jumlah peserta UN SD/MI, SMP/ MTs dan SMA/MA/SMK daerah ini 2011 ada 3.975 orang. 546 siswa SMA, 169 MA dan 235 SMK. Lalu, 1.147 siswa SMP/MTs dari 11 SMP dan 9 MTs serta 1.878 murid SD/MI, gabungan 70 SD dan 4 MIN. (b33)

Jelang Pilkada Aceh Tamiang 17 Parpol Dan Parlok Berkoalisi KUALASIMPANG (Waspada): Menjelang pelaksanaan Pemilihan Kepala Daerah (Pilkada) Aceh Tamiang pada April 2012 mendatang, 17 partai politik (parpol) dan partai lokal (parlok) di kabupaten itu berkoalisi, agar mengusung satu pasangan calon bupati/wakil bupati. “Koalisi ini kami namakan Koalisi Parpol untuk Perubahan Aceh Tamiang,” kata Koordinator Koalisi, Ir. Syaifannur didampingi sejumlah pimpinan parpol anggota koalisi itu, di Kualasimpang, Rabu (6/4).

Ke-17 parpol yang tergabung dalam koalisi adalah Partai Hanura, PKPB, PPPI, PPRN, PPD, PPI, PNI Marhaenis, PMB, PDK, Republikan, Pelopor, PBB, Partai Patriot, Partai Buruh dan tiga parlok, PAAS, Sira, PRA. Syaifannur menjelaskan, koalisi itu dilakukan untuk memenuhi syarat pencalonan dalam Pilkada. Soalnya menurut UU no.11/ 2006, persyaratan gabungan partai untuk mencalonkan pasangan harus memiliki 15 persen dari jumlah kursi di DPRK atau 15 persen dari akumulasi perolehan suara

dalam pemilu legislatif di daerah bersangkutan. “Sedangkan akumulasi perolehan suara dalam koalisi parpol untuk perubahan Aceh Tamiang ini sudah 18,4 persen,” ujarnya. Kini, jelas Syaifannur, koalisi itu masih belum mengantongi nama bakal calon yang akan diusung. Namun mereka sudah membentuk tim untuk menjaring para bakal calon bupati/wakil bupati Aceh Tamiang. Para bakal calon yang lolos dalam proses penjaringan itu nantinya akan dinilai berdasarkan

track record (rekam jejak) dan visi-misinya. “Bakal calon yang dinilai paling baiklah yang nantinya akan kami usung dalam Pilkada,” katanya Juru bicara koalisi, Haprizal Rozi menambahkan, koalisi parpol itu mekanisme politik dalam suatu Pilkada, baik untuk proses pendaftaran maupun penggalangan kekuatan. Dia yakin koalisi itu akan menjadi kekuatan besar dalam Pilkada. Berdasarkan pengalaman, 62 persen Pilkada di Indonesia dimenangkan koalisi parpol.(m48/b24)

Kantin Kejujuran Awal Pencegahan Korupsi IDI, Aceh Timur (Waspada): Bupati Aceh Timur, Tgk. Muslim Hasballah mengatakan, bahwa melalui Kantin Kejujuran yang digalakkan di tingkat pelajar akan mengawali generasi muda dari pencegahan korupsi. Bupati Muslim dalam sambutan Peresmian Kantin Kejujuran di SMA Negeri Idi, Kamis (7/4) mengatakan, melalui Kantin Kejujuran tersebut diharapkan genarasi mendatang di Aceh, khususnya di Aceh Timur, dapat bersikap jujur dalam setiap langkah dan tindakan sehari-hari, mulai dari pelajar hingga ke tengah masyarakat. Muslim mengisahkan, Nabi Muhammad SAW adalah mahkluk dan hamba pilihan Allah SWT yang dinilai memiliki ketauladanan kejujuran yang sangat tinggi. Sikap rasulullah kini diagung-agungkan dan dijadikan contoh sekalian alam, bahkan kaum kafir kuris (jaman jahiliyah—red) segan dengan sikap kejujuran rasul. Oleh sebab itu, harap Muslim Hasballah, di masa mendatang generasi muda mampu mengaplikasikan sikap kejujuran dalam kehidupan sehari-

hari. “Intinya, kita harap ke depan budaya tidak jujur yang kini bertaburan dimana tidak ada lagi berdarah daging dalam setiap masyarakat Aceh,” ujar Muslim Hasballah.

Dalam peresmian Kantin Kejujuran, hadir Bupati Aceh Timur Muslim Hasballah, Kapolres Ridwan Usman, Dandim 0104 Aceh Timur, Kajari Idi Hasanuddin, SH, Asisten II Setda-

kan Aceh Timur, Kepala Dinas Pendidikan yang diwakili Sektaris Dinas Pendidikan, Syawaluddin, SH, MH, dan puluhan KepalaSekolahdalamlingkungan Pemkab Aceh Timur. (cmad)

Waspada/Muhammad H. Ishak

BUPATI Aceh Timur, Muslim Hasballah bersama Muspida setempat saat membuka selubung pertanda dibukanya Kantin Kejujuran di SMA Negeri Idi, Kamis (7/4).

BIREUEN (Waspada): Harapkan guntur di langit air di tempayan dicurahkan. Akibat keterlambatan menyerahkan dokumen APBK Pemkab Bireuen 2011 senilai Rp120 miliar 25 persen dari Rp 480 miliar dana DAU untuk Pemkab Bireuen hilang percuma terkena penalty. Sejak terbentuk Kabupaten Bireuen dimasa konflik tahun 1999 belum pernah mengalami penalti seperti sekarang ini. Kendati dalam kondisi konflik pemerintahan masih tetap eksis, namun pada zaman damai sekarang ini bukannya bertambah maju, roda pemerintahan sudah kembali nol dan kesejahteraan PNS termasuk pendidik semakin morat-marit. Anwar Yusuf, salah seorang tokoh masyarakat Bireuen mantan anggota DPRD setempat mengmukakan hal itu kepada Waspada di Bireuen, Kamis (7/4). Dikatakan, Pemerintah Pusat mengenakan sanksi penalti terhadap penundaan penyaluran dana Alokasi Umum (DAU) 2011, senilai Rp120 miliar, sebagai konsekwensi terhadap Pemkab Bireuen yang hingga kini belum mengesahkan Rancangan Anggaran Pendapatan dan Belanja Kabupaten (RAPBK) 2011 dan belum menyerahkan dokumen APBK 2011 ke Pemerintah Pusat. Dana DAU Rp 120 miliar yang hilang lantaran pihak Pemkab Bireun mengabaikan dan terlambat mengirimkan dokumen poengesahan anggran APBK 2011 sungguh naif, dan belum pernah terjadi sejak terbentuknya Kab. Bireuen. “Dana senilai Rp120 miliar amat besar bagi kepentingan pembangunan Bireuen, namun hilang sia-sia akibat keteledoran eksekutif dan legislatif setempat yang terkesan kurang mementingkan kepentingan rakyat banyak,” ujar Anwar Yusuf. Sesuai ketetapan RAPBK sudah harus diserahkan ke Pusat sebelum Januari tahun berjalan, namun pihak eksekutif maupun legislatif kelihatan masih mengabaikan dan belum mampu mengesahkan anggaran APBK tepat pada waktunya telah berdampak buruk terhadap kelangsungan pembangunan yang anat dibutuhkan masyarakat. (b16)

Aceh Timur Bantu Rp82 Juta Korban Banjir Bandang IDI, Aceh Timur (Waspada): Guna meringankan beban terhadap korban bencana alam berupa banjir bandang di Tangse (Pidie), rombongan Pemkab Aceh Timur dibawah Bupati Aceh Timur, Muslim Hasballah diwakili Ketua DPRK Aceh Timur, Tgk. Alauddin, bertolak ke Tangse, Rabu (6/4) menyerahkan bantuan Rp82 juta. Ikut dalam rombongan sejumlah pejabat teras Pemkab Aceh Timur, diantaranya Asisten II, Ir. M. Yasin, Asisten III, A. Munir, SE, M.AP, Kepala BPBD Aceh Timur, Muhammad Ikbal, S.Pd, dan pejabat SKPD terkait lainnya. Bantuan Pemkab Aceh Timur tersebut diterima Bupati Pidie melalui Kepala Badan Penanggulangan Bencana Daerah (BPBD) Pidie, Afriadi. Ketua DPRK Aceh Timur, Tgk. Alauddin didampingi Kepala BPBD Aceh Timur, Muhammad Ikbal, S.Pd, mengatakan, bantuan yang diserahkan tersebut diharapkan mampu meringankan beban warga korban banjir bandang di Tangse, dimana hingga kini masih harus mengungsi di barak-barak penampungan. Menurut Tgk. Alauddin, Pemkab Pidie diperkirakan masih sangat butuh bantuan berupa logistik, karena memang kondisi masyarakat korban banjir yang sangat terpuruk itu kehilangan tempat tinggal dan harta benda serta yang paling menyedihkan adalah hilang lapangan kerja seperti areal persawahan yang tertutup total akibat banjir bandang. Sementara Kepala BPBD Aceh Timur, Muhammad Ikbal, S.Pd secara terpisah mengatakan, pihaknya juga telah menyalurkan bantuan logistik terhadap puluhan Kepala Keluarga (KK) di Birem Bayeun dan Ranto Selamat. “Kita juga telah bantuan untuk korban banjir bandang di Birem Bayeun dan korban angin puting beliung di Ranto Selamat,” kata Ikbal singkat.(cmad)

Mutasi Kepala Sekolah Di Kota Langsa Berlanjut LANGSA (Waspada): Kepala Dinas Pendidikan Kota Langsa Drs Abdullah Gade, MPd melantik dan mengambil sumpah delapan pejabat di lingkungan pendidikan di Langsa, Rabu (6/4). Ke delapan pejabat Kepsek tersebut terdiri dari empat Kepala Sekolah Dasar (SD), dua Kepala Sekolah Taman Kanak-Kanak (TK) dan dua Pengawas TK-SD. Empat Kepala SD adalah Erlinawati, S.Pd menjadi Kepala SD Swasta Al-Kautsar Langsa, Iqbal Husni, S.Pd Kepala SD Negeri Gampong Baroh Langsa, Ahmad Syahbuddin, S.Pd menjadi Kepala SD Swasta 2 Muhammadiyah Langsa dan Marzuki, S.Pd Kepala SD Negeri Buket Meutuah Langsa. Ke empatnya sebelumnnya bertugas sebagai guru dan dipromosi karena prestasi. Dua Kepala TK, Yusriana, S.Pd sebagai Kepala TK Negeri Pembina Langsa Timur dan Yusnidar, S.Pd menjadi Kepala TK Negeri Pembina Langsa Baro. Sedangkan dua pejabat baru pengawas yang dilantik yakni Erninda, S.Pd dan Sri Erwati, A.Ma.Pd ditingkatkan menjadi Pengawas TK/SD Dinas Pendidikan Kota Langsa. Erninda sebelumnya Kepala SD 2 Muhammadyah sementara Sri Erwati guru SD 1 Langsa. Kadis Pendidikan Kota Langsa Drs Abdullah Gade M.Pd menjelaskan, mutasi bagian dari mutasi yang telah dilakukan sebelumnya. Mutasi Kepala Sekolah, katanya, akan berlanjut sebagai upaya membenahi pendidikan yang kemudian diharapkan dapat mencapai standart pendidikan nasional seperti yang menjadi acuan kemajuan sebuah daerah. Kota Langsa adalah juara umum pendidikan di Aceh dan gelar tersebut sudah lima kali diraih sehingga piala bergilir juara umum sudah menjadi hak milik daerah.(b26)

Kaukus Desak Pemilukada Sesuai Jadwal BANDA ACEH (Waspada): Sekretaris Kaukus Partai Politik untuk Demokrasi, Rahmad Djailani mendesak Dewan Perwakilan Rakyat Aceh (DPRA) untuk menyelenggarakan Pemilukada sesuai jadwal yang sudah ditetapkan Komisi Independen Pemilihan (KIP) Aceh. Kaukus, kata Rahmad menjawabWaspada, Rabu (6/4), menolak wacana DPRA mengundurkan jadwal Pemilukada. “Pengunduran dinilai akan berpengaruh negatif terhadap transisi kepemimpinan di Aceh,” tukas aktivis ini. Terkait maksud itulah, pihaknya akan beraudiensi dengan pimpinan DPRA, Kamis (7/4), membahas masalah tersebut. “Kami dukung kerja keras KIP Aceh yang telah menyusun tahapan Pemilukada. Sayangnya ini tak mendapat respon positif dari DPRA yang berupaya memperlambat Qanun Pemilukada,” sebut dia. Rahmat menyebutkan, pihaknya meminta KIP Aceh untuk tetap melaksanakan tahapan Pemilukada sesuai jadwal. “Bila revisi QanunPemilukadabelumselesai,makaKIPbisamenggunakanQanun Pemilukada yang lama sebagai payung hukum,” ungkap dia. Menurut dia, jika Qanun yang lama terdapat pasal-pasal yang belum sempurna dengan perkembangan kontekstual, maka halhal yang bersifat umum bisa mengacu ke UU No.12 tentang pemilihan kepada daerah. Memang, perkembangan politik menjelang Pemilukada Aceh semakin memanas, khususnya setelah keluar keputusan dari Mahkamah Konstitusi (MK). Putusan MK ini mengabulkan gugatan untuk mencabut pasal 256 UU Pemerintah Aceh tentang calon independen yang akan ikut dalam Pemilukada mendatang. “Begitu MK mengabulkan pencabutan pasal tersebut, DPRA kembali menolak dan berusaha membatalkan keberadaan calon independen dalam Pemilukada Aceh ke depan, padahal dalam sistem ketatanegaraan RI, tidak ada satu lembaga politik pun termasuk presiden bisa menolak keputusan MK,” seru Rahmat. Celakanya, sambung dia, melalui Pansus III, DPRA berupaya membatalkan calon independen masuk dalam revisi Qanun Pemilukada. Kata dia, 15 anggota kaukus menolak upaya DPRA tersebut. “Ini akan merugikan Aceh,” tukas Rahmad. Ke 15 partai politik yang bergabung dengan kaukus adalah Partai Demokrat, PAN, PRA, Partai SIRA, PBA, Partai Hanura, Partai Gerindra, PDI Perjuangan, PBB, PKPB, PDA, PPRN, PARA, PKS, dan PAAS. (b05)


WASPADA Jumat 8 April 2011

C3 Empat Tahun Gedung SMKN-1 Sawang Terlantar

Jadwal Pilkada Aceh Belum Jelas SIGLI (Waspada): Komisi Independen Pemilihan (KIP) Kab. Pidie menggelar sosialisasi Pemilu Kepala Daerah (Pilkada) di aula Diklat, Kamis (7/4). Dalam acara tersebut terungkap jadwal pelaksanaan Pilkada Aceh belum jelas, karena belum adanya qanun. “Pelaksanaan Pilkada Aceh belum jelas, sebab belum ada qanun yang disahkan DPRA,” kata Ketua KIP Pidie, Junaidi Ahmad, S.Ag. Menurut dia, pihaknya selaku penyelengara Pilkada masih menunggu lahirnya qanun yang menentukan kapan jadwal Pilkada dilaksanakan. Pada bagian lain dia juga menyampaikan tentang tidak diperbolehkannya PNS dan TNI/Polri terlibat dalam mendukung salah satu kandidat peserta Pilkada.(b20)

SAWANG, Aceh Utara (Waspada): Gedung Sekolah Menengah Kejuruan (SMK) Persiapan Negeri 1 Sawang, Aceh Utara mulanya dibangun untuk gedung SD Negeri 10 Sawang sudah empat tahun diterlantarkan begitu tanpa perawatan. Kendati demikian, lahan seluas 9 ha untuk pembangunan gedung sudah dibebaskan pada tahun 2010 silam. Amatan Waspada, Kamis (7/4) akibat diterlantarkan, pekarangan sekolah ditumbuhi belukar. Selain itu ternak masyarakat juga bebas berkeliaran. “Mubazirnya gedung ini kita sayangkan pada saat Aceh Utara defisit anggaran,” ucap Geuchik Lhok Kuyun Kec. Sawang, Asnawi Ismail. Menurut warga, sebenarnya pada tahun ajaran 2010 silam SMK ini menerima siswa perdana dari delapan Sekolah Menengah Pertama (SMP) di Kec. Sawang, dan untuk sekolah lanjutan hanya satu Sekolah Menengah Atas (SMA) yang tersedia. Menurut geuchik, dengan alasan gedung sekarang sebanyak lima ruang belum memadai dan guru dari kejuruan masih minim maka rencana penerimaan dibatalkan, kemudian ditunda hingga tahun ajaran 2012. “Sebenarnya jumlah ruang yang tersedia sekarang sudah bisa diterima siswa perdana tetapi tidak dilakukan tanpa ada alasan yang jelas,” terang geuchik. Pada kesempatan lain saat dihubungi Waspada via telefon, Kepala Unit Pelaksana Teknis Daerah (UPTD) Kec. Sawang Jalal Bayar menyebutkan pada tahun 2011 gedung baru akan dibangun pemerintah pusat, rencananya dibuka dua kejuruan yaitu SMK Pertanian dan Perikanan. “Dibuka jurusan perikanan mengingat di Sawang sudah tersedia Balai Benih Ikan (BBI),” sambung Jalar Bayar. (b03)

Polisi Bekuk Pemakai SS LHOKSUKON, Aceh Utara (Waspada): Aparat Kepolisian Sektor (Polsek) Lhoksukon, Kamis (7/4) membekuk seorang tersangka pemakai sabu-sabu berinisial HJ, 31, warga Desa Meureubo, Kec. Lhoksukon, Kabupaten Aceh Utara. Laki-laki itu kini diamankan di Mapolsek Lhoksukon bersama barang bukti SS seberat 0,12 gram atau senilai Rp50.000, alat hisap atau Bong, sejumlah kaca pirex, 12 pipet plastik, satu buah gunting dan uang tunai Rp200.000. Kapolres Aceh Utara, AKBP Farid Bachtiar Efendi melalui Kapolsek Lhoksukon, Iptu M Ridwan, kemarin, menyebutkan, tersangka HJ ditangkap petugas di desanya, berdasarkan laporan dari masyarakat setempat. ‘’Warga melapor, HJ terlibat cek-cok dengan salah seorang warga di Desa Meureubo. Petugas lalu mengamankan HJ ke Mapolsek dan setelah digeledah, ternyata di kantong celananya ada satu paket kecil SS plus sejumlah barangbukti lainnya,’’ imbuh Iptu Ridwan. Sementara HJ, yang ditemui terpisah mengakui SS itu miliknya. Ayah satu anak ini mengaku baru seminggu terakhir memakai narkotika jenis SS dan barang haram tersebut dibeli dari seorang kenalan di Aceh Ta-miang.(cmus)

Perlu Peningkatan Budaya Baca Buku Dan Menulis NAGARI AIE ANGEK, Sumatera Barat (Waspada): Sastrawan dan penyair nasional, Taufiq Ismail menegaskan, penting sekali peningkatan budaya baca buku dan menulis di kalangan anak-anak dan pelajar. “Kecintaanmembacabukudalambidangapapun,secara awalditumbuhkan melalui kecintaan membaca karya sastra,” katanya ketika ditemui Waspada, Rabu (6/4) di Rumah Puisi yang berada di Nagari Aie Angek, Sumatera Barat. Taufiq menjelaskan, latihan menulis yang dilakukan terus-menerus dapat mengantarkan siswa menulis karya sastra, kalau dia berminat. Jikalau tidak, dia akan memiliki kemampuan menulis secara umum. Selain itu, kelak si anak akan menjadi generasi yang cerdas dan cinta terhadap buku. Atas dasar itu, Taufiq mendirikan Rumah Puisi, gabungan dari perpustakaan, tempat pelatihan garu bahasa dan sastra, sanggar siswa membaca dan melatih menulis, sastrawan berinteraksi, dan sebagainya. Setidaknya Rumah Puisi sudah melatih dua ribu lebih guru dalam program Membaca, Menulis, dan Apresiasi Sastra dengan 113 sastrawan serta sebelas aktor (aktris) di 213 SMA di Nusantara. Selain itu telah melangsungkan kegiatan di 164 kota yang terletak di 31 provinsi dalam program Sastrawan Bicara, Siswa Bertanya.(b12)

Waspada/Muhammad H. Ishak

SERTIJAB: Kapolres Aceh Timur, AKBP Ridwan Usman (kiri) sedang menyematkan tanda jabatan terhadap Ipda Candra Kirana dalam Sertijab di Aula Mapolres Aceh Timur, Kamis (7/4).

Kapolres Aceh Timur: ‘Utamakan Koordinasi’ PEUDAWA, Aceh Timur (Waspada): Jajaran kepolisian, khususnya petugas di lapangan, diharapkan mengutamakan koordinasi dalam setiap langkah dan tindakan. Hal itu dianggap penting dipatuhi, sehingga tindakan polisi tak salah. Demikian Kapolres Aceh Timur, AKBP Drs Ridwan Usman dalam amanat Upacara Serah Terima Jabatan (Sertijab) tiga perwira polisi dalam wilayah hukum Markas Polres setempat. Menurutnya, polisi adalah tulang punggung masyarakat dalam menjaga Keamanan dan Ketertiban. Menjelang Pemilu-Kada di Aceh akhir 2011, sambung AKBP Ridwan Usman, seluruh Polsek diharapkan terus meningkatkan kewaspadaan dan bimbingan terhadap masyarakat, sehingga kondisi aman pasca MoU Helsinki RI-GAM tidak ternodai dengan aksi-aksi sekelompok orang yang tak bertanggungjawab. Ridwan Usman menambahkan, selain melaksanan Tugas Pokok dan Fungsi (Tupoksi) sebagai abdi negara, polisi juga harus melaksanakan tugas-tugas lain dari setiap perkembangan yang terjadi di Aceh, menjelang dan saat berlangsungnya Pemilukada. “Kita harapkan, polisi tetap Waspada dan terus mengutamakan koordinasi dalam setiap gerakan dan langkah di lapangan, sehingga tindakan polisi tepat dan tidak melanggar hukum,” terang Ridwan Usman sembari menandaskan, polisi diminta benar-benar menjadi pelayan dan pengayom masyarakat. Tiga perwira tinggi yang dilakukan Sertijab yakni, AKP Bukhari dari Kapolsek Peureulak Barat menjadi Kasat Pol Air Polres Aceh Timur, Iptu Masri Aswara dari Kapolsek Pantee Bidari menjadi Kapolsek Peureulak Barat dan Ipda Candra Kirana dari KBO Lantas Polres Aceh Timur menjadi Kapolsek Pantee Bidari. (cmad)

Ribuan pelajar ikut mewarnai aksi demo meminta aliran sesat keluar dari bumi “Serambi Mekkah”.

Waspada/Aldin Nl

Guru Dan Pelajar Demo Sekolah Libur BANDA ACEH (Waspada): Seluruh sekolah SMP dan SMA se-Banda Aceh secara serentak , Kamis (7/4) libur karena guru dan pelajar diwajibkan demo besar-besaran meminta aliran sesat, Millata Abraham dan sejenisnya keluar dari bumi “Serambi Mekah”. Para pelajar satu hari sebelum demo sudah diinstruksikan kepada guru, untuk mensiapkan dari rumah kertas kartun berisi berbagai kalimat yang intinya tolak aliran sesat di Aceh. “Kami, satu kelompok disuruh bawa tiga kertas kartun,” ujar seorang pelajar SMPN di sela-sela unjuk rasa di kantor Gubernur Aceh kemarin. Instruksi ini ternyata dipatuhi. Tampak dalam unjuk rasa pelajar berpakaian seragam mendominasi aksi yang tak

biasa itu. Karena itu, banyak pertanyaan yang menggugat kenapa pelajar ikut dikerah-kan. Bahkan sampai kegiatan belajar mengajar satu hari kemarin terpaksa diliburkan. Bila pelajar tinggal di kelas juga tak bisa menerima pelajaran karena hampir seluruh guru yang bergabung dalam wadah PGRI melakukan demonstrasi menolak kehadiran aliran sesat yang diduga dibawa oleh kaum misionaris tersebut. Tak semua orang tua siswa setuju anak mereka dilibatkan dalam aksi itu. Menurut para orang tua, masuknya aliran sesat di dalam masyarakat dan sekolah unggul di daerah ini mengindikasikan pola pendidikan yang gagal. Apalagi sekolah selevel SMA Fajar Harapan (Sekolah Unggul), yang dikelola Pemko Banda Aceh dan telah menerapkan sekolah unggul semi pesantren, ternyata ada sejumlah pelajarnya yang ikut masuk atau tersusupi aliran sesat, Millata Abraham.

Terkait itu, menurut sejumlah orang tua siswa, perlu evaluasi menyeluruh antara guru, orang tua dan pemerintah. Mengejar target, anak harus lulus UN atau masuk ke perguruan tinggi bergengsi, kata mereka, memang menjadi harapan orang tua, tapi pendidikan agama dan akhlakul karimah juga menjadi kewajiban, sehingga terjadi keseimbangan antara Imtek dan Imtaq. Selain pelajar, PGRI, juga Kobar GB, LSM guru ikut dalam aksi damai memberantas pendangkalan aqidah pemurtadan di Aceh. Tercatat 43 organisasi pendukung aksi, di antaranya, yakni farum masyarakat peduli Kota Banda Aceh, Wanita Islam, Rabithah Taliban, BKPRMI, PII, Iskada, MPU Kota, Pema Unsyiah, IAIAN, KNPI, Muhamamdiyan aceh DD Islam Aceh, Wanita Perti , Hisbuz Tahrir, HimpunanWanita Islam, Forsap, Komite Perempuan Aceh Bangkit, remake masjid, Muslimat Alwashliyah, Satkar dan Mustasib. (b02)

Unsyiah Tebar 7.000 Petugas Pengawas UN 2011 BANDA ACEH (Waspada): Universitas Syiah Kuala sebagai pengawas pelaksanaan Ujian Nasional (UN) 2011 untuk SMA/MA dan SMK di Aceh akan menebar sebanyak 7.000 petugas di seluruh sekolah, pada 18 - 21 April 2011 mendatang. Rektor Universitas Syiah Kuala, Prof. Dr. H. Darni Daud, MA, didampingi Purek I Unsyiah Prof Dr. Samsul Rizal menjelaskan, petugas itu telah termasuk 590 dari Unsyiah, 2.500 guru sekolah, polisi, perguruan tinggi swasta, Disdik dan Kemenag. “Unsyiah terlibat dalam pengawas Ujian Nasional Aceh pada tahun 2011 ini termasuk sejak percetakan soal ujian, distribusi dan pengawasan pelaksanaan ujian,” ujar Darni Daud kepada pers, Kamis (7/4) di ruang rapat rektor Unsyiah, Banda Aceh. Menurut Darni, sebagai Koordinator Pengawas UN tahun 2011 ini tidak ada lagi yang namanya pemantau independen. Tapi perguruan tinggi negeri (PTN) ditunjuk oleh Badan Standarisasi Nasional Pendidikan (BSNP) sebagai pengawas

Ujian Nasional tersebut. “Pengawas UN ini merupakan tugas yang diberikan BSNP Kementerian Pendidikan Nasional kepada Unsyiah untuk Aceh,” tutur Darni yang menyebutkan, seluruh sekolah nanti akan ada satu pengawas yang ditugaskan Unsyiah. Sementara untuk pengawas dalam ruangan ujian akan dilakukan oleh guruguru sekolah yang berbeda. “Pengawas ruang ujiannya adalah para guru yang dilakukan secara silang dan guru mata pelajaran yang diuji tak boleh mengawas,” tandasnya. Rektor Unsyiah selaku Koordinator pengawas UN menegaskan untuk tahun ini tidak dilakukan ujian ulang yang ada ujian susulan bagi yang sakit atau ada bencana sehingga siswa sekolah yang bersangkutan tidak mengikuti ujian nasional. Karena itu, Darni meminta para siswa untuk mempersiapkan diri secara baik dalam pengisian lembar ujian karena hal tersebut sangat penting dan tidak merugikan peserta ujian karena hasilnya akan dilakukan pemindaian dengan komputer.

Pada bagain lain, Samsul Rizal menambahkan nilai kelulusan bagi siswa itu gabungan antara ujian sekolah dengan ujian nasional, yaitu nilai akhir 0,6 atau 60 persen diambil dari UN dan 40 persen dari nilai sekolah. Rata-rata nilai akhir minimum 5,5 dan tidak ada nilai di bawah empat. Kelulusan dari satuan pendidikan dirapatkan oleh dewan guru dengan memperhatikan nilai akhlak dari siswa. Nilai sekolah diperoleh dari gabungan 60 persen ujian sekolah dan 40 persen rata-rata nilai rapo semester III, IV dan V,” ungkap Samsul. “Nilai sekolah itu nilai ujian akhir sekolah dan nilai rata-rata nilai rapor semester III, IV danV yang harus dikirimkan ke dinas yang diteruskan ke BSNP sebelum pelaksanaan ujian nasional dilaksanakan,” cetus Samsul. Menyangkut lembar ujian, kata Samsul untuk empat kabupaten/kota yang terpencil dan dianggap jauh sudah mulai bergerak dari Jakarta. Empat daerah itu adalah Simeulue, Singkil, Gayo Lues, Aceh Tenggara dan Subulussalam. (b04)

LHOKSEUMAWE (Waspada): Krisis etika di kalangan remaja menjadi alasan panitia Maulid Nabi Muhammad SAW di SMK Negeri-2 Lhokseumawe, untuk menggelar dakwah visual. Pesan-pesan yang disampaikan dai yang dipandu visual menggunakan perangkat multi media membuat ratusan siswa menangis, Kamis (7/4). “Etika di kalangan remaja sedang mengalami krisis. Kita dari pihak sekolah ingin menyampaikan pesan-pesan melalui renungan yang menggunakan perangkat multi media,” jelas Wakil Kepala Sekolah Bidang Kesiswaan,

SMKN-2 Lhokseumawe, Nurmalawati, SPd. Dalam dakwah yang disampaikan Ustad Nasullah dan Ustad Rajali, dijelaskan tentang perjuangan seorang ibu dalam membesarkan anak-anaknya. Ratusan siswa yang mendengarkan ceramah dan disertai dengan visual melalui proyektor menangis mendengarkan kisah itu. Bahkan, sekelompok siswi yang bersimpuh di sudut aula sekolah tak berhenti meneteskan air matanya, kendati dakwah telah usai. Nurul, 15, Endah, 15, Triana, 15, Mora, 15, memeluk Rika, 15, siswi Kelas I Jurusan Kecantikan.

Menurut Endah, dia dan kawankawannya menangis karena terharu mendengarkan kisah jasa seorang ibu. “Kami berjanji akan selalu berbakti pada ibu dan guru-guru kami,” ungkap Endah. Mereka juga menangis karena salah seorang rekannya, Rika tidak lagi memiliki ibu. Orang tuanya meninggal tahun lalu. SMKN-2 Lhokseumawe merupakan sekolah kejuruan kelompok Pariwisata. Melalui Jurusan Tata Boga, Busana, kecantikan dan Perhotelan, para siswa dilatih untuk trampil menciptakan lapangan kerja dan meningkatkan industri pariwisata di Lhokseumawe.(b17)

Berangkat (flight, tujuan, waktu)

GA 146 Jakarta/Medan


GA 147 Medan/Jakarta


Y6 537 Medan


Y6 538 Medan


JT 304 Jakarta JT 396 Jakarta/Medan

11:35 20:00

JT 397 Medan/Jakarta JT 307 Jakarta

06:40 12:15

SJ 010 Jakarta/Medan


SJ 011 Medan/Jakarta


AK 305 Kuala Lumpur *


AK 306 Kuala Lumpur*


FY 3401 Penang **


FY3400 Penang **


Batavia Air Lion Air

Sriwijaya Air Air Asia Fire Fly

Waspada/Zainal Abidin

* Setiap Senin, Rabu , Jumat dan Minggu. ** Setiap Selasa, Kamis dan Minggu.

BIREUEN (Waspada): Sejumlah elemen termasuk Lembaga Sosial Masyarakat (LSM) membahas draft qanun (rancangan perda) tentang pendidikan Bireuen di SMAN 2 setempat, Kamis (7/4). Setelah itu diajukan kepada Dewan Perwakilan Rakyat Kabupaten (DPRK) untuk digodok kembali lalu ditetapkannya. Ada pun elemen dan LSM yang duduk membahas qanun pendidikan itu antara lain, Dinas Pendidikan Kebudayaan Pemuda dan Olahrga (Disdikpora), Majelis Pendidikan Daerah (MPD), LSM BIMA, LS-PENA, GaSAK, Kobar-GB, PGRI dan sejumlah elemen serta LSM lainnya. Kadisdikpora Bireuen, Asnawi M.Pd, kepada Waspada Kamis (7/4) menjelang dilaksanakan acara pembahasan qanun pendidikan itu, menjelaskan, pembahasan draft Qanun Pendidikan Bireuen yang melibatkan sejumlah unsur dan elemen yang bekerja sama dengan pihaknya merupakan draft yang pernah dibuat sejumlah LSM lalu, dibahas kembali untuk menyempurnakannya sebelum diserahkan ke pihak dewan setempat yang akan disahkan. “Draft qanun pendidikan Bireuen ini mencakup keseluruhan tentang dunia pendidikan, makanya hari ini dibahasnya lagi supaya sempurna,” katanya. Menurutnya, perlunya pembahasan draf qanun pendidikan itu yang telah dirancang LSM itu agar ke depan dunia pendidikan selain dapat ditingkatkan kemajuannya juga ada pegangan atau aturan baku yang dapat dijadikan pedoman bagi pelaku pendidikan di kabupaten itu. Ke depan, selain berupaya memajukan dunia pendidikan juga berupaya memohon pihak terkait supaya kantor dinas pendidikan di Bireuen memiliki kantornya sendiri. “Kita sudah sediakan lahannya, namun sekarang kita juga akan berupaya memohon bantuan pemerintah untuk membangun gedung kantor dinasnya dan sejumlah UPTD,” pungkasnya. (amh)

Pasca Banjir Tangse Panas Terik TANGSE, Pidie (Waspada) : Pasca banjir bandang yang berlanjut dengan curahan hujan tinggi (hujan deras) melanda kawasan pegunungan Tangse khususnya, Kabupaten Pidie dan Pidie Jaya pada umumnya dalam sepekan terakhir, kini kondisi di daerah itu mengalami panas terik sinar matahari. Sejumlah warga Tangse, Pidie dan Pidie Jaya kepada Waspada secara terpisah menyebutkan, kondisi cuaca dalam tiga empat hari terakhir ini yang berubah dari cuaca lembab (hujan) terus menerus menjadi panas terik (kemarau) dinilai lebih baik dibanding sebelumnya. Seperti diungkapkan Keuchik Gampong (Kepala Desa-red) Ranto Panyang, Tangse, Hamdani Hasballah kepada Waspada, Kamis (7/ 4), setelah dilanda banjir bandang pada, 10 Maret 2011 lalu yang disertai guyuran hujan tinggi terus menerus. Kini, dalam sepekan ini warga di kawasan kecamatan pegunungan itu mulai lega menyusul cuaca yang panas terik alias kemarau. Menurut Hamdani, suasana gerah ini bukan saja terjadi pada siang hari, malam hari pun cukup gerah. “Kondisi dalam empat hari ini, bertolak belakang dengan kondisi sepekan sebelumnya yang terus menerus diguyur hujan hingga membuat warga waswas kemungkinan bakal terjadi banjir susulan, “ ujar Kepala Desa Ranto Panyang, Tangse itu. Sejumlah warga Tangse lainnya, juga mengaku cuaca panas seperti ini lebih baik dibandingkan hujan, hal ini mengingat kawasan pegunungan itu memang daerah yang rawan banjir di saat musim hujan. “Namun dengan perubahan cuaca menjadi kemarau warga di sana tak perlu khawatir lagi terhadap banjir susulan, kata Zainal,” warga Peucok Peunalom Sa.(b21)

Dakwah Visual Tentang Jasa Ibu Ratusan Siswa SMK Menangis

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu) Garuda Indonesia

Sejumlah Elemen Bahas Draf Qanun Pendidikan Bireuen

Seorang siswi SMK Negeri-2 Lhokseumawe menangis di depan kepala sekolah usai mengikuti dakwah visual tentang jasa ibu pada acara Maulid Nabi Muhammad SAW, Kamis (7/4).

Waspada/Muhammad Riza

DUA perempuan Tangse, Pidie korban banjir bandang sedang membersihkan areal persawahan yang tertimbun kayu sisa terjangan banjir bandang beberapa pekan lalu. Akibat bencana ini ribuan hektar sawah rusak.

Banjir Bandang Hancurkan 149 Kolam Ikan Air Tawar TANGSE (Waspada): Lebih 149 kolam ikan air tawar hancur akibat banjir bandang Tangse, Pidie, Kamis (10/3) malam silam. Akibatnya, 83 petani tambak mengalami kerugian sekira Rp738.500.000. Fachruddin Nur, petani kolam ikan air tawar di Desa Layan, Kec. Tangse, Pidie, Kamis (7/4) mengungkapkan, akibat banjir delapan kolam miliknya rusak parah dan ribuan ikan jenis Nila Gif, Lele, ikan Mas, dan Keureuling (sejenis ikan jurung-red) habis terbawa banjir yang juga menghancurkan 12 perkampungan di Kec. Tangse. Dia mengatakan, ribuan ikan gagal panen di delapan kolam, di mana setiap panen ia bisa memperoleh penghasilan berkisar Rp100.juta lebih per tiga bulan sekali. “Kami mengharapkan pemerintah dan donatur dapat membantu petani ikan air tawar. Kami sangat butuh modal usaha dalam membangkitkan kembali usaha ikan air tawar yang selama ini kami geluti,” kata Fachruddin Nur. Kepala Dinas Kelautan dan Perikanan, Pidie Ir. Said Ramadhan kepada Waspada, Kamis (7/4) di ruang kerjanya membenarkan hal itu. Menurutnya, dari data sementara ada sekira 83 petani kolam ikan air tawar terkena imbas banjir bandang. “Jumlah ini bisa lebih, kita masih di lapangan melakukan pendataan,” papar Said Ramadhan. Untuk membantu petani ikan, pihaknya akan minta bantuan dinas perikanan Provinsi Aceh dan kementrian terkait di tingkat pusat. “Apabila ada donatur atau NGO yang memperhatikan tentang perikanan kami juga siap bekerjasama,” katanya.(b20)

Mimbar Jumat


Ungkapan Syukur Melalui Jamu Laut Sesat Dan Menyesatkan Oleh Erwan Effendi


an aku tidak menciptakan jin dan manusia melainkan supaya mereka beribadah kepada-Ku.” (Adz Dzariyat: 56). “Hanya kepadaMu lah kami beribadah dan hanya kepadaMu lah kami minta pertolongan. (Al Fatihah: 5). Sebelumnya masyarakat meragukan idenvendensi MUI (Majelis Ulama Indonesia) Batubara sebagai pewaris para nabi, namun setelah banyaknya desakan masyarakat akhirnya lembaga para ulama tersebut mengelurarkan fatwa bahwa jamu laut melarung (membuang) kepala kerbau di laut adalah haram dan pekerjaan yang dikatagorikan khurafat. Keraguan masyarakat terhadap eksistensi MUI Batubara tersebut wajar-wajar saja mengingat kegiatan itu melibatkan Pemkab Batubara. Bahkan jamu laut itu dirangkaikan dengan peringatkan hari lahir ke 55 pejabat tertinggi di daerah itu. Mengingat keterlibatan umara (pemimpin), harusnya MUI Batubara mengeluarkan fatwa apa hukumnya bagi penggagas, mengajak atau berdakwa serta menyeru orang untuk melakukan perbuatan ke jalan yang mungkar kepada Allah SWT. Lebih-lebih lagi ajakan itu kalau dilakukan oleh umara. Padahal, kita berharap seorang umara bertindak sebagai pelaku amar ma’ruf nahi mungkar bukan sebaliknya mengajak kepada perbuatan mungkar. Ironisnya, alasan umara melaksanakan jamu laut dengan membuang kepala hewan yang dopotong beserta isi perut ke laut merupakan bentuk ungkapan rasa syukur kepada Allagh SWT, masya Allah. Alasan itu jelas sesat dan menyesatkan. Ungkapan rasa syukur yang direnkonstruksikan seperti itu yang kemudian meminta pertolongan dan perlindungan kepada laut, itu indentik seperti yang dalakukan oleh masyarakat pada zaman jahiliyah, mereka menyembah berhala lata dan huza meminta pertolongan dan perlindungan. Padahal, laut hakikatnya adalah hamba yang diciptakan Allah SWT. Justru, ajakan umara kepada masyarakatnya untuk mengungkapkan rasa syukur dengan kegiatan jamu laut itu, sama artinya mengajak masyarakat Batubara untuk mengikuti perbuatan masa jahiliyah, na’uzubillahiminzalik, hanya Allah SWT lah yang tahu. Ditambah lagi pendapat kalangan yang mengakungaku tokoh adat atau tokoh budaya bahwa jamu laut itu dapat dibenarkan dengan alasan tradisi atau budaya masyarakat yang sudah dilakukan bertahun-tahun. Ucapan itu terkesan syarat kepentingan, sehingga mengabaikan yang haq dan melegalkan yang bathil. Harusnya, sebagai muslim landasan utama dalam melaksanakan suatu perbuatan adalah Alquran dan hadis bukan kebiasaan atau tradisi. Tradisi boleh saja dilaksanakan apapun bentuknya sepanjang tidak bertentangan dengan akidah. Tidak dekat Dari gambaran di atas mengindikasikan bahwa umara di Batubara sama sekali tidak dekat atau tidak melakukan komunikasi aktif dengan para ulama. Jika saja terbangun komunikasi yang efektif dan harmonis, gagasan atau seruan mengajak masyarakat untuk berbuat khurafat bahkan syirik dari mulut umara tidak

akan keluar. Kecenderungan tidak adanya komunikasi dengan ulama, mungkin saja umara bersangkutan menganggap dirinya sekaligus sebagai ulama seperti pada masa sahabat (Abubakar Assiddik ra, Umar Ibn Khatab ra, Usman ibn Affan ra dan Ali Ibn Abi Thalib ra). Persoalan yang menyangkut ibadah apalagi akidah, itu adalah wilayah kerja para ulama sebab mereka adalah ahlinya, karenanya sebagai uamra yang bersifat siddiq, amanah, tabligh dan fathanah harusnya setiap melakukan sesuatu menyerahk kepada ahlinya, jangan sok tahu semua, sehingga berpikir sendiri berbuat sendiri dan makan sendiri seperti menanggani proyek pembangunan fisik. Dalam konteks ini, ma-syarakat harus mendesak MUI Batubara mengerluar-kan fatwa, apakah masih boleh taat kepada umara yang sudah pernah menyeru masyarakat kepada perbuatan syrik. Sebab, syirik besar bisa mengeluarkan pelakunya dari agama Islam dan menjadikannya kekal di dalam neraka, jika ia meninggal dunia dan belum bertaubat. “ Hai orang-orang yang beriman, taatilah Allah dan taatilah Rasul (Nya) dan “Ulil Amri” diantara kamu. Kemudian jika kamu berlainan pendapat tentang sesuatu, maka kembalikanlah ia kepada Allah (Alquran) dan Rasul (Sunah), jika kamu benar-benar beriman kepada Allah dan hari kemudian. Yang demikian itu lebih utama bagimu dan lebih baik akibatnya”. (QS.4:59). Akan tetapi Umara yang wajib ditaati hanyalah umara yang memerintahkan berbuat makruf. Umara yang memerintahkan berbuat munkar, haram hukumnya ditaati, sesuai Hadis “La tha’ata li makhluq fi ma’shiyat Allah” (HR.Muslim). Penutup “Dan aku tidak menciptakan jin dan manusia melainkan supaya mereka beribadah kepada-Ku.” (Adz Dzariyat: 56). Ayat ini menegaskan bahwa tujuan Allah penciptaan kita tidak lain adalah untuk beribadah kepada-Nya. Ibadah adalah segala sesuatu yang dicintai dan diridhai oleh Allah baik berupa perkataan atau perbuatan, yang lahir maupun yang batin. Ibadah harus ditujukan hanya kepada Allah tidak kepada selain-Nya. “Hanya kepadaMu lah kami beribadah dan hanya kepadaMu lah kami minta pertolongan.” (Al Fatihah: 5). Barangsiapa yang menujukan salah satu ibadah tersebut kepada selain Allah maka inilah kesyirikan dan pelakunya disebut musyrik. Misalnya berkurban (menyembelih hewan) untuk jin seperti jamu laut. Ini semua termasuk kesyirikan karena menjadikan jin itu sebagai sekutu bagi Allah. Syirik besar adalah memalingkan sesuatu bentuk ibadah kepada selain Allah, seperti berdo’a kepada selain Allah atau mendekatkan diri kepadanya dengan penyembelihan kurban atau nadzar untuk selain Allah, baik untuk jin atau syaitan, atau mengharap sesuatu selain Allah, yang tidak kuasa memberikan manfaat maupun mudharat. � Penulis wartawan Waspada, mahasiswa PPs KOMI IAIN Sumut dan Wakil Ketua Bidang Kominfo MUI Sumut

Perlu Dibentuk Badan Wakaf Pengelola Air Minum Oleh Dr. Sjahril Effendy P, MSi, MA, MPsi


aad bin Ubadah setelah kematian ibunya datang kepada Rasulullah Saw dan berkata: “Wahai Rasulullah, sesungguhnya Ummu Saad telah meninggal dunia, maka sedekah apakah yang paling baik untuknya?” Rasulullah Saw menjawab “Air”. Maka Saad bin Ubadah pun menggali perigi dan setelah siap dia berkata: “Perigi ini adalah wakaf untuk Ummu Saad”. Saidina Usman bin Affan telah mewakafkan sebuah perigi Rumah yang dibelinya dari seorang lelaki dari Bani Ghifar. Pada mulanya lelaki itu menjual air periginya kepada orang ramai dengan harga satu mud untuk setiap kirbah. Rasulullah Saw berkata kepada lelaki itu: “Maukah engkau menjual perigimu itu kepadaku dengan harga satu telaga di surga?” Kata lelaki itu : “Wahai Rasulullah, aku dan keluargaku tidak punya apa-apa selain dari perigi itu.” Ketika Usman mendengar berita itu dibelinya perigi itu dari pemiliknya dengan harga 30.000 dirham. Lalu Usman berkata kepada Rasulullah Saw:” Maukah engkau menjadikan bagiku seperti yang dijanjikan kepada pemilik perigi itu?” Rasulullah menjawab: “Ya”. Usman berkata: “Aku telah menjadikan perigi itu sebagai wakaf bagi Muslimin”. Dimensi Ekonomi Dalam Wakaf “Wakaf adalah menahan harta baik secara abadi maupun sementara, untuk dimanfaatkan langsung atau tidak langsung, dan diambil manfaat hasilnya secara berulang-ulang dijalan kebaikan umum maupun khusus”. Wakaf merupakan shadaqah yang pahalanya berjalan terus (shadaqah jariyah) selama pokoknya masih ada dan terus dimanfatatkan. Pengertian kata “ada” disini bisa berarti karena secara alami barang tersebut usianya ditentukan oleh nilai ekonominya, juga bisa berarti ada karena sesuai dengan kehendak wakif dalam ikrar wakafnya. Karena itu, wakaf merupakan kegiatan yang mengandung unsur investasi masa depan dan mengembangkan harta produktif untuk generasi yang akan datang sesuai dengan tujuan wakaf, baik berupa manfaat, pelayanan dan pemanfatan hasilnya secara langsung. Semua bentuk wakaf yang telah disebutkan tadi menjadi saham, dan bagian atau unit dana investasi. Investasi sendiri mempunyai arti mengarahkan sebagian dari harta yang dimiliki oleh seseorang untuk membentuk modal produksi, yang mampu menghasilkan manfaat atau barang dan dapat dipergunakan bagi kepentingan generasi yang akan datang. Dari penjelasan diatas, maka menurut tabiatnya maka dapat dibedakan hasil atau produk harta wakaf menjadi dua bagian. Pertama, harta wakaf yang menghasilkan pelayanan berupa barang untuk dikonsumsi langsung oleh orang yang berhak atas wakaf, seperti rumah sakit, sekolah, rumah yatim piatu dan pemukiman. Wakaf seperti ini semua disebut sebagai wakaf langsung. Kedua, harta wakaf yang dikelola untuk tujuan investasi dan memproduksi barang atau jasa pelayanan yang secara syara’ hukumnya mubah, apapun bentuknya dan bisa dijual di pasar, agar keuntungannya yang bersih dapat disalurkan sesuai dengan tujuan wakaf yang telah ditentukan wakif, baik wakaf ini bersifat umum atau wakaf sosial maupun khusus yaitu wakaf keluarga. Instalasi Pengolahan Air Para wakif diajak untuk berwakaf dibidang pengolahan air minum yang produktif yang sangat dibutuhkan oleh masyarakat banyak (muslim) yang diperlukan setiap hari secara terus menerus dengan kuantitas, kualitas dan kontinuitas yang terpelihara. Untuk membangun sebuah Instalasi Pengolahan Air Minum sesuai dengan kapasitas yang diinginkan menggunakan peralatan dengan proses sebagai berikut: 1) Intake, fungsinya mengarahkan air sungai agar lebih mudah di ambil dengan pompa, menya-

ring kotoran/sampah agar tidak terhisap pompa, dan transfer air sungai ke Bak Pengendap I. 2) Bak Pengendap I (prasedimentasi), fungsinya mengontrol fluktuasi debit dan kualitas air baku, bak pengendap awal (partikel dengan diameter 0,1 mm atau lebih) dengan target sebesar 80% dan sebagai tempat pencampuran antara air baku dengan klorin dan penyediaan waktu tinggal chlorinasi. Fungsi klorin untuk membunuh bakteri pathogen atau desinfeksi awal, oksidator untuk logam Fe dan Mn. 3) Bak Koagulasi dan Flokulasi, fungsinya untuk pengaturan pH proses dengan menambahkan kapur Ca(OH)2 agar sesuai dengan kondisi operasi, menambahkan koagulan (Alum/ PAC) untuk menurunkan parameter turbidity, senyawasenyawa organic tersuspensi, dan logam berat, penambahan polymer untuk memperbesar flok, percampuran bahan kimia dengan air baku. 4) Bak Pengendap II (sedimentasi), fungsinya sebagai tempat pengendapan padatan atau flok yang terbentuk dari proses flokulasi, hal-hal yang harus diperhatikan adalah Bak pengendap II dikondisikan tenang dan jika banyak flok mengambang, maka harus di cek proses sebelumnya, dan target pengurangan turbidity sebesar 80%. 5) Bak saringan pasir cepat, fungsinya menangkap flok yang tidak dapat dipisahkan pada Bak pengendap II, melakukan Backwash Filter secara berkala, target pengurangan turbidity sebesar 90%. 6) Bak Netralisasi dan Klorinasi, fungsinya pengaturan pH agar air hasil pengolahan mempunyai pH netral, penambahan klor untuk menjaga agar kandungan klorin dalam air yang akan didistribusikan selalu ada, untuk menghindari adanya bakteri pathogen dalam air. 7) Bak Penampung Air Bersih¸ fungsinya sebagai penampungan air hasil pengolahan sebelum didistribusikan kepada konsumen. Adapun alat bantu Instalasi Pengolahan Air Minum antara lain adalah : peralatan chlorinator, dosing Aluminium sulfat, dosing kapur, dosing PAC, dosing polymer, dosing HCI. Biaya pembangunan Instalasi Pengolahan Air Minum diperkirakan sebesar Rp 125.000.000 setiap liter/detiknya. Jadi kalau ingin dibangun kapasitas 100 liter/detik maka dibutuhkan dana sekitar Rp 12.500.000.000. Biaya pembangunan instalasi tersebut belum termasuk lahannya yang dibutuhkan sekitar 0,5 Ha yang diharapkan dari wakaf para dermawan muslim. Hartawan dan Dermawan Di Indonesia banyak sekali Hartawan dan Dermawan dari kalangan muslimin yang mempunyai konsep hidup atau menjalani hidup dengan tahapan sebagai berikut: Waktu kecil dibina, Setelah dewasa berkarya, Sesudah tua bershadaqah jariyah, Insya Allah bila meninggal dunia ke surga. Sudah saatnya kita perlu membentuk Badan Wakaf Pengelola Air Minum dengan dukungan Hartawan dan Dermawan muslimin untuk membantu kaum muslim yang membutuhkannya dengan harga jual yang relatif murah. Pekerjaan yang mulia ini dapat ditindak lanjuti oleh Majelis Ulama Indonesia (MUI) setempat dengan membentuk Badan Wakaf pengelolanya. Harta wakaf produktif dibidang pelayanan air bersih/air minum ini sangat bermanfaat bagi kaum muslimin. Yahya bin Muadz berkata, “Sebagai seorang muslim, hendaknya engkau mempunyai tiga hal positif; jika tidak dapat memberikan manfaat kepada orang lain, maka janganlah engkau memberikan mudharat kepadanya; jika tidak mau memujinya, maka janganlah menjelekkannya, dan apabila engkau tidak bisa membuatnya bahagia, maka janganlah membuatnya bersedih”. � Penulisadalah Pengamat Masalah-Masalah PengelolaanAir

Minum dan Dosen Magister Manajemen Program Pasca Sarjana UMSU dan Magister Psikologi Program Pasca Sarjana UMA

WASPADA Jumat 8 April 2011

Alquran Sumber Inspirasi J

ika manusia - khususnya umat Islam- mau menjadikan Alqur’an sebagai sumber inspirasi maka kuat dugaan bahwa kehidupan sekarang jauh lebih maju dari apa yang kita saksikan saat ini. Urgensi menginspirasi Alqur’an karena pesan-pesan kemajuan di dalamnya selalu dibarengi dengan pesan-pesan moral. Penggandengan pesan Alqur’an ini (kemajuan dan moral) tidak terinspirasi secara utuh kecuali hanya sebatas kajian tentang moral. Akhirnya pesan-pesan Alqur’an yang berkaitan dengan teknologi dan fenomena alam tidak terinspirasi dengan baik sehingga membuat ayatayat tersebut luput dari kajian. Dampak yang paling dirasakan akhir-akhir ini adalah tidak adanya penemuan yang spektakuler dari sarjana-sarjana Muslim khususnya dalam bidang teknologi dan fenomena alam. Ironisnya, ayat-ayat Alqur’an yang membicarakan kedua hal ini (teknologi dan fenomena alam) selalu dijelaskan secara pragmatis. Peran Akal dalam Menginspirasi Alqur’an Di dalam al-Qur’an terdapat perintah agar manusia menggunakan akalnya dengan baik dalam membaca ayat-ayat Tuhan baik yang tertulis maupun yang tidak tertulis. Penggunaan akal ini dapat dilakukan dengan cara tafakkur, ta’abbur dan tadabbur. Pada prinsipnya, adanya perintah ini mengindikasikan bahwa kehadiran Alqur’an layak dijadikan sebagai sumber inspirasi. Alqur’an mensugesti manusia agar memperhatikan dengan serius ciptaan-ciptaan Tuhan. Perhatian ini tidak hanya sebatas pengakuan tentang adanya kekuasaan Tuhan akan tetapi bagaimana ciptaan Tuhan dimaksud dapat diinspirasi oleh manusia. Sebagai contoh, di dalam Q.S. al-Ghasyiyah ayat 17-20 disebutkan bagaimana unta diciptakan, langit ditinggikan, gunung dipancangkan dan bumi dihamparkan. Urgensi menjadikan Alqur’an sebagai sumber inspirasi dapat dilihat dari penggunaan kata yanzhurun yang terdapat pada surat al-Gahsyiyah yaitu afala yanzhurun ilal ibli kayfa khuliqat. Kata ini (yanzhurun) menurut al-Zamakhsyari (w. 538 H) di dalam tafsir -al-Kasysyaf me-

Oleh Achyar Zein

ngandung makna nazhran i’tibaran (melihat dengan tujuan untuk mengambil pelajaran). Selain objek-objek di atas yang sifatnya berkaitan dengan fenomena alam masih terdapat lagi ayat-ayat lain yang berkenaan dengan hukum, sosial, ekonomi dan lain-lain yang patut untuk dijadikan sumber inspirasi. Jika ayat-ayat ini dijadikan sumber inspirasi maka akan memunculkan teori-teori baru yang dapat dikembangkan sesuai dengan budaya dan peradaban. Kuat dugaan, jika pernyataan Alqur’an ini direspon dengan baik yaitu mempelajarinya secara serius maka akan menghasilkan berbagai penemuan yang bermanfaat bagi kehidupan. Ini juga termasuk salah satu makna yang dapat dipahami dari keinginan Alqur’an ketika menyatakan bahwa kehadiran dirinya sebagai petun-juk bagi manusia. Sekiranya Alqur’an dijadikan sebagai sumber inspirasi dari dahulu maka kuat dugaan perkembangan ilmu dan teknologi akan jauh lebih maju bila dibanding dengan keadaan sekarang. Hal ini dapat dibuktikan dengan banyaknya penemuanpenemuan yang hanya dilandasi kepada kekuatan akal saja tetapi sudah mampu membawa kemajuan yang luar biasa. Kemajuan ini akan lebih pesat lagi jika ayat-ayat Alqur’an dijadikan sebagai sumber inspirasi karena bersatu dua kekuatan yaitu wahyu (Alqur’an) dan akal. Kedua kekuatan ini saling mendukung karena Alqur’an sumber inspirsi untuk mengarahkan akal sedangkan akal memerlukan Alqur’an agar tidak berlarut-larut dalam menemu-kan

sesuatu. Apa yang sudah diketemukan oleh kekuatan akal akhirakhir ini semuanya memiliki korelasi dengan isyarat ayat-ayat Alqur’an. Namun sayangnya, isyarat-isyarat Alqur’an ini didapati setelah penemuan akal berlangsung sekian lama. Hal ini disebabkan adanya upaya pemi-sahan antara kekuatan Alqur’an dengan akal sehingga masing-masing berjalan dengan sendirinya. Alqur’an dan akal adalah mitra karena kedua-duanya ber-asal dari Tuhan. Jika keduanya samasama diefektifkan maka manusia tidak perlu berlarut-larut dalam menemukan sesuatu. Tugas Alqur’an adalah menginformasikan kepada akal tentang adanya objek-objek yang layak untuk diteliti. Kemudian tugas akal adalah mengembangkan informasi Alqur’an tersebut. Oleh karena itu, ayat-ayat Alqur’an pada umumnya selalu berbicara pada tataran global. Hal ini untuk mengantisipasi perkembangan peradaban manusia supaya pesan-pesan Alqur’an tetap aktual. Selain itu, Alqur’an memberikan kebebasan kepada akal manusia untuk mengembangkan isyarat-isyarat Alqur’an agar manusia dapat menemukan hal baru yang bermanfaat bagi kehidupan. Peran akal dalam hal ini adalah merinci keglobalan pesanpesan Alqur’an karena Tuhan sudah memberikan kepada manusia kemampuan akal untuk melakukannya. Dengan adanya kemampuan akal ini maka Alqur’an tidak perlu mengungkapkan suatu objek secara detail karena hal ini sama dengan memasung kekuatan akal manusia. Salah satu kekuatan akal ialah mampu mencari cara dalam menata kehidupan yang baik. Akan tetapi apa yang sudah didapati oleh akal masih perlu pengkajian yang serius karena tidak ada jaminan bahwa hal tersebut sudah pasti baik. Berbeda halnya dengan pernyataan Alqur’an yang sudah dapat dijamin bahwa setiap pernyataannya pasti baik untuk manusia. Dalam tataran ini Alqur’an nampaknya hanya mengarah-

kan apa-apa saja yang seharusnya dikerjakan oleh akal. Arahan inilah yang seharusnya diinspirasi oleh akal karena setiap yang disebutkan oleh Alqur’an pasti dapat di-kembangkan oleh manusia. Hal ini dilakukan agar akal tidak raguragu untuk mengembangkan isyaratsyarat Alqur’an. Penemuan-penemuan dimaksud terjadi pada abadabad terakhir ini sementara isyarat Alqur’an tentang itu sudah ada jauh hari sebelumnya. Keterlambatan ini disebabkan kurangnya kemauan untuk menginspirasi isyaratisyarat Alqur’an sehingga penemuan yang dilakukan mutlak dikerjakan oleh akal secara mandiri tanpa melibatkan informasi Alqur’an. Sikap menginspirasi Alqur’an ini harus diawali dengan satu keyakinan bahwa setiap ayatnya sudah pasti memberikan kontribusi positif bagi kehidupan manusia. Untuk menyahuti adanya kontribusi yang positif ini maka inspirasi paling tidak-difokuskan kepada objek-objek tertentu yang disebutkan di dalam Alqur’an untuk dilakukan pengembangan lebih lanjut. Fokus terhadap objek-objek ini perlu dilakukan karena sudah pasti memiliki keistimewaan-keistimewaan. Terlebih lagi jika objek tersebut diungkapkan dalam Alqur’an berulang kali. Sebagai contoh, Alqur’an menyebut jenis hewan tertentu, langit dan bumi serta benda-benda angkasa, demikian juga tumbuh-tumbuhan dan beberapa tokoh tertentu yang diyakini dapat dijadikan sebagai sumber inspirasi. Penutup Alqur’an diturunkan oleh Allah adalah untuk manusia dan karena itu semua pesan yang terdapat di dalamnya adalah untuk kepentingan manusia. Mengingat bahwa manusia adalah makhluk yang ditugaskan oleh Allah untuk mengelola dan memakmurkan bumi maka kehadiran Alqur’an adalah sebagai pedoman untuk menunjang kesuksesan tugas tersebut dan karena itu patut dijadikan sebagai sumber inspirasi. � Penulis adalah Dosen Fak. Tarbiyah IAIN-SU dan Pengurus el-Misyka Circle.

Reposisi Hakikat Toleransi


aat ini, banyak yang salah dalam memposisikan makna toleransi. Sering sekali toleransi ditujukan kedalam persoalan aqidah (keyakinan) padahal persoalan tersebut merupakan perkara ushuli (prinsip). Dalam aqidah semua umat Islam harus komitmen dan tidak ada tawar menawar dalam bentuk apapun. Komitmen ketauhidan ini telah ditunjukkan oleh Nabi Muhammad SAW, ketika pada waktu itu tokoh kaum musyrikin di Mekkah seperti al-Walid ibn alMughirah, Aswad ibnu ‘Abdul Muthalib, Umayyah ibnu Khalaf menawarkan kompromi menyangkut pelaksanaan tuntunan agama (keyakinan). Usul mereka adalah agar nabi bersama pengikutnya mengikuti keyakinan mereka dan mereka pun akan mengikuti ajaran Islam. Nabi SAW. Menjawab dengan tegas “Aku berlindung kepada Allah, dari tergolong orang-orang yang mempersekutukan Allah”. Sikap ketegasan Nabi Muhammad SAW. itu juga diperkuat oleh Allah SWT. dengan diturunkannya surat alkafirun (1-6). Di ayat terakhir Allah menegaskan “lakum dinukum waliyadin” (bagimu agamamu dan bagiku agamaku). Dalam Islam, landasan ketauhidan sudah sangat jelas yaitu la ilaha Illa Allah, Muhammadur Rasulullah. Kalimat Laa ilaha illa Allah ini mengandung pengertian yang menjadi inti dari seluruh ajaran Islam. Bagian kedua dari dua kalimat syahadat adalah pernyataan Muhammad Rasulullah. Kalimat ini bermakna bahwa menerima cara pengabdian kepada Allah itu hanya dari nabi Muhammad SAW. Mengakui syahadat pertama tetapi menolak kandungan syahadat yang kedua membuat syahadat seseorang tidak sah. Nabi Muhammad adalah khataman nabiyyin (penutup para nabi), mengakui ada nabi setelah Nabi Muhammad dan juga mendapatkan wahyu berarti penyimpangan dari aqidah Islam dan penyimpangan tersebut tidak boleh ditoleransikan karena itu persoalan keyakinan. Sebagaimana kasus Ahmadiyah yang mengaku Islam tapi berbeda dalam keyakinan (aqidah). Untuk itu, tidak ada toleransi terhadap penyimpangan dasar ajaran Islam. Kalau Ahmadiyah masih mau berada di rumah Islam mereka wajib ruju’ ilalhaq (kembali ke ajaran Islam yang sebenarnya). Arti toleransi Makna leksikal kata toleransi

Oleh Sugeng Wanto, MA

adalah bersabar, menahan diri, membiarkan. Dalam Encyclopedia Americana disebutkan: “Namun toleransi memiliki makna yang sangat terbatas. Ia berkonotasi menahan diri dari pelarangan dan penganiayaan. Meskipun demikian, ia memperlihatkan sikap tidak setuju yang tersembunyi dan biasanya merujuk kepada sebuah kondisi di mana kebebasan yang diperbolehkannya bersifat terbatas dan bersyarat. Toleransi tidaklah sama dengan kebebasan agama, bahkan terlampau jauh dari persamaan hak beragama.” Dalam mengkaji isu toleransi dalam Islam, kita menemukan sebuah situasi yang sama sekali sangat berbeda. Hal itu adalah tidak ada kata bahasa Arab yang sepadan untuk mengartikan apa yang secara tradisional dipahami sebagai “tolerance” (toleransi) dalam bahasa Inggris. Kata yang dipergunakan untuk mendekatkan kata toleransi ini adalah tasamuh, yang telah menjadi istilah mutakhir bagi toleransi. Bentuk akar dari kata ini mempunyai dua macam konotasi: “kemurahan hati” (Jud wa karam) dan “kemudahan” (tasahul). Karena itu, kaum muslimin berbicara tentang tasamuh al-Islam dan tasamuh al-dini sangat berbeda dengan toleransi yang dipahami oleh Barat. Di Barat kata “toleransi” itu menunjukkan adanya sebuah otoritas berkuasa, yang dengan enggan bersikap sabar atau membiarkan orang lain yang berbeda. Namun, dalam Islam kata “tasamuh” yang menjembatani kata toleransi justru menunjukkan kemurahan hati dan kemudahan dari kedua belah pihak atas dasar saling pengertian. Istilah itu selalu dipergunakan dalam bentuk resiprokal (hubungan timbal balik). Dengan demikian toleransi dalam Islam bisa dimaknakan membangun sikap untuk saling menghargai, saling menghormati antara satu

dengan lainnya berdasarkan ketetapan yang diberikan oleh Allah SWT dan Rasul-Nya. Azas toleransi dalam Islam Dari pengertian di atas menunjukkan bahwa Islam bukan agama yang kejam tidak toleran, tidak memiliki welas asih dan kasih sayang terhadap umat yang lain. Islam memberikan penjelasan-penjelasan yang jelas akan pentingnya membina hubungan baik antara muslim dengan nonmuslim. Islam begitu menekankan akan pentingnya saling menghargai, saling menghormati dan berbuat baik walaupun kepada umat yang lain. Allah SWT berfirman: “…Dan pergaulilah keduanya di dunia dengan baik…” (QS.Luqman:15) Ayat ini menyuruh kita untuk tetap berbuat baik kepada orang tua yang jelas-jelas mengajak kita untuk meninggalkan agama tauhid (murtad). Artinya, dalam kontek sosial kemanusiaan tetap harus berlaku baik tapi persoalan aqidah (keyakinan) tidak boleh dipermainkan sekalipun orang tua yang mengajak berbuat musyrik. Ada beberapa hal yang bisa dijadikan sebagai azas pemberlakuan konsep toleransi (tasamuh) dalam Islam ini, antara lain adalah: Pertama, keyakinan umat Islam bahwa manusia itu adalah makhluk yang mulia apapun agama, kebangsaan dan warna kulitnya. Firman Allah SWT: “…Dan sungguh telah kami muliakan anak-anak Adam (manusia)…” (QS. Al-Isra’:70) Maka kemuliaan yang telah diberikan Allah SWT ini menempatkan bahwa setiap manusia memiliki hak untuk dihormati, dihargai dan dilindungi. Kedua, keyakinan umat Islam bahwa perbedaan manusia dalam memeluk agama adalah karena kehendak Allah, yang dalam hal ini telah memberikan kepada makhluknya kebebasan dan ikhtiyar (hak memilih) untuk melakukan atau meninggalkan sesuatu. Allah SWT berfirman: “Jikalau Tuhanmu menghendaki, tentu Dia menjadikan manusia umat yang satu, tetapi mereka senantiasa berselisih pendapat.” (Hud:118). Ketiga, orang muslim tidak diberikan tugas untuk menghisab orang kafir karena kekafirannya. Tapi umat Islam harus tegas dengan kekufuran. Persoalan peng-hisab-an bukanlah

menjadi tugas kita, itu adalah hak prerogatif Allah SWT. Hisab bagi semua adalah di yaumul hisab nanti di yaumil qiyamah/ akhir. Allah SWT berfirman: “Dan jika mereka membantah kamu, maka katakanlah: Allah lebih mengetahui tentang apa yang kamu kerjakan. Allah akan mengadili di antara kamu pada hari kiamat tentang apa yang kamu dahulu selisih pendapat karenanya.” ( 68-69). Keempat, keimanan orang muslim bahwa Allah menyuruh berlaku adil dan menyukai perbuatan adil serta menyerukan akhlak yang mulia sekalipun terhadap kaum musyrik, dan membenci kezaliman serta menghukum orang-orang yang bertindak zalim, meskipun kezaliman yang dilakukan oleh seorang muslim terhadap seorang yang kafir. Allah SWT berfirman: “…Dan janganlah sekali-kali kebencianmu terhadap suatu kaum mendorong kamu untuk berlaku tidak adil. Berbuat adillah, karena adil itu lebih dekat kepada taqwa.” (al-Maidah:8). Kelima, ajaran Islam tidak pernah memaksa umat lain untuk menjadi muslim apalagi melalui jalan kekerasan. Allah SWT berfirman: “Tidak ada paksaan dalam agama”. (QS. Al-Baqarah: 256). M. Quraish Shihab dalam alMisbah menjelaskan bahwa jika seseorang telah memilih salah satu aqidah/agama maka dia terikat dengan tuntunannya dan dia punya kewajiban melaksanakan perintahnya. Penjelasan ini menunjukkan bahwa kalau sudah memilih Islam maka ia harus terikat dengan prinsip ajarannya dan tidak boleh berbeda dengan prinsip ajaran tersebut. Akhirnya, Islam memang agama dakwah. Dakwah dalam ajaran Islam dilakukan melalui proses yang bijaksana. Allah SWT berfirman: “Serulah ke jalan Tuhanmu dengan hikmah, dan pengajaran yang baik dan bantahlah mereka dengan cara yang lebih baik.” (QS. An-Nahal:125) Tidak diragukan lagi bahwa Islam adalah agama yang toleran. Dalam artian, agama yang senantiasa menghargai, menghormati dan menebar kebaikan di tengah umat yang lain (rahmatan lil’alamin). Hal ini tentunya memiliki batasan tertentu yang sesuai dengan aqidah dan syari’at Islam. Wallahu a’lamu. � Penulis adalah Dosen Fakultas Ushuluddin IAIN-SU dan Anggota Komisi Ukhuwwah dan Kerukunan MUI Provinsi Sumatera Utara

Mimbar Jumat

WASPADA Jumat 8 April 2011

BI Berharap Akademi Ciptakan Banyak SDM Syariah UNTUK memenuhi kebutuhan SDM Perbankan Syariah, Bank Indonesia (BI) terus melakukan sosialisasi kepada para akademik. Kali ini di Jawabarat BI mengadakan sosialisasi kepada para praktisi pendidikan dan akademik untuk memenuhi permintaan dari perkembangan perbankan syariah yang semakin pesar. Dalam Sosialisasi tersebut dibuka oleh Direktur Perbankan Syariah BI cabang Jawa Barat Gunawan Setiawan dengan dihadiri 50 dosen perwakilan PT di Jawa. Di kesempatan itu, Gunawan Setiawan mengatakan pertumbuhan perbankan syariah semakin pesat tapi disatu sisi terkendala dengan permasalahan sumber daya manusia (SDM). “Permasa-lahanpermasalahan tersebut yang ingin kami sinergikan dengan lembaga PT,”ujarnya. Dia mengakui, perkembangan industri perbankan syariah harus seiring dengan jumlah SDM yang ada jika ini tak terpenuhi pengembangan perbankan syariah akan mengalami kemunduran. Senada dengan Gunawan, Guru Besar Fakultas Ekonomi Universitas Trisakti Sofyan Safri Harahap, mengatakan saat diperlukan SDM yang berkualitas yang dapat memenuhi pertumbuhan perbankan syariah selain itu perlu menciptakan trainer-trainer di bidang pendidikan terutama pada kampus yang mampu mengajak umat untuk menggunakan sistem ekonomi syariah.

Baginya, sangat terasa sekali kebutuhan SDM Syariah sangat sedikit sekali yang kualitatif di Industri tersebut, disaat pertumbuhan perbankan syariah semakin pesat. Terbukti dengan banyak permintaan dari terbukannya Perbankan dan Unit Syariah di Indonesia. “Oleh karena itu, para dosen menjadi ujung tombak untuk mendidik para calon SDM yang bergelut dalam ekonomi Syariah,”paparnya. Sementara itu desakan Bank Indonesia (BI) agar bank syariah menyalurkan pembiayaan di sektor pertanian disambut positif. Bank Muamalat—sebagai salah satu bank syariah terkemuka di tahun 2011 akan menaikkan porsi pembiayaan pertanian sebesar 4 persen yang sebelumnya hanya sebesar 1 persen. Direktur Corporate Banking Lulu Mahfudah dalam keteranggannya mengatakan saat ini pertanian bukan lagi secondary sector karena sudah mencakup perekonomian global. Pertanian bukan permainan pinggiran lagi, karena sudah memasuki sektor internasional, seperti ekspor sayu rmayur dan lain-lain, produk pertanian juga sudah tidak

Perkembangan Bank Syariah Terkendala SDM Perkembangan bank syariah hingga kini masih terkendala sumber daya manusia (SDM). Akibatnya, tingkat kepercayaan masyarakat menggunakan jasa perbankan syariah belum sesuai harapan. Padahal secara prinsip, bank syariah menggunakan sistem transaksi maupun administrasi yang dipercaya lebih adil dan melindungi hak masyarakat ketimbang bank konvensional, sehingga pemberdayaan umat bisa tercapai. Hal tersebut dikatakan Auditor Bank BNI Syariah Pusat, Abu Muhammad Dwiono Koesen Al Jambi dalam acara Syari’a Economist Training 2 yang diadakan Forum Silaturahmi Studi Ekonomi Islam Komisariat Semarang bekerja sama dengan Bank BNI Syariah Cabang Semarang di ruang kelas Fakultas Ekonomi Unissula Jalan Kaligawe, akhir pekan lalu. Menurut Abu, belum berhasilnya bank syariah hingga kini menjadi pembelajaran para pengelolanya untuk meningkatkan kompetensi dan profesionalitas para pegawainya. “Karena ini bank yang berlandaskan nilainilai keislaman, harusnya, para SDM harus menguasai ilmu Islam secara penuh. Lebih baik lagi jika latar belakangnya dari pendidikan Ekonomi Islam,” tandasnya. Secara bersamaan, kata dia, kejujuran para praktisi perbankan syariah harus ditingkatkan.Selain itu, sosialisasi perihal sistem bank syariah yang mengedepankan prinsip keadilan harus dilakukan secara intens kepada masyarakat. “Selama ini, masyarakat ragu menggunakan jasa perbankan syariah karena takut dananya tidak aman, terlebih bank syariah belum akrab karena masih kecilnya market share dibanding bank konvensional. Memang untuk merubah persepsi negatif masyarakat itu, butuh waktu,” ungkapnya. Dikatakan, untuk mendongkrak kepercayaan masyarakat terhadap bank syariah, maka jika sewaktu-waktu suatu bank syariah mengalami masalah terkait SDM-nya, hendaknya lebih memilih mengkomunikasikan terlebih dulu ke Dewan Syariah Nasional guna dicari solusi terbaik. Seluruh bank syariah, menurutnya, harus meningkatkan layanan hingga menjadi lebih baik ketimbang bank konvensional. “Jangan terkesan kaku. Penguasaan produk syariah juga harus ditingkatkan, sehiangga dapat dengan mudah menjelaskan ketidakpercayaan masyarakat terkait produk syariah,” jelasnya, Dikatakan, pencampuran uang dengan bank konvensional yang notabene induk dari bank syariah bersangkutan, perlu dihindari karena masyarakat akan menganggap bank syariah hanya menambah label syariah pada produk-produknya. Keyakinan bank syariah bisa memberdayakan umat, menurut Abu, karena sistem bagi hasil lebih bersahabat dengan masyakat. Jika untung bank syariah makin besar, maka bagi hasilnya pun lebih besar. “Kalau di bank konvensional, apapun kondisi bank bersang-kutan, bunganya tetap,” ujarnya.(gc/m20)

bisa dianggap remeh lagi, karena hasil dari pertanian adalah makanan pokok kita. “Itulah salah satu alasan kami mengapa menaikkan sektor pembiayaan pertanian,”terangnya. Sementara, Sekretaris Jenderal Ikatan Ahli Ekonomi Islam Indonesia (IAEI) Agustianto menambahkan selama ini banyak peluang-peluang yang bisa diambil oleh bank syariah dalam membidik pembiayaan disektor pertanian. Tapi sebelum mengarah kesana, perlu sebuah pembuatan produk pembiayaan yang

Sistem Keuangan Setan Oleh Emil W. Aulia

khusus untuk pertanian. Agustianto menegaskan dalam fiqh Muamalah banyak sekali akadakad yang bisa dijadikan dalam rujukan pembuatan produk pembiayaan tersebut. “Tinggal sejauh mana bank syariah mampu mengeksplorasinya dengan baik sehingga menjadi sebuah produk pertanian yang berkualitas,” terangnya. Sedangkan Deputi Bidang Restrukturisasi Usaha Kementerian Koperasi dan UKM, Choirul Djamhari, menyambut baik keinginan bank syariah dalam menyalurkan pembiayaan ke sektor pertanian. Sebab di sektor itulah banyak sekali potensi sektor riil yang bergerak. “Saya sendiri akan mendukung langkah-langkah yang diperbuat bank syariah dalam menyalurkan pembiayaan di pertanian,” terangnya. (m06)

Tanpa Persetujuan Jamaah, Nilai Bunga ONH Haram PAKAR Ekonomi Islam, Prof Dr Halide mengingatkan Depag, agar tidak memanfaatkan pendapatan bunga simpanan tabungan haji yang telah mencapai Rp1,2 triliun. Dana itu, dari hasil tabungan haji ONH (Ongkos Naik Haji) yang mencapai Rp 27 triliun. ‘’Apapun alasannya, tanpa persetujuan dari jamaah, hukumnya adalah haram,’’ tegasnya, di hadapan ribuan jamaah Masjid Raya Makassar baru-baru ini. Sampai saat ini, tabungan ONH telah mencapai Rp27 triliun yang tersimpan di bank sejak tahun 2000 an. Bila dihitung, bunganya telah mencapai Rp1,2 triliun. Dengan kata lain, pendapatan dari bunga saja telah mencapai Rp1 miliar/bulan. ‘’Dana ini harus dikembalikan ke jamaah, ataukah bila ingin digunakan harus mendapat persetujuan dari jamaah,’’ katanya. Karena itu, lanjut Halide, dalam waktu dekat ini ia akan diundang ke Jakarta untuk membahas dana tersebut, mengingat jumlahnya yang cukup besar, dan pemanfaatan harus jelas serta mendapat persetujuan dari para jamaah. ‘’Untuk Sulsel saja, mendapat kuota hanya 6.000 jamaah per tahun, bisa dibayangkan berapa lama jamaah harus menunggu dan berapa banyak penghasilan dari bunga simpanan tabungan haji,’’ ungkapnya. Dia juga mengimbau, agar tabungan haji tersebut disimpan pada bankbank syariah dan pada saat calon jamaah tersebut akan berangkat, bunga simpanan itu harus diberikan kepada jamaah, bukannya disimpan di Depag yang selanjutnya instansi ini yang menyimpannya di bank.(gc/m20)

Ulama Sumut Dukung Program Kapoldasu DOSEN STIK-P Medan Ustadz H.Amhar Nasution, menegaskan kondisi riil (nyata) yang ditinggalkan Irjen.PolDrs.Oegroseno,SH masih dirasakan masyarakat Sumut memberi jaminan, bahwa di Sumut tidak ada teroris. Amhar mengatakan kepada Waspada belum lama ini menanggapi kinerja dan kontribusi Kapoldasu lama Oegroseno terhadap penanganan keamanan di Sumut khususnya. Dibuktikan dengan terungkapnya perampokan Bank CIMB Niaga di Dolok Masihul, aman dari judi karena secara integratif belum dirasakan mengganggu Sumut dengan penegakan hukum dan penindakan yang keras dan jelas, tidak ada 86 kasus judi. Kini Polisi berangsur-angsur telah merubah jati dirinya untuk ikhlas melayani masyarakat di kantor Polisi dengan motto: “Jangan sampai ada menetes air mata dan darah di kantor Polisi”, artinya memberi pelayanan terbaik dan ikhlas membangun citra Polri yang santun, tegas. Ke depan diharapkan pada Pemerintah meningkatkan finansial Reskrim agar bekerja profesional, sesuai dengan harapan Kapolri ketika fit and proper test di DPR-RI. Perubahan Polri ke depan dengan jaminan positif, ujar Amhar ketika tausyiah singkat belum lama ini dihadiri Kapoldasu baru Irjen.Pol.Wisjnu Amat Sastro di rumah dinas Kapoldasu. Serta acara zikir dipimpin Buya KH Amiruddin,MS,Phd dilanjutkan shalat Maghrib berjamaah dipimpin ustadz KH Zulfiqar Hajar,Lc. Amhar mengingatkan kepada Kapoldasu baru bahwa ulama di Sumut siap mendukung program Kapoldasu selama berjalan pada koridor, tetapi bila tidak sesuai dengan harapan masyarakat Sumut kami siap juga menantangnya dan bermohon kepada Allah SWT memberikan kekuatan dalam mengayomi umat. (m24)

PMM Sun Yat Sen Gelar Majelis Ta’lim UNTUK meningkatkan pengetahuan keagamaan tentang Aquran dan Al Hadis, Pemuda Masjid Muslimin (PMM) Jl. Sun Yat Sen Komat I Medan bekerjasama dengan Ma’had Aly as-Sunnah Tanjung Morawa menggelar majelis ta’lim. Majelis Ta’lim yang digelar setiap Rabu (malam Kamis) di Jl. Sun Yat Sen dimulai setelah shalat Isya s/d selesai ini diisi oleh Syaikh Utsman Sholeh Aly dari Makkah Saudi yang diterjemahkan al ustadz Indra dan ustadz Sofyan. “Pada majelis ta’lim ini akan membahas tentang kitab Syarh asSunnah Imam al-Barbahary dan beberapa ayat-ayat Alquran sebelumnya,” ujar al Ustadz Indra.Sedangkan untuk Rabu ke tiga dan empat, lanjutnya, akan diisi oleh al ustadz Husnel Anwar Matondang, MA dengan materi kitab shahih Muslim “Dan Insya Allah bagi peserta yang hadir akan mendapatkan buku kecil sunnah yang dapat digunakan sebagai panduan kehidupan seharihari sebagai partisipasinya untuk datang ke majelis ta’lim ini,” lanjutnya kembali. (m38)

Faizula Drs. H. Syarifuddin Drs. H. Lukmanul Hakim Siregar Zaidil H. Ahmad Fuad Sinaga, S.HI H. Mursal Harahap Drs. H. Pandi Filham Lubis H. Djufri M. Mangkuto, SE H.A. Muin Akmal Lubis, MA Mhd. Rahim, S.Pd.I Duroni Lubis Drs. H. Lukman Hakim, M.Pd Drs. Khalidin Musa

Agung Kota Binjai An-Nur Jl. Veteran No. 7 Kel. Tangsi Ar-Rahmah Turiam Kel. Tanah Tinggi Al-Hidayah Jl. Talam Kel. Nangka Al-Hilal Jl. Ikan Arwana No. 17 Kel. Dataran Tinggi Darussalam Kel. Tanah Tinggi Istiqomah Jl. T. Amir Hamzah Kel. Jatinegara Jamik Athohirin Kec. Binjai Utara Nurul Falah Jl. Sisingamangaraja No. 60 Nurul Yaqin Jl. S.M. Raja Kel. Tanah Tinggi Nurul Amin Al-Washliyah Kebun Lada

Drs. H. Jahiruddin Nasution, Lc Timbas Tarigan, Amd. Drs. H. Jannah Siregar Muhammad Arif, S.Ag H. Farhan Rawy, S.Pd.I H. Mhd. Yusuf Tanjung Drs. Misli Tanjung Drs. Wagirin, S.Pd.I Drs. Asmuri Hafiz Drs. H. Ahmad Nasir Drs.Zainul Bahri

STABAT Ar-Raudah Dusun VII Masjid Desa Kebun Balok Al-Furqan Lingkungan I Kel. Kwala Bingai Istiqomah Pasar Baru Stabat

Drs. H. Usminoto Usman H. Tengku Muihammad Nasir H.A. Mahfuz

TEBING TINGGI Amal Muslimin Kp. Rao Amaliyah Jl. K.F. Tandean No.344 Lingk. V Kel. B.Sakti An-Namirah Jl. Gunung Papandayan Lingk. II At-Taufiq Jl. Jend. Sudirman Kel. Sri Padang At-Taqwa Jl. Dr. Kumpulan Pane No. 58

Bachtiar M. Syafi’i, S.Ag Zulkarnain, S.Ag M. Darwin, S.Ag Anshori, S.Pd.I

Waspada/H. Suyono

Ustadz H.Amhar Nasution (paling kiri) bersama Kapolri Jenderal Timur Pradopo,SH, Buya KH Amiruddin,MS dan Irjen.Pol. Drs. Oegroseno,SH (paing kanan) dalam satu pertemuan.)

DELI SERDANG Graha Deli Permai Jl. Tani Bersaudara, K. Namorambe Khairul Fatihin Dusun II Kec. Tg. Morawa Jami’ Jl. T. Imam Bonjol No. 17 Jami’ Jl. Pantai Labu Dusun Masjid Desa Beringin Jami’ Asysyakirin Delitua Jl. Medan-Delitua Km.11,5 Jami’ Al-Ihsan Jl. Imam Abdul Desa Selemak Kec. H.Perak Jamik Al-Ikhlas Jl. Pengabdian Dusun I Desa Bdr. Setia Lembaga Pemasyarakatan Klas II-B Jl.Sudirman No.27 Nursa’adah Jl. Medan-Tg. Morawa, Km. 12 Nurul Ikhwan Jl. H.A. Dahlan Tanjung No. 38 Raya Lubuk Pakam Jl. T. Raja Muda No. 26 Taqwa Jl. Diponegoro No. 1 Lubuk Pakam Ukhuwah Jl. Binjai Km 11,2 Dusun II-III Ds. Mulio Reko BINJAI

JELAS ada yang tidak beres dengan dunia yang kita tinggali saat ini. Hari ke hari, jumlah orang miskin terus bertambah. Kota dan desa dipadati para penganggur sementara pabrik dan industri di sekitar mereka terus berproduksi, mengeksploitasi para pekerjanya dan kekayaan bumi. Ironis dan tragis, ada daerah yang kaya sumber daya alam namun penduduknya melarat, kurang gizi bahkan didera kelaparan. Pelbagai usaha telah dilakukan untuk memperbaiki keadaan. Serangkaian kebijakan politik, ekonomi, hingga proyek pengentasan kemiskinan diluncurkan. Namun tidak satupun yang benar-benar berhasil saat diterapkan. Sementara itu, inflasi kian memperburuk keadaan. Nilai uang merosot, harga barang dan jasa melambung tinggi. Rakyat kecil dan mereka yang berpenghasilan tetap kian menjerit. Otoritas moneter berjuang menekan laju inflasi namun secanggih apapun pendekatannya, akar inflasi tak pernah sungguh-sungguh bisa dihancurkan. Semua upaya memulihkan keadaan masih jauh panggang dari api. Para politisi mengumbar janji, menyatakan kepada khalayak bahwa keadaan akan membaik. Namun tidak ada janji mereka yang benarbenar mampu terealisir. Di sisi lain, resep perubahan dari para akademisi tak pula manjur. Sementara itu, beban utang dan bunga yang harus dibayar pemerintah kepada berbagai lembaga keuangan asing terus melambung. Jenis pajak-pajak baru pun ditingkatkan. Rakyat kian didera krisis demi krisis. Dunia, masyarakat kita, makin terperosok dalam krisis ekonomi yang meluas menjadi krisis hukum, politik, lingkungan, sosial, budaya, dan moral. Jelas, kita sangat membutuhkan perubahan mendasar. Namun, apa dan dari mana memulainya? Mantan Dirut Bank Muamalat A. Riawan Amin mengusulkan perombakan mendasar dimulai dari ranah ekonomi. Menurutnya, akar masalah ada pada sistem keuangan yang kita dan dunia pakai saat ini. Riawan menyebut sistem keuangan moderen itu dalam sebutan “sistem keuangan setan” (satanic finance). Inilah biang kerok yang menyebabkan pelbagai krisis dan kerusakan di muka bumi saat ini. Tiga pilar setan Dalam bukunya berjudul Satanic Finance, True Conspiracies (2007), Riawan menjelaskan cara kerja sistem keuangan setan itu. Sistem itu berdiri di atas “tiga pilar setan” (Three Pilars of Evil). Pilar pertama, penggunaan uang kertas (fiat money). Kedua, cadangan wajib bank (fractional reserve requirement/ FRR). Ketiga, bunga (interest). Uang kertas, pilar pertama satanic finance, kini menjadi sistem global. Uang kertas dicetak dan diedarkan tanpa sokongan logam mulia, dalam hal ini emas atau perak. Itulah fiat money. Uang kertas bernilai —persisnya dianggap bernilai— hanya karena diberi cetakan angka oleh otoritas moneter yang menerbitkannya. Selebihnya, uang kertas hanya lembaran kertas biasa, tak berbeda dengan kertas lainnya. Maka fiat money, sebut Riawan, rentan spekulasi dan manipulasi. Saat penciptaannya melebihi jumlah barang dan jasa yang bisa diproduksi maka inflasipun terjadi. Melalui uang kertas pula, kolonialisasi moderen dijalankan. Tidak perlu serangan militer untuk menguasai negara lain. Negara yang punya mata uang kuat, bisa membuat negara yang nilai mata uangnya lemah, bertekuk lutut. Hanya dengan beberapa trik keuangan dari segelintir pemain keuangan, nilai mata uang sebuah negara mudah digoncang. Pilar kedua, fractional reserve requirement (FRR). Ini juga kebijakan moneter global yang kini juga jamak ada di setiap negara. Kebijakan ini menempatkan

INDRAPURA Burhanuddin Lubis

KISARAN Agung Jl. Imam Bonjol No. 182 Abrarul Haq Haji Kasim Jl. Budi Utomo Kel. S.Baru An-Nur RSU Ibu Kartini PT. BSP Tbk Al-Hidayah Jl. Cokroaminoto Al-Husna Jl. Arwana Kel. Sidomukti Al-Husna Simpang 6 Kel. Kisaran Barat Al-Jihad Jl. Dr. Setia Budi No. 54 Kel. Selawan Al-Muttaqin Jl. Ir. H. Juanda Kel. Karang Anyer Ikhwaniyah Kel. Gambir Baru Kel. Kisaran Timur Jami’ Baiturrahim Kel. Kisaran Naga Jami’ Lingk. I Kel. Bunut

bank-bank sebagai pihak yang leluasa mengucurkan pinjaman (kredit) kepada deposan. Di sini, bank, termasuk bank sentral, ikut mencetak fiat money lalu menggandakannya. Pilar kedua ini, lanjut Riawan, bertemali dengan pilar ketiga; pungutan bunga (interest) –praktik lumrah berikutnya dalam perbankan moderen. Bank memungut bunga karena beberapa alasan: biaya servis atas transaksi pinjaman (utang) atau kompensasi mendapatkan hasil produktif bila uang tersebut diinvestasikan dalam bentuk lain. Apapun alasannya, Taurat, Injil dan Al Quran melarang memungut bunga karena hal itu tergolong riba. Meski terlarang, “tiga pilar setan” itu kini kokoh menguasai sistem keuangan dunia. Kembali ke muamalat Satanic finance adalah sistem keuangan berbasis riba. Islam menentang riba. Allah SWT dan Rasul-Nya menyatakan perang terhadap riba. Namun oleh masyarakat moderen, riba justru dianggap hal biasa. Untuk meruntuhkan sistem riba yang tegak berdiri melalui tiga pilar setannya itu, Riawan menyerukan kembali ke muamalat. Tinggalkan riba.Wujudnya, stop bunga utang dan tinggalkan uang kertas. Dalam muamalat, sistem moneter yang dipakai adalah dinar dan dirham. Dinar adalah koin emas murni seberat 4,25 gram (22 karat); dirham adalah koin perak murni seberat 2,9 gram. Menurut Riawan, keduanya patut dijadikan alternatif pengganti fiat money. Dinardirham bernilai ril karena berbahan baku logam mulia (commodity currency). Ini berbeda dengan uang kertas yang hakikatnya tak lebih dari kertas cetakan belaka, nihil karena tak mewakili nilai emas atau perak. Potonglah sekeping dinar menjadi bagian-bagian kecil, seluruh bagian emasnya tetap berharga namun guntinglah selembar uang kertas maka ia sama sekali tak akan berguna. Disebabkan kandungannya, dinar dan dirham lebih stabil nilainya ketimbang fiat money. Sejarah menunjukkan, dinar-dirham bebas inflasi sementara fiat money adalah biangnya inflasi. Banyak kalangan menyebut dinar-dirham sebagai mata uang surga (the heavens currency). Maksudnya, bukan mata uang yang digunakan di surga melainkan sebagai penjaga keadilan yang menjadi salah satu ciri penghuni surga. Dinar-dirham adalah sistem keuangan berbasis emas dan perak. Sejarah menunjukkan, ribuan tahun peradaban manusia menempatkan emas dan perak sebagai instrumen moneter. Koin emas pertama digunakan 500 tahun sebelum masehi tatkala Raja Croesus berkuasa hingga era Julius Caesar dan Nero. Dinar sendiri dikenal sebagai mata uang Byzantium dan dirham dari Persia. Belakangan, Nabi Muhammad SAW mengakuinya sebagai mata uang. Dinar dan dirham terakhir digunakan sebagai mata uang pada tahun 1924 seiring jatuhnya Kekhalifahan Usmaniah di Turki. Setengah abad lebih menghilang, kini dinar dan dirham kembali bergemerincing melalui dakwah Syeikh Dr Abdalqadir as-Sufi. Di era moderen ini, murid Syeikh, Prof Umar Ibrahim Vadillo mencetak kembali dinar-dirham di Spanyol (1992). Tujuannya, menegakkan kembali sunnah yang hilang sekaligus jawaban Islam melawan riba-akar sistem keuangan setan. Dinar dan dirham telah kembali. Peredarannya kini meluas di 22 negara termasuk Indonesia. Inilah saat bagi muslim untuk memilih: berdamai dengan “sistem keuangan setan” yang berlaku sekarang dengan segala bencana yang ditimbulkannya atau memilih tata keuangan Islam (muamalat) untuk menyelamatkan keadaan. Wallahu-alam bis-shawab. Emil W. Aulia, Manager Wakala Amal Madinah Medan

LPM IAIN-Sumut Dan RRI LEMBAGA Pengabdian Masyarakat (LPM) IAIN-SU sebagai sebuah perguruan Tinggi Agama Islam Negeri (PTAIN) tidak saja memfokuskan diri di kampus untuk menimba ilmu pengetahuan keislaman, tetapi juga mengabdikan diri di tengah pergaulan kemasyarakatan seperti dalam ceramah, khutbah Jum’at, pelatihan bilal mayit dan lain-lain. Ceramah diisi dosen IAIN sebagai nara sumber interaktif Hukum Islam dan kemasyarakatan yang dikemas sebagai bentuk kerjasama LPM IAIN-SU dengan Radio Republik Indonesia (RRI Medan). Menarik untuk dicermati pengabdian dosen IAIN-SU melalui radio ini yaitu kesempatan menyampaikan ilmu yang dimiliki dengan topik tertentu yang dipersiapkan sebelumnya dan secara be-bas menyampaikannya kepada masyarakat pendengar radio dengan presenter yang sudah terlatih secara matang yang disiapkan RRI. Presenter mengerahkan pembicaraan sehingga tujuan maksimal tercapai. Dosen IAIN yang tampilpun tampak betul-betul menguasai topik yang diamanahkan kepadanya terbukti banyaknya SMS dan pertanyaan yang dikemukakan yang kadangkadang jauh melenceng dari topik yang ditentukan namun Dosen IAIN sebagai pesanan LPM IAIN tetap dapat memberikan jawaban yang memuas-

Al-Abidin Jl. Kom. Yos Sudarso Kel. Lalang M. Tahir Nasution Al-Hidayah Lingk. 03 Jl. Kunyit Kel. Tg. Marulak Hilir Syahroni, S.Pd.I Al-Ikhlas Jl. H.S. Beringin Lingk. 6 Muqarrabin Abror, S.Pd.I Al-Ikhlas Lingk. 03 Kel. Tanjung Marulak H. Wijaya Damanik Al-Ihsan Simp. Dolok Kel. Sri Padang Kec. Rambutan H. Syaiful Arjuna Al-Jihad Jl. Gunung Arjuna Lk. 01 Kel. Mekar Sentosa H.M. Khalil Al-Muttaqin Jl. Sofyan Zakaria Lingk. 2 H. Sujarno Alamsyah, S.Ag, MM Al-Mukhlis Jl. Ahmad Yani Abu Hayim Siregar Al-Maryam Jl. Darat Lingk. VIII Kel. Rambung Drs. H.P. Dasopang Al-Muthmainnah Lingk. I Kel. D.Sundoro Ilyas Hiban, S.Ag Al-Haq Kel. Deblot Sundoro Kec. Padang Hilir Drs. H. Akhyar Nasution Al-Qomar Perum. Purnama Deli Lingk. V Kel. Bulian Khairuddin Noor Hasibuan Darul Jannah Jl. Bhakti LKMD Lingk. 01 Kel. Lalang Muslim Istiqomah Darul Jihad Brimob Jl. Ahmad Yani H.M. Amin Lubis Farida Jl. H. Ahmad Bilal Lingk. V Kel. Damar Sari Drs. Abdul Kholik, MAP Hikmah Jl. Lengkuas Lingk. II Kel. Bandar Sakti Mahyuddin Ardy Rangkuti Jami’ Jl. Batu Bara Kel. Satria H. Amir Hasan, BA Nurul Huda Jl. Bukit Bandar Lingk. 03 Kel. Lalang Drs. H. Syabaran Harahap Nurul Islam Jl. Pulau Irian Lingk. 04 Kel. Persiakan Aminullah, S.Pd.I Nurul Ikhwan Rumah Sakit Sri Pamela Drs. H. Gazali Saragih Raya Nur Addin Jl. R. Suprapto No. 126 Supardi Syuhada Jl. Iskandar Muda No. 70 Drs. Daulat Sibarani Taqwa Jl. Prof. H.M. Yamin SH, Kampung Keling Asnami M. Alam/Mhd. Idris Sitorus Jami’ Indrapura


Drs. H. Yusuf Marpaung H. Ahmad Bin Yasir H. Nono Astono H. Salman Tanjung, MA Drs. H. Mahmuddin Lubis Drs. Malkan, SH H. Ahmad Kosim Mrp., S.Ag, M.SI Suyatno Patriadi Lubis Drs. Muhilli Lubis H. Nurul Ichsan, S.

kan, tetap dapat memberikan jawa-ban memuaskan. Sebagai contoh topik yang dibahas adalah tentang perkawinan berbeda agama. Islam melarang perkawinan berbeda agama seperti dengan Kristen, Hindu atau Budha. Ini menunjukkan betapa urgensi memperhatikan aqidah dalam perkawinan. Umat Islam harus memilih yang seaqidah dalam melangsungkan perkawinan. Bila diperhatikan yang pernah terjadi pada masa Rasulullah Saw yaitu laki-laki muslim yang bermaksud menikahi wanita non muslim di Madinah dan menyampaikan hal itu kepada Nabi Saw, maka turunlah ayat 221 surat Al-Baqarah yang melarang menikahi wanita musyrik. Dosen IAIN juga menyampaikan tentang aliran sesat seperti Ahmadiyah yang banyak diperbincangkan dalam masyarakat yang masih aktual sampai sekarang. Dosen utusan LPM IAIN-Sumatera Utara yang mengudara di RRI telah tampil DR. H. Hasan Mansur Nasution, MA dan Prof. DR.H. Ramli Abdul Wahid, MA, dan yang akan datang akan tampil Prof. DR. Nur A. Fadhil Lubis, MA (Rektor IAIN-SU) dengan topik: IAIN dan Perkembangan Hukum Islam di Indonesia. Dosen lainnya menyusul. Insya Allah.(m20)

Nurul Yaqin Kantor Direksi - Kisaran Siti Zubaidah Jl. Budi Utomo No. 285

Drs. H. Abd. Rasyid H. Nummat Adam Nst., Lc

LABUHAN BATU An-Nur Desa Kuala Bangka Baiturrahman Kec. Kualuh Hilir

Syamsul Bahri Tanjung Aslan Marpaung

BATU BARA Jami’ Al Mukhlisin PT. Moeis Nurul Huda Desa Tanah Tinggi Kec. Air Putih Quba Tanjung Kubah Kec. Air Putih Syuhada Sukaraja Jl. Raya Medan-Kisaran Km. 108

S.M. Ruslan Sueb Burhanuddin Lubis H. Lukman Yanis, HS Muslim, AR

PEMATANGSIANTAR Al-Ikhlas Jl. Nagur Kel. Martoba

Rudi Hartono, S.Ag

RANTAU PRAPAT Al-Qodar Jl. Terpisang Mata Atas

Drs. H. Ahmad Ruzaini Hsb.

SIBOLGA Al-Munawar Sibolga Jl. Tapian No. 10-A

H. Zainun Sinaga

BIREUEN Masjid Agung Bireuen Masjid Taqwa Kec Gandapura Masjid Besar Kutablang Masjid Besar Peusangan Masjid Besar Peusangan Siblah Krueng Masjid Besar Peusangan Selatan Masjid Besar Al-Furqan Kec Kota Juang Masjid Ridha Kec. Jeumpa Masjid Besar Kec. Kuala Masjid Besar Baitul Huda Kec. Juli Masjid Al Hijrah Juli Masjid Besar Peulimbang Masjid Baitunnur Peudada Masjid Baiturrahim Kec Jeunieb Masjid Al-Mabrur Kec Pandrah Masjid Besar Samalanga

Tgk H Ismuar Yusuf S.Ag Tgk M Kafrawi Murtadha S.Ag Tgk Anwar Tgk H Imran Tgk Ismail Tgk Dahlan Bentara Tgk H Umar Budiman Tgk Abi Usi Tgk Abdul Hamid Tgk Jamil Kasim Tgk Faisal Hadi Tgk Sulaiman Saman Tgk Akmal M Ali Tgk Zulkarnaini Tgk Mansur Tgk H Ismail Yusuf

Mimbar Jumat

C6 K

Bencana, “Takdir” Atau Akibat Perbuatan Manusia

ita tidak punya banyak kosa kata untuk menjelaskan pristiwa menyakitkan dan menyedihkan yang menimpa bangsa ini. Satu-satunya kata yang kita punya adalah bencana. Menariknya kata inilah yang kita gunakan untuk menyebut semua peristiwa naas itu. Gempa dan Tsunami kita sebut bencana. Banjir dan tanah longsor juga kita sebut bencana. Pesawat yang jatuh, kapal yang tenggelam, dan kereta api yang bertabrakan dengan truk, juga kita sebut bencana. Mungkin ada yang menyebut musibah, namun kata ini sendiri berasal dari Bahasa Arab. Akibat miskinnya kosa kata ini, kita menjadi tidak mampu lagi membedakan peristiwa-peristiwa yang mengenaskan itu, antara yang natural dengan peristiwa yang disebabkan oleh tangan manusia sendiri. Oleh sebab itu, kita perlu kembali kepada Al-Qur’an dan membiarkannya berbicara sendiri tentang bencana. Setidaknya ada tiga kata yang sering dipakai AlQur’an untuk menjelaskan peristiwa menyedihkan dan menyakitkan itu; musibah, bala dan fitnah. Kata musibah terambil dari kata a, sh dan b (ashaba) yang berarti mengenai atau menimpa. Kata ini juga dapat berarti “sesuatu yang tidak enak atau tidak menyenangkan.” Kata musibah disebut 10 kali sedangkan kata yang seakar dengannya disebut sebanyak 76 kali. Menurut M. Quraish Shihab, jika kata musibah ini dianalisis setidaknya ada tiga hal yang penting diperhatikan. Pertama, musibah terjadi karena ulah manusia, antara lain karena dosanya (surat AsSyura (42) ayat 30, An-Nisa’ (4) ayat 79.) Kedua, Musibah tidak terjadi kecuali atas izin Allah swt.( Surat AtTaghabun (64) ayat 11) Ketiga, Musibah antara lain bertujuan untuk menempa manusia dan karena itu dilarang berputus asa. (Surat Al-Hadid (57) ayat 22-23). Selanjutnya kata bala’ ditemukan di dalam Al-Qur’an sebanyak 6 kali. Kata ini semula bermakna tampak atau nyata. Selanjutnya kata ini berarti “ujian yang dapat menampakkan kualitas keimanan seseorang.” Dari 37 kata bala’ ada beberapa hakikat kata ini yang menarik direnungkan. Pertama, bala itu adalah keniscayaan hidup. Itu dilakukan Allah tanpa keterlibatan orang yang diuji. Semuanya ditentukan Allah mulai dari cara, bentuk dan waktunya.( Surat Al-Muluk (67) ayat 2). Kedua, ada kalanya ujian itu tidak menyenangkan manusia, namun ada juga bala yang menyenangkan. Namun semuanya tetap ujian. (Surat Al-Baqarah (2) ayat 155, AlAnbiya’ (21) ayat 35). Ketiga, bala


Oleh Azhari Akmal Tarigan

adalah cara Tuhan mengampuni dosa manusia, menyucikan jiwa dan meninggikan derajatnya. (Surat Ali-Imran (3) ayat 154). Berikutnya kata fitnah yang pada mulanya berarti membakar. Selanjutnya kata fitnah ini berarti ujian yang maha berat. Kata fitnah juga bermakna peringatan yang jika tidak diindahkan manusia mengakibatkan kemarahan Allah swt. Kata ini dalam berbagai bentuknya disebut sebanyak 60 kali. Dalam hal tertentu kata fitnah memiliki kesamaan dengan kata bala.( Surat AlAnfal (8) ayat 25, 28). Berkenaan dengan pengaruh dosa atau perbuatan maksiat terhadap bencana dapat kita lihat dalam beberapa ayat berikut ini. Pertama, Firman Allah di dalam surat Al-A’raf ayat 96 yang artinya, “Jikalau sekiranya penduduk negeri-negeri beriman dan bertaqwa, pastilah Kami akan melimpahkan kepada mereka berkah dari langit dan bumi, tetapi mereka mendustakan (ayat-ayat Kami) itu, maka Kami siksa mereka disebabkan perbuatannya. (QS. 7:96). Kedua, Firman Allah di dalam surat Hud ayat 117 yang artinya, Dan Tuhanmu sekali-kali tidak akan membinasakan negeri-negeri secara zalim, sedang penduduknya orang-orang yang berbuat kebaikan (muslihun). Ketiga, Firman Allah di dalam surat AlAnkabut ayat 40 yang artinya, Maka masing-masing (mereka itu) Kami siksa disebabkan dosanya, maka diantara mereka ada yang Kami timpakan kepadanya hujan batu kerikil dan diantara mereka ada yang ditimpa suara keras yang menguntur, dan diantara mereka ada yang Kami benamkan ke dalam bumi, dan diantara mereka ada yang Kami tenggelamkan, dan Allah sekali-kali tidak hendak menganiaya mereka, akan tetapi merekalah yang menganiaya diri mereka sendiri. (QS. 29: 40).

Berangkat dari ayat-ayat di atas, jelas sekali keterkaitan antara bencana yang diturunkan Allah dengan sikap perbuatan manusia. Ketakwaan dan kesalehan manusia telah cukup menjadi alasan bagi Allah untuk menurunkan keberkahan baik dari langit ataupun dari bumi. Para mufassir menyebut makna keberkahan di dalam Al-A’raf ayat 96 adalah kemudahan bagi manusia dalam mengelola alam ini untuk kesejahteraan hidupnya. Sebaliknya kedustaan, penolakan dan pengingkaran manusia terhadap ayat-ayat Allah, itu juga telah cukup untuk mengundang kemarahan Allah Swt sehingga ia menurunkan azabnya. Oleh sebab itu, analisis ilmiah manusia dengan menggunakan perangkat ilmu dan tekhnologi sejatinya harus dilengkapi dengan analisis qur’aniyah. Ilmu pengetahuan dan tekhnologi mampu menjelaskan secara rasional mengapa terjadi gempa, stunami, banjir dan sebagainya. Akan tetapi analisis ini tidak akan membuat kita melakukan instropeksi diri. Akan tetapi dengan menggunakan perangkat analisis qur’ani kita akan sampai pada satu kesimpulan bahwa kemaksiatan manusialah sebenarnya yang mengundang bencana itu sendiri. Paling tidak kedurhakaan yang dilakukan manusia telah mempercepat bencana tersebut. Layak kita renungkan, kendatipun yang melakukan kemaksiatan hanya sebagian kecil manusia tetapi akibatnya dapat menimpa semua manusia tanpa memandang bulu, apakah ia orang saleh atau tidak. Di dalam surat Al-Anfal ayat 25 dengan jelas Allah menyatakan, Dan peliharalah dirimu dari pada siksaan yang tidak khusus menimpa orangorang yang zhalim saja diantara kamu. Dan ketahuilah bahwa Allah amat keras siksaan-Nya. (QS. 8:25). Ayat ini mengingatkan manusia bahwa kemaksiatan dan kedurhakaan yang mengakibatkan kemurkaan Allah Swt. tidaklah hanya menimpa para pelakunya saja. Akan tetapi orang-orang saleh juga akan merasakan akibatnya. Untuk itulah bagi setiap muslim berkewajiban untuk melaksanakan amar ma’ruf nahi munkar. Berkenaan dengan ayat ini, M. Quraish Shihab dalam Tafsirnya AlMisbah menyatakan bahwa sendisendi bangunan masyarakat akan

melemah jika kontrol sosial melemah. Akibat kesalahan tidak hanya menimpa orang yang bersalah. Ayat ini mengingatkan tabrakan tidak hanya terjadi akibat kesalahan kedua pengendara. Bisa saja yang bersalah hanya seorang, tetapi kecelakaan dapat beruntun menimpa sekian banyak kendaraan. Oleh sebab itu dalam pandangan Alqur’an sangat tidak bisa diterima jika ada orang yang mengatakan, bahwa kemaksiatan yang dilakukannya apakah berzina, berjudi dan lain sebagainya itu adalah urusan pribadinya sendiri. Orang lain tidak boleh ikut campur. Dalam pandangan Alqur’an pernyataan ini keliru. Oleh sebab itu kontrol sosial dan pengawasan dari masyarakat menjadi mutlak penting. Amar ma’ruf nahi munkar harus tetap jalan dan tidak boleh berhenti. Namun harus diingat, amar ma’ruf dan nahi munkar tersebut harus tetap dalam bingkai yang ma’ruf pula. Oleh sebab itu, cara yang paling tepat untuk menolak bala-bencana adalah dengan kembali kepada jalan Allah Swt. Selanjutnya bencana apapun yang terjadi di negeri ini sejatinya tidak membuat kita berburuk sangka kepada Allah swt. Bencana memang menyakitkan dan akan menyengsarakan. Akan tetapi jika manusia mampu menangkap pesannya dengan baik, bencana adalah cara Allah swt. berkomunikasi kepada kita agar kita mengingatnya dan kembali kepadanya. Bencana juga merupakan media dan sarana yang diciptakan AllahSwt buat kita untuk membakar dosa-dosa sehingga kita kembali menjadi manusia bersih dan suci. Bencana juga cara Allah menempa kita agar menjadi orang yang tegar dan kuat dalam menghadapi berbagai macam ujian. Uraian di atas setidaknya menunjukkan kepada kita beberapa hal. Pertama, bencana alam hakikatnya merupakan akibat dari perbuatan manusia itu sendiri. Kedua, bencana berada dalam kehendak dan kekuasaan Allah dan ia juga berkuasa untuk menahannya. Oleh sebab itu manusia harus meminta kepadaNya untuk tidak menurunkan azabNya dengan cara membangun ketak-waan diri dan kesalehan sosial. Ke-tiga, bencana juga mengandung nilai-nilai positif bila disikapi secara arif dan bijaksana. Adalah keharusan bagi kita untuk mengambil pelajaran darinya sehingga kita menjadi lebih kuat dan lebih baik pada masa mendatang. Wallahu a’lam bi alshawab. � Penulis adalah Koordinator Tim Penulis Tafsir Al-Qur’an Karya Ulama Tiga Serangkai Sumut.

Eksistensi Jahiliyah Moderen

atakanlah, ‘maka apakah kamu menyuruh aku menyembah selain Allah, wahai orang-orang yang jahil (yang tidakberpengetahuan)’ (QS. Az-Zumar: 64). Membicarakan jahiliyah maka pikiran kita akan langsung tertuju pada masa sebelum Rasulullah Saw diutus oleh Allah SWT di Negeri Arab untuk sekalian umat manusia. Namun, kita sering terjebak dengan peristilahan jahiliyah, yang selalu kita artikan dengan kebodohan belaka. Sehingga identik dengan keterbelakangan, kemunduran ataupun tradisional. Pada akhirnya, jahiliyah hanya ada pada masa lalu. Padahal jahiliyah itu senantiasa ada sampai saat sekarang ini. Di zaman yang penuh dengan kemajuan ini, ditandai

Oleh Diah Widya Ningrum, S.Pd.I

dengan pesatnya perkembangan Ilmu Pengetahuan dan Tekhnologi (IPTEK) kerap kali di jumpai indikasi dari apa yang ada dalam pe-

Konsultasi Al-Quran Ikatan Persaudaraan Qari-Qariah & Hafizh Hafizah (IPQAH Kota Medan) KONSULTASI AL-QURAN adalah tanya jawab sekitar Al-Quran, yang meliputi: tajwid, fashohah, menghafal Al-Quran, Ghina (lagu) Al-Quran, Hukum dan ulumul Al-Quran. Kontak person. 08126387967 (Drs. Abdul Wahid), 081396217956 (H.Yusdarli Amar), 08126395413 (H. Ismail Hasyim, MA) 0819860172 (Mustafa Kamal Rokan).

Assalamu’alaikum Wr.Wb. Al-Ustaz, Sebelum Al-qur’an dibukukan, adakah Rasulullah menyuruh untuk membukukan Al-qur’an? Dari manakah Rasulullah beramal ketika belum adanya Al-qur’an ?, Yang kedua ustad, mengapa Al-qur’an disebut Ummul kitab ? dari 085762494047 Jawab : Terimakasih atas pertanyaanya. Rasulullah memang menyuruh untuk membukukan Al-qur’an sejak wahyu awal diturunkan. “Zaid bin Tsabit menceritakan bahwa ia sering dipanggil dan diberi tugas penulisan Al-qur’an saat wahyu turun”, dan Rasulullah berkata: “ Siapa yang telah menulis sesuatu dariku selain Al-qur’an, maka ia harus menghapusnya” (HR muslim). Sirah Ibnu Hisyam menceritakan bagaimana “marahnya umar ketika saudara sepupunya sedang membaca Al-qur’an yang ada dalam sepotong tulisan”. Bukti ini menyimpulkan bahwa Al-qur’an memang ditulis sejak awal dan Rasul menyuruh untuk itu. (M.M. Al-A’zami, Sejarah Teks Al-qur’an, hal 71). Sebelum Al-qur’an turun Rasulullah melakukan amal dengan pedoman pada sisa millah Ibrahim dan Ismail yang masih ada, Tradisi dari millah Ibrahim ini masih ada terlihat di masyarakat Arab dengan mereka masih berthawaf, walaupun dengan tata cara yang salah yaitu dengan tanpa pakaian, bersiul dan bertepuk tangan. Di gua Hira sesungguhnya Rasul tidak berdo’a dengan tata cara do’a seperti kita sekarang, beliau hanya merenung, menyepi dan bertahannus, berfikir dan melakukan evaluasi tentang masyarakatnya. Surat Al-fatihah mempunyai banyak nama, Qurais Syihab menyebut lebih dua puluh nama yang disandang kepada surat AlFatihah ini. Diantara sekian banyak nama tampaknya ada empat nama yang sangat popular, yaitu: Al-Fatihah, Ummul Al-qur’an , As-sab’ul Matsani dan Ummul Kitab. Tafsir Ibnu Katsir menyebutkan bahwa jumhur ulama menyebut surat AL-Fatihah dengan Ummul kitab karena mereka tidak suka menyebutnya dengan istilah Fatihatul Kitab. Penyebutan Ummul kitab didasarkan pada hadis sahih riwayat imam Turmudzi dan dinilai shahih olehnya, bahwa Abu Hurairah menyatakan bahwa Rasulullah bersabda: “ Alhamdulillahirobbil ‘Alamin adalah Ummul qur’an, ummul kitab, sab’ul Matsani, Dan Alqur’anul ‘Azim. Wallahu A’lam. Al-Ustadz H. Ismail Hasyim, MA

mikiran kita tentang jahiliyah. Era kekinian disebut dengan Era Modern atau lebih dari itu Post-Modern, kita justru melihat berbagai hal yang tidak jauh berbeda dengan apa yang terjadi sebelum Rasulullah Saw diutus ke muka bumi bahkan lebih parah dari itu. Sebagai contoh, membunuh anak lewat praktek prostitusi, membuang anak ke lobang sampah, ke selokan atau pun di mana saja memperjual belikan anak, dan lain sebagainya. Ini menunjukkan betapa jahiliyahnya masyarakat sekarang. Dengan demikian, kata jahiliyah tidak menunjukkan tempat, atau waktu tertentu saja. Sebab, jahiliyah berarti kebodohan tentang kebenaran dan hidayah Allah SWT. Berarti, ia bisa menghinggapi siapa saja dan kapan saja. Kondisi Moral Masyarakat Jahiliyah Pra-Islam Masyarakat Arab Pra-Islam menganut faham polytheisme (menyembah banyak Tuhan). Mereka mengadakan persekutuan kepada Allah denganmenyembah banyak berhala.Setidaknya ada tiga berhala yang paling besar merupakan sesembahan mereka, yaitu: Manat yang ditempatkan di Musyallal di tepi laut Merah di dekat Qudaid. Kemudian Lata di Tha’if dan Uzza diWady Nakhlah. Dan masih banyak lagi berhala yang lainnya. Tatkala Rasulullah menaklukkan Mekkah, disekitar ka’bah ada tiga ratus enam puluh berhala. Beliau memerintahkan agar berhalaberhala itu dikeluarkan dan dibakar. Begitulah kisah kemusyrikan dan penyembahan terhadap berhala yang menjadi fenomena terbesar dari agama orang-orang jahiliyah. Di kalangan bangsa Arab terdapat beberapa kelas masyarakat, yang kondisinya berbeda antara satu dengan yang lainnya. Hubungan seseorang dengan keluarga di kalangan bangsawan sangat diunggulkan dan diprioritaskan sekalipun harus dengan pedang yang terhunus dan darah yang tertumpah. Di antara kebiasaan yang sudah dikenal pada masa jahiliyyah ialah poligami, tanpa ada batasan, berapa pun banyaknya istri yang dikehendaki. Demikian pula sebaliknya dengan praktek poliandri, yaitu pernikahan satu wanita dengan beberapa orang laki-laki. Mereka hidup untuk fanatisme kabilah dan mati pun rela karenanya. Landasan aturan sosial adalah fanatisme rasial dan marga. Secara garis besar, kondisi sosial mereka bisa dikatakan lemah dan buta, khurafat tidak bisa dilepaskan,

manusia hidup layaknya binatang, wanita diperjual belikan dan kadangkadang diberlakukan layaknya benda mati. Pemerkosaan ataupun perzinahan sudah merupakan aktivitas yang tidak tabu di mata masyarakat. Anakanak perempuan dibunuh hiduphidup karena takut malu. Perempuan menempati posisi yang sangat rendah di kalangan masyarakat. Hubungan di tengah masyarakat sangat rapuh dan gudang-gudang pemegang kekuasaan dipenuhi kekayaan yang berasal dari rakyat. Begitulah kondisi singkat masyarakat jahiliyah pada waktu dulu. Bila ditarik ke kondisi kekinian, tidak jauh berbeda, dekadensi moral yang terjadi mirip seperti apa yang sudah terjadi pada era jahiliyah. Jahiliyah Modern Bila kita saksikan tayangan televisi, mendengar dari radio, membaca lewat media massa, tabloid, majalah dan sebagainya. Senantiasa hadir berita-berita kriminalitas, tindakan amoral, penyalahgunaan seksual, penyalahgunaan jabatan, seperti KKN, Ijazah palsu, Money politic. Satu sisi setiap hari pula kita saksikan bagaimana penegak hukum mengambil tindakan tegas terhadap pelaku kriminal seperti penangkapan pengedar, pemakai obat-obat terlarang, penangkapan terhadap pelaku curanmor, perampokan dan masih banyak lagi. Namun, kenapa tidak ada habis-habisnya ?. bahkan terkesan semakin banyak dan merajalela. Hari ini, kita harus mengkaji diri sendiri terhadap situasi dan kondisi diri serta keadaan jiwa kita. Ada beberapa hal yang perlu untuk diwaspadai dan dijauhi agar dekadensi moral mampu diminimalisir di era modern ini. Antara lain adalah: Pertama, watak sombong yang dimiliki oleh manusia dengan menganggap dirinya lebih dari orang lain. Sifat ini adalah sifat Iblis yang ditularkannya kepada manusia. Q.S. alA’raf : 12 “aku lebih baik dari dia. Engkau ciptakan aku dari api sedangkan ia dari tanah”. Sifat sombong ini tidak hanya membuat manusia menolak hidayah Allah, tapi juga menjauhkannya dari orang banyak. Kedua, berprasangka buruk terhadap Allah. Manusia yang menolak hidayah Allah juga disebabkan karena tidak berprasangka baik (husnuz Zhon) kepada Allah. Mereka memang mengakui keberadaan-Nya, kekuasaan-Nya, tetapi berprasangka yang bukan-bukan terhadap-Nya. Akibatnya, mereka menyekutukan Allah, mengingkari perintah-Nya dan mengabaikan larangan-Nya. Akhirnya mereka tidak hanya sesat tapi juga menyesatkan. Wallahu a’lamu �Penulis adalah Guru Madrasah ‘Ali-yah Al-Jam’iyatul Washliyah Perbaungan.

WASPADA Jumat 8 April 2011

Rahasia Tidur Rasulullah Berbaringlah Ke Kanan (1) Terkait dengan waktu tidur yang terbaik tentu saja pada waktu malam. Sebab, siang hari pada umumnya manusia bekerja dan malam hari waktunya beristirahat. Meskipun begitu ada juga sementara orang yang bekerja di malam hari sehingga mengganti tidurnya di siang hari, seperti dokter dan perawat di rumah sakit. Oleh karena itu, jam-jam tidur setiap manusia berbeda-beda, tergantung frekuensi kegiatan dan jam-jam sibuk orang itu. Akan tetapi ada waktu tidur akan membawa mimpi buruk, karena pada saat itu terjadi perpindahan suasana, seperti pada waktu shalat shubuh atau waktu ashar (sore hari). Rasulullah SAW selalu bangun di malam hari untuk mengerjakan ibadah shalat tahajjud. Saking lamanya shalat sampai kakinya bengkak, sehingga waktu tidur Nabi Muhammad SAW sangat terbatas alias tidak berlebihan. Selain itu,, posisi tidur pun mempunyai andil besar dalam menjaga vitalitas kesehatan tubuh. Dalam hal ini Ibnu Qayyim Al-Jauziah dalam bukunya metode pengobatan Nabi SAW mencatat beberapa hal tentang tidur yang dapat membahayakan bagi kesehatan. Tidur di bawah sengatan matahari misalnya, dapat memicu timbulnya penyakit terpendam. Tidur antara sinar matahari dengan tempat teduh juga tidak baik. Diriwayatkan dari Abu Daud dalam sunannya dari hadist Abu Hurairah, ia menceritakan: Rasulullah SAW bersabda: “Kalau salah satu di antara kalian berada di bawah matahari, tiba-tiba terkena teduh sehingga sebagian tubuhnya di bawah sinar matahari dan sebagian lagi ditempat teduh maka hendaknya ia bangkit”.Secara logis hal ini mudah dipahami, karena cahaya matahari menyebabkan berbagai penyakit seperti tekanan panas klenger (sunstroke), kejang otot (kram), dan lainlain. Penyakit-penyakit yang timbul karena cahaya matahari ini memiliki aneka ragam ciri dan gejala, yang untuk lebih detailnya memerlukan penjelasan sendiri. Bagaimana dengan posisi tidur? Dalam riwayat yang dicatat Abu Umamah dalam Musnad dan Sunan Ibnu Majah menyebutkan bahwa Nabi SAW pernah lewat di hadapan seorang lelaki yang sedang tidur menelungkup maka beliau menyepaknya dengan kaki beliau sambil bersabda: “Bangun dan duduklah! Inilah tidurnya para ahli neraka!”.(Bersambung). (Sumber dikutip dari berbagai buku hadist shahih).

Pemikiran Pendidikan Ibnu Sina Oleh Rahmat Lubis


bnu Sina yang memiliki nama lengkap Abu Ali Al-Husain bin Abdullah bin Sina, dilahirkanTahun 370 H/ 980 M di Afshana, sebuah kota kecil dekat Bukhara, sekarang wilayah Uzbekistan (bagian dari Persia). Ketika lahir ayahnya menjabat Gubernur di salah satu pemukiman Nuh ibnu Mansur (Sekarang wilayah Afganistan). Ibn Sina memiliki kepintaran dan ingatan luar biasa. Sejak kecil, banyak orang yang mengaguminya, bahkan pada usia 10 tahun telah hafal Alquran seluruhnya. Pada usia 17 tahun, ia telah memahami banyak teori kedokteran. Karena kepintarannya ia diangkat sebagai konsultan dokter-dokter praktisi. ini terjadi setelah ia berhasil mengobati Pangeran Nuh ibn Manshur, yang tidak seorang pun yang dapat menyembuhkannya. Ia diberi kebebasan belajar di perpustakaan istana. Ia juga pernah jadi menteri pada masa Sultan Syams al-Daulah yang berkuasa di Hamdan. Di usia 18 tahun, ia memperoleh predikat fisikawan, dan menemukan bahwa Kedokteran bukanlah ilmu yang sulit ataupun menjengkelkan, seperti matematika dan metafisika. Di antara guru yang mendidiknya adalah Abu ‘Abd Allah al-Natili dan Isma’il sang Zahid. Karena kejeniusannya, sampaisampai ia mampu melampaui ilmu gurunya. Sebagai pemikir ulung Ibnu Sina tidaklah terlepas dari cobaan yang menimpanya, tatkala perpustakaan istana terbakar, musuh-musuhnya menuduh Ibn Sina yang membakarnya agar tidak orang yang bisa menandingi ilmunya. Bahkan ia sempat dipenjarakan Putra Al-Syam al-daulah, yang akhirnya ia melarikan diri ke Isfahan, dikota inilah ia menjalani kiprahnya sebagai seorang intelektual. Ibnu Sina wafat pada usia 58 tahun, tepatnya pada tahun 1037 M di Hamadan, Iran, karena penyakit maag yang kronis. Beliau wafat ketika sedang mengajar di sebuah sekolah. A. Pemikiran Pendidikan Islam Ibn Sina 1. Hakikat Manusia Dalam pemikiran ibnu sina, Secara garis besar, manusia terdiri dari unsur jasmani dan rohani. Keduanya mesti dikombinasikan. Namun dalam kajian filsafat, unsur rohani atau jiwa mendapat perhatian lebih karena dianggap sebagai hakikat manusia yang sesungguhnya. Demikian halnya dengan Ibn Sina, meskipun ia sebagai seorang dokter yang mengkaji tentang organ tubuh manusia secara jasmani, tetapi ia juga memiliki pemikiran yang unik tentang jiwa. Ibnu Sina berpendapat bahwa akal pertama mempunyai dua sifat yaitu: a. Sifat wajib wujudnya, sebagai pancaran dari Allah (Wajib al Wujud li ghairihi), dan b. Sifat mungkin wujudnya jika ditinjau dari hakikat dirinya Ibnu sina juga berpendapat bahwa ada tiga obyek pemikiran manusia. yaitu Tuhan, dirinya sebagai wajib wujudnya dan dirinya sebagai mungkin wujudnya. Dari pemikiran tentang Tuhan timbul akal-akal, dari pemikiran tentang dirinya sebagai wujudnya timbul jiwa-jiwa dan dari pemikiran tentang dirinya sebagai mungkin wujudnya timbul langit-langit. Ibnu Sina membagi Jiwa dalam tiga bagian, yaitu jiwa tumbuh-tumbuhan, hewan dan manusia. Hal ini sesuai dengan konsep Alquran. Bahwa pembagian jiwa adalah: 1. Jiwa tumbuh-tumbuhan (Nabatiyyah). 2. Jiwa binatang (Hayawaniyyah), 3. Jiwa manusia (Insaniyah), disebut juga al-nafs al-nathiqat, mempunyai dua daya, yaitu: a. daya praktis (al-’amilat), hubungannya dengan jasad. b. daya teoretis (al-’alimat) hubungannya dengan hal-hal yang abstrak. Ibnu sina dalam konsepnya tentang pendidikan yang mengutamakan pendidikan jiwa. Meskipun antara jasad dengan jiwa juga memiliki hubungan yang erat dimana antara keduanya saling mempengaruhi dan membantu. Jasad adalah tempat bagi jiwa. Dengan kata lain jasad adalah syarat mutlak bagi adanya jiwa. Karenanya, manusia juga harus memelihara jasad sehingga dibutuhkan pula adanya pendidikan jasmani yang baik. 2. Tujuan Pendidikan Ibnu Sina berpendapat bahwa tujuan pendidikan adalah “pendidikan harus diarahkan pada pengemba-

ngan seluruh potensi yang dimiliki seseorang ke arah perkembangannya yang sempurna, yaitu perkembangan fisik, intelektual dan budi pekerti.” Selain itu tujuan pendidikan menurut Ibn Sina harus diarahkan pada upaya mempersiapkan seseorang agar dapat hidup di masyarakat secara bersama-sama dengan melakukan pekerjaan atau keahlian yang dipilihnya sesuai dengan bakat, kesiapan, kecenderungan dan potensi yang dimilikinya. Pendidikan yang bersifat jasmani, Ibn Sina berpendapat tujuan pendidikan tidak melupakan pembinaan fisik. seperti olahraga, makan, minum, tidur dan menjaga kebersihan. Sedang-kan tujuan pendidikan yang bersifat keterampilan ditujukan adalah menyiapkan tenaga professional. Dan juga memberikan pendidikan budi pekerti (akhlak) agar ada kepaduan antara keterampilan dengan budi pekerti. 3. Kurikulum Ibn Sina juga menyinggung tentang beberapa ilmu yang perlu dipelajari dan dikuasai oleh seorang anak didik. Menurut Ibn Sina kurikulum harus didasarkan kepada tingkat perkembangan usia anak didik, yaitu fase 3-5 tahun, 6-14 tahun, dan di atas 14 tahun. a. Usia 3 sampai 5 tahun Menurut Ibn Sina, diusia ini perlu diberikan mata pelajaran olah raga, budi pekerti, kebersihan, seni suara, dan kesenian. b. Usia 6 sampai 14 tahun Selanjutnya kurikulum untuk anak usia 6 sampai 14 tahun menurut Ibn Sina adalah mencakup pelajaran membaca dan menghafal Alquran, pelajaran agama, pelajaran sya’ir, dan pelajaran olahraga. c. Usia 14 tahun ke atas Pelajaran yang harus diberikan pada anak usia 14 tahun ke atas menurut ibnu sina amat banyak jumlahnya, namun pelajaran tersebut perlu dipilih sesuai dengan bakat dan minat si anak. 3. Metode Metode yang ditawarkan Ibn Sina adalah metode talqin, demonstrasi, pembiasaan dan teladan, diskusi, magang, dan penugasan. a) Metode talqin Metode talqin perlu digunakan dalam mengajarkan membaca Alquran. b) Metode demonstrasi Menurut Ibn Sina, metode demonstrasi dapat digunakan dalam pembelajaran yang bersifat praktik, seperti cara mengajar menulis. c) Metode pembiasaan dan keteladanan Ibn Sina berpendapat bahwa pembiasaan adalah termasuk salah satu metode pengajaran yang paling efektif, khususnya dalam mengajarkan akhlak. d) Metode diskusi Metode diskusi dapat dilakukan dengan cara penyajian pelajaran di mana siswa di hadapkan kepada suatu masalah yang dapat berupa pertanyaan yang bersifat problematis untuk dibahas dan dipecahkan bersama. Ibn Sina mempergunakan metode ini untuk mengajarkan pengetahuan yang bersifat rasional dan teoretis. e) Metode magang Ibn Sina telah menggunakan metode ini dalam kegiatan pengajaran yang dilakukannya. Para murid Ibn Sina yang mempelajari ilmu kedokteran dianjurkan agar menggabungkan teori dan praktek. f) Metode penugasan Metode penugasan ini pernah dilakukan oleh Ibn Sina dengan menyusun sejumlah modul atau naskah kemudian menyampaikannya kepada para muridnya untuk dipelajarinya. g) Metode targhib dan tarhib Targhib atau ganjaran, hadiah, penghargaan ataupun imbalan sebagai motivasi yang baik. 4. Konsep Guru Adapun pemikiran ibnu sina mengenai guru yang baik adalah guru yang cerdas, beragama, mengetahui cara mendidik akhlak, cakap dalam mendidik anak, berpenampilan tenang, jauh dari berolok-olok dan main-main di hadapan muridnya, tidak bermuka masam, sopan santun, bersih dan suci murni. Kemudian seorang guru menurut ibnu sina sebaiknya dari kaum pria yang terhormat dan menonjol budi pekertinya, cerdas, teliti, sabar, telaten dalam membimbing anak-anak, adil, hemat dalam penggunaan waktu, gemar bergaul dengan anak-anak, tidak keras hati dan senantiasa menghias diri. � Penulis Adalah Mahasiswa Program Pasca Sarjana IAIN-SU Medan Konsentrasi Pendidikan Islam

Mimbar Jumat

WASPADA Jumat 8 April 2011

Kepedulian MUI Terhadap Aqidah Umat

Jangan Makan-Minum Sambil Berdiri Dalam hadis disebutkan “Janganlah kamu minum sambil berdiri”. Dari segi kesehatan. Air yang masuk dengan cara duduk akan disaring oleh sfringer. Sfringer adalah suatu struktur maskuler (berotot) yang bisa membuka (sehingga air kemih bisa lewat) dan menutup. Setiap air yang kita minum akan disalurkan pada ‘pos-pos’ penyaringan yang berada di ginjal. Jika kita minum sambil berdiri. Air yang kita minum otomatis masuk tanpa disaring lagi. Langsung menuju kandung kemih. Ketika menuju kandung kemih itu terjadi pengendapan di saluran sepanjang perjalanan (ureter). Karena banyak limbahlimbah yang menyisa di ureter inilah awal mula munculnya bencana, penyakit kristal ginjal. Salah satu penyakit ginjal yang sungguh berbahaya. diduga diakibatkan karena susah kencing, jelas hal ini berhubungan dengan saluran yang sedikit demi sedikit tersumbat tadi. Dari Anas r.a. dari Nabi SAW: “Bahwa ia melarang seseorang untuk minum sambil berdiri”. Qatadah berkata, “Kemudian kami bertanya kepada Anas tentang makan. Ia menjawab bahwa hal itu lebih buruk.” Pada saat duduk, apa yang diminum atau dimakan oleh seseorang akan berjalan pada dinding usus dengan perlahan dan lambat. Adapun minum sambil berdiri, maka ia akan menyebabkan jatuhnya cairan dengan keras ke dasar usus, menabraknya dengan keras, jika hal ini terjadi berulang-ulang dalam waktu lama maka akan menyebabkan melar dan jatuhnya usus, yang kemudian menyebabkan disfungsi pencernaan.Adapun Rasulullah SAW pernah sekali minum sambil berdiri, maka itu dikarenakan ada sesuatu yang menghalangi beliau untuk duduk, seperti penuh sesaknya manusia pada tempat-tempat suci, bukan merupakan kebiasaan. Ingat asas darurat! Manusia pada saat berdiri, ia dalam keadaan tegang, organ keseimbangan dalam pusat saraf sedang bekerja keras, supaya mampu mempertahankan semua otot pada tubuhnya, sehingga bisa berdiri stabil dan dengan sempurna. Ini merupakan kerja yang sangat teliti yang melibatkan semua susunan syaraf dan otot secara bersamaan, yang menjadikan manusia tidak bisa mencapai ketenangan yang merupakan syarat terpenting pada saat makan dan minum. Ketenangan ini hanya bisa dihasilkan pada saat duduk, di mana syaraf berada dalam keadaan tenang dan tidak tegang, sehingga sistem pencernaan dalam keadaan siap untuk menerima makanan dan minum dengan cara cepat.(Sumber dikutip dari berbagai buku hadist shahih)

‘“Berkaca” Dari Bencana Oleh H. Syarifuddin Elhayat Firman Allah: Tidakkah mereka memperhatikan bahwa mereka diuji (dicobai) sekali atau dua kali dalam setahun,(tapi) kemudian mereka juga tidak mau bertaubat (mengakui kesalahan dihadapan Allah) dan mereka tidak mau mengingat kebesaran Allah (mengambil pelajaran dari peristiwa itu).(QS Attaubah: 126). Hari-hari kebelakangan ini,bencana dan ujian Tuhan kelihatannya semakin ‘akrab’ dan ‘ramah’ dengan bumi tempat kita berpijak.Semenjak dari gunung meletus, hujan yang mengakibatkan banjir, gempa yang tidak jarang datang dengan tsunami sebagai ‘teman pengringnya’. Kemarau panjang yang tak berakhir, hutan terbakar, lahan kering kerontang, angin puting beliung berhembus melanda dan memutar apa uang ada di depannya, bahkan terakhir wabah ulat bulu yang menyerang perkampungan dan lahan di Probolinggo hingga dalam beberapa waktu saja meluluhlantakkan taman mangga yang menjadi andalan hidup masyarakat di daerah itu. Menanggapi semua itu, tidak sedikit diantara kita angkat bicara, berkomentar sesuai dengan keahlaian yang dia miliki. Tidak sedikit para ahli dan pakar menyebutkan bahwa bencana yang terjadi itu merupakan kehendak alam,kemauan natural karena dunia sudah semakin tua. Ada yang menyebut,itu semua merupakan ketentuan Tuhan yang meskipun itu berjalan sesuai dengan silkus alam ini.Tuhan hanya menciptakan saja, sesudah itu,alam inipun Dia lepas bergerak sendiri hingga sampai pada tapal akhirnya sesuai dengan qodho dan qadarNya, bagaikan sebuah jam,setelah dirakit, diberi baterei dan diakurkan perjalanan jamnya, maka diapun akan bergerak dengan sendirinya. Ana agak sedikit, celengeh (cengang) ketika mendengar seorang pejabat menyebut, wabah ulat di Probolinggo adalah penomena alam saja, disebabkan udara yang tak menentu, bahkan kata dia dalam beberapa hari, puluhan juta ulatulat akan segera habis ketika dilakukan penyemprotan dengan racun. Huiiih Tuhan, piciknya kita, lupanya kita dengan Kuasa Tuhan yang menurunkan ‘abalilNya’ buat menyadarkan kita. Meskipun tidak sedikit,orang melihatnya dari sisi agama,bahwa apa yang terjadi dilingkungan kita hari ini merupakan kehendak Allah semata sebagai ujud rahmat dan kasih sayangNya bagi ummat dalam rangka pemeliharaanNya terhadap kelestarian alam seisinya.Allah Yang Maha Kuasa dan Maha Tau menghendaki ada rahasia di balik peristiwa atas semua keterlibatan kita umat manusia dengan sikap dan ulahnya. Tuaan..kalaulah kita kembali membuka Alquran sembari melihat peristiwa sejarah yang dia ungkapkan melalui kalam Ilahi itu, akan kita temukan berbagai cobaan bahkan hukuman yang Allah turunkan buat orang-orang dahulu yang kita jadikan sebagai contoh dan peringatan buat kita dalam mengisi hidup di masa kita. Allah pernah menghukum umat nabi Nuh dengan banjir yang cukup besar hingga menenggelamkan seluruh negeri. Hal itu karena umat termasuk anak dan isteri Nuh tidak mau perduli dengan ajakan Rasul Allah itu agar mau beriman dan menyembah Allah.Orang-orang kaya di negera itu tidak memperdulikan kaum dhuafa, fuqoro dan masakin bahkan mereka minta agar Nuh mengusir kaum ’lemah’, itu ke tempat lain. Nabi peringatkan agar umat mewaspadai akan terjadi banjir,namun itu mereka abaikan hingga saatnya Allah menurunkan

azabNya yang memencarkan air dari bumi bahkan dari dalam rumah-rumah penduduk. “Hingga apabila perintah Kami datang dan fara (sumber air) telah memancarkan air (QS Huud 43). Allah juga, Ncek pernah menurunkan balaNya bagi umat nabi Syuaib di Madyan yang tidak perduli dengan seruan Syuaib untuk tidak mengurangi timbangan. Ber-kalikali nabi Syuaib meminta agar penduduk di negeri itu tidak curang dan tetap adil terhadap timbangan (taka-ran), namun mereka tidak menghiraukan,bahkan merekapun mengejek ajakan nabi itu lalu kemudian mereka anggap Syuaib adalah nabi yang lemah. “…..Orang-orang yang zalim di binasakan oleh suatu suara yang memekakkan telinga,lalu jadilah mereka mati bergelimpangan dirumahnya. Seolah-olah mereka bagaikan orang yang belum pernah berdiam di tempat itu. Ingatlah kebinasaan bagi penduduk Madyan sebagaimana kaum Tsamud telah binasa” (QS Huud 94-95). Demikian pula pada zaman nabi Luth, Allah balikkan bumi itu, Allah lempar penduduknya dengan batu panas dari tanah sehingga merekapun lenyap dari dunia ini.Hal itu terjadi karena penduduknya telah ‘keranjingan’ melakukan hubungan sesama jenis,—Liwath,- (homoseksual. Luth memperingatkan mereka agar tidak melakukan perbuatan terkutu itu,namun mereka bahkan mengejek dan melecehkan Luth dengan ucapan yang sangat menyakitkan. Akhirnya tuan, Allah turunkan balaNya, ”maka tatakala datang azab Kami (Allah),kami jadikan negeri kaum Luth itu yang di atas ke bawah (dibalikkan) dan kami hujani mereka dengan batu dari tanah yang terbakar bertubi-tubi yang diberi tanda oleh Tuhanmu, dan siksaan itu tidaklah jauh dari orang-orang yang zalim.” (QS Huud 82-83). Alquran juga menjelaskan kepada kita tuaan, betapa Allah menenggelamkan kekuasaan Fir’aun, ‘menanam’ hartanya Qorun, mengapuskan kelihaiannya Haman bersama ‘penjilat’ ulama Bal’am terbungkus di telan air karena kedurhakaan mereka kepada Allah telah-telah melampaui batas.kekeuasaan dan kehebatan Fir’aun,kekeyaan Qorun, kepintaran Haman dan keulamaan Bal’am akhirnya hanya tinggal dalam cacatan sejarah kelabu. “Kami benamkan harta Qorun beserta rumahnya ke dalam bumi, maka tidak ada satu golonganpun yang dapat menolongnya dari azab Allah, dan dia tidaklah dari orang-orang yang (dapat) membela) diri.(QS AlQoshosh 81). Tuaan,kalaulah kita hendak bercerita tentang cobaan dan azab Allah dalam Al-quran, begitu juga dengan nikmat dan anugerahnya,tak cukup hanya sebatas balikan seujung jari,namun agaknya sekelumit kisah yang ana nukil di atas, cukuplah menjadi pelajaran bagi kita betapa Allah sesungguhnya tetap akan mengawasi kita dengan basyirohNya dan secara tidak langsung memberikan pendidikan buat kita perbuatan yang telah melampaui batas,kemaksiatan, mengurangi timbangan,takaran dalam arti luas, maksiat seperti homoseks dan sejenisnya, songbong dengan harta dan kekuasaan, pengayom agama yang sudah jauh dari sosok seorang ulama jauh dari Tuhan, jauh dari Alquran dan jauh dari nilai-nilai ajaran agama, akan mendatangkan hukuman,azab dan cobaan dari Allah. Karena itu Nceek, mari membaca dan berkaca dari sebuah bencana .



ecara sederhana, aqidah dapat diartikan suatu keyakinan yang harus terpatri dalam hati secara kuat tentang Allah Swt sebagai pencipta alam semesta, dan keyakinan kepada para Rasul-rasul/utusanutusan yang membawa perintah Allah serta keyakinan akan adanya kehidupan abadi setelah mati di alam akhirat serta hal ihkwal yang terjadi di dalamnya. Aqidah yang telah terpatri di dalam lubuk hati yang mendalam itu bersumber dari ajaran Alquran dan sunah yang telah dicontohkan oleh Nabi Muhammad Saw dan para sahabatnya dalam bentuk keyakinan (tauhid) yang murni dari wahyu dan belum terkontaminasi dan bercampur baur dengan filsafatfilsafat, pemikiran-pemikiran, tradisi-tradisi, apalagi hal-hal yang bersifat tahyul-tahyul dan khurafat-khurafat. Kemurnian aqidah tersebut diperkirakan berlangsung selama masa Rasul Saw dan awal masa khalifah arrasyidin Abu Bakar, Umar ra. Dengan artikata belum terjadi gonjang ganjing masalah aqidah pada pem-rintahan Rasul Saw dan dua khalifah berikutnya. Barulah pada masa khalifah Usman bin Affan ra terjadi kekacauan politik. Terjadilah perpecahan dan golongan-golongan yang masing-masing mempertahankan pendiriannya, terutama tentang persoalan dosa besar, bermula dari pembunuhan terhadap Usman bin Affan, dan pada gilirannya berimbas kepada iman dan kafir. Hal yang dipersoalkan adalah, sejauh mana perbuatanperbuatan lahir dapat berdampak pada aqidah sehingga dapat divonis menjadi kafir, seperti seseorang yang telah melakukan pembunuhan, zina, apakah dapat dikatakan telah keluar dari Islam atau masih tetap Islam, atau Islam tidak berimanpun tidak, yaitu berada diantara iman dan kufur ? Persoalan di atas paling tidak menimbulkan perpecahan dalam masalah aqidah Islam men-

Oleh H.M. Nasir Lc, MA

jadi tiga aliran besar. Kelompok pertama adalah golongan Khawarij, golongan ini menyatakan bahwa pelaku dosa besar adalah kafir. Kelompok kedua adalah golongan Murji’ah, yang menyatakan bahwa pelaku dosa besar tetap mukmin, tidak kafir. Perbuatan dosa tidak ada pengaruhnya dengan kerusakan iman sama sekali. Golongan ini menyamaratakan iman semua orang. Iman sahabat-sahabat Nabi sama saja dengan iman seorang koruptor, karena menurut mereka dosa tidak mengurangi iman. Kelompok ketiga golongan Mu’tazilah, menyatakan bahwa orang-orang yang melakukan dosa besar berada diantara dua posisi, mukmin dan kafir (manzilah baina manzilataini). Sejalan dengan perkembangan dan meluasnya wilayah Islam sampai ke seluruh dunia Islam masuk ke masyarakat yang sudah mempunyai keyakinan tersendiri. Dengan kata lain, pemeluk-pemeluk agama lainpun berduyun-duyun masuk ke dalam agama Islam, dan tidak mustahil keyakinan mereka yang pernah dianut di luar Islam masih tersisa – boleh jadi disebabkan pengaruh tradisi ataupun kultur – masuk bercampur-baur dalam aqidah Islam. Walhasil – disebabkan gonjang-ganjing aqidah dengan pendiriannya masing-masing mengkristallah kelompok-kelompok aqidah di da-

lam tubuh Islam sampai saat ini. Para ulama berupaya keras untuk meluruskan gonjang-ganjing aqidah tersebut, sehingga kembali kepada aqidah yang dianut oleh Nabi Muhammad Saw, muncullah ulama-ulama yang peduli terhadap persoalan ini, antara lain lahirlah aliran Ahlisunnah wal Jamaah yang dipelopori oleh Abu Hasan Asy’ari (324 H) dan Abu Mansur al-Maturidy (w. 333H) Pasang surut aqidah Ahlisunnah wal Jamaah dan segala persoalannya tetap dirasakan oleh uamt Islam hingga kini. Lebih dari itu, persoalan aqidah umat di negeri ini sudah sampai pada tingkat mencemaskan. Hal itu ditandai dengan lahirnya aliran-aliran sesat, nabi-nabi palsu, khurafat-khurafat, sampai pada tingkat politik persoalan dan demokrasi sudah hampir menjadi aqidah dalam perpolitikan dunia Islam saat ini. Peranan Majelis Ulama Indonesia (MUI) dalam hal melanjutkan tanggung jawab para ulama terdahulu adalah melakukan pencerahan kepada umat berupa fatwa-fatwa, pengkaderan ulama, sosialisasi aqidah, menghadang aliran-aliran sesat masuk ke dalam “rumah tangga” Islam memberantas khurafat, tahyul-tahyul dan sebagainya. Karena salah satu benteng pertahanan Islam di Indonesia adalah MUI, setelah Kementerian Agama, dan pesantren-pesantren, serta lembaga-lembaga Islam lainnya. Tidak terlalu berlebihan, jika saya katakan bahwa MUI merupakan ujung tombak aliran aqidah Ahlisunnah wal Jamaah, melihat perannya begitu strategis di negara yang mayoritas muslim ini. Karena MUI bukan hanya sekedar mitra pemerintah dalam melaksanakan tugas keumatannya, akan tetapi MUI berperan penting membangun aqidah, moralitas mulai dari akar

rumput (rakyat) hingga pejabatpejabat tinggi yang seharusnya menjadi contoh bagi rakyatnya. Melalui tulisan ini, penulis akan menanggapi “keluhan” salah seorang dari pembaca Harian Waspada yang menyampaikan keluhannya melalui “Rubrik Surat Pembaca”. Dimana ia telah mengatakan bahwa MUI Kabupaten Batubara atau MUI Sumut pasif, tidak menentukan apakah amalan itu sunnah atau bid’ah dan syirik untuk umat mempunyai pegangan (Harian Waspada 4 April 2011). Penulis juga mengingatkan kelalaian “pembaca” terhadap respon MUI terutama MUI Kabupaten Batubara sebagai refresentasi (perwakilan) MUI Sumut dalam menaggapi “Kenduri Laut”, ditambah tulisan tetap penulis di Mimbar Jum’at tanggal 1 April 2011. Secara struktural pencegahan kemungkaran dalam perspektif normatif (Hadis Na-bi), setelah pemerintah (falyug-hayyir biyadihi) adalah tugas majelis ulama (fabilisânihi). Namun pada Hadis Nabi yang lain, juga disampaikan bahwa pencegahan kemungkaran adalah tugas semua orang, terutama bagi yang mengaku orang beriman. Akhirnya aqidah umat wajib dijaga dari segala bentuk penyimpangan. Dalam hal ini yang berkompeten untuk tugas yang teramat mulia ini adalah para ulama, dan dalam konteks keIndonesiaan kita, para ulama telah “diwadahkan” di dalam satu lembaga yang disebut MUI (Majelis Ulama Indonesia) yang telah menyebar ke seluruh pelosok-pelosok Indonesia hingga ke tingkat kecamatan, gunanya agar tidak ada tumpang tindih dalam berfatwa. Wallahua’lam bil ash-shawab. � Penulis adalah: - Pimp. Pondok Pesantren Tahfiz Alquran Al Mukhlisin Batu Bara - Pembantu Rektor IV Universitas Al Washliyah (UNIVA) Medan - Ketua Majelis Ta’lim & Zikir Ulul Albab Sumut

Keadilan Dalam Alquran


lkisah disebuah riwayat yang sahih diceritakan bahwa seorang sahabat bernama Abu Darda Al-Anshari, selalu puasa di siang hari dan selalu shalat tahajud semalam suntuk sehingga keluarganya kurang mendapat perhatian. Melihat keadaan itu saudara angkatnya yakni sahabat Salman Al-Farisi datang mengingatkannya bahwa tindakan tersebut keliru. Tindakan yang benar adalah bahwa raga atau badan kita punya hak untuk diistirahatkan, keluarga kita mempunyai hak untuk diperhatikan, masing-masing harus seimbang ditunaikan haknya. Setidaknya inilah salah satu makna adil dalam Islam. Malahan jika merujuk pada Alquran, keadilan dalam Islam merupakan satu tema inti yang sangat ditekankannya. Bisa dikatakan antara Alquran dan keadilan ibarat dua sisi dari sekeping mata uang. Keadilan adalah esensi yang menyatu dalam semangat Alquran. Bahkan dalam surah Al-Hadid ayat ke-9 dinyatakan bahwa Alquran diwahyukan untuk mengeluarkan manusia dari kegelapan dan kezaliman menuju cahaya yang berupa keadilan sosial. Di dalam Alquran terdapat banyak ayat yang mengangkat tema keadilan, diantaranya adalah dalam surat Al-Maidah (5) ayat ke-8, “Hai orang-orang yang beriman hendaklah kamu jadi orang-orang yang selalu menegakkan (kebenaran) karena Allah, menjadi saksi dengan adil. Dan janganlah sekali-kali kebencianmu terhadap sesuatu kaum, mendorong kamu untuk berlaku tidak adil. Berlaku adillah, karena adil itu lebih dekat kepada takwa. Dan bertakwalah kepada Allah, sesungguhnya Allah Maha Mengetahui apa yang kamu kerjakan.” Pembicaraan Alquran pada khususnya dan Islam pada umumnya tentang keadilan memiliki berbagai spektrum makna, tidak hanya terbatas pada proses penegakan dan penetapan hukum saja. Setidaknya ada tiga aspek keadilan dalam Alquran. Pertama adalah keadilan dalam aspek aqidah, yakni menghindari kezaliman dalam hal keimanan, menghindari syirik atau mempersekutukan Allah SWT. Hal ini ditegaskan Alquran dalam surah Luqman (31) ayat ke-13, “Dan (ingatlah) ketika Luqman berkata kepada anaknya, di waktu ia memberi pelajaran kepadanya: “Hai anakku, janganlah kamu mempersekutukan Allah, sesungguhnya mempersekutukan (Allah) adalah benar-benar kezaliman yang besar.” Ayat ini menjelaskan bahwa mempersekutukan Allah merupakan suatu perbuatan yang sangat za-

Oleh Muhammad Arif Fadhillah Lubis, SHI, MSI

lim. Manusia-manusia yang berlaku syirik berarti telah berbuat tidak adil dalam akidahnya. Selanjutnya terkait adil dalam aspek aqidah ini, maka keadilan tersebut tidak hanya berlaku bagi makhluk manusia namun termasuk alam semesta ini yang ditegakkan oleh Allah SWT atas dasar keadilan. Hal ini ditegaskan Allah dalam surah Ar-Rahman (55) ayat 7-8. Aspek keadilan kedua adalah dalam aspek syari’ah (hukum) khususnya yang berkaitan dengan muamalah. Penekanan keadilan dalam aspek ini adalah adil dalam menetapkan hukum. “Sesungguhnya Allah menyuruh kamu menyampaikan amanat kepada yang berhak menerimanya, dan (menyuruh kamu) apabila menetapkan hukum di antara manusia supaya kamu menetapkan dengan adil. Sesungguhnya Allah memberi pengajaran yang sebaik-baiknya kepadamu. Sesungguhnya Allah adalah Maha Mendengar lagi Maha Melihat.” QS Al-Baqarah (2) ayat ke-58 terkait keadilan dalam aspek hukum. Selain ayat di atas, ditegaskan oleh Allah SWT dalam firmannya surah Al-Baqarah (2) ayat ke-282. Ketiga, adalah dalam aspek akhlak keadilan dituntut bukan hanya kepada orang lain akan tetapi juga kepada diri sendiri. Hal ini digambarkan Allah SWT dalam Alquran surah Al-An’am (6) ayat ke-125, “Dan janganlah kamu dekati harta anak yatim, kecuali dengan cara yang lebih bermanfaat, hingga sampai ia dewasa. Dan sempurnakanlah takaran dan timbangan dengan adil. Kami tidak memikulkan beban kepada sesorang melainkan sekedar kesanggupannya. Dan apabila kamu berkata, maka hendaklah kamu berlaku adil, kendatipun ia adalah kerabat(mu), dan penuhilah janji Allah. Yang demikian itu diperintahkan Allah kepadamu agar kamu ingat.” Prof. M. Quraish Shihab dalam

Tafsir Al-Misbah-nya, menafsirkan frase “apabila kamu berkata hendaklah berlaku adil”, dengan menyatakan bahwa ucapan seseorang terdiri dari tiga kemungkinan; pertama adalah “benar”, dan ini bisa saja bermakna positif atau negatif, serius atau canda. Kedua adalah “salah” dan ini ada yang disengaja (bohong) ada juga yang tidak disengaja (keliru), dan ketiga adalah “omong kosong”, ini ada yang dimengerti namun tidak berguna sama sekali, dan ada juga yang tidak dimengerti sama sekali. Ucapan bohong dan omong kosong tidak dibenarkan sama sekali untuk diucapkan. Adapun ucapan yang benar, tetapi tidak adil, yakni bukan pada tempatnya, maka ucapan semacam ini tidak dibenarkan. Adalah wajib berdiam diri tidak berucap sepatah kata pun kalau ucapan itu tidak benar dan tidak adil. Hal ini dipertegas oleh sebuah hadis yang diriwayatkan oleh Bukhari dan Muslim, “Siapa yang beriman kepada Allah dan hari kemudian, hendaklah dia mengucapkan kata-kata yang baik atau diam saja.” Jadi yang dituntut dari ayat ini adalah bahwa ucapan itu benar sekaligus adil dalam arti sesuai pada tempatnya meskipun tertuju pada kerabat sendiri. Demikianlah aneka ragam pemaknaan keadilan yang disebutkan dalam Alquran. Dapatlah disebutkan bahwa Alquran merupakan ruh untuk mewujudkan keadilan dalam kehidupan. Seorang ulama bernama Hasan Al-Bashri dalam kitabnya Risalah at-tauhid wa al-‘Adl mengutarakan bahwa Alquran adalah kitab yang berisi masalah-masalah ketauhidan dan keadilan. Bahkan menurut Alquran keadilan merupakan pendamping tauhid. Lebih dari itu, dalam surah Al-Hadid (57) ayat ke-25 dijelaskan bahwa, “Sesungguhnya Kami telah mengutus rasul-rasul Kami dengan membawa bukti-bukti yang nyata dan telah Kami turunkan bersama mereka Al Kitab dan neraca (keadilan) supaya manusia dapat melaksanakan keadilan.” Ayat ini menegaskan bahwa para rasul dan kitab suci diturunkan sebagai petunjuk dalam bertindak adil atau berkeadilan. Jelas dan tegaslah bahwa ini menunjukkan agama Islam merupakan agama yang menjunjung keadilan. Lebih lanjut, senada dengan penjelasan di atas, dalam surah AnNahal (16) ayat ke-90 Allah SWT memerintahkan pada manusia untuk berlaku adil. Berikut redaksi ayat itu,

“Sesungguhnya Allah menyuruh (kamu) berlaku adil dan berbuat kebajikan, memberi kepada kaum kerabat, dan Allah melarang dari perbuatan keji, kemungkaran dan permusuhan. Dia memberi pengajaran kepadamu agar kamu dapat mengambil pelajaran.” Ayat ini secara eksplisit menggunakan kata penguat “inna” yang berarti “sungguhsungguh” dan menggunakan kata “ya’ muru” untuk menegaskan apa yang diperintahkan. Untuk itu, jelaslah bahwa berlaku adil (menegakkan keadilan), berbuat kebajikan (memperjuangkan keadilan), melarang dan merintangi perbuatan keji, kemungkaran dan permusuhan, adalah hal-hal mendasar atau pokok yang sangat diperintahkan oleh Allah SWT untuk dilaksanakan oleh setiap orang. Ini menunjukkan hukumnya wajib‘ain, yang berarti setiap orang terkena kewajiban untuk melaksanakannya secara sungguhsungguh. Jadi menegakkan keadilan adalah suatu kewajiban tiap pribadi manusia. Hal ini menjelaskan pula bahwa berlaku adil atau menegakkan keadilan dalam kehidupan dan merintangi kemungkaran dan penindasan merupakan esensi atau inti dari semangat Alquran. Akhirnya, sudah seharusnya jika umat Islam menjadikan keadilan sebagai paradigma utama dalam kehidupan pribadi, bermasyarakat dan bernegara. Karena itulah, para ulama ushul fiqh menjadikan konsep keadilan ini sebagai bagian dari tujuan diturunkannya syari’at (maqasid al-syari’ah). Untuk itu pulalah, Ibnu al-Qayyim al-Jauziyah menuliskan dalam salah satu kitabnya sebagai berikut, “Bangunan Syari’at Islam itu sesungguhnya didasarkan atas hikmah (kebijaksanaan) dan kemashlahatan umat manusia, baik di dunia maupun di akhirat. Syari’at Islam itu membawa rahmat, kebijaksanaan, keadilan, dan kemaslahatan. Apabila ada masalah yang tidak adil, tidak bijaksana, merusak, dan tidak membawa kerahmatan, maka itu bukanlah Syari’at Islam.” . Islam tidak menghendaki keadilan secara parsial hanya antara umat Islam saja, melainkan Islam mengedepankan keadilan terhadap diri sendiri, dalam bermasyarakat (bermu’amalah) termasuk pada umat non-muslim dan pada alam semesta terlebih adil dalam menegakkan hukum, juga menghendaki berlaku adil pada Allah SWT dengan tidak menyekutui-Nya. Keadilan merupakan semangat dan ruh Alquran. Dan Islam adalah agama keadilan. Wallahu Al-‘Alim. � Penulis adalah Dosen MKU Agama Islam Politeknik Negeri Medan

C8 MEDAN AREA Amaliah Jl. Amaliun Gg. Bandung Kota Maksum II Al-Hidayah Jl. A.R. Hakim Gg. Sukmawati Al-Huda Jl. Gedung Arca Gg. Jawa No. 46 Al-Istiqomah Jl. Seto No. 33 Al-Ikhwaniyah Jl. Utama/Amaliun Gg. Tertib No. 15 Al-Ikhanul Wathan Jl. AR. Hakim Gg. Langgar No. 53 Al-Ikhlash Taqwa Jl. Medan Area Selatan No. 129 Al-Muhajirin Kel. Sei Rengas Al-Misbah Jl. A.R. Hakim Gg. Langgar/Damai No. 27 Al-Makmur Jl. A.R. Hakim Gg. Langgar/Bahagia No. 25 Al-Utaminiyah Jl. Utama Kota Matsum II Gg. Syukur Hidayatul Islamiyah Jl. Gajah No. 39 Istiqlal Jl. Halat No. 53 Kel. Kota Matsum IV Jamik Jl. Medan Area Selatan No.289 Kel.Surakamai-I Jamik Jl. Sutrisno Gg. Damai I No. 6 Kel. Komat I Jami’ Darul Ikhlas Jl. Batu No. 13 Jami’ Taqwa Jl. A.R. Hakim Gg. Langgar No. 8-A Khairiyah Jl. Rahmadsyah Gg. Subur 192 Muslimin Jl. Dr. Sun Yat Sen No. 71 Muslimin Jl. Gedung Arca Gg. Jawa No. 3 Nurul Huda Jl. Denai Gg. Pinang No. 12 Perguruan Ketuhanan Jl. Puri Gg. Perguruan No. 4 Rahmat Jl. Denai Gang I No. 2 Shilaturrahim Jl. Emas No. 10 Syekh Hasan Maksum Jl. Puri Gg. Madrasah Taqwa Ar-Rahim Jl. Utama Gg. Ampera I No. 240-AR Taqwa Jl. Bromo Gg. Taqwa No. 11 Taqwa Jl. Bromo Gg. Aman No. 23 Taqwa Jl. Megawati Taqwa Jl. Puri Komplek Masjid Taqwa No. 183 Taqwa Lawang Jl. Gedung Arca Gg. Sehat No. 8

Daftar Khatib Shalat Jumat Taqwa Jl. Pemasyarakatan Gg. Masjid No. 7 Sukadono Asrizal Tanjung, S.Sy. Drs. Alwi Batubara Syahril Bashrah, S.HI Drs. H. Mar’i Batubara Drs. Ade Mustahdi Ali Drs. H. Usman Batubara Drs. M. Salim Tagor Muda Lubis Drs. Ridwan Fahmiluddin Dahriun Harahap, S.Ag H. Zuhri Nasution, Lc H. Jamaluddin, Lc Ir. H. Helmi Walid Nasution Drs. H. Darwansyah Simanjuntak H. Yazid Syamsuddin, Lc Drs. H. Muhiddin Gurning M. Tuah Sirait, MA Mustafa Lubis, S.Q. H. Muhammad Yahya Muhammad Afif H. Rumalis Drs. H. Yahya Indra Drs. H. Lukman Hakim, M.Pd H. Bahauddin Nasution, Lc H. Mhd. Yusri Indra, Lc H. Ismail Malik Drs. Sunaryo K.H. Munawar Chalil Mex Zainis Chaniago Drs. H. Agus Thahir Nasution Zainuddin, S.Ag H. Jamaluddin Al Bathani

MEDAN AMPLAS Al-Hidayah Mapolda SU Jl. S.M.Raja Km.10,5 No. 60 Al-Hidayah Jl. Kongsi Gg. Syukur No. 307 Marindal I Al-Huda Jl. Bajak I Kel. Harjosari II Al-Jihad Jl. Garu II Villa Harjosari Indah No. 106 Baiturrahman Jl. Bajak III Kel. Harjosari II Ikhlashiyah Jl. Garu-I No. 69 Kel. Harjosari-I Jami’ Harjosari Jl. S.M. Raja Km. 6,5 No. 21 Kampus UNIVA Jl. S.M. Raja No. 10 Komp. UNIVA Miftahul Jannah Jl. Pertahanan No. 70-A Timbang Deli Nurul Barkah Jl. Selambo IV No. 29 Nurul Iman Jl. S.M. Raja Km. 9 Nurul Tuvail Khatijah Jl. Garu IV No. 140 Raya Taqwa Jl. S.M. Raja Km. 5,5 Kel. Harjo Sari I Ramadhan Jl. Pertahanan No. 37 Kel. Timbang Deli Ramadhan Jl. Garu VI Kel. Harjosari I Shilaturrahim Jl. Garu III Kel. Harjosari-I Salman Jl. STM Kel. Sitirejo II Sepakat Jl. Turi Gg. Sepakat No. 5 Tarbiyah Medan Amplas Taqwa Jl. S.M. Raja Gg. Pulau Harapan No. 1 B

Drs. H. Sutan Syahrir Dalimunthe H. Nazhar Daulay, Lc, S.Pd.I H. Fauzi Lubis, MA Basri, AT Drs. H. Akhdar Bunayya M. Hasbi Almawardhi Lubis, S.Ag Drs. M. Tholib Harahap Imam Yazid, MA Drs. Abd. Jalil Rahmat Hidayat, MA Drs. M. Nuh, SH, MH Drs. H. Yahya Tambunan Drs. Mustamam Batubara, MA Ruschan Nawawi, BA Arifin, S.Ag Drs. M. Idris Hasibuan Drs. H.M. Nasir, MA Zailani, MA Muhammad Rojai, S.HI, S.Pd.I M. Arifin, S.Ag

MEDAN BARU Agung Jl. Pangeran Diponegoro No. 26 Al-Amanah Jl. Diponegoro No.30-A Kom.Gd.Keuangan Al-Falah Bank Sumut Lantai X Jl. Imam Bonjol No. 18 Al-Hasanah Jl. Letjend. Jamin Ginting No. 314 Al-Ikhlas Jl. Sei Padang No. 129 Bulan Jl. Letjend. Jamin Ginting Gg. Masjid No. 1 Muslimin Jl. Batang Serangan No. 93 Nurul Muslimin Jl. DR. TD. Pardede No. 42 Nurul Huda Jl. K.H. Wahid Hasyim Asrama Brimob

Drs. H. Abdul Rahman DR. H. Ahd. Zuhri, Lc, MA Prof.Dr.H.Ahmad Qorib Muchtar,MA Asmui Lubis, S.HI Abror Parinduri, S.Pd.I Drs. H. Qamaruddin, S. H.M. Rusli Yusuf Drs. M. Sholihul Amri Drs. H.T. Baharuddin, S.

MEDAN BARAT At-Taqwa Jl. Putri Hijau No. 14 Al-Furqan Jl. Karya II Kompl. Ex Kowilhan Al-Hasanan Inna Dharma Deli Al-Jihad Jl. Kom. Laut Yos Sudarso/Jl. Pertempuran Al-Muttaqin Jl. Karya No. 41 Kel. Sei Agul Al-Mukhlishin Jl. G.B. Josua No. 8 Al-Massawa (Arab) Jl. Temenggung No. 2-4-6 Al-Istiqomah Jl. Putri Hijau No. 01 Komp. Deli Plaza Baitus Syifa RS. Tembakau Deli PTP Nusantara-II Haji Maraset Jl. Sei Deli No. 139 Jami’ Jl. Merdeka No. 3 Pulau Brayan Kota Nurul Hidayah Jl. Tinta 63-B Kel. Sei Putih Nurul Hidayah Jl. Danau Singkarak Gg. Masjid No. 6 Nurul Islam Jl. Karya Lk. VIII No. 203 Kel. K.Berombak Lama Jl. Mesjid Gg. Bengkok No. 62 Kel. Kesawan Rumkit Jl. Putri Hijau Tk. II Putri Hijau Kesdam I/BB Syuhada Jl. Danau Toba No. 2 Kel. Seil Agul Taqwa Jl. Karya Gg. Madrasah No. 24

H. Sabam Sabaruddin Str., S.Ag H. Mukhlis Nasution H. Nurdin Mhd. BA Drs. Zulkarnaein Hasibuan Drs. H. Sa’dullah Ahmad Drs. Saukani Muda, MA Drs. Hisyam Dalimunthe, SH Drs. Nursarianto Prof. Dr. Asmuni, MA H.M. Ishaq Lubis Drs. Gazali Umar Drs. H. Ismail Mukhtar Drs. H. Aman Rosyadi DR. H. Raihan Nasution, MA Drs. H. M. Sazli Nasution Mayor Inf. Badri Drs. K.H. Amrin Siregar Drs. H. Burhanuddin, MA

MEDAN BELAWAN Jami’ Belawan Jl. Selebes Belawan Taqwa Jl. Veteran Belawan

H.T. Ahmad Bakri Drs. H. Masaluddin Brutu

MEDAN DELI Amalyatul Huda Jl. Nusa Indah No. 22-A Lingk. 26 Ar-Ridha Komplek TNI-AL Barakuda Tg. Mulia As-Sa’adah Jl. Alumunium IV Gg. Tawon Tg. Mulia Al-Amanah Jl. K.L.Yos Sudarso Km. 6,8Kel.Tg. Mulia Al-Ikhlas Jl. Alumunium III Kel. Tj. Mulia Al-Jihad Lingk. VI Kel. Mabar Al-Munawwarah Jl. Pulau Batam No. 1 Al-Syarifah Jl. Metal Gg. Rukun No. 06 Lingk. XVIII Jamik Jl. K.L. Yos Sudarso Km. 6,2 Tg. Mulia Jami’iyyatush Shoolihiin Jl. Alumunium I Lingk. XIII Nurul Iman Jl. Sidomulyo Ujung Kel. Tg. Mulia MEDAN DENAI Arafah Jl. Pertiwi No. 22 Kel. Binjai Amal Bakti Jl. Raya Menteng Gg. Abadi No. 21-A Ar-Ridha Jl. Camar 18 Perumnas Mandala Al-Anshor Jl. Raya Medan Tenggara Gg. Anshor Al-Hidayah Jl. Bromo Gg. Masjid Al-Hidayah Al-Hidayah Jl. Menteng Indah VI H.Kel.Medan Tenggara Al-Hasanah Jl. Merpati I No. 1 Kel. Kenangan Baru Al-Muslimin Jl. Menteng II Gg. Pembangunan Lingk.XI Al-Muslimun Jl. Bromo (Rawa Sembilang) Gg. Kurnia Al-Mukhlishin Bromo Ujung Jl. Selamat Kel. Binjai Al-Mukhlishin Jl.Enggang I Perumnas Mandala Al-Makmur Jl. Bersama Ujung K.Perum.Griya Al-Bania Al-Ridha Jl. Jermal VII Lingk. IX Kel. Denai Baiturrahman Jl. Medan Tenggara II Kel. Denai Baiturrahman Jl. Medan Tenggara VII No. 42 Baiturrahmin Jl. Pelajar Timur Gg. Darmo No. 5 Darul Ilmi Murni Lingk. I Kel. Tegal Sari Mandala II Hijraturridha Jl. Selamat Ujung Gg. Subrah/Ketua Muslimin Jl. Selam II No. 47 Tegal Sari Mandala-I Nur Islam Jl. M. Nawi Harahap Kel. Binjai Nur Hidayah Jl. Datuk Kabu Gg. Masjid No. 11-C Nurul Iman Jl. Rawa Lr. Sedar Rahmatullah Jl. Kramat Indah Gg. Trenggeno II Raya Miftahul Iman Jl. Panglima Denai Jermal 7 Taqwa Jl. Jermal III No. 10 Taqwa Jl. Mandala By Pass No. 140 Taqwa Jl. Pancasila Gg.Masjid No.1 Kel.T.S.Mandala III

Drs. Zainul Arifin, GM. MA Sudirman Drs. Jontar Dongoran Drs. Ahmad Suhaimi Drs. H. Muhiddin Gurning H.M. Rajab, Lc Drs. H. Agus Salim Pardede Drs. Nazamuddin Drs. H. Muri Damri Ali Akbar, BA Drs. Hasbullah Jafar, MA Drs. H. Legimin Syukri Drs. H. Nurman Almi H.M. Silahuddin, S.Pd.I Drs. H. Abu Bakar Adnan Srg., MA Drs. H. Asnan Ritonga, Lc Asroruddin Saidi Drs. Haitami Lubis T. Syarifuddin, S.Ag Badu Amn Nasution, S.Ag Drs. H. Muniruddin, M.Ag Drs. H. Ade Fifan Khairul Zaman, S.Fi Drs. H. Sampurna Silalahi Drs. Syaifuddin Daulay Astra Wahyudi, SH Drs. Zulkarnaen Lubis, MA

MEDAN HELVETIA Amaliyah Jl. Sakura I Lingk. II Blok-19 Perum. Helvetia An-Nur Jl. Budi Luhur No. 75-A At-Taubah Jl. Prona No. 12 Lingk. VII Cintai Damai Ar-Raudhah Jl. Persatuan No. 22-AR As-Syarifah Jl. Pembangunan Kompl. Pondok Surya Al-Bashir Rusmi Jl. Kapten Muslim Gg. Solo Tengah Al-Falah Jl. Palem Raya Perumnas Helvetia Al-Hidayah Jl. Bakti Luhur No. 21 Kel. Dwikora Al-Ikhlas Jl. Bakti Lubur No. 113 Kel. Dwikora Al-Ikhlas Jl. Bahagia Lingk. VI Kel. Cinta Damai Al-Ikhas Jl. Jongkong Komplek Dolok Sumut Al-Ishlah Jl. Kapten Muslim No. 54-A Al-Kautsar Jl. Gaperta Ujung K. Perum. Tata Alam Asri Al-Mukhlisin Jl. Bakhti Utara No.21 Link. VI Kel.T.Gusta Al-Mustaqim Jl. Kapten Muslim No. 226 Al-Masturah Jl. Binjai Km. 7,8/Jl.Sekolah No. 29 Darussalam Jl. Asrama No. 11 Istiqomah Jl. Amal Luhur No. 86 Ikhlasiyah Jl. Amal Luhur No. 29 Kel. II Dwikora Raya Al- Falah Jl. Cendana Blok 17 Perumnas Helvetia Taqwa Jl. Kapten Muslim Gg. Jawa Taqwa Jl. Kamboja Raya No. 319 Blok IV P.Helvetia Taqwa Jl. Kapten Sumarsono Gg. Safar Taqwa Jl. Setia No. 30 Cabang Helvetia

Drs. H. Pono Siregar Usman Matondang Nurdin Arsyad, S.Ag, S.Pd.I Amirwan, S.Ag H. Fahmi Mahyar Abdul Kadir, S.Ag Drs. M. Idris Ginting Drs. Mahyuddin Daulay Drs. Maghrib, P. Drs. M. Yusuf Tanjung Parlindungan Batubara, S.Pd.I Drs. A. Wahab Kalimantan Drs. H. Sudarso Bukhari, S.Ag Tamrin Butar-butar, S.Ag Drs. H. Marasonang Siregar Drs. Tarmizi Dalimunte, S.Pd.I Drs. H. Mahmuddin Sirait Drs. Lily Suheri Buchari Siregar, S.Ag Drs. Satiman Abu Hadid Gunawan, S.Ag Drs. Budiman

Drs. Syafaruddin Sofyan, MS Drs. Mahyuddin Masykur Syamsul Bahri Sarwan Nasution, S.Pd.I H. Musyohur Siregar, S.Ag Drs. Jamaluddin Ahmad, S.Pd.I K.H. Kadi Hasibuan,S.Pd.I Syamsul Bahri Drs. Fahrul Rizal, M.SI Helmi Fahmi Dalimunthe, M.Ag

MEDAN JOHOR Amanah Jl. Eka Bakti Ujung Lingk. IV Gedung Johor Arrahman Jl. Brigjen Zein Hamid Kel. Titi Kuning Amaliyah Perumahan Citra Wisata Ainul Iman Jl. Ekawarni I Kel. Gedung Johor Assyafi’iyah Jl. STM Suka Tari No. 9 Ar-Raudhah Komplek Risva I Blok V Kel.Gedung Johor Annazhirin Jl. Karyawisata Kel. Gedung Johor Al-Amin Jl. Eka Surya Gg. Eka Kencana Ged. Johor Al-Badar Jl. Karya Dharma No. 19 Kel. Pangk. Masyhur Al-Firdaus Jl. Karya Jaya Gg. Eka Jaya II Lingk. II Al-Huda Jl. Eka Surya Psr. V Gg. Sidodadi Ged. Johor Al-Hidayah Jl. Brigjen Katamso Km. 7,2 Kel. Titi Kuning Al-Hidayah Jl. Karya Jaya Kel. Gedung Johor Al-Ikhlas Jl. Karya Tani Lingk. VIII Pangk. Masyhur Al-Ikhlas Jl.Eka Suka Lingk. XIII Kel. Gedung Johor Al-Issyah Hakim Jl. Karya Jaya Kel. Gedung Johor Al-Muslimin Jl. Suka Luhur Al-Mahmudiyah Jl. Brigjen Hamid Km 6,5 Kel. T.Kuning Al-Mustafa Jl. Karya Jaya, Gg. Karya XII-XIV7 Al-Qisth Kejaksaan Tinggi Jl. Abd. Haris Nst. P.Mashur Baiturrahman Perumahan Johor Indah Permai 1 Baiturrahmah Jl. Karya Jaya No. 101 Pkl. Masyhur Baitul Iman Jl. Karya Jaya Asrama Arhanud P. Masyhur Fajar Ramadhan Perumahan Johor Indah Permai II Graha Deli Permai Jl. Sidodadi Pasar IV Kel. Gd. Johor Istiqomah Jl. Abdul Hamid No. 70 Muslim Jl. Karya Jaya, Kel. Pangk. Masyhur Muttaqiin Jl. Luku I No. 42 Kel. Kwala Bekala Nurul Aldys Jl. Karya Bakti No. 34 Pkl. Masyhur Nurul Falah Jl. Eka Rasmi No. 42 Kel. Gedung Johor Nurul Huda Jl. Letjen Ginting Km. 8 Kwala Bekala Nurul Huda Jl. M. Basir No. 9-A Kel. Pangk. Masyhur Nurul Iman Jl. Stasiun No. 75 Kel. Kedai Durian Nurul Ikhwan Jl. Karya Kasih Sunnah Al-Muhsinin Jl. Abdul Haris Nasution No. 11 Sunnah Rabithah Jl. Karya Darma Pangk. Masyhur MEDAN KOTA An-Nazhafah Jl. Rumah Sumbul No. 4 Lingk. I Al-Hidayah Jl. Saudara Kel. Sudirejo II Al-Hasanah Jl. Tanjung Bunga II Kel. Sudirejo II Al-Ikhlas Jl. Salak No. 9 Al-Mashun Jl. Sisingamangaraja Da’wah Jl. Sakti Lubis Gg. Amal 19-B Hikmah Hongkong Plaza Jl. Cerebon Islamiyah Jl. Jati III No. 85 Kel. Teladan Timur Jami’ Teladan Jl. Teladan/Gembira No. 2 Muslimin Jl. Air Bersih Lingk. VII Sudirejo I Mua’llimin Jl. S.M. Raja Kp. Keluarga No. 33 Ma’ul Hayah PDAM Tirtanadi Jl. S.M. Raja No. 1 Pahlawan Muslimin Jl. Pencak Raya Pusat Pasar Setia Amal Jl. Sakti Lubis Gg. Pegawai Kel. Sitirejo Silaturrahim Jl. Pelajar No. 58 Drs. H. Hayat Harahap Taqwa Jl. Demak No. 3 Taqwa Jl. Mahkamah K-36 Thawalib Jl. S.M. Raja Gg. Isa No. 7 Yayasan Zending Islam Indonesia Jl. SM Raja No. 11-A MEDAN LABUHAN Al-Amal Jl. Banten Gg.Amal No.170 Dusun IX-A Helvet Al-Husin Jl. Raya Blok IX-Griya Martubung Al-Istiqomah Blok IV Griya Martubung Nurul Hidayah Jl. Veteran Lr. Sukoharjo No. 27-A Nurul Ikhwan Jl. Helvetia By Pass Gg. Masjid No. 234 Nurul Khairiyah Jl. Veteran Ujung Psr X Ds Manunggal MEDAN MAIMUN Abidin Jl. Brigjen Katamso Km.3 Gg. Nira Kel.Kp. Baru Al-Muhajirin PTPN-IV Jl. Letjend. Suprapto No. 2 Al-Mujtahidin Jl. Brigjen Katamso Gg. Lori Kp. Baru Darul Ali Jl. Brigjen Katamso Gg. Nasional No. 20 Jami’ Ash-Sholihin Jl. Brigjen Katamso No. 208 Jami’ ‘Aur Jl. Brigjen Katamso/Kampung Aur Kel. Aur Jami’ Al Fajar Jl. Brigjen Katamso Gg. Alfajar No. 15 Jami’ Jl. Brigjen Katamso Gg. Masjid No. 53 Kp. Baru Muslimin Jl. Juanda (bundaran) Kel. Jati Muslimin Jl. Brigjen Katamso Lingk. II Gg. P.Burung Thoyyibah Jl. Multatuli Lingk. V No. 64 MEDAN MARELAN Ar-Ridha Jl. Platina Raya Lingk. 21 Kel. Rengas Pulau Ar-Ridha Jl. Jala IX Lingk. IV Paya Pasir Al-Ikhlas Jl. Marelan IX Lingk. VII Kel. Tanah 600 Al-Muslimin Jl. Masjid Pasar V Kel. Rengas Pulau MEDAN PERJUANGAN Amal Jl. Ngalengko Lr. Saudara No. 11 Ar-Rahim Jl. M. Yacub Gg. Langgar Batu No. 24 Ar-Rahmah Jl. Gurilla Gg. Melati No. 5 Al-Amin Jl. Prof. H.M. Yamin SH, 482 Al-Aminin Jl. Pahlawan/Sakti Kel. Pahlawan Al-Falaah Jl. Ibrahim Umar Gg. Sato No. 03 Al-Hidayah Jl. Pahlawan Gg. Anom No.12 Lingk. III Al-Huda Jl. Malaka No. 117 Al-Hurriyah Jl. M. Yakub No. 17 Al-Muslim Jl. Pelita VI Gg. Serayu No. 10 Al-Muslimin Jl. Gerilya No. 1 Hidayatul Ihsaniah Jl. Sentosa Lama Gg. Amana No. 5 Istiqomah Jl. Bambu Runcing/Pahlawan Ikhwaniyah Jl. M. Yacub No. 3 Jamik Ubudiyah Jl. Pelita-I Gg. Tangga Batu 11 Jami’ Sentosa Jl. Sentosa Lama Gg. Perwira No. 1 Malikus Saleh Jl. Gurilla No. 10 Kel. Sei Kera Hilir Syuhada Jl. Pahlawan No. 11 Kel. Pahlawan Taqwa Jl. Pelita II No. 10 Kel. Sidorame Barat Thaharah Jl. Pelita II No. 29 Kel. Sidorame Barat Taufiq Jl. Mesjid Taufiq No. 120 Kel. Tegal Rejo Taqwa Jl. Karantina Asrama Glugur Hong MEDAN PETISAH

Prof. Dr. Ir. H. Basyaruddin, MS Drs. H. Ali Husin Siregar Drs. H. Hamid Mashudi Drs. Fakhruddin Rokan H. Edi Putra Hasibuan Drs. Ali Muddin Siregar, SH Drs. H. Syamsuddin Hasan Sofwan Harahap, S.Ag Drs. Kasron Hasan Nasution Son Haji Harahap, S.Ag H. Ahyar H. Sugianto, Lc, M.Ag Drs. Fahrurrozi Drs. H. Syarifuddin Nasution Drs. Mahyudin Azro Drs. Mauddin Nasution Drs. H. Syamsul Basri Tamar H. Parsaulian Siregar, Lc, MA Drs. H. Qamaruddin Sagala Abd. Aziz Tenendeng, S.Sos.I DR. H. Ahmad Zukhri, MA Drs. H.A. Syaukani Drs. H. Safaruddin Daulay MuhammadYusuf Marpaung, S.HI Faizula Drs. M. Ilyas Mustawa Zulkifli Harahap, S.Pd.I Ir. H. MMB. Damanik, MSc H. Muhammad Razali, S.Pd.I Drs. H. Khaidir Tanjung Drs. H. Sholahuddin Lubis Drs. H. Syamsuddin Hasan Drs. H.M. Syafi’i, S.Ag Drs. H. Khaidir Lubis Abu Faqih Husin Dr. H. Hasan Mansur Nst., MA Drs. Ahmad Wazir Drs. Son Haji Harahap Drs. Zakaria Damanik H. Zulfikar Hajar, Lc Ihsan Satrya Azhar, MA Drs. Waldemar Gazali Drs. Deliman Siregar Drs. H. Burhanuddin Lubis Drs. H. Mara Jaksa Harahap Drs. H. Syaifuddin Daulay Prof. DR. H. HasanAsari, MA Drs. H. Hafidz Ismail Prof. Dr. H. Amiur Nuruddin, MA Drs. H. Abd. Razak Drs. Syaifuddin Azmi Lubis Drs. H. Kasman, MA Drs. Susiyanto, MA H. Jasmi Assuyuthi, Lc Thoib Hasan Lubis, S.Pd.I Sofyan, BA Drs. H. Sugiman, S. M. Tohiruddin, S.Ag Drs. Harun Nasib, S.Pd. Amirsyah Lubis H. Zainul Arifin Harahap Efendi Sadli, MA H. Latif Khan, S.Ag Drs. Bukhori Muslim Drs. Umar Rifai Hsb., S.Pd.I H. Darwin Zainuddin, MA Drs. Azhar Razak Lubis Drs. Agus Salim Drs. Jamaluddin A., S.Pd.I H. Hasanuddin Hasibuan, Lc Pamonoran Siregar, S.Pd.I Suhedi, Lc, MA M. Rusli Nasution, S.Ag Drs. M. Nurdin, B. Drs. Halpan Siregar H. Jamaluddin, S.Ag Mahyuddin Tambunan, S.Ag Khairul Rahmi Drs. Syahnim Siregar Drs. H. Makmur Situmorang Darwis, S.Ag Drs. H. Khairul Zil Azan Drs. Ibrahim Arbi, S.Pd.I Drs. H. Musa Yahya Drs. H. Hasyim Sahid Drs. Hasrat Effendi, S. Drs. Mahmuddin Batubara Drs. Husyairi Drs. Mahmuddin, M.Ag Drs. H. Askolan Lubis, MA Drs. H. Muslim Wahid Mohd. Fadli Said, MA Drs. Safaruddin, MA H. Zulkarnain, M.SHCN H.M. Yasin Drs. Abdul Mazid Syam Drs. Nurdin Syarifuddin Umar Lubis

Amaliyah Jl. M. Idris No. 22 Kel. Sei Putih Timur II Drs. H. Hafnan Simbolon Annas Komplek Diskes Jl. Ibus Raya/Jl. Rotan Damri Tambunan, S.HI, S.Pd.I Ar-Ridhwan Jl. Abd. Hamid No. 28 Drs. Muhammad Rais, M.Pd, M.SI As-Syahaadah Jl. Sikambing Belakang No. 18 Drs. Zainal Abidin Asy-Syura Jl. Surau No. 16 Kel. Sei Putih Timur-I H. Jamaluddin Batubara, Lc Al-Hidayah Jl. Periuk Gg. Mesjid No. 2 H.A. Daud Lubis Al-Ihsan Jl. PWS No. 48 Kel. Sei Putih Timur II Drs. Ahmad Supriyadi Al-Ikhwan Jl. Mesjid No. 142 Kel. Sei Putih Tengah Drs. Syahrul Nasution, M.Ag Al-Mukarram Jl. Sikambing Gg. Patimura No. 9 Hasanuddin, S.Pd.I Gaudhiyah Jl. Zainul Arifin No. 200A H. Aslam Umar, S.Ag Istiqamah Pasar Petisah Drs. H. Zulham, ZA Jamik Kebun Bunga Jl. Kejaksaan Kebun Bunga Ahmad Jais, M.Ag Nurul Haq Jl. Listrik No. 12 Drs. Manaon Batubara Raya Aceh Sepakat Jl. Mengkara No. 2 Drs. Syafruddin Syam, M.Ag Taqarrub Jl. Darussalam No. 24 DR. H. Syarbaini Tanjung, MA Ubudiyah Jl. Kebun Bunga/Jl. Jend. S. Parman Drs. H. Ramlan Yusuf Rai MEDAN POLONIA Amaliyah Jl. Balai Desa Gg. Amal No. 43 Kel. Polonia H. Imam Muhdi Assakinah Jl. Polonia (Starban) Per. Angkatan Udara Drs. M. Tholib Harahap, S.Ag Al-Hidayah Jl. Starban Kel. Sari Rejo Drs. H. Selian Al-Hasanah Jl. Teratai No.17-A Lingk.V Kel. Sari Rejo Kess Karnaen, S.Ag Baitussalam Kosek Hanudnas III H. Al Ahyu, MA Baitut Tahmid KPPBC Tipe A2 Jl. Suwondo No. 1 H. Abdul Rahim, Lc, SA, S.Pd.I Bakti Jl. Mongonsidi I Baru No. 11 Drs. H. Harianto Effendi Dirgantara Lanud Jl. Imam Bonjol No. 52 M. Nasir Anshori, S.HI Hidayatullah Jl. DC. Musi Lingk. I Kel. Sukaramai Drs. Ramli Mansyur Silaturrahim Jl. Antariksa No. 64 Kel. Sari Rejo M. Adlan Taufiq Jl. Pendidikan Gg. Taufiq No. 17-D Thoib Hasan, S.Pd.I MEDAN SELAYANG Ar-Ridho Jl. Abdul Hakim Pasar I Tanjung Sari Drs. H. Solihin Dalimunthe Al-Ghufron Jl. Bunga Wijaya Kesuma Pasar IV Ramli Kardi Al-Ghufron Jl. Suka Baru No. 21 Kel. P. Bulan Ibrahim Harahap, SE Al-Ikhlas Jl. Raharja No. 25 Kel. Tg. Sari Drs. H. Suparmin Sareh Al-Ikhlas Pasar VII, Padang Bulan Sofyan Sirait, S.Ag Al-Istiqomah Jl.Sei Asahan Gg. Masjid No. 3 Drs. Zulkifli, S.Pd.I Al-Ikhwan Jl. Bunga Wijaya Kesuma Psr-IV Pd. Bulan Muhyiddin Al-Muttaqien Jl. Setia Budi Gg. Tengah No. 11 Drs. H. Ilyas Nasution Al-Muhtadun Jl. Karya Sembada No.179 Kom.Koserna Drs. Usmar Chan Baitul Mukmin Jl. Bunga Terompet V No. 6 Kel. P.B.S. Drs. H. Zulkarnaen Jami’ Jl. Pasar I Lingk. VIII Tg. Sari Drs. Humala Harahap Muslimin Jl. Setia Budi Kel. Tg. Sari Drs. Affan Suaidi Nurul Iman Jl. Penerbangan No.77 Komp.Perhubungan Habibullah, MA Nurul Mukmin Jl. Bunga Kantil 18 Psr VII Pd. Bulan Arifin Nasution, S.Pd.I

Nurul Mukmin Jl. Bunga Mawar No. 46 Kel. Pd. Bulan Nurul Mukminin Jl. Kenanga Raya No. 10 Kel. Tg. Sari Nurul Huda Jl. Bunga Asoka No. 117 Asam Kumbang Nurussalam Jl. Bunga Cempaka No.53 P.B. Selayang II Taqwa Jl. Bunga Wijaya Kesuma Gg.Masjid Taqwa No.1 Taqwa Jl. Abdul Hakim No. 2 Tg. Sari

WASPADA Jumat 8 April 2011 H. Daud Yakub H. Ahmad Iqbal, Lc Drs. Abdul Khalik, SH Drs. M. Shaleh Rambe Dedi, S.Ag Zailani, MA

MEDAN SUNGGAL Ar-Rahmat Jl. Mesjid No. 20 Dusun III Desa Helvetia Ar-Ridho Jl. Tut Wuri Handayani Perkamp. Kodam I/BB As-Saajidiin Komplex BTN Dusun III Sei Semayang Al-Amin Jl. Setia Budi No. 202 Kel. Tanjung Rejo Al-Basyir Jl. Garuda No. 78-B Sei Sikambing B. Al-Badar Jl. Binjai Km. 6,8 Medan Al-Falah Jl. Murni No. 27 Tanjung Rejo Al-Huda Jl. Perjuangan No. 44 Tg. Rejo Al-Hikmah Jl. Kiwi No. 7 Sei Sikambing-B Al-Hasanah Jl. Stasiun Dusun I Tg.Gusta Kp. Pertamina Al-Hafiz Jl. Pinang Baris No. 142 Al-Istiqomah Dusun I Desa Pujimulio Al-Ikhlas Jl. Binjai Km. 16.5 Dusun I Aman Damai Al-Ikhlas Jl. Beo No. 15 Sei Sikambing-B Al-Islamiah Jl. Binjai Km.14,5 Gg.Gembira Dsn.V Diski Al-Irma Jl. Rajawali Sei Sikambing-B Al-Jihad Jl. Sunggal No. 129 Al-Muttaqin Jl. Hanura No. 10 Kel. Tanjung Rejo Al-Muhtadin Jl. Setia Budi No. 29 Tanjung Rejo Al-Mukhlisin Jl. Darussamam Jl. Sei Tuan No. 38 Al-Muhajirin Kompl. Pondok Karya Kodam-I/BB Al-Muhajirin Komp.BBLK Industri Jl. Gatot Subroto 7,8 Al-Mu’awanah Jl. Puskesmas I/Jl. Seroja Al-Musabbihin Jl. Masjid Al Musabbihin Blok C TSI Al-Munir Jl. Karya Baru No. 07 Tanjung Rejo Darul Huda Jl. Kasuari No. 53-56 Sei Sikambing-B Isti’adah Jl. Amal No. 4 Kel. Sunggal Istiqamah Jl. Perwira Kel. Lalang Istiqamah Jl. Dr. Mansur No. 155 Kel. Tg. Rejo Ikhwanul Muslimin Dusun VII Gg.Damai D.Paya Geli Jamik Jl. Pinang Baris No. 19 Kel. Lalang Jamik Muh. Jayak Jl.Jend.G.Subroto Km. 5,5 No.184A Nur Amaliyah Jl. Jend. Gatot Subroto Km. 9 Nurul Huda Jl. Sei Serayu No. 38 Kel. Babura Nurul Hikmah PT.Perkebunan Nusantara-III Kandir Mdn Nurul Ikhsan Jl. Kelambir V No. 53-B Kel. Lalang Riyadhussholihin Jl. Sunggal No. 198 Lingk. XIV Raudotussuffah Jl. Pinang Baris Kel. Lalang Raudhatul Fatimah Jl. Swadaya P. Baris Kel. Lalang Syuhada Jl. Balam Lingkungan XIII Sei Sikambing-B Shafiyyatul Amaliyyah Jl. Setia Budi No.191 Tg.Rejo Silaturrahim Jl. Perintis Kemerdekaan D.Sei Semayang Taqwa Jl. Garuda Masjid Taqwa Sei Sikambing-B Taqwa Jl. Merpati Gg. Mushollah Sei Sikambing-B Taqwa Jl. Taqwa Gg. Pendidikan Tanjung Rejo

Syarifuddin Pasaribu, S.Ag Drs. Abd. Majid Supriandi, S.Ag Drs. Tohiruddin Pohan Drs. H. Syahron Sulaiman H. Nazrul Fahri Drs. Lukman Hakim Hsb., M.Ag M. Khumaini Hamyar Ahmad Muttaqin Nasution Drs. H. Azhar Drs. M. Yusuf Arhad Susanto, ST.HI Zainuddin, S.Ag H. Raden Taufiq H. Misto, AR H. Syarifuddin, Lc Drs. Luqmanul Hakim Drs. Burhanuddin Harahap Drs. Khairuman, ARS Drs. H. Ahmad Suhemi Hasanul Arifin, S.Ag Drs. Ruhiyat Drs. H.M. Yazid Mufti Lubis Prof. DR. H. NawirYuslem, MA Maulana Ibrahim, S.Ag Drs. Asman Ali Nur Harahap Drs. H.M. Arifin Umar Bambang Permadi, S.Ag Drs. H. Nazaruddin Hasibuan Drs. Ishak Ibrahim Muhsin Nasution Maulana Ismail, S.Ag Drs. A. Mujib Syihab Drs. H. Asnan Ritonga Drs. H. Abidin Azhar Lubis Sawo Edy Harahap, S.Ag Syafrizal Harahap, S.Ag K. Tanjung Drs. H. Ali Amnar Tambunan H. Hertin, S.Pd Prof. DR. H. HasballahThaib, MA Arman Nasution, BA Drs. Bahrin Manik Drs. Rahmad Pohan Drs. Mashul

MEDAN TIMUR Amaliyah Jl. Perwira II Pulo Brayan Bengkel Amal Ridha Jl. Cemara Pulo Brayan Bengkel Baru Arrahim Jl. Purwosari Gg. Masjid/Puskesmas. P.B.B. Ash-Sholah Jl. Pendidikan No. 39 Kel. Glugur Darat I Al-A’la Jl. Pembangunan I No. 46 Kel. Glugur Darat II Al-Barkah Jl. Setia Jadi Kel.Glugur Barat I Al-Furqoan Jl. Asahan No. 78 Kel. Sidodadi Al-Hidayah Jl. Jawa No. 3 Kel. Gg. Buntu Al-Iman Jl. Sidang Raya, Komp. DPRD Tk. I P.B.Bengkel Al-Ikhlas Jl. Umar No. 71 Kel. Glugur Darat I Al-Ikhlas Jl. Madiosantoso No. 197 P. Brayan Darat Al-Ikhas Jl. Timor Al-Ihsan Jl. Jemadi No. 34 Pulau Brayan Al-Ikhwan Jl. Prajurit No. 28 Gg. Bali Kel. Glugur Darat Al-Muslimin Jl. Brigjend Bejo/Cemara Gg. Rambutan Al-Ma’ruf Jl. Sidorukun/Wartawan No.99 P.B. Darat II Al-Qudus Jl. Pukat Harimau d/h Jl. Aksara No. 136 Al-Waritsiin Jl. Bilal No. 71 Kel. Pulo Brayan Darat I Bustanul Huda Jl. Perwira I Lingk. VIII P.B. Bengkel Daarul Ma’arif Jl. Damar Raya No. 8 Sidorukun Jamik Jl. Kapten Muchtar Basri, BA Gg. Masjid No. 40 Muttaqin Jl. Pasar III No. 40 Glugur Darat I Nurul Iman Jl. Bambu VI Kel. Durian Nurul Yaqin Jl. Bukit Barisan I No.74 Kel.Glugur Darat II Nur Chadidjah Komp. Wartawan Jl. Letter Press No. 51 Perjuangan 45 Jl. Prof. H.M. Yamin, SH No. 51 Syuhada Jl. Budi Pengabdian No.2 Perum Pemko Mdn Taqwa Jl. Sutomo Ujung Gg. A No. 47 Kel. Durian Taqwa Jl. Rakyat/Lr. Maninjau No. 6 Sidorame Timur Taqwa Jl. Bilal Gg.Keluarga No.74 Kel.P.Brayan Darat I Taqwa Ubudiyah Jl. Bambu III Kel. Durian Taqwa Pulo Brayan Bengkel Taqwa UMSU Jl. Kapten Mukhtar Basri No. 3 Tabligh Tarjih Jl. Mustafa No. 1 G. Darat 1 Kp. Dadap Ulul Albab Jl. Sutomo IAIN-Sumatera Utara

H. Nazauddi Lubis H. Marhamin Tanjung, S.Ag H. Musohur Siregar, S.Ag Drs. H. Juliardi Drs. Yose Rizal Lubis H.M. Taufik, MA Drs. H. Amhar Nasution, MA Drs. Zainuri Suparman, S.Ag Drs. H. Ramli Asmuni Drs. R.Mhd.Daud Sagitaputra, S.Ag K.H.Willyuddin AbdulRasyid Dhani Drs. Muhammad Drs. M. Yunan Silalahi M. Husni Ritonga, MA Amir Shalih, S.Ag Drs. H. Thohiruddin Nasution Drs. H. Usman Suher Drs. Hasbih Dasopang K.H. Husein Aly, Lc Drs. H. Effendi Batubara Drs. M. Zuhri Pulungan Drs. H.Milhan Yusuf, MA H. Syamsul Anwar A. Yahya H. Musdar, Lc H. Ali Amran Zakaria, Lc Drs. H. Aspan Sianipar Prof. DR. H. AliYakub Mtg. MA Tukiman H. Ruskhan Nawawi, BA Drs. H. Kasman, MA Drs. Kayat Amin Drs. Zulkarnaen Lubis, MA DR. Sudirman, Lc, MA Prof. Dr. Asmuni, M.Ag

MEDAN TEMBUNG Akbar Baitus Sujud Jl. Metrologi Raya Gg.Karya No. 1 Ar-Ramli Jl. Surya Lingk. XII Kel. Indra Kasih Ash-Shobirin Jl. Pukat Banting II (Mestika) Kel. Bantan An-Nurul Hakimiyah Jl. M. Ya’kub No. 51 Al-Anwar Jl. Willem Iskandar Kel. Indra Kasih Al-Bayan Jl. Gurilla No. 10 Al-Falah Jl. Pukat Banting IV No. 10 Al-Huda Jl. Tuasan Gg. Aman Kel. Sidorejo Hilir Al-Hidayah Jl. Letda Sujono No. 62 Kel. Bdr. Selamat Al-Hikmah Jl. Letda Sujono Gg. Amal No. 5-B Al-Hilal Jl. Belat No. 76-B Al-Ikhlas Lingk. II Kel. Bandar Selamat Al-Ikhlas Jl. Ambai Ujung No. 15-B Kel. Sidoarjo Hilir Al-Istiqomah Komplek Veteran Medan Estate Al-Ijtima’iyah Jl. Letda Sujono No. 152 Al-Muslimun Jl. Pertiwi No. 94-C Kel. Bantan Al-Muqorrobin Jl. Pukat II No. 52 Bantan Timur Al-Izzah Kampus II Pasar V Medan Estate Baiturrahman Kampus Unimed Jl. Williem Iskandar Darul Amin Jl. Letda Sujono Ujung No. 1 Lingk. I Darul Djalal Jl. Taut\Sukaria No. 29 Kel. Sidorejo Hidayatul Muslimin Jl. Bersama No. 105 Lingk. 5 Hidayatul Ubudiyah Jl. Kapten M. Jamil Lubis Ikhlashiyah Jl. Tempuling/Suluh No. 20 Kel. Sidorejo Ikhwaniah Jl. Tuamang No. 47 Kel. Sidorejo Hilir Nurul Iman Jl. Pertiwi Ujung Kel. Bantan Raya Muslimin Jl. Pukat I No. 1 Kel. Bantan Timur Taqwa Jl. Enggang Raya No. 85 Perumnas Medan II Taqwa Jl. Kolam No. 01 Kampus I Medan Estate Taqwa Jl. Letda Sudjono No. 15 Taqwa Ranting Sidorejo Hilir

Indra Suheri Drs. H. Kamidin Selian Marwan Nasution H. Windi Chaldun, Lc Drs. Ahmad Syamsuri Drs. Syahrin Pane Drs. H. Yusdarli Amar Drs. Khairul Siregar Drs. H. Mulkan Daulay Drs. Amron Lubis Drs. Faizal Lubis H. Amir Saleh Nasution, S.Ag Drs. Asril Pohan, Lc Drs. Fauzi Rahmadi Drs. H. Amiruddin Batubara Drs. Joko Santoso Zulkifli Nasution, S.Pd.I Dr. H. Sofyan, MA H. Fajrul Hak, Lc, MA Shufriadi Drs. Zakaria Batubara Drs. Irwansyah Sitorus Drs. Ramli Nur, MA Drs. Sulaiman Barus Drs. H. Akhyara, SM H. Iqbal Ahmad Syauki, Lc H.M. Thahir Nasution, A.Md M. Yunus Daulay, S.Ag Drs. H. Kemal Fauzi Drs. Lisman Lubis M. Surip, S.Pd.I, M.SI

MEDAN TUNTUNGAN Azizi Kel. Tanjung Selamat Al-Amin Jl. Pala Raya Perumnas Simalingkar Al-Ikhlash Cengkeh Jl. Cengkeh X No. 1 Kel. Mangga Al-Ikhlash Jl. Nilam 11 No. 1 Perumnas Simalingkar Al-Muttaqin Jl. Jamin Ginting Km. 14 Kel. Sidomulyo Al-Muhajirin Jl. Kopi Raya II Blok A Perum Simalingkar Al-Muhajirin Jl. Seroja Komplek Medan Permai Al-Muhtadin Jl. Kemiri Raya I No.1 Blok-G Simalingkar Al-Razzaq Jl. Sakura Raya Kel. Tanjung Selamat Baitul Rahman Jl. Rami II Perumnas Simalingkar Baiturrahman Jl. Flamboyan I/04 No. 2 Tg. Selamat Iklab Jl. Letjend. Jamin Ginting Km. 12,5 No. 100 Nurul Iman Jl. Irigasi No. 12 Kel. Mangga Nurul Hayat Kompl. LIZARDI Kel. Kemenangan Tani Silaturrahim Jl. Kapas 13 No. 49 P. Simalingkar Taqwa Jl. Sawit Raya Perumnas Simalingkar DELI SERDANG Amal Islamiyah Jl. Sudirman Kel. Lubuk Pakam Pekan Ainul Yaqin Jl. Pembangunan IV No. 30 Al-Falah Jl. Pasar V No. 73 Dusun XIV Desa Tembung Al-Firdaus Jl. Medan Batang Kuis Ds. XI Empl. Km 10 Al-Furqan Perumahan Bumi Tuntungan Sejahtera DSC Al-Hafiz Hamparan Perak Kec. Hamparan Perak Al-Hikmah Kompleks RS Jiwa Daerah Propsu Al-Ikhlas Simpang Beringin Hamparan Perak Al-Ikhlas Desa Suka Makmur Kec. Delitua Al-Muttaqien Gg. Kolam Deli Tua Al-Muttaqin Dusun V Desa Bangun Dari Komp.Koserna Al-Mukhlishin Jl. Terusan Bandar Setia Dusun II Al-Salam Jl. Raya Medan-Namorambe Kom. Pisu No.1 Baitussalam Dagang Kerawan-Tg. Morawa

Drs. H. Sulaiman, Mhd. BA Drs. M. Yusuf Asyhadi Drs. Arifin Syah H. Ali Imran, S.Ag.I Drs. M. Ridwan Drs. Amrin Yus Drs. Jakfar Imran Syarifuddin Sinaga, S.Ag Drs. H. Hamdan Hamidi Hrp. Drs. Agus Suhedi Drs. Rajuddin Harahap, S.Ag Rozali, S.HI H. Muchsin Amiruddin Miskan Nerwin, S.Ag H. Andi Syaputra Lubis, S.Pd.I K. Tanjung, S.Pd.I Junaidi Arsyad, S.HI Muchtaruddin, MA H. Umar M. Siregar, Lc Abdul Latif, S.Pd.I Haidir Lubis, S.Pd.I Zainuddin, S.Pd.I H. Irfan Batubara H. Rifa’i Matondang Drs. Usman Hsb., SH, M.Hum Herman, S.Ag Syofwan Harahap, S.Ag Mualim Mardi

Waspada, Jumat 8 April 2011  

waspada daily

Read more
Read more
Similar to
Popular now
Just for you